3BQUB

Crystal structure of the 2f5 fab'-3h6 fab complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
231
structure length
214
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIVNAMDVWGQGITVTISSTSTKGPSVFPLAPAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLTCNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 2F5 Fab' light chain
publication title Crystal structure of the complex between the F(ab)' fragment of the cross-neutralizing anti-HIV-1 antibody 2F5 and the F(ab) fragment of its anti-idiotypic antibody 3H6.
pubmed doi rcsb
total genus 36
structure length 214
sequence length 231
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquB01
1W0WA 1R3JA 2K7PA 4HKJA 4ELKB 2ID5A 3QEQE 4OUUB 5I75B 3DVFA 3BP6B 1A3QA 2PTUA 5JORB 5MENA 1YYLH 4GW1A 3KLDA 5EC1B 1DBBH 3OR6A 2PYEE 3SEPA 5EORH 1QKZH 3LKPB 5H8DA 4KK9D 2XA8L 3ARBD 2DWDA 5ADOL 1KJ2L 2F19L 2UV3A 4RZCA 3N85H 3LY6A 2ESVD 3UTQA 4U1GC 1MY7A 5L2KB 3GSNB 3SE8L 4ODWB 4QT5B 4X4ZA 1A7NL 4WO4D 2JJWA 1RQ5A 2Y36H 3NN8B 4LAQH 1IGIH 3LKOB 3C60C 4MS8C 3FO1B 4GXVH 4HWZA 4GRMA 1FYTD 2F9BT 2GITA 2DQJH 1AGBB 1F6AB 4PJGB 2YOCA 4PJCF 1HK6A 4WEUD 1OP9A 3STBA 3VFPB 1MLBA 3ULVH 2IBZY 1XGRB 4HCRL 3ZDZE 4G42B 5D2NE 3VI3E 4JM4H 1P1ZA 1XMWA 3MQIA 2OQJA 5KOMC 3OHXB 1MREL 1WWCA 1NCBL 1YEEL 1CDYA 2XWJB 5DHYA 2P8MB 1A6PA 3NFPB 2EXYD 2YK1L 4P5TC 4XNZC 3LV3B 4YBQC 1EXUB 5KANI 5T1MB 3P4NA 5F7DA 5C6PB 4ZXBA 1OGTA 5SX5H 5D7SL 3DMMA 3FQXA 1OP5K 4YHKH 3DUHA 1RHHA 2X9YA 5M94B 1NCNA 1G6VK 4FQLH 1XGPB 4KQ4H 4NCC2 1K8DA 4A6YA 4P2OB 4PRBB 1VCAA 1QFPA 3GDBA 3WFBH 4J23A 4DN4L 3RZCC 1FRGH 4U6VL 1MRDL 5IJVA 3WIFB 1VADA 2IFFL 3CDGB 3G6AA 2VWEE 4WUUE 2CUIA 4HIJA 3HCVB 4ODSL 2C4FT 4KY1L 1OSZB 4JFDA 1N26A 4PJ8A 1G7MA 3ECBB 2BOCB 1QNZL 3KLAB 4HIHA 1IBGL 3FQRA 1MJUL 2GJ6E 3DXAA 5DDHB 5HDOA 3SDDB 5AUMB 3ZTJG 5CCKL 1QHPA 1RUQL 4NCDA 4W81A 1VKXA 5I8OH 4XGZB 4G8IB 3O3BB 4G7VL 5C0GA 2F53D 2NXZB 4M5YL 3WNOA 2F54E 4OT1H 4L4VA 3SOBL 3BZDA 2H6PB 4WNQB 4NC2B 1GCFA 3A6CH 5J1SC 4KTDL 1G7HB 5FOBB 1VFAB 3CX2A 5E2TL 1CLOH 3V4PH 2JJTA 2HT4D 5JPNB 2RB8A 3PQYA 4W4NA 1SYSA 3IDMA 4ZD3H 4XVUD 5EBMA 3ZTNL 1S9XA 5JOFB 1XIWD 1YEHH 3HI5L 3RWFA 2MPAH 5A43C 3QNYA 4E41A 1FIGL 3BWUC 5D1XA 4HS3B 3ARBB 1NFDB 2H41A 3PWJB 4NRZB 2IQAB 4KKBD 4PR5B 5FUOH 1QSZA 4G9DB 3CFDB 4I77L 4JANB 4XAKD 1KEGL 1K2DA 1I8IB 1BM3L 1P9MC 2A74A 2AGJL 3MV01 4LVHB 2X5PA 5DRWA 4R2GD 1ZLWK 4JGUA 2WQRA 2WINA 3GB7A 3CUPB 1FYTB 2Y5TA 5E5UB 1CD1A 2J8UA 2OL3H 3QQ4A 3L3JA 5IB5B 3HE6A 2NY4B 4M6OH 3L6FA 4KV5F 3ZT7A 3WN5C 1UKQA 3V6OE 3DX6B 3UJTL 4PJIE 2I24N 2OJEA 2DMKA 3C6LD 3ZKXC 5EU3B 5DD3H 1MCCA 3BD5A 4QNPF 3WHE1 5I1EL 3HAEG 3HNSH 1G9ML 4PREB 5ACLA 5CD3B 1A2YA 1JJUA 4GMTH 4XC3H 1ZEAH 4MA1C 1Q0XL 5DURD 4CW1A 3L7EA 5AZ2L 3RVWD 3RL2B 4OSUL 4HWEH 3M8OH 4XMPL 1CT8B 1K4CA 4CKVX 4RIRA 4CN6A 3BKYH 3UO1L 3INUH 2DKUA 4PJGE 4UOW1 2BVTA 1ZHKB 3MRMA 3G6JE 1LK3H 2EIZB 4I0CC 4O58L 2D31B 5D8JL 1JCKA 2HH0L 2MKWA 4IRJB 1RJZB 1HXMA 1QBAA 1KF9B 4DGIL 3EYVB 9CGTA 1CXFA 3C5JB 5D1ZA 2ITCA 4PJHB 4Y16A 4OLYL 4RAHA 4L8SC 5T1KA 3C9NA 4QCIB 3GJEA 3VGDA 2CLZB 3O0RL 2E9IA 3V95A 4D9LH 4NUGH 1OARL 1U0QA 1KTDB 2A6KA 2YRLA 4X7TA 4HJJL 3SBWC 4UB0H 3MXWL 4KDTC 4KMLB 2BXYA 2HTLC 4P2RE 1MWAL 2F53B 1VACB 2VDKL 2B0SL 4K7PY 3KAAA 5ABDE 1NEZA 1S7WA 1I1AB 5HYEA 1N8ZB 1RJLB 5FO8B 4JM2D 2HVJA 4JFHD 1U6AH 4HXAH 4S1QH 2R1YA 1CL7L 3U9UA 2QADB 3O8XB 1NAML 2LTQB 4IRSC 5KSUB 1CK0H 3G6DL 5HGAB 5MEND 1PQZB 3Q3GB 2BSTA 3RVXC 4HLZH 4PRAA 1ZWIB 1T21A 2XQYK 4PYHA 5MP6H 3AAZA 5D7JC 5IB1B 2AQ1A 1S7UB 1UCTA 1YJDH 1JGLL 3LRGA 1LO5A 1M6OB 3BAEL 1I8MA 5C0CE 4PLKC 4OGXH 4IDJL 5HI4C 5ICXA 3VW3H 1DFBH 3OAYH 2V17L 1M71B 3V8CA 3VXMA 2XICA 1NEZG 2VLKA 1JBJA 4UBDD 5CGTA 4OGYH 4HT1L 5BRZA 3SDAD 4HKXA 2XWBA 2FB4L 4HJ0C 4H0GA 4Q6IB 4FABL 3RIFF 5C0EB 4OCYH 3ZSTA 3JBG7 4LRIC 5EIIA 3V5DA 5F3BB 5EU7E 3CVHA 5C86A 5I30H 5CMAB 1AGDB 1JHTA 1GZPB 4WI3A 3WNMA 4FMKA 5D5MB 1J1XH 1MF2L 4ZG1A 1U95B 5CEZE 3VXUE 5FB8B 3LSOB 2OTPA 2JB6B 5AYUH 1NBZB 1QTYT 1P7QD 3ILQD 3N1PC 1NFDE 3TYFA 4LCYB 1ACYH 1SEBA 2F58H 1JF6A 5JW4R 3MRBB 1NC2A 3TYGL 5KZCD 2DQUH 4QXUH 3OXRA 5DURB 4FTVE 3DMMD 4MB5A 4NO5A 4OIAA 3QB7C 4X6FB 2V5SA 4ZSOB 5FGBC 3TZVC 2HWZH 5EZJA 3C87A 3MNWA 1HINL 5CFHA 1UZ8A 5F7NC 3QUMB 4UINH 4QRPE 2ITDB 4IM8A 1FH5L 5L0QC 4NCC1 5IW6B 1EZVY 3KPQB 4EXKA 3IFLH 3A67L 4NZTH 4F3FB 2DKMA 4PJ8D 1ES0B 1REIA 2WK2A 4DWHA 5F6IC 2ARJA 4L9LB 1S3KL 4QHKJ 3EOYG 1FFOB 5F9AC 4NRYA 4U1KB 4X5XB 3M1BA 3QDJD 5IOPA 1I85A 4X7CC 4YO0B 5C0DB 2VL5A 1G0DA 1K8IB 2E7CA 2EZ0D 2Q6WB 2VLJA 4HFWB 4L4VD 4Y4FA 5IUSA 4HUKB 4NWUL 1DANT 4R4NC 4ODVH 1CFBA 3MLZL 4NZUL 1N2RA 1A22B 2GTWB 5CJXC 5DC4B 3NGBC 1KLUB 2ZUVA 4JO1L 1FGNL 1S7SA 1KB9J 2L4OA 5C0IB 2X4QB 4JM2B 2DLIA 4JPIA 4PJHF 1M7XA 1N4XL 5KVEH 4Z7NF 1W0WB 1R3JB 4HKJB 3SHSA 1WICA 3MJ8A 4TPRH 4E41D 1QO3A 4XPFH 1RZJH 4GW1B 3UMTA 3OR6B 5D1XD 4X8JA 3WFCH 2XQYG 2BVOA 4JAMA 5F72S 3J8F7 3FMGH 4YDKL 5LVEA 1J88A 3H9YA 4GKOA 2DWDB 1XF3A 1DQMH 4UAOB 5D7LE 5ILTL 4L3AA 4BH7A 5CIPH 4M8QA 3QCVH 1EHNA 2GT9B 1I1CA 1JF1A 2GUOB 4PS4L 3HZVA 3QUXC 3QO0A 5LQBL 2IANA 4HWZB 4I2XA 1BFVH 