3BQUB

Crystal structure of the 2f5 fab'-3h6 fab complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
231
structure length
214
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIVNAMDVWGQGITVTISSTSTKGPSVFPLAPAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLTCNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between the F(ab)' fragment of the cross-neutralizing anti-HIV-1 antibody 2F5 and the F(ab) fragment of its anti-idiotypic antibody 3H6.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 2F5 Fab' light chain
total genus 36
structure length 214
sequence length 231
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquB01
4F57L 1H3UA 3RPIB 3GBMH 4J3SA 1CXIA 4H1LG 1ADQA 2ESVD 4MCYB 4ZFGH 3VA2C 3MRCA 3UTSE 4LCIH 4AQ1B 2CKBH 3P30H 2YC1B 5B22A 2E8YA 5IB1A 4G3YH 3QAZC 2IF7A 3PWPD 1HOCA 3GRWL 1CG9A 5D1ZA 4NKOA 2IMNA 3TGXA 4K8RC 5C6TL 2YOCA 4QNPF 5KAQG 3QDMB 4G7VL 1IAIH 1Y18B 4NUJB 2Y6SC 1UEMA 3WCYA 3VG0H 2R29L 3GMNB 3C5SB 4HS8L 3U0TA 4KRNA 1U92A 4GT7A 1YNTA 1X3DA 3BZ4B 1BIHA 3O3DA 3CH8A 2EDFA 4OUUA 3P9LB 3VXOA 4I5BA 3ZKXC 4I77H 2H8PB 3A6BL 3RJQB 4HBCL 5FA3A 1JZ4A 4GG6E 3CLFL 4FQ1L 5SWQB 1ROWA 1FGNL 2NY7H 3WIIH 3HLAB 4FNLL 5DEZA 3NIGE 5CHNB 3TEUA 1GGTA 4JFHE 3ULUD 1NSNH 4U1LB 2ZP0T 3IDXL 1LO2H 4XGZA 3RNQA 2AEPH 2OTWA 5T1DL 4HLZG 1EJOL 1F3RB 2OL3B 1OAKL 5DRWA 2B1AH 5HYEA 4QY8B 5DRZB 2J5LC 2A1WL 4QXGH 1CL7H 2DIJA 1FNSL 4PJ8A 1LVEA 3WXVL 1RIVL 4F2MB 5CBAA 4OUOA 3ORJA 4LHUA 3QPXL 4OV6F 5GGTL 4YHLL 1JZ8A 1IGML 2VLJB 1MPAL 5HDQL 4DGVL 1D9KD 3NPSC 4NQEE 4Y5XC 3O3BA 1AHWC 3WNLA 5EO0A 3RVXD 1BLNB 2V17L 4NO0A 4WFEE 4KK5C 4H88L 5I16A 1HH9B 4OKVB 4XPTH 1EX0A 1NFDF 3UJTH 2KKQA 3OPZH 1NC4A 3SKNB 5KSBB 4Z7NE 2DDQH 1LP9E 3IU3A 4JM4L 4QWWC 2D03L 4RQQB 2I9LA 5CEZL 3RI5F 3FONA 1HHJB 3AC0A 3EOTL 3GMOB 3OKNB 4U2ZA 1HINL 5C0AA 1U2HA 4N0YH 5AWNL 3RTQD 2X40A 2VL5B 1BMGA 2P8PB 4RDQG 3O3UN 1MFDL 5F9WB 4EXKA 2W60A 2DM3A 4ODTH 1BOGB 3X11A 2UY6A 1CXEA 4M7KL 4DZBA 1S7SB 3G04B 5KZCD 4MDJA 2HRPH 5JOEA 1KELL 3B9AA 2DICA 2OJZL 4YFEA 5IB3A 1UXSA 3DUUA 1Q1JH 1DUYB 4WW2A 3UTTE 4OB5L 3FO2B 1WZ1H 4LPTA 3VDAA 1PKQE 1QR4A 2VR4A 1HCVA 5ETUA 4YC2B 3O9WD 2VISA 5I1IH 3U7WH 2R56H 3R0NA 4NQEA 1UB6A 2AJSL 3ROOA 2AXGA 3FN9A 1EO5A 4Z7WA 2AKRB 4QWWD 2EDDA 5MEPB 3M8OL 2Y07H 1QRND 4GAJL 2Q86A 3BH9A 3JV6A 2AJXL 1T7ZA 1P4IL 1TVBA 2A74B 4ACPA 3VWKB 4XPAH 1BVLA 3MGTA 4JQVC 2RFXA 2SEBB 2VIRA 4PBWD 4KJYA 1OP9A 4I0PA 3SJVB 4X4XB 1YMHB 5BV7L 3VCLB 5J0BA 4A6YL 4X5WB 3OR6B 4HQQH 2F54A 3MJ7A 1RIHL 4MLIA 5JORA 2XY1A 1O0VA 4LAQL 4HT1H 4PRPE 4P3CH 1S7UA 3O8XD 3CK0L 3KPPA 3O11A 4TULL 1HYSC 1ADQL 5IB5A 2E9BA 1NCBL 1OD7A 1A21A 1IEAA 4PG9B 3ES6B 4G43A 4MXQD 4L8SA 3UAJD 1JIBA 3KPSD 3R8QA 4OM0L 2VKWA 4TTDC 3ZTJG 4HMDA 4U1SA 2CLZA 5T3ZH 4XNMB 2WQRA 3V4UH 4U6VL 4WHDA 2NXZD 5GSRA 5B38B 1M4KA 2EYRB 3LZFH 4PJIF 3U4BH 1D5ZB 1B0WA 4XC3H 3BZEB 1DE4A 2DWDB 2VL4A 1UM5H 4MB5A 4YPGB 3WNNA 2EIZB 3OJ2C 1N8ZA 5BRZE 2BNQA 1HDMB 4LHQB 4HIHA 1QKZH 4HDIB 1OW0C 4P5MB 4W81A 1CDGA 1KEGH 3CUPB 3P40A 1JYXA 3PDOB 4JFFA 3QWQB 2ZSWB 3T0EE 5AG9A 1QFUL 5JW5A 2C3GA 2NY6B 1FJ1B 4ZYKA 1T1WB 3DSNA 3JTSB 3I2CL 4RGOL 2HT3C 4BUGA 3L5XL 1JHTA 2D7MA 4OF3A 3ZSSA 3DLQR 4R90L 4FFYL 5D7LA 5CAYB 2R1YB 4A2MA 4LDLB 5FCUH 2NTSP 3GBNL 5F97E 4JRYE 5CIPH 3VFGL 3S5LG 5GRVL 4ETQA 3TVMB 3V0VA 5BVPL 1BWWA 1C12B 3HI1A 3U36A 3GSQB 3Q6FA 1U8JB 2VTFA 2VLLA 2DYPB 4ZNCD 3RVVD 4UQ2A 4WUUE 3HMWL 3P2TA 1JI2A 1QPPA 4MXWH 4NN7C 4MDIA 5AZ2L 5HDOA 5IMMB 5ANME 2E27H 3ZDZE 3WSQH 4MQXD 3ARGD 3QDJD 2VOTA 1MY7A 4HUUA 4IHOB 4PRHB 3PDOA 3AFLA 1NBVH 4U7KA 1FDLH 4U1KB 4D3CL 5HYSG 5D1ZD 3W2DL 1QSFA 3UTQB 3L3OB 3WBDA 3DMMD 4Z7UE 1MUJA 1LE9B 2WM0A 1GL4B 2NTFA 3F7PC 3WS3B 4PJHF 1IGCL 1R0AL 4G7YL 2OX5A 1FAIH 1VCAA 3QXAB 1KTLA 2EE3A 5LBSH 3DVNA 4L4TD 4ZAKB 1EZVY 3CCHA 3QR2A 4Z7QE 2YEZB 4X7CC 2IC2A 4HBCH 4MS8D 4PG2C 5IP4A 4OSUL 3HNSH 5C0RL 4GMTH 5DUPH 1UQSA 5EBMA 5FGBA 2ZNWA 4EN3D 1G7PB 3W9DA 1F02I 1RHHA 1RZ8A 3WJLA 4YO0B 4JM2F 3WIHL 4L8SB 4C56A 1X4XA 3D9AL 3EO9L 5HHVH 4MGXA 3IF1B 3VXMD 2OI9B 4ZD3L 1RULL 4WWID 2UYLA 1BGXL 1A7NL 4LBEB 1S9XB 3P77B 5EUOF 4J1UB 1U8PB 4NJAL 1QFHA 5E8OA 3BUYB 4GRLA 4BSWA 4R0LB 3HS0B 1A1NB 4EXPX 3KYOA 1N4XH 2H45A 5T5FH 4PJ9B 1B6UA 4KMQA 4V1DD 4EJ1C 1NC4D 5KW9L 2V2XA 5FGCE 3VFSA 1V8HA 1PSKL 3GK8H 3IAQA 4L3ED 3F5WB 3IDJA 3D87B 2J12B 1NEZG 3HTLX 4P2QB 5J1TC 1EMTH 5DK3A 3ARWA 4ZUVA 4IRZH 3VI3F 4MJ5A 3RDTD 4PJEA 1HZHL 5BS0E 5FGCB 5BVJB 5F1KC 4DVBB 2DJSA 4F37F 5JQ6L 1A6PA 4NCC1 3IJSA 2VZTA 1N64H 1NC2B 1YY8A 1FFNA 4JPIA 3MV9E 3O45B 4HZLB 5BS0B 5C6PB 5IFJB 1FN4B 1DN0B 5JW4Q 3GBLA 5DMJB 5DUMH 5GZOD 1LP9A 1HILA 4M62H 2GAZB 3SO3B 3P0VH 4F57H 2EXWC 4WW2B 3BXNA 5F7EH 3EAKA 1V7NL 5A2KH 4MA3B 2J8UE 1I1YA 2GY5A 4HK3J 1QVOB 4C4KT 3L7EA 2AJ3A 1FL6A 4ZPVA 3SDDC 1IJ9A 2WW8A 4GAYA 4X98A 3WDJA 2CXGA 5B3JF 4HSQA 3TBWA 3MLSH 1BEYH 4OLUL 5ESQB 4PGDA 4IMLB 1I1RA 1S7VA 3BQUA 1NKRA 1ZT4A 3C6SA 3SQOH 2ERJB 4MCZA 2GUOB 1H8SA 5DQ9B 1BM3L 5CBEB 5B39B 4LPUA 5KOVC 4WI7A 1C5CL 2Q3AA 3CLFH 4PJFF 3X12B 4KVCL 5MHSD 3DBXA 1I7ZA 2AW2A 1GYAA 4RNRB 1KIPA 4E5XB 4KDTC 4YX2L 4HUXA 5EIVA 