3BQUB

Crystal structure of the 2f5 fab'-3h6 fab complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
231
structure length
214
Chain Sequence
b'RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIVNAMDVWGQGITVTISSTSTKGPSVFPLAPAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLTCNVNHKPSNTKVDKRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab' light chain
publication title Crystal structure of the complex between the F(ab)' fragment of the cross-neutralizing anti-HIV-1 antibody 2F5 and the F(ab) fragment of its anti-idiotypic antibody 3H6.
pubmed doi rcsb
molecule tags Immune system
total genus 36
structure length 214
sequence length 231
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquB01
1W0VB 3UBXG 2L0DA 3S37L 3HB3D 1IKFH 3VXTB 3EGSB 5JXED 3RWCB 1FNHA 4I13B 3F7QA 1HHIB 2R9HD 1XH3B 2NQCA 4M6ML 5GQBA 3IDIB 1ZGLP 3O6MH 4P4RB 3UTPE 5C0BB 2Q7NA 5T1LB 5LGJA 4ONFL 5BCAA 5D1XA 5IOPA 3QFJB 3GJFK 1U8QA 5H2BA 3RGVC 3KXFB 1BVLA 4HUWA 3AFLA 2C7UA 3S97C 3T8XA 4MCYA 4UILL 1F4WH 4LKCA 1K5NB 4Z7UB 1JYNA 2NY4D 3G6JA 4KTDL 4X4ZA 3RVUC 3WFEL 5A40E 2UZIH 2A6IB 3BPNC 2AGJH 3QDJA 3QIBA 4DCQB 2YUWA 4PRNB 1SY6L 1HKLH 1FNGA 4P3CH 1FVEB 4HZLB 2IBZX 4RDQG 5E2UL 4MJIA 5F7DA 1MWAB 4AK1A 2IBZY 3QSKB 5C9KA 1P2CA 1RURH 3RNKB 4LOUD 5DVNA 1LO3H 4ZUVB 5DSCB 2YXMA 3B5GA 3MRNA 4LLDA 5DK0A 2EDYA 1MCSA 1FO0B 5DJ6A 1G6RA 2WWKT 3B6SB 4LSPH 4ZSOA 3MGTB 3DBXB 4MJ4A 4KHXH 5B8CB 3DNKA 4FA8A 3QPXH 1TFHA 2H26A 2ZCHL 3ARFB 4HX1A 4NT6A 1Q0YL 1CDGA 2VQTA 5GRJL 4GS7B 3MNWA 5IHLB 1QLEH 4HJGB 4BZ2L 5I18H 5CD5C 1N3NA 1KXTB 3UXFA 5JLZA 3PWJA 2HFFB 2ADIB 3WS3A 1B6UA 1A6ZA 3ZDZE 4RBPK 5FDYA 3BH9A 3PJSB 2ADJB 4YHMH 1OTUC 4M7ZB 2I60H 1MCHA 3BKJH 3DVFA 5C0AD 3MUHL 5DURD 4GRWB 1QA9B 5E5MB 5L2KA 2XRAH 1JJUA 3IDGA 2DI7A 5C0EA 4Y2DC 1CDHA 1VFBA 3QQ4A 4OZIE 3O6FD 3K8KA 4OI9A 4CGTA 1UJ3B 3MODH 4N0UA 2RIKA 1U91B 5DJYB 3GIVA 1LNUA 1R5IA 1IGIH 3OHXA 5HJ3A 4LAQL 4H1LH 5C07E 1K8DA 1MFAH 2DQHH 3TPUB 1OLZA 2EEDA 4LDEB 3A6BL 4XCCL 6FABH 3M07A 3QNZB 1UACL 3MRJA 2EKJA 4JRXD 4P9HH 1H8NA 2QHRL 3FFCD 4UV4H 3PDOB 4Q6IA 1FAIL 5E94A 4JM4L 3D3VE 3FAWA 4GG6E 1JGUH 4HC1A 4XAWL 3H6JA 1CK0L 4JHAH 5ACMA 3ARRA 3PWPD 3W0WB 2EIDA 3BZFA 1IFHH 43CAB 2DTSA 5FEBA 4DKAA 4Z77A 4JANA 2F8OA 1BFVL 4JO2H 3FT4A 2X1XR 3FN9A 4M93B 5BXFB 4I18A 3BP5B 2DQUH 2OJZL 5EBLA 3MCG1 3PWUB 4IOFD 5B3JF 1A0QH 1A6TA 5T1MB 2VLJE 1P5UA 1ZLVK 1IGYB 3ULSA 4RAVA 4PJCF 4PRHD 4EI5D 3LS5L 1MJ7H 1G7LA 4J8RA 4LNRB 1I7RA 3RUGB 1P1ZB 4XP9H 3BT2H 5IB5B 1QRNE 5CJBA 4EI6B 1DR9A 3IS0X 2NX5A 2AJVH 3VGHA 1ONQB 1MCQA 3MV11 5JW5A 5DS8A 4WUKH 4PY7B 4F15C 1IQWH 4PG9B 3RVVC 4NOFA 3KPSB 1L9MA 5EC1B 2R23B 4MLIA 1UZ8B 4I5BA 4KGJA 2DDQL 2YD6A 4W6YB 1DSFH 1RZIA 3G04A 4ZUUA 4X6BB 5DD5H 4J4PD 2LAGB 3EAKA 4APQD 1S9WB 1QSZA 4G5ZL 4JFFE 5F1IA 5GSVA 1KELH 4JHZA 4OM0H 5I73C 5I6XB 1E28A 4FP8L 1NJ9A 3LIZH 1RUML 3J7HA 4NO2B 1DVFA 2Y72A 4QOKD 1WIPA 4ZUTB 1T66D 1UWGH 3IDXH 2GT9B 2E7LA 1OGAB 2WV3A 4OQTA 2YSSA 5K93A 4K8RD 4QWWD 1G7QA 3SDAB 3N06B 1ZHNA 3KJ6L 4K3GA 5CEZD 2P8LA 1RJZA 3Q6FB 5D1ZD 1YN6B 3GHEH 3QI9D 3O81A 2VQ1A 1R3JB 1MCPL 4EUPB 1T1ZB 2J8UE 3G9AB 1CIUA 4QNPE 1DE4A 3FB7B 4X6DA 1J5OH 5EU5A 4KJPD 4KDVA 1P4IH 2V5SA 5DQJA 1VDGA 1AQDA 2P8PA 3QH3A 1J0IA 5F72S 3WHXB 4HT1H 4PTUA 1YC8A 2GSGB 4D9RE 5LGHH 4NM8H 5E8PB 4LSRH 4MJ2A 3RP1A 2HLFC 2FATH 3EZ8A 3O0RL 4LU5L 3DURA 3P40A 1CFSA 2BCKA 3EFFB 4QHNA 1MAML 3DTXA 1CE1L 3MC0A 4GW5B 1OGTA 2M26A 3G5ZB 3L5WA 4ZUSA 4IJ3C 5E00A 1WZMA 4UIMB 5F9WB 5CIPH 3WV0A 1FSKC 3DO3A 4DFIA 5E4EB 3KNBA 3MUJA 1X5ZA 5D2NC 4W4OC 4NJ9L 1MVUA 4AL8L 4U1KA 5HGGS 1YN7B 5FFLA 1OARL 3QG7H 2K9UA 4NOBA 4CU7A 5D6CA 3CFCH 1UA6H 4DZBA 4NGHH 2VXVL 1G7HA 1OAZL 5F9OL 1I9JH 3TWCL 5HGBB 3E6HA 4WHTA 2FEEI 5C92A 2V2WA 1J1XH 2VJXA 4AENB 1PKOA 1N5YL 3T4YB 3MRKA 3AU1A 2Q86A 4M8QB 4JO4H 2AXGB 5L88H 1J8HE 2CIIB 4DGVH 2BNUA 1CGYA 4KJYB 2F5AH 1CGUA 1RIHH 3CPLB 3KYAA 1YPZB 5D6DC 3X13B 3HR5B 2W9EL 2VDMH 2X4SA 2F54E 3RVWD 3WN5A 2EDDA 4P49A 5ADPL 5IEHA 2EDLA 5I8OL 1LP9E 1W0WB 4JG1H 5GGQH 4ONOA 4JFDB 4YR6A 3K3QA 2DWDA 3BI9X 2DI8A 1Q9LB 3FQWB 2VISB 3ARZA 5IVZB 4E42A 1YC7A 1QFPA 4JFEE 4YH6A 3B9KA 1NGYA 2IAMB 2QLVB 3RU8L 3SJVE 1V3MA 1ZLSH 3D6GA 1MHEB 1ZS8B 4BH7B 4NQSA 3VRLF 5BS0B 2J6EL 3H9HA 4Z78A 3QCUL 2NXZB 1T3FB 4IMLB 4U1HA 2EE6A 2H2PC 2R69L 4X4XB 3PL6B 3IF1A 5L2JB 5HPOA 3D18A 3HCVB 4XP6H 4PJGB 2E9JA 2JIXA 5IVXB 3V0WL 4R4BB 4WEBH 4KY1H 3VFWA 1FRGH 3HFMH 3UBXB 1BEYL 4OGAC 5DA0B 4IIQA 4ZTOL 3GSXB 4GLRH 4F9LC 2F58H 5C6TH 4PJXB 1A02N 1ZEAH 4LDLB 1VA9A 5BVJA 2HVKA 4F57L 3O3BA 3FQRB 3RZCC 1YDPA 1MCWM 1QZ1A 3VXUD 1F4AA 1YUHA 1MJJA 2Z91A 1I8LA 4ZO9A 1RUAL 1VACB 4D3CL 3F65A 3I3BA 1E0OB 3MRRB 5FGSA 1V7MH 4OM1L 4K94L 2JELH 3DX9A 4P2RD 1TCRA 3OB0H 1GGYA 2DM2A 1TQCC 1AR1D 4H8WL 4OQ1A 2ZP0T 4DKFH 2B4CL 2I07B 5EWIL 4JVWA 3LS4H 5E70A 5CAYB 5IROC 2X09A 4HHAA 1IL1A 3V7AE 1IMHC 3P4NB 1CQKA 4BZ1H 1S7VA 3O9WC 1CR9L 2A6JA 2X1OA 2N1KA 1J0HA 4BUGA 1KLGA 4ODHL 5FYKD 4OFIA 2FIKA 1MQ8A 3MJ8A 1B88A 2AXFA 3GDBA 4XTRD 4LSVH 2O93L 3MRFA 3GMQB 4G6JH 4ZNEE 2W65B 4YHOH 2P5EE 3O41A 3LQAL 5DJ0A 3VFSA 5GS1B 1X5AA 2OR9L 3DOSA 