4FQCH 2GITB 4YEFA 1TETL 1E4XH 4BSJA 3HE6D 1NBVL 4CMMA 3QCUL 4NO0B 4CVXA 5I74B 5EBGA 3LEXA 3EYOA 4FQJL 1RJYA 4QHNA 1IL1A 5DRNA 2AKRA 5DO2D 4KZDL 1P1ZB 3G5ZA 5FKPB 3BESR 3PWPE 1QSEB 1JRHL 2OQJB 4GG8B 5HHMD 2BVYA 1N6QL 1DZBA 1T1ZA 5DRXA 4P49A 3OGOE 5DWUL 2Y06H 4UT9L 4JPKL 1CXIA 1HZHH 1BQHG 4U6HA 4YE4L 4AMKH 1MHPL 1NCDL 5KZCB 3DVNA 4IOFD 2ZUYA 3P4NB 5BVPH 3VMNA 1HQ4B 5F7DB 4EI6B 4JKPH 3HPLA 4ZXBB 3SDXF 1JTPA 1G9NL 1X6LA 3DMMB 3FQXB 5GRVK 3X3FH 1UKTA 1JGVL 5CUSL 5ESVA 1RHHB 4ZPVB 5A3IC 2W9DL 2NY6D 5T3ZL 5D5MF 4A6YB 1K8DB 4WFFD 2HT3D 4ZFGL 3UC0H 3W2DL 1JFQH 3BKJL 5DUML 5IJVB 3AREC 4ISVA 3BXNA 1IAIM 1VADB 2AABL 3V5HA 3BDXA 3G6AB 5D1ZD 4Y16D 3MV8E 5T1KD 4HIJB 5J89A 5CKGA 1OSPH 4JFDB 4TSCL 1WUNT 3Q1SH 1KGCD 1MCWW 1F3RB 1QYGH 4HIHB 2AJSL 3FQRB 1IAOA 1RIVL 1X5LA 4RQQA 4ZSOE 3DXAB 4EI5A 3REWA 3UCRA 5J13B 2EH8H 3UBXG 1VKXB 2WP3T 1B0RA 1OF2A 1FZKA 1HSBB 1NBYA 4L4VB 4AJ0A 5EOCL 4J7RA 2IADB 3WE6A 4KTYA 5F1NA 5GIRA 1MRFH 1KIQA 3BO8A 4XPGH 2ZG1A 3HRZA 1QR1A 1C5BL 1VGEH 5IGXH 3JTTA 4NBZB 4FXGA 3PQYB 3VH8B 3H3PL 2Q20A 5D6CA 1R3KA 1SYSB 3P9WB 3O3EA 3DO7A 5EBMB 1S9XB 3RWFB 2AXFA 5JUEL 4N5ED 5I76B 2AP2A 2JIXA 1ZGLM 4BELD 3OKOA 4FFYL 2GAZA 5DK3A 2KPNA 3VXMD 2VLKD 3VWKA 4P2QA 5BRZD 5H94A 2BRRH 3JXAA 3KYNB 4K9EH 3RVVD 5B38G 4HF5L 1HDMA 5EOQL 2A74B 3LN9A 1AXTH 2UVFA 4JM2F 1U9KA 4UNVA 3ALPA 5DRWB 4YHPA 5MI0B 1VFUA 3T8XA 4RMRA 4RX4A 3B9KC 5DK2A 2WINB 3FN3A 3GB7B 2Y5TB 4WU7A 1CD1B 2J8UB 5DJCA 2QQKH 3QQ4B 3L3JB 2Z8RA 3HE6B 3HFMH 4KXZH 4KROC 2HT2D 3GJFB 4QRSB 2RFXA 1JUFA 5TF1H 1CVSC 2R1WA 2NY2C 1YECL 3WUZA 4XVTH 1NCUA 4XP1L 3MBEC 3SDYH 2GK2A 1P84K 2RJMA 4OLZH 3V4UL 1JHKH 4R7NA 1NC2D 5HHMB 4WVRA 4M6ML 1MCPH 1HH9A 1A2YB 4K8RH 3S3PA 2EKJA 2R56H 2LU7A 1PDKA 5CD5D 5IT2L 3C08L 1K3ZA 1X44A 3L7EB 4BFGA 1CVRA 4H1LA 4PRDA 3MR9A 32C2B 1K4CB 1IGMH 1DQLL 4RIRB 4I9WE 3LS4L 2X4RA 5CEZH 4NC1C 4R90L 1OOAA 3MRMB 2NY6B 1IEBA 4BQ8A 3NBNA 2FD6L 2ICCA 4HWUA 2VDPH 3BRGC 3SDCC 4ZOBA 2DAVA 1W0VA 1QSEE 3EYSH 2BSSB 3ARDA 4HH9A 2JCCA 3VRLF 3AS3A 1TLKA 5D1ZB 4IDLA 2ITCB 2WWKT 4Y16B 2Y6SD 4PRPA 4F2MA 3GJEB 1ZGLP 3UYRH 2VZUA 1MFEL 3AY4A 1C7TA 4H1LG 3LOWA 1KTKE 2MMXA 3THMH 3MLUH 2NNAA 1DDHA 1TMCB 1QLFB 3K4DA 2XIDA 2CRIA 3E6HB 1NUGA 1RD6A 2E8YA 4X7TB 5J11C 2VLJD 5F9OL 1FO0H 1VEMA 2I9TA 1K4DA 5C0FA 4ZUTA 5ENWA 4LPTA 4X6CA 3T2QA 5KSAC 5K59E 3ESUF 3BDYL 3DBXA 3U46A 2HVJB 3MODL 2R1YB 3U9UB 3D18A 3P30L 5ACMA 2J3SA 4JFDE 2I5YL 3NA4A 3BVNA 4Z7QE 4GMSL 1LO4L 2BSRA 2DI7A 1QFUH 1AE6H 2XI9A 1HEZA 3RWEA 2AERT 1JL8A 1T21B 2XY1A 5I1LA 5FUZL 4YQXL 1FNLA 3AAZB 3KJ6H 4QEGA 4PGCA 5K9QI 4L3CA 3DXAE 3QFJE 5DHVH 3EYUH 4X8XA 1LE9A 1I8MB 5I18H 5ICXB 4DK6A 5EUOB 3L3GA 3LN4A 1X5KA 1XGQB 3VXMB 5CZVH 3OKKA 2BSED 4O51A 4YFEA 5BRZB 3MRQA 1D5IH 4NBXB 2XWBB 2IAND 2XN9B 1U36A 4FFZL 1CQKA 1CGSL 4NO2A 3PQYE 5EULV 3B2VL 1QLEL 2BY1A 5EIIB 3V5DB 3CVIH 3CVHB 3L5XH 3ZKSD 1MLCA 1M7IA 1WFOA 3N50A 4MMZC 1QBMH 3PP3H 1EO7A 1F4AA 3P2TA 2R1XA 3T3PE 4LSRH 2CXKA 3TYFB 3ARFA 1MRCH 3VFSA 1SEBB 3H9HA 2ZCKH 4R0LC 2ICES 1EX0A 1Q9LA 4LU5H 3T1WA 2AJUH 3OXRB 5KN5A 2QSVA 4TYUA 1YQVL 2BHYA 4DTGH 3JV6A 4LHJB 3KYKH 3O3DA 4NO5B 5CP3H 4E0RA 3HC0A 3SCMA 2C1PA 1NL0H 5IHZA 4TRPH 2XZQH 4OM1L 5EZJB 2J8UF 3DLQR 3JV4A 4DZ8A 1EEUA 3WFEL 4GKSB 3S37L 5ISZA 2J88H 3SGKA 4HEPG 4O2EA 4M1CC 3U36A 5JW5A 4KTEL 1DN2A 3RQ3A 2C4XA 4N68A 5E95B 2DBLL 3LQAC 4J3UA 1HWHB 5C07E 1RUPH 1OAXH 4QGTA 4LL9A 1BJ8A 3Q48A 4ZTOH 2HKHH 2DKSA 1JYNA 1IILE 1ITCA 3CC5A 2E6QA 5BOZG 4NRYB 3M1BB 4EI5D 3GI9L 1URLA 2B5IC 3UTSE 5I71B 1IE5A 4Y4FB 3MRHA 5D7KD 3ZSSA 3MJ9L 3JSSA 1N2RB 5HVWA 2VOTA 1OAQH 1RV6X 1MHCA 2V9QA 4BFBD 4I3SH 3NCFB 4HWNA 3V7MA 2G5BA 2PTVA 2B2XH 1DBBL 4JPIB 1NC4A 2V9RA 4ELMA 4PJ7A 4OFIA 2FIKA 5EORL 4LDEB 4ZNEE 1ZVHA 3N85L 3MJ8B 2LVCA 2XQBH 1P4LA 4Z7WA 1QO3B 5GJTL 3HRPA 1JPST 2JIXD 4X8JB 1CGXA 3WS3B 2BVOB 1CDIA 5DS8B 2F74B 3CSGA 2Y36L 3BDBA 4K3JH 4LAQL 1XF3B 1FZOA 3VWKD 4P2QD 3NIFE 4BH7B 2WMPA 3RA7H 1PJ9A 3TT1L 4J6RL 1CFTA 1JF1B 2DQJL 2F5AH 2FRGP 4PJ9C 3QO0B 2GKIA 5C3TA 4RX4D 1KCRH 2IANB 4PRHA 4Q9RL 2GCYA 1OY3B 4I2XB 3WMSA 1WBXA 4MX7A 1TPXB 1H8NA 3TLRA 4GG6A 4CMMB 4CVXB 1BFOA 3ILPA 1W72L 3EYOB 2XY2A 4HV8A 4KK6D 4QHNB 3ZE0F 5I1IH 2CKBL 3AUVA 3KHOA 4NHUA 5AWNH 4ZS7H 3G5ZB 5EUOE 3RWDA 2UWEA 3DPBA 4XT1C 4X4YB 5DRXB 4YHKL 3WDHA 2VKWA 2NW2A 3LQAL 4U6HB 4FQLL 3DVNB 2XN9E 3MOAL 4V2BA 5FA3A 4FG6D 5GS1C 3WFHA 3WFBL 1NGZA 4U2ZA 5ESVB 4N8VG 4DUXA 5IP4A 4WEBL 2HRPH 3BGFB 3QIWC 4JVPA 5ANMA 2MKLC 4I48A 4M3JA 3FTGA 5DTFA 1BZ9A 3R8BB 4X0KA 1S7RA 3BXNB 4LCCC 4KHTH 3V5HB 1V3KA 5FAAA 4JFEE 5MHSE 4PRPD 2NY1B 4X6DA 4O00A 3QXUA 2AXJA 2WLZA 2YMXH 3EOAB 4GW5A 1FFRA 4RMSA 5I8OL 2V9TA 1K6QH 4OT1L 1IAOB 5C2BL 5D2LA 4RQQB 4K55A 3S5LA 1FNHA 3PL6C 2P5WA 3REWB 1A64A 4EI5B 3RI5K 5EO9A 1O0VA 4KKCD 1B0RB 1F8TH 2GY7B 1OF2B 2WWMD 2YZ1A 1NGQL 1FZKB 1CLOL 3V4PL 1NBYB 3EFDL 2YRPA 1NAKL 3SKMA 1ZVSA 2DLTA 3NH7H 3DGGA 2VE6A 3WE6B 1MCDA 3V4VH 2CPCA 3Q0HA 1KIQB 3BO8B 3HRZB 1QR1B 1YEHL 1XGYL 1FP5A 3JTTB 4I0PA 1WGOA 1N59A 4FXGB 1QOKA 4M02A 5D6CB 3D85A 1R3KB 3ARZA 3O3EB 1KLGA 5DQJA 3WNKA 1IJ9A 5BV7B 3REVA 3QXWA 2EDHA 2AXFB 3LN5A 2VDOL 3S5LG 