4NZUL 2HKHH 1FNLA 1MI5B 2X4NA 4MMXC 4PJAF 5D1XC 4NZRL 2FGWH 4OZGA 2F8OA 1I9IH 2N1KA 5IUSA 3G5ZA 1NCCL 4NIKB 3TZVB 2NLJB 3ETBF 1U3HD 4NKMA 5EO0B 5FYKH 3DURB 2EO1A 5EOTB 3MRJA 2ESVE 4ZAKC 3WFEH 5DC4B 1IQWH 4C57C 5C2BH 2O5ZL 5CWSA 3DXAA 4QTIH 4AK1A 3FB6B 2Q1EA 4KDWA 4DGIL 4OZGB 5GGTH 3T0WA 1TZHA 3PP3K 5IWLC 3SKJL 1OAQL 4KY1H 4NQXA 3NCFB 2YPLD 1IGIL 5HPOA 1P7KA 3N0PB 3OAZH 3BKYL 3QUXD 2EEBA 1HHHA 3S36X 3GIZH 4NQTA 3CIQA 3EHBC 2WBJB 4QXTB 3SDXA 3C6LD 3LRSA 4N8VG 5EORL 4UT9L 1UWGH 3HLAA 1U0QA 4HHAB 1U8HA 1RY7B 1U58B 2XZAH 3KPRA 1WIUA 4Y4KA 3GMMB 5CZVL 5FA3B 3GSUB 2VXQL 5FUZL 3GSUA 4LPYA 3T65B 3P9LA 5CJBA 3VXOB 1U58A 1KG0B 1NAKL 4GRWE 2E6QA 3UPRA 3O3DB 4XXDB 4JZOB 3Q2CA 1YNTB 4NC0B 3VXSE 5FK9A 1QFWM 5ICXB 3QIUC 3PP3H 4KKAC 1TIUA 4P3DB 1V05A 3C8DA 4WUKL 4QEGA 4KKLC 5IQ7L 5ADPL 4UIKH 1SJHA 3QUYB 2DBLL 4HWEH 4JFDA 5K93A 1OGTB 1JPFA 4M6AA 3UJJL 4JPIB 1P9MA 1Q9WB 5FM8A 3U7AA 3LS4L 4U3CA 4MXVE 5F88A 4B7IA 5IGXL 3H6JA 2FCBA 3IFLL 1EFXA 1GGUA 4NKOB 4M1CD 3TIDB 3MLVH 1HOCB 3HI6H 5T33L 5EOCJ 4X7EC 3RX7A 1DLFL 2CKBA 5MP6L 1MOEA 2A73A 4LLQA 2QKIB 3B3IA 5EUOE 3MJ9A 5DA4A 3C87A 5HHXH 4OZHA 2AJVL 3CC5B 1S78D 1JGUL 3T77A 3IKCB 3KWWB 3SDDA 2BK8A 4POZD 1HEZA 5FO9B 4HKZB 1S3KH 4X5LA 5I1DA 5F7KC 1QSFD 1HI6B 6FABH 1KJ2L 1KCRH 5HGDB 3HMWH 5DEFA 1JL8A 3DBXB 4P0DA 3EYFA 3K2MC 3SGEI 2YPLB 2ADJA 1MWAL 3S34L 2ZKHL 1UM4L 4H20H 3P77A 5I19L 3QUXB 2NW3B 4GAFB 3SDAC 5HHOA 4OM1H 2F19H 3PXJA 2DQIL 3QJFB 3P9MB 1ZS8B 1IGTA 3VGAB 5E6ID 4P3CL 4BFIB 5DJ2B 2IPKA 3ARFA 4JM2D 3CK0H 5AAMA 4PJEE 4U33A 3FQRB 3EYSH 1FC1A 3KAAA 3PWLB 3AY4C 4W70A 2EDXA 4OLZH 2MTPA 2ADFL 4K07A 4KUZL 1HSAA 3X17A 2XG4A 3D2UB 5JOFA 1DQQB 4JR9H 3CZFA 4PJAE 2D7TL 3STLB 3HG1D 5DUPL 2EDEA 2YUWA 3QZWA 4BSVA 4X8JB 3GSXA 4QF1B 3V4VH 1FGVH 2BRRL 3PP4H 4ONFL 1P5VA 4XC3L 3HI5L 5TFSH 4WHTB 1L4IA 1RJZB 5K9JL 4W4NA 4RGND 2Z92A 4IRJB 3KLHC 4OQ1A 3HE7A 4N90E 1OCWH 3VDCA 4AG4H 4YBQC 1PKQB 2RB8A 1C08B 4ZD3H 1QLFB 3THML 3R06B 4TULH 5B3NA 1JPGB 3OZ9L 2YBRA 2NNAB 5HI4D 5I1EH 3WUWG 5MEOA 3JBG7 1FQ9C 5SWSE 3SE9H 2ZUYA 3MV7E 5F3BA 4LCWB 3MRNB 1QA9A 5FGSA 3TH4T 3T8XB 2VDNH 3QUKA 1GGCH 3U36B 1MJJB 3MRHB 4Q9RH 3F7VA 5D7JA 1B90A 4CADB 4NDMB 3ZL4H 1OSZA 4G6AC 3MOQA 3LPFA 2WSKA 5JLZB 1S78C 2NX5D 3Q3GB 2VLRD 4HUWB 3KXFD 5F9WC 2R1YA 2H2PC 4RMSA 3BUYA 1EUTA 2R15A 2E9IA 4ZXBC 5I8EB 2IADB 1BX2A 2G75A 1JRHL 1SJVA 4AM0A 1X44A 2CRZA 3SGKC 2I26N 4LNRB 2JIXA 4CNIB 1WCBB 5GJSL 3X14B 4U1MA 5L7XL 4H0IA 2OZ4L 2DQJH 3OXRA 3P73B 2VJXA 5E7FA 4MQ7A 1G7IA 1H3TA 4PJIE 4NHCL 2JKXA 2IPUK 4KKCC 5FCSH 4RA0C 2BNQB 3GSOA 3TBTA 4JPWL 4MNHB 2P44B 3P9WB 3QWOB 1VHPA 2DWDA 4OZIF 2QJDA 4MB4A 3DX8A 4NNPH 5FKPB 3VD5A 3OV6A 3BKCL 5GSRB 4HIXL 1G7IB 1IAOA 5EB9A 4ZFZA 3HRZB 3ZTNL 2FB4L 3L1OL 3QHFL 4NQED 5DJXB 1EZVX 3BZDA 2GHWB 3ZE1F 3MYJA 4HS3A 2E6JA 2FX8L 3GKZA 3NMEA 3NVQA 4LNRA 5EC2A 3FFCA 1MFBL 4AM0B 3AXLB 3KPPB 3O11B 2DYPA 3TH3T 5GHWL 4Q0XL 1WWCA 1IKFH 4O5LH 5L8KB 3K74B 1YDPB 1XGQB 4KVNL 9CGTA 3TO4A 1BQHG 1I9IL 4K7PY 4EN3A 3IXTA 4IEFB 3ARFC 1RZFH 1Q9OA 4YGAB 5JMOC 4X4XA 3ZKXB 4PJ7F 4JE4B 1NBYB 5CJ8A 4CN4A 1UWXK 1AGFB 4G6ML 3PE9A 2P46B 3HRPA 1QA9B 1HK6A 2Q76A 4LSSH 2MSPA 3SDYH 4LSUH 5ADOL 4O02L 1CU4L 4RX4A 2XQBH 4FXLA 4WFED 3UCRA 4PLOB 3QQ9C 1JPGA 2BNQE 1OQOA 2OTPA 3AMKA 5T3XD 3PL6D 5DQDL 4DGYH 4NZTH 3JV6B 5KSVB 4JFFB 1J0KA 2HJLA 1T0NB 1OB1A 2YUZA 3V5KB 1NEZB 1R6VA 1N5YL 2AXGB 5E08L 3B9KC 2V5TA 2P8MA 5C0JB 4HDIA 1PG7H 1XF3B 4MJID 5E5RB 3ULVE 1A6VH 1G9NH 4PGCB 4ELKB 3NIFF 2F54E 4DKDC 1JV5A 3VMPA 5IEHB 4BSVB 1YEJH 3RGHA 1QFWH 3AS0A 2D7PA 4OBSA 5IBTL 4NBXB 4U6YA 3HNVL 3UBXI 5GZNC 3CZJA 5IVOA 3HZMB 4EIZC 1F6LL 1IMHC 4PRDB 1ZXQA 4JFDD 4WFGD 4C58B 4D0CA 5IIEB 3U1SL 3PWNA 4GUPB 2IBZX 1Q94B 5SWSA 2IGFH 4GKNA 4R26L 2BNRA 4G8GE 2MMXA 1UJ3C 4AEHL 2R9HD 3DETC 1KJ3H 4BH8B 1JWUB 5FKAA 4RRPG 5I1LA 2HN7B 4KPHL 1EK3A 1S7UB 2IAMD 3T0EB 3WFCH 3GMLA 5I75B 3MX0A 5I1HL 4HKBB 2B4CL 4I3SL 5I76A 2E5EA 5LGJB 3DXAE 4X5WA 1EVTC 4OF0A 3T2NH 5HY9A 2O5YL 3MLXH 2I27N 1TQBC 4GW5B 2GCYA 4QOKB 4XCYA 1YMHA 3M17A 2NW2A 2IQ9L 4I8DA 2FJGA 1LNUA 4NYLA 3EKCA 5H37H 1ACYH 2BHYA 2ZCHL 4NO0B 4LDEB 1F3JB 3LH2L 1A6TB 1MAMH 3VXTA 4YX2H 4LSRL 5HBBA 2E7LC 5E9DE 1FZOA 5GGQH 1B3JA 5I1JL 2VQ1B 3MXWL 3LKSA 3MLSL 3BYTA 5SWZA 5D7LE 1QR1A 4KTYA 3VWJC 3FRPG 3OHXA 3MRGA 4HFUH 2IJ0C 5IFAL 3GRWH 3IJYA 2F9BT 1K4DB 4PB9H 1S7WB 4UINL 4WHYH 1A3LH 4YLQT 4K23L 1W2KT 4BELD 3PG2A 4QHMA 4P9ML 4ELMF 1D5BA 4Q9QL 4JFFE 3OMZA 5TF1L 3RIFF 4JO3H 1UWEH 1X7QB 2DAVA 2V5SA 4XB7A 3BP4B 1AGDB 4HF5H 4DZ8B 3S36H 1CE6B 2W59A 3T65A 4NM8H 4XP5H 1CIDA 5AEAA 4PUBL 4OB5H 3RL1A 2BOCA 3WS6A 1XF4A 1U8HB 1CT8A 5DMGD 3RWFA 4WV1A 1RIUH 4KXZI 4MJ6A 1A5FH 3BZ4A 4G9DB 5EU3B 4H8WC 3SDXB 2W9DL 15C8L 2MFNA 3VD3A 5J9PA 5ILTH 1N6QL 5E24E 1M05A 1Q0YH 1QBMH 2DQEH 3UC0H 2YN3A 3UROR 2KH2B 4MZ3A 3H42H 5F7DB 2WUBL 4OGXL 4JHBA 3ZKNC 4L9LB 1YEKL 4KQ3H 2VZVA 1U91A 3I6LD 1LO2L 1WBYA 3MLYL 1G9MC 1WITA 1FYTA 4EUPG 3DXAB 1GGIH 4BFEA 1CG9B 5I1KH 4R96A 4OZIE 1N3NB 4CAGA 2ZCKL 4FZEH 3DV6A 5KG9A 1YEFL 4PRHE 1T21B 5CZVH 3VXPA 3M1BB 4PGBB 4O4YL 3HG1B 4F7EB 5IB1B 5F9JB 4PPTA 4Q2ZB 4PG2A 3S8WA 5CBAB 