4BGLA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
b'ELFQTADWKKEKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE REDUCTASE
publication title Superoxide Reductase from Giardia Intestinalis: Structural Characterization of the First Sor from a Eukaryotic Organism Shows an Iron Centre that is Highly Sensitive to Photoreduction
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 24
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bglA00
1VZHA 2AMUA 4C4BA 3QZBA 2JI3A 2JI2A 1VZIA 4BK8A 1DQKA 4BRJA 1Y07A 4BV1A 4C4UA 4BFFA 4BRVA 2JI1A 4D7PA 1DQIA 4BGLA 1DO6A 2HVBA 4BFKA 1VZGA 4BFJA 1DFXA
chains in the Genus database with same CATH superfamily
2ZP9A 4PJHB 1UFUA 5IVXF 4ZS6C 4DQOH 5KVFL 5EBWB 4U1NB 3P02A 4PS4L 4KX9A 2QQQA 2XKNB 4LE8A 2VLLB 4HIJB 4B7IA 5CP3A 1QNIA 3HAEG 4JFDD 3HZYB 3QDGA 2X2HA 5C8JA 1NKOA 1GYWA 3VTMA 5K9QI 5HD8D 1CK0H 3MJGX 3ZTNH 3GSNA 2J7LA 4FFZH 4KTGA 3AREC 4JO1L 3VFGH 2EUXA 2WQRA 4ODWA 4KVPA 3BUPA 1RUMH 3C2AL 3RVXC 3FW6A 2R0LH 3PGFL 5AW0B 3QDJB 2QPFA 2Q10A 5GGTL 1H9VA 1HIMH 2BW4A 3K71B 4LARL 3QFJA 3DETC 2GJZB 3NJGA 5DDHB 2CDGB 3QC5X 4Q89A 5D7KE 1ONQA 4OBSA 1HNGA 2BMKA 4NKMA 2WZAA 4YDZA 3D06A 4IOSD 2I7SA 4ZUWB 1S7VB 4EZLA 1TETH 1M3JA 4OF8A 5HHOB 1HL5A 4HJUA 4QXGH 4ONHA 2J8HA 2PYEA 3CSYA 1FZOA 1K5WA 3GSWB 4XNXH 5EHFA 3WN6A 3F6IA 3ULUD 3SYCA 4NC1C 4ODHL 3ZKSD 4F58L 3WTTA 1TQCC 4K94L 4MDRA 1XCXA 3KBHE 3FU7A 1XSOA 2ESVB 5SWZE 4K8RD 5E9NA 3N85L 1NGZA 2BOCA 4W9GC 4CAGA 1JYWA 5K9QG 4Z95L 1U33A 2X2JA 4XXDB 1A7BA 1QZNA 4U7KA 2YXMA 2AK4D 2KHAA 3T08A 2FT8A 4ANXA 4MMYB 3DV4A 3TJHC 3TIEA 1MCHA 3ILQD 1LK2B 1TZOA 4HFUH 1BV8A 5ALBH 3EW3B 2D03L 3ETBF 2ATAA 4MQSB 2ZNWA 1WA2X 2FSEA 2QDWA 5KUMA 1SY6A 4ZMTA 2HZHA 1D6EA 1OEZW 4MYPA 4Z3JA 1PY4A 3MR9A 4ZW8A 43CAB 4MQ7B 1MREL 3VFUA 1JGUH 4KJWD 2OMTA 5DD1H 4Q2ZA 4IKKA 2EYTB 2BSSB 4M6NL 1N68A 3FOLB 2DBLH 3EDKA 4KO5A 5T5FH 3UTTB 1X5XA 2F7OA 4PJDE 2PCPB 3IGKA 5KSBE 1DVUA 2F15A 3PQYE 1Q1PA 1VCBC 3OAWA 1Y7VA 2V9TA 4PJ9D 5EU5B 3S5LG 1IO4C 3BI9X 3GJFH 1UJ3C 1NCGA 4JFFE 2AMUA 4ODXA 5I8EB 4X7DC 1MCOL 1FVCA 3NSFA 5CHNB 3BWZA 3MTXA 5JQ6H 2VN4A 2Z7UA 4CC4A 4ZXBA 4H2CA 4Z3FA 3SKMB 2EUZA 2X6MA 4NRZA 1UYWH 1RQ5A 3D07A 3U7WH 4OZFB 1EAPB 2WLHA 4LVOC 4Z78A 1N59B 4WK2B 4PP2A 4AE0A 3LMJH 3STLA 3OVUB 5F3HB 1E67A 2Y7LA 5KSVA 4WO0A 3UTZA 1O6VA 4GI8A 2R29L 5DJ0B 3D39E 4LP4A 5DGRA 4IHOA 1BZ7A 1URIA 5I5IA 2AK1H 1N2RA 3ALXA 3GTTA 2NQCA 4C59B 1OT2A 3DPBB 4JG9A 5TDNB 4AEIL 1UWEH 5KYYB 1C5CL 5GRUH 5EN2A 3MCYA 4HYTB 3V4VB 3WTWA 3D4GA 5BS0B 4LCIH 3PY9A 4JZJC 5EU3B 3V52L 1JI1A 2W81C 4G5AA 1JGVH 3BEWA 3VACA 3T6VA 3ASNB 4DZ8B 5JW5B 2XWBB 1DQJA 2ALWA 2HLAB 8PAZA 2UY7A 4N2CA 4PJEB 1XGUB 1L6XA 4AMXA 2BNQE 4FQJL 4PS3A 1UZ6E 1FP5A 1KC5H 4HS3A 1DVFB 2N3JA 5BUPA 5K93A 2PTVA 3ZBMA 2VN3A 5DMIH 3QCTL 4OF3A 4GFXA 1WBXB 4LKCA 4F7EA 5HHQA 4MCZA 2WXOA 3D3VB 1UXSB 4E42B 3WO3B 5J6GA 5HHVH 1UKTA 4U2ZA 2UYLA 4PJIA 5D70H 3O3BB 4F1ZA 4OCWL 5C07B 4I18B 4U0RC 3KS0H 3WDHA 4D94A 1A3RH 4HX1B 4U6HB 1CDCA 2ADGA 3L4WA 4GKSB 1SXSA 4UOW1 3QC6X 4TLSA 1GH7A 3RWGB 4XPAL 1QRND 1HINH 4GIAA 4K71C 2GPZA 4YBHA 4FKEA 1W72H 1A6ZA 4KUCF 2BVOA 4H8WC 4RAVB 3IT8D 2I7OA 4WV1A 3AG1B 2MPAL 3HUJF 2C26A 3DXAE 3BT0A 2CO2A 1U8CB 2QVKA 4R97B 1A9EA 1J1XH 3GNMH 3BH4A 1JRHI 1E4KA 1I8KA 1G1OA 2F6AA 3FZUD 3JSSA 5I0XA 4KZEL 3I6KA 4M3HA 4YDVA 3KL0A 4MCNA 2O5XH 2ZOLA 4XPFL 4C58B 4LCUA 1SHXA 3FUKA 4HC1A 5FAAA 5I8OH 2VDKB 3F7VB 4JDVB 5K39A 4JHVA 4IRSB 2L3BA 1L7TL 3PGDB 3LXCA 4BSWB 1YQVH 2FQGA 3HHRB 3REVB 3WKMH 2Q1EA 1FNLA 1E2ZA 4NN6C 1GRWA 4U1MA 1B88A 1E9PB 3GXPA 3V6ZA 3VD0A 1PZUB 3U1QA 1NFKA 4MTMA 4KWUA 5E4AA 3H1ZA 4IMLA 2Y7OA 1G6RL 3MUJA 2A4ZA 3SB3A 2GK2A 1I8IB 3VXRD 1CL7I 4ZFZB 4PJ5A 4F9PA 3MODH 3IDYC 4MB5A 3SDXA 5HVFB 3MA7A 2OSYA 2EEBA 5I0ZA 1HHJA 3C60D 4L4TE 1KBGH 3B7RL 2E7CA 4L4JA 3RDJA 3US1A 4QRQA 2QZQA 1P2CA 2FLMA 3DI2B 3G5ZA 3GSUB 1E4JA 4P23C 1JK8A 5GRVL 4BQ6A 2EABA 1AZNA 5K9KA 4EUPB 2R1WA 3CHQA 2CA4A 4GO6B 3R06B 4MBRA 2OAAA 4PW9A 1O7VA 4WUKH 4O02B 1SXAA 4C4KO 2NY0D 3FT0A 2J8OA 4ZMQA 4Q14A 4A6YA 1NINA 4ABWA 4M8VA 2UWEE 3CX5K 1KIUB 1L0QA 5HHXH 4J3XA 3A67H 2OJZH 1X3DA 4X6EA 1NC2B 3MRMA 2DQJH 3HPJB 1BVNP 3KHQA 3L2MA 3N43F 3HVDA 4MWFB 4X6FB 1HI6A 2C34A 3DHJA 1FHGA 3HLAB 4MJIA 3SJVD 3UPAA 2OI9B 5ACZA 3WAJA 1YLBB 1KN4H 2Y69B 4AQ1A 2YPVH 3HZMB 1ACXA 4KMQA 2CM5A 4ETYA 5CZXD 5HYJE 5CEYB 4ZMOA 3VWJA 3JWNC 1AO7B 4DVBA 3D0VA 3B9VA 4QRTB 2VDLH 2OX5B 4NJAH 3IXAB 3WGUB 5FW8A 3MXVH 1FYTB 3QQNA 1E7UA 4R0LC 2BIIA 4J8RA 5CEXB 2FVNA 3FUHA 1NCBL 1J48A 5IEKA 5CP7A 1E5UI 4DSYA 1INEH 3IAPA 3U46A 1LM8V 4IIQA 3GINA 4MNQD 3QEQA 1UB5B 3UZVA 1BXUA 1U92A 2NY2C 4LPCA 5FO8B 4R5VA 4FFVC 2C3HA 3AZUA 4JFDB 4E5XA 4NFBA 1P1VA 3DSFH 2ADFL 1JPGB 2NZ1A 2X4PB 3L3GB 3HEIB 5G5DA 4B5EA 1YN6B 4POUB 3LJ3A 3QQ4A 3E0GA 5ICZB 1QX1A 1EGJH 4CMMB 5JOPE 4OCNC 1XV8A 2AXJA 4HEPA 2R69A 1H3PH 1L6ZA 4HH9B 4HH8A 4X5QA 5AG9A 4P3WA 1U3YA 3QO1B 4HHGA 3FQ1A 1KYDA 2AQSA 2ODHA 3ZN6A 3VRIB 2HMIC 1SMOA 4XO4A 6PCYA 4JK0D 2QT6A 3G6DL 4M8QB 4OUUA 5E6IC 4QNPF 4W9KC 2VDML 1KXHA 1QBMH 4YDJB 5HDBF 3S8WA 5C71A 4FXTA 3SDYH 