4BGLA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
ELFQTADWKKEKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Superoxide Reductase from Giardia Intestinalis: Structural Characterization of the First Sor from a Eukaryotic Organism Shows an Iron Centre that is Highly Sensitive to Photoreduction
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE REDUCTASE
total genus 24
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bglA00
4D7PA 4BRVA 2JI1A 4BK8A 3QZBA 4BV1A 2JI3A 2JI2A 1DO6A 4BFJA 4BRJA 1DQIA 4BFFA 2HVBA 1VZHA 1DFXA 1Y07A 1VZGA 4C4UA 4BFKA 4C4BA 1DQKA 2AMUA 1VZIA 4BGLA
chains in the Genus database with same CATH superfamily
4N90E 1MJ8H 2YSTA 4JNXA 3N6YA 3MKGA 5JHDA 2NZ1A 1Y6KR 2PN5A 4GMTL 1CXLA 4OLEA 5EBWA 4PJ8C 3TCXA 5JOEA 1AMYA 1BF2A 1BAWA 1ZLDA 4DTGL 5JMOC 3NH7L 2WN3A 3H2WA 4ODTL 2E59A 5AAMC 4JL2A 1AHWB 4UM8A 4XXDA 1NKOA 4QRFA 3TBVB 2SEBB 2ZJSL 4P9HC 3S36H 1CBVH 1EJOL 1KZYA 1TJGL 5DHVB 3RWJB 4AGLA 2DPKA 4N5UA 2X9ZA 3VH8A 4JO2L 1ACYH 4HZLA 2D7TL 3SKOA 4H1LB 4E9TA 1NJ9A 1QEWB 5IB1B 2YPVH 4AQAA 4OU3A 5JZ7C 4HKBA 4JHAH 1NPJA 2J4WH 5D7SH 1Y1UA 3RVTD 4KV5F 2MCG1 2QADD 3FB6B 3FNKA 5JHMA 1OGAE 2A83B 1U21A 5EIVA 1P4LA 3L54A 4PJFA 1JSYA 1XCWA 4D8PA 5EU5A 2KZBA 5I19L 3M17A 2X0VA 3ETBJ 4XNUL 4OTXH 5KEZA 2Y36H 3E8UH 4ERSL 1NGWA 4LP8A 4L4VB 2CO4A 1J5DA 1G7QB 2RJMA 3ARTA 4Q0XH 1KXQE 3FSVA 4Y4FC 3SGEH 3WN5C 3KS0H 4BUHA 4H88L 2YD1A 4G9DA 5FYJH 4BD4A 3RHWK 3R06A 1QFWI 5EUOE 1DQDH 2Z31B 4M7ZC 3EH3B 2Q76A 2H6UA 3LNFA 4P3CH 1DTUA 4N8UA 1VDGA 2VZVA 5DF0A 5AL8A 5E6IB 5AW3B 4QJ3B 4AVHA 5JXAH 5AW7B 1ZHLA 1HHGA 3MUZ1 3P2BA 2OMTA 5IHUL 3T3PF 3VDAA 4ABWA 5HD8D 4GOSA 2BVOA 1FSKB 3IWUA 5ADPL 3VWKC 4WDIA 2Z4QA 1ZJAA 3WGUB 2HLFC 3UTSA 2W8CA 5T1LD 3ZU8A 4OD2B 3NAAL 1C9SA 2AGJH 5AG8A 3QUMB 3NBNA 2YWYA 3NABH 4PM1A 5FW8A 5TGBA 4PJ8D 1OTTC 5AWNH 5KSUB 2V7HA 4GG8A 5F88B 4E0RB 4N2EA 4PWKA 5CD3B 1RZKL 3HE7A 2Q20A 1JN6A 4N6QA 3UZQB 1PAZA 3NZUA 3JWOH 2DWYA 3PG2A 4NQCD 3S97C 3JWDC 3SE8L 3WCYA 2IG2L 4EN2A 3RX5A 3BKYH 3HG1B 3GQFA 4M5SA 4D9QD 3S35L 5GRWA 2X53A 4QHLA 1EJFA 3VI4A 5K9OA 3BH4A 3UFIA 2APWA 4IEFB 2D3LA 3HR5B 5A3ID 2OFQA 2CSPA 3IXAB 4FQIL 5KYYA 3MBEC 1V05A 3FFDB 4XVUD 1BREA 2J44A 3AZUA 1E9PB 3TV3H 3UZEA 5JPMB 3FU9A 1FZOB 1SEQL 2NY5C 3FQTB 1JRHL 2WLIA 3QJQB 4PREA 5IJVB 5KOMC 1XGZA 2DQJL 2OSYA 1QP1A 2Q76B 1O7DE 3PGDB 4IKIA 3FU7A 2E74C 5F6IC 5ID1A 1WFUA 3CVHA 2JI1A 5JDJA 3HC0A 4G7VL 4XMXA 1NGWB 2WD0A 1CQKA 3L81A 1FNLA 4UIMB 3CXHK 2C1PA 4Y2NA 3G5VA 1H5BC 2APVA 4GRMA 4DT2A 5D1ZI 5I0ZA 3KPNB 4WU7A 5C0EB 1TTRA 3TLRA 1D2OA 4QRRD 4OZ4A 3L95B 4KWUA 1KJ2B 5AD0A 3D1MC 4JCMA 1SMOA 2NZ9C 3VWKA 5CGYC 4Q9QH 1GGCL 1E8YA 1BBDH 3L4WA 5C9KA 3BC9A 5DHYB 4XX1G 1LP9E 4Y7OC 3K8LA 2WKGA 3E6HB 2IDSA 3PV6B 2VLRD 5DO8A 3LH9A 5JW4N 5D7JA 2R1YB 1W6LA 2LFGA 4XP5L 4G9FD 4P2AA 5I71C 3MJGX 3EYQD 4FQ1L 3TWYA 2QT6A 4JZNA 4O9HH 4M48L 3OVUB 1WISA 1AXTL 1MFBH 3QEQA 4WI7A 3KL5A 4PJGF 1JYWA 3UC0L 3EF4A 4Q97A 3UTPD 2I24N 3EDDA 4TL4A 4ZFOB 4BZ1H 1ETJA 1MW3A 4LDCA 4AEEA 12E8H 4QRBA 4O2EA 3CX2A 4PVBA 3WFZA 3PDGA 4Q14A 5LGJB 1RHHA 5D7JC 4M6AA 5FYLE 1WQVT 4HF5H 4H7VA 1X5FA 3DX8B 4AEIL 5KYXB 3R19A 1R3HB 5C6TH 1GZPB 4W6WB 4K5LA 5I8KL 4Z1PA 1VGEH 3PL6B 3BP7A 4K7PH 4W1TA 5DRXA 1U30A 5AL0A 4UB0H 3WMPA 3AG1B 3T3PB 2ITCA 3GSNB 3ZYIA 1OCWH 1NGYB 2XVBA 4Y19A 1OF2A 5DS8A 1YO4A 1FZOA 2F54E 3SDXE 2WQAA 1C5CH 4DKFH 4BQBA 4JR9H 1I7UB 5LCVL 1QHQA 2E6JA 4XAWL 4MNQB 3KLDA 5ETUA 5J7CC 4XVTH 4Z7OE 1KIQB 3ASOB 5ABDE 1UYWH 2PP7A 5DWUL 3D25B 3Q01A 2YBRA 3MA9L 1S7QB 4QXUH 3DNKA 3LNDA 4NN5B 1BEYL 3OGOE 3IXTA 3LIZA 5FCUH 4AXWA 2FUTA 5IB2A 1H9DA 2O72A 2X3BA 3QISA 4LSPH 2YARA 3A0OA 1MCWW 3DURB 4FLSA 4OQTH 2ORBL 2R59A 4I2XE 4R4ND 3TJPA 4BSVA 2R0ZL 2EIZA 4BCZA 3VFRB 4Y2OA 3MBXH 5KVFE 3WFCL 3T04D 4Z7WA 3SE9L 2ZNWA 4HJ0C 4OI9A 3CDGA 1BM3L 3KPPB 4H5SA 4YUEH 5E2TL 2QHRH 2Z31C 3HC0B 4M7ZB 1NMCB 5IQMA 2O5XL 5I18L 5DQDL 2P7TA 2WLMA 1ZKAA 1U8NA 3BP5B 4PVNA 4WUKH 5KSAC 3F7VB 5E6IC 3P4NB 2FLRT 3PLYA 3B56A 4WU7B 1CF8H 5C0EA 3PXHA 3IFOA 1V7NH 5BS0A 1GPOH 4JY4A 2VDLH 3VD3A 1AGFB 4JE4B 1LTXA 2QQNH 4V2CB 4ABQA 4LRNH 3NPSC 3QDMA 5I6NA 2WVSA 4IBWA 2WZ0A 4TMPA 4FNQA 2XJKA 1M53A 5I75B 3IPFA 3U4EA 1R33A 2WQ8A 3Q6FB 4K94H 4AV0A 2WKOF 2D7TH 2WINA 3N1FC 2NW3B 2AEWA 1S5IH 3OAZH 3EBHA 1UA7A 5EOQH 3CPUA 5FV1L 2C9XA 2G5RA 1OVZA 2YUZA 3U9UB 2GTWA 3FCTA 4YHPA 2CIKB 1C12A 3R4DA 2LQRA 5IIEA 3CHQA 3IE9A 3D8MA 1CI3M 1E8WA 1EGJL 2MPVA 4YX2H 