4G3YL 2JIXB 3U7WH 3BGMA 5CSBA 3OKOB 2GAZB 3HI1A 3T0EC 2VERN 5ID1A 1C08A 1ADQH 4RCAA 3VXRA 1OTTC 5H94B 25C8L 4LIQL 3P4MA 4WTZA 1HDMB 1P4BH 2OL3L 2R2EB 4M6OL 1BQLH 2VZ1A 4HS8H 3QIUB 4HPYH 4YHPB 5T5NF 4JO2H 3T8XB 4ZUSB 3VGHA 5DK2B 3T0WA 3O6KL 4WU7B 5DD3L 3IDYC 1KJ2A 2NZIA 2B4CH 1H8OA 2FX7H 4J8RA 3NCBB 3JTSA 1JUFB 3KR3H 3AVEA 1C7SA 4YBLB 3VWJC 4IEFB 1ZXQA 4XC3L 2R1WB 4HWBL 3ARFD 5FYJD 3ZE1F 4JPVH 2QL1A 3M8OL 4R7NB 3RTQC 4QTHA 3T3ME 1EHLH 1HH9B 2ERJC 4WI6A 3BKYL 4D0DA 3V7AG 4WTZG 3FQWA 1YEKH 4P5MA 4U1SA 4XP6H 3EO0B 1FNGA 3TEUA 4PRDB 3CSYA 3MR9B 4D0BA 3OQ3B 5B4MD 2R69H 3MA9H 1R0AH 2Q87A 3QIBA 2QBWA 3NZ8B 1J10A 5MEOA 5F9WC 1YNTA 5CZXD 4BK4A 3RWJA 5ISZD 1IEBB 1IGFH 4WFGE 1WK0A 4RFNC 5IHBA 1U2CA 1W8NA 1AIFA 1WIPA 5FYJU 3FT4A 3V6FA 1T1YA 1XR9A 5T3XD 5GSVA 3ULUD 3NFNA 1Y6KR 1W0VB 4D9LL 3ME0A 3ARDB 4HH9B 2JCCB 5C0RH 1ZA3A 3GI8H 3SGDI 4PRPB 3PWUA 3TFKC 3D69B 2NNAB 3RP1A 1AR1D 4Y89A 5BCAA 4APQC 4MJ4A 3QHFH 1MCIA 4WWID 3SY0A 3WCYA 1XF5A 3T0XA 1Z6JT 2X40A 4DVBA 2I9TB 2ATKA 2HLFD 5IBTL 3NACL 1A14H 5C0FB 1KCUH 1MJJA 3RWCA 2CK2A 5ENWB 4X6CB 2GFBA 4LLDA 4RWYL 3BIBX 1SY6H 4LLWA 4YHYC 2J8OA 3DBXB 3IGAA 1NC4D 1YZZA 1E27A 3DI3B 5BO1L 5MP6L 4M9PA 2EYTA 4YXLH 4OZIF 3AB0C 1FYHB 1KLFA 4Y5VB 1HH6A 3BVNB 1QFOA 3JWOH 1HEZB 3QPQD 3RWEB 2FJHA 1DFBL 3KPOA 2ZJSL 5I1LB 3S88H 1X5ZA 4PGCB 4L3CB 5JDJA 1EEQA 5BS0E 4FQ2H 5E08H 4IOIA 3C09C 3FB7B 3OKDA 2VXVL 1U3JA 3L3GB 2ZCLH 4C57C 3QH3A 4P46D 4QXGL 5D6DA 2ZUWA 2AJZA 2ICWB 4CJ0A 4N0UA 1JHLL 4N1CA 3MRQB 4N8CL 4PRHD 3IDIA 1KCSH 1IGYA 4NO2B 1MCEA 1MNUH 2J12B 1U8IA 2M26A 1MLCB 2BK8A 1ACYL 2F58L 4RGND 1M7IB 4PD4J 3OMZA 3TBYA 1NGXA 2HJKA 3W9DA 2C1OA 3TV3L 4OZFH 2R1XB 2DQUL 5FDWA 4Y5YA 4NPYA 3GSXA 3ARFB 3VFSB 3GMPB 4FQQA 3VD4A 4ACPA 4OKDA 2ARJQ 1NLDH 1T7WA 3ZKNC 1T83A 2Y9RT 4XHJC 5GS3A 1FE8H 3HR5B 3EGSA 3RWGA 5KN5B 5SWSB 4PBVC 4Y2OA 1QP1A 3O3DB 1JTOA 5ELIA 5I9QC 4E0RB 3HC0B 3SCMB 2ZOKB 2FEEI 1JPSL 5CINL 2I60H 4LLMA 5HVHB 2APTA 4I18C 5ISZB 3IFLL 1F97A 1RZKC 1UJ3A 4O2EB 3HTLX 4Y2DA 5I75C 5JW5B 5KOVC 1FNEA 4GFTB 3BN9D 4NN6B 3GBNL 4NSKA 1WIUA 2YZ8A 3BQUC 3F5WA 5ICZA 4YZFE 1XZ0B 4M61B 5FM8A 3CFIC 4WV1C 2Y07H 5IG7B 2Z31D 3CC5B 3UEZA 4JPWH 4ODVL 1KJMA 1D6EA 1WAAA 2DL2A 2P5WD 1KFAL 4HDIA 3SJVA 4FA8A 1UB6B 1TZHA 3MRHB 3K46A 4JJ5A 1SM3H 3GGWA 1RUMH 1N3NA 5KVEL 1HHIA 1MHCB 3MCLH 3CXDL 1BD2E 4I0PD 2G5BB 2JCCE 4XPFL 2AJVL 4X7DC 1NC4B 4ELMB 1NH6A 1DSFH 3WFDH 1X4ZA 5EC2B 4YHZL 2FIKB 3O2DH 5C0ND 1UWGH 1KC5H 2HRLA 5GRXG 1WT5A 3UXFA 1DQML 5HHXH 1RAMA 2NY5C 2DRUA 5FHBH 1OPGH 1P4LB 2UYLA 4Z7WB 3UBXI 3QCVL 5TJWK 4BUGA 1QVOA 5FYKU 3NCYP 2KQMA 1RULH 3TA3A 1QD0A 1FZOB 1WWAX 3ARUA 3KWWA 5TE7L 3VXRD 4AEFA 2PNDA 4U0QB 4X6CE 1KPRA 1NAMA 3VMOA 1P4IL 1CFTB 5JPMA 4P2OC 4YBHA 1JZ4A 4CU8A 4TVPE 3OAUH 4FFWD 4F57L 4PRHB 2GCYB 2PW2B 4MX7B 2PKDA 2GHWB 3FFDA 4GG6B 4RSVA 1T89C 3D39A 5FYLE 3ILPB 1YYML 4HV8B 1AQDA 1C1EL 4N1EA 3QWQB 2WBKA 4NHUB 4QRQA 5BVPL 2B7DT 2UWEB 4JKPL 4NYLB 4U1MA 3X3FL 4DKAA 2NW2B 1CFVL 4OTXH 5DMYA 4GBXA 2Q76A 1VA9A 4FFVD 5FA3B 3P0VH 1CTOA 1YY8A 5EN2A 1IC1A 1KELH 3LQMA 2HVKA 3QIBD 4DQOH 4XBPA 3UC0L 2XYCA 1AGFA 1JFQL 3GSNL 4L8DA 1CWVA 1T80A 1CICA 4XP5H 5C0AA 2D03H 1BQUA 4Z0XA 2IG2L 5ANMB 4I48B 5BOPA 2FATH 3FTGB 5DTFB 1BGXH 1BZ9B 2VISA 4H20L 4X0KB 1S7RB 3Q1SL 3MV11 3QXDA 2OM5A 4U1HB 2MWCA 2P48B 3DYOA 2EIEA 4CVZA 4LKXA 3TBTB 1CLYL 2OS7A 3FZUD 1CU4H 4G5ZL 4UILH 4F80A 2BXZA 3HE7A 1CI5A 5EZIH 2FYYA 3ARBC 4PRID 3KPMB 4GW5B 5SWSE 2EH8L 2H26A 4POZD 2JELL 1MSPA 4W70A 1PY9A 3RJDA 5B39B 4FNLL 3EYQD 4CVWA 2X1PA 4HUUA 2P5WB 3QXAA 4UTBH 5EO9B 1L7TL 2A77H 5C08E 1VGEL 3GNMH 3SKMB 5IGXL 3N0PB 1ZVSB 2HFGH 3DGGB 2VE6B 2DJ4A 4E5XA 4P23B 3ULUF 2DQGH 2EE6A 1J0YA 1G7JA 3PP3K 5TQ0H 4HIXH 3P11H 2Z9TA 1QBLH 3D85B 2X1WL 2FO1A 1KLGB 3MZTA 4WHTB 5DQJB 5E24E 3NCCB 4YK4B 4WHDA 1I8LC 1QSVA 5FXCH 5IQ7L 2P43B 1ZA6A 2BRRL 4NP4H 2EXYC 3GSUA 4ZFOL 1KTRL 1TTUA 4KPHH 4LP5A 3BGMB 3DYPA 1B0GA 3HI1B 2DLHA 1MFDH 2ESVE 4R3SA 1FLRH 5ID1B 1IMHC 3L3OA 4KUZL 5I8KL 3VXRB 3LIZL 5BMFH 4NQEE 4NN5B 1PY4A 1A7QH 3GKWH 3RPIA 5ALBL 5DJ6A 1KB9K 4ERSL 3CPLA 4MHHG 1TVDA 4YHOH 3HFML 4S1DD 4ELME 3PJSB 4U6XA 5E8OA 4PJ7F 4OM0H 5TF1L 4IRJC 4TN9A 3UJIH 1IC7H 3LS5L 3CLEH 4YHLH 3STZA 2WSKA 3K2MC 1YEDA 2AXGA 4KRNA 4Z7WF 4OLZL 1JHKL 4DFHA 4J8RB 4JY6A 1T1WA 3LHPH 2AEQH 1GGBL 3JTSB 4K8RL 1HKFA 3OGCB 3VD5A 5KJRH 1MHEA 2R56L 1MAJA 2RR3A 1B4RA 2AK1H 1AKJB 2UY7A 2F8OA 5K9JH 1UM6H 4LAJH 4YBQD 1Q9OA 1IGML 4S11A 5DEGA 1MI5E 4EUPH 2LFGA 2YHGA 1X5XA 4G80A 4D0DB 1OT2A 5IEHA 1QHOA 4P5MB 3IU4H 4U1SB 2D4DA 2JB5H 1FNGB 4HH8A 3CSYB 4D0BB 4K23H 1H3VA 1I1AC 1AY1H 2VDPL 4R8WL 4WGVB 3JV5A 1A8JH 2XTJE 5MEOB 1YNTB 4GG6F 5E9DA 3VRIA 1DUZA 4RMVA 4Z5RA 3O8XC 1YDPA 5E2UH 3V6FB 3FT4B 1XFPA 3B9DA 3NFNB 3UYRL 1NCTA 2ADJA 1MJ8H 2WWKO 4XVUC 3CMGA 5EIVA 5C7XH 2G75B 2UWEF 3THML 5J7CC 1XIWC 1DQDH 1IGCH 5H37H 4RMQA 1ZA3B 5TQ2L 3PWUB 3UDWC 2NY0D 1FO0L 1ITBB 1I7ZA 1ODAA 1X5GA 3VXPA 1VEPA 3SE4C 3L7FA 1U8OA 3MRDA 2AS5M 3SJVD 3VGFA 4PJFE 3SY0B 4Z7VF 5HYJB 4CGTA 5IEKA 2A1WL 4Q6IC 1J0KA 1XF5B 3HC3H 4DVBB 2W91A 2ATKB 4FQ1H 3O6ML 1ZHBA 2Z4QA 1MJJB 4JQVA 3FRPG 4N0CD 4R2GC 