4BGLA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
ELFQTADWKKEKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Superoxide Reductase from Giardia Intestinalis: Structural Characterization of the First Sor from a Eukaryotic Organism Shows an Iron Centre that is Highly Sensitive to Photoreduction
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE REDUCTASE
total genus 24
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bglA00
3QZBA 4C4BA 1VZGA 1DFXA 1DQIA 4BRVA 1VZHA 1DQKA 2HVBA 2JI1A 4BRJA 4D7PA 4C4UA 1VZIA 4BFJA 4BV1A 1DO6A 4BK8A 2AMUA 4BFKA 2JI3A 4BFFA 4BGLA 1Y07A 2JI2A
chains in the Genus database with same CATH superfamily
3EO9L 4NKOB 4GAFB 2F7IA 4MHHI 4F9LA 4NCC2 4OLZL 1U8IB 3B8SA 1NSNL 1WFUA 1A4KA 2R2CA 1FV1A 4NJ9L 4UNUA 2ATPA 3LZLA 1FGVL 1GSKA 4G6AC 2J1KA 5FC9A 3T0AA 5BS0B 4X9BA 3RL2B 1MCBA 1BF2A 1GS6X 2GTQA 4LLAA 1TQCB 4N22A 1MF2H 3QAQA 2WMPA 3BUYA 3ZDWA 1CDYA 1WZKA 4H40A 2CO7B 2CU9A 5GRYA 1ET5A 3LIZL 4Z7UE 5T33L 1JXFA 3LKRA 5D1ZD 5I19L 4C55A 3IETB 1QA9B 2O4EA 3BN9D 4LLMB 1ZHLA 1SM3L 2VXUL 4YMPA 4KOCA 3MO1A 3ZW3A 4CADB 3X13A 2HB0A 5CSZB 3RLSA 4CC1A 4G8FB 3G6JE 4EIZC 1E3ZA 3E9UA 5T5FA 1BQSA 1T04B 4ABUA 2DLGA 4TSCL 2QPSA 2APSA 3RGBA 1FG9C 3HR6A 1J0HA 3PGDA 4JDTL 2VDMH 4YHLH 4YDLC 3HTLX 4OUUB 5ELIA 4BQ9A 1WAPA 3Q2VA 3EZJB 4L9LB 1FNLA 3GGWA 1FL3B 3UZVB 4L5FH 1X5ZA 2X4RB 5L0QC 3QCUL 1L9SA 3NIFF 4ZMYA 4HJIA 4AOFA 4NDMA 5JIPA 5CP7A 5I8EA 3QH3A 4GNKB 3UP1A 2PP8A 3DOIA 5GS0D 1CE6B 2X4OB 1U21A 2X4TB 2NNFA 3CZNA 4FN0A 5E03A 2IBGA 4E9QA 1ECYA 1HXKA 4N0FA 1BVLB 2GSGA 4RAVB 2W1NA 3V52H 3LB6D 2F1AA 2PYEA 5DFVD 1NMCB 3RVXD 3ZT7A 3VCLA 3BSHA 1KLFA 5HP5A 4CAGA 2H3XC 4FNUA 2GKIA 2XVBA 3NSFA 4OFPA 1PMYA 1T4WA 3IGLA 3WKQA 5D7KE 5E8NA 4LQFH 3SPVA 3NZ8A 5IKCB 2BVQA 4WENB 3OKKB 3PP3K 4IBUA 3OC8A 4I48A 2OYLA 3SYCA 4KK5C 4YLBA 2BW5A 4JBSA 4JFPB 4YX2H 1JUFB 3MDJA 3OKDB 2YARA 1QR1A 3DUUB 1YA5A 1M4KA 2VN7A 2JVUA 3WDJA 4HS8H 3ETTA 5DMJB 3SZ6A 1HN1A 3QDMA 1S4IA 1IM3B 4NN7B 5DVKA 1SF5A 1WWBX 3W9EA 3MLXL 5CU9A 4Q6YA 1NMAH 2Q8BL 1T66D 3HG0A 4F37K 2GIXA 4Z7NE 4OVUA 1LVEA 4H26A 5HJBA 1F0LA 4N0YL 5T1LA 5CEYB 4LVOB 1IC4L 3W2DH 1R24A 2CK2A 4N5EC 4XCFH 3HJ0A 4B9GA 1U8OB 4FFYL 5DJ6B 1QLEB 1QSEE 3I6LD 1ZT7B 1F4YH 1CGYA 4A66A 3HS9A 3APFA 4PRPD 1A66A 1D5ZB 4FGMA 2CUAA 1CK0L 1DCLA 3VI3A 2EIZB 1X6LA 3UC0L 3FRPB 1ZT4A 1OGTB 1FYTA 3QDGB 1OZTG 4L37A 5EC2A 4B9YA 4DF9A 1INEH 1TEYA 2VC2H 2CE6A 3BRDA 8CGTA 4R7VA 4WI8A 4UB0H 1DLHA 4UT6L 2Y2YA 3DGGA 1HESA 1DO6A 3EOAB 4DT2A 1TTGA 3VXSE 4ZS6C 1E0OB 4FXLA 2D0FA 2PYFB 2Y5EA 5C0GA 4D2NA 3FPXA 5HHQB 3REVA 3BVDB 3FQYA 4K5PA 1EJ8A 1XGQB 2FLRT 1EV2E 1RK0A 3BH9B 1TZAA 5L2KD 3OGCA 5SWZB 2XFXA 4RVBA 5JHDA 1DQQA 1OF2A 3EH5B 2F58H 4ZTOL 3ZT5A 1BDYA 1FVDB 1SOSA 5FW8A 5DSCB 2J5LB 2VXTH 1TYRA 5FOBA 1K72A 4N6RA 4WCYL 4A55A 1Z9OA 3CZGA 4UIKL 1J87A 5KS9F 1Z5HA 2G4GA 4GBXA 1ZJBA 1MNUL 2YPVL 1L7TH 4Y2DA 5T5FH 4YDVA 4P46B 2B5IB 1JGEB 5I0XA 1DQDL 5J6HA 2V9TA 4M7KL 1D9KA 1TNNA 1QVOB 3MV8D 3O2WH 4GAJL 4CVWA 4NKDA 5EC1B 4OBSA 4YC2B 3T8XB 2JJWA 1LP9E 4RRPA 2F54D 5CD5D 1TF4A 3DXAE 3TBSA 3QORD 2ZKHH 2H1LM 2X87A 4LAJH 3GSQA 1AS7A 3JWNC 3KXFA 5IB5B 4KXZI 3WL9B 1T5XA 3FHEA 3QXDA 3TASA 2E6QA 1WUNT 1RZPA 4HETA 3KLQA 3KYNA 3J8F7 5KJ7E 4JPSA 1MRCL 1PSKH 3EJPA 1QRNE 3KW8A 1RMFH 2AK4E 3M7OA 3IFLL 3KR3H 3T4YA 4HJJH 4U1MA 1CJYA 1GS7A 1JYWA 3CXHJ 4LEOA 5TFSH 2EDBA 4AJVA 2D31A 4KDTC 3T0BA 4GEIA 5KW9H 4WAFA 1BV8A 2Y69B 4ATTA 1F4AA 1IAIM 1PD1A 3OKKA 4GH7B 6FABL 1OSPL 3RQ3A 1SYVB 3QNZA 3SGDI 3TFKC 5DS2A 3V79C 1ZLVK 3VXMA 1NOAA 4R7XA 4HUUB 5A7BA 2Q7AA 1HTYA 4Z7WE 5DLLA 2GBUA 3FO2B 3C6LB 3UDWA 4QJ4B 1MFEL 4UDUA 4TVPL 3RURA 2ICEA 3BSZA 2ZUWA 3ZUNC 3TYGH 3EOYG 5J1AB 5CLTA 2C7UA 4G9FA 4UWQB 4L4JA 2DIEA 4ERSH 1MCSA 2NY0B 3IRZA 4IRZA 4XODA 4K5LA 3RAJL 4QJ5B 4R83A 2GHWB 2F9BT 4W6WB 5L2KB 2R7EA 1JCVA 2QHRL 4JM4H 5B3JF 4U1IB 3S4SG 3RVWD 3S97C 4DKAA 5C0IA 4H8WC 3UYPA 5LHDA 1T2QL 4G42A 1UKSA 2AHIA 3L3OB 4YIQB 2E9BA 1NWPA 1QEWB 3DVGA 3FCTB 4ZMVA 2RQEA 5HVWA 1DHKA 3I3BA 4MXQC 1K2DB 2EIEA 1A7NL 3BWUC 3K4DA 4QKTA 3GSOB 4MZIA 4S2SA 4A6YA 1PX4A 5I76B 4I89A 4XN4A 1OB0A 5IEKB 1FAKT 2VQ1A 2UXVA 5HI4C 5EULV 5FX3A 3SGKA 4DCQA 3T3MF 3CJJA 2A1WL 2DQGH 3BZDA 4PP2B 4UQ3A 1F6LL 2YRLA 1PSKL 3DX6A 4J7RA 4O2EB 2QSVA 2VL5A 5CFHA 1UT9A 5KOMC 2DEYX 4BDVB 4M6NL 5EU3A 4F7EB 1PLBA 1TKWB 2NDFA 5D2NB 4FQJL 1NGPH 1M2VB 3SYPA 1H15B 1F41A 1D6EA 5EG6C 3UPRB 4Y9GA 3L54A 3VFMA 4QHKJ 1QHPA 5DJ2A 5BO1L 2AZUA 3FO1B 3ZKMD 4G1MB 1VFOA 3T3ME 3CFBB 4Y2NA 5DS8B 2DQHL 3EFDH 1JBJA 3L3GA 1SYSB 4F2ME 2ZOWA 3BP4B 4PSPA 4BQBA 5LXVA 1IO4C 3HKZA 3VB9A 1ADQH 1THAA 1UM5H 5CM1A 3AS1A 4MD4A 4OUUA 4AQ8C 1Z5LA 2GCYB 2VQUA 4UNIA 2W80C 5SX5K 4G8EA 4NLHA 3Q01A 3C60B 5E99L 1H3PH 5D5ME 3OHXC 1CK0H 1XWVA 1I1AB 1IC4H 1TO5A 4TF4A 5DJAB 4ZS7L 4PJXB 1OARL 4UQ2A 3CFEA 5HGDA 4KTGA 3GZOA 2XTJD 4OGYL 3S96B 3VH8G 2CIKB 2CHZA 3OJDB 3DJ9A 4WEEA 1R3JA 3C5ZD 1VFMA 5J12B 3HNVL 4U6TA 3QXVA 2PTUA 3NCXA 4ZX6A 1MVYA 2LLGA 4CBZA 2EIKB 4P5KA 2PO6B 4UTAH 2NYYD 3GMQA 4DO5A 4DW2L 4PJ7F 3GO1L 3MLVH 4NJAL 3CHPA 1HH6A 3MV9A 1RZJH 4HKXA 