1EAJA 9CGTA 5ICYB 2AI0L 5EB9A 5KSBB 5HVHB 4V2BA 3C60A 5TH2B 1EVTC 5E08H 3AB0C 4WV1B 1INQA 4RFOH 4HIJA 2F5BL 5H37H 4KZDH 4W68A 4YLQT 4U6HB 1W72L 3VXMA 3NN8B 1AP2A 3IFNL 4ALAL 3NIFF 3TO4C 4QRQB 4LSSH 2X70A 4L3EE 1XIWC 1P69B 1RHHA 3N85L 3E6FB 3X12B 1FVCA 2LU4A 3HMXA 4KMQA 4NP4H 1KCRL 2D0HA 2VSCA 1JK8B 2Z35A 2NW2A 2YRPA 2XA8L 5BRZB 5D2NE 1TQBC 1HXMB 2FX7L 1F2XK 3VFGL 2Z92B 1PQZA 1AD9A 1IM9D 3EDKA 4HGKC 2VITB 4MS8C 3L3OB 3QWOA 2YC1B 2XA3A 1XFPA 3RQ3A 1N7MH 4E41E 2HRPH 5MENB 3LEVH 3LN4A 4Z7NE 4PTTA 5EZOH 1HWGB 5LQBL 4GRLA 2UY7A 5C0IA 5EBWB 4POZC 4OTXL 5TDNB 3DVNB 2VZVA 5ISZA 1LEIA 4I9WD 1F4XH 3GSRA 4FXLA 2EO9A 2XN9A 5SWSA 3GM0A 4ELMA 2IQAA 1JPFB 5EO1B 5DYOB 3GJFA 3OKOA 2IANB 3LMJH 2VOTA 4RISL 2JF1A 1H8OA 5E8OA 2DM3A 5FOBB 3KYOB 3CH8A 4M6AA 5E6IC 2ESVE 5FGBC 3HLAA 2C1PB 1BFTA 3UP1A 5DRWB 1FCCA 4QF1A 2GCYB 2EDNA 3MBEC 1Y6MR 2DQFA 4XRCA 4OUOA 2CXGA 3RAJL 1NLBL 2HG5B 3RKPA 5HD8D 3JUYA 4OFVA 5IB1A 3VXQB 2QQKL 4KKAD 4HJ0D 5IFHH 4X98B 1PW3A 1DBML 4NCC2 4GRWH 3EDFA 3UTSE 2E8ZA 1UKSA 1N5AB 4LKXA 1AGBA 1U9KA 2BHYA 3C6SA 4FQXB 3T04D 1JPTH 4KK6C 4JQXC 2EE3A 4Z7WE 1AGFA 4AEHH 3ZTNH 3CC5B 5JMOC 4TQEL 2O5YL 1BZ9B 1F11A 5FO7A 2C3WA 3OKYA 1KACB 3HI1B 3REWB 1U58A 2DM4A 3DROA 1EK3A 1FNAA 1EAPA 3BGMA 1IGMH 1D5BA 3KPNB 3IFOA 3I02A 2FHFA 1BF8A 4N8CH 1D7FA 5JR1H 4MA8H 4GAYB 3VXRD 3H8NA 1VEPA 3TLRA 4L9LC 3VXSB 3P30H 2H32A 3AS0A 2BNRA 4PJEA 1MVFA 2QR0A 4MDJB 1NH6A 3L3IB 2Z31C 2B5IB 1I85C 1WVZA 4MQ7B 3OX8A 4ACPA 1S9VA 3TNNA 4PJBA 3VMOA 4GW4A 5AG9A 2G9HB 1FC2D 1JFQH 3DRTB 1VERA 3QO0A 1MFNA 3X14B 1KG0B 1O0VA 5C09D 3QB7C 3U4BH 4KKCD 3G5XB 4NZRL 5F1OB 4NIKB 2JJSC 3S96A 1ZK9A 1FFOB 3MTRA 3TVMC 5I15L 3VMPA 1HINL 1KN2L 3MCLL 4G7VH 4Y1AE 5DC4B 2OR8A 3SY0A 4FQ1H 1Y6KR 1MFEH 3UX9B 3GBMH 3MRGB 4U6YB 2H6PB 1CFTB 5EO9B 1X5FA 1UXWB 4L8BB 3PV6A 2HLAB 3TJHD 3ELAT 2V5YA 1UENA 4JZOB 4RMRA 4AG4H 3QNYA 3GK8H 2NXYC 3CMOL 4S11A 2UZXB 2GITB 4G9DB 4OLYH 3T0EC 1C16B 1F58H 5HYIA 5I76B 2NY7H 1MHHA 1NUNB 3FT3B 3GMMA 5CJXC 4WO4B 3U9PH 3H2WA 4HS3A 4JAMB 1CLOH 1OWRM 4MJ5A 4TSBH 1ZVSA 1N8ZB 4KUZL 1DLFL 4OZFA 4PD4J 3IU3B 2P4AB 3Q3GB 1MFDL 5JIIA 4LIQL 4LLWB 4Z18A 1IAIM 1O7SA 4MWFB 4N68A 2OCFD 1UH3A 1BFSA 4OCXL 2AKRB 1GGUA 1AY1H 2DLFL 3ET9F 3QUMH 2B2XH 3MRMB 3P11H 3FQTB 3PWNA 2VLKB 1RV6X 4L4VD 2FB4H 2PUQT 1NLDH 4ETQA 5LGJB 2YUZA 4LVEA 5D1XB 1MPAH 2WIIA 3MRBA 1U8QB 3O8XD 3GEWB 3OQ3B 1JNJA 1L0YA 2FEEL 4JY6A 2I24N 3VXNA 5LWYL 1N26A 3GMRA 3CFEA 4V1DD 2WZPD 3PE9A 4LKCB 2YBRA 4GKZB 4QRPA 1HK6A 2FDBP 2CDGA 1OP5H 4Y4FD 3G6JB 3L7EA 3L95B 4S1QH 5EOQH 4UT6H 5GHWH 2BP3A 5DFVC 4EIGB 3QIUA 3ARDD 1NMCB 1NEZA 4J23A 1INDL 4X6CA 4ONHB 4TYUA 1JNHB 4YO0A 5KVGL 3EIFA 3B2VL 1FYTE 3BRFA 4GO6B 4MZ2A 8FABB 4MJIB 1G7JB 5F7DB 4N1EA 1CZ8L 1HNFA 3JWDH 4P57A 3QUXD 3PHQA 2DQIH 4ZFZA 1PAMA 1FFQA 4JVUA 5EA0L 1CXLA 5B3JE 4LLDB 5DK0B 1F90H 3O2VL 3INUH 1S78D 5DJ6B 1G6RB 3ZHDA 4JKMA 5MP6H 4PJCE 4PV8B 1OAXH 5IIEB 4L8SA 3PV7A 4J3OC 1FFNA 2H26B 5L6YH 4HX1B 4NT6B 4CN4A 1UJTA 5I8CA 4JFXB 1NC4D 3BWUC 2F53D 2N7BA 5JLZB 2HFGL 3LRHA 4C56B 2XFXA 1N6QH 4LVNC 3NBNA 1TVHA 4OCRH 1A6ZB 1J05A 2O61B 4ISVA 1IGJA 4X8JB 3TZVB 3QEGH 1R3HB 4N0CD 2FD6L 1QSFB 2VC2L 3KPQB 1KPVB 4UNTA 2IC2A 5L2KB 1CLCA 1JN6A 3BMVA 3I50H 2VWEC 1FH5L 3QQ4B 1XF3A 4XWOC 1MWAL 1AE6L 5F9DC 3VWKC 1AXIB 4N0UB 5I17B 1RU9H 3GIVB 4XNQA 4K8RL 4WFGE 4W70A 4H8WC 3BYTA 3OHXB 2B4CC 3S37H 5CEZL 1K8DB 2X4PB 2P43B 2BVOA 5LCVH 4HXBL 1GSMA 3AUVA 4Q0XL 3QEQE 4HJJH 4YXLH 4OFYD 1XCQA 3UJTL 3CX5J 3MRJB 3QNXB 1UB5A 4Q6IB 2IALA 4M6MH 5E94B 2GJ6D 2UWEF 5CEXB 5TE7L 1HQ4A 4PJIB 1VESA 2J5LC 5ERWA 5AAWA 3RIFK 1T6WA 3K2UL 4NQVB 1Y0LA 3VWJC 1Q9OB 1ACYL 5IBLC 1FV1A 4P9ML 4C83B 4ZOEA 3C6LC 3HZYB 5DRNA 5E99L 4HUXA 3BKML 2FCBA 4JANB 3EBAA 1B6DA 4UILH 4YGVA 3WEXB 3FT4B 3ROLA 2MKLC 5GRUL 1JP5A 4KTDH 5KG9A 1TIUA 2D7NA 4X7FC 1A6WL 5A3IC 4I2XE 5C07A 4Y4KD 5JO5A 4KROC 1JZ7A 1SY6H 2Z9TA 4YBLC 3D39D 3DSFH 1RFDL 1VSCA 3QAZC 4B50A 3HZVB 1AQKL 1YMME 1I7RB 2VLLA 5J13B 3HRZA 1QD0A 1BJ1J 4M5ZL 2DLTA 2IF7A 4NWUH 3WO3B 3IJYA 2VN7A 1HSBB 2NX5B 1KB5A 2VZ3A 2BSTA 5E7BA 4EN3B 2PTVA 4XBPA 1Q0YH 1IZJA 5GRJH 3UYOD 3LPWA 2E27H 5HYQA 3MV7D 4F9PC 1UM4L 4BZ2H 2NY2B 1RZIB 3EKCA 4HBCL 3G04B 4U3HA 4Y16C 4M1CD 3TFKC 1T20B 2DICA 4NQUA 2VLJA 5GSVB 1HHKA 3MV9B 5EORL 1C12A 1DVFB 2QADD 4OI7A 1JYVA 1BWMA 1WTLA 2CDEA 4HIEB 5DF0A 3TYGL 5E5RB 1DEDA 3NGBC 4NNYA 1FNEB 1KPUB 1CXHA 2DBJA 3U0PA 1G7QB 4X7TA 3RUGF 1J87A 5HHNA 2H2SC 4S1DD 3QQ3A 4LAQH 4YWGL 5HHOA 1RIUH 2VQ1B 3JWNC 4PG2C 4Y5YA 3U6RA 4JRYD 4LCCC 2CUHA 4MB5A 4M5YH 3A6BH 4XCCH 5I71C 4LLMB 2QHRH 4QHMA 2A0LC 1DE4B 1TZHA 4RWHA 4HK3J 3BEWB 1KIRB 4NQEB 1A7RH 4XAWH 1NBZB 1OAYH 1K4CA 1AQDB 2NY4B 5JXEC 5JHDE 3AM8A 4PTUB 1H5BC 1RUKL 5DTFA 3L3KA 5D7KD 4Z7VF 4RCAA 2BRQA 4OGYL 5IMOB 5D7IA 3DURB 1BFVH 2G2RB 4XNYH 3VRLE 3QDAA 4QHNB 4IRSA 3DTXB 3HC4L 1CGVA 2ITCA 5IJKA 3OF6D 4N9OB 1OGTB 2VSDA 3VRIA 3VMNA 1F42A 1AGDB 4OZFG 4ZUSB 2ICWI 4XC3L 5E00B 2V17L 2CJUL 2W59A 4BQ9A 1A7QL 2A1WL 5GGTL 3LS5H 3EO0B 3CNKA 1MVUB 4JGUA 4U1KB 4LHUD 1FIEA 4O2EB 5IESH 1WC7A 1R24A 3QIWD 5D6CB 1G7MA 4URTB 5DQ9A 4IM8A 3RI5F 3MV8E 2DMKA 3H9ZA 5DRXA 