3QEGL 4NN6B 2IH9A 3GMQB 1RHHB 4MMXA 1YNLH 2QLVB 1E4JA 4K23H 4LGPB 3KLQA 2CK0H 4ZNEE 3Q13A 2AQRA 4PYHA 1DBJL 1KCLA 2WO3B 4PRHD 5DUBA 4UIKL 4NPJA 2EDOA 2X89A 4R2GB 4F80A 1X5GA 1CDYA 3NPZB 3P11L 3U6XS 2A9NH 5HGBB 3BWUF 5I82A 2FR4B 1YEWA 4L23A 1AY1L 5GS0D 5I1GH 5CLYA 3SOTA 5K9JH 1WP6A 4BZ2A 3NESA 1FZJB 2NQCA 5GGTL 3OLIA 4FG6D 2YRLA 1TLKA 3B7TA 1SLUA 1ZCRA 5CJ8A 4Z7NF 1T03H 3SPJA 2CLVB 4CDGC 2CMRL 3IETA 1X5ZA 4CMMA 5CEZD 1F3RB 3MYJB 3ARDD 1IFHH 3V4PA 3ZR6A 3ZT5A 4W68A 2P1YA 3V9EA 2R9HC 2ENQA 2MTPA 2BZCA 4BDVB 3CBRA 4QRTB 1UEYA 2B16A 4UTAL 4I9WD 2AERT 2FYVA 3VG9C 2FK9A 5L88H 1DVFB 2J5LB 4F3FA 2XQBH 4YHZL 2MCMA 5L7XL 3PQYD 5B4MC 3RL2A 2QVKA 3VXNA 4R83A 1SN0A 1FLTX 1MCHA 5F7EL 4R5VA 4Y1SA 4BFKA 3VU2A 1AHMA 3FOLA 2AJZA 4UAOB 2ZPKL 1BX2A 5T5FA 1NCHA 3BQUD 4JFYA 1RKRA 1OWWA 2DQGH 2JXMA 3WJMB 5FPIA 2VJXA 5SV3A 1MCRA 2W60A 3WXWL 3FTVA 3MJ7A 1NAMA 4HXAL 1PY4A 1NGZB 4GSDH 2OL3L 4OUUA 1HK6A 2NX5E 3F01A 1YJDC 3G5XA 3IMVA 3PAUA 4DKDC 1GPOL 3Q48A 1B6UA 1NDTA 1L7TL 4HV8B 3DJ9A 5AW5B 4F5CA 5I66B 1JGLH 4TVPE 2WOYA 1A5FH 3V4VA 2X0UA 3L4ZA 2EICA 2A73B 2JKSA 2V33A 5TDOA 4DNLA 2MTAA 3X17A 3CLEH 1QNZH 1THAA 5TF1H 1UT2A 4P23C 4FA8A 5K9JL 3WTXA 2VNCA 2R4SH 3MLVH 1IEBA 3VTTA 1AP2B 1N19A 1A1OB 4L8BB 2X70A 1FL5A 2UWEA 1WWCA 4FYQA 4LVHB 2B1OA 3MV7B 4UM9D 3N0AA 4HH8A 4KKBC 2ICEC 4N9OB 2GIYA 1F5WA 1EPFA 3OTTA 2R2BA 3ESVF 5GS2H 3L1FA 3QEQD 2UX7A 5IK3A 5IVOA 4S1QL 1SEBA 2ESVD 3D9AL 3KCWA 5F1SA 3VGEA 3A23A 3FN9A 2FECL 2DBLL 4XPAH 2VSDA 3U30B 3V4PL 4CRPA 1WZLA 4NBZB 1K3ZA 1XB3A 4I89A 1MHPL 2NUTB 3QAZC 5EUKA 3WAKA 6FABL 4UB0L 2WBJA 4GSRA 4UINH 3UDWA 3QW9A 2FX8H 2X2HA 2DQCH 4AZ8B 3DGDA 5HYSB 5JLZB 4OZHF 1S7TB 2Q7NA 2DQTL 2K9UA 4LLMB 2NXZC 1RZ8A 3ES6B 2OTUB 3C2AL 4W4OC 2AJSH 5EN2A 1IMHC 2JFCA 4JZJC 3U9PH 5A16B 5I73B 2TSAA 1ORSA 3RTQA 3TCLB 1KLGA 2IFFL 4JKKA 5KSAB 4F58H 5EEVA 1VACB 1RU9H 1BLIA 4HD9A 4XTRD 5EA0L 4ZFGH 1N10A 9CGTA 1ZT1B 2BINA 2X38A 1U58A 5FM8A 4XN2A 2KQNA 4EIZC 4DN4L 3B2MA 3GEWB 4JPIA 4PJCF 2AQPA 1U8OA 2UWEF 3WNIA 5CF3A 5FYKD 1PFCA 1EAPB 4Z7NB 1YCSA 4P3WA 1H6UA 3GSNA 3H9SB 3B9VA 1A7PL 3GLEA 5C08B 3BISA 4LSDA 3U6RB 5DRZA 4TNEA 4YDMA 3VO0A 3MCYA 2VDQL 1UWEL 4ZS6C 4NJAH 5D2LF 5ADOH 1IEBB 3VNZA 5FDYA 1SNRA 2O1AA 3VXUE 1RZ7H 1YUHB 4LL9A 2VC2H 4OLXL 1H5BB 5DT1L 3VXTA 3X1GA 4APQC 3HC3H 4A7TA 3QZBA 2IGFH 4H8WC 1S4IA 5FCUL 4RDBA 2AXFB 4HWEH 5JHLA 3W38A 4Z7IA 4OZFG 4F91B 4PCTA 5D1ZC 1LK2A 5GRZA 4YPGA 3GBNH 5DJXB 1EDHA 2F2HA 1DUYB 4KHTL 1A1NA 2JJUA 1H8LA 3L3KB 4E36A 3DX7B 4ZFQA 4MRCA 2WZPD 5DZLA 4HQQL 2FEEL 1L9MA 4S1DC 5EO0A 1NAMH 1S8DB 1N4XH 1DN0B 4Z8FH 1DLFL 3N91A 15C8H 1J0HA 4EOWL 5KBMA 2Y7QA 4Y19E 1QZ1A 3QZWB 5DD1H 2ZOTA 1LO3H 1BBJB 3O0RL 8FABA 2EUVA 4NCC2 4G8AC 3UADA 5KSAD 1NEZB 2AJSL 4XNQB 3T6QC 3A4DA 4N86A 3QDMB 4KJQC 1W0VA 2FGWH 2NZ9D 4DAGH 3SDAA 2IBBA 3QDGA 3WL9A 2NTFB 5C7XH 4R7XA 3QJVB 5DMKB 2DDQL 4XP6H 3UCQA 4BQ6A 5ENWB 3CFCH 4W81A 5CN1A 2CKBB 3JVGC 3L1GA 4HIPA 2HTKC 1KTDB 2VDMB 1U6AH 3VFPA 1H3GA 1A6WH 1VCBC 4Z76B 5JQ6L 1IBFA 1PZDA 1EMTH 1IFGA 3VXSD 1SUJA 3Q44A 1OXYA 5IV2A 1E27B 3FFCD 2PO6B 2MPAH 2CR6A 4GO8A 3CU1A 1R19A 5F1IA 1CU4H 2ZKHL 3SDAC 5DK3A 5KW9L 3BYYA 2H41A 5SX5K 3QUXD 1S5HA 3M86A 4P2RA 1FJ1B 2AJUH 4UQ2A 4E2OA 2FATL 2GHZA 1CR9H 3U4BL 1DQLL 2R0WH 4ATTA 4LNRA 1F97A 4RAHA 4EZJA 4OCMC 3LX9A 3LRSA 5IJDC 3B34A 1JGUH 5I1DB 2GSIB 4PTUB 1PKOA 2CLZB 2GBVA 2CG9X 1WAEA 1SOXA 2R7EB 2EDDA 4UANA 4F33B 3L4CA 4JMXA 3OX8B 5KWYC 3STBA 5FKAB 2F54B 3RB5A 4KKCC 5GS0H 2BRRL 2FAUA 1CQYA 1VIWA 4IRSC 3S5YA 2VKWA 2XKUA 3WXWH 2I85A 4Q52A 1SHMA 4JQVA 5EZJB 1RK0A 4G7SB 3S48A 2X2JA 25C8H 3MFGB 5JHDD 1OHZA 3HCVA 3VFWB 5J3HD 1N67A 1ICTA 3K6NA 3LXAA 2VDOH 5TQ2H 2FSEB 3N5AA 1PDKA 3F7YA 4F8LA 4JJ5B 3GKWL 1MIEL 1PG7H 4N8VB 1PZ3A 4OT1L 1RI8A 2FGZA 1NIBA 1SXBA 3MV7D 3T6WA 4QXVA 2ZIDA 2G9KA 3BN9D 5ICZA 1MNUH 1KIPB 2O30A 1V55B 5A2JH 1KB5B 1U0QA 2TRYA 1N59A 3C6LD 2YO3A 3CQFA 1K8IB 4MDIB 5FFGA 4Z8FL 3O2DL 2W80C 2R1XB 4OKVA 1Y6NR 2MMXA 1I7TB 2XN0A 5C07B 5BV7H 1PNDA 4WY7L 2X3AA 5CJOH 2XWJB 2HKHL 5DHMC 4Z7VB 4ZO7A 5GZNA 2O5NA 2P5WD 4JVWA 4XNAA 3QUKA 4R2GC 3MNWB 4XNYH 1A7OL 4PRAA 4LCUA 3C87A 3MCLL 1M9SA 4M6OH 4S1QH 1IZJA 3WEMA 4WHYG 5KSBA 3V7AE 3FU3A 1HXMB 1XO8A 2Y7LA 2DQUH 1U8PA 4DGVH 2VAJA 1UT9A 4A2DA 2K1MA 1SFDA 2DWDB 1QFUL 3BCDA 4MJ5B 3ZKND 4I1RA 4PN6A 1I4FA 4UILL 1DQDL 2F53D 3V6OE 4Y9GA 4A1RA 4Z0XB 4RGMC 5AOZA 4LSUH 2F54D 3CIQA 1KCVL 4P9MH 1Y1DA 2J6EH 3HG2A 4JM4H 1ERNA 5J1AA 1E4XL 3SKJH 