5DQDH 3VWJB 4ZG1A 2ITFA 3Q8FA 4TNWK 2R4SH 4PY7A 3U0PB 2FX7L 4DN3H 2VDRH 4XMLH 4AGNA 4LHUB 2Z8SA 5FGSA 1IGIH 1ZDQA 1NGYA 35C8L 3DKHA 4W68A 3IDXH 1KT2A 3MXVH 4KKLD 4AEHL 1F42A 4IBLT 3ATEA 4WEMB 2X4SA 3SJVA 1TZGH 5KN5B 5I6OA 2OYKA 4NENA 4NO5A 1DVSA 1KBBA 3CD4A 2X2YA 4X6CF 3V5KA 3LTVA 3TZVA 4EZMA 3DSFL 2PTTB 3K6FA 3D4GA 5D5MA 5JTWA 4LLUA 3OAUH 1U95A 1DO5A 5DT1H 5INCA 1O7SA 1LO4L 1BBJB 1HDMB 3NA9L 1VESA 4PRBA 4CGUB 1HJCA 3Q5TA 4ODSL 4XCCL 3IJSB 1JHTA 1UOVA 4UT9A 5L2JA 4AX3A 4WEUD 1JD7A 1RIVH 1UH2A 5DJ6A 1RJZA 3MLUL 3T09A 2OLDA 4FQHB 5E1AA 4OGZA 5A2CA 3O4LD 5C0AB 1PU0A 2WTOA 3FTYA 2UXGA 3CN2A 3KPSB 4FHKA 1IKFH 4M8QA 4XBPA 4A2GA 5CCJA 2HRPH 3DMMD 3M07A 2J44A 4KH2A 4BGLA 2EDWA 3QYCA 1RJYB 3JXAA 1ZDSA 4EN3B 1DZBA 3BMVA 5C1MB 2NR6C 4PGDA 5C3TA 3AZUA 3FU7B 1VF5C 3IMSA 1CD1A 3ZL4L 1ZA6A 5EIIB 1CXIA 2OTUB 3K6IA 3VG0L 1M7XA 5DWUL 4LSRL 4LT7A 3V6FB 1RURH 3RU8H 2ICWA 2P8PA 4JDZB 3AXIA 4X9HA 4L29A 2Q20A 3T0EE 1R3HA 2BFVL 5KSAA 4XP1H 3VAEA 1SHXA 2PKDA 2ICEC 2PYED 3WMPA 1PQZA 4M9PA 2EJ1A 4AKQA 3MR9A 3OM3B 4ODTH 4TQHA 4Z7QB 4Z76A 1CB4A 3KJ6L 1U8NA 3QQDA 5MHSE 3HB3D 1UA6L 5FGCB 4I3SH 1SMAA 3I6SA 4OZGB 2G30A 5DS8A 2J5LC 4AEFA 4GP4B 1G7JA 1I8IA 4XBGB 4Q9CA 4K3JH 5JUEL 2UXTA 2BIPA 3EDFA 1MJ7H 2Z1KA 3F64A 4WSGA 3BT2L 1RHFA 4N2KA 2QLYA 1A2YA 4JUSA 3L9RB 2DQDL 4YFDB 5IVXE 2J1ZA 1Z5LB 1L0QA 3BKMH 2CH8A 2D03L 2MNWA 4RMRA 4JE4B 1F4HA 4P57B 5EV7A 2GJ6B 1FPTL 1IGTB 3EJYC 5GS0H 5MP6L 4L8SB 3ETBJ 3FT4A 1HZHL 1VENA 1ZANL 2G75B 2V33A 4D0DA 1IAMA 5GS1B 3O41A 4WUUE 2CIIB 4K55A 4PJDB 5LJYH 3GSVA 3OMIB 4E42A 1K4DB 4JZJC 3SKNA 4AYID 1DANT 4MXVF 4GRWH 4HJ0C 5C07A 1WZAA 4JG0H 4QTIL 3POHA 4AC4A 4BFBD 5AAWC 2VTFA 1OOWA 1KLGA 2WXHA 3D87B 4DW2H 1ADQL 4N0CC 3UG3A 4KK6D 3CVHL 3BUIA 1FDLL 1E30A 5D7JA 4OKVA 1IV8A 1X9UA 4I77H 4XMPL 5IMLB 2OCCB 3IJEB 3CZUB 1CYXA 3WFZA 2F74A 3LNDA 2K0RA 1V10A 5EO9A 1YEKL 3BWUF 1J0IA 3WOVA 4OV5B 2OR9H 1TTFA 3QJQB 3RVUC 1IL1A 3ZDZE 3T2OA 1DEEB 1SOKA 3VDCA 4JPQA 3LS4L 3Q9PA 4NKIH 4LCUA 5D7JD 4ANWA 1N4XH 1A65A 2H2SC 2IPKB 4DGIL 5B1JC 4ZFOA 5JHMA 3G5ZA 2NYYC 2PR4L 5J1AA 1SXAA 3QZWG 3NCBB 4ZSOE 2ZWNA 1ZS8A 3DPDA 2J2ZA 4BFFA 1L9PA 3MROB 3MJ8A 1ACYH 5D6CB 2V2WB 4AVJA 4KJQC 4RIRA 4I77L 1F1GA 4XMPH 3FUIA 4BWWA 4NT6A 1LO0L 1TETL 1BXVA 3BGMB 3MV7D 4U1IA 5D70L 4ZAKA 3FB6B 3SDCB 1SFHA 3I6GB 3OQ3B 2WSPA 4HUCA 4JPKL 1IIIA 3ML8A 2NXYD 3AXHA 1XGPA 1JAEA 2Y1VA 3BIAX 2DTML 1I75A 2WAQA 1F2XK 1ZLDA 3FBQA 5D4IA 4D9QE 5AOZA 3D2TA 4K7PH 1RJYA 2OZ4H 3TONA 1NCGA 3IGAB 4LNRB 4EN3A 1RD6A 4MTMA 3NABL 3VD5A 4K3GA 5DZPA 3IDMA 1HHKA 4TRPH 1ACZA 5E94B 4GQPH 1Q90A 4TL5A 3TXAA 3U30B 1IJ9A 2W81C 4D3CH 4Z7VB 4N4YB 5I0WA 4N8CL 5DD5H 4MXVE 4ZNEE 2JCCB 3HZMA 4BSVA 1A6WH 3DHPA 4JN1L 4TOYH 2DRUA 1V3LA 4IOFD 4Y4KB 3EXJA 3PQYA 3LZFH 3QXAB 4CU8A 3QIUD 4GW5B 4L9LC 5C3IA 3U0WH 2FYYB 2O5YL 2J21A 3HFFA 2H7WA 1YYLH 3MBWB 5EDSA 2I32A 4H1LB 2NRDA 2GFBA 2ZX7A 1R4XA 3P77A 1KPUB 1ZLUK 4PJ7A 3AMKA 1OHQA 1YEGH 4O58L 4ODWA 3QPQD 1NFDF 1DFXA 2A9MH 4FQ2H 1UZ8A 4YDMA 5LN4A 3DX9A 1KBGL 1SY6L 4N2NA 1EHLH 1JHLH 3DRTA 3EDDA 2ZWLT 5JW4M 2MWCA 3NCJL 2Y5TA 3RWHA 5ID0A 5D7SH 3PWUB 1E2ZA 3ARBA 5IJKA 1NOLA 4QNPF 3TWCH 4O02L 1JERA 5IEHB 2BXZA 3U6RA 5I8OH 5E24E 2JXMA 1ROWA 4HXBH 4Y19E 4HBQA 5E6IC 3OXSB 4KO5A 4XWGH 1G87A 3GSVB 4IMLB 4OZ4A 5SV3A 4E42B 1TPXC 2AJZA 4LGRB 5CZRA 4HIPA 3AW5A 3CFKB 4N9GB 4WI3A 5DD3L 2V6HA 2VAJA 4QTHB 3TBBA 3KYKL 4LP5A 1MRFH 4J28A 1UHVA 2WV3A 4AQAB 4PRID 4E36A 1ZAGA 3K74B 1OAZL 1PCXA 2A5UA 3K91A 1LXMA 4HC1A 5I71C 1U8IA 1A6PA 2QGBA 1NC2A 1UUSA 3FQXA 5DJ8B 3NA9H 2G9HA 1CGSL 4LCWD 2ZYHA 1YY8A 3U36B 3OZLA 4ZOCA 1VCBC 3QFJE 2ROYA 2J4WL 3C5ZB 3KGUA 2NY4C 1KGCE 2F58L 1ZHNA 1EXGA 2EVHA 2AQSA 1JL8A 1KJVA 4NWUL 4HMCA 5FV1L 2WNXA 1OD7A 3E2HB 1H3GA 4EI5D 1TZGL 1IVLA 3G04A 2O6DA 2AV1B 2AXGB 4IK6A 4XB8A 5ADOL 4PJFE 1QZNA 4NRYA 1HI6B 3SSGA 3KXFE 4GT0A 2JJSC 4YDJA 4FQLL 1MCJA 4I9WD 3ZHNA 2XIBA 2L7EA 3PFUA 5CMAB 4FQXB 2DLTA 4NERA 5LCVA 5SV4A 3G5WA 3C2AL 1OPOA 2HG5A 3ZYJA 4W9JC 1WV7T 3BUBA 3FB6A 3E7JA 3SDCA 4G5ZH 4KZ0A 1QBBA 3L4UA 1TQVA 2LW3A 4PJEB 5F0MB 1X9LA 4RGNE 2FEDC 2VSCA 1W0VA 4QHNB 2XV0A 1IAOA 2F08A 2ZCLH 4JFUA 4PJGA 5DHYA 2VXQL 1NCBL 3IGAA 2WLYA 2V2TB 1IQDA 2DZEA 2XWBB 4Q2ZB 5HYIA 4MB3A 1ND0B 1DVQA 1DVXA 3CDGA 2IOMA 4JRYA 4WWOA 3TC9A 4TL4A 5F8RC 5CP7B 4X9FA 4BFKA 3JVGC 1FFQA 4QXGL 4HZLB 4UM9A 5AKSA 3W57A 4PRAB 3OMZA 1NCWH 3BGFC 4OJFL 3T4AC 1NLBL 2FT7A 3JZ7A 4NZUH 4GG6A 4KHXH 2PYEB 2D0HA 4ISVB 4OGXL 5IB1A 2VKXA 3INUL 2F8XC 1VHPA 4GW5A 5FHBH 3EFDL 3BFQG 4AMXA 2ATKA 4HC1H 4G83A 4M1GH 1J7VR 1OP3K 1BQLH 1E7VA 4JY6A 3QQDB 4UM9D 4W9LC 3T0WA 4PWGA 4JFTA 4ODHL 4DIXA 3DHUA 1JZDC 5EBMA 4N90E 4AQ1B 3LYRA 1NBZA 2EE3A 4PBVC 1G9NL 5F1OB 3O6FA 3HHRB 5DYOB 1E28B 2O72A 5E9DA 1GKEA 4BKLB 4H7VA 3ARBB 5T3ZD 5FM4A 1YEWA 4J3XA 1ZXKA 3APCA 5D1XC 1BZ7A 1NDMB 1RUKH 2HLEB 2NY7L 3QIWA 5K9KB 3BP7B 3EDEA 4WEBL 4AW7A 2R0ZH 4U0RB 1YNTA 1KXQE 5FDWA 2AJUH 1OZUA 1KV7A 4RNRB 2I07B 3BT0A 1B4RA 4LIQE 4RDQF 4IK7A 1PZAA 3BYTA 5EBLB 5C07B 2X0WA 3WO4B 4JZNA 4UV4L 1J9CT 1VRSA 4XX1E 1DL7H 1GH7A 1VEMA 2FATH 4DWHA 4U6YA 3ASWA 5T1MA 