2GFBB 1U3HA 4LLDB 3T0AA 2YSSA 5KAQF 1L7IH 2BERA 1QFUL 4LLWB 4TSAH 4D0CA 3QG7L 3P77A 3O6LH 2DB8A 2VR5A 3IGAB 1Q8MA 1E27B 4H26A 3WJJA 2EYTB 4X6DF 3VXSA 3KJ6L 2EKSA 4MD0A 1JIBA 1HH6B 3EYUL 5I18L 1OW0A 4W6YB 2GI7A 1JTTA 2FJHB 3KPOB 5GGSY 2R2HB 5D2LF 5SV4A 5HYIA 4R26L 1DEEA 1Q94A 3TA3D 4LGPB 1D5IL 1RK0A 4M4PA 4IOIB 3RVWC 4LSTL 4MJIA 5E94A 3OKDB 2VXSH 2AJZB 4HD9A 5HHVH 3L5XL 4HXBH 4DUWA 1RZKH 4YGAB 5CILL 3QR2A 3IDIB 5ITFA 4DEPB 1X6NA 3SDXE 1FNSH 3MLWL 3N1FC 1QBML 1AGEA 1IGYB 3C8KB 5GGUB 2EDYA 5F1OB 4N1HB 1YNLL 1U8IB 3MRKA 3BJ91 3HZMB 2ZCKL 1WVZA 5AG9A 2HJKB 3W9DB 2C1OB 2BMKA 1EBAA 5FDWB 4Y5YB 4P9HC 2AJUL 4NPYB 3GSXB 1S9YA 1WBZA 4XCFL 4DTGL 3FHQA 1V7MH 4GBXD 1NL0L 1Z9MA 1FSKB 2FLRT 4TVPH 1TTGA 4ZUUA 1LMKA 3RWGB 4MVBD 5HXMA 3QWOB 4M1DH 3VXTA 1QSFA 2J88L 3AXLB 2FGZA 2VZSA 5TGBA 1CICD 4QRTA 4AM0A 4JM2C 1RUPL 1OAXL 4U6YA 2AVGA 3T1FA 3GHBH 3HS0A 1JN6A 5HY9A 1T1XA 1UJ3B 2CLVA 3MCG1 1ZGLA 1KJ3L 4Y2DB 4PJAA 1P2CA 4ZTOL 2HKHL 5JHLH 1DQJB 4MQXD 1FNEB 2R0WH 3Q6GH 3F5WB 2W92A 4EDWL 5ICZB 3MV7A 1FORH 4UAOC 4HGMA 2F8XC 4H8WL 4OF7A 2NY0B 3F12A 4JN2A 4M93B 5HPMA 1L6ZA 2HA1A 2YD7A 1KJMB 1D6EB 5IJKA 1HXYA 1OD9A 4UBDC 2HTLD 4HDIB 3F7YA 4JFYA 3SJVB 2CJUL 4F7PA 1TZHB 4YDLB 4WI7A 4JJ5B 4NQXB 1N3NB 3IFOB 3V0WH 2ZZUT 5I74C 4IRSD 2VNCA 2V2WA 4HEME 5C09D 1FQ9C 35C8H 4OFDA 4LVNB 4G6JH 4NT6B 4K3JL 3ILQC 1JPTL 2PO6A 2OBGA 1R5VA 4V1DD 1LO2L 1JNLH 5DVLA 1QVOB 1U2HA 5HYJE 2F5AL 3VFOA 3KNBB 4PB9H 3QISA 4ZXBC 4WHYH 3KWWB 1MCQA 1RIHH 2FJGB 3DMMC 4ORZC 3DSNA 1KCRL 4EDXB 4S1SL 3VXOB 3TBWA 1FZJB 1KPRB 2NY3B 2DIAA 2K7QA 4OCWL 4HJ0D 2ADIB 4Q0XH 4PGDA 1CD0A 5GZND 3VDAA 5LWYH 3W5MA 3BZFB 3HG1E 5DHXB 2VR4A 3P40A 5E6ZA 1J1OH 1LGVA 3NMEA 3GO1H 3FFDB 5LG1A 2IH3A 3D39B 1EFXB 4PJ8C 2DQFA 1AQDB 4OLWH 3LZFL 1U58A 4LEXL 1DLHA 4JVWA 4QRQB 3DHJA 4PJDE 4OCXH 5C9JA 3OKLA 4U2YA 5I8CA 3TJEL 1H3XA 1ZMYA 4U1MB 1ZLSH 3S37X 5IWLA 5CKAA 1S7TA 1RZFH 1F5WA 4GBXB 2EZ0C 2Q76B 3H9ZA 2VXQH 1ZVYA 1HHJB 1YY8B 5EN2B 2HVKB 4XBPB 1KNOA 2H2PC 1J0ZA 5E9DD 4L8DB 5C0AB 4Z0XB 2FHFA 1YPZA 2JJTC 1FHGA 2VISB 2C4FU 2ED9A 2YMXL 1CR9L 1VFBA 3QXDB 4DAGL 3HUJE 5B3JE 1TCRA 4CVZB 4LKXB 1K6QL 4KDVA 5D1XC 3MRLA 4ZTPL 5GPRA 5JW4M 1UM5L 3HE7B 2NY7H 5T3ZD 2FYYB 2AEPL 3MJ6A 4KU1A 3HC4L 1D7FA 2H26B 1F8TL 2HN7B 4OCLC 2EICA 3QDGA 5IFHH 3NH7L 5IBUB 1M1SA 4ZDHA 3V4VL 4R4ND 4HUUB 4FP8L 3QXAB 5HGGS 3GEWB 3GM0A 3PDOA 4XBEH 2DM2A 5DD1H 1CZ8H 4D94A 2IJ0C 5MI0C 4OCSH 1U3HD 5D93B 3ARGA 5IHUH 1KBGL 2NR6D 4X5LA 4E5XB 4LSUH 2E6JA 1HIML 3HE6C 4ZAKA 5FUCC 3HZKA 1P6FA 3VXSD 3MRRA 4X80H 5DRZA 3FFCB 4IHOA 1HKLH 4Q9QH 5DO2C 1T7VA 1LP9E 5L7XH 3GMQB 1NKRA 3O6FA 2R4SL 3EJJX 1AO7E 2X4SB 4OFKA 4HUNB 1WAAE 1L9NA 3I75A 4Z77A 3SQOH 3MJ9A 3BX7C 1ZA6B 5IHLB 3GSUB 3MFGB 4MJID 1P4BL 1CS6A 1M7DA 4IOFC 5DC0A 1BQLL 5E00A 3DURA 4R3SB 5FF6A 4WUKH 1WFNA 4JO2L 5B22A 4BZ1H 4F7CA 4Y19A 2NY6C 3O2WL 1XGTA 3G5YA 5DJ6B 3WLBA 4Z7UB 5IMLA 4RMUA 1C8PA 2B4CL 2IF7A 5B21A 4NJ9H 3QAZB 2VLME 3KHQA 2HT3C 4U6XB 1OGAA 5E8OB 2BCKA 1H9VA 3STZB 4OGZA 3S3JA 4M7LT 4JPVL 5L6YH 5D1ZC 3CFKA 4Y16C 1KN4H 2BY0A 1MHEB 3RY6A 3IDUA 4HUVB 1SVCP 1IEHA 5GGTH 1AR2A 4G6KH 3IJYA 1Q9OB 1TQCB 2R69L 2ZG2A 5DEGB 1FPTH 3TPUA 1UT9A 4G80B 1FFPA 2MQCA 5IEHB 4OZ4A 5GXBB 1QSFD 3JWDH 5E03A 1A4KA 1IGFL 1OB1A 4P9MH 5KVDL 1F4XH 4X5WA 1INQB 3FOMB 1XF2A 1W72A 3TJHD 2EH7H 3MRNA 3ARVA 4EVNA 1F4YL 1AXSA 4M6NH 2GW5A 4Z7OF 3OR7A 4Y1AE 5E9DB 3QUKA 3VRIB 1DUZB 2IBBA 4Z5RB 2AJXL 1YDPB 2PXYB 1QQDA 4K7PH 2ADJB 3DGCR 2PUQT 2OXGA 3PGCB 4O9HL 3MV7D 4LQ1A 4Y4HB 5JW4N 2R8SH 1LDPH 4PG2A 4N5EC 2ZSWB 3VFRA 4L4TA 4X4MA 2CR6A 3MPCA 4DK3A 1JPGA 2X70A 5EBLA 5H2BB 1I7ZB 2CO7B 3GSOB 3VXPB 4O5LH 1U8OB 3MRDB 4UIMA 4XNXH 4C59B 1GGCH 2XOTA 2VZVA 1SY6L 2OP4H 4JR9H 3RVVC 5C0AE 2C3XA 1WWBX 4WI8A 1FAIH 4O4YH 5FIEA 2JJVA 3GSRA 3KPPA 2Z4QB 4LLYA 5I1KL 1OAZH 2YBRA 4LKCB 4BZ2L 4O2FA 2DF3A 4Q9BA 4GAFB 5CSGA 4TOYH 2AK4D 4BQ9A 3P77B 1DTUA 3P73A 1Q72H 4S10A 1BX2A 4H26B 2HT2C 3VXSB 5LXGH 3S88L 4OD1L 5JMOC 4PTTA 2WIMA 2P44B 4MD0B 4O02H 1IKFL 4FQ2L 5IB2A 4YHIA 4KZEH 2CDGA 2PO6D 2VQ1A 1GH7A 4MA8H 2VLLA 1GOGA 2ZCLL 3QDHA 3P9LA 3E1F1 4YX2H 1PW3A 1Q94B 3ZT5A 5JIPA 1KCSL 4MJIB 5E94B 2Y7QA 2FCBA 2CRMA 3D87B 3FN0H 2DQHL 2KKQA 3NAAL 1EGJH 3G5VA 1TQBB 3U9PH 4OFPA 1NCWL 4PP2B 1CF8L 1QRNA 3CFBA 5IW3A 3FFCE 1TJHL 2I25N 3FB8B 1AGEB 1F4WL 2CIKB 1PG7W 3UYPA 3FONA 1T2XA 1MFCL 2KZWA 3OB8A 2Q1EA 2QV2A 3MRKB 1EDQA 1Q38A 3OZ9L 3MMEA 4AIZA 5FHAH 2B20A 1NLDL 2VC2L 4MCZA 2Y6SC 2FSEA 3QEGH 1FE8L 4C56B 1FGVL 1S9YB 1WBZB 2OL3A 3U48A 4OZHB 1OAYH 1I85C 4M03A 3H9SA 5I71C 3ZKQD 1S9KC 4HGWA 3B43A 4Y4FC 4ZUUB 4Z7UE 1EK3A 2I60L 3VXTB 1QSFB 2G9HA 3VDBA 2VIRA 5I73C 4LHUG 4JFPA 5TGBB 4NQDA 1YEJL 3ZO0A 3GMLA 3O3AA 1RMFL 4QRTB 3VFUA 3RFZC 4AM0B 4ZPTA 4HWBA 5E8EA 4OLUL 4U6YB 5GGQL 3T1FB 1JN6B 1SEQH 1NMCC 2BNQA 5J12C 1T1XB 2CLVB 3T04D 4PJAB 1P2CB 1CL7I 5HHOA 2Y07L 4NN7B 2ARWA 5JQHC 4G43A 3CVHL 4LEOA 2N7BA 1ZT4A 4G8FA 3SN6N 2V2TA 3MV7B 4PJBA 3I6KA 4UDUB 2YPLA 4L3EA 4LDOB 5INDA 1BBDH 1KTLB 3QDGD 5FKAA 5I15L 1G7IA 2W60A 4JN2B 3ZTJH 3BPNC 1DANU 1SM3L 5HPMB 2OMNA 4LLQA 4LLVA 5HGBB 1EERB 1FCCA 1HXYB 3WIIH 1G6RH 1Z3GL 