1NMBL 3DECA 5AYUL 1XGRB 4NJ9L 1Z9SA 4R6UA 4X6CB 4XPFL 2JCCA 4BZ2H 1RZJL 1L9NA 5JW4R 4HKJB 1EHNA 5HHXL 4MHHI 4PJ5E 1MAKA 1JGEB 5ALBL 1XF5B 1OTTD 5GS0H 5DK0B 4WWKC 1OGAB 4UQ3B 2AK4E 3I6GB 4WEMB 2EDWA 3IDNB 3DVIA 4WWKB 1YNKL 4CU6A 3C6SB 4GRLC 2P5WD 4PGJA 5SWQA 4YBQD 4RGNC 4JG1H 4KK5D 4HJ0C 4JRXB 1OARL 3TBWB 3P11H 4PJCF 1ZLVH 1B2WL 5FXCH 1CYGA 3EYOB 4OZGE 4GXVH 5C0GA 1RZ7L 1X5JA 2AXFA 1HXMA 4XVTH 3RY4A 3NCMA 3GBML 2ZUVA 4HX1B 5FECA 5JO5B 4KV5E 1AKJB 3DUSA 4M3KB 1B4RA 4M5YL 3INUL 5T1KB 1U6AH 5IW3A 1HILB 3MNZB 1U8MB 3C08L 5DVMA 2EYSA 2VSDA 1GZQA 1F97A 1KENL 1BQHB 1OWWA 3ARXA 3P4MA 3ARPA 1YY9C 4EVNB 4O2EB 3T3PF 4MJIE 5IFHL 1UVQA 2FJHB 3OKOB 5AWNH 3RKPA 2XKNB 5IJVA 2OR9L 1J5OH 1H3VA 1OY3B 1BAFH 1KB5L 5BO1H 4QHUA 3U46A 3D0LA 5I0ZA 4W68A 2IH1A 4Q9BA 1UACH 1MJUH 5ISZE 4UT7L 1RZFL 1K6QH 4I4WA 4XNUL 1M7DA 4YR6B 4ZNEA 1EERB 1X5IA 5FOJA 1OWRM 3D39A 1G0DA 5TQ0H 4XPGL 3NA4A 4PJXA 1MCWW 1W72B 3ZYZA 1SY6H 3RPIA 5ECJE 1NUNB 1FO0A 1MCOH 2G60L 1A4KA 2VXSH 4JY4A 1A0QL 1U42A 4X5XB 2XQBL 3MV7D 1YA5A 2XT1B 1J8HD 1OLLA 1GZPB 3QDMD 4A6YH 3BN3B 3ULUF 3Q5TA 1EH9A 2YWYA 1S5IH 3B2UD 3QDGD 1G0XA 4NRYA 1JNLL 5DJYB 5HYSA 12E8H 1CK0L 3FQXB 4HLZH 4WCYH 4WWKD 2L0DA 3JV4B 2Q8BL 4JO4H 2XQYK 3O8XB 1A6VL 1G9NL 1A3QA 4H1LH 1J8HB 1UVQB 2FJHA 1S9YA 1NCBH 2IALB 2FHCA 1ZGLA 2ITDA 5I1EL 3T3PE 2JJTC 1A6ZB 4EVNA 2DQJL 3K81A 4PJ7B 1EGJH 2XZCL 3NBNA 2DQTH 5B8CB 1IC4H 2VC2L 3D6GA 2BSTB 5T3ZL 2XN9B 4U2YA 1P6FA 3LHPH 3BPOB 1R3LB 3QH3B 4RWYH 1I1AD 1YEEL 4BQ6A 1MJ8H 2XV6B 3O2DH 3QHTC 4KU1A 3EYOA 4KMTL 4UU9A 1L7TL 5HHVL 4PJCB 1HNGA 2BSED 2WWKO 4PJDB 1DANT 2J8UF 3RX8A 3DMMC 1C5DB 1OGAE 1I75A 1BF8A 1WEJH 2BCKB 2DM2A 1TQBB 2GSGA 2ENYA 5MI0C 4ZMAT 3ZO0A 3GO1L 2DD8H 2AK1H 5KS9A 1HN1A 2BOBA 5I75C 4XMPH 1RUML 1J0ZA 1CFNB 1LO3H 3HCVA 5F93C 1CDYA 3GSWA 5LAXB 1WT5A 3MJ6A 1BF2A 5CEZH 3I2CH 4RGOH 3HI1B 4Y4FA 3L3HA 5SV3A 4ZO8A 4NHCH 3U4BL 1PLGH 2CDGB 3I85A 4NO5A 2GT9A 4KHXH 5D72H 2APXA 5GGVL 3OJVC 2GJ6A 3QT2A 1FFPA 3LCYA 2IBGA 1L0QA 4YAQB 4A2LA 1UADC 3ZMRA 3G9VA 3NCEB 3C09B 1KCKA 4XP6H 2P43B 4O51A 3SCMB 2X4SB 1TVHA 5IM7A 1AO7D 2IPUG 1XGPA 4H8WH 4G80A 2P7TB 1CLYL 1VPOL 4JRYA 1T1WA 2P24B 3DO3A 4FFZH 4UINH 5DO2D 4S0TD 5JW5B 5DFTA 2Y4SA 4CJ1A 3IXAA 4K3JL 5DUBA 4WO4A 3TPUA 4HS6A 2XA8L 3CVIL 4WHYG 3LIZH 2ZUTA 3IDGA 4FQLH 4P49A 1KTDB 1HDMA 1C16B 2KL6A 5ANMB 1R3JA 1M6OA 4FTVE 4OZHF 1KN2H 4Z7OF 1ZHBB 3QI9D 2EIZA 3M8OH 4D8PB 3BPLB 5F7YC 4Q9CA 1DE4B 2XACC 3MNVB 5ESAB 3UZEA 1MLBB 3C2AL 1EHLL 4JKWA 3EDKA 5D5MA 1I1AB 4LLUA 3WHXB 4FQJL 2Z31B 3RUGF 2PXYA 1PZ5A 1I4FA 3MPCA 3QFJA 4LGPB 4UOJA 5D7IA 3ES6A 2GK2A 3LQAL 5GZOC 4M5ZH 5C08A 3U4AA 1JWMB 2NY0B 4ISVB 1OQXA 5JORB 2YPLE 3GI9L 1KLUA 4KHTH 4NZRH 2AQ3A 3IGAA 4KRPC 1EEZB 3DROA 4FQXD 1WK0A 4KKBD 2NX5B 5DRNB 1HHGB 5I1KL 4H0GA 1HKLL 3NN8B 3P4LA 4F7PB 4KJYB 4ZTOL 3KYKH 1E4XI 1N2RA 3LEXA 1MEXH 4DQOL 3KDMB 4YWGL 3WO4B 4NKIH 4P5TA 4WI5A 3FMGL 1A7PL 2C1OA 3V8CA 3BIAX 1D5IL 2A74A 5J12C 4OCRL 2GFBB 4HFWB 4DN3L 3OAUH 3FHQA 1IGJB 4FQHA 1N2RB 3LEXB 1UCBH 1BQLH 5MEPA 3VGFA 5DS8B 2D3VA 2FGZA 3HE7C 2ORBH 5DHYB 3I6KB 5GISL 5MHSE 4XCYB 3CVHA 5J13B 4CMMA 2G5BB 4ZUSB 5LCVL 5EA0H 4QHNB 3WN5C 2AERT 4IBLT 2Q6WA 4F8TA 2DQUH 3V5HB 2XZZA 3UJIL 1F4XH 1JWMA 4Z8FH 4ZXBB 1WT5C 3FT4A 4FABL 3K3QA 4HCRA 5DXWA 3BW9A 4RZCA 3T0BA 4JO3L 2ZCHH 1G7MA 3NAAH 1F3DH 2Z31A 1G7MB 3PWNB 3OX8A 3CSYB 1NBZB 1A9BA 3GSNH 3TCLA 3BW9B 3F12A 4LRIC 1I1AA 3ZYIA 4LHUG 4RIRA 4P5KA 1XFPA 2CH8A 3LY6A 5I6XB 4HWEL 1JBJA 3SGKA 4AENB 1CCZA 5KSAC 1WFUA 2UVFA 2RR3A 5IEHA 3ZYJA 3S5LB 4PY8I 2OQJA 1MREH 1BIIA 2LFGA 1GAFH 1BM3H 1D6EB 1XF3A 4ZNEE 3BDXA 1BAFL 3MCLH 4WO4B 3UX9B 2FJFA 3UC0L 4JRXD 4HAFA 1M1SA 4G9FD 4U1JA 4NQVA 1IGJA 2QADB 2V7NB 3QULA 1EV2E 2X7LB 4Y2OA 3CVHH 1H0DA 2UWEF 2XICA 3ARUA 5DR5L 3H3BC 1PG7X 3D3VE 5GGSB 3KDMA 5FA4A 2AJZB 3UYRH 1PGRB 5A2JH 4F9PC 4HCRL 3ULVL 4OF8A 4XP1H 3TC9A 5HHQB 4LP4A 4AH2A 2W9EL 3DV4A 2A0LC 1QBML 1JP5A 2OL3A 3UPCA 3BGMA 2OTWB 1K8IA 1I9JL 2P45B 3D18A 1D7FA 1D5XB 1XR9A 4ISVA 1CGWA 3RWJB 2R2BB 3ZYOA 3BN9C 1AI1H 1UC6A 4NBZB 4JFXA 4X9GA 2IQAA 3SE3A 4L1DA 2ADFH 3L9RB 2HMIC 5EG6C 2FGWL 4JQXC 4JY6A 5DYOA 1ZLUK 1PZ5B 1MIMH 3DGGA 1C5DA 4L5FH 2Z35A 3OB8A 3PNWB 3MBXH 1UB5B 4NP4H 1S8DA 3H9HA 2NXYB 2VXTH 4CVXB 2WMPA 2EDHA 3TO2B 2O5ZH 4CW1A 1MJ8L 2VXQH 2HH0L 4PJCE 3L5WA 2ZOKA 1NMBH 2XWBB 4H1LA 5D1ZC 5SX4I 2V9QA 1JYNA 1TENA 2ADGA 3LKOA 1BZ9A 2R2EB 1T83A 2RBLA 3T4YA 2H3NA 3NH7L 2N4IA 3GIZL 3VE0B 1A1MB 2VH5H 3NZHH 4ODVH 5JXEC 5J1AA 4PJ9D 5F8RC 5GS1A 3B6SA 1XGPB 2R9HC 3DETD 4OTXH 3U9PH 3S4SG 3J8F7 4ZFFB 5IFHH 1RI8A 4OAWA 4R4NC 1MHHA 3OKKA 3L6FA 4LHUD 1MJ7L 4X83A 4Z95H 5H94A 1OOAA 3QB7C 3TYGH 3JXAA 1ES0A 3P0VL 4L4VD 4MCYA 3GI8L 1KPVB 2JB5H 2V5MA 4GKSA 1W72A 4XNUH 5E70A 3VFOA 3H7BA 3D25B 4Z77B 3QUKB 1NFDB 4ODSH 3I50L 2BVPB 2ZUUA 1IBGL 2WBJC 3FT2A 4G8GB 4OLVL 3TWCL 1QEWA 2XY2A 1MCNA 4NRXA 4OGAC 1CF8H 2N7BA 1ZWIA 3VXMB 3RVUC 1MHCA 4DTGH 2YUXA 3RTQC 2XKNA 3S97C 1QTYT 3V0WH 1D3CA 4S1SL 4X6BA 4X4ME 1U93A 3MOAH 5F7UA 3FB5B 2JB6B 4C56D 3QIBD 5B39G 1HSBA 2F5BH 4WHTA 3IDIA 3MROA 5IMLA 3QEGH 2AV1A 2H32H 3QH3A 1J1XH 4YBLB 5E2TL 3O2WH 