4YHLL 2KI6A 3ILPB 2FX9L 5DC4B 1IFHH 4LOUD 2K4AA 1B4TA 4MWFB 2FO4A 2FUQA 2Z7YA 2IMNA 3HZYB 2OCFD 3IJEA 3P73B 4ZQKB 1BYPA 3N3EA 3VFTB 2FD6H 1BECA 4BK8A 3GRGA 3Q43A 3UAJD 4GMTH 1O6VA 3G04B 3MRIB 5F9WB 5FUCC 3FB7A 4H0GA 4I87A 4TVPH 4Y1AE 3QIBB 1BX2A 4A7QA 2ZCKH 3PWPB 4RGOH 3VWJC 2OQJB 4MRCA 2ZXDA 43C9A 1QFHA 5E8OB 1A1MA 2KS0A 4FNQA 5HHVH 2XSKA 4OZGE 4M62L 3MV01 3MRLA 3IWVA 1BG9A 1E5YA 3MNMA 3FMGL 3SDDA 2BP8A 4BFJA 4AK1A 1KLUB 2OL3B 1MOEA 3MJGX 2LTQC 1LE5A 1ACXA 3NSJA 5BV7C 3NFPB 2MCAA 3SN6N 4ORZC 3V95A 3WFEL 4JMXA 4PTTB 2NOYA 1JNHB 2W95A 3FTXA 3PE9A 4OD3L 3ZY7A 4YEEA 1HHIA 3CBJB 4LEXH 2B3IA 2P52A 1EH9A 3TV8A 3HBPA 4OF8A 1FNFA 2JB6B 3BAIA 4MS6A 3O2DA 2B39A 3MBEB 2ODHA 3VI4E 5CIPB 3IMVA 5DRNB 2Z7WA 5D2LE 1PFCA 5FYKH 3GMPA 4S1DD 5MI0B 1MY5A 3CIQA 4JM2F 5KUKA 4NC2B 2J43A 3WD5H 3SY0B 2IAMD 3V6OC 1L6XA 5JR1H 5F7DA 3GSRA 2EKSB 5F1SA 1ERNA 3BH8A 4G5AA 4M3JA 3IKKA 1GW6A 1DBAL 1PFOA 3QQXA 3TA3D 3UADA 3PV7A 4K15A 4Y4HA 5DD0H 4WW2A 4DP8X 1I9JH 3A4DA 4YSSA 2BLFA 5B39A 2XTLA 1XAKA 3MBEC 2Y3AA 3QR2A 4PD4J 2ZG1A 3UL4A 5F7MC 4FD0A 1JI2A 4J3OF 4DEPC 5IREA 3ILQD 6TAAA 5DA0B 1PYWB 3D3VB 1P7KA 4LOUC 1XCQA 4K5NA 4OLVL 4OKDA 5IR1A 3B2DC 1UZ8B 5C2BH 2BCKA 1SVBA 2QPEB 4PCTA 5AW1B 2W8CA 2OXGA 3DRTB 1OL0A 4G7YH 3SCMC 1S7TA 1X7QA 4V1DA 3KPRD 3CK0H 1E3FA 4TNGA 3QPKA 4U2ZA 3L5JA 4ICXA 3FU3A 2DWDB 2B0SH 3BWAB 1BQRA 3DUSA 3QRFM 5BVPL 1W0YT 4WI0A 2VERA 5CZXD 1MCRA 3N9GL 3JVGA 2AJZB 3NT0A 2FL5A 4PV9B 3L48A 3MHZA 2K3HA 5DF0A 4HULB 4K5OA 5DJ0B 1A6VH 2LR4A 4U1JA 1KC5L 4CRPA 1KTCA 4BZ2L 4PHXA 2VABA 2ZCLL 4ALAH 3UBXA 2EYTA 1NBQA 3KPMA 3WV0A 2YMTA 4JFFB 3TEUA 5JQ6L 2X3BA 1NGXA 4XO5A 1PKOA 4QRRA 4MYPA 1J1OH 4GIOA 4F7KA 5DJCB 2DL2A 2F19L 2VSMB 2M1KA 2X2HA 3H7LA 1ZGLM 4TVPD 4W81A 2VUYA 5KVGL 3L3DA 1SXCA 4N2OA 3RBGA 1QSFE 2V9RA 4LLWB 3WY2A 4JFZL 4RA3A 2FBJL 5IIEB 4P5MB 5DVNA 1U8CB 5E00B 3U1SH 4Z7OF 3QS2A 1L7IL 2AQ2A 2ZUQC 4OI9A 2OSXA 2PLTA 3AQXA 1QI5A 2YA1A 3LEYH 4YSTA 1VERA 4DZBA 3F84A 4G2AA 4X6CB 3K6OA 3VGBA 3ZDXB 3TNMB 4KV5F 3CUPA 4OZFA 1EXUB 4BSWB 4RMWA 4MJIE 1LO3L 5D7LA 1UADC 4ANVA 2R39A 3GM0A 2MCPL 2ZP8A 5AAWA 2BNQB 4OZFH 3CLFL 1KLUA 3RVUD 3VUAA 2NXZC 3L4TA 2DH2A 4NFBA 5HHMB 3UTSD 4MD0B 1KCSH 3N41F 2HRHA 4L23A 1V7ML 1C7SA 4KQ4H 2CBTA 4XPAL 1U8LA 5E2JA 2XV3A 4AQ1C 3BP4A 4QO1A 1R5WA 2N1TE 2EXWD 1RJLA 1BREA 4MD4B 3UTSE 3WXVL 3ZL1A 1CZ8H 4NHUA 2CJUH 5IHWA 4NYLB 1VZGA 3OG6B 4PJGB 5C0FA 3LZRA 4FFVD 4PWHA 5DRNA 4XR8C 4DVRH 2F15A 4GRWF 4PR5B 5I66B 5F71A 3ABKB 1YEJH 3AREA 4G8GD 4PWEA 2YZ1A 4DUXA 4GRLA 3QEUA 3BP6A 1MIML 3FOLA 3T4AB 3B1TA 4FA7B 4J4PD 3MUY1 5AOIA 2JJVA 3F12A 3U25A 3S36X 1P6WA 1MPAH 1IBHA 1IBDA 1SQ2N 1TJXA 3NN8A 5AVXB 1QSFD 3VQ2C 3VXMD 4XPAH 1S9WA 4CW1B 1DJSA 1FN4B 1A7PH 1FVEB 1ETJA 2NZ9D 1JS4A 1KB5H 2GI0A 1N12A 4HF5L 4I0PC 4NN5B 3B4NA 1FCCA 1EO8L 2ZUYA 3EBIA 2D31B 2EDKA 3HC3L 4W9CC 1KC5H 4Q0XH 3A23A 3GJFH 3P0VL 3FT2A 3LZQA 3IN0A 1XF4B 1J86A 4Z7NF 1K8DB 4Z7WF 3O6FB 2HJFB 3K81A 5FKAB 3SGDH 1RZJL 4APQB 3CMOH 2NR6A 3QA3B 4KX8A 3PDOA 5DTFA 1N6QL 1S3KH 3HRZC 3BKJL 4NHCL 4G6FD 3MVSA 5EFIA 2DMKA 4XTRD 3MLSL 2DJUA 3VW3H 4X6FB 1ZV5A 3NJJA 4RFNC 5EOTA 1BM3L 1OWWA 4ONHB 5CBEA 2PF6A 2F7QA 4NZTH 5KVGE 4GUOA 2G0LA 3MGOB 2HH0H 3E8UH 4N0UE 4RDBA 4OQTL 4P3CL 4M4RA 1OP5H 2WSDA 4LLYB 4N2EA 4F33A 3KPOB 3RP1A 1A6VL 1XF2A 2FRGP 1A4KB 2OR9L 4M29A 5J6SA 5GHWL 4U1NB 5IJBC 4O5LH 3DRQA 4WI9A 4AV4A 1FVCB 2ADFH 2Z9TA 3MBXH 3O2DH 2Y0SA 4UZGA 2HJLA 2EIBA 1MFCH 5DRWA 4BE5A 5IT2L 1CLZH 4JANB 3QZMA 1JNNL 3SPCA 5E2TH 1KELH 4J3BA 3DTUB 4CU6A 3LEVH 5E2WL 4GUPB 2ICWB 3D39D 2IOOA 5CXPA 2I5YH 4QLWA 1AIFA 3MACL 4ZSOA 1HNFA 5FECA 3V0AC 2AAAA 4J3WA 4MA1B 5I6PA 5ALCL 3JWOC 3MNZA 5DHXB 5FO2A 4B53A 5M95B 1TQBC 3O6LL 2OR8A 3PHAA 4YSAA 2WD0A 4XAKE 2UZPA 4OF0A 4X6DA 3Q8CA 5L7XL 4AXWB 2YN5A 3PABA 4OZGA 1M05B 3HMWH 3QUZC 3IAPA 4JDEA 3ZTNL 5IMMA 1CTMA 5GS3A 4EUPG 5FFGA 3LX9A 3IMTA 2AABH 3IU3A 3QFDB 4NHUB 3LHPL 1CXLA 2SEBA 1NEZA 4KY1L 2GJZB 5FYLD 2ZSWA 5L88H 4DJMA 1ITBB 1BG1A 3OF6A 2DJ4A 3D30A 4X99A 1JZ7A 4HJSA 3TF4A 2N0MA 4J5VA 5IQMA 5E9DE 5EUOB 4GLRH 5F6IC 4IU3B 4ZO7A 1D2OA 3GMLB 3B56A 4E41A 3JYCA 4JHAL 4WSJA 3NCEB 5HGDB 5G2NA 4N2BA 1NBCA 3JWNH 2FEDD 2UZYB 4OGQC 4UBDD 4Y1AD 2AKRB 1G7HB 5ESAB 1T1YA 2BNQE 1DUZB 3V4UH 4YHYC 5M7QA 1R3JB 4UTBH 4YGVA 3S5LG 3N0AA 3QBTB 3VTTA 4PV1C 4Y1AB 5FF6B 3KCWA 3VCLB 3OZ9H 5CJ8A 1XSKA 4HFUH 2FQEA 4RMTA 3S4SA 1PLAA 4OCWL 3K7UA 3RIKA 3S8FB 1Z0MA 3BD4A 4YE4L 5E8NB 2E8YA 4U1KB 2B59B 3IJHB 3AQDA 4Z3HA 1CDIA 1HILA 1YECL 3KW7A 4ES8A 4PY7B 4MCZB 3JBG7 4NWTH 4RISL 1QR1B 4DGVH 5LWYH 3BHBB 2BC4B 5LB1A 3GMNA 1CF1A 4KQ3L 5DEFA 2B9AA 2Z92A 2LVCA 1Z66A 2IFFH 3ARFB 1GIGL 2VDLL 4GI8A 4OB5L 4P59H 4F9PA 2F1BA 2DQCH 1Q1JH 3OB8A 2LU3A 1G7LA 2CKBH 2PMZA 4P5TC 2L0DA 4U1HA 1DANU 2J12B 3VXRA 1CTNA 4DOHB 3V9EA 4OLXL 5T3ZE 2DBLH 3BPCB 4GKSB 1J8HA 2OXHB 4KKNA 4TQ8A 3AT8A 3V0WL 3HN8A 1EMTH 1HCFX 3DURB 4OZHE 1UXLA 4XNXH 4BWUA 4JEGB 4YHZH 2EZ0D 4PY8I 1INQA 4JJ5A 1FWXA 2EEFA 3HUJB 4LCWB 5I0DA 3H6JA 3WEOA 5C0RL 4R26H 1IFGA 3TBWB 5DUPH 1UVQB 4BK5A 1GHFH 3ZTJH 5AOKA 4ZYKB 1X4XA 3BXNA 4EIUA 3F2LA 4GRMB 3AG4B 