5SWQB 4M7LT 3GSUA 4YK4C 3BVVA 5JIKA 3TXAA 3O4LD 4CN4A 4FQXB 3DX4A 3MLTB 2X6CA 4JREB 5C08D 5DDHB 2J88H 4NC1C 1S9YA 4H8VA 5FA3A 5I1CH 3CFQA 4QEGA 5BXFB 5IHZB 1YUKB 1L7IL 4TNWF 2JQZA 4MXWL 1LEIB 3RDTA 1BZ7A 2KLRA 2X4TA 4ZW7A 1FP5A 2DLHA 3NFSL 3EJZD 3UTTD 2WBJB 2AQNA 4O58H 1UOWA 4QNPF 3OG6B 3ZL2A 4JRFA 3FTXA 4DP5X 4H0IA 4LFHG 5B7MA 2NNRA 5AB0A 4KO9A 2BSED 3H9YA 3SKNA 3VE0B 2B0SH 4AQZA 2HVJA 2XKNB 2EIDA 4YHYC 1GGYA 5FWQA 3BPCB 4PV9A 2XXGA 2A6DB 3DO7A 3MRIB 2DQIH 2MQ3A 4LGSB 1KELL 1JZFA 3ARSA 4Y2DA 4X99B 5AVVB 3MRFB 3LV3A 1XF4A 1ZS8A 4I88A 5KZCD 2HN7A 3QIWC 4ZFFA 4WHCA 4ZFGL 3UPAA 1BMGA 2QR0A 2WO4A 3APFA 4IEFA 5CCKH 4OCRL 5DD3H 4MAYB 1UM5H 3QDAA 4HK0A 4X80H 4ZTPL 1JHLH 4ZMYA 2RAMA 5D6CB 1X4YA 4XMTA 1BZOA 2VDKL 3UBXB 5LDSA 3L9BA 2ODHA 3O6KL 1XBRA 5KBPA 3LH2L 5E94B 4XNMB 4L1SA 3OXSA 4J4PC 3QDME 4Z7VA 2WGNB 2N56A 2L7QA 4OGYH 4NO2B 1I7RB 4AL8L 3D3VE 2CD0A 4WNQA 4XPGL 4WWNA 4N0CC 3L5XL 4JFPB 4NQEB 3SODB 1YEKL 4K3EH 3WE1A 1D5IL 4S0SD 1TR7A 3RWCA 2PCPA 3GMMA 4JM2A 3L5IA 3BUPA 2LE9A 1HCVA 4PRID 1DQKA 3HMXL 5B22A 4EO5A 4C83A 1XBDA 4HWZB 4J28A 1YNTA 3PHOB 1S9YB 4JRWA 1XGUB 2R69L 4TVPH 3MRPA 3WKML 1DVFA 1CTMA 2VXQH 3FQWB 1N8ZA 3WSQH 3B9KA 1OPGL 3GUFA 3KYNB 1YEEL 4FZEL 3EGDA 5ECJE 3WGVB 3NP4A 3IJEB 1OGAB 2NR6D 4JZJB 1NC2B 1Q9LB 2OW7A 5EU6A 1J9RA 2DM2A 3P30L 4V11A 2VRAA 3K6SA 3DIDA 3VXUB 1MWAH 2NDFA 2FH8A 4KVNH 1ZTXH 3KPSB 1VFAB 4ORGA 5F21B 5IEKA 2B0SL 5TGBB 4PGCA 3HRPA 1BG1A 4AM0B 1B0WA 4QPEA 1BIHA 1JMZA 5IBUG 3TPUA 2EDNA 3SDXA 4K3HA 3NA4A 1GYAA 4MXWH 2JKJA 1KB9K 3ULUF 3T0WA 2HTLC 3FCSA 1CL7L 4YC2C 4Y1AA 5L6YH 5KJRH 2B20A 3I02B 3GC3A 1H3VA 3QQNA 3WO4B 4IM8A 3DXAD 1KB5H 1J05B 2XXCB 4JFYB 4U1KB 4P5MA 2WGXA 5SX4I 4YLBA 3MJ9L 3LKNA 4X99A 4AL8C 5HPMA 4HEMA 2WKLA 3FH7A 5DQDH 4N2CA 1HU8A 2OZ4L 1AGCA 1E65A 3SE3A 4NAJA 4U1JA 5A2CA 5CCGE 3F62A 1XB8A 3IU3B 5CEZH 3GMOA 5HDQH 1XF2A 4QTFA 4CSZA 4X0NA 1NCCH 4HXBL 4JKMA 4O02L 2EINB 4EN3A 1KIUB 2OZ4A 2IFGA 4ZUVB 2NY7H 2FT7A 1LP9A 1V5JA 2ORBH 3ZUNC 3TBWB 1E4KA 2WHVA 1BZ8A 2XXFA 3AREB 4UZGA 1RULL 2BP3A 4M5YH 4HS8L 1GZHA 3RTLA 2B5IB 2V9TA 3ZE0B 1I7ZA 3LPWA 4X8CA 4TVPD 4Y2OB 5K69A 1RFDL 1EHKB 1AKJD 4QY8B 1CG9B 2C7UA 3RNKA 5DS2A 3N9GH 5IQ9B 4LCYB 5DJ2A 3VFOA 1IT9L 5CD5D 5K9QI 3MRJA 2P5EA 4GSUA 5JXEC 3NDZE 1KTKE 1SYVB 3QE5A 5GRYA 2YA2A 5E8PA 2D3NA 3VACA 4PJ7E 3FUJA 1FIEA 3C60B 2RBLA 4H20L 4GO9A 2FJFA 3EYVB 3NJVA 5CP3A 5IVZA 1KC5L 1N5AB 5IW3A 2PUQT 4BH8B 4DO6A 5IR1A 4PJBA 2ZYRA 4L3ED 4Q56A 2BMKB 2FSEA 3UXFA 1IGJB 1SDYA 3WO3B 4MHHG 3KCPA 4E41A 2QPSA 4GAYA 3CDYA 4DN3H 5L8LB 1CUOA 3QDGE 1MG2C 3AGWA 4EKXA 3ULAB 4DZBA 2ED6A 3OMZA 4HU2A 4Z3IA 2BVTA 2H2SD 4KH9A 3WSQL 3AB0C 1R46A 4XMVA 1GAFL 2UUDK 4MQXC 4YZFE 4YHPB 2Y7SA 4N1CA 3CSPA 1TQWA 1YY9C 2CGRL 1D7CA 1F18A 3VJ6A 5I71B 1RZJC 1VACA 1U8LA 3CWGA 1L0XA 4ZX6A 1MOEA 3B9DA 4OFDA 3S88L 5D5ME 2HX7A 4EIGB 4ADGA 2GEEA 1QTSA 5FGBC 1X5KA 3HJEA 3L1EA 4N25A 4WW2A 3V4UL 4A6YH 5A6IA 1TTFA 2QSVA 4RWYH 2C1OA 3DTXA 2CK0L 2PTUA 4NZRL 4HOMA 1GVIA 1PZAA 1NAML 4XP4H 1LE9B 2IIJA 4NRXB 4XP1L 1KB9J 1CDCA 1I8LA 5AZ2H 3VRLF 1G6RA 2FE0A 4Y88A 4P5SA 4Y16B 4K8RC 1C7SA 2O5YH 3BD3A 5FK9B 4H2AA 1HWWA 1B4LA 1KY6A 2C9AA 1HYSD 5IHHA 5HY9B 4LCYA 5DJ2B 4OJFH 1HH6A 4XCYB 4CMMB 4IRZH 3C8HA 3UPRA 1JD9A 2YA0A 4FG6C 1P5UB 4NPKA 4LAJH 4WO4D 3B1UA 4FMFA 4I3SL 4YSSA 2MH4A 3F8UB 2AMGA 2ZP8A 3APDA 1XIWA 1YPZF 2BY3A 1FCGA 2N01B 3NACH 4G6JH 1DO6A 1C5BL 4NEHB 4CDHA 5B3JE 1W0VB 2NY6D 3VDCA 2DQ6A 3T6VA 1R34A 1I1AB 4NM8L 4XC3H 3L9RA 3MJWA 4KXCA 3ZIYA 4NQED 4WF7A 2K6YA 4I4WA 1M2OA 2PLTA 1FNAA 3DHPA 2G30A 3B2VL 2DM3A 1JF5A 1R5WA 3U2IA 5CJXA 1G7IA 3MREA 1MWAB 5CEYB 1ZXKA 3O0RH 3EIFA 3TC9A 3RZCD 2XHNA 2F8XC 2HX9A 3BH8A 1PCXA 1HIMH 4NAQA 3S4SA 2P8LA 4AK1A 2RGSA 5DJAB 5LAXB 4WEEA 2Q8AL 5TFSL 3U4BH 3LNIA 1PZBA 2QKIB 1GIGH 2XQYK 4TUOB 2CIIB 3LKSB 4P5TA 4LSPL 2F8VA 2HFEA 1CD1B 4U6VH 4HK0B 2YA1A 3UACA 4AITA 1Z32X 4WO4C 5HHXH 1BXVA 1WA2X 4P23A 5KYWB 4R4BB 3TT3L 3BP7B 1IZKA 1SOQA 2NY0C 2V2WA 1NANI 3R8BB 4Z7OF 1HCZA 1WJ3A 3WEXA 4MQ7B 4U1SA 1R6VA 3HW7A 1LO0L 4P9HL 1J1OL 1QKZL 3K4DA 5DJZB 1U8LB 1TVDA 3U1PA 3PXJA 1NLBH 1AAJA 2MPAL 2Z65C 3AG2B 4GQPH 4K7FB 1G7JA 5J12B 3S7GA 4HHAA 4KRNA 1OB1B 3VGBA 5KVGL 2NMSA 2PWDA 4K4KA 4Z5RA 2CCWA 1S7RB 1KFGA 4DEPC 2AK4A 3ZGIA 3VSUA 4U6HA 3FMGL 3DXAB 3PNWB 3IKCB 2ZOKA 2HB0A 3MOAH 5E00A 3PS6A 4ZS7H 2WY3B 5IK3B 1HVXA 2Y5EA 2BCKB 2WBJC 3QZWG 4J3TA 4AMXA 3FT9A 5BQ7B 1G1YA 3FB8A 4ZMTA 1WA1X 4ZX5A 2EUZA 3K7UA 