3PXHA 5L8KB 4GLRI 2YPKA 3F7YB 1NSNH 5D1QA 3F65A 4JFYB 5GHWH 3ARGD 2CMRL 3IF1A 1N7MH 4AQOA 1TPXC 3WFDL 4ESKA 3CH1A 3O2DL 4ZAKD 1UWGL 4KHXL 3PWLA 4M3KB 1DLFH 1OWWA 2V2WB 3KPLA 3O6FD 2VQUA 4A2MA 1UH2A 1RULL 4JFFA 4G9FE 1J8HA 1R5VB 4XXCA 4M7KH 1F42A 1UGNA 1NDGA 3VFOB 1S7XA 2EDWA 1FIEA 1G9EA 1PD6A 4X9FA 5DZNA 1EMTL 1JI2A 3OAUL 1KT2A 2D3VA 2PETA 3TBWB 1ZK9A 3BGFC 4PGDB 2X7LB 3OJ2C 4CAGA 5J9PA 5KG9A 1UCBL 1OGAD 4QHMB 2AV1B 3MSPA 2BDNL 2VDNH 4F37F 1UEMA 3WXWH 3CFCL 2WV3A 3MREB 3V5KA 4XC1H 2Q3AA 3EOTL 4YUEL 1E6JH 5GGVL 1DBJH 2J6EH 2Y23A 5T33L 1CLZH 2P46B 3QEQA 3PWNB 1HHHA 3VXQA 4U1IA 3HAEH 2DQFB 1U58B 3PV7A 2E7HA 2UY6A 3P0VL 5DD0H 2PYEA 4PUBH 1RZ7H 4S2SA 3BSZL 4FXKA 1KELL 4P5KA 2K9UA 4LCUA 4MHHI 1S7TB 3E8UH 4EI5C 4HMEA 1LNUA 2FATL 4JZNB 1BGXL 4B53A 1A7PH 3LRSA 1KNOB 1I9JH 5ETUA 4ZFZB 2R15A 3VFVA 3HNVL 1I1RA 3B83A 5J1AA 1CU4L 3IAPA 4GQ9H 1S5IH 3TT3L 5EZIL 5BV7C 1WQVT 1VFBB 4C56E 2H9GA 4TSBH 2WANA 4OZHE 5T1LA 4OZIE 2J4WH 4JY5L 3QZWA 5D2NA 3P0YH 4L4TD 3MRLB 5F71A 4CN4A 2HLAA 3S6CA 3EDEA 4K3EL 3BGAA 2VN4A 2Q8AH 2A77L 3VWKC 4FQXA 1FDLH 3GNML 5EH1A 3QDGB 4LVEA 2HFGL 1RURL 3SE9L 4WI2A 1U8MA 1GGTA 4X7SH 4ZDHB 3OJDB 2XKSA 4ETQB 4NQTA 3IDXL 4WFHE 2DQGL 1IQDA 3PDOB 4EJ1C 3S7GA 3ARGB 1UC6A 4P59L 2FHBA 2ZG3A 5DJAA 4PJAF 5GRWA 4PLNC 4J1UA 1LEKB 1QBLL 3BT2H 4FZ8H 4WW2B 3HZKB 1PKQB 3MRRB 5DRZB 4YBLC 3RAJH 4IHOB 4ONHB 5DJYA 1X5IA 5F8QC 4KK6C 4NHCH 1BOYA 4WUUA 1NANH 1PEWA 3O6FB 3B8YA 4NKDA 1IKNA 4OV5A 1FLRL 5JOPD 3I75B 4Z77B 1S7VA 1VB9A 3HLAA 4E42A 1B4JL 1M7DB 4BSWA 1OWRM 4FG6C 4YHOL 3G04A 4OQTH 2GJ6A 3DURB 5FF6B 1TVBA 3D48R 1U8PA 2F8VA 4U1LA 1I7UA 1KCKA 3WFZA 4YHLL 1QRND 1JGDA 4QTIH 4F7CB 1I9RL 4LRNL 4Y19B 4ODHH 2F54A 1XGTB 1Y6NR 3G5YB 1YMMB 4XZUA 1FBIL 4GSDH 5IMLB 4RFOL 5A2IH 1ZLWH 3LHPL 3MCKA 5CIPA 1R5WA 1H15A 4LSSL 4XX1G 1OGAB 2BCKB 1A47A 3CFEA 4XRCA 1D5BA 2JKXA 6CGTA 3MYZA 3ARDC 3SO3B 1H3PL 3CFKB 1MCOH 5K9JL 1BP3B 1QBBA 4M9OA 3VFGH 4H88H 4GAYA 4WW1A 5HD8C 3D5OF 1A5FH 3AY4C 1U92B 4W6WB 4FQPA 5CJOL 4HG4J 3DSFH 3IU4L 4IIQB 1BAFH 2CR3A 3RKDC 1EEYA 1NKOA 4MDJA 3H9SD 3WDIA 4K23L 5BV7L 3TPUB 5JQ6H 1LE5A 1FFPB 4OZ4B 2ZKHH 4ZO8A 1A4KB 1OB1B 4KKCC 1BOGB 1I8KA 2WWMC 2P1YA 4NQDD 4M1GL 5E2UL 4Y8DC 3WUWG 3MRNB 1JV5A 5L9DH 1AXSB 5C71A 3OWEA 1MJ8L 5GRZA 2YPVH 3OR7B 2IQ9H 3X14A 1RUAL 5C7XL 2BNQD 2D7OA 3O9WA 4ETYA 1DQDL 1VPOH 4WY7H 5DQ9B 5TDNA 1QQDB 3V6OA 4RRPA 3FT3B 3LKPA 2WUCH 4PJIA 4WU5A 2YPLD 2ZUSA 3D9AH 3VFRB 4Y8AA 4L4TB 3VI4E 1P84J 1JPGB 2OZ4H 2X70B 3HC3L 4PY7B 5IF0A 2W9EH 1SBSH 4XI5C 1EJOL 3RIFK 4UIMB 5EBWA 4IMKA 5D1QD 4HK3N 1NDMA 3FO1A 2IGFH 4TSAL 2MFNA 4ZUWB 4M43H 5HDQL 2YA1A 1YPZF 2C7UA 2EDTA 1H3UA 2FLBT 3GSRB 3KPPB 3LEYL 4QWWC 2YBRB 1DQQA 3G6JA 3TO4A 1SJHB 4Y5XB 4RRPG 1W8OA 3P73B 3UTTE 1A7OL 1BX2B 3JV0A 4G42A 4GRLA 5KVFL 3X3GH 1U41A 4PTTB 3OHXA 4LMQE 4JFFD 3T2NL 5IB2B 4YHIB 3ARPA 1TITA 1J8HD 2XWJA 3ARFC 1GAFL 2VQ1B 4MYWB 1FC2D 3NFPA 5I6XB 2VLLB 1X5FA 3MGTA 5ADPH 1EXUA 3TNMB 1Y0LA 2O5YL 2VXUL 2NMSA 1QZ1A 4K2UH 1OAUH 4OJFH 3QCTH 3SCMC 3Q6FA 5CLTA 2DN7A 3PP4H 1FJ1B 3G5VB 4HJGA 5HVHC 4P2RA 1QRNB 3QDME 4GQPH 1PKQE 3SGKC 1ZANH 3NZHH 4JN1L 3VCLA 1HOCA 3WLWD 1BIIA 3CDGA 3FONB 4XBGA 2PR4L 1J86A 3F62A 4AT6A 4K94H 5EU6E 3B9VA 2E3VA 2X05A 3WD5H 4ZFOA 3G9VA 1OSZA 2HP4A 3QEQD 4BH8A 3ECBA 1V7ML 4AIZB 5BXFA 3I50H 3KLAA 2FBJH 4TVPL 2IAMA 1ZLUK 2FSEB 1B6UA 1CDUA 2GSIA 2PYED 5E2WL 5SWZD 4I0KA 3O2VH 5DMGC 1CGUA 4UQ2A 5DDHA 5HJ3A 3SDDA 5AUMA 2G5RA 1KACB 3H9SB 3U82B 5CEXA 5C0CA 5TDOB 3WO4B 1RIUH 4Y19E 5FYLL 1XF1A 1YMME 4OCRL 2DTML 1J9CT 4JG1H 2HLFC 3GHBL 1IZJA 5BVJA 1CE6B 2GYSA 2G9HB 1G7HA 1T2QH 3QJFA 4JFPB 4NQDB 5ESAA 1N5YL 5JHLL 3GMLB 3O3AB 3VFUB 5E2VH 5EFIB 5SX4I 4BQ6A 2BNQB 3OAZK 2NXYD 1PFCA 4AG4H 5JOFA 3ULUE 3BKMH 5HHOB 3VXUA 3OKYA 4G43B 4QKXB 4LEOB 4XPAH 1ZT4B 1LDSA 2V2TB 3ULVE 4LVOB 2IQAA 4J3XA 2YPLB 4FQXD 4L3EB 4X9HA 1A0QH 3CFDA 5FKAB 2BFVL 1D5ZA 2EDKA 2VB5A 1G7IB 2W60B 4JANA 3TF7C 2XKNB 3IU3A 4LLQB 1ONQA 5F7FA 4FTVA 2XV6B 2YPKB 4W68A 5D1QB 4NWTH 1R3HA 3IAQA 4OCMC 5HVFB 3CUPA 3IF1B 2FGWH 1WEJL 5JXAH 4ZFFA 3F7QA 4G6JL 1TJIL 1MELA 2IPTL 1FO0A 4QRPA 4RGNC 1T20B 4LASL 5IW1B 5EU3A 3AU1B 4WUUD 3KPLB 3UTPE 1MFBH 4JFFB 1AH1A 1GC1C 2A6IA 3BZEA 1J8HB 1RIHL 4LCIL 3RDTA 5F96L 5T3XL 3RL2A 1A9BB 2P8LB 1NDGB 4P0DA 1CT8A 2GJ6D 3N06B 5LWYL 1S7XB 5DJXA 1SJVA 5E8PA 3DOSA 1ZHKA 2F54D 1YEGL 4XCYA 3GO1L 1NUFA 4IS6A 5J9PB 5KG9B 2YN3A 1YMHA 3LMJL 4ZOAA 1HHKA 1F02I 1E6OH 3EYVA 4XB7A 3V5KB 1J8KA 3BN9C 3MXVH 1SJXA 3ZDXE 3BI9X 4ZOCA 3S8WA 1MEXH 4QCIA 4DGYH 2EDRA 4NGHH 3QEQB 3WSQH 3VXQB 1RZFL 1F90H 4U1IB 5I16B 5DK0A 2D7MA 4ZOEA 5GGRY 3W11D 2VXQL 4RNRA 3GHEH 2PYEB 3KPSE 4FXKB 4P5KB 3MUZ1 4LCUB 2RBLA 5D7LA 4I13B 4F33A 4JREB 3D0LB 4KJPD 3V6BR 1LNUB 1MJ7L 2X4PA 1S8DA 1DBMH 4P23C 4JZOA 2H1PH 4Z7VE 2UZXB 3LRSB 5ETUB 2OSLA 5IVXA 3VFVB 3O9WD 4I5BA 1ND0A 3MBXH 3OL2A 3WHXB 3CU7A 1LQSR 1P7KA 3QUYB 5J1AB 5HGAA 4DKEH 4AYFA 1BBJA 5CP3A 2ORBH 5C0NC 2NXYB 3FJTA 3V52H 3K4AA 5FM5M 5T1LB 2Y25A 5DGRA 3LKRA 2P4AB 4H1LH 4D8PA 3W39A 5IFHL 3QZWB 5D2NB 1IM9A 1MPAH 3PWPA 4MQTB 2EDQA 2HLAB 2JLLA 3NFSH 1EAPB 4UT7L 1WJ3A 4FQIH 5GISH 