1BZDA 1KPVB 2A9NL 3QHZH 3JWOL 4Y4KC 2FSEB 1MAKA 3HKFA 1AP2A 4AYGA 3PHSA 1A3RH 2EC9U 2BK8A 1OM9A 3DVNB 4AL8H 1I7UA 2KZKA 4S1RH 1IE5A 4R8WH 4OM0L 5JORB 5H4ZA 5I71B 2WINA 4RZCA 4UIMA 3VO0A 3BUDA 5FCUH 5E08H 3G6JB 2FZ3B 1EXUA 3FOMB 5CHNB 2I5YL 1QA9A 5AAPA 4NN6B 1UD8A 1SXZA 4BELD 4IGBA 2CRIA 2FX7H 4DN3L 3MV8B 4YS4A 3GI8L 2Y7LA 3Q1SL 3KS0H 1L0YA 3ABLB 3D1MC 1GTFA 1MFCL 3NZSA 1ZHKA 4NAQA 1KCLA 4W70A 4M7ZC 3F7LA 3Q2LA 5HYSB 3BZFB 1CU4L 2HTKD 3OPZL 1GGIL 4ZW7A 3UBHA 1T03H 5JDSB 4NYLA 3GGWB 3WDHA 1B90A 3AY2A 1FL3A 1QVOA 3UZVA 2R1YA 2P5WA 2NTSP 3IN2A 3KPRA 1E65A 5ESVB 5IOPB 5KAQF 2WB1A 1QFWL 3QJTB 1P1ZA 2B1AL 2G75A 3PGCB 1IC1A 2XZCH 4GXFA 4YHNB 3ATFA 2HLAB 4AYEC 4JCWA 5IQ9B 2OBGA 2VDOH 3V0HA 3K46A 1KGYE 1I53A 3GWJA 5GZNC 4HKBB 1UD6A 1RUAH 4I0CC 3KYNB 4FG0A 4YBQD 2H1PH 1I9RL 1N3NA 4ZFFA 1F1DA 4OJCA 5J9PA 4S1DC 2J6EL 1KLFB 4OJYA 2H3NA 4YHIA 1ANUA 3QFJD 1NAKH 2MRYA 2XWJA 1N0XL 2G9HB 3LN5A 2ZF8A 4RFOH 4Y4HC 1MEXL 4NLAA 4P49A 4PJDE 3DARA 3KBFA 4NKMB 3RGVC 3V8OA 4LCWE 5IMLA 5H94B 1OAKH 2X1PA 3MA9H 2YK1L 2NY3C 3V9CA 1CGTA 4IBQA 4PRDB 3B9KA 2BIHA 3FT2B 1HILB 4XPFL 1GJUA 4PRIE 4KRPC 2NQCA 3QR1A 1BOYA 4HV8B 1E42A 1XCTB 1BZOA 2Y3NA 2ZP0T 3C8KA 3GRWA 4NRYB 3MOBL 5DRZB 3WSQH 3ULUF 5EORH 1NFIB 4Y19D 5BRPA 3H9YA 3V4VH 1SJXA 4F7CB 1T0PB 4URKA 5T5NG 5CMAA 1VFBA 3RDJA 2P24A 2VN4A 4FQXD 4PJCA 3TH3T 3WS3B 3UAAA 2WJ7A 4R5TA 4TNWF 3ROOA 2XPGB 2CA3A 1MCPL 1INQB 4KRNA 4MDIB 4TSBL 1DJXA 4QOKB 3HW7A 2F18A 4KQ3H 5FV2A 32C2B 3QFGA 3T0VA 2PCFA 1FFNA 3GKZA 4JY4B 4HUWA 3S5LA 2F2HA 5FYKD 4LU5H 2R23B 3QEHB 5EU5B 3ECBA 1KXVC 1LWHA 2B8OT 3VH8B 3ZN6A 2YN3A 1VADB 4FQQA 1I1FA 2L04A 1AIZA 2WGXA 5EC2B 2ADJA 4OLXH 4UMGA 1BQHG 4X4ME 4BSJA 2YJQA 1TMCB 5LGYA 4ZMQA 4P99A 2DLEA 5EOCL 1I1AC 3KPTA 4WTXA 2IDFA 1D5XB 5FECB 5CNHA 1T1XB 2BSED 2LU4A 4Q52A 4XI5D 3WAKA 2KDYA 5IROC 3TN0C 2X6BA 3ECUA 4MSWB 1P6AB 4WWKC 5ANMA 5AVZB 3O6ML 5ICZA 2VZVA 4NWTL 5KBPA 3H7BB 1PD6A 1X4YA 4LO9A 5BOZG 1OT2A 4UYPA 5TE4H 3CZKA 1CBVL 1A9EB 3D5OF 1GC1L 2CDFB 3TPKA 3B5GA 4XMKH 5DYOA 3EG9A 3BZFA 1JRHI 1U8HB 2YBGA 2WW8A 5D7EA 1QO3B 4YXKL 2R4RH 2NDGA 3FFDB 3RIAF 2Y24A 1H3XA 1U2HA 5J0BA 5LUMA 2EQDA 3VFWA 4Q6KA 1E90A 2HRGA 1JYNA 3W56A 4L8BB 5FS5A 4QAWA 3ESOA 2DMGA 3ZTJG 5I73C 4X0KB 2G0KA 3VA2C 4TQEH 5A1AA 4TV3A 1E50A 1H3VA 4UQ2B 2WXFA 3LNHA 1EFXD 3CVIH 3A24A 3BE1L 4WFFD 3NBNA 1CL7I 2CIKA 4Q56A 3C9NA 4EI6A 5D55A 4C58B 4YDIH 2IFGA 5E1QA 3HZKB 2GY5A 2X09A 2R27A 4QYOB 1XR8A 1ZXQA 1HYSC 3QYNA 2K7PA 4OLWH 2Z0BA 2OX5A 1CXHA 1WBXA 3H4HA 2FO4B 1RZFL 1PZ5B 2XVKA 3VNZA 3C87A 1WE5A 3ULSB 1ACYL 5BXFA 5EZIH 4YQXH 1B0RB 2VH5L 3U4BL 4KUCD 4P23D 5AUMA 3HS0C 3R19A 2GI7A 4NS0A 4E2OA 3VG9C 3IPFA 2OL3L 4HOMA 3CFMA 4MJ6A 4PJIF 2QSTA 3AU0A 5HGBA 3V4VB 5I28A 2V17L 2BY3A 4R4BB 4BEIA 5BUGA 4G6KH 4WUUD 4YNYB 4B50A 2BVUA 5DMIL 4JQXC 5JA8B 3WTWA 3SDCD 2WLKA 2AERT 2PXYD 3ARGA 1W80A 5IQOA 1AACA 4Q8BA 1A7QH 1KY7A 2NLJA 4MHHG 3CZJA 4AE0A 4N8VA 1PS3A 4AVHA 4X80L 3LKPA 1Z9MA 3QG6A 4WU5B 1M53A 2OL3A 1LE5B 3GM8A 1C16B 2WLLB 4M61A 3TFKD 2RAMA 3QT2A 4K8RL 4HG4J 1SUHA 1E27B 1WVZA 4FQIH 3SDAA 3QWRD 4QXUL 3DO7B 2AXFB 4WHTB 2PXYA 1KTKE 4FP8H 3MLYL 4YO0A 4F8LA 4QRUA 1FFNB 3S5LB 3AADB 4FFYH 4J3OH 3H42H 5MHSD 2ZF9A 3ES6A 3UZEA 3ZE2F 1PKQA 4ETQB 4FXKB 2DB8A 2Y7NA 4R0LB 4Z9KB 4S2SB 1YNKH 2EIMB 2BVPA 3L08A 1MN4A 5T1LD 3BXNB 1R34A 4MNQA 4RAHA 3ZRCC 3Q1EA 3IDYC 3BGAA 4O2FA 4NIKB 3CXHK 4UOQA 3T0ED 3LDBB 3MLSH 5IMKB 2OMTA 3OR6A 1KEML 5KJRH 5DJZB 1DQIA 4U6VH 5JOPE 1U9KA 5DWPA 4RA0C 4BXVA 1MSPA 3FW6A 1XTLA 4PREB 3AMLA 4KK8D 3CFJB 3WJLA 4PRIB 3O6FD 4F37F 3OZKA 4U1SB 4XPGH 4CMHC 2GQHA 3H9ZA 1CLCA 4UOZA 5H35A 2GHZA 2ARWA 2R9HD 4FRWA 2TSAA 1MREH 2XTSA 1UH3A 1LO4H 4WU7B 5E0QA 3S8GB 5SWSA 4WNSA 5HI4D 1GY2A 5CLXA 3ZO0A 2GAZB 3C5SA 2Y1YA 3R7RA 4LL4A 4OLUH 3FONB 4Y5VA 5LGKA 3ULAB 1S5IH 2OXGB 1JN6B 5CN2A 3RU8L 2GK0A 4TUOA 1QLFA 3A21A 1FBIH 3ORJA 3QDHA 3QEQD 1N0LB 2EUXA 1YAZA 3L7FB 3BKCH 1OPGH 2GY7B 4U4BA 4F58L 4X4XA 1RHHA 1U3JA 3VXSA 4U6XB 4HIIA 2FT6A 3GB7A 3K4AA 4DP9X 1A7RL 2HAZA 3OLEA 3WLWC 1COBA 3PP4H 2ZXEB 4BQCA 2EXSA 4JFQB 3V0DA 1DE4B 1D7FA 1QBMH 4JO4L 3SEPA 2NQ3A 3WJJC 1DSFL 3KPMB 4RRPG 4HSQA 3NYKA 2LQRA 4PJFB 4P2RD 1W0WB 4K0OA 1WCBB 4JQVC 3QUZA 1B0RA 5AB9A 1R0AH 1SUJA 3SE8H 4Z3JA 2YJLA 5IJCC 2ZXGA 4J8QA 2X6CA 3HC4L 2ZKYA 3OAYH 3ZOAA 5GS2H 1GYAA 1KB9J 5AW7B 4EN3D 3RWCB 1ADQA 3LB6C 5DEGA 5ACMA 5FIEA 1ES0A 1G1YA 1KT2B 3MJ9L 2OTPA 3H42L 5M94B 4KAQH 4BA0A 2XTJE 3QJRB 5E4EC 1IEBA 3OL2A 1BAFH 4FULA 4BFNA 1J1PH 1NKRA 1A1MB 4IYKA 3CHRA 3U46A 3T8MA 1QYGL 1JV5A 4X83A 2Y7MA 2J2ZB 4JFYA 2EECA 1NGWA 5AWNH 4CADA 5C6WH 2DQHH 2W65A 4PJGE 1AR1D 3ZZLA 4XNUL 1DFBL 2BNUB 3ZDXE 4NI6A 5FO7B 1A9BB 3UBXG 1JZ4A 4XBMA 3OB0K 5IFHL 4YXLH 3IXTA 2NTFB 3BKYH 2PPCA 3NIGF 1I8AA 4XBEH 5DUMH 4NB7A 3WYRA 4Q9QL 4NKIL 1UD5A 2WZAA 3KPSA 3A22A 3C6LC 3RWFB 3GDBA 1XH3A 2BVPB 2Z7UA 4G1EA 1HZLA 3RA7H 2X2JA 3F7QA 5FB8A 2BIQA 4GAGL 1CD1B 1HHKB 4B7LA 5J3HC 4XBEL 5LG1A 3OR6B 3S88H 2K4WA 1B2WH 4IRJC 5D1ZI 3RGHA 3E0GA 5KTEL 2A38A 4F9LC 3LKQA 4IOIA 2APBA 2DOCA 4Z7QE 3GI8H 1MHEB 1YJDC 3GZPA 4JR9L 4W4NA 4QY8B 3T65B 