1YMMA 4ODBD 3US1A 5AW0B 3TV8A 3VD7A 1S5IL 3O3EA 4QOKA 2FYYB 3ROLB 3HE6C 4GBXC 5D71L 1AVAA 1VESA 1JFQL 2NT1A 1M05B 3OKYA 4MNQE 5D70L 1WAAA 4HBQA 3QUZB 3K72B 4GI9A 1T1XB 2UXFA 1TTGA 3HPLA 4UZUA 2J8UE 1AYOA 3SDXB 4ONFH 2BIOA 2Z7ZA 2F74B 1W6WA 3TO2A 3I9IA 5F9WC 3QDJD 2UZPA 3L13A 2EC9U 1K2DB 5F7FA 2BM3A 5AEAA 3VG9B 3ZTJH 2CIIA 4Z3TA 4HS8H 3B8SA 2ICWB 1Z5LA 3GI9L 1DFBL 1KB5A 2YAFA 4EJ1C 3NIDF 3HUJB 2ZG2A 4MB1A 2IDTA 1YEHL 1UXWA 3SD2A 1BOYA 2DWEA 1ZLUK 3BUBA 3FK3A 4M8RA 3TA4D 2X09A 5IEHB 1T83A 2L7JA 5MHSD 9PCYA 4TUOA 3DX6A 3HNVL 4RAVB 4D0DB 1U92B 1IAOB 1NMBL 2P28B 2VLMD 1BQLL 2G3MA 4DP2X 1E43A 4ZI8A 3A5VA 3EO0B 1M3JA 5KTEH 3CFEA 3KH3A 4CSPA 1RVFH 3SYQA 5DSCA 2G5BB 1MQKH 1KENH 3SO3C 4BUQA 1DBAL 1LP9B 1XGYL 5E8OB 4IJTA 1R3LB 3V0HA 1LM8V 3OM3B 3TFKD 4NNPH 4LRIA 2XZCL 4QRRB 4FEIA 2X9YA 1T0OA 2LU5A 5JUEH 2V3DA 1QSFD 4HHAB 3KYMB 2ZKXA 1CE6B 3BLBA 3RNQA 2QKSA 1CICA 4CU7A 1ACYL 3S5LA 4YXHL 5AW8B 3GMNB 5LN4A 1HAUA 5EFIA 3SKMB 2E46A 3IJ9A 1YYCA 2DN7A 4NPYA 3QORD 5FM4A 5C0GA 4JFEA 4KTYA 4KBPA 2AZAA 2HJFA 2YD9A 4WCYH 4X4XA 5CU9A 1N64H 2XX0A 1J0IA 4GBXA 4EI0A 4ZS7L 3D69A 1X5YA 1IKOP 3SDAB 4NENB 4XI5D 4YC2B 5FAAA 4N90D 3R0NA 2XWTA 2B59A 2PXYB 1RP9A 2FJGB 4LLVB 3QUYB 4R5XA 4LHUD 1NCIA 1BJ1J 3AWGA 3WTVA 5LDUA 3F7PC 5BS0E 1I1AC 3Q9QA 4LU5H 1JDDA 5BZWA 4JN1L 1Q4NX 1QEWA 5IB1A 2X05A 1RIHH 1MCPL 2QPUA 4FF9A 1F4YH 1AR2A 2YMTA 1CVRA 1KYUA 3DTDA 3BVUA 3WNKA 3B83A 4FYTA 4XVTL 1MIML 4JO4H 4A67A 4KXAA 1BF8A 1DQVA 3KPLA 3STLB 1AR1C 1DSFH 3V0WL 1MZZA 3WFDH 5I30L 3RFZB 3ZE1E 2J12B 5EV7A 1DBMH 5GGRB 4NZRH 2W95A 3P0VL 2ADJA 2ZUWA 3PGDA 3KVQA 4TVPL 1AIFB 3T77A 5I19H 5KVDL 1WC7A 3RWCB 4ZTPH 1YUHA 1JTOA 3VXTB 5TTRA 1JWSB 1BYNA 3KXFE 5DMJB 3SDDC 2OMUB 4HJJL 4OT1H 5ABZA 1U95A 2G9HA 3SDCB 1WWBX 3VXMA 5MI0B 2H9GB 4YO0B 1PLGL 1NCAL 2XY2A 43C9A 1IBDA 1G7PA 4R7LA 2PYEE 1P4IL 4KMLB 4J4PA 4C8XA 1KCBA 4TSCL 3S2AA 1OAZL 3B7UX 2DV6A 3ZE0F 2GJJA 2XTLA 4MS8D 5E8OA 3SKUD 2H6PA 5EU6B 3I50H 2ZXAA 1S8DA 5DZAA 1T3FA 2JIXA 3LPGA 3DVNB 2DS4A 3KWTA 3QNXA 2F58L 2QVIA 1DVZA 3DGGA 3IMWA 4A04A 3WY1A 3T3ME 5CD5C 3D08A 2AQ1A 1DEEB 2K78A 3QJSB 5BMFL 1TETL 2YKLL 3QUYA 4JG5A 2PWEA 4GXFA 3RIAF 1SDDA 5TD4A 1I8MA 3RVWD 1MPAL 1SLXA 3FCSB 1KV7A 3SPVB 1R75A 4U3XA 5AWNL 3MRCA 3WL9B 4KNTA 3NFPB 4HOWA 5I8EA 5B38G 1NTDA 1UJ3A 2DQTH 1G4MA 2XWCA 2I25N 4GBXB 2BXYA 4OKVB 4R96A 4ZPVB 4AIEA 2OXHB 2EZ0D 5KYNA 5JZ7D 1G9NL 1OAUH 3PWPD 1IU1A 2BSSB 4HPOH 2J20A 1HQRA 4WVRA 1PD1A 4R7VA 4XVSH 4ZDHA 3KLHC 4KI1A 2OPCA 1OSYA 4MCNA 4JFED 4HHWA 3Q8AA 3GMLA 3TEYA 4JPIB 5D7IE 2F5BL 1XGRB 1S7UA 4Y5XC 3EOBA 2BNUA 3QR1A 4U6XA 1IAIM 2V37A 3V5DB 3QULA 3RVXD 2F8OA 3EGSA 3S36X 1NQBA 3GPEA 2B15A 2ICCA 1KJMB 4HX1B 1W72L 3WNOA 4QT5A 1RLBA 5H94B 1UM4H 4OD3H 2GJPA 2YSSA 2JKTM 4ZW8A 3JSSA 4NERA 3SJVE 1OOWA 4WWKB 4QY8A 2ATPB 2VC2B 2A6IA 4PRHE 5KOVC 5I8OH 4LSUL 1JJUA 2CBQA 5JO5B 3B2UD 1SF3A 3MX0A 1ZWIA 2P5PA 4GRWE 4FLQA 4X6BB 3K74B 1F13A 3L48A 3HMXA 3FHAA 2FQGA 3ZK0A 4HT1H 3L1OH 2WBWB 3FQ1A 3FT2A 4OFYA 4KO7A 1OSPL 2J21A 1U9KA 4L3FA 4NQDA 4NXSA 4X8JA 1H19A 5DQJB 5HHOE 4PU2A 3MLZL 2CNYA 3Q8EA 3TFBA 3NRQA 2BOBB 4MTMA 3KDMA 3IF1A 4FNUA 4IK7A 2BDNL 4KDWA 4M1GH 3HVDA 4LVEA 4X6FB 3X12A 5INDB 1I3RB 2ZG3A 1J8SA 2ZT9C 3GTTA 5CCHE 3OKKB 3IVKB 1GW6A 3G6AB 4JG1H 5C0CE 3AS0A 1LQSR 1RZGA 5CLXA 5TPWL 1RUAH 3FT3B 2V7NA 2F6AA 5LN8A 3N2JA 4JFHD 3CN3A 4YDJA 4F2MB 3ULVD 3F12A 2E7LA 3W1ZA 4Q4EA 1A7NL 1XZWA 3HZVA 4KUCD 1WT5A 2XWXA 5DLML 3P0GB 1TITA 2NRDA 1QA9A 5AB1A 1P7HL 2FX7H 3DRQB 3T2NL 4FGMA 4PJIA 1BEYH 4WEBL 1NBVH 1OTUC 2E9IA 3IJHA 1KPUB 3PHQB 3QIUD 3FO2B 2XETA 4YR6A 1ZA3B 4WWPA 2KLSA 2OTWA 1J5HA 1LGVA 2AI0L 2K4WA 4JHWL 3JTTA 1DFBH 4QOKD 5C2UB 1QWNA 2OK0L 5HHVL 3NCJL 1RURL 3FW6A 3KPTA 5F1IB 2PR4H 2QBWA 1C7TA 4YDVB 4DQOL 4KK8D 4JX0A 3HTLX 4X6DB 5TQ0L 1DQIA 1K85A 2R2HB 4LO9A 1NC4A 4Y4KA 4ONGH 2N59A 4JANA 1LNUA 3HZMB 3WKQA 3RKDC 4D3CH 1Z5HA 1FPTH 1BFOB 3WFHB 1SVZA 5E2WL 3P4LA 3UAFA 3A6BL 4XZUB 4LLQA 3CZUB 4HW6A 1TZHA 1KXQA 3D33A 1TYRA 2YEZB 4G1EB 3CK0L 3RWDB 1PCSA 2LW3A 2FT8A 1XXFC 3RPIB 3KXFA 3MRRA 4AV4A 4IKNA 3U4KA 2EP6A 4K5PA 2R51A 3BLKA 1MLBA 2Z92A 1AC6A 3QJFA 4QJ5B 2IEPA 3BPNC 2LU3A 2LABA 4Z23A 1FHGA 4FHJA 1DUZB 4IGBD 4ZFZA 3KHOA 3GMNA 1OAKH 1PZ2A 2GTZB 2LOEA 4KFMA 3JWOL 1D5ZA 2WBXA 2WLKA 1I1FA 4PJ9C 1ODAA 2IF7A 4N8PA 1B3IA 3D18B 4EUPG 1HESA 4X4XB 2NUPA 2XJLA 3DARA 2GCYA 3EO9L 4P5TD 4YXLH 4G6AD 1U93A 4CADB 5HHME 1OT1A 3RHWF 4ZMWA 5JIPA 3RWHA 2ZUQB 2YUXA 4I1NB 