3X13B 5FEBA 4LRIC 4XBGA 4JO3L 4JUTA 3SGKA 2H6PA 1ND0B 1E42A 5DC4B 4DEUA 3S34H 1BF5A 1W0WA 2QPDB 5CXPA 1FG2A 2YRLA 4XGZB 2CDFB 1NDGB 2OL3B 3AU1A 2WD0A 2GITA 3NP4A 1UQSB 3GBNH 2BWQA 2O26U 2KDGA 1KCBA 1OARL 1VPOL 3H6AA 2H32A 5FM5M 2H9GA 4C56E 2Y06L 3VD3A 1IC7H 3JZYA 2WYIA 1BLIA 4AZUA 2V3FA 1HT6A 5EU6B 2EH8L 3CFIC 2ICWI 3MKKA 4S0SD 4IDJL 3FOMA 4NRXA 4S2SB 5E70A 4NM8H 1J1PH 1IFRA 3IDXH 4LLVB 4I5BA 4JFPA 4DP8X 1UOWA 2D7OA 3GLZA 3D05A 5F3BB 4Z7UE 3DUSB 1BXXA 4FXGA 1HOEA 3P0GB 2DLIA 2YEQA 4L9LB 1UM6H 2J6EH 4PJ8A 3MJ9L 1MJUH 2CIIB 2E7MA 4FQLH 1YEFL 3L45A 2Y3AA 1JPTH 4NRYB 5F7EL 1ZT4A 3VWKA 4R4ND 1JN6A 3U9PL 3P9LB 5D1XC 3VI4E 3TVMA 1B6DA 1JZHA 3T9WA 1HHHA 3DBXB 1RJLB 1F97A 2ICEA 5F7HA 2GBVA 3MREB 1OKEA 1XH3B 1WWCA 4JCMA 4QDGA 1B6UA 3QUYC 4PJ9B 2YXWA 2HN7B 3FRUB 1RJZA 1J9CT 2YO3A 3QEGL 2MTAA 4FFWD 5I5MA 3NEXA 3RJOA 3WN5C 4IU3B 2DDQH 1U8KB 4KNUA 1KYFA 1WBYB 2X6UA 5AUMB 1KJVA 5E1QA 2XETA 1MFDH 4Y16D 4LMQE 1SXNA 1I1RA 3LN9A 3Q8CA 3MJ6A 3ZK0A 2GEEA 3FO1A 5ADPL 4HWZB 3MLSL 1ZV9A 5CJQL 4LBEA 3MNMA 1HSAB 5IQ9B 2Y5TB 4NP4L 3PWVB 4OT1L 3FFCB 2X0UA 5JXED 4QR7A 4GAGL 1GSKA 4LQ1A 1OSYA 4EQ2A 2IDSA 1IGTB 1T83A 4H26A 4NZDA 4XB8A 5T1MA 1EHLH 3BKJH 2DM7A 3EGDB 1I3VA 1NBVL 4XMLL 4QHLA 2BZ7A 5IMLA 4RFNB 1UD2A 4FERA 4G8GD 4PRPD 3KLKA 3S36L 1AR1D 1XTLA 3KR3L 1J11A 2X4TB 3BYYA 4S11A 5HDBB 1PZDA 3QAZC 3V0WH 2PF6A 3UAJD 1JPSH 3VSTA 5F9JB 4WHTA 4ZPVA 1CLZH 1LEGB 1T5WB 3L3HA 3I50H 4MA8H 1RULL 5CD3A 4HSCX 2I9TA 1PGRB 3MXWL 3CQPA 1MCEA 2DQCH 2H8PB 2YAEA 1BM7A 2YAMA 1NSNL 4KDWA 4S0TD 2IMMA 3G6JE 3ESNA 3FU9A 4AT6A 3SE9H 4DGVH 1AMXA 1H8OA 2MRYA 2X44D 5J9PA 2OXGB 1Q9KB 2QHRH 1CYXA 2D3JA 4D0CA 3CVDA 2YPKB 4R4FH 4C83A 1QHPA 1QVOA 3OKNA 1FH5L 1XR8B 2NX5E 2V2XB 2F5BL 3KYAA 3X12A 2YLHA 4LOFA 4CUCA 4Y2NA 4G9FD 5C0BD 4UNIA 2QADB 1KPRA 1TR7A 1QRNB 3RA7L 1SMAA 1UWYA 2J71A 5SWSB 1AQHA 3W9EA 2YR3A 4UOJA 3O81A 1YUKB 3M1BA 3U6XS 1B3IA 4CSPA 1F4XH 2H0EA 2WO4A 3EG9B 4TOYL 5AVXB 4YDKH 1R5IB 4F33B 3CH8A 1GGBL 1QR1A 4P5SA 1EAQA 4FQQA 1RU9L 3LQAC 1S7QB 2X4SB 3FQ4A 4XVSH 2FO4A 4PCSA 3QDME 4W9FC 3S3PA 4IBLT 3APMA 4GAJL 5GSRA 3WKYA 3H3PH 1E7VA 3IU4L 1EO8H 1PS3A 2V9RA 4Y0GA 4MQXD 5GGVL 5TQ2H 2XZQH 4X4ZA 4BDVA 3ZKND 3K3QA 2X28A 2PP9A 3P3YA 1CUOA 4XCFH 1IFHL 3ZDZF 4FQXC 4GXFA 2R0KH 1SQMA 4H5SA 5I0VA 3NIFB 3RWDA 1AH1A 3ZDYB 5LGJA 2EXWC 5FX3A 1F1DA 1ZVSA 1KPVB 5SWZA 4B9ZA 2VQ1A 5C86A 4AI7A 1D5RA 4BWWA 4YAQA 1TJIL 2FJGA 1O7DC 2BRRH 3S3DB 2WNWA 1TZGH 1IX2A 3MBXL 5KBDA 3GSXA 1LWHA 1MI5A 5JIPA 3JWDC 1QLEB 1A2YA 1S5HB 4S1DC 3VA6A 4A37A 2NY4D 2IMNA 3APNA 5SX5K 1IGCH 3RPIB 5D71L 1YMMA 4HLJA 3C60B 2EDTA 4BQCA 1ZLWH 3TYFB 3T3ME 5DHVH 4Z8FL 4R7DB 1QNZL 5ENWB 3VXUE 3ROOB 4ICWA 5L7XL 5FYJH 1DLFH 1Y18A 5F70A 3JWOL 1L9RA 3VE0A 4WJ5B 3TO4C 3TBCA 2VXSH 4FRWA 2JMRA 3NZ8B 1JGLL 4XC1H 4N86A 5BZWB 2NY0B 2YD0A 3BVWA 1AACA 4ZUTA 2HXAA 3S37L 4KKQA 4WAFA 4PJDA 2Y5EA 5M7QA 4Q6IC 5KSBA 5BW7A 1Y6NR 2ZOUA 5KVEL 1U3HB 1MCJA 3PQYA 4NO5B 1ADQA 2KLSA 1A14H 2CKBH 4KUZH 1NGYB 3IJ9A 5I8KH 4K3JH 1I3GH 4MMZA 3SJVB 2IAAC 4JFFA 2PO6C 3TC9A 1JZ4A 2CUMA 2YKLL 3P3TA 5GJSL 2PABA 1ZGLB 3WBDA 4NZTL 3VGAB 1A3LH 1G9MH 3O8XD 5CU5A 4GFTB 5EBLB 3MV7D 1S7TB 4DWHA 2WBJB 2DD8H 4ZI8A 3QUHA 4MAZA 5DO2D 1R33A 3HAEH 3ARPA 3DX0A 5DRZB 2BLFA 2XQBH 5DVMA 5H94A 1QFHA 2B59A 5DJYB 1AG0A 2J56A 2DQEL 4NO2B 1DJXA 1JXGA 4A68A 4KY1H 3ULVF 3QIWA 3P4OB 5F6IC 3BAWA 3CN3A 2HLFC 1XR9A 1R4XA 1Q9OB 3IKKA 1JYXA 4MNQB 3D39A 2JI2A 2J73A 4MAUL 4LZKA 4X2UA 3W38A 3LKOB 4WTWA 3N04A 3IJYB 1XSJA 2B8OT 1RZ8A 2AZUA 3FQNB 1AIZA 5DJXA 1PD0A 1D9KC 3QQXA 4DPAX 3M88A 3LZFL 1I1AD 1JV5B 3LRLA 3X3GL 4WJG3 3O0RL 1OHQA 1XVSA 1PQZA 5CINH 1CF8H 1ZHNA 1DANU 5IR1B 1SY6L 1C7TA 2VWEC 4GSRA 3EDDA 4WY7L 1WZAA 2BNQA 3SPVB 1SM3L 1HE8A 1TJGH 3AS1A 1R3JB 5DMGD 3MCKB 4F93B 4H8HA 2VDQB 3PPEA 4O51B 2J88L 3Q2NA 1EZLA 4A2GA 1JOIA 4K5OA 1YSOA 1EWHA 2WLJA 4M43H 4QYOA 3PV6B 4BKTC 3QJQB 1YEWA 1DQKA 1XF4A 4FFZA 3FQTB 2VQUA 1CD9B 1NLBH 4FNRA 3BO8A 5IZ7A 1VFOA 5FYLL 5GSVA 2JKTM 1KUMA 1H5BB 1F4YH 4UBDD 2JJUA 1T3FB 3AMLA 4OCSH 3VRLF 4LP5A 3ASOB 4P9ML 2OTPA 4JPWL 3TBTA 3HPLA 3MOAH 4L2YA 2GSIA 4UQ2A 4LCWE 1M1SA 2Z93B 1A6UL 3V5HA 4LLYB 4RIRB 2QMJA 4XNYL 2G75A 4UT9H 5IVZB 5K33A 4PVMA 2Z8WC 2WBKA 4KTDH 2HPOA 3BKCH 3NCJL 4DPBX 4IEFA 5JPNB 1TENA 3DXAA 5JORA 2IH1A 4HHAB 1KTLA 1FV1B 2XVBA 3IFPA 1R5VB 1M6OA 4QXTA 3FB7B 1CT8B 1M7DA 3AW5A 5D1QD 1TTUA 3VFPB 3CN4A 4QEGA 4YO0B 2EIMB 3G5YA 4Y2LA 4U0QB 4W70A 3T4AB 3T2OA 5D7JB 4P9HH 5C3LD 4K23H 4DEPB 1OTUD 4GRLD 4U1GB 1GGUA 4YSOA 4YWGH 4YVUA 3T0EB 3KLSA 1XD1A 4R96B 1JF5A 1QYGL 1DANT 4XZUB 2EC9T 2CNZA 3VAEA 5IFHL 1M1XB 1OAQH 4FLOA 1XXDC 1A7PL 1N12A 5DA4A 1ET8A 4JFWA 4NSKB 4K5LA 3UJJH 2AMGA 2IXQB 3C6LB 2UZPA 1JPST 1NTDA 1WRFA 2GT9B 4K9EC 4B53A 4L0YA 1ASQA 1OLLA 4JO2H 4NQDE 1BIIB 2NR6D 2NY5C 5FYJE 1FORH 1IGML 1V7MH 1JGDB 2XG5A 4JM2A 4X4XB 2FR4A 1LWJA 2VM4A 1DTUA 4NP9A 4L4TA 3BGFB 5F96L 1S7UA 4WU7B 1IKFH 2WXKA 1I7ZA 2FB4L 1XL6A 3P4LA 4P2RD 5A16A 4Y16B 1X5YA 3IDGA 3OB0K 3BWUF 4X0KA 2YZ1A 5T5FA 1HJCA 2IDQA 2R59A 4RX4A 4XVUC 4HPYL 3CZNA 4X0NA 4Z3HA 3AAZB 3HRZB 3EUUA 1UH2A 4KTYA 