1HHHB 2MKWA 5IJVA 1OW0A 4YPJA 4HOXA 3NJMA 3AM8C 3VXPA 1UB6B 3CPLB 5DFVC 2RH0A 3QJFA 3WENA 4BE6A 3UYOD 3H9HA 3CC1A 3N55A 4JREC 2R2EA 4R84A 5HSFA 1AOHA 2J73A 1RZIA 1SHMA 3KZ8A 4UQCA 3OX8B 4YDKH 1C1EH 2G3ZA 2FIKB 2FQFA 1AS6A 2OPCA 3U30C 5J13B 3BCFA 4KAQL 2IDCA 2Q0ZX 3DUUA 3BDBA 4HK3J 4XGZB 4BGDA 4PW4A 2CUIA 3LV3B 3LRGA 4NUGH 4ADIA 4QHPA 1IARB 5CCHE 3ETSA 2A99A 3EYVA 3WE1A 3K71B 2F7OA 2H32B 4J2QA 4MB5A 3PL6B 4PJXE 4Y2LA 4XP5L 5DD6B 5K59F 4DFIA 4OZ4B 1D5IH 4R97B 4U1GB 4MMXB 2IGTA 3ZTEA 4ODXA 5F7EL 4LAQH 4KKBC 4RMBA 1KCVH 2CMRL 1XZ0B 2EVJA 1CR9L 1OF0A 3VYPA 3WKMH 5HDRA 3S35H 3FT1A 2YA2A 3TT3H 1F58H 2Q3AA 3CV5A 3L5XH 3BW9A 3B43A 3TJHC 4Z95H 3KPLB 4JFFA 2WQSA 3FSWA 2OX5B 3Q7JA 5I0VA 4HGKC 5AYTA 1N9PA 4PSRA 3ZKQD 4JQIH 1AY1H 3BKCL 1L9RA 4FZ8H 2VDLH 1XIWB 3PIQB 1OOAA 4LVNB 5EO9B 5EOCJ 1QRND 4R0LC 5JHDD 1J5CA 3KYMB 2GBTA 5IIEA 4FKHA 1Z3GL 3AT9A 5EF2A 4HJ0D 2CDEB 5J11C 4YJZL 3V4VA 2CO7A 2GSMB 4LL9A 1A0QH 4LCUB 4Q9RH 4GSUA 3K2MC 3UTTA 3X3GL 2EXYD 3DXAD 4RGOL 4XMXA 2WQRA 1QTYT 2IQAB 4N0CD 3LKRB 1H8OA 1TYJA 2BSEA 3FSVA 4OCWH 4XZUA 3MV8E 2NPLX 4N25A 3NGBC 3A4AA 3O6KL 3S35X 3JYBA 4PS4H 2YSTA 3P4NA 4AQEB 2ZCHL 5ITBH 1I8KA 4WEBH 3HI5H 3GQFA 2XQBH 4XMUA 3ZHLA 2KQMA 4MD0A 4NO3A 4MJ5B 5AVTB 3F7YB 2E56A 1R75A 1G7PA 3IFNL 4XNYH 5HJ3B 3QRLA 1XMWA 5IF0B 3SDAB 3CXDH 3WO3B 3DO7A 2EVIA 1EZLA 2CBPA 2WBXA 1NC2D 2Z4QB 1L0XA 3ELQA 5EO0A 5IW1B 2P8LB 4EOWH 3NCMA 4NN7C 4PVBA 1BBDH 2RACA 3VWKB 2A74C 2Y6TE 1BQLL 5C0BE 5L2KE 1S7RB 4HMDA 2AVFA 4HBCL 2CRYA 3QI9C 4LNRA 3CDGB 5TTRA 3A6CH 2O6CA 5CLYA 5HDQL 1WBZB 4N6QA 2AEIT 3VQLA 2E74C 3I84A 2ZUUA 3EYSH 1ID2A 3OMNB 1GYVA 1OK0A 4DPRA 4Y4FC 2AKRA 4NUPA 3ZDYB 4EKXA 3BDYL 4GG6B 4AUJA 3MRQA 4OF5A 3VRIA 3OAWA 4A04A 1E40A 2VE6B 2Z31D 3HE7D 5GQBA 4U1MB 3RX5A 2AXWA 4LE8A 1PX3A 1KJMA 4H1LG 4AYSA 1O9ZA 3DIVA 4MFHA 1GPOL 3U7YL 3WS6C 1G9NH 1KJ2B 3CXFA 3GT6A 1RPQA 1RQ5A 3L3JA 4KMTH 4FXGB 4DN4L 5FLVA 2DY2A 3IJHA 2YEZB 3OX8A 1PZBA 2Y36H 3I6LE 4B5EA 3VXMB 1XF4A 1UURA 1OXYA 1WD9A 1A64A 2VNCA 1R5VA 1XZWA 4LMQI 1AH1A 5E6YA 3C5JA 4HHWA 5F6HJ 3KPSE 4HISA 2QV2A 2JKWA 1KG0A 4OF6A 4KY2A 1AVAA 5ALBH 1G1OA 4Z8FL 4XMTA 5FOJA 5FGRA 2PW1A 2ITDB 3IBEA 1RHHB 2VMJA 3STZB 2JXMB 3B37A 2BSRB 5A2LH 5BJTA 1OLZA 4GKLA 2A9AA 2XWZA 4N9GA 5EZLB 4A7GA 5CINH 1NPJA 4NI3A 2P5EB 3DJSA 5D9SB 3VFVA 1BVZA 5C6TH 1AGCA 4LBEA 1NICA 4HIXL 4LCWA 2CJ3A 3V0FA 4PPTA 1Q72H 1NC2B 2VQ4A 1W8NA 1UXMA 2AW2A 4MGXA 5D7KD 1F6FB 2Z1PA 5FXCH 3DECA 4HS3A 3VI3B 1L6PA 1CFSA 2I7OA 4NBYB 4WK0B 5AKRA 5BZXA 4A6YB 1AXTH 3O3AA 1T21A 1RERA 2QADB 2X4UB 1OGTA 2B3RA 2OJEA 3VQ1C 2AJ3B 3TIDB 2YD2A 4C83A 3FHAA 1AJ7H 1FJ1A 1CGSH 1DVFA 1UXSB 1A3QA 2BY2A 1QWHA 4KKBD 1ZEAL 1J5DA 4OSUH 4CKVX 2XV6B 3LXCA 4PRPB 5GGVL 3ESUF 1VJSA 1YC8A 3CLEH 2IPUG 1HZKA 5AZ2H 1AIFB 4ZSOB 2I26N 2GJ6E 4UINH 3RWDB 4BDVA 2IQAA 3TJHD 2QBWA 3OAZH 1DJWA 2Z64C 4YHZL 5JPMB 1V8HA 2F53A 4GRWE 3IJ8A 5KSVB 3BDXA 4G43A 3PWJB 3D52A 3W9DA 5J12C 4G1MA 1NWOA 1TT6A 2Z31C 4FQ2L 4WGWB 1M57B 3EGXA 4C56E 2E7LC 1SJEB 5HJ3A 5IB4B 1WO2A 4PI0A 3ZE1B 2QELA 4GFXA 3UJJH 2JI3A 2ZT9C 2Z4QA 1N8ZA 1PG7L 4P04A 4PUBH 2NTFA 3FFCE 3D0VB 2XN9E 4R5XA 1UT2A 2GC7C 3MGAA 1GIGH 2UWEE 4OB5H 1F58L 1XBDA 2GCYA 4BQ6A 5CEZL 2GJZA 1U8PA 4R2GB 4W9FC 2ZWSA 4GMSH 5DZOA 2CJUL 2HT2D 3WXVH 4P2OB 3KJ4B 3WHXA 5GSVA 1WBZA 2VDML 2YPKB 4PJAF 1WG3A 5IK3B 5T1KB 3RY6A 3GKWL 5E5MB 4NQXB 3LZNA 5I16B 3UYRH 1BFSA 1JI1A 1P5VB 2HFFA 3QAZC 5KW9L 1GOGA 2H4EA 3E6FA 2MTAA 1GGUA 2R59A 3BLKA 4ELMA 5I6LA 5BUAA 3NP4A 3SKOA 1UWFA 2VDKH 5TDPB 4WUKH 5E4AA 3UJJL 4N26A 1PL3A 4ATWA 4FTVE 3AVEA 1I8UA 2IGFH 1W8EA 3TOPA 5D2NC 1KBPA 3AS3A 3L3JB 4C4KO 4FLRA 4JFEE 5I1JH 3IJ9A 4KXAA 3E3QC 3KLSA 1EPFA 1TFPA 2X4PB 2VDQB 3QNZB 3AFLA 1VGEH 1AO7D 1YMME 1UACH 4C56A 4IDLA 3VD1A 3DDGA 2HRLA 1KXTB 3QIUB 3VXNA 3GBNL 2JCCF 4XP5H 3I3DA 4GBXC 4Z7UB 2V7NA 3LV3A 4JE0A 4Y2DC 2ICEB 2Q9OA 3HE7C 4H8QA 4H8HA 4PVNA 2FYVA 2BX5A 4CGTA 5LDUA 4AMKH 4HJ1A 4QOKE 4FS0A 5MEOB 3T0EB 1EFXB 1FO0L 2VO5A 2FSDA 1N0XH 3JUYA 3EFOB 4RFOL 2YPLD 3SDXF 3ZMRA 4I1RA 1GZPA 4XXCC 5FDWB 3WFBL 1BJ8A 4EIGB 2DQIL 2FBOJ 5EZLA 1A1NB 1H3TA 4NNXA 3DURA 2JCCE 1EXHA 1MCKA 1SLUA 4HIXH 4KPHH 1VAHA 3RVTC 5GJSH 1BFOA 1OAYL 2DQEH 3L3OA 2JQAA 4RX4A 3RZCB 3HUJA 2HZHA 3ZE1E 4HEME 2ARJQ 3CHQA 4HKJB 4OCXL 1JWSB 4E9TA 3PDDA 3MUUA 3O9WC 4HAFA 3FRUB 1JNNH 1E6JL 2Y23A 5EOQH 3O11B 3H8NA 3IK2A 3RWJB 1XSOA 3N42F 1LMIA 4PG9A 4AYFA 1TCRA 2ADFL 3SB3A 3BAJA 3FN9A 3OR7B 4N2LA 5MERA 2VLME 3VE0A 4DCQB 3HCVB 4WK2B 3MV11 2JKIS 1KN4L 4HWEH 2C9RA 2D3JA 1UD2A 1W72H 2ZUXA 1U8QA 4JDZA 3RY4A 3RZCD 4J39A 1NCCH 4X6CA 2VL5B 3ARYA 2C26A 1I9EA 2G2NA 2XWCA 4PGZA 2VMEA 3E8UL 3X14B 1I4FB 1XEUA 3G5YB 4DO4A 4N68A 5ANMB 4KKRA 3NFSL 4X0NA 1ZE3H 3MGTB 5IQNA 4Z3EA 5DUML 1UKTA 4A2MA 1DBAH 2DQFA 4F3FB 3IJYA 5DZVA 2WWMD 3U9PH 3WIAA 3IDGB 1ZLSL 5E4IA 2Q76B 5FM5M 1LK3H 4OD2A 5C07D 1N10A 2DW5A 3SDXE 1BQKA 1DSFH 1CD8A 2PO6C 3KJ6H 4XXDA 2CBMA 4R96A 3GZKA 1JCKA 3FO9A 2Y1ZA 1BLNA 3JQOB 3KVPA 2OULB 2NR6D 5HTSA 5GSRA 2BFVH 3F3HA 3QEUB 4KROC 1U3HD 4PRHB 2J25A 2ATAA 3VMPA 4EI6B 3V10A 1FIEA 1A6TA 1ZSDA 4M43L 5MEND 1MUJA 