5H35A 4XNMA 1OTUC 1D6VH 4FQXB 5DD1L 5FK9A 1UVQA 4U33A 1PSKH 4OCSL 2HFFA 5IHUL 2E27L 4NN5C 5E8NB 4DFIA 2J2ZA 1GC1L 2BVPB 2VITA 5C0EA 3VG0H 3MLPA 1IQDB 5FYKE 4X80L 5DMIH 2HMID 4FFWC 3FO0H 4HIIA 1GZPA 2YC1A 5DJAB 5DR5H 3TO4D 4P2YA 4J1UB 4X6BB 2YKLH 3AROA 1A1NB 5HHOE 4AY0A 3LSOA 4U1NB 5L7XL 3IS0X 1A6ZA 3KXFB 1NBZA 2EYSA 4GRLD 5E6IA 3SGEH 2EO1A 4NNPL 1XCTB 5DJYB 4PJBF 3MRFA 1WCBA 5B8CA 3FRUA 5FV1L 5KSBF 4M8VA 3MV8A 3MRBA 1TFHA 4NKDB 1KB5H 4OV5B 4WUKL 2I07A 1S7VB 4BZ1L 1MVFA 3HLAB 4E42B 4BSWB 4ZSOA 5F88A 4AIOA 3G04B 4N0YL 4HQQH 4XNZB 3WEXA 5IIEA 3QIBC 4U1LB 1VFMA 1I7UB 4P2RD 4EN3A 3V7AE 1I75A 1JGDB 1KEML 3STLA 2F54B 3MJ7A 1Q1JH 3BH8A 4XZUB 5L6YL 1Z0NA 3MCKB 4JRXE 1KN4L 5CIPB 5EG6C 1R5WB 1H15B 2JJSA 5IW6A 1CD9B 4XRCB 3U7YH 1MCJA 3DNKA 1ES0A 2MQ0A 2DLGA 1ETZA 5GGSB 4L9LA 2IAMD 1AGCA 4CUCA 4GAYB 4PJXF 4WW1B 3SDDD 4POZC 1A6AA 1EEYB 4P9ML 2VLRE 4JFXA 5C0CD 5DJDB 1KPUA 2NXZD 2Q6WA 4HFWA 3R1GL 5D9SB 4D9RE 5K9QG 1LE5B 3EYQC 1EO5A 5FOJA 5FCUL 2OTUA 4M62H 6FABH 4HAFA 1K3IA 4PJEF 1I8KB 2GTWA 3LEVH 2VDLH 4K8RD 1KLUA 1IQWH 4RA0C 4KWUA 5C0IA 4LF3A 4K7PL 2FJFA 3CDFA 43CAA 4U0RB 1QFWM 3X14B 3O9WB 2R9HD 3MLXL 5FYJH 2R8SL 1KJVA 3OKNA 4K3HA 4XAWH 1I1FA 4JRYA 3T0BA 1OM3L 1J12A 5CEZD 3VXUD 3DX8B 1FVDA 3BUTA 5TDNB 2B1HH 4N90E 4NO3A 3TVMA 4MNHA 4O5LL 4PJIB 5E4EB 4C4KT 4WU5B 2BHZA 4XVJH 3MA7B 3BH9B 2DQEH 1GGCL 3UAJD 3L5HA 1Z5LB 1YUHB 1R3IH 2XPGA 4HMCA 1BPVA 2GT9A 3T65A 1BQSA 5IF0B 2GUOA 5D6DC 1OP3K 1OAZL 4FTVD 5EBWB 1AQKL 1GGYA 1NDMB 4AEIL 3H42H 4DEPC 1YEFL 2C7UB 1Q72L 1QFWL 4S1DC 3ULUH 4WFEE 2NY4D 5DUPH 3WKNA 3DIFA 4NO0A 1DQQB 2D7NA 2AEIT 3G6JB 3TO4B 1G1CA 4QRPD 4YC2B 3QJHB 3ZE2E 5HBBA 2QQNL 2FR4A 3D3VE 5D71H 5TFSL 1KN2L 1JYXA 3ZDZF 5GS0L 3VI3F 3G5XB 4QRUA 4GRLB 5E1HB 5F3HA 5FKPA 1QSEA 4GG8A 2ILLA 4Y5YC 5LBSH 4LNVA 3WN5B 3RDTD 4DJMA 1UB5A 3MGTB 3FN0L 1FSKC 1T83C 1Y0LB 2DQTH 5BW7A 2H45A 3ALXA 3QI9A 1HQ4A 4EI6A 2X1XR 2D2OA 4ZPVA 3BE1H 3L5JA 3Q6FB 2EEDA 4LSVL 3MOBL 4HJGB 4P2RB 3ZYIA 3KXFE 5F1KC 4IRJD 2W0FB 3HZYA 1UJ3C 5IROA 3VCLB 1HOCB 1G9MC 4Y2DC 4GS7C 2CIIA 5FHAL 1BIIB 1ADQA 1NMAH 4XBGB 4DKFH 4HPOH 4AT6B 4ZFOB 3PWVA 4W4OA 1OAYL 2WZPD 4A2LA 2ICEA 2N1KA 4BH8B 5DEZA 3MLYL 4F7TA 3DUSB 5BXFB 4UIKH 2IAMB 2GSIB 2NY0C 4M93C 4YXKL 4ONFL 4L5FH 3QFJA 4UQ2B 5HJ3B 4YXHH 5D7LD 4OLXH 4ZO6A 3MRGA 4JQXA 5CEXB 5C0CB 1GL4B 5TE4L 4M5ZL 3MACH 1HSBA 2FECL 4YDLC 3B4NA 1A1MB 4LSPH 1I1AD 3OB0K 4OFVA 2COQA 5HDBE 1JWMB 2IADA 4HC1L 5BVJB 2ZCHL 4JZJA 4N0CC 2DTSA 3QJFB 4QRRB 5ESAB 1I3UA 5DJZA 2QADD 3O8XD 2LABA 2HYMA 1KIRB 3RNQA 3GIZH 4R7DA 3CZFA 3VH8A 3EDFA 4N9GB 2XZAL 4I3RH 2O5ZL 4LVNC 4ZMAT 3D6GA 1WT5C 1A6WL 3VXUB 1BBDL 4MXWH 3MZGB 5I76A 3EJZD 4LGRB 4JJHA 1IM9D 4MNQB 2J8HA 5I1GH 3WIIL 1G6RL 5D70L 3WL9A 1B0WA 3LH2H 3TA3C 5JIHA 2J5LB 1D5ZB 4JHWH 3VGAC 1WZ1H 3KYNA 3IU3B 3RX5A 2P49B 1ONQB 1RFDH 4RMWA 4FTVB 4XCEA 2Q8BH 2FNBA 4L8CA 3DVIA 3VH8G 4B41A 1R3HB 1N0LA 2NW3A 4ZFFB 1EFQA 2W0KA 1XCQA 3S96B 2CGRH 3R06A 4MAYA 4U31A 3GJFA 4GRWE 4QRSA 1FFQA 3VD9A 1FO0B 4PJIF 4QRPB 3DV6A 5IVNA 2VH5H 1GOFA 4M7KL 3OG4B 3QQ9D 3MV8D 5C07A 4JRWA 3BWAA 1SY6A 4HBCH 1DP0A 2A6IB 3BZEB 3RDTB 5EZOH 4PLOB 4MMXC 4LLAA 2DDQH 4GBXC 5FYKH 3SKUD 1KIUA 3BISA 3IAGC 32C2A 3RGVA 4MVBC 1IM3A 3OSKA 4EQ2A 2WM0A 3L1OL 5DJXB 2P7TA 2W65A 4EN3D 5E8PB 3UTSA 4PJGF 5F7EH 1T0NA 2QJDA 3TC9A 3RU8L 3WXWL 3TPKA 1TZGL 1JI1A 3G6JF 1CICC 5GRUL 4XC1L 3WKMH 4Z6AT 5DHVB 4XCYB 1X5YA 4ALAL 4IS6B 1UA6H 5GRYA 1GPOH 3E3QC 4FQHB 1DBJL 2XFXB 4XPTL 1YMHB 3TZVB 4HZLB 1HHKB 3MLVH 4JKMA 2BSSA 3LAFA 3QG6A 4MQXC 2MHAB 2C3WA 5DD0L 1B88A 1KPVA 4Y88A 4PUBL 5F6HI 2GIYA 3WDJA 5I1CL 1IAKA 2APXA 5J6GA 4M7JH 3HE7C 3HNTH 3E8UL 1LVEA 4DOHE 4ZNEA 4UT6H 1ZT1A 4NM4L 4Q97A 1QLFA 5DK0B 3ZL4L 1IT9H 2IMMA 3E6HA 1FVEA 4RNRB 1RK1B 3GBML 3ALWA 2HKFL 3QA3A 3UROR 5D7LB 1A7PL 4F33B 1I9JL 4OZFA 5D93C 5DFTA 5CS7A 2QLVB 2XA8H 2X4PB 5ADOH 1S8DB 2X4UA 1KJ2H 1FG9C 3HKFA 4JZOB 5A1AA 2Z93A 2OSLB 5IVXB 4NM8L 4XPHH 3SE8H 4TSBL 4I5BB 1ND0B 2GY5A 1A7NH 1BMGA 1P7KB 3IT8D 4TNWF 2NX5B 5D7IE 1BBJB 2ZUTA 3TVMD 5JW3L 2EYRA 2Q8AL 12E8L 4U1JB 1QPPA 3LKRB 4D8PB 3W39B 3FB6A 4GAJH 1CFQB 1IM9B 2E7BA 1RZGA 3PWPB 4DUVA 5EUOA 4X7SL 3L5WB 2C5DC 5H35B 1XGQA 3S36L 4HCRH 4XNMB 5FK9B 1UVQB 1EAJA 2HFFB 5DVOA 1FC1A 3TIDA 4QRRE 2XN9A 1MREH 1NCBH 4ODTL 5DJ0B 2VITB 3BT2L 5GZNC 3VFWA 4I9WD 2YK1H 3QAZC 5EO0A 4F9LA 4NO0D 4OB5H 1T7YA 4HIIB 2DQDL 3B5GA 2YC1B 2A9NL 3QUXB 5E8DL 4NHCL 1J7VR 4S0TD 1A6ZB 4XP9H 4X83A 1DVFA 4X4XA 2EYSB 5E6IB 5IK3A 4MNQE 1QSED 4C58B 2FHCA 2VZOA 4OI9A 3U2SA 1NFDF 5C09E 5HYSA 3MRFB 1WCBB 4PLJD 1NFKA 5B8CB 3A6BH 3FRUB 4NBYB 1OHQA 3MV8B 4JFEA 3K1DA 4HUWA 4OQTL 1MRDH 4U6VH 1X3DA 4TULL 2I07B 2IFFH 3I02B 5HHNB 3QI9D 4NKQB 4ZXBD 4QTIL 1ORQA 4ODHL 3O2DA 3C5SA 1QLRA 1H3TA 4ODSH 3I2CL 1J0JA 4JE4B 4GSDL 5F88B 4NZRH 3NIDE 5CHNA 3WEXB 5IIEB 3OX8A 4GKSA 1QNZH 3NABH 4EN3B 1IBGH 4ONGH 3STLB 5E99L 3MJ7B 3C2AH 3BH8B 3GMNB 3I9GL 1A6UL 4URTB 1MCOL 1DN0A 4ZO7A 2FH6A 4H88L 3T2PA 1QUNA 5TPWL 1BAFL 4JFDD 3F6LA 4Y4HC 4LP4A 5GZOC 1ETZB 5CP7A 4LOUD 4KTDH 1G9NC 1MCBA 1AGCB 3AREB 4B7IA 4P99A 2HG5A 4WI9A 5E2TH 2OR9L 5DVNA 3DXAD 3IRPX 4PIRF 