3NN8A 2PWEA 4NQQA 2WLIA 5D7EA 5EZJA 4PJAE 3HFMH 2ZUYA 1JK9A 4IU2A 3MJ8B 1OP5K 2UWEA 1KIRA 2EDBA 3ARGA 3EYUH 5AB1A 3K6SB 3K6OA 3RIAF 4K7FA 4PJCF 5LN4A 1JNNH 3BHBB 4AY0A 1UXMA 5J12B 2NDFA 2RCSL 2AJ3B 4P4KD 4J6RL 5E2JA 2DIBA 5JXEA 2R7EA 4JCWA 1KMGA 4G8GB 1NC4D 4PRPB 2CLRB 3OKKB 3OZ9H 1S9VB 1ZWIB 3PNWA 5GGRB 2BSRB 3ZE2E 4L2LA 2FEEI 4NKOB 2C9XA 4FKHA 2ZKWA 5EC2A 4BK5A 5MHSD 2BSCA 3DHMA 5E2WL 5HYJA 1BFTA 3UTOA 1EXUA 4HC1L 4A2LA 4AQAA 4PV8A 1V8HA 1PSKH 3I02A 4JPIA 1F4AA 3V6OE 2BSEA 2IVFC 3RGVD 2Z8SA 3MACL 1H3XA 5BO1H 5B7MA 1F90H 3AROA 3KDMA 1F1AA 1IFGA 4N28A 5F9WB 4DVRL 1A5FL 2BP0B 4I1RA 1BAGA 3H9SE 2LV4A 4DGUA 3FU0A 4ZNEE 4TMPA 3D0LA 1YEHH 1SLUA 3T0AA 4AL8H 4JFZL 4JHBA 3LRHA 4XHQA 4WTXA 3EOAB 2B9AA 2HT4C 3CLEH 2OV0A 2WWMD 2W5PA 5IROA 3MRRA 3CZFA 2IOMA 4G9FB 3U2SA 1CICA 4BHUA 2AHIA 3IJ7A 3DJSA 3ARWA 3UTQA 2QSQA 1IJNA 1T66D 1NCUA 2F19H 3V0AC 1P6FA 5I18L 2W0KA 4M7ZB 3AUVA 3LV3A 4ZO9A 3OKLB 4G7SB 1GMIA 5HYQB 2HG0A 2ITCB 4M4RB 1D7CA 1N8ZB 1WIOA 2VJ8A 2V7NA 1TVDA 4JFQB 1RKRA 3U4AA 3MLVL 4R97C 4A6YL 1IAKA 1TZIB 4RGND 5BXFB 4Y1TA 2UXFA 3H6JA 3SDDA 3WJMA 1MRFH 3E2HB 1MFEH 2OBGA 4Z7VF 3SE3C 1W72A 3L1EA 5L4MA 3U36A 2SEBA 5IQOA 1QR4A 4GKLA 1U6AL 4ACTA 1OM3L 5DYOA 4TULL 5I17A 2ZXWB 4IRSC 2WZ0A 3L4CA 1J0ZA 1WZLA 1CBVL 2HRHA 1QHQA 4DZBB 5KSUA 4KK9C 4B50A 3MV9A 4J6IA 2PCFB 1I7TB 4E41A 3LPFA 5IP4A 2AJUL 2WXIA 4RMSA 3U48A 3KGSA 3MBED 5CR8A 2XWJB 4G82A 4BE5A 2OSLB 1AI1H 1GJUA 1X7TA 4UNUA 2OFQA 4YOKA 4PRHD 3OHXC 5HPOA 5CGMA 4D2NA 4HPHA 2B1AH 1CURA 4OJEH 2JLLA 3EJQA 1BM3L 1BBDL 1NCDL 5FC9A 2OZ4H 5MP6H 4KMLB 4L3FA 4HMCA 2V2TA 3DTXB 4DETA 5I6KA 4ZSOE 1R47A 4HUWB 2HTLD 4BYHA 4U49A 5I2IB 2YBRA 3UYPB 4GXUN 2W60B 2KMWA 2K6WA 4YR6A 2BIHA 4RMBA 5LDSA 2A83A 1XDTT 4TYUA 1X6NA 3HS9A 4C57C 3BPOB 3RGBA 1GOHA 3U9UB 5JOEA 4FQ1L 4L8DA 3OR7A 1BIHA 2HFTA 4XVJH 2R69L 1WF5A 4F8PA 4XN9A 3B4NA 2X2YA 5CEZL 3QUKB 1AE6H 5KEZA 3KG5A 4EN3D 1CFTB 1G7JA 3E1ZA 3IB4A 2C3VA 4MGXA 4Y19D 1TOXA 4ACPA 1JV2B 1P7BA 2OI9C 4QPEA 2HYMA 4ALAC 3O8XB 3D25A 1NAKH 4Q6YA 1MFCH 3MV7B 2CM6A 2VLMD 4KX7A 1RUPH 5E03A 1E27A 1WAAF 3QPXH 4NN5B 4MMXA 3QFDA 1T1WB 3MJWA 1O6TA 1QSEB 3MRHB 2KZWA 2WGXA 2FGZA 5HDQL 2ENQA 4D3CH 5J4MA 3QWRA 4FZEH 3JV6A 4YX2H 3VFMA 3VFRA 1IEBB 3BP7B 3BD3A 1GZHA 5LDUA 2YPVA 2H2PD 4L3AA 4ADIA 2ZPKL 4UZSA 1FVDA 1CE1L 5F0JB 1SEQL 3EJZC 3KJ4C 3HNSL 4NQSB 3BDYH 5DJ8B 5TPWH 4P5KB 2XC8A 5EA0H 2VJXA 1HE7A 3FULA 1QSFD 4XC3H 4Y2DA 3L4VA 1I1AB 3BZEA 3NDYE 4LPTA 4RETB 4XR8C 4X5PA 4DGIL 4ADJA 4A2MA 4ODSL 3HCVB 1I31A 4N1CA 1QA9B 4KRLB 1SYSA 2YD7A 4GW1B 1WS8A 4UB0H 1BZQK 2UXTA 4HUXA 1WWWX 1M7IA 1KENL 3G6JA 1P4LA 1YJDC 5DQJB 5TE6H 2OMYA 4HKJB 4NHCH 4DHLA 3FQWB 1NKRA 2JQAA 1G6RB 1YYML 2VERN 3TA3D 5JPMA 2ZX7A 3C5ZC 3MFFA 4AYFA 4NYLB 4U3SB 3OKOA 4MZIA 1EGJA 1RLWA 4RGOH 1W2KT 3O45B 3WAKA 4C55A 3KL3A 5CCJA 3JTBA 3UC2A 5CFHA 4ZUSB 4WI2A 1MXDA 32C2A 4EXKA 1CFVL 3F12A 3QDGD 3GMLA 5GGRY 4X6DE 4WHDA 4AV5A 4EQ3A 4WK0B 1IAIH 3RL2B 5JDSA 2VDNL 4FHBD 4M6ML 1PW3A 3C5JA 3NIGF 4LEXH 1HCFX 4NO3A 3QDMA 1MCCA 1P6AB 4HLZG 2W0FA 5D1QB 1SJHA 2XBDA 3SKNA 3TX4A 5LJYH 5IMKA 5HI3C 4AC4A 1IKNA 3FU3A 3QFJD 4GRLB 2VE6B 4PCYA 4L23A 3Q48A 4CILA 5I19H 4C4BA 4HAFA 4FEIA 3WFBH 3UG4A 3WKNA 3GBEA 4L9LC 4TSBH 4BFIA 2Q8AH 1QUNA 3VFSA 4NO0A 2PYED 3K6IA 5F8QC 4KJWC 2AQ3A 2ZX6A 2YD9A 3HC3L 4KXZI 5GRJL 3LNEA 1BFVH 3BUQA 1C7SA 1G7PB 2DQIL 5DD5H 5MERB 4Q8BA 3B3IB 5JO5B 4OZIE 2DQHL 2J6EA 4Z5RB 4Y5YB 1T0NA 2VB5A 5BJTA 4OFDA 1KTCA 3GMPB 3IFOB 4PJ9C 5C09B 3FTGB 3VMOA 4NUGH 5DRWB 4O2CB 2QR0B 3GMOA 1WE5A 4FCHA 4NZUH 1AC6A 3WELA 3GSQB 4P2RB 5C08E 1K8IB 2A9NL 3DJTA 4HS6B 4G8FB 3UO8B 1ZE3H 4Y5VA 2X4UA 1W0VB 3UC0L 3ENEA 3X14A 1NMBL 2RHEA 1T03L 2YAPA 3TM6A 2VDPH 4JN2B 4P59H 4JPKL 4WTQA 4IIZA 2XV3A 5K1VA 2WUCL 1OGAE 1CLYH 4P4KB 3FSZA 4GG6F 5BQDA 1TCRB 4H4NA 2VDMB 4WDIA 1HNFA 3HG1E 5CSBA 1LE9B 4RFNC 1VKXB 2YAOA 1S78D 2A77H 3B8SA 1RIHH 1M7UA 3Q3GB 2JJSC 5FYLD 1XEDA 3T8MA 4GG6A 9CGTA 5KZCD 5EC1B 3DLQR 4PREB 2KLTA 4BQ9A 4BGDA 4QTFA 3RGVB 2Y7NA 1Z3RA 1XSKA 3RFZB 2IH8A 2Y36L 5ABDE 1J5OL 1PZBA 2WBWB 3PL6C 3UP1A 4ZXBD 3GC3A 2NTSP 4MJ2A 1DDHA 3FT1A 3NFNB 4GBXC 5CIPB 2WMPB 3K5SA 1ID5I 4FA8A 2EE3A 4BXSV 5IGXH 3ML9A 2BS8A 4O5LL 4QHUB 3RY6A 1HHGB 1I1YB 4QXWA 1CFNA 3W3BA 3L5IA 3WFEH 3VD2A 2DWTA 3VI3B 1JBJA 1FIGH 2CUAA 2X88A 4LEOA 4Y8DC 3ZU8A 3UCQA 2D31B 5IJKC 3JTSB 1Z3GL 2QADC 4LPVA 4U7SA 4FI6A 2WWOA 4IRZH 1S7WB 1HKLL 1AP2B 4HD9A 2QFPA 4HJGB 4KROD 3OM3B 4Y7OC 5DUMH 3U7AA 5AL0A 4Z0BL 4D8PB 1BZ9B 4FNUA 3WDIA 4F7PA 2PXYA 3DUUB 4K3DH 4HUUB 2F8XC 2YSSA 3EUDA 4U1JA 1BOYA 3DGGB 2OK0L 3NQIA 4G7RB 3FN0L 2CH8A 5EZLB 1HFUA 1F00I 1U8QA 4RGNB 1ZIBA 2MH4A 2YA1A 3D30A 2FH6A 5C6WH 1PAMA 4AGLA 2G3NA 5IQLA 3L4UA 5D7SH 4AJ0A 1UKQA 2CALA 1XFPA 3T6QC 5IMOB 3MLPA 4F8QA 3U30C 4A7UA 3AT8A 2JCCB 4QRSB 5HDLA 3LKSB 1JFQL 1S9WB 1OAXL 4YL9A 3ZIMA 5M95B 4EDWH 1GPOH 1NJ9A 3BLBA 3O3UN 4POYA 1IL1B 4LHUA 3V10A 1MKFA 3SBQA 1DEDA 3MHZA 4NWTL 3KPOB 1MCFA 3MBEB 5FDWA 4Q0XH 5T3XH 1XB3A 1V10A 3X3FH 2W65B 2CPUA 3X1FA 4X5WB 3K81A 3M1CA 2DIAA 2Y22A 3EJRA 4FYQA 1QQDB 4G6AD 4A04A 5F3FA 2WPGA 3SGJC 2P46B 