4JX0A 2YOCA 4LSSH 1EGJA 3FMGH 1VFAB 4LRNH 5J9PB 3AGVA 1WRFA 5FYLL 2OSLA 2CLRA 4AUYA 3LN5B 4LU5L 4P2QD 4K3JL 4UNVA 3X17A 1IKFL 5J4MA 4PGBB 3FU5A 4MYWB 4KNTA 1TUPA 3O3BA 1M3JA 4MCYA 4NZFA 4UV4H 5IKCA 1TZHA 4GSDL 1PIGA 4W6XB 4HUMB 3TURA 1YEJL 2YD3A 4WDIA 4XNQB 3ZZSA 4TUUA 4KTEL 3HG3A 5AOJA 3DJTA 4EDXA 2DYSB 3QCUH 1MVFA 2UYLA 1YJDL 4HV8A 2QFPA 4G7VH 4UOJA 5MI0C 4U2YA 4KXDA 3O9WD 1EZUA 4FG6C 4Z78A 3QQ3B 2IG2L 1S7TB 1H0DB 1S7WA 4HX1B 3UTTD 3ZXAC 2E6JA 2KLTA 4QHLA 5LBVA 5BCAA 2AI0H 2CJSA 2VM3A 2E7HA 3ARZA 2XG5A 4FJ6A 4O02B 4Y9CA 2MJWA 4QF1B 4F7CA 3UTTE 3PWLB 3BWAA 4E9VA 1ZK9A 1VFBB 5FYLH 4AC2A 4YAQB 1YHPA 1G6VK 4Q9BA 4YWGL 1D5BA 5T1LB 2EUZA 4KJQD 1LEGA 3A4FA 5JQIB 3MGOA 3P9MB 4R4FL 3ROOB 5CUSH 5K39B 4LKCB 2R4SL 3GIVB 3JV4B 4CC4A 1ZT7A 4YGAB 1XF2B 5T5FL 1Q9KA 2NQDA 1LLAA 2YXVA 4DGVL 4JHAH 5LWYL 4A67A 2ZOLB 1X5GA 4LCCC 4FQIL 4UIKH 5C09D 4LSQL 4O9HH 1MAML 1FIGH 5GRWA 5DRWB 3LN4B 3WN6A 1X7TA 2UY7A 5DC2A 4GXVL 1OSZB 4EBQH 1AKJA 1NM9A 1QG3A 2KBGA 4FQ1H 2AAVA 5MENE 3DSFH 4AEIH 2B4CH 1P9MC 3B34A 2H8PA 3GXTA 5LNDA 3WTXA 4LSSL 3SY6A 5I30H 3ZRSA 1AD0B 4CSPA 4M3KB 1H3PL 3L9YA 2YUWA 3GSNL 4D0BA 4KROD 3D18B 4JVWA 5SWQB 3G5YA 3MLYH 4IRSA 1OARH 2UUDK 4K07A 5D7LB 3VFRA 2ZKMX 2JJTA 1BMWA 1DUYB 2H1XA 1P7QD 4BK5C 2VQTA 1ZPUA 2DTMH 2PP9A 4LARH 2MPAL 1J5HA 1HH9B 4W93A 3G5VB 5ITFA 1HQRB 4JPKH 2EXYC 2VR3A 3NTCL 2WUCH 5B8CC 3GTNA 4RMUA 4WRLA 3CZSA 3SKMA 4IRSD 3L3IA 3PPSA 3BAEH 1QLFB 5JHBA 2DYPB 4L9LA 2IAAC 4P57A 5DRXA 3SDDD 1ZLUH 2XXMB 1UZ6E 4HA1A 3FH7A 4K23L 3FT4B 2UWEA 3VXSB 3IVKB 1QASA 4E41B 1Q94A 4P2CG 4ELKA 3ARDB 4JRWA 2FH6A 3BP6B 3L4CA 3QHFL 3QG7L 2J88H 3TT1H 1T5XB 1PJWA 4DH2A 1OAYH 4JM2A 1QFOA 4NO0A 3TJPA 3HG1B 4OQTH 5CGBA 3M1BA 2RA1A 4HMEA 2WTPA 2IWGA 3FQRB 3GSXB 4MMXC 3BSZL 4Y5XB 5GRVL 4G3YH 43CAB 3K6SB 1I9IL 4OKVB 1II4E 2DM2A 2WXOA 4NZ8A 3U36A 5JHAA 4XVSL 3ULSA 2HFEA 2ED9A 3MBXL 3VGFA 3VYNA 3MRJA 4CN4A 1W72A 4OLWL 4DP5X 2YUZA 3VM7A 2H2PD 4KC3B 1NZRA 1X5XA 1W6WA 3UG4A 2FJSA 3SBQA 4HCGA 4OQ1A 1AI1L 3MKKA 4KVCL 4M6AA 1J05B 2YPLE 4GB9A 5MEPA 4AENB 1S7WB 3H2WA 3EH1A 3SDAD 4RETB 1AZNA 3CZEA 3G5ZB 5EPMB 4XVOA 4LSVH 3KS0J 4OVVA 1RZGA 4JREB 1GAFL 5MEOA 3QUYD 4GPVA 3U83A 4N0UB 3FUFA 3FTWA 1SLVA 3PHQA 5D6CA 4OCNC 5BMFH 1KCUH 3QG6B 1F8TH 3LKNB 1CVRA 5DD3H 4A6YL 2C9VA 2YAFA 4JCMA 5JUEH 2ADYA 2YLKA 5T1KD 3UABA 3GIVA 1YMMD 1AO7E 1PF3A 2JKTM 1RLBA 1YY9C 1LM8V 1YUHB 1Z5YD 2X41A 5B4MD 1J5OH 6FABH 2P8MB 5AFAA 2JB5L 4QHNA 5E6SB 4CMMB 2YD7A 2R69A 4H13C 4JFED 3D48R 5DHYB 1D5ZA 1UA6H 3L1EA 5B7MA 2CHDA 1U42A 4FF9A 1R47A 5TGBB 3VSTA 1JG9A 1MNNA 1ZWIB 3V0JA 1EJOH 4FTVD 1TQTA 2UX6A 1OE3A 3QNXA 3QP3A 1XR9B 2NY4D 3ME0A 3TTYA 2QT6A 3FF8A 4KHTH 2G2PA 3AS2A 3S0PA 3OLGA 2ITCB 2VZUA 3IFLH 1SM3H 4Z7VA 1KDIA 3UP6A 5D1QE 3ZDZB 5GISH 1PLGH 2XZZA 4KKCC 4TVUA 2NX5D 3O4OB 4ESKA 3GF8A 1T3FB 4Z0BH 2GUOA 2VRAA 4XPHL 2FO8A 5EEVA 2JB5H 1A7BA 1F3JB 1NFDB 2X2UA 5G5DA 3BH9A 4ZQTA 2VIRA 1BCIA 2YD8A 4POUB 5KSUA 1ETZA 2XN9D 4HK0B 1MHPL 3FFCD 1I31A 2WQVA 3I3EA 5B1JA 4DZ8B 5CEZH 1E4WL 3VWJD 1MHCA 1EGJL 1XIWD 2NX5A 1IM9A 1DQML 1BA9A 3WIIH 4C56D 3WTYA 4OD2B 2BRQA 2R51A 5LNEA 3L3IB 1MFVA 3DX1A 1OP3H 2R2BA 3BEVA 3EF7A 4GBXB 5EZJB 3SYAA 3VSUA 2W07B 2DYPA 1T1WA 3N43F 3Q48A 1E9QA 2VYRE 1CICA 5F9JB 2H32A 4GG6F 2C7FA 4E5XA 2XU9A 4F20A 1BQHA 2WIIB 3HFML 5ALCH 3JV0A 4N8UA 4NUJA 2F19H 2O6FA 2HTLD 4XN1A 2GJ6D 1N18A 2LLLA 5DJAA 4C59B 2APTA 3QDJA 4X8XA 4JGJA 3GXFA 2JWYA 3MRRB 2F7PA 4X5RA 1A6ZB 4K23H 5D1QC 5ABDE 3QUZD 3MRMA 4B3VA 2PWEA 4ZX5A 1C5DA 2QZQA 3QUYC 2A7BA 4I3RL 4OCYH 5LAXB 5KBNC 3GMQB 1D9KD 1RIUL 4J6IA 3QQ4B 2LABA 4WCYH 3S4SB 5E1GA 3LH2H 3NIGB 4HGWA 1PG7W 4IRJA 3Q05A 3LHAA 1JGLH 4Z6AT 2VLRA 2CDGB 3U4EB 3WKNA 4Y1SA 3KJ4C 3GPEA 4J3VA 4Z5RA 2P3YA 4HSAC 5K1JA 3PCYA 4AGMA 1A3LH 4GIAA 1GGBH 7FABL 5E7FA 3CFCH 1BX2B 1FZOB 2BY1A 2HPTA 4AH2B 1FHGA 3FN0H 3RPIA 1WTGT 1MW2A 4H1LH 1T03L 4NENB 2RGSA 3ZDYE 1DQLL 1M1XB 1QFWH 3IYLW 2Z31B 3TZVB 1S3KL 4N0UA 3TYFA 5FGCE 4PV8B 3T2LA 2IALA 3KLLA 1HYSD 1AZCA 3BQVA 2E0PA 4PJAB 5DZLA 4XNDA 5I1LA 1P4IL 3KPSD 3F6IA 3CFIC 4WFGD 5I74C 5TF1H 4C4BA 3RDTA 3VSVA 1F02I 2ED7A 4UF7C 1MCOH 1HFUA 2IANE 2BIIA 4YBLC 1YN7A 4XE5B 4M56A 3T08A 1HXMB 5LCVL 1ZGLB 1JPTH 3T2PA 4LCYA 1EZVX 3OJ2C 1JGDB 5MP6H 3BRGC 3GTVA 1RZKC 1CMOA 4DTGH 1LJMA 3N5AA 4Y5YB 4EOWL 2A6DB 1G9HA 5AVRB 3VFNA 1Q9OB 4FFWC 3RDTD 4UT9L 2XY1A 1KPVA 5DGRA 1XGTB 4L1BA 4XZ4A 5DZAA 4B60A 5JHLH 4KNQA 1AZUA 1L3WA 3IFPA 2GITB 1DLFL 2IAMC 4YDNA 3UTZA 3MRQB 4KJWD 3KPQA 2W9EL 3ZKXC 1FO0B 3L3HA 3MREA 1K4CB 1BVOA 4D0BB 4PHZA 2VN6A 5D2LF 2QTEA 4UIMB 5J5EA 3V5DA 5K9QI 2N56A 3T0DA 3OKNB 1E4HA 2ATKB 1HEHC 2AK4A 4HH9A 3H9HB 1HCZA 4KQ0A 3OKEA 4MA3A 2P4AB 5C0BD 1HOEA 4MKTA 1DBJL 2E9GA 2EC9T 1AR2A 2V5RA 1I8IB 1ZIBA 2NY2B 4A2FA 4K9EL 1H6TA 2WZPA 1E28A 4F7MA 2NNCA 3QJOA 2CKBL 5HI5C 2WQWA 3HS0B 4LPUA 5EOCH 1X7QB 4V1DB 2COVD 5CJQL 3OKOB 5DO8A 1G5AA 3VDBA 4U33A 4ZPVB 1L0PA 4P9MH 3QIWB 3RB7A 3TCLA 2EDYA 5CSGA 2ERJC 4J3OD 3IGFA 5GS1A 1SF3A 2D3VA 5CEXB 3CFEB 1Q9LA 1V55B 2BP3A 3NJVA 3UAFA 5C3LD 5FAAA 2B4CC 4G70B 3DYMA 1WAEA 1PX8A 1EZSA 4IIZA 3CE1A 