2A6JB 2ARJB 4HGKC 4ZFGL 1UCTA 1ZTXL 1U8MA 2HKHL 2AAVA 4X8JA 5BJTB 4GFTB 1R3HB 4N8VB 2J6EA 1MLCA 1JTTA 1YPZE 3UYOD 5IMLB 2DQTL 3D2UA 1AD9B 3DI2B 5D1QA 5CINL 5CSBA 1A6ZA 4EUPA 3FB7B 5FUOH 4IMKC 3DARA 1KT2A 3L3DB 3PWLA 1NAML 2B20A 3PF2A 1LO0L 1IKFL 3JV4A 4YK4B 1MELA 4YEEA 2CDFA 4OGYL 3CFEA 1BQSA 1S7TB 2CO6B 4KJWD 1YYML 3MREA 1T3FB 3SDDD 5D96C 5HHOB 2OP4L 3ZE1E 1HHIB 3QISA 1HYRC 4HS8H 1A02N 3H7BB 3B9VA 4ZTOH 1VGEL 5L9DL 4UZGA 4HKJA 5MEQB 4HKZA 4HG4K 3NCYS 5FO9A 1MVUB 3PGFH 4JPKL 3SDDB 1FL5A 1A6AB 3T2PA 1K3IA 1M7DB 2IG2L 4YR6A 1II4E 4HPYH 4NBYB 5DQDH 1HXYB 5TFSL 3O2DL 5CZKA 5AYQA 4LQFL 3VXPB 4ZFFA 1ITCA 2IH1B 4U4BA 3FTGA 1WBZB 1N0XH 1RU9H 4JLRA 4G8GD 4MMZC 3LKRB 4EOWL 1EJ6A 2X89D 5A3IC 3FT3A 1JRHH 4LEOB 4N5UA 1J1PL 4K9EC 2H3NB 3LN4B 4H8WL 4QHLB 1YEJL 4Y8AA 4X99A 1RUMH 5L7XH 4RA3A 4FFZL 3MA9H 1LO3L 3ZE0F 4YZFE 5F1NB 5KTEL 4QRRB 1KFAH 4G6JH 2I5YH 2VUOA 3ILPB 2BY1A 1DN2A 5BRZD 1M05B 3V95A 1WAAE 1AKJA 5FK9B 4PJIB 4TNVK 5JPNA 1X5AA 5HGBB 2Y72A 3AREB 3G6JB 1H3PL 3TT1H 2XFXB 1WAAA 2D0HA 5D7JC 3EO0B 1UA6L 2WWMD 3O3AA 3UO1L 4WW1A 1CI5A 4YFDB 3LKPA 5IF0B 4WEBH 2DOCA 1EHLH 1B0GA 1KIQB 4FOMA 5EBLB 1XGTA 4XPTL 5KVGH 3QA3A 1FVDB 3E3QE 3SHSA 5JNYB 1RD6A 3IDNA 4R8WL 4OCXL 3QEHB 1CLZL 2OI9C 1IM9B 4YHMH 5GS3A 3QJHA 5E1HB 1HIMH 4RAUB 3RA7H 4OIIH 1TCMA 4PRPD 4YK4C 2IPTL 2FX8H 4L8SC 5BZWB 1MFBH 4PV8B 3CFDA 1OTTC 2QHRL 3VXNB 4NC1E 5GHWH 1MQ8A 1SYVB 5ID1B 3HPJA 4WUUA 3RVTC 2FSEA 5E4EC 4MD4A 5I1JH 3V6FB 4LL9A 1MCKA 2AEQH 3EFFA 1WTLA 4F9LC 4PIRF 5KJRH 4F7EA 4WIQA 4G8EA 4JFEE 3B2VL 5ICYB 3MJGX 2EDTA 3C9NA 3ARZA 4PD4J 3QDGA 4RISH 2I9TB 3AAZB 1WC7A 4QYOA 4A6YB 3NTCL 4RAVA 5D71L 3DGCR 2COQA 1MF2L 4M1CC 4GRWH 3V4VL 4ONFH 5JOPE 5I8CA 4HLJA 1JF1B 5D7SL 3BAEH 4YHNB 4PB0L 3S5LA 4X6FB 3AUVA 4JFHD 4XNXL 2EXYD 3O6LL 4NOFA 4N0UE 2EIDA 5CBEA 4MB3A 3GSNB 2XPGB 4I2XE 1BBJB 3L7FB 1O7VA 1RFDH 2J8OA 5LCVH 4HEPG 1JGDA 1CT8B 2XRAL 5IG7B 3MLZH 2OSLB 3F6IA 4JDTL 4PV9A 4WI3A 1N5AA 3BP5B 5HYJA 2XNAA 3FQNB 2BRQA 2C1PA 3QPXH 1FE8L 1L0XA 5EPMB 5HDQH 1A6WH 4EI5B 4JN1H 3RIAF 3G6JE 2P47B 4P2YA 1AGDA 3OAUL 1I1YB 1DQDL 3I3BA 1AE6L 1PW3A 4U6YB 5GRUH 4UIMA 2VLRA 1TTGA 5C07A 1EDQA 2EH8H 2A9ML 5J56B 1AXSA 3OPZL 2J4WH 2NY6C 3E8UH 2D03H 3MNWB 3CVHB 4S11A 2P8MB 5C0JA 4FS0A 1UXWB 4IS6A 4LCYB 4RGMC 5F1SA 5JHDB 1NC2A 1YY8B 4OTXL 3JWDC 2X4OB 4K7PH 1VENA 4WENB 5ABDE 3DHMA 4EI6B 1FZOB 3FRUB 1BZQK 3NA9L 4N8PA 4GS7B 5TE4H 4X6CE 4WTZG 1JE6A 4P2QA 1B4JH 1KEMH 2W0PA 2FX9H 4P59L 2OJZH 4M93C 1ITBB 2LU4A 3VXSA 5K9QI 2VSCA 4X6EA 4MYWB 4S0SD 3IXTB 2YD5A 3GMQB 5FHAL 5E94A 3HS0A 5IB4A 2DLIA 3RJDA 3BIKB 3QI9B 4J1UA 3GMLB 1YEIL 1YNLL 1Z2KA 1PG7W 4M7LH 4IOSD 5TF0A 3EYVA 4ZPTB 2AJSH 3L1OH 3QHFH 3ULUE 3QIWD 3JZ7A 1UYWH 4LSQL 2B7DT 3TA3B 3S3SA 4GKNB 4W6XB 2HMID 3GUTA 2DWEB 1H5BA 3GGWA 3BPNC 1NGYA 5CD3B 5EOCL 3LV3B 1X4YA 1A3RH 4JFYB 1ZA6B 3GJFH 2PYEA 4PJEF 3QO0B 3EO1B 1K5NA 4I48A 3VWKC 5E8DH 2E7LA 1XCQB 5FUOL 3MOBH 3U30C 3EDJA 4WFHE 4FQQA 4JDZB 5JHLL 1U8QA 4L29B 2ICCA 1RMFH 1GH7A 2QADC 3EOAB 1AC6A 1X5XA 1MUJB 1BOYA 4HD9A 1LE5B 1MCDA 2BERA 3MLPA 1I8IA 4CU8A 3HZKA 2JLLA 3NFPA 4PRBA 5EZJA 1OB1B 3MUHL 2HJLB 4BFBD 2QTEA 5B4MD 1MCHA 2EYTB 4N5ED 4NZTL 4OGXH 3MXVH 4MSWA 4XAKD 2APWA 4K7FB 5EO9B 4Y19A 1KCLA 3MV8B 1QYGH 3QSKB 4EBQL 3QZWG 2DKSA 3A67L 3BD5A 35C8H 2IADA 4WI9A 4CL7A 4ODVL 4KV5F 1U9KA 4O9HH 4TUJB 3HMXH 3PWPA 3TBSB 1FFPB 3HZVA 3O0RH 4MNQA 5DD1H 4PBXA 2QQLH 2BSSB 3QNYB 4JVUA 1RJLB 1QSVA 4JRWA 5EH1A 1U8NA 3OKLA 5A1AA 3VMOA 3GHEL 2AABL 4MWFA 2IGFL 2NYYC 5SX4H 4ORZC 3WN5B 4EDXB 1U8IA 3RGVD 1QO3A 1WZLA 4CDHA 1BD2D 3N85H 5F7WC 5CEXB 4NQDB 2EYTA 4GRMB 3WFCL 4NJAH 5EZJB 3TWCH 3GDBA 1VB9A 1RVFL 2ZCKH 4FZEL 4NHUB 4P48A 3NCBB 2B4CH 4I3SH 2YD4A 1KCVH 3E3QC 4GRWF 3WNOA 1SJEB 5IK3B 3EOAA 4KK6D 4X0KB 5TDPA 3LSOB 3MV01 2EE6A 5KN5B 1R5IA 3TYGL 5AYUH 3B2UC 1ZLSH 1HHKB 2Z9TA 3E6FB 1GGBH 3K46A 4Z6AT 2FIKB 4GG6B 1DBAL 4OCWH 2BMKB 1BBDH 3LV3A 4XRCB 2DM7A 4WU5A 2QADD 1F5WA 4F8QA 1J0IA 5CINH 4K94L 5B21A 1RK1A 3ZHDA 3MLWH 4BA8A 1AGEA 2ZG1A 3T1FA 2DMKA 3MRMA 4N1CA 1A7BA 1INDH 2UZXB 4M1DH 2WZPD 3W82A 8FABB 5ERWB 5F44A 4O2FA 1RV6X 2CRMA 2HWZH 4OZFG 3G6AB 5DEFB 4TSBL 2EH7L 1SVZA 1UWEL 1VA9A 1R0AH 2Z31C 5CEYA 5C07E 3C5JA 5FUCE 3TO4D 3IDMB 3VD9A 3DOSA 3EYQC 3ZT5A 3D3VD 3F65A 3C08H 3KWWA 1MJJA 1IAMA 1S7QB 3C5ZB 2Y9RT 4OZHB 4E41A 1KJMA 3KPNA 1J0HA 4LCWA 1W0VB 1J05B 4UB0L 3BPLC 1J88A 3QIUA 3HR5B 4XHJD 4LVOC 4X4YA 1OAUL 3GJFA 2CKNA 4J6RL 5KSUA 1KC5H 5IV2A 1OT1A 4I2XA 4ELME 1DLHA 2A77H 4LQFH 1CLOL 2YKLH 5AUMB 4G6KL 3QDJA 2VDRL 2AJUH 3UTTB 1SJHB 3HMXA 3QUYA 2VISB 4K3GA 5HI4C 3VMNA 3B8YA 1GZQB 2NY5C 3LDBB 1ORQB 1YEKH 5AD0B 4JGMA 3EZJB 4O00A 3STLA 3CZFB 3L5JA 2R0KH 1EEUA 1KOAA 3UMTA 5JOFB 3H3PL 5GGUA 5C0GB 1F2XK 1ZHLB 2FO4B 4G6AD 2AP2A 5IB3B 4XNYL 5CFHA 3FO9B 3LQAH 4ZUWB 3DTXA 2VDKL 1EUUA 4P23C 1S7SA 2YK1L 1Z9MA 3KPTA 1KLGB 3VI4F 3HC4H 1H3XA 4QRPE 2G5RA 2OSLA 1TJGL 3KPRB 5CILL 1IGTB 3BDYH 1ZS8A 4HJJH 4Y5VA 4KHTL 1A64A 5F96H 3WNKA 4FFVC 5JR1L 3E8UL 3BP7B 4W4OA 5E2VH 3BGFB 2R2CA 2EZ0D 4ODXA 4NN5C 1D5MA 5MI0B 1X4ZA 4YWGH 4NQXB 3DMMB 2XTJE 4XBPA 1X5YA 5C09D 5MERA 2F15A 3ARVA 