4PRHB 4NCC2 4PRIA 1JMXA 1UEYA 2JKXA 5IHUL 1UH4A 3AXLA 4P2OC 5AQ0A 5GS3A 2IPKB 2HLEB 5D7IE 5FF6A 1CU4H 2UX7A 5DTFA 1RZJL 4AGOA 3F5WB 4L8SB 3MLRL 3PWJA 1BQRA 1QACA 4H1LB 2OYKA 3DX1A 3UBFA 1JWMB 4YHPB 2B4CL 4F7TB 3GMMB 3IMSA 2IALB 4NCDA 3FSVA 4LSTH 4MD5A 5AB0A 4DQOL 1ZPUA 3QQ3A 1KB5H 2J1KA 1HL9A 1X5FA 1MHPH 4H7VA 4BUHA 5CMAB 1LO2H 2FE0A 2WINB 5DHVA 4IMKA 1TUPA 2EKSA 2Q76A 4Y1AE 3PHOB 1U3HC 3WJJA 3FHQA 1NCWH 3VXPA 4KV5F 2CWRA 1AD9B 1CK0L 2H0PA 4Y19B 4FFZL 1JDCA 3CHRA 3PXLA 4UWQB 3ZTNL 3T4YA 3DMMA 4KQ4H 4AYEC 3VFGL 4BRJA 4PJ5D 5JZ7C 5J1AB 1RUML 5CZXC 5IREA 4LCCB 2A6DB 2ARWA 3V7AG 2WBJC 1AGDB 2TSAA 1ZLUH 2R0LL 1WK0A 3RGHA 3HHSA 3V5KB 4ENED 3LEXA 1XF3A 2CKBA 3C5XA 1DN0A 2CO3A 3BH9B 1HIML 4APXA 1EBPA 3NEOA 3R18A 3IDUA 1IGIH 5C3TA 1MFVA 1Z0NA 3VGBA 5I1HH 4J28A 1OSZA 1XQ4A 3GK8H 1YCSA 4JFYA 5EZOH 5E8PB 1GC1H 5AYQA 1TETL 4QXGL 3HAEA 4HJIA 3MRCA 3MO1B 3ILEA 4RGMB 3RUGB 5G4MA 1QSFB 4XNXL 3OJDA 5JIDA 4HPOH 1XCQB 4MJID 3INOA 1QAWA 4DW2H 5HDOA 3C09B 3T8XB 3HN8A 3MOQA 1PX8A 5ESVB 5ITFB 4Y4KA 1OY3B 4OGQC 3NESA 5GZOA 3LRSB 2DI7A 3KBFA 3SE4A 3Q2WA 3VWJD 2D9CA 1T4KA 4I3RH 1ZOXA 2BSBA 1TVHB 1UH3A 1U8IA 1DJSA 3MRBA 2XKUA 1DL7H 3TA3B 5GS0D 4HFUL 1LP9E 3OJVC 1AYRA 3OR6B 5ALBL 4EMZA 2Z35A 4QHMA 4YFDB 1G1CA 3N1FC 2ZYIA 4RMTA 1KYUA 4N2HA 2QTEA 2FJHB 2XY2A 3QEQD 2NTFA 5TK2A 2EO9A 1H5BC 4X9FA 1ZVHA 3WIHA 4P46B 4DN3H 1WV7T 3TONA 5DD1L 1FZJA 3TOPA 1JHTB 3QDGB 4J7RA 3DX6A 3CHOA 4KVNH 2DBLL 2WYTA 5T5FL 2ADIA 1TSRA 4OV6F 2Z4QA 3D4CA 3GZKA 3IMBA 1EAJA 5JPNC 4ODWB 3NACH 3WLWD 1IC1A 2WZPA 2F9BT 3EADA 1UJTA 3CJJA 3BQUA 1JZGA 3A23A 2OR9H 2EP6A 4Z0XA 2NUTA 4UTCA 3L95A 4L05A 4L8CB 3TESA 3QFJB 5JQ6L 3P4NA 4UT9A 3T4AC 5K9JH 5D7JC 2B7DT 5LLIC 4DEPC 1ONQB 2ZG2A 2BMKB 1UT2A 3LH9A 1KPUA 4KJQC 4NKMB 4U1GC 1UYWL 2D8KA 1A8JH 3T0EC 1I7RA 3U7WL 5T3XE 4JFEE 4MDJA 3DARA 1T21A 4U3CA 4X80H 3I75A 5I5JA 4HJ0C 2DQGH 3DVGA 3LMJL 1L4IA 4ONHB 4R4NC 4WO4A 2PYEB 5KJ7E 4XMKH 3CSYB 4XOBA 1TYRA 4PBWD 2VM9A 3JVGC 2F1AA 2VW7A 5B3SB 2ZUSA 1SN0A 2AK1L 5CJOH 5AZEH 3FU7B 3C6LC 4GRWB 2BOCB 1UWEL 1TDQA 5I75B 4YBQC 5GRUL 4FZ8H 1VAHA 1SBSH 1TQSA 4MDIB 4HGWA 4LCIL 4BKSC 2EE0A 3UTSE 5ICYA 1EK3A 1JGVL 3BGFC 4K0OA 3VQ2C 4RRPM 5L4IA 1F11A 4P49A 1MOEA 5EO9A 3EGSA 1BLNA 4NBXB 4LF3A 4R3SB 3BUDA 1KC5L 4Y16C 4OZ4B 3TV3H 1RLBA 3V4UL 3K7UA 2FSEB 4Z7OE 1F86A 5CGTA 1IU1A 3AVEA 5DMIL 3TPKA 1DJZA 2HCZX 4PJ8D 1ZV2A 3REWA 1XH2A 3SQOH 1GZQB 5I73B 2B15A 3MR9B 4HDIA 4H44C 3VWKD 4PUBH 1R24A 3PAVA 2CHZA 1IM3A 3VFUB 2LABA 2WVVA 3ATBA 5HHVL 2OMTB 1T22A 3TVMD 4Q2ZB 4WI7A 4AQEA 3HA0A 4FX5A 3LIZH 5D70L 1CQKA 4L4VE 4ELME 3RG1C 5F93C 1B0GB 1A3RL 1PZ5B 1Q0XH 2JWYA 3ECQA 4PTUA 5DS8A 3TN0A 2AQRA 1HINL 3IDJA 3PHSA 1HEZB 5MEOA 3RHWF 4IHBA 1W72L 3UAJC 3LPOA 1RIVH 4KGLA 4OQ1A 4PJBF 4ODXB 2XWTA 1H8SA 1A9BA 3MRGA 1FVCB 5L2KE 2PLTA 5K59E 1HH6B 1KYAA 4AQ8A 1J1XL 3GNML 1NIBA 4K94C 3VU2A 4AUJA 4OLWH 2H3XC 2P43B 4NRZB 2EDEA 2XTSA 2V5MA 4P57A 5E00A 3AGVA 4I1NB 1CB4A 1MELA 4LSSH 2O5XL 4Z78B 1FFQA 2H3NA 4PP2B 4NUPA 3STLB 2IDFA 5HTSA 5FDYA 3UTPD 1ZLVK 3VJ6A 5LBVA 4OV5A 1BVKA 1OQOA 2ZXEB 3UTZB 1YQVL 4UZUA 3WKML 1RZIA 3BGMA 2BY2A 1N2RB 1VZGA 1KGUA 4NQEE 3ARDA 3OF6A 5LBSH 5FLUA 4PVBA 1OP4A 4KROB 2R27A 5C97A 4FADA 4HV8B 2EEAA 3IE9A 5DURB 3FUJA 1CLCA 4M7ZC 1TJMA 4AYMC 4EVNB 2HRLA 2P7TA 1L9PA 3MUGA 5KS9A 3ULUH 4ZUUA 3BEWB 3GHBH 1DQJB 4Q97A 4F92B 3MODL 1E4HA 4G80A 4Q56A 1XIWA 1NFDF 3OL2A 1KBGL 2VSKB 4HIIA 2AQTA 3CIAA 2QQKH 1ZT7A 3IJHB 4XRCA 3E2HC 3ZRSA 1DVSA 1EV2E 1N0XH 4LKCB 3NJXA 5FUCE 4EIZC 2X4OB 5HHQB 2EDWA 3ZZLA 2LFGA 3F62A 2FNWA 2GAZA 1ZSDA 1YEJH 2C9AA 3OHMB 4J3OH 3QCUH 5J6GB 4WUKL 1UZ8A 3COOA 1P4IH 2UYLB 4P2QE 1PIFA 4PJIB 5IBUB 5CN3A 4UDUA 1ML0A 2WY3B 2DJMA 1PZSA 4FAAB 2ADGB 4U4BA 5HHXL 3UMTA 3A67L 2OJZL 5CM1A 2DQJL 3BWUC 1N6UA 1REIA 3PHAA 1NFAA 1A6ZB 2BVOB 3DIFA 4UI2A 3GO1H 2DH3A 3Q8AA 4WV1B 1PZ3A 1DQLH 4XH2A 4C4KT 2XY1A 2IH3A 2EILB 1KN4L 5ILTH 2YPVL 4I9WD 1WIUA 2CRYA 4LLAA 1KZYA 4BUGA 4EIUA 1EJOH 1SLWA 1F42A 3EH5B 2H7WA 3DYPA 1MW2A 1I8KB 4G7QB 3WNIA 5KW9L 1KWGA 1ZDSA 2EXTA 3D09A 4FLHA 6TAAA 3CFMA 2VDLL 3I6KB 3K91A 4YDVB 4EO5A 4FA7B 4NJAL 1UXWA 1TSHA 4Q9CA 3MXVL 1LMKA 3T0VA 4LCUB 4WW2F 4LBAA 5K39B 5A40E 4XCNB 4TKWA 4Y9BA 1YNLH 3GPEA 4PJBB 4R5XA 5E1AB 1INEL 5KYWA 4LT7A 4V11A 3BPOC 4U1MB 1T04A 2GK0A 2OZ4A 1KFGA 2LLNA 3V6ZB 5KJRH 4IBVA 4OFVA 5SWZD 3PP3H 1OGTA 4IS6A 1TEYA 2CO7A 4IMLB 1MIEH 2OTUA 3TU6A 3QUXA 3L3JA 3WXVH 3DSFL 4F2FA 1MI5D 2AVFA 4PJ5B 3KPNA 3UX9B 1EGJL 3SDXB 5C08A 1AO7E 1WHPA 1KXTA 1LK3H 1GS6X 1YMMD 1HHJB 1GR7A 4PJFE 1YECH 3OGCA 5DO2C 4G1MA 1H3PL 4NN5C 2EAEA 1P2CB 1SRDA 2D7PA 2MNUA 1A8ZA 3G5ZB 2BNRA 3HC4H 1W16A 1JK8B 1EUUA 2VZTA 3MLUH 3MRNA 4RBPK 5K9KB 1RZGA 4GAYB 2R1WB 2ED9A 1J87A 1PG7X 1YY8A 1MVYA 4URTB 2QGDA 1SGKA 1QBML 5F7FA 1IBBA 1KNOB 3GSRA 4JGMA 3LRMA 3SDYL 1OGAA 1JL8A 2JKWA 4WFFD 4OLZH 3ET9F 3B1UA 3S34L 4A6YB 4F24A 4JDTH 2BIQA 3U6XA 5DJDA 4Y1SA 1RCYA 5CCHE 3FN9A 3HG1A 3Q5YA 4X6EB 2XG4A 3RI5K 3MRMB 3VTAA 3AY4A 3ATDA 3PQYD 4JFHE 1YC7A 3EOYG 3GBNL 1HI6B 3E6HA 1I1AC 4XMXA 4MJIB 4JFFD 5ACZB 5EF2A 5ID1B 3BPNB 5CBEA 4P48A 1DZ0A 