2QSVA 4Y19A 1G7HB 1OLLA 4ELKA 1YQVL 1R3LA 4YNYB 4NO0B 2VWEE 4LOUC 2R0ZL 3MFGB 3TN0C 4P23D 2ATKB 1KENL 3MRKB 4IHOB 2GSIB 2Q86B 1D5ZA 4G5ZH 3O4OB 4GBXA 3BP6B 4F7PA 1NEZG 4FP8H 1TMCB 3TBYA 1I8KA 2P24B 3QHTC 1RUMH 2AEIT 2R4SH 4R9HA 4IRJA 5FA3B 3P2TA 3P3YA 2ZCKH 5FF6B 3IDYB 4WHDA 3ULUD 2YKLH 1NSNL 3WNPA 1I7UB 1ZWIA 1NMAH 3KJ6H 3WDJA 4LCUA 5E2TH 2XQBL 1T0PB 3MOAH 3S34L 4HKJA 3OR6A 1X9QA 4YR6B 3T1FA 4OF5A 5HYSA 1MCPH 3FONA 4HBQA 5DMIL 2EH8H 1EEYA 2YPVH 1MCIA 3B9KB 1NGYB 4P3DB 2DKSA 4ZQKA 3MZTA 1OTSC 4NQSB 5D9SA 5DDHA 2H9GA 4C59B 4ZXBB 2D7TH 5DI8A 4P0DA 3MCKA 4GXUM 4HK0B 4U1HB 3BN9D 3KPOA 3NVQA 1RZKL 1EV2E 5BZDA 2JIXB 2GTWB 4AEIL 3QRGH 3O0RH 4YDJB 4EI5B 3HPJA 1FZJA 4GMTH 4UDUA 3VFWB 2VZSA 1ZT4A 1DQQB 1MAMH 1NCTA 3BH8A 1YPZF 3WUWA 2BSRA 3UJJH 1M1SA 3C5ZA 4FZEL 1I7TB 5ELIA 1HCFX 1D6EA 1Y18B 5BVJB 2HVKB 4JFEA 3SDCA 5C8JA 1YDPB 1YY9D 4NJ9H 4OLXH 2XOTA 3N9GL 4N0YL 4QT5A 4AL8H 2PW2A 4JM2B 1CT8B 1YUHB 4PFEA 4AEEA 1AKJD 3WS6C 1HEZB 1U41A 3PUCA 4IOFC 4U1NA 2VXVH 3DX9B 3WD5H 3VFNA 3VFUA 2DWEB 2ZOLB 1OT2A 1OAZH 3EOAA 4GQ9H 5F9OH 1J88A 5CZVH 3UJIL 2CD0A 4HHAB 4UOJA 1N5YH 2A6JB 4YQXL 3ARBA 4ZFFB 4X9FA 3F7VA 2FIKB 2PXYA 3LDBB 3MRCA 3DUHA 4LLQA 3IAPA 1QOKA 3Q48A 3G5YA 3FHQA 4PJXF 1S7TB 1F6FB 4L3CB 3O41B 3VFSB 4JLRA 2WW8A 5SWZA 4J4PC 2MQ3A 3L9RA 2W9EH 5B39G 2EXYD 4U3CA 3L6FB 5C2BL 1KJ2L 1HQRA 3C60B 3EDJA 4FTVA 2DBLL 2IFFH 4A6YL 5ADPH 2K7QA 3RY6A 5I8OH 2HJKA 3UDWA 4HIJB 1FCGA 1Q94A 3K74B 1T66C 5F3HB 3UPRA 4L1DA 1Z0MA 3FMGL 2OTWB 3VXMB 4HFUL 1AP2B 5JOFA 3RWHA 4K8RC 4QWWC 2X70B 3W11D 2AJZA 4G8GB 4J6RH 4QRSB 3RU8H 4KV5F 1M4KA 3PHSA 1FVCB 2P45B 3TH2T 1X44A 3QI9C 2J6EH 3S35L 5MEOA 3P77A 3QCUH 2Z35B 2NW2B 5E9DB 1MI5A 3IXAA 2BC4B 1DN0B 5FIEA 4NRXA 2QQNL 4KI5C 3RTQA 5IV2A 1PQZB 1BBJA 3QWOB 4TUOA 4NUJA 1A1NA 1BEYH 1CD8A 4I0PA 3NPSC 4ZTOH 3LN4B 4M7ZC 3WFBL 5KSBF 4PTTB 4OJFL 3OAYH 1A4JB 4F57H 5C0IB 4XPAH 5INDA 3PGCB 5ISZB 1PG7W 4WCYH 2BNQE 1N4XL 2WWMD 1S7UA 2C4FU 3GJFB 3OKOB 3L3GA 3THML 1RUAH 4D3CH 4Y4HA 5E8OB 4CVZB 4K94H 1OM3H 2ADFL 3HLAB 1UQSA 3C2AL 4NFDA 1NFDA 1MLBB 4DZ8A 4YPGA 2V9TA 1EEQA 1QPPA 5BVPH 1QYGL 1JUFA 1I75A 2JKXA 4P4KB 5T3ZD 5C0JA 1FFPA 4Q2ZB 5DJDB 5KN5A 2GEEA 3L3JA 3C87A 4U0QB 1CR9H 5IB1B 5D5MA 2OL3A 3BPOC 5SV3A 4ODHH 4GSDH 4LKXB 1AGBB 4NHUB 4WWID 3VW3L 2R0LH 5KVFL 1X5HA 3RX8A 3Q0HA 3TV3H 1JVKA 3UTQA 3QXTA 4ENED 2WBJD 2FJFA 4UIKL 2LQRA 3VE0A 3CVHL 3LQAH 4FRWA 3GRWA 2OR9H 1F11B 4UB0L 1PYWB 4OAWB 5TF1L 3SGEI 4M93C 2AI0H 4MNGA 1IEAA 1BF2A 1DEEB 4GJTB 3BHBB 1U58B 4OF6A 2CDFA 3DROB 4WWKD 4CUCA 4UQ2A 3CD4A 2SEBA 1EAPB 3BGMB 2NTFA 1D5BB 2GUOA 3MFFB 4L4TA 4U1LA 1GCFA 3IFOB 5AAMA 4PJFA 1W72H 2KQMA 4HMDA 3IFNH 4ALAH 2BXZA 5F71A 2XQYK 4MVBC 3N1GC 3RVWC 2H32B 1D5MA 1YEDA 3N85H 4JY5L 2IMNA 2BNRB 3CZJA 3MLSH 4D0DB 3VFVA 2LFGA 4AYFA 3ARED 5IHUH 1KCRH 3GUTB 3DSNA 2YD7A 5KSVB 3RWIB 5FO8B 2XA8H 1FHGA 2XZCL 5LXGL 2FGZA 3TNNB 1HHHA 2KKQA 5KW9L 1CG9A 5GZNC 3VFGH 3R06A 5DJCA 2AS5M 3V8OA 4NQCE 3CSYA 1TJHL 5TDOA 2EDRA 5LGKA 5CBEA 5T3XD 4FQIH 3S96B 3EYSH 5I6XC 3OKEA 1EO8L 2IH3A 4P2OA 5L8JB 2EDFA 5CJQL 3WFZA 4OTXH 3SY0B 3PGFL 5HYSG 4F37K 1KIQB 1E4KC 2C26A 1D6VL 4TUKL 5IM7A 4OCSL 4ZOCA 1RK1A 5KSUB 3HAEH 3JWOC 4RISH 1N6UA 1SJHB 2OS7A 3RWJB 5C0BE 1MCRA 3G08A 1CFBA 2JTDA 2R0WL 3QFJE 4MB3A 1S5IL 1UKTA 3KXFE 4ZO7A 1VEMA 1GGIL 3CXDL 4L1HA 1MHHB 1JI2A 3B3IA 3CDGA 1HOCA 1CVSC 3V5KB 3RAJH 4XX1G 1SJXA 1RD6A 4KRLB 2QQKH 1DUYA 4NC1C 4G6KL 4OZFB 4LVOB 5C0NC 5J1AB 2FLBT 1G9EA 3HI5H 4LQ1A 2R56L 1AHWA 1CL7L 2VNCA 4QRRB 5LAXA 2BMKB 3KPRB 4C58B 4BK5A 4X5XB 2DIAA 1Q9WA 4GRLD 1CGTA 1LDPL 4PJHA 4EOWL 2O5YH 3PWNB 1VCAA 4M61A 5KJRH 2Q3AA 2XN9D 5SWSD 5F7MC 2PETA 2WIIB 3MRBB 4OCMC 4XTRC 3D87B 3ZE0F 4L3AA 1P53A 1RK0A 2W91A 5F9WC 3RWFA 2UWEE 4KI5E 5JNYA 5TPWL 2CDGB 4KUCD 2NY1B 3LH2L 4KRMB 2G60L 4P48A 4MD0A 5JDJA 3QIUB 3QPQC 4WNQB 3RY5A 1NEZB 3NFPA 5L7XH 1QSED 1BJ8A 4YO0B 3IDNB 1NPUA 2Y6SD 4U31A 4Q9RH 1KJMB 4NNXB 1EHAA 1XR8B 3P0GB 3VFMA 4RIRB 1MY5A 4JY4A 4E5XB 2GJJA 3CLFL 1PG7X 2XKSA 1NDMB 1HZHH 2FRGP 3SPVB 4WHYG 3RNQA 4WTZA 2BOCA 1F02I 5I15H 3WJLA 2OMNA 3ZKQD 1KN2H 4YHLL 4GG8A 4GKSB 3O45A 4C4KO 3U30B 4ISVB 1IGJB 2EO1A 3FOMA 4XVUD 2R2EB 2BY2A 3G6JF 3LRSA 2DQJL 4AM0B 5CSZA 5JMRA 2LVEA 1Z2KA 3CMOH 3S36L 5FYLD 3VGAB 1FQ9C 1YEGL 3LEXA 4PB9L 4LCYB 1XF3B 1JZ5A 2JCCB 5F7EL 2LTQB 1KV3A 4LRIC 1HYSD 3IKKA 5AYUL 1MFDH 1P9MA 1DBJL 4LHUG 4LIQH 3JSSA 1G9NL 3STZA 1BJ1H 3GKZA 1B0GB 4QHLA 3HI6H 3OB0K 4OCXH 3LKPA 1NBQA 1CDCA 5CBAA 4MZ3A 2DLFH 2Z93A 2D7OA 3RUGE 1CD9B 2GY7B 4NZTL 1QFWI 3V52L 2E7HA 3WIHA 1HQ4B 1C5CL 1I9RL 3MA9L 4M1DL 5DRZA 4TVPD 1Y0LB 1Q0XL 3QXVA 1UYWL 4JQXA 4RAUA 4YDIL 4ZMAT 3UTTA 2QQLL 4F7MA 4HUXB 5CS7A 4DAGL 5LWYH 3KPSE 5AEAA 5HDLA 3DIFA 4YGVB 2XNAB 1B4JL 2OTUA 5J3HD 5DMKA 4P2QB 4UUJA 1IC5L 3U4EB 4ZFGL 1INDH 1RULH 4HMCA 5DMJB 3ILQC 4Z7VE 4EEEA 3GSNA 5KVGH 3B2VH 1C5BH 4XCNB 4JHWL 4YFLF 4LASL 2LABA 4PLNC 1OCWL 1A3QA 3SCMD 4XB7A 5MI0B 5B39B 3MJ9L 5IB4A 2Y1VA 3AS3A 5EA0H 2CIKB 3PQYB 3O2VH 5DHVB 5IW1A 3IJYB 3WKNA 1KB5B 3TA3B 1DFBL 1G9MH 4H20L 4XBPB 1WZ1L 1BHGA 5C0CD 3QQNA 5FGRA 3TCXA 3NFSL 1UWXK 2OYPA 3TT3L 4H5SA 4R2GD 3WNMA 