5JHDE 2QADC 4P2QB 1F00I 2KL6A 4WJG3 4ZODA 3P0GB 3E8VA 5LAXA 1KGUA 2CD0A 5I6MA 3VGGA 3RFZA 4LSPL 2CO6A 4E9WA 1KTJA 4K2UL 1MCDA 1OGAA 3OZ9L 1IC0A 1J0JA 2WTRB 1IX2A 5E1IA 4BH7B 3B2XA 3FN3A 3KPNA 1U4FA 4JHWL 2HTLC 3WNLA 4TRPL 3LVEA 1OO2A 1MI5B 1OP9A 2G2RA 2DQTL 2FWSA 1X9QA 2GEEA 3ASOB 3PXHA 2ARJA 3GK8L 1CDCA 2FNBA 3PAUA 5DC0A 1MWAL 4OCRL 5E8EA 5AW6B 3AJ7A 4ANUA 2WXRA 1TJMA 3NZUA 5DFAA 3PJLA 5TK4A 3UO1H 2DF3A 2BJML 4KH9A 5DA4A 1NCIA 2ZKHL 1TTRA 4OZFB 4NO5B 5CGYD 3MX0B 1REIA 3KL5A 2PETA 3ECQA 2IALB 1OGSA 4PJHF 2QSCL 3UO8B 2WB7A 5ICYA 3PWJA 1CPUA 3ZQWA 4LASH 5INCB 3IBOA 3FS9A 5H8DA 1C12A 3QK0A 2IXQA 3HUJE 1AE6L 5EEZA 2WQUA 1GR7A 1R5WB 1PY9A 1ODUA 3NOIA 3GBMH 5CJXA 3D34A 1URZA 3SGKC 2PCFB 2DJSA 3CG8A 1NCAL 2DQJL 4DUVA 1LE9B 1AGFB 1VA9A 3CX2A 2NY0D 3VH8A 3VJ6A 5A3IC 4DP0X 4MNQB 5DUJA 3RUGE 5DZ9A 1ZLWH 3C08L 1EHNA 4U7KA 1FC1A 4P5TB 4HKZA 4N24A 3UJIL 1NJ9A 4FJYA 3IU4L 2EDOA 5B38B 5IFAH 4XNAA 1U8MA 4J4PC 4GQ9L 3EYOA 4N0FB 3ARFC 4NO0D 4RAVA 1WAAA 5D96B 3UH8A 3ULVL 3FK3A 5CIPH 3IMBA 5KTEH 3PQYB 1G9NC 3F5WA 2P9RA 1BAFL 1KJMB 2XDHA 1NGQL 4RSYA 3FQ4A 5D1QA 5D4QA 1QD0A 4BIKA 2VT0A 2JIXB 3LRSB 1AHWA 3L9BA 1EEYB 2EH7L 4LRIC 1MLBB 2E75C 1J11A 4HK3N 5KZCD 5JNYA 2HUHA 1MHCB 4NOFA 2IGFL 3C5SB 3I75B 5HDBF 5DLML 5GZOC 3QEQB 4JO3H 4EVNB 2C3VB 5EA0L 4ES9A 2D0GA 3QA3A 1F56A 2E5EA 2FB4L 3KLKA 4OT1H 2B2XL 4JL2A 1PD0A 4HG4K 1R3IL 3WXWL 4XMKL 3VFWB 4J2XA 2KLRA 5IEHA 1KENH 3U6RB 3T0EA 5TQ2L 3GBNH 3CVCA 2JJSA 3O3EB 2PTVA 1NH6A 3EFOA 4Q89A 3CDZB 4S1QL 3O41B 1X44A 3IDJA 4GJTB 3CHOA 5C9JB 5CEYA 5INDA 4FLHA 2C9PA 1RUMH 4N2GA 5F93C 5H2BA 1I1YB 1R5IB 4HOZA 2EIJB 3SE3A 2DLHA 3LIUA 4WV1C 1XR8B 4LLYA 3VTMA 1WJ3A 4ERSL 1QWNA 4XP1L 1A7PL 1NKOA 1S9KC 4QUOA 1DQKA 1ASQA 2WO4A 3JV6A 1YY8B 4JFEA 4XO3A 4HKJA 2YKLH 1MRCH 4P2RE 3N44F 3QUZB 1CYGA 1IEAA 1F5WA 2CDGA 1WEJH 4KJPD 4PJ5A 1NTDA 1ORQA 1SHSA 1JGVL 3SODB 5I2IA 1ROCA 3QZWA 3HI6H 4X6BA 1BF8A 4LL1A 1FJ1B 4PJBE 2AI0L 3FYEB 4EUPB 4FG2A 5MERB 2C1OB 1PG7X 1TZIA 2ZPKH 1IVTA 1T80A 2WXIA 2AF2A 5HGBB 4LSUH 2V37A 4MNGA 1HI6A 2X38A 2WKLA 2IOIA 4IU2A 4D8PB 3REVB 1K5WA 2DWXA 1CF8H 5HY9B 1QUNA 4YPGB 4UAOB 4ODSH 4Y5XC 1M1XA 3U1SL 2QHLA 3IETA 4LLMA 3MROA 3QEQE 3FCBA 5A7EA 5C0JA 4PEEA 4MMYB 3MO1B 2QGEA 2Y6SD 4N3TA 1I7RB 2A74B 1HWHB 2DQFB 4K94H 5FEBA 1ZVYA 1C16A 2WLLA 3O4OC 1WEJL 2GT9B 4M61B 4E41D 1GZHC 1P7BA 3CSBA 5D7SL 5DD5L 3FO0H 3DIFA 4PJEA 3ULUC 1AG0A 2IIJA 2PXYB 1HIML 5F1IA 5F3HA 1XGPB 3GHBH 3MOBH 5ABZA 4F2EA 3B6SA 5HYQB 3NAAL 5A43C 1BGXH 2X6AA 3KCPB 3ARQA 4FXKA 4PBDA 3ALWA 3BX7C 3VMOA 3EFFA 4PR5A 3C6EA 4AGLA 4RFNB 3LKOB 3RNQB 4L1SA 2YAQA 4JY5L 2AJXH 4JRFA 5A2BA 3LNGA 1WDAA 3BO8B 3PGFH 1OIOA 1TZ8A 1MW0A 3O3DB 3FOLB 4WNQB 3H2QA 5HI3C 3QXDB 1EWHA 4JB9H 5JOPD 2HFFB 5F7KC 4ORGB 4OFQA 2HVJB 2VLLA 3CK0L 4QXGH 1JVKA 3SKOB 4N8CH 4UTAL 1Q0YH 3VXQA 4TQPA 4K3EH 1KACB 2Y5QA 5IFAL 1KYOJ 3CFJA 3PY9A 4PWKA 1T7XA 4IOSA 1UWGH 3SJVD 3ZTCC 3BN9C 1RULH 1AD9A 2NNAA 4NJ9H 5SWSD 2FQGA 2C1PA 1KTDB 3NEOA 4U1KA 3NJKA 1YNKL 4KGJA 4PAZA 2FIKA 1WP6A 2ORBH 3NDYE 4ABVA 2XYBA 5G55A 1XV8A 2UYLB 3C75A 3GNMH 4UTAA 1XGYL 3P0YL 1I3GL 2H47C 3B3IA 1XH2A 1H8LA 2IH9A 3RWHB 1EEUA 1G7LB 3UROR 3PL6A 1RFDL 4U1HB 3M17B 1T4KA 1YNTB 2XUWA 3GXPA 4RGMB 3W0WA 3E3QE 1Q9LB 1D5BB 5C9JA 2V5YA 3BAYA 5L2KA 2QQKH 1OAUL 4HIEA 5BOPA 4DN4H 1QZ1A 1TJGL 4G6AD 2DQJH 5JMRA 1UG9A 1GGCH 4NFCA 1U8OA 1WFNA 1XL6A 3LZPA 3MV9E 4JJ5B 1U91A 4BINA 3VU1A 1MWOA 5ECGA 2D3LA 25C8L 3K8MA 4HUXB 4FFTA 2DQTH 3GS0A 4FNLL 4RZKA 1BD2A 4AE1A 3HG4A 5GS0L 4MQXC 1QATA 4JPVH 4P2AA 5D1ZB 2UY7B 1MI5A 1RZJC 1TSRA 2VW6A 3RVVC 1KJVB 3JWNG 3MFFA 5D1ZC 4GG8B 1KIQA 3VE0B 1CI3M 2ARJB 1YEFL 1IKNA 3DIDA 4WFFE 3AWEA 4LF3A 3SIKA 1PGRB 3QCTH 1IEBB 4JG0L 2X9XA 1IBBA 4JG1H 1F11B 1WSST 1B0IA 5MENB 4C57C 3MX0A 2FE0A 1R3KB 3N42B 3MUZ1 1OALA 5I1JL 1N5YH 2XYCA 4ENED 3T6XA 2DBLL 1TYEB 1T66C 1T2JA 4F2MA 1G0XA 1SJMA 2V9UA 2OSWA 5E8DL 4ANXA 3MFGB 4P4KA 1WA0X 3EF4A 2UV3A 2BVTA 2IXQB 3IRPX 3H0TA 3IDIA 2Q76A 3D2UD 1JNHA 1D5MA 5KYNA 3E1ZA 4KROB 2VDKL 5F3HB 4F80A 4AJYV 4IRZL 5C6PB 2CHWA 1UASA 2BXYA 4XH2A 1UWXK 4HWBH 2F5AH 2ZUVA 4X4MA 1A5FL 4P46A 2C3XA 3GKWH 3FO9B 4ZTPL 5BS0E 3ULUL 2W9DH 4GXUN 4IRZH 1MJUH 1MF2L 3GLEA 4WFHD 4PJXA 1N64H 4F57L 3LRHA 4AIZA 1CCZA 3B83A 4MS8D 1U8MB 3LQAC 3WUWA 5T1DH 2P26A 4H8UA 3FQWB 2EEXA 5ANME 3T65A 1WC7A 1RURL 1NIDA 4OLZH 2H3NB 4YHIB 1FFOA 1S9XA 4PD4K 3K6SA 3H2PA 3TV3H 2XQYA 4NKMA 1JPFB 1DP0A 4X6EA 4XP9L 5CR8A 5FYKE 4CVZA 4IKJA 2NUTA 1H5BC 1U92A 2QQKL 5AD0B 3FH5A 3RPKA 3FUHA 1G0DA 3BVWA 4ODHH 3QSKB 5I73B 1T5WA 4BYHA 3K2KA 2Y2WA 3F05A 4WDIB 4XNQA 3HBGA 4DAGH 1F45A 1BZ9B 2O6PA 2ZQKA 3NIFE 3WNOA 1MNUH 1EZVY 1YQ2A 4DPBX 2HMID 4H8WH 4KHXL 4YDLB 1N6VA 1CIUA 3K4ZA 5B1CA 2YUXA 5I1GL 5HDLA 4U7MA 3P0YH 4HVBA 5MEQB 1AJ7L 1RUKL 1MVUB 2NY7H 3IRCA 3KNBA 4PJEE 3LS4H 2HFGL 2BS71 3TZVD 1WGVA 4MMXA 1OAUH 4MD5A 1Q72L 3VD9A 1HE8A 2UX7A 4QRQA 1FL6A 1JHTB 1FNSH 1I8LC 3NDZE 1FYTE 4PB0L 4XNZC 4YBQC 4JMNA 4Q9QH 5D72L 4JNXA 2WXMA 4QPEA 4AY0A 1GGYA 3OPZH 2PWGA 1K2DA 2DIAA 1XCWA 3HE7B 1WITA 2LTQB 4M1GL 5IWLA 1IEAB 3SCMA 2AJ3A 3NA4A 2DWEB 3UFIA 