1IC7L 3ZZQA 4AQ1B 4LLQA 4POZD 1S2EA 1MHEA 5DT1H 4F15B 2WIIA 4PS8A 3VWJB 1AGCA 3B7YA 3L81A 3OZKA 3D0VB 1E4XI 3O0LA 3QULA 4WEUD 4NM8L 3W5NA 2P48B 1J1PL 1N19A 2VR8A 3IDXL 2GQHA 5C0RH 1EJFA 1FZMA 2IPUG 4J8RB 3N41F 5B4MD 3V0JA 2ZOKB 3NSCA 3QIWD 4YN3A 5C7XH 5IEKB 3LTVA 4OLXH 3ZO0A 1SFDA 1UM6L 3KLQA 2J6EL 4FXKA 4U6YA 3V7MA 3D39D 1MJUL 3L6FB 1TG8A 2Z31A 2DF3A 3QEQB 4FQLL 3UZVB 1U92B 4UBDC 4N8PA 1JPTL 1E40A 3CZLA 3E38A 1CE6A 3ULVD 3ULUE 1OT1A 1TQUA 1CGUA 1TZAA 2ZT9C 3FT3A 3PIQB 3EJUA 3V2AR 5FGRA 4E5XB 5AW4B 3SBRA 2O5ZH 4Y8AA 3T1WA 2CIKA 2R0ZH 4LAQH 5G5DB 1E9QB 4K7PY 3QQ4B 3WTSA 4WW2B 2LLGA 3KYNA 1T6BX 2W38A 4JFOB 1DUYA 1SYVA 4RQQA 5D2NB 5HP5A 2AK4E 4PJGE 2E8ZA 2BNQD 3HFFA 3AADB 3STBA 2R2HA 2OQJB 5D1QC 2DDQL 3O3AA 5C9JA 4DUVA 3UPRA 1MFDL 5F0PB 5I8CA 3KWWA 1OTUC 4GRLC 1HXMA 3ZO9A 2WSDA 1RZKC 1KEMH 5F7WC 3BUIA 4LGPB 2BVPA 4XBGB 2GBUA 1URLA 2H6PB 1W0WB 1E90A 1FG2B 5A6LA 4JZNA 2WZ6A 1NEZA 2QQLH 2Z3FA 1DN2A 2E9WA 2NCMA 3AU1B 4BIKA 1NFIA 2DYRB 2XTJD 5I82A 4D0DA 1EHLL 2P26A 3BKJL 1H6EA 4L1DA 3WTVA 2OMNA 3ZRCC 1MVUA 3MVSA 3NA9H 2H9GB 4OD1H 4DO5A 1CXKA 4YNYA 2K1MA 3THMH 5B8CA 4MZRA 2J8UE 4QLRA 4I2XB 2VZ3A 3DXAD 4OGAD 3V0WL 2NR6C 4S10A 4Y5YC 4YDIH 1JPSL 2FIKA 4CN1A 4NRXB 2VAAA 2PKDA 1CLZL 1C08A 3I85A 3LHPH 4H1LG 3I50L 4MA8L 2NYYD 5DEFA 1CR9H 1S5IH 4I5BB 2DQCL 4JFPB 3WUZA 2LHAA 5KANG 4FXGB 1GS8A 4M93B 4PJ8B 1KJ3H 3SE9L 4DGVL 2CCLA 3O9WC 2WCPA 1ZT4B 2YBGA 4YFLI 2QHRL 1JN6B 3EOTH 3VD1A 1YAIA 2NZ9D 2YWYA 2B3IA 4LOUD 4R4FL 4QXVA 3BIBX 4FQ2H 2F58H 3TVMB 3TGXA 1NA8A 2X5PA 4AYSA 1X5GA 2N1TE 2ICEB 2IDUA 5GZNC 1FL3A 2Z64C 1PKOA 1TQBB 5B21A 4LXFA 2FJSA 4TV3A 3D0AA 3L1OH 3CFDA 1H3WM 2ZCKH 4I89A 1RJZB 3JTTA 4LLMA 3WENA 4JM2D 5TQ0H 1YEIH 4L4TD 1F4XL 1T2JA 3B2PA 3F65A 2TAAA 4YDKL 5D6DA 1FQ9C 1KJVB 4N2KA 3RFZC 1OIOA 5TD4A 2A5UA 3QNFA 4RX4D 2FX7H 4XVSL 3FO1B 3GHEL 5HGAB 2VDNB 4KI5E 2L0DA 1WT5A 4Y2OB 1EO8L 3IETA 3MDJA 5TQ2L 4J1UA 2XZQL 3ARGD 5FO7A 1G6VK 4DGWC 4H26B 3RWHA 3CDFA 2XLLA 4KJPD 4XCFL 4BK4A 3IKCA 2EDDA 2R0KL 5E9DE 2AITA 1QRNE 4QHLB 5EO1A 1TLKA 1NICA 3ASWA 3DX7A 3L5HA 4WEEA 4AYDC 3IYLW 5F2FA 3QO0B 5IMLB 1BWMA 5KWYC 2IQ9H 3HW7A 1TU2B 3QIUA 1T66C 1N7MH 2Y6SD 1MH5A 3SYQA 4NKIH 5I1AA 4ZOAA 3VH8A 2BRRL 3ISRA 5HYJD 1TZGL 4ZPVB 4AH2A 1AR2A 3H55A 1BX2B 4G70B 3L3HB 1TCMA 4N20A 3KPLA 4G83A 2J5WA 4YE4H 3QJFA 2BSED 3I9IA 2I9TB 4UOQA 1IGCL 3FO9A 4UQ3A 1KG0A 3QBTB 3LZQA 4XP9H 4YDNA 5HHMD 1ORQA 1BF8A 1DQDH 3VFTA 3Q1EA 4JVPA 1PPIA 3SZ6A 4AT6B 2WWKO 4IRZA 2J1ZA 4FG6C 3WU1A 3FFDA 3RU8H 5FYJL 1DLFL 2G5BA 2WAHA 4A1RA 1G0XA 2VXSL 4PP1C 4LPYA 4C83B 2DI9A 4QWWD 5EUOA 2R51A 1QP1A 3OKNB 3TJEH 1EO7A 3NIFE 1JCKA 3X12B 1N9PA 4N26A 4YHOH 3SDCA 3RDTA 5IROD 3P73B 1CICD 1BSIA 2QVTA 1KPRB 4I7ZC 1XB8A 4N0UE 4XB7A 3TZVC 3VXRE 5ADOH 5DFTA 3N0AA 1A14L 2CKBL 3CX5J 3MBEC 4KUZL 5I8KL 5B38B 4JFXA 3QARA 4K3JL 3ZHLA 1A4CA 1I3GL 4RMVA 5I74C 3PXHA 5J57B 3LKPA 3QHFH 4JKWA 3K72A 2AEPH 1OCZB 1QR1B 3ZHNA 1ECZA 4HJSA 2NY6D 2GHWB 3CN1A 4GSXA 1A3LL 1G9ML 3AT0A 3OSVA 1DCLA 1ZVNA 1VF5C 1ZMYA 2DD8L 4C54A 2ZXCA 1VENA 5T1LA 2FO4B 3G08B 1J8KA 1QFWM 3SDDD 5GSRB 1N64H 2XQBL 1NGXA 4L8SC 1ZKAA 4JFEA 4IBQA 3L17A 4MD4A 2K3TA 3EIFA 3W39A 3ZGHA 4BDVB 3E3QC 4KY1L 3AS0A 3DKHA 4LLWA 3I6SA 4UM9A 4PWFA 4Q9RH 1RK7A 1UZ6F 3SZKC 3HE6C 3TBBA 1RK0A 3QQDA 4EKXA 4H5SB 1M9SA 3MV9D 3RWDB 4DKTA 5A7BA 2FX9H 1DJYA 4TSCH 5LGJB 4E41D 5SWZB 1ZVSB 4AMWA 1JZFA 4KDTA 4LDOB 2VQ1B 5E7FA 4K9JA 4IW4C 2QPSA 3BT2H 4YAQB 4X4KA 2FJGB 4H8WH 2Q6WA 2HPTA 1A2YB 3U4BH 3UTSA 4HJ1A 5IIEA 5CINL 4YGAB 3L3IA 1CF8L 1CI3M 4ZQKA 2BIPA 5DLMH 2VW4A 1NM4A 1KB5A 5I6OA 5F88A 3EFFB 1TJGL 4LCCC 4TQPA 2VIRA 4E9LA 3JV4A 1CGTA 5DFAA 4N8VB 1Y18B 3UYOD 4M43L 3VE0B 1RMFH 2H1PH 5FOJA 1RPUA 3QJVB 4X83A 3S3BB 1NLBL 3ZTEA 2H2PC 1G9HA 5FA3A 2P8PA 4ZUTB 5HGGS 4L4VA 2R1YA 1F4YL 4H20H 2D9QB 4ELMA 3KEDA 4OCSL 4PJDB 3TCXA 3Q8BA 5KSBB 5D2LE 3O11A 2GTWA 4CBZA 3PQYB 4CSTA 4RGMC 3MOAL 3T3PE 4XBMA 3V0DA 4ZYKB 4G6FD 4JFFB 4UT9L 1FFPB 4DP4X 2GC4C 4KTDL 3BKCL 4PRNA 2AZAA 3FTUA 3IWUA 1UD8A 5L2KA 3C09C 3MGOA 1UM4H 2LGNA 3K1KC 5ANME 2C8NA 1HC1A 1RJYA 2B59B 1IE4A 1AHWA 5J6SA 3WS6A 3QZLA 3QWRD 3TA3C 3P3SA 3QIWB 4P9HL 3QS3A 2KKQA 4K23L 3FT2B 2MCAA 4Z7NB 4YWGL 1UC6A 5KBLA 3T71A 3B9EA 3D39B 1ZTXH 1OAKH 2JJWA 3G04A 1FG9C 3FB8A 4NQEA 2XFGB 4DN4H 1GOGA 4WSJA 1CCZA 1RZ8B 5DJXB 2V3EA 4P46C 2CO6A 3BWSA 4MD0A 5L4JA 2CU9A 1OAQL 4Y2DD 1JVOA 3JWOC 3LPPA 3EDJA 3TBVB 5KVDE 4YLCA 3UJJL 1PQZB 2R23B 3H9HA 2BNQB 2Z1KA 1FORL 1V7ML 3JWNH 5KYUB 1EDYA 3LYRA 3BZFA 5I71B 1R6VA 1IKFL 3NJHA 3ZE1E 1UVQA 2WC7A 2H2SD 4U6TA 3UH8A 4QYOB 3SGDI 3CZKA 4N8CH 2IBZX 1SDDA 3H42H 4HWBH 4XMPH 1F6FB 1BBJA 4B0MM 2LTQB 4URKA 4EJ1C 5IBUG 1Z5HA 5GSVB 1CLOH 3UADA 3O2WH 3DVIA 3HFML 5DD6B 2A1WH 1ED3A 3EYUL 4D9LL 1DVYA 3L4TA 2BS9A 3TBTB 4BZYA 3HPLB 5FHAH 2XTJB 2GKIA 4LKXA 2GSIB 2YEZA 4UQ2B 1JNNL 3UJTH 5KBMA 2F54E 3V5HB 1MSPA 1AC0A 3IDNA 1Z5YD 2G75B 3VCLA 4G5ZH 3TT1H 1RV6X 4IEFB 3OZ9L 1G4MA 3T8VA 3DXAB 3P30H 2IH1B 2VLKE 4ZTOH 3DJRA 2FJFA 5I75C 1EZVY 1KTLB 4ZMZA 2P5WA 3SBWA 1ZTMA 2BP3A 3IFPB 1M6OB 3KD4A 5EIVA 1PSKL 1M7DB 3QDMD 4A39A 1HQRA 