3F7PC 3VXUE 5CKAA 3MOBL 5CSGA 4O2FA 5FV1L 2AJUH 4NC1E 3FL7A 4P46D 1F4YH 1MLCA 5IBTL 1U6AL 4DEPB 1HHKB 1U8OA 1XGRA 3KHQA 4H88L 1XGUA 2X4OB 2CLZB 1C12B 2FD6H 4H26A 4Y5XA 5DT1L 1UT9A 4HH9A 5F7UA 5HDQL 1X4YA 4U0RB 2R2HB 2H3NA 4LGPB 4NNYB 4PJ5B 1FH5H 2DQTH 4FFYL 4Q74A 5GGVY 2HRLA 1ORQA 3QEUA 4PB0H 3CIQA 3TJHC 4X7TB 1NGZB 4K8RH 3T2QA 3HE6D 2EKSA 3BIBX 3QQ3B 3CDCA 5CEZH 4HLZH 4KMLB 3QFDA 5JW4M 4Q0XH 5FYJH 5F70A 3BESR 2OK0H 3BP4A 1TLKA 5IHZA 4FOMA 5KSAB 4JFPB 4KK5C 1URLA 3DXAE 3VG0L 5J7CC 5TE7H 4U7KA 5CZXD 3BSZL 2CMRH 1LO5B 1K4CB 3Q1SL 1J0ZA 5DJAA 4R26H 5HY9A 1HDMB 3F6LA 4P9MH 3ARGD 5DTFB 3H9SA 3O11A 5E99H 5ENWB 1OD7A 4PRAB 5D7IB 2IG2L 4Q9QL 3HE7A 5E2WL 3TJEH 5GRUH 4WI9A 3ULVH 2ITCB 3QCVL 4L8DB 3VRIB 4H25B 3NIGF 3K80A 4OQTL 4J3TA 2VR5A 3BD4A 2E7CA 1WK0A 1X5GA 2HTKD 4TNWK 4Z5RA 5JDSA 2YK1L 4LAJH 1AQKH 1LO0L 4YEEA 5F1SA 5IHBA 1YPZE 4NPYA 1R24B 4WY7H 5KVMC 3NFNA 3ARDC 4M5ZH 5FCUL 4Z9KB 5DQ9B 2Q8BL 3OKDA 4D9LL 4WW2B 4P59L 4X6DF 4Y19B 3CFIC 2HN7A 4C4KT 1F5WA 4JFDE 4FQXC 3UAJD 2HVJA 2DB8A 3EFDH 1TITA 5EN2A 4UTBL 2IGFH 4HBCH 1YMHB 4XPBL 2XWJB 3LB6C 4HWBL 1JV5A 4U1SB 1U3ZA 4MGXA 3NCYS 5EPMA 4GBXB 3PWVB 4F7PB 5C07D 5BS0E 4H1LA 3GMLB 5EORH 3JTSA 5TF0A 3F12A 2GK0A 4LDOB 5DQDL 2YD4A 3EO1A 3BJ91 3OKMA 3SGDI 5IVXE 5FK9A 3MV8A 4R0LC 2Y5TA 4AY0A 1ZWIB 3DMMD 1JYWA 3S88H 1YJDC 2EDKA 2B1HL 1I3RA 4XXCC 4HKJB 3OR6B 4YWGH 4PJXE 4HZAA 5DO2D 4WTZG 3NOIA 5FHAH 4KTEL 3FONB 43C9A 5FO9B 5HYSB 1SJEA 2VDOL 3GHBL 4F7EB 2FR4A 1T22B 1ULVA 2D9CA 3ZYJA 5EUKA 1FBIH 1X3DA 2WLYA 2MNUA 4ZQKB 2JJTC 5D9SB 4MXQD 3OZ9L 4MJ6B 2H9GB 5DDHB 5KS9B 4HPOL 4RMSA 1J9CT 2VLJD 5IQ9B 1OTTC 3SEPA 2AK4E 3LEYL 3U79A 4FABL 1RUKH 3ARYA 2XIDA 3C8HA 3T65B 4RBPH 5BZDB 4BKLA 5CKGA 3D39B 3VXRE 5FM8A 2CK0L 4UNUA 1QRND 2MHAB 3FQXA 5F7KC 1T83A 3LY6A 4I48B 5T33L 1QFHA 3HC4H 3C6LA 2X9WA 3ZKXB 3BH8B 5HGAA 3C5ZB 3SBWA 2V17H 2CJUH 3GO1L 3NABL 1A7QH 4MMXC 2CKBA 4WW1A 3DECA 4HKBA 2A1WH 3SDCB 1FE8L 1SEBA 4F8QA 4PJDB 4CNIA 3CUPA 5DD6B 3RGHA 1EDQA 5DJZB 3ZKMD 5C09E 4WO4C 2AJYL 1SBSL 3T0WA 1OP5K 4JFFD 5KSBE 3G5VB 1KULA 5T5FL 1CXEA 1JE6A 1IRAY 2VZUA 1B0RA 4NQDA 2ED7A 3EOAB 1IC7H 3MRIB 3RIAF 2V7HA 3DX7B 1L0XA 2UVFA 2R0ZH 4NZUL 5T3ZL 1EXUA 1FZOA 3ARBB 2NW3A 1VHPA 3I85A 4B0MM 2OI9B 3K8MA 4IRSD 3RGVD 1MAKA 3FQUA 1TJIL 5D1XC 3MLRH 4JQIL 1IT9L 3BAEL 5FYKH 1ZVYA 2YOCA 4B5EA 1EH9A 2DYPA 2R1YB 5I1IH 1KF9B 2ERJB 2VLMD 3RVUD 4JRYB 3L9RB 4F80A 4BQ8A 2RFXA 4OFDA 1NSNH 3SQOH 4JDZA 1JGDA 4LPYA 5LKNA 1X7QB 2YPLB 3QIBC 4LBEB 1NMCC 4FTVB 1UFUA 4HKZB 2XQBH 3BZDA 4LVHC 4PRPA 3KG5A 4D9RD 4K3HA 5FUOH 1Q94B 5IVOA 1FJ1A 3UPRB 3QUKA 4HWNA 3RDTA 3BMWA 3HMWH 3TM6A 4JB9H 3ALXA 3RWHB 4EBQL 3U46A 5L0QB 1G7IA 4OZGA 4PRDA 2ZKHL 1B4RA 5EC2A 2J8OA 1FNFA 2CUMA 4YK4C 2AK1H 5CIPA 2VLRA 5H94A 1A9EB 3VFOB 4NRYB 2QHLA 3BVNB 5GZOC 5J1SC 3WKML 1RZKH 5CD5D 5IV2B 3ETBF 1HYRC 3I75A 5DWUL 5KANG 1A8JH 1NBVH 4O5LL 2AEPL 4TUOB 1U93B 4NUJB 4F3FA 1H5BA 5GIRB 4LHUB 2P5WE 3QDMB 5KZCD 5KOMC 3OXSA 3QIWB 3O3DB 2W0KA 4FZEH 5T3XL 2ZSWB 5C0GA 3IAGC 1WV7T 1JRHI 3ZLQC 4QCIA 4ZPVA 3V5HA 4TRPL 4Y2DD 4N0YH 4X9IA 1I1AA 2ARJB 1A7NL 3LN9A 4WUUB 1IE5A 1QFWL 4X5WA 4X9HA 1S7UB 1ZA3A 1C08B 3QWQB 1J8HD 1PJ9A 3O4LA 2QEJA 1A2YA 4ZPTA 4HUUA 2EICA 3BN3B 5K9KA 4YPGB 3HMXL 1JHLL 1BGXL 4FG6C 4O02L 3I3EA 4YHPA 5C0JB 1FFPB 3REVA 3PHOA 4R4FL 3MROA 3BQUB 4M4PA 5DVOA 3TGXA 4YQXH 4Q6IC 3BW9A 3CU1A 4R3SA 3VXSE 2C3XA 4HXAL 5C08A 4ZYKB 3LZFL 4HUKB 1UM6L 4UT9L 3STBA 3MGOB 1L4IA 5CGYD 3WCYA 2NY3B 3MRLB 2FJFB 4JFED 4NRZA 4YHIA 2EEBA 1INEH 4I18C 4MNGB 4F8TA 3LN5B 4X83A 4I4WA 2RB8A 2CDFB 2HKFL 2DBLH 1GGCH 3VJ6A 4A6YH 4ELMF 4UQ2B 5C9JA 1T0MA 5IK3A 5J6GA 2GUOB 3KLAB 2D4FA 5DJXA 5F3BA 4XVJL 4HCRH 1JNLH 5E6ZA 4N5UA 1U8HA 4EQ3A 4KUCF 5J13C 5DUML 5F21B 12E8H 1CTNA 3ZE0E 3GNML 1QEWA 4MNQB 3RVVD 3S35H 2HFEB 4M02A 4EN3C 1QKZL 3RHWF 4H1LG 2HJFA 1NCUA 4JE4B 4KPHH 1TJGL 4LQFH 1F13A 3R06B 1ZE3C 4WENB 5DJCB 3SE9L 3UTZA 2NY2C 1H3VA 5SWZD 1T0NA 4MCZA 1XF5A 3BWAA 3HA0A 3SKJH 3ARPA 3QJHB 4MYWB 3JV0A 4JR9H 4MQTB 2YA0A 5T1DL 4P2OB 1DVFC 5HGDA 3QUYA 1GL4B 3DUSA 5AZ2L 4WU7A 4HGMA 5HI3C 1TETL 4NFCA 1X5XA 2HAZA 5IM7B 1N4XH 5DHVH 2E7LC 5EZLA 1LVEA 3ZTJG 4FMFA 2N56A 1RK1B 3V4VH 3SN6N 3THMH 2VLKE 2OZ4L 4ZS7L 3HNSL 1FNLA 2OR7A 3X3GL 4ZDHB 4QGTA 4YZFF 2ADFH 1AGCB 4XBGA 1OP3H 4NZJA 3GM8A 1U8JA 5F7NC 1VGKA 4PJEF 2QJDA 1MI5D 3QXDB 2P5ED 1QYGH 2Y9RT 1IM3A 3B3IB 4NQCA 3CDGB 3IJHB 4DUVA 3WSQL 3RTQD 5D1QA 1VGEL 1W0VA 5I1CL 3G6JE 1DUYB 4PJBF 2E9WA 2MFNA 4ONGL 1T1YA 3CSGA 3WYRA 3VXTA 3QDJE 4KU1A 4HKXA 1XT5A 1A3LH 5I19L 4OFPA 3VW3H 1HHIA 5LAXB 2HLFD 4MJIE 1Q9WB 1M6OA 4HD9A 4YUEL 5I1HH 4L4JA 3GI9H 5T1LA 5TF1H 3V9FA 3OPZL 1FL6B 2DLEA 3KXFA 4ZSOE 4ZO8A 5ITBH 2RGSA 32C2B 1SMOA 4TVPL 4Y4HD 1RK0B 1C1EL 1PY9A 4Z7UA 3RY4A 2ENYA 1CF8H 1H3TA 1PKQB 3NA9H 3H3BC 1V7NL 3ARXA 3O3AA 2XQYG 4DCQA 1MJ8L 4PRNA 4E41D 5T1KA 1BAFH 3NFPB 2XG5A 4JY5H 1FVEA 1TZIA 4HZLA 2O5ZL 1RPQA 2PO6A 5EUOA 5D7KE 3WJJA 3RNKA 1QSFE 4ZUVA 5LXGH 5L2KE 3X17A 1AC6A 5D7SL 3BIKB 5KW9H 4JY4B 3W11C 2GJZA 3B6SA 4MD4B 3D9AL 4LLVB 3MGTA 3DBXA 5D2LB 5B8CA 4N0UE 1TJHH 2CXKA 1CBVL 3ARFA 4AZ8A 4PJ9B 3RNQB 1BOGB 3VRJB 