1A6AB 4P48A 1F13A 3PHSA 4JFXB 1GSMA 4JHZA 3TH4T 5FM5O 1KPUB 1PKOA 2H32H 3ZTNH 3LCYA 5L9DL 4TUJA 2YPVL 4D3CL 3DWTA 2OTUB 1FIGH 2EDNA 1DL7H 4JQVC 2H2PD 1F3JB 1U3HC 5CBEA 3RX8A 4DW2H 1VPOL 4N0FA 3ULSA 3ABZA 2NR6C 3PQYD 4LF3B 1LO3H 2FJFB 2KQNA 43CAB 4XWGH 4I77H 3WJJC 1Y18A 1KEGH 1BM3H 3WJLA 2Y72A 1KJVB 3OKNB 3T08A 1I1FB 4JRYB 2D9QB 3D9AL 3VFNB 1CGTA 2ZSVA 1OW0C 1FVDB 1L0QA 5EOCJ 2OZ4L 1O7VA 3OPZL 4NO3B 3TVMB 3WS3A 1B2WL 4MNHB 5DS8A 2F74A 4UV4H 1T4KA 1SBSL 2W9EL 3S34H 1F58H 3DX9A 2VAJA 4NQCE 2IGFL 3E2HB 5A2JH 2XPGB 3VFMA 5EPMA 3S4SB 1A6TA 1YC7A 4KKLD 3T65B 1TQBC 4EOWH 1IFHL 4JHAL 5I1EH 1FG2A 5EWIH 1OTSD 5IVXE 3GZKA 5T5NG 5D96B 5J3HD 5LCVH 2NX5E 4JQIH 3X3GL 4OSUH 4KXZI 5F1IB 3DIFB 5GS2H 4XMPH 3EZJB 2E7MA 3CMOH 4MA7H 2FR4B 3B9KB 5ADPL 1I1YA 4QRUB 2P24B 5F3HB 3MROB 1BVLA 4O58H 4X4YA 4K2UL 4NFBA 4RISL 3U83A 1EO8H 3QCTL 2HH0H 1UB5B 2NY2B 2JF1A 3PP4L 4DGIH 3TO2A 2E7LA 1G7QA 3MBEB 4NRXA 3X11B 3RGVD 3QI9B 1CTNA 4HK0A 1ZANL 3UTSD 3NZHL 4GRWH 3O0RH 1I9IH 3TJHC 1OARH 1FL3A 5KVMC 3ZYZA 2FBOJ 5JMRA 5CBAB 4XVSL 3HZYB 3TBSA 3AM8A 2AQ3A 3MXWH 2CIIB 3I50L 3L5IA 3B5HA 2FBJL 3ZDYF 1Q9WA 1MWAH 3HMWH 5J8OA 2B0SH 2ZPKH 3ELAT 3O2VL 4PGZA 3PWVB 2VXTL 3S35L 2FEDD 5C0BE 3SDCB 4QOKE 3EOAA 2ICEB 4KVCH 4F7TB 3OF6A 3IFNL 2YUXA 2JJUA 3F8UB 3K4ZA 3D1MC 1NAMH 2BNRE 2CXGA 3QDAA 3DO3A 4JG1L 4F58L 3QFJB 5IJKC 3AGVA 3G6DH 5BS0A 1OL0A 1UWEL 3MRGB 1MCNA 1WISA 4N9OB 2XRAH 2MCG1 4PBXA 3CDCA 1BFSA 3GFUA 4KMTL 5J11B 4JDVA 4IDJH 4JZJB 4AG4L 4QY8A 2V17H 4EUPA 5DJZB 1EEZB 3BKML 3RNQB 2XWTA 4R7DB 2C26A 4U05A 5DMKA 3CZFB 4HT1H 2FX8L 3B2UC 1A6VL 4UUJB 2FB4H 3TP4A 4FABH 4HG4K 4PGJA 1BWMA 2PO6C 3CK0L 4ZODA 1PZ5A 4ZNCD 2DICA 3LQZA 5ALCL 2Q3ZA 1CGVA 3WL9B 1VEOA 5JDSA 4NWTL 4GT7A 2XN9D 1BVKA 5JXAL 3QULA 1BHGA 3BMVA 2R2EA 4XMLL 4XCEB 3QIUA 3CZJA 5I0DA 4L8CB 5IFJA 4ZUSA 5ID0B 1MFAL 2NW3B 3SKJL 4JRYE 3K2UL 3PDDA 2BVQA 5AZEL 1XCQB 1HE7A 3R06B 4MAYB 2EXWD 1DVFD 2N4IA 2AK4E 4Z78A 1JWSA 5L8LB 3DV6B 1AI1L 1HINH 1HI6B 4OV6F 1E4KA 4JFED 4LGSB 5C07B 5MHSD 5I19H 3BWAB 1BEYL 5T1DL 2APWA 2PTTA 2ZUUA 4KJQD 5DVMA 5IWLC 1FH5H 3EO0A 1I7RA 5F7KC 2JK5A 3A67H 4JDTL 4MQ7A 3RGVB 4R0LB 5FO9A 1IM3B 1U42A 2P7TB 2W65B 1V5JA 3NZ8A 3PIQA 3UTSB 1S3KH 2C3HA 1T0NB 4RBPK 1E6OL 4UZGA 3PNWA 3MXVL 1MVUA 3IJHB 1MEXL 5FGCE 3WS6A 4NGHL 4F9PA 3WSQL 4WWKA 4YNYA 3O81A 4DN3H 1BD2A 3IFPA 4G8GA 5C0JA 3QG6B 3MLZH 4OD3L 3RIAF 3UTZA 3BEVA 2A0LD 1KPVB 1NEUA 1IAKB 3P4OA 1E4JA 5J6GB 3FQTB 3MYJA 3D69A 1FGNH 4JO1H 4LCWE 5KW9H 1ZT1B 2ZP0T 7FABH 1N4XH 4KRPD 5GRVL 1FVEB 4JLRA 4KGLA 3MO1B 4Y4FD 1DBML 1WZKA 1O7SA 5A40E 5FECB 3QA3B 1MY5A 1CFNA 3IDNA 4KAQL 3JVGA 1MQKH 4OZFB 3ZHLA 3KPNB 1N64H 3MBXL 4P4RB 5A2LH 3ARGC 4YDKH 2A83A 5J6HA 2Z35A 5K59F 3EDKA 2X4UB 2VJXA 4NC1E 3IKCA 5ILTH 5JIKA 5E70A 1GHFH 1NUNB 4ZAKC 2Z93B 3PF2A 1BVZA 4K3GA 2R29L 3M07A 2UZIH 5F7HA 4Y5VA 4Z7QF 4PS4H 4HUXA 4XTRD 1MPAL 3O6FC 5LQBH 3UZEA 4LFHD 1NLBL 4OKVA 2EYRB 4FQIL 1TNNA 2ZUXA 1H5BA 3CGTA 3N1QC 3N9GH 1FAKT 1KCVL 3DX7B 3TWCL 1NBVH 2DLFL 3FB6B 5ITBL 2V7HA 3EYFA 1KG0A 1RZGB 3FB7A 4IJ3C 4FQJH 2ICWA 3AMKA 3FCTB 3OKEB 4KZDH 4KGJA 4AQ1B 3S98A 3TIDB 1N6QH 2IH1A 3B3IA 3PG2A 5JXEA 4UT9H 2IBZX 4JPKH 3VFWB 4M48L 4ODXA 3U0WH 4YE4H 1F2XK 5EO0B 4TTDD 2ADFH 1MAML 4WFGD 3TGXA 3NOIA 3F7RA 5DA4A 5CUSH 5TE6H 2W9DH 1DVFB 1BREA 4X4XB 3RRQA 4CN1A 1KB5L 5IK3B 3RHWF 1GIGL 3T3PF 5IFAL 3DV4A 5T3ZH 4HMDA 5FGSA 4LHUB 3U2SB 5HYSB 3RY6C 3GMPA 1V3LA 3HI6L 1QRKA 4JFEB 2DD8H 3O4LB 3W2DH 1P69B 4HUWB 5DUMH 3QPXL 5KS9E 4HQQL 4XXDA 3ULVC 3HR5A 1LO0H 5SWSA 2VUOA 1EH9A 1ORQB 3WNNA 3C5SB 1QLRB 3RUGE 4WCYL 2ZOKA 4TSCH 3T4YA 3GMOA 5CHNB 3OX8B 1CDHA 2PCPA 2L7UA 2R2BB 2AJSH 1Z9SA 5C08A 3IKKA 1T3FB 1DN0B 5IVZA 3A0OA 4HKZA 5CJBA 2NY1D 1IRAY 4KK5D 5EOCH 2R0LH 2P8PA 3SPVA 1XZ0A 5E7FA 4M61A 3OF6D 4OGAD 5CP7B 4NKMA 4PG2C 5IESL 3U7AA 1N6UA 3R4DA 4LCCB 5IG7A 2HG5B 4HW6A 1C5BH 1IAIH 1T66D 2LU3A 2RAMA 6FABL 4OIIL 5BS0D 4KI5E 1GVIA 3L3DA 1RUKL 2VDLL 4KRPB 5HSFA 3JWNC 1E4WL 4N5UA 1UB6A 4PP1D 3RWHA 5JUEH 4TUJB 2ESVA 1EJ6A 2EECA 5CBEB 4NQEA 1FNFA 4WO4A 4XAWL 4N0FB 1NMBH 3ULSB 1YYLL 4X9GA 1CG9A 4XCNA 2B1HL 4PJ5B 5EC2A 1Y18B 1QKZL 4NC0B 4HF5H 4B50A 5EOQH 4XVJL 2DQEL 4MXVE 2ZSVB 1CIDA 4C4KO 5IB3B 5I6XC 1R3IL 1JK8B 5GRJH 1U8LA 1T4KB 3PHQA 2FIRT 3DX9B 3UPAA 1IGIL 3NIFF 1A02N 2ENYA 3C2SA 2P45B 4GXVL 1BZ7B 4LQFH 1H0DA 1J0HA 2NYYD 3VFMB 1MI5A 5EPMB 1YECH 1A6TB 2GTZA 5F7LB 1S7QA 3QIUD 1FG2B 2P5EE 1U93B 1UZ6F 4UI2A 4M6MH 3OBAA 2PW2A 5I1AA 3ULVL 2H2SC 4NOFA 2ZUQB 5D71L 5IT2H 3C08H 4JM4L 5C9KA 1DBKH 1DEDA 1JYVA 4MA3A 3KPRE 5JW4Q 1W2KT 4H25A 4ZO9A 4R90H 3MLTA 3QYCA 1I1YB 4BSVA 3I84A 1BVLB 5EUOF 4OZGE 1T03H 4NYLA 3Q5TA 3BE1L 3TIEA 3L9RA 3WO4C 4D9QD 4TQEH 4KQ4L 3TO2B 2EDEA 1G7QB 2X4OA 4NRXB 2D0GA 5E2JA 3SE3A 2WUBH 3RTQB 4HK0B 2DMBA 4NDMA 1FRGL 1RZIA 2G2RA 3KLHD 1MFEH 4PJFA 3BFOA 4NKIH 4NNYB 3W0WE 4DKFL 5FFLA 5KSVA 1FL3B 2EDBA 2Z0BA 4GW4A 3TBSB 4EIGB 1BD2D 5F9WB 4U1HA 3ARDD 4UIKL 1BJ1J 1Q9WB 1F11B 2VDRH 3TBTA 4RFNB 1WBYA 3O4LE 5HD8D 4L5FL 3VFTB 4I1NB 1K9TA 3BDYH 4LVOC 5SX4H 3KPMA 3RKDD 3MODH 4PJCB 3MACL 4LSPL 4K7PX 2E9JA 4J3TA 5B39A 4GMSH 3A6CL 3ZYJA 2DJSA 