1M56B 3GKZA 2PP8A 1JGEA 1H3GA 1S3RA 3GSVA 5BO1L 3V7AE 1XX9C 2Y2TA 1F90L 4K3HA 1JMZA 3FRPA 4LVNB 1S7RA 1DUZA 2WLZA 4YK4C 1KCVH 4HJTA 4WWKA 3WOVA 4OIAA 1YEHL 4AL8L 1KDIA 4O2FA 5AOJA 5I73C 5JOFB 3SO3B 4XPHH 1JYVA 3CLEL 3S4SA 1SF3A 1IBHA 4NO0D 2M26A 1WFJA 2ATPA 4QHKJ 2CUIA 1T5KA 2MTPA 2I27N 1CTNA 3R0NA 3EDEA 4HCRH 1AANA 3FO0H 3QEUA 4LEEA 3BIKA 1EH9A 4F8LA 1TQVA 2F19L 1S78C 2XICA 2H4EA 4YQXH 2HFFA 2XG5B 3ZKMD 3CAFA 2FR4B 3IRZA 4DERA 2EDOA 4L4TB 4PJFA 2CAKA 1NOLA 1S7UB 4K07A 3QUZA 1IBZA 1MJJA 2LW3A 4YPJA 5BZDA 2DN7A 1NANH 5A16B 3LIZA 5F8RC 3DYOA 1A6PA 3DOHA 3IDGB 3PYCA 4X0KB 2WQAA 3VMNA 4CC4C 2FJUB 2CJUH 4JHAH 3WHE0 4HBQA 1MRFL 5IB2A 3NN8B 1Z5LA 2WLIB 4HF5H 1MFEL 1WLHA 1JK9B 4IU2B 1A22B 3WS3A 1INQB 2UWEB 2JE8A 1KIRB 2H3KA 2QTVA 1JRHH 1BYPA 2PWHA 1GGCH 5E5MA 3TT3H 5FO9B 4H0IA 3GI9H 4G9FE 3OAYK 1IT9H 5C0BE 4ZMWA 5FK9A 2RBLA 3O6LH 3HR6A 3VX1A 4Z7UF 2BHFA 3CCHA 2HKHH 5I24A 3MN8A 4DP0X 4QRFA 2R7EB 3QQ9D 2EVIA 4YS4A 3O6MH 5FKAA 4AK1A 5HYJB 2Z91A 3FL7A 2OULB 1EXUB 3VI4F 1I53A 1AI1L 4AQAB 4JPIB 1WISA 1G87A 5CLZA 4GP8B 3N44F 2YUWA 2B1AL 1DO6A 2P5PA 1ZTXE 5HHMB 1QWHA 1P4BH 5IBLC 1CL7H 2OZ4L 3GBLA 5MP6L 3NYKA 2B08A 4EZJA 1GY2A 4UTBH 4HU2A 43C9B 1ZIAA 4WQOA 1HH9A 1XGRB 2YAFA 3D0LB 4LHJB 5B39B 1XGPA 4IKNA 2ITFA 4L1LA 1XAKA 2V0AA 4FFYH 4GG8A 3HJ0A 4W9HC 3MRRB 3CZFB 3P9MB 5J6HB 1YNTF 1VFBB 1SJMA 1YPZF 3HG5A 1CICB 1MFBH 1QTSA 3JWNE 5I6XB 3U2SB 2N7SA 3UTQB 4XVJL 2QFRA 3RWJA 3D9AH 4EKJA 5EIQA 3SQBB 1AE6L 3LV3B 1HL4A 1QO3A 4PJGA 4IGBA 4HEPG 2PXYD 4G6AC 4ZDHA 4QRPE 4WV1C 5FIEA 2XZCH 4NGHH 3VFVA 2NY6B 3LNIA 1N26A 1NCBH 2OMVB 4AIEA 1NAKL 1MFCL 2V37A 2Q3AA 1IAKB 4M1CD 1OQXA 2Z0BA 3CN2A 1RUPL 3CLWA 4HCFA 3QPXL 5SX5H 3K8MA 3FF8A 3SDDB 3WJMB 1C12A 1YEDA 1SFHA 2HT3C 1W72B 3WUWB 3EDFA 3MAWA 3U36B 4D3CL 1AIFA 2SEBB 1MWAA 4FZEL 4JJHA 5EIIG 1RZFH 4YX2L 3AACA 4UMGA 5DYOB 5I17B 4M3KB 1LO5A 3T5WA 5KSUB 3SGEI 4LHUD 5DMJB 4WHYH 3W9DA 4Z7WE 4C56B 1IAMA 3BDYL 4E41B 5TPWL 5EA0L 1QTPA 4XN5A 2KS0A 1GSMA 4XC3L 1MCSA 3IFNH 4FD0A 5DD3H 3RVUC 2JVUA 1M05A 3MV7E 4XOCA 4N2OA 4PRID 4EN2A 5IB1A 4F9PC 4UB0L 2BY1A 5DUBB 5HGBA 1ID2A 3GLEA 3VSQA 4L1HA 1LO0H 3RQ3A 2D0GA 4Z7UB 5D7HA 3MLTA 2YQ3A 2V2TB 5AAMA 5TE6L 2YUXA 4NHCL 2DWEA 2ZAGA 3FPYA 2ZXQA 1ZLEA 2A74A 1ZHBA 2YBRB 1LO4H 5H37G 2MSPA 3CFQA 1J9RA 4YR6B 1U8JA 4WFHD 2A83B 1GKOA 1E5CA 3D50A 4D8OA 3WY1A 2XWCA 4RGOL 3GYRA 4GO8A 4X6CE 1ZA3A 2WWNA 4LDEB 2X2UA 4PJXF 3OR7B 5GS1C 3KL5A 4FI8A 1K9TA 4DK3A 2WYZA 3DIDA 4UT6H 2P44B 5FYJD 2EE6A 3FNKA 3IWVA 4APQA 3IAGC 1G7JB 5FGBA 2C3VB 1IAIL 5TK4A 3T0BA 1IQWH 2NY1C 1VACA 3BPNC 2HKFH 3DMMD 3OV6A 4FHJA 4JRLA 4AQ1C 5B1BB 5F72S 3RP1A 2ZUTA 3NPSC 5L2JA 3INUH 4JN1H 1E27B 5B3JF 1JAEA 4MMXB 3VWJC 4O4YH 4LEXL 5C3IA 3ARQA 2X4QA 5CJ8A 4QGTA 3FAWA 4F20A 3IAQA 3GIVA 3JV6B 3VFRB 4OCYH 2A38A 5I19L 3WFBL 5HPMB 1FVDB 3EJTA 1ZHKA 4TSBL 3RBSA 5E9DA 3PDDA 5BZZA 4E9SA 2EDRA 2GTZA 4OR1A 2EDXA 2Q8AL 3DPDA 1K5NA 2IC2A 2VDLB 3EYFA 1J88A 4GIOA 1SXCA 5EWIH 1OSEA 4Y2DB 5CJBA 1MJ8H 5F0MB 3BZEB 3UAEA 3QZOA 1BFVL 1YN7A 2WLLA 5AVZB 2WVSA 5DD5L 1G7IA 1HWHB 4WW2C 2X12A 1NDMA 2FYYA 4Y4KD 5D2NC 4NHUB 3SPHA 1UGKA 4AV0A 5GZOD 4CVXB 5CILH 1M7IB 4NUGL 3G6JB 1P4LB 3ML8A 1QI5A 2OMYB 4NZUL 3EJCA 3OQ3B 6CGTA 1Z32X 2Y7QA 3AXIA 2F2HA 5IB3A 2ZUXA 3DTUB 5JPMB 3MFFB 2A4EA 3GS4A 2AGJH 4AYFB 3C6SA 2ENYA 3TTSA 2CBPA 2EKJA 3S48A 4ZD3H 1ROCA 5ITBH 2NX5B 4HUVA 1ORSA 2DAVA 5DUPH 4C4UA 3SOTA 2E59A 4TNGA 2GHZA 4H1LH 2VDPL 3T0XA 1Z66A 4P59L 3VDBA 5D93B 1CLYL 3PF2A 1U36A 1GZPA 32C2B 1ILUA 3F12B 3GMLB 5E8OB 5D5ME 2CO4A 3C9NA 3GSOA 2BNUA 2A4CA 5JDSB 2A77L 1RIHL 3PHQA 1GYAA 3ZXAC 5BO0D 1MAMH 2ZZUT 5DSCA 2WZPD 2PW2B 4P2RE 2Q9OA 4PJ6A 4JQXA 3QDMB 4IQHA 3S5YA 1SJHB 1P7KA 2C1OB 1MW3A 3BQUD 3SKNB 3UL4A 5IMKB 5IW1A 1BYOA 1I9RH 3U82B 1V54B 2MQGA 3FUMA 2ZG1A 1HS6A 1JXDA 1FZKA 2BX5A 2VR6A 3AREA 3EBGA 1WO2A 3L2LA 3PDOA 4L48A 3SDAC 3AQYA 4FXGC 4M93C 1G7LA 1G7MB 4PJ8C 5DWPA 4MSWA 5JLZA 2VT0A 4GKZA 4BFIB 2A0LC 4CGTA 3MNWB 5IGXL 2XA3A 2E3VA 3T77A 1QUNB 4WO4D 4NO0B 3VFSB 4U1KB 4FFTA 1MNNA 4PY8J 4M7KH 3CWGA 5DZ9A 3D8MA 1OP5H 4OI9A 3FT4B 3TVMC 1U8HA 3WFEL 1FIGL 1TYJA 2D0FA 1FPTH 2BCKA 1SOQA 1D7BA 1Q94B 1FC2D 4BZ2A 7PCYA 4LU5H 1TQBC 4FNLH 1C5DA 4J3VA 4XN8A 4IRZL 4DKEH 1K4DB 5DUML 5A43C 5BJTB 3PXJA 5PCYA 4WF7A 4BEIA 3EFOA 2VITA 2TRHA 4PPTA 3HBZA 4AKOA 1SVCP 4K3DL 3T3MB 3LB6D 4GP4B 3GMOB 4LNRA 2A99A 5DZNA 1OALA 1OO2A 1O0VA 4Y5VB 1RZ7H 5E0QA 2WZ5A 4M62H 2NLJB 4KDVA 2GJJA 3AFLA 1IKOP 4OZHA 3ZDXF 1PFCA 3X14B 4WSKA 3GXUB 1KCRH 4BRVA 5D7SL 2FQDA 5CKAA 2CBTA 5EFIA 1H9DA 3BVVA 5EULV 1IM3D 3NUKA 1JHKH 5D4HA 3WMSA 4EDWL 1T83C 5DWUH 1GPOL 1HN1A 5FS5A 3ZT7A 1BGXH 3B9KB 4FLRA 1M71B 2H0FA 4WDIB 5AALA 4AVIA 1XZ0B 4TPRH 1H15A 2NY5H 3TN0D 2NNAB 3BRFA 1N70A 4Q0XL 5T3XL 1CDIA 3X3FL 1CXFA 2AEOA 4D7BA 3VG0H 4RGNE 5CLTA 3GSNH 1CG9A 1BJ8A 1K6QH 3KCWA 1CGVA 1CU4L 4H0GA 3U4KA 3UBHA 4JM4H 1DDHB 2J1WA 1XF5B 4TUJA 3WY3A 5T1KA 4X9BA 4JHZA 1MCIA 4LSTL 4KRPD 4WKZA 4LB8A 2P24A 3OTTA 3QR2A 2EZ0C 4I88A 1KB5L 4ZTEA 4LEOB 3VG9B 1OD9A 2XQYA 1MHPL 2CHNA 1WICA 2E6PA 1LO2L 2ZUWA 3F58H 3ARDD 3OF6D 1MFMA 2BHYA 