4PS4H 4AZ8A 3LHPL 4RAVB 5CEZD 1IFHH 3CC5A 4KZDL 2F53A 4XVUC 2QKIA 3B3IB 1NGPH 1B4JL 3WMSA 2LABA 1XT5A 5CLTA 3M1BA 3BPOC 3ZKSD 4Y7MA 2M2DA 1N3NA 3CFJB 3TIDA 4G8EB 2HT4D 3D85D 2OM5A 3QYCA 1EFXB 4GLRH 2X41A 4BQBA 3V6FA 3DIFA 2EDNA 4MA8H 3CSBA 4XBPB 4JFDB 5E8EA 4V1DA 2CDEB 4GRLD 5ADPH 5JHDD 2V5RA 5EO1B 2KQNA 5BZWA 2ICEA 1I7ZB 2QHLA 4PGEA 3LKQA 4B50A 4KROC 1F6AA 4U1LA 5ICXA 5J11C 3NAAL 4WTZA 3VW3L 3MRRB 4P9HH 4I3RH 1VERA 3BAEL 1Q9KA 4YDLB 5I1AB 5D8JH 1KB5H 1KG0A 1S7XB 4XAWH 5DD6B 1S9VA 5LVEA 1T04B 5CKAA 5CJXC 1PDKA 2UZIH 4NCC2 1QZ1A 1K6QL 2MNUA 1GSMA 3C2AH 3RUGE 4Y4HA 5C8JA 3IFOB 1S9VB 1U95A 5HD8D 5DD6A 4M7ZB 4JZNA 1MREL 1ZLWK 5GGUB 3TESA 3MRRA 4P4KC 4QHKJ 4XVJL 1AJ7H 1KCRL 2YXFA 2NR6C 3NTCH 1CFQA 3MODH 3ZKQD 2X1WL 2GJZA 3QEQA 3QHZH 5CJQH 1ORQA 2ICEB 1U3JA 5CGTA 4J4PD 5JTWA 1IGIH 5E95B 3GMNA 3PQYE 5E8EB 2J8HA 4WRLA 1KN2L 3ARGC 4YHOL 3TNNB 1JNLH 5JUEL 4OLYL 4LKXB 4F3FA 2FR4A 3HHRB 4OFVA 2XXMB 4YBHA 5CWSB 2H41A 1EGJA 4NT6A 1MI5E 2C3WA 2BSRB 1EGJL 2XZCH 3FL7A 1BHGA 1ZLVK 3ROLB 4D94A 3WFBL 4GQPH 4RBPK 5GS0D 1FL5B 1FGNH 4Q74A 2UWEA 2WIIA 3ULUL 4KI5D 4UV4L 1MH5B 3KYOB 2YD1A 4JKKA 4GRLB 1RSFA 2FX7H 5TQ2H 2GITA 5FYJH 2JELL 4KUCF 4TSCH 3MV8D 1GCFA 2D0FA 3MREB 1AO7B 5C0DB 1X5GA 1I3UA 4P2QD 2VDOH 1JPST 3GO1H 3LS4H 4N5EC 2BNRB 1A6UH 1KPUA 1LHZA 2XN9D 1RZ8B 3MRQB 3HC3H 3B8SA 3QCVL 1A7QH 2J8UB 1FVEA 1IEBB 4F7CB 1F4HA 1QVOA 4P46D 1NC2D 1TPXB 1JWSA 1XGYL 4LASL 3UTZB 4D0BA 4KFZC 5JHDE 3WEXA 2J7LA 2FD6H 3KGRA 3LQZB 2D7OA 1DBBH 1KTLB 4WI2A 1NCAH 4PGCA 4NWTH 4ELKA 1FNGA 2G9HB 5L88H 4ZSOE 5FFLA 3FN0H 3ARGB 1NGWA 1P84J 1U93B 4M8QA 3IJSB 2YPVL 2HT2C 4F7TB 3U0WH 1IGYB 1MFEL 5C08D 1F4WL 1CGSH 4KRLB 4FHBD 4PLNC 1M7IA 2Z8SA 2JJSC 1FSKC 2UUDK 4JDVA 1RUKH 4ZODA 2VLLB 4FQLL 2XTJD 2UUDH 3OKDA 4XNZC 1QRNE 4K3HA 3P3YA 4OJFL 4HULB 3JWDL 2V2XB 1RJLA 4J4PA 5A16B 1Q9OB 4ETQB 4OZIA 5ENWA 5GS2H 1NUGA 3C60B 4EN3B 4M1GH 1A7RH 3G6AA 4PLJC 1E0OB 1OAUH 4J6RH 5EFIB 5HHME 5ERWA 5ISZD 3OL2A 2VXVH 4YDLC 1A1OA 4NSKA 3MCG1 3MRMB 1I3GL 3A6BH 4P4KA 2R56L 2AV7B 1EAPB 5J11B 4B5EA 1FHGA 4L8DA 5IHLB 1LDPH 4FXGA 4Y19B 3WIIL 5HYQA 4JM2B 4J3VA 3HRZA 1FORH 4ZFZB 3FO1B 5FO7B 2FZ3B 1G7PA 2DKMA 3T4YB 5CEZE 5MEND 4F58H 4X6DF 5EBMB 2YHGA 4OKDA 2A0LD 1LE5A 3RVWC 3A67H 1I1FB 2YPKB 3BKML 3EHBD 2NY1B 5DFVD 3T0DA 1DSFL 1EO8H 3A6OA 3C5ZD 3CCHB 5DMGC 1DVFD 2NY3C 2VDKH 3UAJC 4X0KA 1ZA6A 3V2AR 2NXZC 4JFYA 2EDYA 4MA1C 3HC4L 1LE9A 2NY4D 5EZLB 2VXUL 3O3EB 4CVXA 5B38A 3L3OA 5DQJB 5E2UH 3CGTA 1QSFB 4M43L 4WDIB 5FM4A 1NGYB 3UTQA 5CD3A 1RUAH 5F96L 5JR1H 3OB0H 1E4KA 2BDNH 1AY1L 3FO1A 4U7MA 1I8KA 4NQDA 2ZUXA 1G6RH 5DYOB 3L3KA 4MDIB 1U8IB 3L9RA 3GSRA 1IEAB 5I18H 2FECI 1LEIB 2FLRT 4HUKB 3BGFC 4JKLA 1EAPA 4ODBD 2C3XA 25C8H 5J3HC 2XKSA 4MA7L 3Q6FB 1BJMA 4LRNH 1U8KA 1RVFH 5C3TA 5IB4B 1CXKA 1T7VA 2VXTL 1IFHL 1CD1B 3GMQA 4UBDD 4JQXA 5CJ5A 2VDMH 2GYSA 2BJML 4X6EB 4M1DL 2DM4A 2YUVA 3VI4E 1KBGL 4TUJA 4G9FB 2F5AH 1LO4H 2X4UB 2DI9A 3QXDB 3RPKA 5MEOB 2HRPL 5JA8B 4N0FA 3REWB 3BWAA 3UJTL 2OXGA 4ZDHB 3VDBA 4H25A 1Y6MR 3LDBC 2ZWLT 2X7LA 3OKEA 4PJ5B 5DJZB 4NQVB 3MRLB 1MCSA 1I7UA 1ZLWH 3HZKB 4UILL 43C9B 4M61A 2BY3A 2WP3O 2FLBT 4DVRH 5IW6B 3V6ZB 1R24B 1WWWX 1WUNT 1M71B 2B8OT 1NLBL 3KJ6H 2DB8A 4D0DB 4FQQB 4JDZA 5D70H 1P4LB 4PJFB 4GAGL 4G6KH 4HIEB 5DJAA 1YMMB 2PNDA 4OD2B 4NC1C 3P0YH 2H32B 2BX5A 2JJSA 5JDSB 3EO1A 2EH7H 2PYEB 2NQCA 2FL5B 4KTEH 1JWSB 4P5KB 1O5DT 2GK0A 3CXHJ 1FBIL 2CMRH 2QSVA 3C5ZC 4EDWH 5IESH 2ZOLB 1T03H 2R8SL 1MIEH 3MO1B 2PO6D 1OM3H 5DGRA 1AGBB 3PJSB 3ARFB 4PJAB 4XXCC 3MJ8B 2C5DC 4O02H 4M03A 3BOVA 3LRHA 2IPTH 5LQBL 3S88H 1L6XA 1TCRA 3V5HA 1XZ0B 4Q6IB 4LU5H 2DLFL 4IOFD 4TNWK 5IB2B 4FQ1H 2YRLA 4QRUA 1LILA 1ND0B 4L4TE 1DQML 2F5BL 3EYFB 1C7TA 5GSVA 1BREA 3IU3B 4E42A 2R0WL 1QSEA 2X1XR 5EN2B 3SJVA 5EU4A 5I16B 1GPOH 1N7MH 4OCSL 4R3SA 4OV5A 5HHMD 5K9KA 1E6OH 3O41A 3HNVH 3QNZA 3RWCA 1FIGH 2A73B 1OSPL 4QXWA 1LO5B 3REVA 1IM9D 5I30L 2NY5H 3K1KC 2CIKA 1CVSC 3RP1A 2W1NA 1AIFB 1JF6A 3DVGA 7CGTA 3DYPA 1KCSH 4JFPB 3WIHH 4QCIB 4XWGH 4M6OH 2OCFD 5D1QC 2GQHA 4LKXA 4WJ5A 3V5DA 4KAQH 4PR5B 4BH7A 1Q9WA 3PIQB 5EU5A 2GIYA 2GJ6D 3KJ4B 4KH2A 5C08E 3CFDB 3VXRE 5T3ZD 5DRWB 4MZ2A 3QEQB 2B2XL 1SMOA 1N4XL 4YXLL 2ZCLH 1H15B 3T2NL 2O5YH 1QFUH 4XXDA 2R4RL 5KW9H 2OYPA 1T1YA 4I1NB 4R4FH 5KSBF 1R5VA 2YA1A 1ACYL 4XAKE 4ODWB 1MAML 1EMTL 3MUJA 4P2CG 5KVDL 2Y7QA 5CUSH 1VFBA 3IS0X 4I5BB 2EH8L 1TQCC 2DLTA 3O6KH 5FCUL 3EGSA 4PJDF 1Q9KB 4YXHH 1IT9L 1CFSB 1MFAL 3WYRA 3WNMA 4X9HA 1NEUA 3GMOA 2VWEE 5L6YL 3ILPA 5F1OB 3EJJX 1ZHKB 3U48A 5D7KD 4CJ0A 2Q7YB 3LMJH 1V3MA 1IBGH 2HKFH 2VITA 3MV8E 5KSBA 4UT6L 1CGSL 5DD3H 1IAII 3MJ9H 4QHLA 4IRJC 4S10A 4YGVA 5T3XE 1TZHB 1QSED 3WSQL 1JMXA 5I1IL 2FRGP 5DRXA 2M26A 2P24A 3H3KA 5A2IH 4ZG1A 4K3DH 2EE2A 1UA6H 1UH4A 4KWUA 3CJJA 3HUJA 2UZIL 1HXYA 3GHBL 4WNQA 4Y5YB 3G5ZB 5DT1L 1A6AA 4JFQB 5CP3A 5J6GA 4CGTA 1MQKH 3DRTB 2YD9A 4JCLA 5KANI 1CXLA 5MERB 5DRZA 2Q8AH 3DMMA 3SKOA 5DGQA 2EC9U 4KI1A 4PV8A 3VGAC 4LLVB 3TA3C 4OZ4A 1D5MB 4RBPH 1U3HA 1HIML 4Y4FB 2CGRL 1B88A 1CWVA 2ICWJ 2R1WA 5CJQL 1HWHB 1MF2H 2E27L 4OFYA 2XIDA 3SDAB 2J88L 3WHE0 2W9LA 3RAJH 3QA3B 