4EXKA 3O4OC 4BQ6A 2BOCB 4IBLT 1EO8H 2BRRL 1QVOB 4HJGA 3E2HB 2K7PA 5CJQH 2W0FA 4TSAL 4UAOB 1N64L 2ADIA 2GAZB 3PGFH 4GG8B 4L4TD 3O45B 1V5JA 3IDYC 2H45A 1RHFA 1DDHB 3FOMB 3UTSD 4PJIE 1VFAB 1A6UL 3ZSSA 1AI1H 3OB8A 3G6DL 2BDNH 5IMMB 4KDTA 4FXKA 1JGLL 5E5MA 3SOBH 4EDXB 2R0WH 5CSZB 3IAQA 4JCLA 1OOAA 2VAJA 1S5IH 4X6CF 5K59F 1T2XA 1GGIH 1H3UA 4JFOB 3STLA 5DMGC 1UJ3A 4OGXL 5BMFL 2WWMC 1U91A 3SKOB 2AJSL 2KPNA 3B9KC 3HNTL 4G6KH 3UZEA 1AC0A 3TPUA 2H2PD 4GKOA 4ZXBC 1VFMA 3F58L 3QNZA 3ZMRA 3HZKA 1TPXB 4BK4A 3PDOA 2RR3A 5CBAB 3PABA 3VU2A 2ADGB 1LDPH 4PGDA 2RHEA 4EOWH 5HHVL 4OGAD 4NN5C 1LO2L 1XGTA 1KXQE 1LD9A 3P0VH 4HIIA 5DRZB 2F19H 3W0WA 2CR3A 43CAA 2NX5E 4YIQA 5FECB 5HYEA 4IIQC 2EEAA 2A6DA 3OSKA 1I4FA 4F7MB 4ENEC 4YBQD 3TH4T 3OGOE 3DIFB 1RJLB 4EDWL 3KWWB 4JFZL 3LH2H 4QXGH 5DMKB 4JM2C 4UNVA 3CDYA 2G60H 1A3RH 1EUTA 3ZDXF 4JPKH 1I8LC 1B2WL 1H3PL 3OR7B 4WI2A 4KKBD 3GMNA 2C9AA 3RL2B 1MCDA 1LQSR 1EVUA 4LNRA 4Y1AD 3T09A 5IB5A 3O9WD 3GI8H 5CMAB 3VH8A 2XACC 2ZUXA 1Z5LA 3B9EA 3NIGE 3CLFH 1ONQA 4CMHC 3ARSA 4PY7A 1VKXB 3VGDA 5EC1A 3DYPA 1KCSL 1UZ8A 1XCTB 4PR5B 4AIOA 1MHPL 5EFIB 4NYLB 2FO4B 3SGJA 4X6BA 1F6LL 2XTJB 1QR1B 1XR9A 4YHLH 1S9WA 2KH2B 3B43A 3IDMB 4OF8A 2ORBH 3DYMA 3WIIL 4C54A 4PUBH 4NO2A 1U8OB 3MA7A 3KPPB 1XGUB 2NY5C 3D2UD 3C60C 4PJ8B 4RA0C 3WNNA 4NWTL 1BECA 4Y5XB 5EIQA 5E95B 4HH9B 2GT9A 1MELA 1ODAA 1OGAA 5I75B 3FRPA 4JGMA 1YEGH 2EZ0C 3TO4D 3QUMA 1MF2L 5F6HI 3SDAA 1XIWD 4Z0BL 1XGQB 3GBLA 1IGCL 1ORQB 3Q6FA 4UDTB 1ROWA 3OKNA 3U36B 1KB9K 3HZMA 1G9NH 2YRZA 1JRHL 5ID0B 5KTEL 2JE8A 4N90E 3WFHB 4MS8D 1KPRA 4MA3A 4NKIL 3FB7A 3BP4B 1A6AB 5IHZB 4XMLL 4WHYH 2YZ8A 3V52H 2VYRE 4K7PL 3FB5A 3MA9H 4M1DH 3WHXA 3AVEA 1E6OL 1UGNA 3MUZ1 1FYTD 1UYWH 4JZJB 1NDGA 5HY9B 4YDIH 4DUWA 1KLFA 1GZQA 3RWEA 5F6IB 3ZZ1A 3H9SB 1NUGA 3AGVA 2QQLH 1EEUA 3EFFA 4MSWB 1QSEB 1P4LA 4U4BA 4R8WL 4LEXH 1RUPH 3W2DL 1Q1JH 4YC2C 3QA3B 4GW5A 1IC5H 4I3SL 4CVUA 3A67L 1JF6A 3QDHA 3T4AA 5I1KL 4XVTL 4UIMA 4QRTA 2NY6B 4ZFGH 5BV7L 5E6ID 3T3MF 2VTFA 1SHMA 3ESUF 5HHME 1TDQA 3IFLL 3WL9B 1UZ6F 1YN7A 4Z5RB 4JHWH 3BKYL 1OCWH 3U7YL 5FM5M 1RUQH 1NCAH 5ILTL 4NPYB 3MJ9H 3WXVL 5GJTL 3NFNB 5EG6C 3Q6GL 1C5DB 1PDKA 15C8L 4LARH 3OKDB 1ZGLA 1DFBH 4S1SH 4BZYA 2DIJA 2HN7B 2Y6SC 4H20H 4NN7B 2LV4A 5IFJB 1WZ1H 4XNMB 1JNNL 1PD6A 3BX7C 3NFSH 1QFOA 5EN2B 1L6XA 4PD4K 1U3HA 4UTAL 3IU4L 3MOBH 4BM7A 4M8QA 1GC1C 3ZSTA 2EH7L 2AXGA 4OIBA 4ZFOA 5D7IF 3JV4B 5IBTH 5EPMB 2HP4A 4HF5H 4KH2A 4H88H 5E1AA 4H1LB 1E4XI 3SKUD 1LO4L 3JTSB 3F12B 2AP2A 3V0VB 2GK0B 1CLZH 3CPLA 5D8JL 5K33A 5DT1H 2EDOA 3HR5A 3HUJA 1PG7H 5ESVB 3DRQA 2FHCA 2WUBL 3R1GL 5FK9B 4CBPA 2DQGL 4U6TA 4FFYH 2Y5TB 3QDGA 1YA5A 5TQ0L 4LRNH 3ULUH 5TFSL 4RZCB 4XT1C 4G6MH 1IBGH 1W0WA 1NCNA 2Z31D 3MX0A 1OSPL 2ZG1A 1YNKL 1MFCL 1Q9LA 1CI5A 5IVZA 43C9B 1IKNA 1SJEB 2FR4B 5E2VL 2CO7B 2D3VA 2IAMA 4LRIA 1T5WA 5CP3H 1ZS8A 3BGAA 4BH7A 3CAFA 5BS0A 3VG0H 3S5LG 5GRYA 4OD3L 2Q8AL 3BSZH 3LOWA 1SY6A 4IMLA 3IXTB 2VR9A 3PL6A 2E6PA 5IBUG 2EC9T 5L2JA 1UM5L 4KRPB 3HCVA 4BA8A 4J3WA 4PJGA 5IVXA 1A21A 3BGFB 4OSUL 4R4BA 2IG2H 5E2WH 2D9QB 4G6FB 1WBXA 3JVGA 4N1HB 4NDMA 1QFUL 1P7QB 3BE1H 3JV6B 4NHCL 5I9QB 3GSXA 1H15B 3QCVH 3W82A 3NAAL 1L7TL 5HGAB 5DZNA 4FQHB 3FTGA 4OQTH 3FQRA 2AXHA 4JZNB 1JMXA 2NTSP 3JV5A 3OG4B 1K4DA 5TE6H 4CNIB 2IBGA 1LO0H 2VDNH 1VACA 3ALPA 3SGEH 5I1EL 3MRRA 5FCUH 4XC1L 1S7WB 3FO2A 5D71H 2Q8BH 5DVLA 2XZQL 3FB8B 4D9LH 3AXLB 4MNHA 4NQDB 1B0RB 4H0HB 4JQVC 2V7HB 3V6OA 4NM4L 3P4NA 4L9DA 3KYNA 3VXME 4YDLB 4UTBH 5DEZA 1FZOB 4R90L 3HE7D 4XPBH 2NW3B 4G8GE 4HWBH 4JPVH 3T08A 5EIIA 1U8MB 4KGLA 3MACH 3CX5K 1DQMH 2EXWC 3GMQA 2W65A 4BQBA 5E9DE 2RCSH 1NUDA 5DQDH 2ZG3A 4R2GC 5GS1A 1FZMA 1RJYA 1N6VA 3FZUC 5DFVD 1I3VA 2R0KH 5FKAB 2EIBA 5TH2A 4K7FB 4JDZB 1JGDB 1XF2B 3QIUC 5JHDD 4PRPB 4WV1A 4FQPA 4Z0XA 4P5TB 3TBSA 4U6HA 2NZ9C 4MXWL 3R8QA 3NN8A 5CP7A 3ZE2F 3KLHD 3OV6A 1FJ1B 2VDOH 4QRQA 2DD8L 5ISZE 5ANMA 5D7JA 3R0NA 3U46B 3X12A 1G7IB 4OZGB 4PLJC 4HFWB 2XN9E 3Q5TA 4ELME 5D72L 1I9EA 2PYEA 1JK8A 4J2XA 5BRZA 3O2DA 4HPOH 5CIPB 3LEYH 4R4NC 4L8SC 4GT7A 5GGVH 4FABH 1YQ2A 3MR9B 2Z92A 2VITA 1Z9LA 2B39A 3L3OA 3FRPG 2CK0H 1QO3B 4ZAKB 2PTTB 5MENA 5T33H 3PP4L 3MV8D 4G8IB 1XMWA 4IRZL 3U30C 5E56A 3OXSB 1IVLA 2EC8A 2X5PA 5C0GB 3S37X 1QBML 4QCIB 5I74B 3VGAC 4XWOD 1I1AB 2VXSL 1JPFA 3IT8D 5EO1A 1T2QL 3VWKD 1PY4A 2IANA 4X5WB 5AZEL 2H1PL 2OM5A 2AJYH 1ZA3B 5FOBA 3KYOA 5J1TC 1JYXA 3GB7B 2IPTL 2LTQC 4ZPTB 3V8CA 1EBPA 1GGBH 5DRWA 5T5FH 5K9KB 2GCYA 2Q3ZA 2D2OA 4DGYL 3MLZL 3REVB 3PHOB 3VXQA 3MROB 2CSPA 4NZUH 4X98A 5T3ZH 4XVSL 3BPLB 3C09C 3BW9B 1J18A 3BZ4A 5F1KC 3VWJD 4R3SB 5IBLD 1WBZB 1VEOA 4YZFE 5C08B 5DUBB 1N5AA 3D3VB 5EU6A 2BNRE 4GG6B 3C6LD 4HLJA 4JN1L 2ED8A 2D7MA 1EGJL 1TJIH 2UZYB 4JQIH 1IT9H 3UAJC 1GZPB 3OAUH 5EOTA 4IDLA 4KDWA 1MNUH 4MAYA 4NRZB 5GRXG 2P8MB 2DLGA 5A3ID 2FHBA 2Q87A 1I1RA 3REWA 3B9VA 5F93C 4I4WB 3WXWL 3CFBB 1KT2B 2W9LA 5DXWA 2AABH 3EO9H 5I1DB 1CFVH 2ZSVA 5DLML 2AQ1A 2D4DA 5IK3B 2X40A 5JPNB 4GAYA 3L1OH 4LCWB 1D9KB 5FYJU 2AV1B 1NFDF 3KLDA 4EBQH 4FXGB 4OD1L 2NZIA 2X89D 2ZKHH 5JORA 3HG1A 5ETUB 4TVSa 1QEWB 4GRMA 3U0WL 3TA3C 2I5YH 5D5MF 2OL3L 3CCHA 