2GTQA 3ETBJ 4PTTA 3ZX1A 3Q9PA 3F00A 4KTEH 1NCWL 2PXYB 4ZFOL 2GJPA 2YSSB 4U1JB 3D2UA 2NSXA 5LAXA 5JIHA 4KQ4L 1VFMA 1RURH 3S3SA 4LP8A 3QS2A 4LPWA 1T20A 3SPJA 4UM8A 1TJHH 1U8QB 4PJ7F 3ZE2F 4KPHH 1XIWD 3NVQA 4YPGA 2IGTA 2L04A 3H56A 2UZXB 2ZKHH 4JZJA 3KLHD 3IU3A 4PJ7A 3OJMB 1D5XA 1W6LA 4Q7DA 3RYMA 4WEBH 4ZMVA 1IGIL 2YD5A 3BVNA 3L3OC 5I1HL 3HMXH 5KG9B 3JT0A 1NJ9B 3GK8L 2MCG1 2F54A 2DMHA 1WD9A 5EZOL 4OF6A 1RUAH 1GC1L 3WE6A 2HSIA 4WRLA 4LVHB 25C8H 2Y6TE 5G2NA 1P5UA 4NUQA 1W8EA 2VLKA 5FDWB 2ZUUA 1CLVA 3LKNA 4G7YH 4KY2A 3ZSTA 3IN2A 1JJUA 4FL4B 2WAQA 4U3HA 3EYQC 4AKQA 2YXVA 1NEUA 4HPOL 4QKXB 3AJ7A 4DW2L 3KPRA 5J3HC 2I26N 4YSEA 4D9QD 1YAZA 3TBWA 1EMTH 1F13A 1LNUA 4MRBA 2DKSA 5DVLA 5FF6B 5DTFB 2DTMH 4K7PH 4I3RL 1HWWA 3PWJB 6FABH 1T7ZA 3LN4A 3K4DA 5JUEH 3VFWA 2R1XB 4P9MH 1J8SA 1DL7L 1Z7JA 5FGCE 1T0OA 3EAKA 4CW1B 4AX3A 5LG1A 4NPYA 1A4AA 2B1HH 4KKCC 5DHVB 3K2IA 2N0KA 4GEIA 2EKSB 1SUHA 2Q76B 3V4PA 2WNKA 4ZAKA 4PG2A 4DN3L 1NCHA 2W9DH 3VXPB 3QUXD 4MHHG 4KVNL 5TTRA 4DP7X 3G6AA 2WLMA 4UQBA 3OLGA 3T4YB 3H8NA 4CVWA 5C08D 3NACL 2CZNA 4R5TA 1SOSA 2AKRA 4JKMA 4W9JC 2H6UA 4JFUA 3HZ3A 3EBIA 2BNRD 3LEXB 1XF3B 2CKBB 2OR9L 3HTLX 4PJAB 1DN0B 3VW3H 1DCEA 4APXB 4BHUI 5EV7A 1N5YH 5F6HI 3QK0A 2EYRA 4QYAA 5K9JL 5K1NA 3QIWC 3CFCH 1OSZB 1OGAD 5DJCA 1WEJH 4JFYB 4MKTA 3RY4A 4X80L 4QXUH 3R4RA 5IVXE 2BC4B 3WNNA 5BVJA 3PJSA 2OCFD 2DQGL 3HAEB 3W0WE 3HG1D 3MRCB 5SX4H 4E9RA 3ZE2B 4XMKL 1A7NH 2LR4A 3ABMB 1P6WA 3OJDB 2B4CC 4XXCC 1XH0A 1MCDA 5CJOL 4KXAA 4A7TA 1IBFA 5AZEL 1JYNA 3OMIB 4F57H 1ZEAH 2I25N 4FZ8L 1KLUA 4A2HA 2JNZA 3MYJB 4XTRD 3MRFA 2FEDD 3OX8A 1SBSL 4LPXA 2JJTC 2JKSA 1T4KB 3U9WA 3H9SB 5HHNA 1VZHA 2K4WA 5I71C 3QFJE 1U8IB 2BJMH 3IJEB 2Y23A 1AHMA 3IGFA 2B39A 3TV3L 3FB5A 4NUMA 2Z35B 3EO0B 4QHMB 4TUOA 1MJ7H 2RQEA 3LKRA 5CGYD 4A7GF 5TFSH 5IFAL 1OSPH 2L7QA 2MJWA 4WVRA 1AD0B 2WIMA 1DJGA 1T7WA 2Z31D 2NTFB 3SQOL 1MN4A 2VO5A 4F7MA 4PUBL 5K9OB 5HGDA 5C0AA 4AGPA 4Y5XA 5L88H 1FZJB 3DX6B 3LIZL 2KERA 2KZ1B 2ADIB 4PQXA 4QAMB 3QYNA 4HWBA 1V3KA 1FSKB 2C7UB 3OKYA 1Q0XL 2Z4QB 4MCYA 4QRPA 4AGMA 1QFPA 2WLNA 4KHTH 1A5FH 2A9BA 4JUSA 1X9UA 3WL9A 3NJFA 4U6XA 3ZGIA 5IJCC 3GFUA 1IBYA 1CWVA 1RIVL 1P0SE 1F41A 1R3KA 1NUDA 3BQUB 1PFOA 1JNLH 5A6IA 2YHGA 2NUTB 1X5IA 3L95B 1AKJA 1BXVA 1XMEB 3P4NB 3R4DA 2WO3B 2WQUA 3CPLA 3FB6A 4OLWL 2KC0A 2OTWA 1KPUB 2VZVA 4X4YA 1SF5A 4LVNC 1I7RB 2D3VA 4MDJB 3KNBA 4HS8H 4LSSL 3I75B 4Z7WA 3SHSA 3DVGB 3S2AA 4WO4B 1EZUA 4NQTA 3SO3C 2Z8RA 1B4JH 4V33A 2IO5A 2IADA 5BRZE 5EDXA 1G9NH 3WEMA 1QSZA 4NC0B 4LMQI 3UGUA 4UU9A 5LBSL 2YFNA 1MCBA 3QXAA 4V2CB 3LEYH 3MJ7A 1A47A 3RKDD 4ZOCA 4YH6A 2IEPA 1P84K 1UXLA 2WBXA 1YY9D 4HGWB 3L3KA 2APTA 3ECVA 5AZ2H 3AGWA 4KKLD 2XCMC 3ULUL 3GHBL 5FFOA 4ZSOB 3ZZSA 4G3YH 4X6DF 2QDVA 1TEFA 5EO9B 1G5GA 3EGSB 1BLNB 2YD8A 5DHYA 3QGVA 4HCRA 2D7MA 4ABUA 1R9FA 4NIYE 3F7LA 1NBYA 2NW3A 1NM9A 2KUTA 1CZ8H 3REWB 2QQKL 4N5ED 4X6CA 1N0XL 1JWUA 4HDIB 1PYWA 5GS0H 3D85A 3JBG7 2WB7A 1P9MC 2RH0A 4PMEA 2WVVB 4AQEB 1P4IL 3IS0X 4KJPC 1MCWW 3ZL2A 1EANA 4B41A 2I07A 1FNEA 5JXEC 4MVBD 5E4EB 2OLDA 1OHZA 4TQHA 4PTUB 3LQMA 3OQRA 5DS8B 3TN0B 3IDJB 4AYBA 4BJLA 5MEOB 1F02I 3GUFA 3QWOA 2EDQA 1DFBH 4BZ1A 2JB5H 3GO1L 5D1XA 1A9BB 3EHBB 1DBBH 4ATTA 1YNKH 4QO1B 1DQLL 4YXHH 3MRGB 5ILTL 2K70A 1CFSA 3DURA 1EJOL 1G7QA 2HJFA 4OZIF 2P5EE 3BFOA 5KYXA 2D2CC 3QUYA 2IBGA 3AY2A 3G7TA 4MAYB 3QUMA 1IC5H 5E8EB 1ZSHA 3KWVA 3NIDF 4Q4IA 3IS1X 5C0DA 4ABQA 3VJ6B 4OV5B 1BVKB 1YNLL 2NQDA 1RZIB 1TZHA 3KH3A 5I1EH 3BGMB 1FIEA 1CICC 5I6XC 2X3CA 4P8QA 3ARDB 3RX5A 5KJRL 4IKLA 2IWEA 3QIUD 1TZ8A 2WOYA 4LLUB 4KJYA 1MIEL 1E50A 3WXVL 2P7TB 5FECA 3MUGB 3QA3A 4ZUUB 2MNJB 4OKVA 1MFAH 2H32H 4FFYA 5I6MA 1GKEA 3PAZA 1OXYA 4BM7A 4UAOC 3HUJE 2NY6C 12E8H 4G80B 4RSYA 1LK3L 1EEYB 1XIWB 1YECL 4NERA 3B2UC 1LE5A 3KHOA 3MGAA 3HC4L 3L9RB 3MLUL 3IJSA 4M3JA 1CFMA 1SVZA 1WJ3A 5JHDE 1N5AA 2FEJA 1E28A 1NPUA 2GAZB 1ZSDB 2HVJA 2JIXB 1EFQA 2M83A 2V5RA 2E9GA 3WEXB 4HMDA 1UZ8B 3ARXA 3OKDA 3S98A 3SDCD 4AIZA 1O5PA 3RDTD 4FTVA 4OLZL 1TFHA 3VD7A 4A7QA 3G3LA 4X6DB 3HI5H 5D5MA 4JDTL 2DYPA 4WWNA 5IUSA 2Z9TA 1D5IH 1ZAGA 3AQDA 5H37H 3L5WA 4JHUA 3DIFB 5IHLB 2NXYD 2EYSB 2IH3B 3BWAA 2PW1A 5DT1L 4N9GB 4XVOA 3DO7B 4F37F 5L0QB 4WCYH 2OSXA 3KGUA 5T1LD 1T1XB 3OJ2C 4XWGH 2XVLA 1E6OH 5DZJA 4IBZA 4MB4A 5C0RL 1DLHA 3HR5A 4JFED 5T3XD 5EOCJ 3UROR 1RK1A 1PY9A 3LXAA 4E9QA 2C9QA 2BDNH 5H35B 1N0LA 1KJ2H 4HWNA 4UM9D 5C7XL 4OLXL 4R4BA 3ZE0E 1FO0H 1GYCA 2BINA 5KYWB 4JR9H 1T04B 1FYHB 2GK0B 5LO7A 4KK8C 1IC0A 2OM5A 1AOHA 1BOGA 4DIXA 5JW4M 2EIDA 4UNTA 4OZIB 1S9YA 1OGTB 4QRUA 2CO7B 1HQ4A 4WZ9A 4KC3B 2C1PB 2OTUB 4XCCH 3QUXB 3L3JB 2GBAA 2O5ZL 4PI2A 2FQEA 5DRXA 1LLAA 1V7NH 4R9HA 2R0ZL 4LAQL 4PH8A 3UTSD 2PCXA 2VC2H 3KPNB 4FQXA 5C08B 2ZYSA 2FECL 4PSPA 2XNAA 4Q6KA 3OGCB 4OJAA 5C9KA 4G1MB 2BZCA 5HGDB 4MMXC 1U95A 1R3HA 1JERA 1MW1A 3MRNB 1JNHA 4I0PC 1RZGB 2FL5A 3H7LA 4OTXH 4N25A 5EOCH 3WLBB 1YY8B 1I8LA 3EJYD 3KVDD 2Q87A 4O9HH 3A4EA 4MCMA 3KBEA 3SCMB 3GSRB 4OZGF 1KEML 3HS8A 3ILPA 4BSVA 1OGAB 2NCEA 1KBWA 5D7IF 4F3FA 4OAWA 2FTAA 3OWRA 2DQHH 4L4VD 1XWVA 2HB0A 5DJDB 3V6FB 1T1ZA 4HD5A 