3TNMA 2AJVL 1ZGLM 3B2XA 1QASA 1NM9A 1JIBA 2AJZB 3GT6A 3PWPA 2VW6A 3AT9A 4Y89A 3TYFA 2MWCA 3ETTA 3BPCA 4PV9B 1F90H 1HN1A 1LO0H 2QDVA 1MHPH 3LZLA 4MZIA 4P05A 1WT5C 3MJ7B 3FT3A 4IIZA 1EA9C 4PLOB 4AEHH 3DUSB 2D3JA 4WTZA 3EAKA 5AZEH 5FO2A 1JZHA 4JM2C 4HV8A 1UZ8A 3OAZK 5DJ6A 3RB7A 2CHWA 1TJXA 2VC2L 1N7ML 1JE6A 3CAFA 4FKHA 1XGTB 3KPMA 3AGVA 4NNXA 4KKZA 4PJIB 3US0A 1AGCB 1N26A 1T7ZA 4HXBH 1DL7H 3B9KC 5A2IH 2CGYA 1LK3H 1KCUH 1RK1A 1KCRH 1NBVL 3L9EA 2FEDD 4YIQB 5E2WH 2HAZA 2JIXD 3ETSA 4WSGA 5DURB 4OI7A 3RIFF 3W57A 1OGTA 5D9SA 3BZFB 2QV4A 5D2NC 2AK1H 5EU5B 1D9KA 3RWIA 3WNMA 4FLHA 5GGVH 5DZOA 4I77L 2FR4A 2JJSC 1U95B 1X7QA 3ARRA 4BWTA 2A74A 4A2FA 3MR9B 3MU3A 4MKTA 3UYPB 3QYCA 1BYPA 4JRYE 4PJXB 1KXVA 5I5IA 1OK8A 1LP9F 2DB8A 1A3RL 4XWOD 1ZTXE 1QX1A 2YD5A 2PYFB 4H13C 4TQ8A 1YJDL 1B2WH 2EKSA 4P4RB 1I9JH 1MJJA 4A2HA 1INDH 4IMLB 3V4PB 5IQOA 2DH2A 3QHFL 3S96B 4LGRB 3DYMA 4HXAH 4RFOH 3AJ7A 4G80B 4N87A 3KPPA 3ROOA 3RWDA 3P9LB 1HYSC 3TZVD 2XFGB 4WK0B 2KUTA 4K73A 4HUWA 2QPDB 3AY2A 4WDIB 4JFQA 1LEIA 2ZSWB 4FZ8H 3UPCA 3S36L 1QRNB 3VXQB 4R0LA 3I3DA 2ADGB 1KNOA 1T6BX 1F6FB 2CWRA 4AW7A 2B8OT 1FVEA 3M46A 1BYOA 2Z7YA 5B1CA 4NO0D 3SPVA 2Y6SC 5B3JF 3UC2A 2P48B 2X1QA 3GEFA 1MAKA 2YRPA 3WEBA 3WJMA 4CL7A 2J8UA 4MX7A 5D93C 1I1CA 5EB9A 2H0FA 1MAML 4ETQB 5IEHA 1T22B 5KVFL 2Q2EB 2E7MA 2IPKB 3MJ8B 5IQNA 1ID5I 4PJCB 4JHUA 2VH5L 2CIKA 4ZSOB 3QWOB 5F89B 3LPPA 2EYTA 3QP3A 1DQLH 1SJHA 4IRZA 1NBZA 3LRKA 3D9AH 4AVIA 4J3OC 4PHXA 3ZQWA 1TNMA 3D85D 5B7EA 5BW7A 4FQJL 4PV8B 4ADJA 4XO5A 5CAYB 2DLEA 3O6KH 2EADA 1XGQB 2XSKA 1JK9B 4WJ5A 1QVOB 2K4AA 3QA3A 1P7BA 2BOCB 3DX6B 1W72H 4P8QA 4ZUVA 1AP2A 3T0XA 4O00A 3PIQA 4KJYA 4Z0BH 1EVTC 2ZKHH 2Y06H 4PJXA 1JXGA 1ORQB 3T0EE 3O11A 4JFVA 1XIWC 3Q1SL 1JOIA 1CYXA 1ET8A 4G9FE 1JGEA 3L5XH 2DQDH 4PBWD 3QQ9C 4HJEA 3GXNA 5H35A 4NO3B 4K8RH 5EBGA 1H15A 2E6QA 2P43B 3FUIA 5BVJA 3REVB 5EA0H 1OZUA 1O9WA 1I31A 3IAPA 5C0AE 1TO4A 1QRND 3DX3A 4NSKB 1WBYB 3M88A 3IDYB 1OAQH 3OJDA 4WI4A 2XN9A 4U4IA 3LKPA 1QPPA 3IMSA 1B4RA 2HT2D 4N4YB 4OCYL 4JRLA 2CJSA 3G08A 4CW1B 3BPNB 4S1RL 3DVFA 4UV4L 2H1XA 5KUKA 2PWFA 4ENED 3MFFB 1UD6A 3KYOB 5TQ0H 3X13B 4UWQB 4PGCB 2ITDB 1KGXA 3HS8A 5ENWA 4NOBA 4KZCA 2EC8A 4A6YB 1IAIL 2EDQA 4XMUA 1I9JL 4NENA 1Q38A 1NDGB 4PLJD 1ADQH 2R29H 2FL5A 5AVXB 4Y16D 3PV7A 1M7IA 4XVUC 2XV0A 2C4FU 5CP3H 2ZKWA 2XZZA 2GJ6E 2XFXB 2NNFA 3PHQA 1QBLH 3QNZB 4IBLT 4X98A 5I5RA 4TQEH 5CXPA 1UXSB 4L37A 3WY2A 1MFEH 4RRPM 3S3JA 5HGHA 1MREH 4IBZA 4DGYH 4P2RB 1FJ1A 2DJMA 1QLEB 1I1YA 2W07A 4IRJC 4X5LA 3IPEA 5HJ3B 3FS9A 4U3HA 2LLNA 2EDLA 2W0FA 1AACA 4BSWA 2RALA 2FIRT 4UBDD 1HYRC 3ZKMD 2YD8A 1YQVL 2CUMA 2EDWA 1KTBA 1T04B 2Q7YA 1KIUA 4KRMB 3MMEA 4MA3B 5BJTB 2V17H 1MEXH 4XO4A 1RCYA 1G5GA 5FYKU 1C5DB 4DAGL 3F00A 3QEUB 4B9FA 2J25A 4GAGH 1T3FB 1Z3GH 1ZHLB 2ZXDA 5JPNB 2C7UB 2HVBA 3NUKA 5D2NB 2B4CH 3K8KA 1PZUB 1Z1WA 3AC0A 3MUGA 4HKXA 3KJ6L 3ABLB 4JRYD 1XAUA 1U91A 4XGZA 3CH1A 4N85A 3HI1A 3VSTA 4OLYH 1KBPA 2F08A 3Q2WA 3QZWA 2APFA 2AJXL 5L2KD 4QTIH 1U3HD 4YWGL 1NOFA 4O02A 5IR1B 4YDKH 1SQ2N 2CRYA 3Q8BA 4YPJA 3M8OL 2QLYA 3L3OA 3PREA 3D2TA 3VXOB 5BCAA 5GS1A 5HHOD 4AL8H 5J57B 1EHLH 3RBGA 1IRAY 1G9HA 4U31A 3ECVA 3N0PB 5IW6B 1AQMA 2IQAB 5C9JB 2KC0A 5L7XH 4KUCF 3AS2A 4GQ9L 4XMKL 3DK0A 5E9DA 2YPLA 2R69H 4PP2B 4FHBD 1QRNE 4YSEA 2ID5A 3OKLB 4YEFA 2BVYA 3O8XD 1TZGL 1O6VA 4N2KA 1SVCP 5T3XE 1A25A 3BUYB 5KANI 2VQ1A 1D5IH 2JELH 1TJHH 1UA3A 3NFNB 4BSWB 5C08A 3U6RA 4FLRA 3IMBA 3ZGHA 4XO3A 1E40A 1IAIH 1VFMA 1XIWD 3O4LA 1YN6B 1QMUA 2VDLB 3PABA 4MA3A 1A7BA 1MHCB 2QHLA 1Q1PA 4FQPA 3SCMA 1BDYA 4AEIH 2EJ1A 4O4YH 4Y7MA 1K6QL 2V5RA 2N1KA 4XPFL 3BKMH 2XCMC 5HI5C 5LNGA 3U9WA 4MDJA 2NYYD 1TTCA 3MGTB 4WIQA 3OJVC 3LKOA 4MQTB 2A6IB 4W4NA 2WXOA 1Q9WB 3UIZA 3JZ7A 1SVBA 4XCYA 5DDHA 1SLWA 3X3GL 3ULSA 1ZTXL 2BCKA 2DWSA 1IKNA 4AKQA 2E7CA 4ZPTA 2WTRA 2XT1B 4H25A 4Q9RL 5L2KB 1RZGB 1BVOA 3SQRA 1Y0LA 3OB0H 4F7MB 4DO4A 1IGIH 2P5WA 1C1EL 4MMZB 4BGLA 3BDXA 3QYNA 5K59E 1N18A 3C09B 3BE1H 4TUKL 4HH9B 4K9JA 3VXQA 3IF1B 4F9PA 2YPKA 2C7FA 1JGIA 2YN5A 5CP7B 5D1XE 3VXRB 4ETYA 2HVJB 4CBPA 5KVDH 5E6UB 4JKPL 1PYWA 3BWUC 4NQCE 4NZTH 2H3KA 3HG5A 1CK0L 2RCSL 5F3HB 4JY6B 4BWWA 3LEXA 5CLWA 2IWFA 2UZIL 3ATDA 3KLKA 4N0FB 5AOKA 1WZ1L 4KMQA 3NPSB 4Q6IA 4MS6A 2IBGA 4Q89A 1IT9H 4DK6A 5J11C 2XI9A 2J8HA 1YNTF 5DHVA 3S3SA 2OR9H 4PJDE 3ZZLA 3LN4B 5J4MA 4YFEA 2IXQB 4QRUB 2EVJA 1CGYA 4HCGA 5IB5A 3B3IB 4WY7H 1E5AA 1MAMH 3BP6A 1LO2H 2ITCB 1W0YT 2DWEB 