1BXAA 2HN7A 4RWHA 4LHUD 5HD8D 1WZLA 2G9KA 2OA9A 2CO4A 3ZYOA 1BW8A 5IVXF 1OSZA 1GW0A 2KMWA 5I1CH 1SVZA 4NP9A 4M5YH 4NX0A 1H8NA 3LS5H 2JF1A 4N2DA 1CUOA 4PP2A 4UQ3B 1KBVA 3G3LA 1HWWA 4DZBB 1QPPA 3DVNA 3C12A 3EW3B 5ENWB 1D5XA 1U58A 2DIBA 2A6JA 2H1PL 4O2EA 3RWDA 3TNMA 2ZKXA 1CFNA 1KFAH 2OI9B 2YBRA 4DO6A 5F9WC 2A73B 5IVNA 5HDOA 2PNDA 2FZ3A 4IW4C 1YZZA 3BQUB 5ACLA 3APDA 3X13B 1MG2C 5EU6D 3UAJA 1R9FA 2GW5A 1J18A 2BP8B 5C08B 5FO8A 4G8FA 1PEZA 1EEZB 4P4KB 5DJXB 5E6ZA 3LRLA 4MCNA 5C0BB 2RCSL 2EE9A 2CDFA 5DGQA 1MKFA 4QO1B 5E7BA 1EEQA 3D08A 1RJLB 2EEBA 4CDGC 3ARSA 3QUXC 2BVOB 3I02A 3PJSA 4TLKA 4XH2B 4XO8A 4APQD 2EILB 3F7KA 4ONGH 3D12B 3Q13A 4L8SA 1OM3L 1CLYL 4IDJH 2AV7B 2YWZA 2K3TA 1B0GB 2IVFC 5DVPA 2DICA 2CIIA 2WWNA 4PJDA 4X5LA 2VDPL 4RDQG 2LLNA 4GSXA 3VFPA 4HBCH 1T7YA 3BD5A 4P23A 3E6FB 4ELMB 1F6AA 4JW3A 1P0SE 3HFMH 3QDAA 4BFEA 1LQSR 1A4JB 1HINL 2BZCA 2QHRH 1HE7A 1WC7B 3F58L 3N1MC 3SQBA 5TF0A 1T7VA 3ZK0A 4GUCA 2Y06H 2I9TA 2JKSA 1FFOB 4JO2H 4LB8A 2FGWL 2KYIA 1MPAL 4XI5C 5IROD 4G9DB 1SVCP 4FYQA 2X3AA 1LP9F 3UJTH 2VLRB 5EEUA 3U4EA 5AD0A 1L5GA 2XACC 2AQTA 2OSYA 1O6TA 2VM9A 3JTTB 2VLJD 1MJUL 2YGNA 3MCG1 4XCNA 4ZFZB 4F5CA 3UTOA 3NCCB 4M1CC 4XWOC 1KPRA 4JRXA 3AREC 5I1DA 3CU7A 4GSDH 4N87A 1JZ6A 5C0RH 1MY7A 8FABB 2D9CA 5DUBA 4KK8C 3X1EA 3QR0A 1A14L 4R5VA 2JSFA 2QTVA 3BGFB 2ZUTA 2XHNA 4G72B 3UIYA 1VKXB 3HS8A 3QDME 4XRCB 4Y4FB 3V5KB 4RMQA 4Z23A 2P5EE 3Q2WA 5HHOB 1UWEH 5C0DB 3C8HA 4Y8AA 3QZPA 5DS1A 3M1CA 3AUWB 5IFJB 2O61A 4M02A 4UQBA 2CSPA 4Y9FA 2OW6A 3GMOB 2IDSA 3HVDA 4M4RB 4MB4A 4O58H 4L1DA 3SOTA 2KKQA 1IGFH 3CPUA 3MLWL 5K59E 3MXWL 1CR9H 2VISA 4ZAKD 4I13B 5ESQB 4FQHA 3CSYB 5E1AB 3QEGH 4WZ9A 2K8MA 4Z3FA 2CLVA 5I6XB 4HUXA 3MLVL 4NO2B 2XN0A 5JIQA 3D7PA 1QRKA 1OSPH 1AQDA 3U6XS 5JW5B 3O3AB 3U4KA 4I2XE 3QNXB 4JQIA 4KY1H 5L88L 5CAYB 1TCRB 1MLCA 2IH1B 4BK4A 2X44D 5L6YH 3CVDA 3QUXD 2JELL 1ECZA 2BNQD 3HCVA 4HLJA 1FGVH 4QTFA 1HT6A 2ZWYA 1W91A 3NABH 4A7UA 5K93A 4NIYE 4QRRD 1IFRA 4YEFA 4TNEA 5JIDA 4PJHE 4PREA 2MMXA 3CH1A 1LK2B 5E9DD 2X70A 2X7LA 3OKNA 3KHOA 5BW7A 4L3EE 4M5ZH 5FYLE 3MUGB 3QUXA 4U49A 5J8OA 2BNQA 3MRPA 2DKUA 2A9DA 1KJ3H 5DJXA 2YGPA 1KPUA 2IPTH 1CD0A 4ZX3A 3O4LA 5IMOB 1MCFA 4ODWB 4X4YA 4OFYA 2OAAA 4R90L 3KGRA 1KIUA 4BUQA 1WZ1H 4UB0L 4UT6H 2BZDA 5D2LB 2WZ5A 1T1ZB 4L8CB 1FLRH 2XIIA 2ZSWB 4RBPK 4XAKD 4NQQA 3VM5A 4DPAX 1BEYL 4HYTB 4LBAA 3BAXA 1QRNB 2HT4C 5BV7L 3UACA 4X4XB 3ARBD 2VLKB 5B1BB 4IHOB 2C4FU 2YIHA 3UBGA 4WO0A 1DZ0A 2OFQA 3HZ3A 3H55A 4P23B 1WIUA 3D39E 2CWRA 1Z9SA 1EDQA 1ZIAA 3C9NB 4IKKA 5LQBH 2J72A 3IKCA 3FF7A 3BIKA 3QWOA 2CGRL 1EBAA 3Q44A 4LLQA 4X5XB 3V6ZB 1FN4A 2N59A 2AC0A 4LEOB 4B9PA 4F7TA 3H3PH 1I85C 4OI7A 3V7AG 1PNCA 5C8JB 5FA4B 1U3ZA 1V7NL 3RGVB 4RMSA 1AO7A 5KYUA 1KCWA 1QAWA 3K1KC 1QFPA 4JKMA 3BN3B 2JK5B 3BP5A 3EGSB 1YG9A 4LVHC 3SDDC 2QPDB 2XVGA 1T0OA 2H0FA 3MLTA 3JWDH 3KHQA 1MCIA 4PJBF 3SBPA 2G5BB 1QSFA 5B22A 3DOHA 2VZ3A 2JV6A 1NCJA 4BRJA 1IZKA 4PJAE 2WN2A 2WQ8A 4LHQB 4KI5F 4A7TA 4PGJA 1OSEA 1KY6A 1QNZH 5FR3A 4PLNC 4YNYA 4M1DH 1Q0XH 1OTUD 4WI5A 1T5KA 4WUKL 4NEHB 3JTSB 5IVOA 4Z7OB 1OP5K 1R3LB 4QCIA 4FQ1L 2NLJB 1KB5L 4HF5H 1JDCA 4GKSA 3BLBA 1X5MA 2VL4A 1NM4A 4J23A 1CGXA 5TE4L 2ZWKA 4MMZB 5IFJA 4ONHA 2BFGA 5CBEB 3ET9F 1AR1C 2C9UA 2GIMA 1NL0H 2JQMA 1BOGB 3HVNA 1P7QA 4CUCA 2ZNWA 2QQNL 2DDQH 3DHJA 3OV6A 2ENSA 4I8DA 1RIVL 1DYZA 1YVLA 1CLOH 4NZRH 5I8KH 4OBRA 3BZ4A 1MZZA 4K3DL 1KOAA 1C08B 1O9WA 2FGWH 3FRUA 1K6QL 3QVAA 3IF1B 3VXME 4X4KA 4HZLA 4H0IA 3SE9L 3VDAA 2C9XA 3JSSA 3FB5A 3GHEL 3MRBB 3QXUA 1NPUA 4NPKA 3ZKNC 1VZHA 2Y06L 5HYJE 1N5YL 1NPNA 1S5IL 1FQ9C 2E7LA 4N2HA 3N43B 1BVNP 2IG2H 4F7PB 5ES4B 1KCSL 4Y16C 2A4CA 1LK2A 4G8GE 4U3HA 5SWQA 4FQXC 5DURD 4LLDA 4XP4L 5I1IL 1OAJA 4M48H 1IGIL 35C8H 3TU6A 1YMHA 3LRSA 4KKPA 1J5IA 4B9KC 4X7CC 3A6BL 5FO8B 2X1WL 4ZUUB 5JW3L 2COQA 2YAEA 5GRXG 3NRQA 1Q0EA 2Z35B 5JNYB 3IDGA 3TESA 4W1TA 4X4YB 3CN4A 5FOBB 4O2CB 3I75A 1CXFA 3KM1A 3LY6A 2R15A 5D1XA 5PCYA 1DJYA 2BNRB 2C3VA 4U3XA 1E4XL 1UYWH 2O5NA 5KJRL 1J8KA 1ZLSH 2V5SA 3FTUA 3IAQA 4JFFD 4MJID 3C60A 4JZJB 2YR3A 2WLZA 2Q1EA 5I5RA 5B21A 1EAOA 1NUDA 4ELMF 4FKKA 4MAYD 2VRQA 1X3DA 3GSQB 3LPGA 4G11A 5J3HD 2BOLA 1MJ8L 4HD5A 1MXDA 3SD5A 5I8CB 5JXEA 3QUYA 1P4BL 4IGBC 3CFKA 2VMCA 2VW4A 2EVFA 3G08A 2OYPA 1RFDH 3N91A 4FP8L 4M8UA 3N04A 4FNPA 3QYMA 3CH8A 1VFAA 5BRZD 4LGSB 3UC0H 3RFZB 4AGPA 1KFGA 4TVPE 1C9SA 4I3RH 1XMEB 2AMGA 1NANI 1XGYH 4FFZA 2RTTA 2VCOA 3ZE1F 4PYHA 4PRDA 1CBJA 1OT1A 3C5ZA 2ORBL 3QZNA 1YRKA 3BVUA 2R2HB 2XZQH 4LHUA 3TEWA 4EDXB 1ES0B 1QSFB 3THMH 5FCUL 3QIBA 4KTDL 1IJNA 3MA7A 2HVBA 2KPNA 4POZC 4AENA 3P2BA 4BM7A 2P44B 2WYIA 3WFDL 3QUMH 2OL3H 5DDHB 4HUKB 3U46B 2ZOTA 3WFBH 3OLDA 4C54A 3F00A 4OIAA 1MCEA 4WWKA 3KPRE 4PTUB 4OCYL 3ZKND 3KDMB 4PW3A 3I50H 3WS3A 3KGSA 3E1F1 4MMZA 3NFPA 3ABGA 4KDVA 1BOGA 4JKWA 1G7IA 3BJLA 5EIIG 3SE4C 3ZGHA 2Z6FA 3JV4A 3JT0A 2E4FA 4NQVB 1YDPB 5FYKL 1USQA 2BS9A 5E08L 1OTSC 1AQMA 1KJ3L 3CZLA 5HGHA 3UPAA 5JLZA 2KZBA 3II3A 1KBWA 4MJHA 4NC1C 3EJQA 5CIPA 1AGFA 3QQ9C 4OAWA 2LOEA 4TSAH 1NCTA 1AKJD 1M7IA 1XR9A 4WTQA 1ZLEA 4BH8B 5E2UH 2KC0A 1NMBL