4NNXA 3W2DH 1SBSH 3QI9C 4XCFH 2CDFB 2HTKD 3ELAT 4WTXA 5DF0A 5EC1B 2MQ0A 2DTSA 5IF0A 3PDGA 2KQMA 2OL3H 4UT7H 4WW1B 1QQDB 5GGVY 5D93C 3RVXC 5LBSL 3VRLF 2L7JA 2MKWA 2VLKE 4PJCA 3RZWA 4BQ8A 4OUUB 2ADIB 3FB7A 3AREA 3LB6C 1VADB 4QRPA 1RUPH 4HXAH 4HUNB 1R3LA 1AFVL 5LGHL 5D71H 4DOHB 3KYMB 4GS7C 4YXKL 4JN1L 5AD0A 2QL1A 5I66B 5F1NA 1ZSDB 5D7SH 3EYQD 4LLMA 3O6ML 3X3FL 4NUJA 3CPLB 4X99B 4XNXH 1V7ML 2H6PB 5IVNA 1JTOA 2ATKB 3DYOA 1RU9L 4QRQA 4LSTH 2IH3A 4X6DB 3QUYC 4LGRB 1A7NH 4JO1L 3V52L 2FBJL 5IV2B 2PO6B 1G1YA 3B9KD 2IAMC 3FQXA 4JN2B 1A14L 5ITBL 4GW4B 1KEGL 3MV9B 2BNQD 2DRUA 4JG1L 3QIUB 3IFNH 5L0QC 2HVJB 4ZUVB 5FUZH 1FE8H 3BP6A 1A7QL 2FYYA 1YQVH 2R1XB 4R97C 1VKXA 5BQ7A 3HAEH 1AXIB 4GKZA 1GC1H 2C9AA 4PRPB 1A4KB 1A4JA 4P23A 3FQWA 5EIIA 5MEQA 3V9FA 1FFOA 3NZ8A 3F7YB 1X5HA 1CXHA 1T4KA 1A1NA 2O61B 2X4RA 4KMTH 4GKZB 2A9MH 1MHEB 1VKXB 4GMSH 5D2LA 2X2YA 4M4RA 2Y06H 1FO0H 3FOLB 1QSEE 3MRKA 2X4QB 4MJIA 4OIBA 3UJJH 5DDHA 3KXFB 4HIIA 2H1PL 3D0LB 4X6DE 3MRIA 2D7QA 4JN2A 5FO8A 5IKCB 2VXVL 4FG6D 2ZPKH 4IJ3C 4R8WH 1YJDH 1L0YA 1CLZH 2IH3B 3MRFA 5L2KD 4GAGH 4LFHD 3CU1A 4XC1H 5D7JD 3QO1A 1ACZA 2Q7NA 5JQHC 5EBWA 4MXWL 4YIQA 3RA7L 1UACL 3CPLA 2OMBA 1DLFH 1Z0NA 1ZKAA 4OIAA 2DQFA 5L8LB 1ETZB 3VXUA 1C7SA 1EEYA 4NKDA 1OT2A 4WVRA 1S9WA 2VZUA 4UOW1 1JN6B 4ZFOA 1NDGA 4S1RH 5KN5A 3KYMA 3MACL 1ZT1B 3MQIA 2OLDA 3LB6D 3QXAA 4PJHE 5CMAB 5H2BA 1JGVH 3D69A 4I0KA 5E6IA 3CDFA 3UTOA 5IWLA 3MV7A 2VERN 4IM8A 4LAJH 1YPZF 4HUUB 4IHOA 4PRHA 1G6VK 1JZ2A 4HJGA 2VN7A 3HR6A 5F9OL 4XNQA 3OF6D 1YEGH 1OAQH 1IAIL 4B53A 2EEAA 2ERJC 4NZUH 2NZ9D 4PB0H 2R1WB 5CJOH 1FNFA 1C12A 2ZSVA 2Z4QA 1N7ML 1KJ2B 4OCSH 4R7NB 1FL3A 1FZKA 5CJXA 4GW1A 5HHQA 4D9QD 3KXFE 4HC1H 5CZXD 1CFTA 3TYFA 4M7JH 4UV7L 4MA7H 1H5BC 2W38A 3L3GA 3MSPA 4PJHA 1ES0B 2PETA 2AJZA 4IDJH 3WFEL 2BFVL 5JA9A 5D7LB 3AREC 3QDHA 5EUOB 1AP2A 4Y16C 2A77L 2BY2A 3LRGA 3P0GB 5C0IB 5C6TH 5E2UL 3T4AB 5KSAA 1KBGH 4G6FD 4KAQL 1OCWL 5GS1B 3PWPE 2APVA 5ESVA 1EPFA 3FKUS 1FJ1A 4PRID 4WEUD 3F7QA 2HG5A 3MUY1 1F4YH 3G6DL 4HWBL 3NCCB 3CUPA 3DSFH 2ITCA 1I8IB 2R2EA 3DX6A 4EBQH 1D6EA 2H2SD 3PUCA 1NAMA 3AMLA 1QBBA 1LP9F 4PY8J 2IAMA 1SMAA 1N64L 4PRIB 4NQDE 5C0BE 3GMPA 2XWBA 3UBXA 1TMCB 1XCQA 1W0YT 4ONGH 4AENA 4I48B 1K5NB 4YPGA 1KLFA 1XR8B 2QQLL 3T2QA 3NCYP 5EU3A 3NFSH 3BZEA 3V6OE 3KJ6L 4Y4KD 4YHLH 1Z3GL 3RWFB 5BW7A 4WTWA 3ZSTA 2EKSA 2NY7L 5T33H 4DGVH 4FNLH 5IHZA 1NBZA 2DWEA 3RL1B 2E7BA 3DGGB 2MKLC 5IVZB 2AJYL 4JY6B 4HC1A 2CMRL 4NC2B 1NCNA 4JVPA 4LDOB 1FRGL 4R0LC 5FF6A 3FZUC 4N8CL 5E6ZA 5EU7E 3RIFK 4TNWF 3N1GC 5IBUG 4CRPA 3R1GL 1S3KL 5GS0C 3I02A 6FABL 2WLZA 1H15A 3D18B 2A1WH 1VGKA 3FO0H 4V2BA 1D5BB 3BGMB 5C0ND 1IC5L 3OR6A 4KJPC 5CIPA 3PHQB 2G5BA 5HHNA 4KI5F 1NDMA 1MCRA 3UJIH 1S7WA 3W11C 3IJYB 1YECL 4I18B 3PIQA 4YEFA 3I6KA 1MPAH 1AR2A 4NM4H 4P4RA 4Y2DA 5ACZB 3W0WE 4ODHH 1Q72L 4EEEA 4FFWD 4LQ1A 3GJEA 4WI8A 1TXKA 2ICWA 3ILQC 3WL9B 5FV1L 2YSSB 2CSPA 3O2VL 3FRUA 1T03L 2A2QT 3RZCD 2YSSA 2ICWB 3WL9A 1G7LB 1LO5A 3REVB 4YBLC 1Q1JL 1A6TA 4JM4H 4UOW0 4G3YL 3LQMA 4NYLB 2K7PA 1LNUB 4N0UB 4XB8A 3S88L 5E9DA 1K9TA 2NW2B 4I18A 5DVLA 3EIFA 4AEFA 3EJZC 5HY9B 1INDL 3RTQB 3QQ9D 4DGIH 2APTA 2F19L 1ND0A 2YMXL 1CDUA 3STBA 4MD5B 4KY1L 3MR9A 3OTTA 3O9WA 1Q9LA 2AGJH 1GOGA 3ALPA 3ESVF 1UXSB 5FKAB 3VXSD 3WDIA 1KCUH 1E6OL 3MJ8A 3MLUL 5HDBF 1FLTX 2X10A 4GUPA 5DMKA 1TZGL 3HUJE 2BVQB 1YN6A 3O0RL 4DN3H 4I77L 3NABL 5AZEH 1Q9LB 3O9WB 1VEOA 1TZIA 2H32A 5DFVC 3AROA 2W65B 3GMPB 3FONB 4HIEA 5DJAB 5E08H 4LVEA 3GJFK 5EULV 4MXVF 3RTQA 5D6CB 4MAYA 1IT9H 3V6ZA 4MNGA 4DKFL 5L2KA 3SE8L 1NFDE 3DX6B 4N0UA 2R39A 5DJCB 4OKVA 1NEZA 3FAXA 4OCLC 3TA3D 3LOWA 3CNKA 1J9CT 4Y89A 1F4XL 1BLNA 1QFPA 3ZKMC 4H25B 1GGCL 5C0CD 2VR9A 4PS4L 1CXFA 1LEGB 1MCBA 4N0FB 3REWA 2JIXD 4JANA 5TDOA 2DTML 1KCVL 3GJEB 3TFKD 2HTKC 4ZOCA 3WUWA 4L3EE 4YQXH 2BVOA 3ARRA 4R26H 5ACZA 1CBVL 5C9JA 2WAHA 1FNAA 3HAEG 3H9SD 2NXYC 4P4RB 2E9WA 3NOIA 2X6MA 2AK4B 2NX5A 2VLJE 5DSCB 2VZ3A 1DBAH 2C7UB 2XOTA 3PHQA 5ITFB 5C92A 2JK5A 3BQUC 3EFDH 1OTUD 3DX9A 5IJKC 1G9ML 3ULVF 3ARTA 4MAUH 1ORSA 3T04D 3KPOA 4D9RE 4ZAKD 2GSGB 2EDKA 5IROA 1F11B 4KDTA 2H8PA 4APQC 2IANE 4Q0XH 4LSRH 5HTSA 3VU2A 1NJ9A 4HV8B 5IVXA 2V2WA 3MXWH 4JCMA 4UI2A 1NCAL 4U6XA 3JWOH 4PJIA 4U1GC 4KZEL 3TVMD 5L88L 1P4BH 5JXAH 4HH9A 2KUTA 4MA8L 1U8OB 3JWOC 4CKVX 3WJJA 3MUZ1 1BECA 1CDHA 2Q8AL 4PB9L 3QEQE 4XP1L 3C5SA 4JY5L 4FRWA 5D9SB 2FEDC 2FB4H 3VXUB 2W9EH 1WFOA 1U3YA 1MFEH 4MXQC 4YIQB 3HFML 3QDMA 3STZB 1S9YB 2XWTB 5AZ2H 5FO7A 1J8HA 5E00B 4E41E 2NY2D 1RUKL 3DJ9A 4YC2C 3NPZB 4R90H 3X3FH 4FFYH 3RUGA 5CJOL 2F8VA 3MOAL 4RMUA 2VLKD 4Z5RB 3TF7C 2HFEB 4XCFL 5HYSB 3T4AA 5KSAB 4ZXBD 2Y07L 4GAJH 1PG7L 3BUTA 5I6XC 1D6VL 1CDIA 4HC1L 4UV7H 2YC1A 5I8EA 4JO1H 2FEEL 3V52H 4X7TB 1WFNA 5EZIL 2YRPA 4X5XA 1UKTA 3MRCB 1T4KB 2O61A 4U6TA 1MVUA 1FO0B 4WU7A 4JRYD 3QUZA 5JLZA 3TT3H 4LSSL 4DFIA 2DI7A 3SDYL 1C5BH 3S37X 1FL3B 1FZKB 1EXUA 4OZGF 5GGSY 5BQ7B 1MSPA 2P5EE 3BP6B 3GSWB 5DWUH 2BXYA 2VAAA 2E8ZA 3G5YB 5D6DA 2CD0A 1M7IB 2D9QB 2Z31D 3SE4C 5J13C 1RQ5A 5DZLA 1QBLL 2YD6A 2P8LA 2XWJA 2FHBA 3L3DA 5BOPA 2VDOL 3HE7B 4PJDA 3U0PA 2JJUA 5IBTH 2ZPKL 