1B6DA 3JWNE 4FCHA 4NQTA 1MXDA 1ML0A 2GB2A 1NKGA 5GJTL 3LJ3A 2E4TA 4B0MB 4TNWK 4KQ0A 4WW1A 1MHCA 4FQIH 4JRYA 3BXNB 3VI3B 4WNQB 4RDQF 5C0JA 2P5ED 3ECBB 4S1SL 1BPVA 2DWDA 2IOOA 3QO0A 1J5CA 1UGNA 1JZ2A 4ZK8A 3WE6A 4WWOA 3L3DA 4KOBA 1XTMA 1V10A 5SWZA 4Y4KB 1UHVA 3AQZA 2X4SA 1GGTA 1UQSA 2PXYD 3OB8A 5HXMA 4KDTA 2HLAA 1WCQA 3D3VA 5F7DB 1IKFH 3RPBA 4TN9A 4LLQB 3KYMA 1PW3A 4H25B 3BFQG 4NRZB 2AJVH 5CZXC 5E8NB 1DJSA 3U2JA 4JGMA 4XN8A 4JK0D 3FONB 4DN3L 3C8KA 3IT8D 1EXUB 5EU4B 1VHPA 4GRWF 3VXRD 1PU0A 1EJOH 2YKLH 2HJLB 5IMKA 3WDJA 4DVBA 5EO9B 1CFNB 5I23A 3GJFA 1SJEA 3G6JF 2WXNA 5DA4A 5LG6A 4F9PC 3SKNB 3TT1L 1QLFB 2XG5B 1NBYB 5JMRA 3ARFA 2ZWZA 3FULA 2IV9A 2V7HB 3JZYA 2OCFD 3I50L 4HUCA 5F7MC 1ZLWK 3U4EB 5K1JA 2WKOA 3FQNA 1LK3L 5EC2B 3SDAD 2F74A 2QQQA 3K2IA 4HS6B 5CP7A 5F1NA 1KLFB 1UVQB 3HNTL 5KSAA 5KANG 4ONHB 1OV8A 5DCCA 5ERWA 2BRQA 3HMXH 2OYKA 1KEGL 1ZT7B 1SBSH 4UM9B 1QUNB 3AWEA 3OR7A 3MJ9A 4HUUB 4CNIB 4YSCA 1ZV5A 4XN7A 5I76A 2WM0A 3EGSB 4NN5C 4BRJA 4TQEL 4GG6B 3OD3A 5K9OB 1JYVA 4MMXB 1BD2B 2APSA 2ESVB 5IKCB 4AYSA 5I5JA 1J12A 4HJIA 2A74B 1KOAA 3WE6B 2BZ7A 4LF3A 4HBCL 3D34A 3KPNA 2BOLA 4KJPC 1O0VA 5CKAA 1OCRB 2IPTH 4HEPG 2R1WA 1OGTB 3GXFA 5D9SB 2H2PD 1W9XA 4UT6H 2YD7A 4X4YA 4J3OD 1YNKH 1HIML 5AVQB 5DFVC 2V3FA 3SJVD 1G7PB 3RFZC 4S1DD 2VLJD 4KDTC 3T4AB 1E50A 3D87B 4M56A 3UAJC 2I5YL 3PV6A 4PS4H 3G5VB 5JW4Q 5SWZD 1ZDQA 3NVQA 2NY6B 4ZUTA 4DPAX 3FRUB 4AIXA 3BZEB 3X1NA 3H42L 2ENSA 3DPDA 3L3KA 4CJ1A 1M1XA 3AG3B 3EJCA 4X7FC 5AD0B 4F37F 5IESL 4P4KB 4JO8A 4HIHA 5ALBH 4P49A 1CDGA 2GJRA 3ATAA 2ZKYA 3PYCA 1A4KB 4HCIA 1T21A 4BFIA 3SE6A 4PCYA 1X5HA 4G8EA 3I3BA 2Y7QB 3FN0H 2E7DA 2NNXA 2VMEA 2R29A 2XACC 3BT0A 4ONGL 4YGAB 3ZW3A 1A7QH 2JSFA 4HJUA 4PG2A 4JDTL 1ZIAA 4HS6A 1PKQE 4JB9L 5F1NB 2QQNL 1KYOK 2FWSA 5AW2B 3QQ3A 1CFBA 2J71A 2VITA 2IPKA 4XCFH 5FGSA 4UMGA 4F37K 4WAFA 2BFVL 1C16A 2OXHA 1G7HA 1QW8A 4O51B 3II2A 4D9LH 2Q86B 3FO0L 1UUSA 2EECA 3MRFA 4JHVA 4R0LC 5I74B 3OKLA 1CXEA 4JEGB 1UXMA 1A4CA 2HP4A 3IM1A 1U8MA 5AB9A 3KPQA 2F19L 3TBSA 4ZMOA 3VB9A 5IFHH 2D0FA 3GJEB 2C9SA 5A2FA 5IKCA 1CD9B 1XL6A 5DJ0A 1UH3A 1I8LC 5IWLA 4UU9B 4CVZB 4OCSH 2EDMA 1UURA 5C0AD 5LNDA 1FNSH 4X5XA 2B4CC 5E1QA 4PGJA 2YGOA 1DN2A 2ENPA 4CNIA 5T1JA 1OE1A 4LBAA 3BMVA 4O02H 4PJAF 5E23A 1D5MA 2J2ZA 1G7LB 2ZOLB 4KQ3H 3RKPA 3U0TA 4BZYA 4B9CA 1A6VH 1BZ9A 1JWSA 4PJIF 2WVUA 4JDVB 4OZHA 5HHPB 5HY9A 3CSBA 2I60H 2XRAL 4HFWA 2Q87A 5FOBB 2VSCA 3QA3B 5HYQB 2JKLA 1IEAB 2Z92B 2F53A 1A66A 4BHUI 4YO0A 2P8MB 2Z0UA 5J0BA 4WO0A 5CEXA 4B95C 3KMDA 4M8VA 4RETB 2EDJA 2H1PH 4MS8C 2WXMA 1AGFA 4NZJA 3IDMB 1JGVL 4K9EL 2KLTA 4PMFA 2IWEA 3MODL 5D72L 1DANT 3Q2LA 3CFJB 3MLUL 3ZLQC 2NCMA 1T21B 3GRWL 5HVHC 3DX9A 5DK2B 1IIIA 1HFUA 3T8XA 1JK8B 1DJYA 3IVKA 1I8KA 3HBGA 4HWNA 3TOPA 2HH0H 3BZEA 3O3UN 1ZEAL 4NZUH 3QUXB 1NDGA 5BS0B 5E2VH 4I1PA 3OJDB 2BNQE 3BEVB 3H7LA 1XVSA 3D51A 3QK0A 2DQHL 3JYCA 4TSBL 4UT9A 5KS9F 5C0RL 4FTVE 4EKJA 1WZ1H 3CZJA 2Q86A 5IFJA 3AABA 4LHJB 1KWGA 2YLKA 4DVRL 4LSSH 5E9DD 3MRNA 5D4HA 3FDWA 3UYRH 1P53A 2FX9L 2ZXWB 5C0BB 3O4OB 4QF1B 3QJOA 4OLWL 3I02A 2ZX5A 4LDOB 2E9WA 4KK9D 3UZQA 4L4TE 4FABH 2ZSVB 3HAEA 3OR6A 3AY4A 5E8DH 1W16A 2IH3B 1LO4H 3S6CA 1CD8A 2XLLA 3VFNB 2BP8A 1P5VA 1UZGA 4MB5A 4Q2ZA 3RX7A 3O3BA 1H3WM 4HLZG 2ATKB 3ZO9A 2ICEB 1WS8A 5CHNB 3VI4B 3LMJH 2A6KA 2BFVH 4U6TA 4WNSA 2A99A 3QH3A 3AU0A 4FTVD 2VM9A 4JDVA 43CAB 4RMTA 3S3CB 1EO7A 3BVXA 3EBGA 3ORJA 5LKNA 5IGXL 2DJ4A 3LHAA 5D7SL 4IOFD 2P8MA 1IC4H 3HS9A 3MRDA 1TKWB 4XBMA 2X89D 1AO7B 4XO9A 3INUH 2VR7A 1E5YA 1FFNB 1GSMA 3MLUH 1I3GH 3C5ZA 5A2LH 1TG8A 5D5MF 4PJ9D 3IJ8A 3QQ4B 2G75A 2CLVA 3C9NB 4TPRH 4AYMC 5I0VA 3U1QA 3FONA 3WV0A 5I6XC 4J3OH 4MA1C 3GKWH 1BXXA 3KM2A 2HUEA 4ICXA 3VUAA 5EN3A 5GGVL 4ODVL 2X6UA 2F68X 4JFDA 3IFNH 4J27A 3LRMA 3TA3C 4AQ1C 3RI5K 2Y25A 5IVZB 1BX2B 5T5FH 4XPHH 4NIKB 3MOBL 4GEJA 2MOVA 1FZMB 1WH0A 1OPGH 4FZEH 1BM3H 1OT2A 1TZGH 2VXUL 3E3QE 5E2TH 2FQEA 5ID0A 3VXSA 1Z9PA 2BWDA 2F1AA 4LCWA 4QRAA 5E9DB 1QFUH 4AH2B 1YJDH 5KUMA 4B60A 1N12A 1M6OA 4OF0A 3SSGA 1K8DB 2G4GA 4YSRA 4JDEB 5HVWA 3HLAB 4NHUB 3QDMD 2OL3A 2QQKL 4QHNB 4YDLC 2IMNA 2IC2A 3A4EA 1R5VA 2WQRA 4L5FH 4LFHD 4Z76A 3MCLH 3P40A 2OCJA 2BLFA 1K4CB 3LKQB 3TVMA 2LLGA 3GK8L 4XNMA 3V4PH 1U8JB 1JTTA 2QSCL 3GBML 1ZS8B 4HK3J 1MFAH 4GKSB 4XNXH 3W5MA 4EVNB 2BJMH 1NGQH 4TSAL 4PBVC 3HS0B 1XF5B 3WEXB 1BZDA 4K94L 3EO0A 1MJUL 4ODHH 3QJZA 1UENA 5I1KL 3T2OA 3V4VB 3ARED 3TIDB 5BRPA 4KUZH 1Q0YL 2OXGB 4KJYB 