1HH6B 3WKMH 3X14A 1NCBL 4Y16D 1JF5A 1KG0A 3JUZA 4XCFL 4KXZI 3TFKD 2DYPD 4G9FA 3G5XA 5DWUH 3UTZB 1EFXB 3NH7H 4U1GB 4O5LH 2Q1EA 1F6AA 4MXQC 5J11C 1FFOA 1KCVH 1XF5B 1CICB 2Y7QB 5CINH 2V5TA 4QXUH 3X3FL 4AEFA 4D8PB 5T3XH 3M17B 4XH2B 2W60B 4D94A 3N1PC 1EHLL 2WLZA 1WF5A 2VO5A 3KPRE 4TRPH 4WU7B 1YEEL 2LU3A 3MRGA 2H6PA 1CFTA 5EO9A 3VFTA 1A7NH 1KUMA 1QFWH 4JPWL 4XNUL 5BV7C 3E8UH 1F4HA 4KK8D 1OHQA 4PJFF 4JZOA 2H2SD 3EOYG 4M43L 5I1JL 3IS1X 5ICZB 2GITA 1SQ2N 1WIOA 4HIHB 5IW6A 4XBGB 5I76A 2VLRD 4Y5YC 1R3IH 3HMXH 1JHLH 1ZHKB 4ZG1A 1BGXH 1GOHA 4O02H 3BO8B 1N8ZA 3ZKMC 4QRPE 3UO1H 3IU3A 3Q3GA 2J8UB 5JW4R 1J1PH 5DD1H 5KSAC 4LLWA 1T1YB 3CGTA 1G7PA 2QV2A 4K3DL 4TNVF 3GKWH 4HKXB 4HXAH 4MWFA 3LZFH 3BD3A 1P7HL 4X6CE 5K59E 2NPLX 1UM6H 2AKRA 5A2IH 4WFHD 3AM8C 3CK0H 4D9QE 2ZZUT 4WJ5A 1M6OB 1GXEA 2NYYC 3MRMA 5ID1A 3FQTA 2AJXL 2VLKA 2ZPKL 4JGJA 4I0KA 3VGGA 3DO7A 3CMGA 1JPGA 4IRSC 2AJ3A 4XPTH 4YGAB 5IJKC 3EYUL 5L8LB 2B7DT 4HAGA 3D5OF 3OGCB 3QZWA 4M6NL 1LE5B 1RZFH 4GKZA 4UINL 3L95A 5A2LH 3O3AB 1D5XA 4OZHB 4JO1H 5A2JH 2V6HA 2BJML 3DGCR 4YXHH 4ONHA 3VD7A 5DUMH 3ZKSD 4UU9A 1EA9C 5T1KB 1JNHA 3MRDB 5EU7C 1TZIB 3GNMH 3TBWB 4XI5C 1E4XL 1FNSL 4HUNB 3IKCA 1G7JA 8FABA 2FX8H 2PO6B 2VB5A 5EUOB 3A0OA 5HDOA 1VADA 3CX2A 1XAUA 1QKZH 4G7YL 3TN0D 2APTA 1WCQA 1A7BA 2BNQD 1UEYA 2CPCA 1XF1A 3ZDXE 1MJUL 4Y8DC 1CDIA 2GJZB 3SE9H 4PBVC 4Y5VA 3BEVA 4PV8A 4Y2DB 5IIEA 3B5TA 3EYOA 2BY3A 2IH1B 4PJHF 2A9ML 2VZOA 4GBXC 4JFXA 5T1DH 2BVUA 1P6AB 2CR6A 3E3QC 4C56A 5HYFA 2W0FB 1DANT 4IRJC 3I6KA 1KYOJ 5AZ2H 1NAMB 3S5LB 2O61A 4QHKI 2FO1A 2VXTL 4X8JA 3TZVA 4YHKL 5IBUB 1R3HA 2OZ4H 1QSFA 4ZS7H 2WBWB 3KPQA 3HNSH 1KPVA 4FXKB 2F54B 4XHQA 1H3WM 2L7UA 3F5WA 4DN3L 1M7DB 3QHFL 3D0LB 4LEOB 3STLB 4R7NA 5FYLH 3MLUL 1MCJA 5I17A 3WSQH 3O6LH 4PYGA 4CJ1A 1OTSD 4BFIB 5I1CH 4P2QE 4FFZL 2NY0B 5AD0B 2X4PA 3SJVB 2OTPA 1NC2D 1T7XA 5CZKA 5F6HJ 5I19H 5H8DA 3QJFB 2DF3A 3HZKB 3QNXA 5FYKU 2ILLA 3WNKA 1QTYT 1NFIB 3PABB 1W72A 3BOVA 3RKDD 3KPTA 2EDJA 3GSOB 3QUYD 5CEXA 4PGDB 4YUEH 4PJIA 1IZKA 4DKEH 3D85D 3LKSB 1FLRL 3DWTA 4KJQC 4NQVA 3OJMB 4AIZB 1Q9OA 4AQ1B 1XGTB 4HIIB 1LD9B 3DX8A 1RZJL 3PQYE 3OPZH 4UQ3B 3DX6A 5ALCH 3U1SH 4C83A 1FGVL 3HZYA 5DD0L 3ZKXC 1JZ2A 4YIQB 2PW1A 4WTXA 2A6DB 4POUB 4TVPH 5CGYC 5E6YA 3C5ZC 5GS0H 1I4FB 3NMEA 4K71C 5A43C 3WEXA 1C1EH 2P44B 4OLVL 5KVEL 3ZTJH 5FCSH 1KJ3H 5HHXL 3SDCC 3I6GB 1GGTA 1V7NH 2GI7A 3HHRB 4NQCD 1MJ8H 3IRZA 4DQOH 5GSRA 2X42A 3VFRB 4WTWA 5D1QD 2YA2A 2OLDA 3GMNB 1NFKA 3VI4F 5I73B 4FQ2L 5D7LA 3HZVA 3EYQC 3U2SB 4LSUH 3RWDB 3SGDH 3DUUB 2APBA 4L29B 1P84J 2VE6B 3VH8B 1Z5LB 2J8HA 2P46B 1HSBA 3T3ME 1BQHA 4EN3A 5C0BD 3ARBC 3MJ6A 1CBVH 1UZ6E 5T1LD 3C8KB 3QFJD 2OI9C 3MSPA 2WQRA 5GPRA 3WIHL 2PXYC 3KXFD 5HHOE 2BRRH 2ICEB 5C0DB 1OW0A 4TSAH 1N64H 1T20A 2ATPA 2VL4A 3SDDB 1XR9B 1KEGL 1PX4A 4KRNA 3MV9A 4PJ7B 5J9PB 3MA7B 1A6UH 1RMFL 5MERB 1SYSA 3RY6C 4HIEA 1QRKA 2ENSA 3UDWC 2PN5A 1FNEA 4G80A 4HIXH 3DLQR 1KPUA 3GSNL 3QUMB 1ZLUK 2HKHL 5D7IE 4OIIL 4OGXH 3KYMB 1JGEB 5BMFH 2AJSH 3BZEA 2L4OA 3MBXH 2GIYA 3HNTH 3OKNB 4L3EB 3HZMB 4LCIH 2QKIB 2YMXH 3OAZH 3ARFD 3F58H 2APFA 3O3EA 4KI5D 4LLMA 4FS0A 5DEGA 2VXQL 1FSKB 2VLME 1KPRB 3W5MA 4MA3B 5D2NB 4NQEA 3BEWA 1KIRA 3RTQC 4ERSH 1NBZA 3IDJB 5I8EB 3IRPX 1MRCL 2QSCL 5HHVH 3FB5B 1J1OL 1LO2H 5EU7E 1KFAL 1KN4H 5F8RC 4PRIB 2H8PA 4I0PC 2J7LA 1A5FL 1NDGB 5CILL 3KHOA 1GZQB 2K3TA 4LMQE 3RWEB 1LDSA 5IMOA 2FGWH 3QXAB 2A77L 4Y19E 2IEPA 3VXOB 3LD8C 2G2RA 1P4LB 1IKFL 3PWLB 4GLRI 1IILE 3W9EA 5SX4I 4EDWH 2XXMB 4JFZH 3HC3H 3OTTA 1TENA 2ZUUA 3VA6A 4U6XA 1AGDA 3T4AB 5FDWA 3BKCL 4QRTB 4LFHG 1SYVA 1B2WH 3DHJA 4Y4HC 4ODXB 3EO0A 2AV7B 1IC4L 2WINA 3E3QE 4O2EA 2ESVB 1BFOB 3S4SA 2FL5A 1DQTA 1UADC 1F4WL 2FWOB 4PREA 2OSLB 3UYRL 1ZGLB 5GGSY 4JN2B 3S98A 4YNYA 1KCSH 4TULH 4NO0A 3W9DB 4QXWA 3WHE1 2ATKA 3QZWG 1PX3A 4U1IB 2NY3C 1U92B 1EO7A 1U3HB 4IHOA 2GSIA 1IEHA 4PS4H 4XXDB 3L5JA 4HDIA 5F9JB 1GIGH 1EJ6A 1RY7B 5CUSL 3MLTB 1RURL 3BP6A 3O6FA 4ZFOB 3WIIH 2P24A 1G0XA 5I1AB 5E1AB 5FA3A 2HFTA 3K2MC 2Y06L 4X7DC 4U2YA 4U49A 5FF6A 4KHXL 5IVNA 3HUJB 3LQMA 3B8SA 3IVKA 3DRQB 1I7UA 4MVBD 5F96L 4QY8B 4JRXA 1FZKB 3QDGB 3FQNA 1IGCH 5EDXA 5I18L 3GSVB 4LPXA 2ZUTA 3UC0L 3WLBB 3MV01 5HHPA 1JRHH 1HI6A 4YHML 3KPSD 2XWBB 2I60L 1NL0L 1FPTH 5ALBL 5GZND 5KTEH 1UWEH 1OP3K 4P3DA 4JFQB 5F9AC 1T5WB 3RZCB 4NKIH 2QTEA 4ZXBA 4JJ5A 4K7PH 1ITBB 4HK0A 4QTIH 5HI5C 1DBKL 1E6OH 3ZE2E 4D0CA 3MODL 5IFAL 1AH1A 1N0XH 4WU5B 1FG2B 2GTWA 2I27N 1DN2A 1TQCB 4YDJA 1KGCE 4JEGB 4PRHA 4EI5A 3DHMA 4P2OC 4BUHA 3RVXD 4GXUN 4R8WH 1J10A 4JO3L 2DQHL 1BZQK 1OGAD 1DQQA 2W9DL 6FABL 1WBXB 2F8XC 4NDMB 3L3HB 1I1YB 3SDAD 2BSED 3O9WB 4ZTPL 1MEXH 4UV4L 4XVTH 1I7TA 3DARA 2CKNA 2EDXA 1X5JA 1Y18A 1IGFL 3FTGB 4MLSA 5DR5L 4OKVA 3VGFA 3IFLH 4JHAL 4YBQC 1YEIH 4JM2A 3BKYH 1CT8A 4RWYL 1K4DB 3U7YH 4HWEH 4P99A 1VENA 5ILTH 2X1QA 1HEZA 5C0ND 3WXVH 5GJTH 5SWZE 5IMKA 4JO2L 3Q6GH 1HH9B 2DWEA 3FO2B 2ZOLA 3BJLA 3CZFB 4KKBC 4APQA 15C8H 2D31B 4FTVE 2O5XL 4MNHB 2DQUL 1AHWC 2BVTA 5T5NG 1H3GA 2CRIA 1SBBA 4OBRA 3AB0B 2F15A 1JNNH 4JVPA 3QULB 1NAKH 3KYNB 4QOKA 5F89B 4UTAH 1MJ7L 4ZFFA 1V8HA 1CQYA 2EH7H 3TO4B 4TPRH 4XP9L 