1DJSA 1W8NA 1W8OA 4UDTB 3NFSL 1Z9OA 5IBUB 1YQVL 1AHWB 1BVKB 3NPSB 4P46A 4Y5XB 1KUMA 3VI3E 5K59E 4OI7A 4YUEH 3TJEH 4P46B 4Y5XA 4FQ2H 2I07B 4PJGA 5JO5A 1DQQA 1NLDH 1T1ZB 4MS8C 3ULUH 4NKDB 3IDIB 1X5FA 3V6OA 1T2QL 1CGUA 1UM5L 5F71A 2VWEC 5EOQH 3MRBB 1MCCA 5T1MB 4PRIE 1ZOXA 1ZGLB 2IALA 4LPWA 1DBBL 2J5LB 4OFKA 3FQRA 2EDRA 5FYJL 1QQDA 4EOWH 2IPKB 4KRPB 2BNUB 4HPOL 4NWTL 3O8XA 4CN1A 1AO7E 1QKZL 3VXMA 3W5MA 3B9EA 1SQ2N 3QJFA 1RUQH 4HIXH 4HFUL 2LAGB 4NNXB 1A6UL 3VXRA 2VDLH 2VLKB 3FOLA 4S1SH 3QUXA 3WNPA 1ZVYA 4Z7UB 3SGDI 4XBEH 2I5YL 1F4WH 4N1EA 2ILLA 1U3HB 3F58L 4FZ8H 1FNEA 4FQCH 5C71A 1HI6A 3VWJD 3SKOB 3QUZB 4X80L 4FFVD 4APQA 2WIIB 4NO2B 3ZHLA 5F1IA 3O4LE 1VSCA 4JFQA 4X7TA 5J6GB 1PZUB 2R1XA 1KIRA 4I4WB 4YHYB 2B5IC 4CMHB 4TQEH 4MLSA 5KVEH 3K2UL 4P2RB 3GFUA 3HKFA 3TLRA 1PYWB 1I8MB 3RUGB 5KS9F 4KQ4H 4CN6A 1I3GH 2PW2B 3U0WL 1LO0H 32C2B 2I24N 5F88B 4O58L 1J5OL 4P2OD 1P7QB 2DQEL 3TNNA 5I9QC 3FQTB 3WD5L 1XMWA 4XCEB 2PCPB 1E4WL 3CFBB 2OP4H 2AGJL 1ZSDA 1HH6A 1BP3B 1JPSH 4LSVL 4U31A 5I17A 4LSDA 3AS2A 3LKNB 5HDBE 4R2GB 1T22B 4UDUB 4L3CB 4RRPA 4LMQE 3P4OA 4J8RB 4Z7VF 1CD8A 1EAJA 3C09C 1P2CB 1QRNA 4K9EL 4UAOB 1DUZB 1KB9J 4GG8A 5I1GH 4JPKH 4JZNB 5HI5C 2ADIA 4K71B 4LLYA 4FTVB 2A9NL 4Y4HB 2IBBA 1CDJA 4OQTL 3VXQB 4QTIL 8CGTA 1HCFX 4JKPH 5CD5D 4IRSB 1T04A 4XCCH 4JZJC 2PYFB 1C1EH 3VXUE 2B1HH 3BMWA 1DDHA 4JGUA 3O4LA 4AIZA 1G6RL 1D5XA 1XR9B 3RRQA 1DEDA 4CVWA 1WTGT 2MPAH 2QEJA 1LD9B 5D2LF 5DEGB 1OAXH 2V7HB 3W9EA 2GTWA 5FYLD 2CDEA 1FIGL 4JHWH 3RWDB 1DQJA 5EORH 1N59B 4LRNL 3BD4A 2P5ED 4K3EL 5FDWA 3FO0L 5SX5K 1WV7T 3PWJB 3MFFB 4LCUB 2JJWA 3GIVA 4UTAH 5JIHA 4XWGL 3U4EA 1BFSA 3WIHA 2IQ9H 4L4VE 1NCWH 1J11A 1VFMA 4P99A 4RFNC 5C07D 3FCTB 4N9GB 1FZMA 1F3JA 2P5EB 3PWUA 4WEBL 1P1ZA 4IRZL 1PX4A 3HE6C 5ALBH 3QCTL 1IL1A 3WIFA 3RGVC 1NGZA 1UEYA 4HEME 4C54A 4YPJA 5GPRA 3VH8A 3NIFE 4MAYB 3O8XC 1BIIB 3C6LB 1D9KA 3RFZC 5TH2B 2QSTA 4OD3H 2OR8A 5I0DA 2Y6SD 3DRQA 5J9PB 1OARH 1NCUA 4XMKH 5DQ9A 3AS1A 2GUOA 4G9DA 5KVDH 1I3VA 1V3LA 4RIRB 5HGHA 2Q20A 4ZS7H 2Y36H 3F12B 1S7VB 1HWGB 2AEQL 4IMLA 3TO4C 3L95A 2Y7QB 3CSYA 3OX8B 4R4ND 5SWSB 1MJUL 4M5YH 1NFKA 4ZUWA 1MHPL 4DZ8A 2ZOLA 4QT5A 3GRWA 3HZMA 3FT4B 2R8SH 4NM8L 4JY5H 1NMAH 2WINB 4TNVF 4F15C 4UIKL 3BXNB 5JW4N 2YD7A 2Q6WB 5BV7B 2OJEA 3Q6GH 4QHNA 4UMGA 1GC1C 1P4LA 1MWAH 3E2HB 2PF6A 4HWUA 4PJFA 3SQBA 4DAGL 4KJQD 1A5FL 1FN4A 4CMMB 4JEGB 3KLSA 2EDOA 1JPTH 4LLDB 3VGDA 2RJMA 4HZLA 1Z5LB 4AEEA 5GZND 3MRGB 3OHXB 3P0YL 4TVPL 5AUMA 1MNUL 4LLAA 2JJTA 4NFCA 3ESUF 4FQHB 4JFPA 5CKGA 2F53E 4JPVH 2GFBA 4OF6A 4TSAH 4DVBA 4NQCE 4OF5A 4KRPD 4X4YB 4X7FC 4PJEB 3CXDH 1MIEL 3K7UA 4P5TB 1QACA 4DUWA 3QXDA 2QLVB 3QQ4A 3KPNB 4JR9L 1A0QH 4R3SB 4WY7H 4OV5B 1AD0B 4F7PA 2FJGB 4PP1D 4EKXA 5C0CE 5C2BL 4Z9KB 1MRCH 3HAEA 1NDMB 2VXUH 3QIBA 1CD1A 4NO3B 4RGNB 5CIPB 2DQIH 2VYRE 3MBEA 3KYAA 1CS6A 5DZNA 3SKJH 4HKBA 4NJ9H 4JRXE 3SBWC 4LBEA 4BZ2L 3OR7B 5I8KH 3Q5YA 4LVHC 4DN4H 4LMQI 4C55A 1WWBX 4AMKH 4BH8A 3GSRB 3K80A 4Z7NF 4BUHA 4XMPL 1DVFB 4JQIL 1ZGLP 4NO0D 1QLEH 1I8KB 25C8L 1AGBA 4ONHB 3BDBA 4Z0XB 3GM0A 1D5IH 1T66C 4O2CB 2XZAL 4P23D 5IBLC 3ZL4L 2R4SL 2BMKA 1KCSL 4Y16A 2E7HA 1KEML 1I3RA 2FL5A 4C83A 3VXRD 3TIEB 3U83A 3OAZK 1T1XA 2PW1A 3LSOA 4IOIB 1NFIB 1JV5B 5J4MA 2A6IB 3RDTB 5BMFH 3SN6N 1W72L 1I1FA 1R24A 2C3VB 1SJEA 2AABH 3KVQA 2LU7A 3RGVA 4M61B 43C9A 4L3EA 4LSPL 4ZO6A 4JFEA 4L9LC 3RNKB 2D31B 4Z76A 5IQ7H 5CEXA 5DJZA 3OKEB 2NY2C 1H3WM 1QO3B 3VRJA 5DVOA 4ODUB 3SY0B 3ARDB 1UYWL 4NPYB 1WBXB 5FHBH 4KC3B 5GRYA 4TOYL 4PJDE 4LHJB 3U6RA 2HFFA 2X4UA 3O81A 3VFWB 3GSQA 4GG6F 4GBXA 4P5TD 4QOKD 5BW7C 4YAQA 3BSZL 2GJJA 1RJCA 5KZCB 4YHIB 3VFNB 5E56A 4M7LT 3TYFB 1YC7A 3EW3B 4Q58C 2D2OA 3WS6C 4KXZH 3TN0D 1U8KB 4Y5VC 2Z8RA 4H5SB 5FYKE 3SOBH 4WV1C 2X09A 5FUCC 3OJDA 5SV4A 5F3BB 1BZ7A 1OPGL 2HFFB 3D2UD 1FV1A 4LPXA 3FB8A 5KS9B 3PGDB 4L4TA 5I2IA 2XA8H 2ZKHH 3R06A 3I75B 2BCKA 2D31A 1MWAA 2J6EH 4NN6B 4M8QB 4Z76B 1SBBA 1DL7H 3KPLB 1T20A 3VWJB 5DQJA 3K8LA 4IRJA 1QYGL 5D1XA 3AU1A 1AQKH 4Y2DC 2J1KA 2P42B 2WNGA 1ZV5A 4OZFA 1U8QB 4L29A 3NFNB 1S9KC 3BT2H 3QZWB 5JDJA 1DQLL 3T3ME 4ZFOB 1KN4H 5GRJL 3PQYD 5HGAA 3NIDE 4HCRH 3TBTB 5JXED 5TE7H 1CZ8H 3GMRB 2VE6A 5B8CA 1D5ZA 5E4IA 1EO7A 3SDXF 4PLKC 4QO1A 1CU4H 2X9WA 1XEDA 4X8XA 3SPVA 4I0PC 5D2NA 3ECBB 4BFIA 3C60D 2DQGL 3OXRB 3P73A 2QQNL 1SBSL 1I7TB 2EEDA 4KRMB 2AEWA 3PV6B 4CNIA 4KKCD 3PGCB 1Z6JT 3N85L 4G8FA 2E6PA 4MJIB 4XWOD 5K9OA 3THMH 4ZQKA 2CK0H 5D2LB 1EVUA 1L9MA 1F58H 1GJIA 4HUWA 1QFWL 5HGDA 3IFNL 3HAEB 5I8OL 4NKIL 4LSUL 5ADOH 4JFED 5IT2H 1ZK9A 3T77B 3W0WA 3T0XA 3O4OB 4JG0H 2IWGA 2QSCL 3OKDB 3PL6B 1QFOA 2HVJA 2UY7A 3T2OA 1BQLL 4J12A 3NGBB 4PRAB 2ORBL 2YBRB 1NPUA 4Z0BL 4BK4A 5HSFA 5C3LD 1IGYA 5IJVB 2Y06L 1XIWD 1RURH 2LVEA 3OKOA 1PKQA 1VDGA 1OAZL 3B9KB 2H1PH 5KVEL 4OD3L 4NQUA 4Z7WB 4JAMB 1J86A 4LF3A 3TBYA 1OGTA 1ZHNB 1RJZA 1ZVSA 4LKCA 4PYGA 3ALWA 3RVUD 3QXVA 3GSXB 4M3JA 4QF1A 4XC1L 4M6ML 3NGBC 5T1KA 4K3JH 5FAAA 2VLRB 5DTFA 5MENE 1GXEA 1FYTD 4F15B 4QRPB 1CGXA 2AXFB 4JHAL 1JPSL 3DUUB 4GBXC 3T1WA 5DFWH 1QOKA 3NACL 1F8TL 5EPMA 2MHAA 2Y5TA 3EDFA 2ZUSA 3FRPA 2Z8WC 1V5JA 3X11B 5DT1H 