4HJTA 2ZCHL 3BVNA 4A2LA 3HRZC 4NQDD 1K9TA 1A6TB 1D5RA 3QI9C 3ZHKA 2J6WA 4JPWL 3TYGH 3IU4L 3VI3F 1ND0B 1MIMH 1AZRA 3FH8A 5ICYB 2QTEA 4EI5D 2VDML 3BW9B 1MAJA 2UYLA 2SODB 1GYWA 4MXVE 2BP0A 2JB6B 5DYOB 3V2AR 3E38A 2NUTA 4ODXB 1H15B 4IRSD 2FO4A 4QYOB 5LBSH 3SBQA 4ECNA 1JVKA 2PYFA 5E6ZA 5TH2A 3CK0H 1PY0A 1XR8B 4UDUB 4WI0A 5GSRB 5TE6H 2XY1A 5T5NF 3QI9A 4AK2A 3B3BA 4RZCB 1YYMH 1HOCA 3GZKA 1RK0B 3FB7A 4JFTA 1EZVY 3EH1A 4LPYA 5EC1B 4JY4B 4ZSOE 1TTUA 1NSNH 3BGMB 1UH4A 1NCUA 3DYPA 4PJCE 1Y0LB 5EF1A 3VYPA 5F8QC 4UT7L 1RAMA 3TTSA 1P1VA 4FFZA 3V4VL 2F0CA 1I8UA 1RMFH 4JFDB 1H8NA 2V17L 2EABA 3WFEL 1BQSA 3EFOA 5DQ9B 4M6NH 4E5XG 4Y5VC 2GTWB 3FCTB 5EG6C 1IL1B 4K94C 3AQXA 1VB9A 3OZKA 2OW6A 4I48A 4OF7A 5ILTL 2CO7A 3HKZA 3APNA 1H3TA 4OZGE 1Q90A 1RJZA 4XZ4A 1E30A 1ZHKB 4FI7A 4TRPL 4KX7A 1JERA 2VZ1A 1XF2B 3QUKB 2VLJE 5F0PB 2Q6WA 4DGYL 1EMTL 5MEPA 4MQXD 1LEKB 5JPNC 1G6RH 2WWMC 3B37A 5D96B 1YYLL 4PRIE 3RUGA 3LCYA 1M2VA 3O4OC 4HC1H 3LIZH 2W9LA 5C0DB 3RWGB 2YZ1A 4LLDA 4QXWA 3TZVA 1T83C 4QHPA 5FUCE 5E1AA 1NLDH 3E1ZA 2HUHA 3CMGA 2WMPA 4BEIA 3M1OA 5D7LE 1EWHA 1INEH 4J4PD 3IDXH 4W9FC 4Z0XA 4ANVA 4C58B 2AEOA 3IGAA 3IETB 4ISVB 4JO2H 4LLWB 1FV1B 1RD6A 4RGNB 3DJSA 1U8QA 1ILUA 3H7BB 3U0PB 4YFLI 1TFHA 3DVNA 1I9RH 4WK4B 5CLTA 4MJ6A 3MRGB 3W39B 1V7NL 3FF8A 1DJWA 3RWFA 3MRKB 3A67H 3MRBB 1BOGB 1KBBA 3ET9F 4MJ4A 3SBWA 1FQ9C 5CJBA 4YXKL 3P3UA 3DJTA 1OALA 1MDAA 1MEXL 5TDPB 3RDJA 3M8OH 4A7UA 3HHSB 4MD4B 3W37A 3NA9H 3E2HC 4WGVB 4ANKA 4AI7A 3FTWA 4X5RA 1SXZA 4DETA 4LCIH 2VDMH 4APQD 2EO9A 2YXMA 2BNQB 4DEUA 2HFFB 5T8IA 3MBXL 4MA1B 5DEJA 2VOTA 4JUTA 4YOKA 2PTVA 1DJZA 3E9UA 3NCYS 2WC7A 2A6DA 1XMWA 1J1OH 5GRVK 2E5EA 5AOLA 3EJTA 3WTSA 4L9DA 3IK2A 4PJ8A 4PTTB 2LV4A 2JH2A 4ENZA 1CFTA 1KGCE 2BIPA 4D9RE 2VKXA 1XD0A 4W9HC 4UQ2B 3E9TA 4NGHH 1H6FA 1OQOA 5AAWC 4L1LA 4UQIM 5HSFA 2YZ8A 4U2YA 1TLMA 1FGNL 1ZMYA 3JVFC 2FJUB 4B53A 5GHWL 3HZ3A 1M2VB 2Z64C 2OMWB 3KPRD 3SE4A 1A6PA 1RPUA 3CXHJ 3QFDA 1SJHB 1E6JL 3WUWG 4R90L 5B1BB 2FWUA 5AKTA 1XH3B 3KNBA 3M7FB 2WMPB 3L08A 4X9HA 4K8RD 1CMOA 1WUNT 4ADIA 1FL5B 4JQVC 4FXKA 4TULH 3T1FB 4L1TA 5FA4B 2Y7MA 1D7BA 4PRNA 4EDWL 3FT4A 3R1GH 3BZ4A 3VQ2C 3LXUX 2C9RA 1GMIA 4W9EC 4B6ZA 2RD0A 4XPTH 5GGSA 4G5AA 3KXFD 1A7RH 1VEPA 1X44A 5A1AA 4IU2B 5FGCE 4E9XA 2Q3AA 4FMKA 4P2CG 3UMNA 2DQIL 3IEAA 4EZKA 2YKKA 3MRBA 3TBBA 5EZLB 3WIHL 3IRPX 3WENA 1XCXA 3BGAA 4WRLA 1TXKA 4TPRL 3WMQA 1BFVH 5B8CC 5DZNA 2NY5H 2J88L 3CSYA 2GFBA 5CIPB 4YHIB 5I1CL 4KZEH 3OPZH 3SY0B 3ZBMA 4CVXB 4O02B 5LCVA 1MWAA 4BZ2L 4I87A 2W81C 4NHCL 1RJYB 2VT0A 4M03A 1AFVH 1LE5B 1QO3B 3NIDE 2J43A 4XMLL 5L4JA 1T4WA 3OKEA 4N1HB 1P9MA 3GJFH 3KYOA 1USQA 3B9AA 1RUPL 4TQIA 5J1SC 4FD0A 3SYCA 5ICZB 2WQVA 4QHLB 3QDJA 5KTEL 4QTHA 3JWDH 3V0AC 1JL8A 5ALCH 3V55A 5I1EL 4CU8A 4HVBA 4WWKC 5GGVY 3BH8B 3KPRB 4AENB 1TVBA 4KO6A 2GUOA 3L1OL 5DRZB 1OE3A 4UAOC 3ARQA 1FGNH 5GZOD 4X6CF 5HGAB 5E6SB 2XOTA 2AKRB 1K4DA 4KXZI 4LVOB 3ISWA 4Y5VB 1WICA 5IJKA 3BXNA 4KQ4H 4FNTA 3GMOB 3PHSA 4WI9A 1DBBL 2PCYA 3IE4A 3IDGA 4A39A 1ZHBA 3ASNB 3KWVA 3VVWA 4QAMB 1MCDA 2KHAA 1RHFA 4NP9A 3GSNL 4U6HB 2X9WA 5T1KB 4FQQB 4PQXA 1CXFA 4F2EA 2CDGB 3DI2B 3CC5A 2XBZA 4NP4H 4RFEA 1H0DB 4P2QE 4G71B 2PCFB 5E9NA 3NSCA 1XH3A 2XICA 1ED3A 4HUVB 3AACA 3DBXB 3QEUA 5CR8A 1TIUA 4TLUA 3HFFA 5I0DA 3QG6B 2YAPA 4WHYH 2HX8A 4Q6IC 3LEYL 3VWJC 3EJUA 2IGLA 4EQ2A 1N0LB 2VDPH 1AKJB 3U36A 3MUUA 4QRTA 3GUTA 4KTDL 2JKWA 2WIMA 3ENEA 4Y19D 4ENEC 2O61A 4NUMA 5AG9A 1EQWA 3HPLB 4S0TD 2WV3A 4M1GL 3O81A 5I75C 3NCJH 4PLKD 1YAZA 2WYHA 1AHWA 4UM8B 4XXDB 3VFUA 2GT9B 5CILL 2E8YA 3BT2H 4L2YA 4OZIE 3RUGE 4ELDA 3SYPA 3KLAB 1MCJA 2IH1B 3WELA 3G9AB 4ZO9A 3IFPA 5L4FA 5IMMA 3MDJA 4Z77B 4JZNB 4M6NL 3K72A 1DBJH 3QC5X 5ERWB 4MWFA 3L8QA 4FFYA 4YL4A 3HS0C 4Y1TA 5H4YA 2GABA 2HVKB 4P9HH 1NGZA 3F04A 3P54A 1XGTA 3KPMB 4FI6A 1I8IA 2BP8B 3RAJL 1T89C 3JTTB 1MFDL 3MRNB 2AQTA 3D85B 4H8PA 2Y5TA 4LLUB 5D7JD 4MNQD 2J1ZA 1I7RA 4R9HA 1RK1B 5H37G 3VSQA 4ANUA 5ICUA 5EOQL 2VZ3A 3KJ4B 3L6FB 2MNUA 4TRPH 2XV6B 4UAHA 3STZB 4QOKE 2Y2WA 4E9LA 2XA8L 3EYSH 4K71B 5EOCL 4LOUC 5C0JB 1TO5A 4PHZA 5B1KA 4QRRA 4N0CD 4Z7QE 2AKRA 2FB4L 2E27H 5FK9A 1PX4A 5CHNA 4U33A 4PG9A 2WYTA 1CYWA 1KIQA 1J5OL 4ES9A 3P3YA 2ED7A 4NWUL 2VDRB 1OAQL 5I2IB 3ZSTA 2E86A 2X42A 3UPRB 1CB4A 3H9ZA 4LOFA 3FB5B 3QO1B 4I0CC 2PPFA 3CFCL 1EX0A 3FRUA 3B7RL 5IBLD 1JP5A 2IPUK 3FO1A 4MCZB 1HILA 5IESH 4AYGA 2QQLL 4OQ1A 3OHXC 4F15B 2RFXB 2ZX7A 3H42H 4OV6F 1MJ8L 3WLBB 3O9WB 3HCVB 3ERXA 