5BS0B 4F7EB 1Q0YH 5DFVD 3EO1A 5D1QC 5FUZH 4YQXH 3FO9A 3GM8A 2MOVA 5KAQG 3BP5A 4P23A 4J3VA 3H3BC 4ZD3L 4JDVB 4TVPD 4WGWB 2C3VA 4QY8B 4EUPB 3BPCA 3V2AR 3SDXA 2MPAL 5AEAA 4MXWL 3LDBB 4P4KA 2XWTB 5DMKB 4YDVB 2AAVA 4LARH 4YHYB 4WHTA 4FFZH 5FYLD 2NCMA 4EBQH 3LH2L 1CGSH 1MIMH 5FUOL 1UQSA 3KS0J 3B2VH 4XXCC 1HYSC 1PZ5B 4G6AC 1INEH 2YS4A 2A9MH 3C6LA 3LQZB 4NQUA 5KSBE 1VESA 1CE1H 2MJWA 2Q8BL 4MAUH 4XI5D 5JDSB 1T04A 1BVKB 1YJDC 3QULB 5BQ7A 4MNGE 2E8ZA 2FL5A 1ZT7A 3PJSA 4PJ5E 4QWWD 5IFJB 1MCKA 3WLWC 1YQVH 2BVQB 1MCFA 1J0IA 3HNSL 1GZQA 4HBCL 4GKZA 4Z78B 1JWSB 3OGCA 4OM1H 4GMTL 2LU4A 3MRPB 1ZEAL 1EIBA 3KJ4B 2QR0B 3EJYD 5FYKL 1WV7T 1AKJA 4J3WA 4HWEL 3IDJB 2DM3A 3T3MF 2PTTB 3T77B 2VAAA 5SWSD 3INUL 1I7RB 5CJ5A 2VZTA 1LK3L 2KUTA 2X1OA 4FS0A 1EVUA 2JK5B 3SCMD 3T0EE 4MQ7B 1PLGH 1UA6L 2YD5A 4LBEA 5FO9B 1LEIA 5I1HH 3BRFA 3PIQB 1G7PB 5C08D 1EZVX 3MLVL 5TDPA 1OQXA 1RI8A 3PNWB 1CFSA 1MVUB 4M7JL 3ZLQC 5D72H 5K9KB 4WWKB 2NXYC 4YNYB 5F7WC 2G75A 4NUGL 1WITA 1BD2B 4P57A 1EGJA 3IFPB 4G8GB 1OT1A 5C0JB 3UTZB 5E6YA 3BEVB 5D2NC 3ROLB 3P4OB 3F7VA 3R0NA 4UB0L 1A1OA 1CDJA 3MYJB 4Q58C 5DMGD 3TNNA 3BQUB 4FQXC 5SWZE 2C3GA 5F6HJ 4JLRB 2WBJA 5HYJA 2QKIA 4XB8A 4WV1B 1CFNB 3IDNB 1U6AL 2HTKD 4HXAL 3LKNA 3LD8B 4S1QL 5GJTH 4XPHL 4NJAH 4Q9CA 3IVKB 3TM6A 4NQED 2A83B 5J6HB 2Z35B 1CK0L 2W0PA 3IKCB 3SDAA 1UXWB 3HG1A 2JTDA 3GUTB 4L1HA 3TT1H 1YJDL 4J6RH 4HX1A 4DZBA 4EXPX 4HUXB 3X12A 3TN0A 4PJCE 3OXSA 4GAJL 2FO4A 3HMXH 4OGXL 2VWEC 3VW3L 4Q9RH 4OKVB 4JY4B 2R2HA 1IKNC 1F2QA 1H5BB 1KIPA 4OGYL 2DM4A 3DVGA 4HC1A 1P5UA 1P7QA 2V7HB 4PJDA 3EYFB 1KG0B 1T5WA 4CU7A 1W72H 3RZWA 4RDQG 1CGYA 1MI5D 4OCYL 3FN9A 4FZEH 2CKBH 1RZJC 4ODBD 5I30L 4OB5L 1JGEB 2CSPA 5IB4A 2DYPA 1PZUB 2IH1B 1J1XL 3B3IB 1T7ZA 1KSRA 3DROA 4QYOA 2IMNA 3C8KA 4XP9L 4YDJA 5GGUA 4ODXB 3LQAH 5AYUL 2XTJD 3MOAH 4PGEA 5CGMA 3BP7A 3HZMA 1BIHA 5I1DA 3OTTA 3A6BL 5JR1H 1G6RA 3VA2C 5F9JA 1IARB 4M7ZB 2DQCH 2DQIH 4WEBH 4J3OC 4QXUL 3DV4B 4XX1E 4OF6A 4CDHA 1D3CA 1B6DA 2P42B 3HUJA 2YWYA 1NJ9A 3I6LE 3MV9B 3W11C 2V5TA 1JWUB 5EB9A 2RCSH 1GOHA 4NZRL 3BHBB 2HWZL 4XXDB 1EA9C 3NABL 3QWOA 2HJFA 4ONGL 4HSQA 5F21B 3AXLA 4KJPC 1FL6B 3C2AL 4UINL 1C5DB 3QDJA 3T4YB 2IALB 3GMOB 4PTUA 1PG7H 3ZKMC 2PCPB 4U0RC 5BJTB 5C08B 5C2BH 3O9WC 4NZTL 5FA4A 1FFNB 4NUJA 1MOEA 4N0RA 1JGUH 2AJ3A 1DQJA 2IC2A 5IVZB 1JNJA 5JHDE 4HKZB 1NGQH 2JE8A 2VMFA 4WDIB 5JA8B 3DJ9A 1L0XA 3EFDH 3V6OC 1NAKH 4YZFF 3DRTB 1A21A 2P8PB 5E4EC 3SPVB 3O41A 4OF0A 1L6XA 4NKMB 4KJWD 1LP9A 1E0OB 4LDLB 1AO7A 3U0TB 1XGYH 3NCYS 4KVNH 1DL7L 3ZT6A 3R0MA 1JE6A 3L3DB 4DW2L 2J6EA 1D5XA 4IMKC 2BOBA 3HAEA 4NQXA 3RWHB 3MRJA 1LO3L 2ESVB 4XWGL 2VDOH 1L9MA 4P23D 3OJMB 3IFOA 4G3YH 4LPCA 3NCJH 1CXHA 5DUBB 4XH2A 2HMIC 1DQTA 4NQEB 4UNTA 4G8EA 4WO4B 2QSTA 1JPFA 3TO4C 4G8GE 4YC2C 4TPRL 4P4KD 2JCCF 1RZJL 1CG9B 4XCNB 3LPGA 1P5VA 2D9CA 3D85D 3WFCL 25C8H 4LIQH 3S36X 4GRLC 3FMGL 4UV4L 4NT6A 3S34L 43C9B 1F58L 2B39A 3C8DA 1PBYA 3ARQA 4KV5E 4X6EB 5DJ8A 4NNXB 4KMQA 3O6KH 4YFLF 1U8LB 3PHQB 4EOWL 4QNPE 4RGMB 3KNBA 1OTUD 2HAZA 5EWIL 5L2KE 2FJGA 2HFTA 4EDXA 4X6CF 3VXOA 1H0DB 1FZJA 7CGTA 1BFVL 2VKXA 3CCHB 2ADIA 1MI5B 4FQCL 4HWBH 5LCVL 1E4XL 3FHAA 2GTZB 4JQIL 1S7QB 1HCFX 3BZFA 1F6LL 2J7LA 4MA7L 3CMOL 5I1AB 1AC0A 2XTJB 4K9EC 4JCMA 2QEJA 4Y1AA 1BJ1H 1EFXA 4MA3B 1EO8L 2Y06L 4H25B 5F9DC 2VABB 5DC9B 1HZHL 4CJ1A 3MLTB 1UFUA 4AMKL 1AKJD 2IAMC 4BSVB 2OR8A 4W6XB 3ES6A 3IJSA 5KJRL 3W81A 5F89A 3SDDC 4HZAA 5C92A 1IEAA 3TIEB 3L9RB 2NXZC 1I9IL 4KK8D 4Z9KB 2X4OB 4U3HA 1HHJA 2LAAA 5TH2B 1IVLA 3CDYA 4NDMB 5GS0D 1RZIB 4HAGA 2G2RB 4PJFB 4MJ6A 4K8RC 4YPGA 5IR1A 1II4E 3GMRB 5KSVB 3HMWL 2XA3A 1OSPL 2ZPKL 5EU7C 4GW4B 2YD1A 1CQYA 2R23B 4OQTA 2R9HC 4X7EC 4KVCL 4HS6A 3EKCA 5IBTH 3NACH 1QYGL 3I3EA 3K8LA 4Z8FH 3MV9E 1WZMA 3KS0H 1WBYB 3QFDA 4RWYH 1T0MA 1AD9A 3QQNA 1R3LA 2XRAL 5BO1H 2HN7A 3UAJC 2J5LC 1ZS8B 4ZS6D 1XIWB 2WBJD 4Y4KA 2WP3O 5HYJD 5HI5D 4YR6A 5IBLD 2GSGA 2Q86A 4LVHC 1MRFL 4XPGL 1FLTX 1U8NB 2GEEA 5E56A 3EO1B 4TNVF 2ZJSH 2Q7YA 3FO9B 3NPSB 4AZ8A 3P9MA 3KYOB 1CD8A 3BP5B 2Z8VC 3VG9B 3HG1D 2NY4C 2I26N 4KH2A 4WHCA 2VXVH 2C3VB 3FFCA 1A9EB 3BPCB 3SDXB 4DVRH 1IGTA 4QXGH 3WXVH 4P4KB 5EA0H 3TN0D 4R2GB 4YHNA 1JHLH 3GMQA 4N8CH 4MWFA 2X4SA 5JO5B 5DJ2A 5F1SA 5IBUG 1UQSB 3EO9H 3RDTC 4K9EL 2DBJA 3C6LB 1AXTL 5HPOA 2E9WA 3RGHA 3TV3H 1EUTA 5J57B 1WFUA 1L4IA 2BRQA 2DYPD 1T04B 4U4BA 5A16B 2QQKL 4Z7UA 4F37K 5BQ7B 4TUOA 4ELMF 2FL5B 1ZT7B 2OZ4A 1FYTE 1CDGA 3O4OB 4XVTL 5EU4A 3SDYL 1OCWH 4YFLI 5EZLB 5I19L 1GZQB 3ARTA 1MCPL 4GKZB 2W9LA 1KXVC 4LPXA 1UH3A 4HUVA 1JPSH 5CINH 1JZ6A 4QHLA 2CDEA 2DLEA 1M05A 2VDMH 1GYAA 2VAAB 3RY4A 2GJZB 3GBNH 5CEZL 1GGIH 2QHRH 3VXNA 1INQA 3FOMA 1A3RH 5LGKA 4LBEB 2L7JA 1LEIB 1J1PH 1MH5B 3S35X 2OTWA 3IB4A 4O2CA 1MIEH 4DN3L 3EYSL 5TDPB 1NPUA 2V5YA 4Y2DD 2QADC 3GRWH 1B90A 2LTQC 1CFSB 1KFAH 2PXYA 2MCPH 1KOAA 3UPCA 2ICWI 3PGCA 5KW9L 3MLUL 2SEBB 4P57B 4PJHE 3PABB 7FABL 4Y4HA 2X9WA 4Z7NE 3EJZC 2ZSWA 3F7VB 2ADGA 1AO7D 3CXDH 1A1OB 5H2BA 5MENB 4BJLA 4G9FA 3GSOA 2AJVH 5LJYH 1MQKL 1CLCA 3TNNB 1T0PB 1N64L 2YUZA 4YHZH 2RIKA 4PJFF 2WBJB 2Z92A 2QKIB 4RZCB 3BYYA 1GHFL 3UTQB 3LKNB 2F53E 4QO1A