3HG1B 3OC8A 4X98A 2QQLL 2XG4B 2DWYA 5MEPB 1HJBC 5FUZH 3K0YA 4BQ8A 4XO3A 3E6HB 1IZKA 2ICWA 1NKGA 3FUEA 3NA9L 3N6YA 5JHAA 4OD1L 3WIFA 2VLJE 3THML 4ZS7H 5CBEB 2DMBA 4LLQB 4YHLH 5L2KD 1MHEB 2WIIB 1AGCB 4Q6IA 4YDIL 1WUZA 3GRBA 3QULB 3KEHA 1R3IH 4JZOA 3LHPL 4AXWA 3ECWA 4Z77A 1CR9L 1QSVA 3CV5A 1S5IL 3TEZA 5IT2H 1FZMB 4FC3E 1GYUA 5JPMC 5HYFA 3QNZA 3W82A 2FO1A 1Z2KA 4QNPE 4R7LA 1KJ3L 4FJZA 4FXKB 2XI9A 1AGEA 4FF9A 4U6YB 5AVWB 1WHOA 4NAMA 3UZEA 1IRAY 3TEXA 2FYVA 3EOTL 3JUZA 4NQED 1PJWA 3FT3B 5F7DA 1IVLA 2GSMB 3OXSB 4FQ2L 2F58L 5D93C 2ICCA 3VXNB 2Q8BH 5D4QA 3WG7B 2CIKB 3KYNB 5GS2H 4PJHA 3L1OL 2CR0A 1SYVB 4G7VH 4TLKA 3EZ8A 1I8UA 2ZCKL 1OGSA 1CVRA 4U1NA 5EBWA 1D2PA 3FHAA 4TVPL 5TQ0L 3EO1A 2PTUA 2RACA 1YEIL 3FSWA 5DF0A 5LUMA 3WGVB 3O3AB 4PBXA 1CF1A 1D9KA 1NH6A 4OFKA 4NENB 2DB8A 4TNWF 3HE7A 5IY5B 3UPRB 2E86A 4MXVF 2AEQH 3SE8H 1AZCA 1HXMB 2FX7L 2PN5A 2XWRA 3AWFA 3KZ8A 4LHUG 2XWXA 3KH4A 4JZNB 4KNSA 2COVD 1NEZB 4UYPA 4HCIA 3CX2A 1LP9F 4OB5H 4Y4HC 4N4YB 1JCVA 1YG9A 1MVUB 4OJCA 5DDHA 2RAMA 2RB8A 3RWCA 3U7YH 5B8CB 2IQ9L 1VB9A 2WSPA 4GINA 2NXZD 1KACB 1N7ML 2CLZA 4NKIL 2CCWA 2P5WD 3ZKMC 1S7VA 2VLRE 2FIKB 4DTGH 2VAAB 5HHOA 1ADQH 5ESQA 3F6LA 1GMEA 4UIMA 1C08B 2DL2A 4YE4L 3UBXA 3F7PC 4EI5B 4N6RA 1XZWA 1ET5A 3GSWA 5TDOA 3U1PA 4YMPA 1JFQH 4XP9L 5ETUA 1DQDL 1V27A 3LZNA 4Y5VC 3PP3K 2XU9A 3VB8A 4ZZKA 3WD5H 4X5RA 3DDGA 3T6XA 2IH9A 2AAAA 4PB0H 4WWKD 3UTPE 3RU8L 3QW9A 5HVWA 3EH1A 3GWJA 1XF1A 2B9BA 5AOMA 5DC9B 3ESMA 1I1FA 4FNPA 4Y1AB 5I76A 1P53A 4NPKA 1HHIA 2AJYH 3TJEL 4YHOL 3I3BA 1ZLVH 1EHKB 1SHWA 3V0GA 3B9KC 2Q86A 3ARSA 1E8WA 2FH8A 1Q90A 3CFDB 3ULVH 4EDXB 5EN3A 5ADOL 2CR3A 2D7QA 4LLMB 3JTTB 2VDPB 1BVLB 5D9SA 1SZNA 4QAWA 2WXNA 4X4MA 3QHFL 4MQ7A 4N1EA 2AEPL 3QUZD 1I75A 4JPSA 4N2MA 1T1YA 5DO8A 3AB0B 2UY6A 3RX9A 4ONGH 4YVNA 4DP6X 3OAZK 1N64L 2VSMB 4JAMA 5EU5A 1E3ZA 3WMQA 3CN0A 5IVXA 4J1UB 4W4OC 4XPBH 4BFGA 5FO7B 1JFHA 3W0WA 3NG5A 5E6ZA 5JIKA 3V5DA 4PWGA 4DPCX 3S6CA 4Q9RL 3M45A 3RWHB 4JFHD 3HZVA 3IKCB 1K4CB 2QGCA 2AI0H 4JY5H 5EO1B 3VG9C 2FX9L 1JDAA 4TSCL 3SKMA 4HFWA 5BRPA 3QIUB 5CLYA 1MH5B 3R0MA 3BT2L 3SD5A 3HC0A 5I1AB 1EAPA 3MRKA 4H8WL 3P2BA 4UCFA 4I9WE 2PXYC 1UD5A 3KPLB 3U4BL 4LSPH 3E9TA 3QJFB 4TS6A 3BE1H 3V0VB 4AEFA 1EX0A 5HXMA 2ZX5A 3FO9B 4UQ3B 5DK2A 1KG0B 5DLML 5EPMA 2CK2A 3H53A 3UGEA 4GW5B 1U0QA 3FCTA 5EEZA 4XI5D 4QRAA 3VFTB 5I28A 2F53E 5IG7A 1LP9B 2CHDA 2VERA 1KDJA 5TDNA 4KMTH 4OCXH 5KYYA 3FFDB 4PJEF 3KGTA 5EZPA 5BS0A 3WO4B 1RMFL 2H1PL 4JQIH 2CR6A 3S96B 4OIBA 5EUOB 4A67A 5EORH 3V9FA 3SDCB 5FV2A 3RDTB 4XOAA 4H20L 1ECYA 2DYSB 1OP3K 3RZCB 2JJVA 3ZDZE 4UIKH 4Z9KB 2FUTA 4NLHA 3MRIA 2MHAA 1MI5E 1B9KA 2XJKA 4LSUH 4FYSA 1W0YT 4IGBD 4JFXB 2VN6A 4FL4C 2NXYB 1UXSA 3LKPB 4ORZC 1NIEA 1YMME 1OD7A 4J3OD 3HMXA 1KCKA 2B0SL 1KN2H 4JDZA 1UM4L 3HOGA 3V6BR 1U4FA 1NQBA 1COBA 2DBJA 1OF0A 2ZXDA 1RERA 5DI8A 1NGXB 3ABLB 1CGSH 3SY6A 1KGJA 4JFEB 4ORGA 2WKOF 2BVUA 4MD4B 3BGAA 3W39B 4LLWB 3L3DA 4WFFE 4RBPH 4UM9B 4XHJC 3TWYA 2B1OA 2K4AA 1QMUA 5BOZG 4HSAC 1HDMB 5BRZA 1RK0B 2JB6B 3QQDB 4BFNA 1ZTXL 4XO5A 1OAKL 2HJKB 2ED6A 4OJFH 1BCIA 1BJMA 3HIZA 3O3EA 4DN4L 1KXQE 2NUPA 2CMRH 4YLBA 1OL0A 1IV8A 2NW2A 1BREA 3F7VA 4JDVA 4OY9A 4IRSA 3UTSB 3QRBA 5IIEB 1XL4A 2BFVH 4MNHA 3ZYOA 1FL5B 1KB5B 1CI5A 1F6AA 5F88B 4AE1A 1U8MB 5LN8A 2VKWA 3M17A 1FJ1B 2VIRB 3I3EA 2BSTB 3N3EA 1XCTA 3JV4B 4Z7OB 2X10A 3P9WB 1NGPH 2Y1VA 3C2SA 5K69A 5JMRA 1EEZB 2K9FB 4HKXB 4P5TA 1BFSA 3HZKA 4NQXA 4Z7NE 4ZFOB 4ZX6A 4TLTA 4N8CL 2FRGP 3OHXA 3H42L 4HWBL 4KK6D 4XMPL 1L6PA 2J21A 4KX8A 4ZFZA 1Q38A 3ULVE 1ZDQA 5FA3B 2P8PB 2WCGA 4OGXH 4ELKA 1CLOL 4HZ1A 5FYKH 3O2WL 1G9MC 4L4VB 2A1WL 2BZDA 2X41A 3B2VH 4AQZA 4ELMB 5FWQA 1VEPA 2DQTH 1TTAA 4N3UA 3BPLB 4YHKL 2GTWB 4J4PA 4X5XA 4XNUH 5FHAL 3M6DA 4IBWA 3WNOA 1MCNA 2B77A 1ZK5A 3UJTL 1ITBB 3QRLA 4D7PA 1NCAL 4APQD 3VDAA 4G5ZL 1F3DJ 2GJRA 4IDLA 5KOVC 3TT1L 3TEYA 4RMRA 4YJZL 4HOMA 4O02A 3V6OC 4JY6A 4HKZA 3ARBA 5L2KB 3P30L 4ZTOL 2OYLA 3V4UH 4EI6A 2J5LB 1U41A 4TNVF 1SLXA 5FOBA 2QKIA 3TWCH 2P5EA 3SE4C 3L7FB 1C9SA 1PU0A 1KXVC 2GSGA 2APSA 1RJYB 1WPCA 4U1IA 4GRMA 2X70A 4IK6A 4KI5D 2JH2A 3QRFM 3WDJA 3ME0A 4HK3N 2CJSA 4NT6A 4GOSA 1P7QA 1A4JB 2EJ1A 3NCCB 3O2DH 5A3ID 4LSQH 1KCVL 2AV7A 2MMXA 2ITDA 2XBZA 2RFXA 5E9DD 5CEYA 1NGQH 2XTJE 3G04B 3FB8B 4NQEB 5LCVA 4Z7IA 2AAVA 4XPHL 3ZUNC 3VRLE 4H8PA 2OX5A 1MEXH 1BQUA 2WQXA 3H3BC 3IXAA 4YSRA 1J7VR 3SOBH 2XQYK 3BESR 4MJ6A 3BUBA 5HVHB 4JG0H 1U8PA 4HCRL 1ZS2A 1F3DH 4Z3GA 3FO0L 4M29A 1FSKC 2Y9RT 2IV9A 2Q5BA 3H9HB 3TIDA 1AGFB 3HUJA 4JKKA 4YQXL 3WKPA 1EUTA 4MFHA 4X9YA 4KO7A 1ITCA 2IFGA 5CZVH 5FO8A 4J27A 3BZFB 3KYKH 3UMNA 5JIIA 1DBMH 3BQUC 1XMWA 3APCA 3PWNA 3KMDA 4BELD 4HMEA 2HX8A 5JHDA 1KLGA 3WFCL 1SDDB 3L3GA 3A6CH 5I0YA 2SODB 1BBJB 1YN6A 4UQAA 2CJUL 3CE1A 4JHAL 4OCRH 2O6DA 4P2QB 4BH8A 4HF5L 3U79A 2B14A 3R8BB 3BISA 1ED3B 2R83A 2ZX8A 1JRHL 3TT3L 3DUHA 1GGCL 4CVUA 4WO4C 3GI9L 3HG2A 1IT9L 4LKXB 4DO6A 2YEZB 3O6LL 3VRIA 2AXWA 1S46A 4XCYA 3C5ZA 3IDNB 5FM5O 3RFRA 3ZKXB 3WJLC 2HKHL 3SPGA 3VCLB 5HYSA 4P9HC 5KBNC 4WHYG 5HJ3A 2NXZB 1HEJC 1VEMA 2FJFB 1ND0A 3ULUF 3O6ML 2P5WB 2JSFA