5EIIB 1ZVHA 3FCTA 4YDKL 1S9XA 5D1ZA 1KCUH 2ZCLL 4N0FA 1MI5E 3QUZB 4XPHH 4X5LA 1S7TA 3FO9A 4RFEA 4YFDB 5BZWB 2V7NA 1GRWA 4L3CA 1M05B 5DHYA 1HXYB 2MWCA 2O26U 1GYAA 1FZMB 1Q72H 1HKFA 1RJYB 1IQWL 1S5HA 2F74B 4N9GB 3L6FA 1CGSL 2CKBL 2WUBH 3DXAD 3QPQD 5IQ7L 2X44D 5TQ0H 1UKQA 3ARQA 5TFSH 4FQQB 1BQHG 1RVFL 3HAEG 2EECA 4Z0XB 5DD5L 4NKMB 2UV3A 5MEQB 1OSPH 2IPUG 5F3HA 5IB2A 3TBSB 1YNKH 1MFCH 3MRPB 2OTWA 5CP7B 4HQQL 3P73B 4LK4A 3LIZL 1JHKL 4G8GA 4QRSA 1YYLL 4M1GL 5ANMB 5D7JB 3GGWB 4WUUE 4M4RA 1DUZA 2EDTA 1UWGL 1A9BA 5FUZH 2Q8AH 2PYEB 4ODSL 5E9DA 1EHNA 2BC4A 1UWXH 1DN0A 4M9OA 4PJ9C 1UM5H 4WHCA 1NFDE 3C5JA 1GVIA 1QNZH 3RPIB 3P4MA 3WJLC 1BLNA 3GHEL 5CCKL 1MCWW 3E2HC 4OSUH 5EIVA 4UAOC 1RZJC 4G3YH 3NACH 4DK6A 3VG9B 3MBEB 4NHCH 5D5ME 4NN6C 3MQIA 5IG7A 3QQ9C 3NAAH 1L7TH 1A4JA 1WBYB 1J5OL 2ARJQ 1P4IL 4JFDD 3PGCA 2Z4QA 5ADOL 3DYOA 3NCBB 4NJAH 4WI5A 1M7IA 3V4PH 1KOAA 2M8XA 3UZQA 2A38A 1LE9A 4F37F 2FX9H 2IAMD 3WDIA 4LSRL 4CVZA 2FATL 4MNGE 4TN9A 1KTLB 4XNXL 5BS0D 1MLBA 2XWTA 4ODBD 4X9GA 2X1WL 4CRPA 1DLHA 4OZGF 3CVIL 2XZQH 2HH0H 2ZUSA 1P9MC 4P4KA 1NKRA 4Q2ZA 5DJDA 4KHTL 1NAMH 4NM4H 3MNZB 4L4TE 4PJFE 1PLGH 3QEQB 5FUCC 3EYVB 1I3GL 4WI7A 4ZD3L 3S3PA 2I26N 3BZ4B 5H35A 4MAUL 1GPOL 4PLKC 1L7IL 4HAFA 4NHUA 3SKMA 5EU6B 4L9LB 4MNQE 1MHCB 3CFCL 1ZGLM 1AO7B 3UYPA 5EOTB 2Z31B 2AEWA 1W0YT 3BP7A 4MAYB 5DHXB 1PYWA 5FA4A 4OAWA 2DOCA 2CO6B 3HTLX 3S4SG 4TTDC 1DEEA 3BHBA 5CEYA 1J1XL 3ILQD 2AK4D 3MFFA 3WNLA 2MPAL 2ZSVB 1KB9J 4JO4L 4MXWH 3TVMB 2HTLC 2DD8H 5DK3A 1MREL 4I8DA 4PV9B 2F5AL 3FRUA 4DVRL 5DC0A 4D0DA 1A14L 1YMMB 3K4DA 5LBSL 3HG1B 2MCPL 5JORB 2UY6A 1OT1A 3GUTA 3F8UB 4GRMB 2BZDA 3M1BA 1ZXQA 3RWIA 5FO8A 5KSVA 4PRBB 2VDML 3FO1B 2J88H 1U8PA 5CD3A 3CCHB 3QWRA 4YX2L 1A47A 2CRMA 2NXYB 2OJEB 1T03L 2IPKA 4JG1L 5GGQL 1P4BL 1FL3B 2XTJC 3T0EB 3S7GA 4G9FB 1U3YA 1SJVA 1F6AB 5HYJB 3ARTA 3PP4H 2A9NL 2EYRA 4P2RA 2QBWA 1QBMH 3QXWA 1KIQA 4ODUB 4Y5XC 1F2QA 3MO1A 4LP5A 4PP1C 3VFTB 5KSUA 1T2QH 1Q38A 4PJHE 5AZEH 5C0RL 2H1PH 1SJHA 3RWJA 4MDIB 2IPTH 5ACLA 4WI3A 4P3WA 3HFML 3LHPL 4O9HL 1C7TA 5IW6B 4PJAB 4J7RA 4QHKJ 1J0JA 4FQLL 5TQ2L 1UB6B 1FG9C 5EO0A 3V5KA 4DGYH 3NCEB 1MRDL 3W39A 1PKQE 4KK5D 5J1AA 1S3KL 4XVSH 5K9OA 4ZUWB 5JQ6H 2WP3O 1G7PB 4JQVA 3GMOA 5MEND 2DS4A 4QRRA 1MIEL 1FORL 1MCBA 2BMKA 3KPRA 4JN1H 4X5XA 1NCCL 1EGJH 4XWGL 5DFWH 5F6IC 4O58H 2JELL 4WJ5B 1QHOA 5ID1B 1LK3L 2Q6WB 3MNVA 1DL7H 3HE7C 2HA1A 1FDLL 3DO7B 2IAND 1JPGB 3WXWH 2AJ3B 2NY6C 3D69B 2ZWLT 4JHBA 1R5WA 4X8XA 1UCTA 2R1XB 3QZWB 2I9TB 5DLMH 2D03H 4P2YA 1BOYA 5DGQA 4ZNCD 3WNOA 4RGNB 1D5XB 4WNQA 4G6JL 4FQCL 4UU9B 2P5WD 2UYLA 1EJOL 1RZ8B 1QR4A 3KYKL 3IDNA 4LVNB 3DI2B 3EJZC 1ES0B 1CTOA 3IKCB 3V2AR 3U0WH 3DV6A 3UBXI 4OCYL 4GOSA 4GW1A 5FGCB 1KJMA 2IADA 1VADB 4FQXD 2OL3H 4NNXA 4QRUA 3QYCA 3RVTD 1XR8A 3KLHC 5JIKA 4HLZG 2HMID 5L8KB 4R6UA 4RIRA 4E5XA 4XCFH 1MUJA 3LB6D 3LSOA 5J4MA 4KZDL 1NDMA 4Y5VB 3BEVB 4RFNB 1EHXA 4P5MB 3SPVA 1T6VN 3EYOB 4BJLA 3VI4E 4G6AC 1U8IA 2IBBA 2GHWB 1IAII 3X3FH 3I2CH 4S1RL 5INCB 5IF0B 2M2DA 4NP4L 4GKSA 1EHLH 3I6KB 3RBGA 5BJTA 1BZ7B 4NCC1 5FUCE 4G8EB 2XZAL 4P9HC 4JPWH 4XNUH 2R2EA 4Z7UF 3VXSD 3ME0A 4AM0A 4DGIL 4RRPA 1WAAA 4M43H 4X0KB 5I1JH 1BIIB 1HHJA 3F5WB 3UTTE 2V2TA 4JDTH 4LCYA 5F8QC 3LEVL 3LVEA 5GGUB 4R7NB 2JCCA 3GSUB 3C9NB 5EUOF 2XPGA 5EZOL 4RMTA 4CL7A 4BQCA 3UEZA 2P42B 5GGSB 1OTTD 3H7BB 3KDMB 3LKRB 1B0GA 1FO0L 4A6YA 4KROB 5J6HB 3UCRA 3F62A 4KRPC 4YXKL 4YBLB 2FSEA 5MEPB 5E8DL 1W72B 4HCRA 4KI5F 3BGFC 2YD8A 1T7VA 3EHBD 2ZPKH 1R0AL 1T83C 3DX8B 4ONFH 3GMPA 5I9QC 2APXA 3DX6B 2PW1B 3KS0J 5IFHL 3EYUH 4MA1B 3K1DA 3SBWC 1OB1B 4M6NH 5F1NA 2XNAA 4PGCA 4GRWF 1S9YA 1S9KC 1JWMB 3WFEH 4P2QA 5DK2A 5J12B 2FYYA 4WO4D 2XTJE 1AD0A 5ECJE 3U4EA 1ADQA 1JF1B 5GSRB 1HNGA 4AEHL 3ARVA 3ZTNL 2Y25A 4M7KL 3JTTB 1QG3A 3DJ9A 5E2UH 2R15A 4XCNA 1E4XH 1FNSH 4GAFB 3R4DA 2B1AL 5D7LB 5B39A 1WWWX 2FJHA 4G7YH 1PZ5B 4TNWF 2V2XA 1I1CA 2CIKA 3PQYA 5F97E 5DHVA 3T0DA 2VKWA 4YDLC 3ECBB 1ZT1A 1BQHB 2VLKD 1JGVL 3HAEB 3TA3A 1HIML 4N8CL 2CRYA 4MA8L 1BD2B 2ZCHH 5D1XD 4KC3B 1H3XA 3P30L 3AY4A 2PCPA 5F88A 1HWHB 2EYTB 1YEHL 4D0BA 1DQJB 4OT1L 2ATPB 4LCCB 4LNVA 5I71B 1ZHBB 1KLUB 2VXTH 4PBXA 3QDJD 2X4OA 3QIBD 4YHKH 2CLZA 2VKXA 5KAQF 3U4BL 1QSVA 1SYSB 4MJID 2R2HA 3H9SE 4PJ5A 4DN3H 1CIDA 1BVZA 4G80B 2WP3T 3JBG7 4JDVB 3RDTC 3MLUH 2BX5A 2YD5A 3LRGA 3VI3F 2WWKO 3BZEB 1NGZA 3NCJL 4KK8C 4FQ1L 4PPTA 3H0TB 3LV3A 4RQQB 3V6ZB 4L4VA 3EYFA 5FOJA 3SE3C 5GZOD 1CGXA 5HHQA 1UACH 5IB3A 3O3EB 5DEGB 3O8XA 4M48L 3OKKB 1FAIH 4CJ0A 4JM4H 5KSAA 3GK8L 4JFPA 5I16A 4V1DA 2UVEA 5JW4N 3PNWA 1CK0H 5J06A 2VDPL 1LO5A 3ESVF 1FLRH 4ZAKC 4G42B 5I66A 5HTSA 2NY7L 1HDMA 3FO0L 2H8PB 1IEBB 1FGVH 3TZVD 4OV5A 4UBDC 5ENWA 1QSFD 4PRAA 3GBNL 4PJ7F 5L2KD 5KVEH 3W9EB 4HWUA 2C3VB 4NO3B 1WCBA 5HHXH 3DPBA 1DZBA 5I74C 3QUXA 2OJZH 1I1AC 1HSAB 4L8DA 4ODWB 4U6XB 3TN0B 4H25A 1BWWA 5FDWB 4L5FL 2BNQB 1KIPA 2BFVL 4X80L 5JZ7D 4XZUA 1SYVB 3MXWL 3JWOL 4QXTA 4Q9CA 2B2XL 3P11L 1CL7I 2PR4L 1OAUL 4FG6D 1LHZA 2WINB 1BVKA 1MPAL 3T0VA 2Z8WC 5B3NA 3S4SB 2FL5B 1QLFB 1VPOL 1F00I 4X4MA 3BPLC 4WW2A 2PYFB 4PREB 3RA7L 5EOQL 5GHWL 4JKPL 1MH5B 3FHAA 1JPST 5C0AB 