5IQ9B 4PV9B 5I1GL 5ID0B 4I0PD 4QRPD 2X44D 2P8PA 3UZQA 1F42A 5F72S 4ENED 3MLXL 3SDAA 5JIIA 1INEL 3DRQB 5HDLA 3SE3C 4ELMA 1F6AB 3DNKA 3V7AE 4XCCL 2ADJB 5GRXG 1JGEA 1XH3B 2I9LB 5EO1A 4EQ3A 1JF1A 3VW3H 4V1DB 3QIWC 4P9HL 4KJWC 1NC4B 1P4IH 3RAJL 3SDXE 3AY4A 4F37K 5E5MB 3WIFB 3IKCA 4KVNH 4ESKA 4XX1G 4TTGA 1WIPA 3H3PH 3JWNC 3D39D 5H35A 3IRZA 3FCTA 4N9GA 2VDQL 5DD0H 3CFJA 1PQZB 4LCCC 4K3EH 5FYJD 3WJJC 4B41A 4NFBA 1E27A 4HWZB 2AEIT 3QIUD 4GOSA 5BV7H 4RGNE 4N0CC 3GIVB 3JV5A 3CMOL 3MODL 4WUUB 5F9OH 2DQHL 2VLRE 2ESVA 2Z0BA 5DJ8A 2VITB 3HC0A 2O5XL 4NN6C 5I8KL 5F7DA 5EZOH 1ADQH 5ICZA 2PUQT 4H88H 2AEPL 1EFXD 1LD9A 4OLXL 3N1FC 4WI4A 2GJZB 5JUEH 4ODXB 1IRAY 3LEYH 3RWIB 4RMVA 4Z7WE 4QRTA 3O4LB 3NZHL 4MCZB 5DC0A 3WKMH 1ZT4B 1FH5H 1RIVH 1JHKL 3PWVB 4XVUD 3NABH 5IQ9A 2Z8VC 5T1KD 4P2QE 5T1LB 3BVNB 3IFPB 2VZ1A 4K8RL 1F3DJ 4HK0B 3VXQA 3PWVA 1V3JA 1S7XA 4G6FB 3L7EB 1MFDH 4GG8B 4HHAA 4JJ5B 5TGBB 4ODTL 5BMFL 4G5ZH 3VGEA 2H9GB 3CDGA 5FYJU 5DTFB 1J1PH 4KI5E 4L3CA 3DWTA 3LKQB 3ARDC 3U0TB 5GS0L 5ICZB 1MRDL 2NY2B 2WP3T 3H0TB 1ZVSB 4LKCB 3CFBA 4KROD 2WIMA 1CE1L 4BH7B 5F7FA 5EU7C 3IB4A 5C0BA 2PW2A 2MCG1 2VABA 3NIGF 3P11L 1JPTL 3B83A 3QCVH 3UTSA 1E27B 3WLWD 5DHVB 4OCYL 1J8KA 4P2RA 2XTJB 3GBNH 4JHZA 4Y0GA 2HFTA 5F6HJ 5CP3H 2C26A 2FDBP 4FQPA 3O41B 2DL2A 1SYSB 2OTUA 3F5WA 1P7QD 2N7AA 2C4FU 2H2PD 5T5NF 4HGWA 3IDMA 4ODSL 4J3WA 4NO2A 3U2SB 2HTLC 3VFRA 1IZKA 3ARBA 1NH6A 4MNQD 5I76B 2I25N 4FQXC 4OIIL 3S98A 1U8PA 2K3TA 5BXFA 3U7YH 1I8LC 2DN7A 2HN7A 5I1LB 3ARDD 2VLKA 4XHJC 1DBML 3QUXC 4K23H 3IF1A 6CGTA 2W0KA 4HQQL 5EU6D 1RK1B 4NM4L 1I9JH 1KGCE 4LAQH 1AQKL 4F33A 1Q94A 1DP0A 4G42A 4YO0A 3TJHC 5KJRL 3QIWA 4JPVL 3ALXA 2RIKA 5E2TH 4X98B 3O6FB 1T5WA 3MTRA 1YPZB 1FL6B 4ZPVB 3CXDL 3VJ6B 1LEKB 4GSDL 4R7DB 1AD9A 3BEVB 2DYPD 2FIKA 4GG6A 1T1ZA 4P5TC 1TZGH 2VXSL 1HHKA 2GAZA 3K0WA 5HXMA 3DVNB 5TDPB 5B3JE 3EOBA 4D9RD 5AG8A 5IFJA 3QXTA 3ZTJH 3VFPA 1M71A 3FOMA 5I74C 2W9DH 4WFHD 1ZHNA 5BS0A 1VEMA 1LDPL 4U1KA 3MRLA 5KSVA 4TPRH 4ZFOL 5C0EB 3KPQA 5T3ZE 3B5TA 3AVEA 5IMMA 5BVJA 3WN5A 3PGDA 4ZUTA 1QEWB 5D2NE 4UQ2B 4I3GA 2AVGA 3TT3L 2DMBA 3SDCA 5C09E 2VH5L 3OKLB 1W0VA 1CN4A 3RVWD 1T5XA 3WV0A 2G60H 1KULA 1T0MA 4L8CB 1S7QA 1EO8L 4H5SA 1UZ6F 3IAGC 1YMME 3GK8L 1XIWA 3LZFL 5C09A 4ONGL 3QNYA 5CEYB 4GKSB 5AZEL 4OI8A 5LJYH 4M8VA 4PJ9A 3VD4A 2AI0H 3TBSA 5H94B 2ZUWA 4M43H 3LS5H 4DFHA 5E8OB 1GHFL 1MHHB 5JQ6H 2BDNL 4XZUB 1W72H 4JFOA 3U6RB 1MCEA 3VFGH 2D7NA 1WBXA 5CZXC 3MV8A 2QBWA 3MMEB 3BIBX 3E0GA 2Y23A 2BNRD 3JTSA 5IHUH 2AS5M 4MSWB 3R1GH 4MAYC 1RHHB 1WLHA 3W9DB 1YEDA 5HHOE 5J3HD 2MCPH 4L3EB 5DVNA 3RGVB 1NCDL 5IOPB 3O3EA 1CF8L 1IQDB 1UJTA 4FQ2L 2C3VA 4DTGL 3RDTA 4EI5D 1VFUA 3E6FA 4H1LB 3UZVB 2XTLA 1UZ6E 3NFNA 3QO0A 1I3RB 3TZVC 2OK0L 3QEGL 2CPCA 5IK3A 4M1GL 3L5IA 3C8HA 5D1XB 2V2WB 1MAJA 1ZTXH 3ET9F 3B5HA 1S8DB 1CGVA 4NHUA 3SOBL 5HD8C 1NJ9B 4HV8A 5BS0D 1CLYH 1VPOH 4ONHA 4KTDL 4Z7QF 1F11A 1MWAB 1K4CB 5D2LE 1DVFA 1RK0A 2ICES 4W6WB 5SX5H 1D9KC 3AB0C 5C7XH 5C0RH 3JUZA 3SEPA 1JGLL 1DANU 5IJKA 4FQCL 1Z0MA 3K4DA 1V3KA 1WJ3A 3W11D 3EYVB 4MWFB 1NMCC 4JFOB 1F90H 3PABB 5I15H 1ZEAL 2GTZA 2YMXH 1QNZL 3DV4B 4HBQA 2PR4H 1RULH 2B4CC 3BKMH 3S37L 5F7NC 2AK4A 1QLRB 3B2VH 2QSQA 4NDMA 3MOBL 3GSVB 4K71C 1T5XB 3MRNA 1DBJH 1NL0L 3QQ4B 2VB5A 3KHOA 3WUWB 4WW2C 1JK8B 4LEXH 3VXUD 3WHE1 3HNSL 4JANB 5TDOB 3SO3C 4PP2B 4R2GC 3SY0A 2MWCA 4HW6A 3VRJB 1MCJA 1AY1H 1H0DB 2W07A 3CVIH 3ARBD 2W0LA 1I7RB 2Z91A 5GIRB 1DQDH 4PJBF 3EO9H 1IGFL 3KLAA 1JUFB 3ROOB 2Z92B 2CR3A 5KS9E 3QRGH 35C8L 3RL2B 5BOZG 2CLRA 1NFIA 4S2SA 1T2JA 2XRAH 3DVFA 4PRNB 4M4PA 1E4JA 4C83B 4AT6A 3IRPX 4K8RH 1PJ9A 3D0VB 1KF9B 3BEVA 3W39A 4ERSL 5FOBB 3F6LA 1YN6B 4EI5A 4O2CA 3NA9H 2F5AL 4M5ZL 4XNMA 3IKKA 3G04A 1DZBA 3QUZC 4U1SB 5F6IC 5C86A 4PJ9C 1BOGA 1I9RH 1KJVB 2YN5A 3RKDD 1U3HC 3N06B 3OKYA 4PG9A 1OAKH 3T0VA 1KXQE 1MRDH 2APFA 1JZ5A 3PV7A 1WEJL 3MR9B 1B0RA 4LGSB 3OKNA 5FHAH 1YYLL 1HKLH 3QIBB 4MQSB 4NO3A 5J1SC 3B4NA 4UTAL 4IDLA 3LEVL 5I1DB 3U2SA 1G7HB 3AM8C 1A7PH 5CD5C 3VXSB 2A83B 4M6MH 4FABH 4OCRH 5MP6H 2RFXB 2SEBA 2ZG2A 3QG6B 4LLQB 5DJ0A 1HQ4B 1REIA 1PEZA 1UCBL 2CKBB 3O3BB 3O2DA 1I9EA 4P46C 3QCTH 3VWKA 4XP9H 1TVBB 3JSSA 5GISH 5KSBE 1JNHB 3MUGA 4D9QE 4LHUB 3OG6B 4YDJB 3OXSA 4OLWH 4LCUA 3BH9B 3OAYH 2Q86B 4F7MB 2FR4B 1JHLL 2CLVA 2AKRA 4XMLL 3HPJB 5CSZA 1HKFA 5EU6A 4IS6B 4LCYA 1HHGA 1JPFB 2VDLL 4NQEB 3VXNA 1EEZA 4KQ4L 3DO7A 3WO3B 3MGAA 1RMFL 1GAFL 4RISL 2V7HA 4J23A 4RWHA 3MGOB 3QFJD 4NN7B 3FFDB 4Y19E 3RNQB 1CFQB 4ZS6D 1IM9A 1MFCH 1E4WH 1NGQL 3I02B 3LIZL 3SJVE 4X80H 3BWUC 1X9QA 1T6VN 1FVDA 3T08A 4RX4D 1U95B 3TVMC 3OGOE 4MDJB 3LEYL 3LKPB 1I4FB 2C1PB 3QFJB 4P2RE 1G9EA 2PXYB 3WXWL 4MQXC 3O3AB 4HXBH 1N5AB 3BP5A 5EWIH 5EBGA 1UWGL 4TQEL 5DD5L 3WHXA 1RFDL 3EO0A 5IG7A 4P2RD 1JGDB 5I1AA 4MD0A 1P2CA 1FGVL 1MLBA 1QRNB 5D1QD 5KBNC 5JPNB 3S7GA 3P4OB 2ID5A 4I0CC 3MCLL 3CMOH 5C0AB 1HHJA 3D5OF 1A6WL 4MNGE 1LDSA 2AQ1A 5L2KE 4PGEB 1M6OB 3N9GH 4HG4J 4JB9L 4NKQB 1KB9K 3IETB 4QXUL 5DJ8B 4HS6B 4OLXH 1TITA 1YUHA 1F4AA 3DIFB 4QYOB 4A6YA 32C2A 5C0AD 2I9TA 1P1ZB 1QP1A 5I73C 2X9XA 3QFDA 4JRYB 4Q9RL 2QQKL 1WBZA 5IMOA 1JHKH 1CL7L