5DURB 1UVQA 1VFUA 2DDQH 5DEFA 4LSQL 1EIBA 1YMHA 1X5IA 2XY2A 3GSQB 1A6PA 2XWJA 4HDIB 5B4MC 2XKNB 3MJ7B 1AR2A 1KEGH 4TUJA 1C7SA 4U1SA 5E03A 2PF6A 2A73B 3O6FB 3PWVA 2DQIL 4EQ2A 3KPMB 3GMLA 1Z9SA 3WE6B 1T7WA 1RMFH 1FN4A 4OFKA 5B38A 3S35X 2AVGA 4DOHB 1NC2B 4KMTL 2VQUA 3IVKB 2HT2D 5L6YL 3GSNH 4OFYA 2HKHH 2I25N 4OIIH 5CJ8A 4EKXA 3AAZB 4JRXB 3FFCB 3FQNB 2GJ6A 3MZGB 1ZLWH 5JHLL 2FECL 2NX5D 2BVEA 2VXUL 4EN3D 1N59B 5ACZB 4OCRL 5FO9A 5HHPB 3PWPB 1HHGB 1HI6B 3ILPB 4K07A 4F7EA 1T22A 4GFTB 1T89A 1A4KB 3IETA 5IJVB 3OKLB 2NY2D 1CDUA 5BOPA 4KKLC 4MB4A 4MJ6A 2YN5A 5KS9A 5JW3L 4JJ5B 5IQ9A 2QSCH 1J1OH 4U1GC 4WIQA 2Y4SA 2YD3A 1NBYA 4D0CB 3MV9D 3UPAA 1RU9L 1A5FH 5CILH 4FZ8L 3T65A 5M7QA 1DVFD 4RRPG 4A2LA 3D39A 4NQDE 2A77H 4LU5H 3SKNB 2MHAA 1RZ7L 4PRHB 3RKDC 5HI3D 3QUYC 3G6AB 4I48A 2E8YA 1UCBL 4K2UL 5LCVL 2Y23A 3RBSA 2YUVA 4HJJL 4YXLL 1CE1H 4YHNB 3HUJF 3BKCH 2R4RL 3EOBB 4NSKB 3PF2A 4LPWA 4N8VG 4OKVB 1UXSB 4KJWC 4PJDA 5TE4L 4B41A 5DD6A 1IC4H 1OARH 4M00A 5DJZA 2R1WA 4KVNL 5JIHA 3MV7A 3G5VA 5IMKB 1WFOA 4NQED 5D1QC 5C70A 1VFOA 5IT2L 4APQB 3MRIA 3UYRH 4S10A 3TWCH 4PRPE 5E2JA 5IEKB 3B5HA 3DX7A 6CGTA 5E7FA 1JWUB 1GOGA 4WI8A 5EBGA 3RHWK 4QOKB 1MCFA 3AMKA 2EIZB 4PJGF 3WFCL 5IVXF 3DSFL 4D2NA 5CUSH 4OZGE 1OF2B 2LAAA 3FCTB 5IR1B 5E8NA 4ZOAA 1S9XB 4LPTA 3LKQA 4NWUL 2VLRE 5D1ZB 4YFLI 2R1YA 3QI9B 4N0FB 1FFRA 2Y06H 3FO9B 4RFEB 2V7NB 4N90D 5DHYB 2WIMA 4JRYA 5DGRA 1S5HB 2VZTA 4KXZH 4HULB 4GXVL 4OLUL 2MOVA 3DV4A 1G84A 2OP4L 2UWEB 5F96H 1AXTL 3MRHB 1X7QA 2E27L 2YPLA 3RWGB 4LBEA 4HKZA 3T77A 4J3UA 3TPKA 1R3KB 1TNNA 1BBDL 4WFHE 1IAIL 3UC0H 5IB2B 3NPSB 2PO6C 4Q7DA 5EZJA 1J0KA 1T2JA 3WJJC 1NL0H 4NO0D 5ALBH 4XMPL 1F3JB 1T4KB 5BQ7A 5C6PB 1DUZB 1A9BB 2KBGA 4WEMB 1ACZA 1A9EA 2ITDB 3VFOA 5IWLA 5B8CC 4NRYA 3BVNA 2R69H 3OF6A 5HHMD 1DBKH 3O4LE 4BFGA 3ARFC 5IFAH 3L5IA 4RDQF 1KBGL 4XAKE 1DCLA 3C5JB 4GS7C 3P4MB 4J3SA 1BLNB 3V0WH 3OXRB 1RIUL 3BFOA 3MYJA 4JO3H 1FAKT 1U93A 3MJ9A 1D5IL 2W9DH 4LF3A 5GIRA 4LHUA 4M5YL 1RQ5A 3QDMA 1EUUA 3QIWA 3O3DA 4ZTPH 5EULV 3F7YA 2ZSWA 5IG7B 5DMYA 1TTGA 5C08E 1IGFH 5SWQA 3BPOB 1BJMA 5DR5H 1A7RL 4KDTC 3FFDA 1OAYL 2Z4QB 2ARJA 5DMGD 4WUUA 1M7IB 2G5BB 1J86A 1IGTB 4RWYH 4FQJL 1RI8A 1LE9B 1UJ3C 1C08A 3B9KD 4P23A 3KGRA 3PIQA 1LEKB 4OM1H 4XNYL 4ZXBD 2XWTB 2NY0C 2WK2A 4H8WH 1DLHB 5LJYH 3PP3H 2B4CH 5EWIH 2O5XH 1T80A 3B2UC 1X5KA 3VA2C 3H9YA 3BQUA 3FOLB 3O2DL 2JIXD 2X4QB 4LCWE 4XMKL 4GUPB 2X41A 3CFDB 4PGBB 5H35B 4ZYKA 3UMTA 3MGOA 5IESL 3SKMB 3NCYP 3ROOA 3V6FA 2Z0BA 4YDKH 3Q5YA 5EBMA 4F2MB 3MRLA 2MQCA 4QHUA 3I84A 2ZCLH 3FB6A 4MD5B 1O5DT 3BP7B 5FA4B 5I0DA 4JM2D 5CP3A 2BSSB 1CGSH 3LN5A 4PP2B 2CKBH 4IS6B 3KR3L 2BVYA 4E9LA 5IQ7H 5CEYB 2W0PA 4X99B 2RBLA 1FGNL 1CE6A 3D0VB 1PSKL 1RVFH 1WTGT 1Y6NR 3NZ8B 1ERNA 3KLAA 2F5BH 4I3RL 1YEKL 3M45A 2C1OB 3TO2B 2KL6A 4HQQH 4Z7VB 1PGRB 3NZHL 3SE4A 4OD2B 1JHKH 2R4SL 1YYLH 4M1GH 1KIUA 3FRUB 4MNQA 4KAQL 2ZCKL 2HFEA 1I9IL 1RSFA 3M1BB 5FHBL 4ODSH 1T5XA 2YKLL 5I1GL 4CMMA 1U8PB 4U7MA 1NMAL 3P4OA 5CD3B 1KC5L 5D93B 2FX7H 1BX2B 5E2TL 3MOAL 5B38G 3OAZK 3S36X 2IPKB 5CCKH 1JZ4A 3SGJC 5FYJD 4XB8A 3HPLB 3MUY1 3SDDC 1K6QL 2VIRB 3VXUB 3QJHA 3C60D 2EH8L 1FLTX 2YPVL 5FM5O 4CVWA 1AKJA 5SV4A 2EYRB 3LCYA 1IQDB 5LQBH 4XP1L 4P2RB 4WI4A 1V3KA 2EZ0D 1E6JL 2D7TL 5ADOH 3RVXC 3JXAA 3MO1B 3VXMD 1G0DA 1ZA6A 2L7JA 4U1MB 4YDVA 2LU7A 3IB4A 3SDAC 4G8GD 3H7LA 4HWBA 2XICA 3QRGL 4ZDHA 3ULVD 4XNXH 1AGCA 4GMTL 1YJDL 4XCEB 3CVIH 5E9DD 1HILB 3QXDA 3TP4A 3QO1B 1ZMYA 3IJHA 4RA3A 3UJJL 5EO0B 4KHTH 1BP3B 1NLBH 4Z7UE 3LKNB 3W39B 4K23L 1I3GH 1DBMH 4OZHE 4OLXL 5K9OB 2RAMA 4ZD3H 4MAUH 1GPOH 3GMOB 4XP4L 1AIFA 1L7IH 4OBSA 3DXAB 1I1FB 5EUOE 4CDGC 4DTGL 3WD5L 3JWDC 5HPMA 5ISZD 4TQEH 4XGZB 4ZS6D 3MNVB 3MLXL 1SM3L 5CWSB 4GQ9L 2A2QT 3V4UL 5EU4B 5CZVL 1FL6A 2DJUA 2ZJSL 3IJSB 1U2HA 1WICA 32C2A 4NNPL 3ZL4L 1R5WB 3NCFB 1BQSA 2CLRA 5E4EC 2MPAH 1QQDB 2NNAB 1PKQA 3C2SA 4E0RA 4P4KD 4ODVL 3KPLB 1PFCA 1KEML 1NEUA 4PJAF 1JHTA 1MREH 4EVNB 4DVRH 1IM9B 1A14H 2UYLB 5LBSH 2MCPH 4GRWE 3DV6B 1ZT7A 4GW1B 2IADB 1XZ0A 4QRUB 2ICES 3KAAA 1CXFA 1QPXA 2X4UA 3BIKA 4YX2H 2IFFL 1T03H 4MD4A 4LLVA 1MUJB 1N2RB 3IGAB 1P4BH 5D2LA 1U3HC 3LSOB 2X4TB 4NZRH 2VH5L 4PJ9A 1BOGA 3VRJA 2X4NA 1U8IB 5IGXL 1QVOA 4J6RL 2A9NH 2G5RA 4F58L 1HINH 1S7RB 3MCLH 1DQDL 2GAZA 4YEFA 3K1KC 1U95B 5BJTB 3KS0H 4YAQB 1Z0NA 1DDHA 5EH1A 5IMLA 4M7LL 1VFAA 1NGXA 5C0RH 3L5HA 5IMMA 2BNRD 4FFWC 4EDXA 5FKPB 3W0WE 5GRVL 4X6EB 2MQ0A 3LHPH 1MSPA 4O9HH 1E27B 1HHJB 3N1FC 4JFOA 2V2TB 1DJSA 1H0DB 2NCMA 4FQLH 4PGJA 5TQ2H 3SKOA 4N1CA 3QWRD 1IKNC 5SX4H 4BSVA 2XPGB 2R2CA 1MRDH 3QG6A 4KUZH 2WBJA 1DLFH 2IAMC 3HC0B 3U7AA 1KXVC 1F8TL 1S3KH 4K9EL 4XPAL 4UV7L 1KJ2B 4WCYL 4UMGA 3RFZC 4N8VB 2NXZC 1G6RL 4A6YB 1MIEH 4LGRB 1FORH 2XY1A 3PL6C 1NCCH 4WWKA 4XWGH 1SMAA 2ADGA 3VI3E 4Z8FL 2FSEB 2AK4B 1OM3L 2Y07L 3AMLA 1LK3H 1RZGB 5BVPL 3KLSA 3F7RA 1FDLH 3VXRB 3JVGC 3GMPB 4CW1B 5FECA 3WDHA 1ORSA 3HR6A 3C5SB 3QP3A 2HT3C 3RX5A 1CFQA 3AREA 5F1NB 1RJLA 1J8KA 1BQUA 4PGCB 1S9YB 5CJ5A 3KWWA 4UZGA 4JKKA 4GSDL 3WHE0 4S2SA 2XV6B 5DK2B 4OZ4B 2FYYB 2R0LL 3TV3L 1AD0B 2YEZB 3D48R 3OR7A 4FQCH 2PNDA 1EJOH 2EDEA 3KYKH 3RL2A 1T21A