2XTJC 3QUHA 3UJJH 4PAZA 3D18A 2UXGA 1FLRH 3RL1B 3WU1A 1KNOB 3X12B 2M1KA 1OCOB 5JYLA 1A3QA 2AS5M 1HEZB 4PFEA 2KDGA 3VGHA 2VR3A 3TO4B 1JXDA 1KN2L 5DHXB 2XWDA 4Q9BA 3CVIL 4DW2L 1RPQA 1SMAA 4I9XA 1R3JB 1KJ2L 1WDAA 1OAYH 3GPSA 2GI7A 3D07A 4GW5A 1UB5B 1UA6H 5DMIH 4FULA 2R1XA 4HIIA 4XBGB 3QIUC 3L16A 5ESAB 3OZLA 4AGNA 4AH2A 4XP9L 3SKOB 4Z9KB 3ARGC 1IV8A 3WS3B 1TJIL 3HS0A 4RMVA 3CPLB 4M8UA 5C7ZA 2ENYA 4PB0L 5ESQA 2BVQB 5B1JA 3GGWB 5BZWB 3D4YA 1MQ8A 3ELAT 4G42A 3TH4T 4HALA 2MCAA 1BW8A 1OY3B 2OV0A 2V2WB 4YGVB 3TASA 1YY9D 3EFDL 5IIEB 3NT0A 3DJRA 3DLQR 3QR2A 1U2CA 1T5KA 2ZX6A 3UTSD 3GK8H 2HFGL 2VLKD 1JPSL 1RK7A 4PS3A 4XRCA 1E90A 2ZOLA 1ZV2A 2PW1A 5D7LB 3C12A 3N44B 1ZEAH 3MNWA 4PWEA 2FD6L 5BZXA 3GXIA 4NHCH 1RUML 4PWJA 5JOPD 5FC9A 2ATAA 4FKKA 3MNVB 1NFIB 1DDHA 2CCLA 5DC9B 4K55A 1BJ1H 1HOEA 1D6EB 2DIJA 4FNPA 4G1EA 4GAJL 2QV2A 3N85L 1W2KT 2A74C 4YVNA 5D72H 3EXJA 2UVEA 4HAGA 4LIQL 1FZJA 3DSFH 4NRZA 1A7NH 5PAZA 3CSGA 4JRXD 2VB5A 1BLNB 2VXVL 1CJYA 1EEYA 1SGKA 5DUML 1I8KB 2NX5D 3G08B 5BOPA 5FUCC 3OF6D 2YOAA 3C6LC 4XCNA 1XH0A 1F1AA 2X40A 1TYJA 3QWRA 3CFMA 3BQUB 3QZLA 4X6CA 4X9GA 5F3FA 2BDNH 5AUMA 1N0XL 3UJIH 2CU9A 2G60H 1AI1H 2A9ML 4NM4H 4BQCA 3ESMA 1IVLA 2JK5B 3LYRA 4YX2L 3D06A 1ESOA 2H2SC 2DLGA 1R3HA 5ESVB 3QYMA 4B5EA 4NKDB 1MCOH 5D1XA 4KPHH 3K5SA 3MRIA 4TTDC 4Y19B 5DS8B 4JY5H 3KPQB 3TBSB 4S0HA 3K4ZA 3MOAL 2WLYA 1M6UA 4KK5C 1CFVH 2TAAA 3VB8A 4EI6B 2BSSA 4ZDHB 1A4BA 4KVCL 4ODSL 5C70A 2HKFL 4BFRA 5EU6D 3CGTA 3ARDB 1A14H 5ILTH 5L6YL 1VFBB 4N8CH 3I2CH 3ZDWA 1F02I 1HH6B 4GXUN 2QDWA 1DQJB 3ARBB 3B7SA 4JN1H 1IBYA 3H56A 3AAZA 3SO5A 2AQSA 1DVFD 1CFQB 4WI3A 5CINH 3OGCB 3V0IA 4NZTL 4PS8A 4S1RH 1C5DA 3TTYA 4G6MH 4NOFA 4BSVB 2Z6FA 4G9DB 1NAKH 3OSKA 2YSSB 2FDBP 3EO9H 4YXLL 3NA9L 4JM2D 2X2IA 4DPCX 1IBZA 3CDCA 5E08L 4MA7H 2XPGB 1J88A 4P2RE 1PAMA 1XSOA 1X4ZA 2AK4D 3UAJD 3MZTA 3LEYH 2DY2A 4UQ9A 1BQHB 2DYRB 3HHSA 4ODTH 5CJXC 1ZVSB 2Z34A 4HPYL 2Z35B 4WK2B 4MD5A 3IJSB 4X4KA 4LSQH 5T1DL 2W59A 1YNTB 3PHOA 4JFEB 3W39A 1JK8A 2EKJA 2DQEH 4G6KL 1UFGA 3WN5A 1WV7T 3EDFA 1RZJH 3DVIA 5F1OB 2HJKA 2PPCA 1UWXK 3T3MF 3K71A 5TDPA 4H44C 1M6OB 5EF3A 4FG0A 4JR9L 4PTTA 1HINL 1B0RA 3WNJA 3DVGA 3CHRA 5J89A 3VAEA 4LDEB 4A6YA 2OYLA 2PO6C 3BAKA 4IRJB 3TYGL 3UAAA 4Q7DA 2AJUL 3FYIB 2BXZA 5JORB 2N0MA 1TZAA 3GRBA 1MQKL 4RWYL 3WMSA 4YSOA 1HZKA 4TOYH 1DVUA 5I8KH 1I7TA 2YBGA 1R3IH 4OFKA 1OM3H 4EIBA 4MYWB 3T2LA 3CZEA 5C92A 1HZHL 4ELKA 3ZDYF 1JWMA 1UC6A 2XYBA 2UZYA 3HG0A 4JGNA 1TCRA 1FBIH 4XTRC 2PNDA 4H4NA 3P9MB 2VR8A 3ARBD 4FFYH 4PY7B 3ZTEA 4OAWB 2XTJE 4GXVL 2OXGA 2DLTA 4NC0B 3AUWB 1P0SE 5I17A 3E3QC 3Q5OA 2NCEA 4WSKA 3IDIB 3QUML 2QQKH 3BFWA 4PH8A 2B1HL 5KZCB 1NCWH 3OC5A 3WIFB 5AAWA 3BVDB 3V4VH 4WCYL 3X1EA 3GI8L 1GHFL 3IU4H 4JKNA 1IKNC 1D5MB 2J2ZB 3CVIH 3U0TB 4B97A 2AANA 1VFBA 2K6WA 1J1XL 5I2IA 4PSRA 3GZOA 4MZ3A 2JV6A 1QFWH 2WXLA 3BAEL 3FTYA 3OJ2C 4LK4A 3ZRCC 1DQMH 3VRJA 1CGSH 1RZFL 5DA0B 1OB0A 5GGSB 4Y9FA 5SWSA 2NY1C 3HR6A 3T6ZA 4HSCX 4ANWA 3ZMRA 2PXYC 1MH5B 3EF7A 1NMAL 1M56B 4OJEH 1A9BA 3DRTB 4XNQA 2YD3A 3C6EA 3GSWB 2YPKB 2X1WL 5D5MB 4J2QA 5DHYA 3O3EB 4QOKB 4F1SA 1YYLH 1KENL 4FQ2H 4LKXA 4LVNB 4HU8A 4IKJA 4XCCH 1O6SB 2VM4A 4I3SH 3NQKA 4GUQA 3WY4A 4X7TB 4GW1B 3KEHA 3WJJA 5DQ9A 2F5AH 4TF4A 5FYKH 3QZMA 4L8SC 5CU5A 1KPRB 3Q05A 1U33A 3NSYA 1FGVL 3A4AA 1WFJA 2PO6A 5DI8B 5HYJD 3PWVB 4N0YH 4IBVA 1KZQA 4AUYA 1FBIL 2CLRB 1FG2B 2CO7B 4GUPB 3BKML 5LGYA 2YHGA 2K6ZA 4EI5B 1Y18A 3WNPA 5A7BA 3CPLA 4LT7A 1VEOA 4RX4A 3VQLA 3KEDA 4F2FA 2BIMA 5CGBA 4CSSA 5DD0L 1AQDB 3SE8H 2HSIA 4PJEB 2VE6B 3GMQA 7FABL 4HWEL 1VA9A 3HC2A 4WW1B 5C0FB 5AOJA 2A4CA 2VN7A 5JTWA 3WYRA 3D39B 3HC4H 4HUKB 1KJMA 4HX1A 4Q6KA 4Q2ZB 2R0LH 4YVUA 2UWEE 4J3BA 3SCMB 1X5MA 1MNUL 2QJDA 1QWUA 3BKCH 4G6FD 1VFOA 4ONOA 2N3JA 5ICYA 1KN4H 4GKNB 2NY2C 2G0KA 2CPCA 3MBED 3BP4B 3F6IA 1IQWL 3V5HA 1AKJA 4JL1A 3L5WB 4HKJB 1A21A 3F2LA 4KMTL 4M7LH 4P5KB 4PTUA 3UYPA 2B1HH 1T5WB 3F5WB 3OF6A 4R4FH 1E5ZA 1SJXA 1YHPA 5C3IA 2NX5A 4TSCH 1I3GL 1SLVA 4F33A 2XWTB 1YNKL 4NQXA 4D2NA 4GRWH 2H0PA 4YS4A 4BSJA 4XCEB 5FYJD 4XODA 1JNLL 3JUYA 4R90H 2Q7AA 2KKQA 2E6PA 4ZW5A 1N59B 1UKQA 4FA7B 2ZSWA 3CLEL 3MLWH 3MO1A 3LEXB 4MAYC 3CFBA 1PX3A 2RR3A 4XC1L 1L3NA 1XCQA 5I9QC 1WBZB 1YQ2A 1U58B 2RCSH 2WXJA 2G5UA 3O8XC 4ZSOA 3HEIB 4LL4A 1KPUA 2ALWA 4J7RA 4KPHL 3SE4C 1JZ4A 1R5IB 1R5VB 5JR1H 4JHZA 4F7EA 4BCYA 3FFOA 3KR3L 3D39D 1T1ZB 3T71A 1P1ZA 3UBXI 1C8QA 4MX7B 4N0UE 5DJZA 1CDBA 5A2BA 1B0GA 3MPCA 4FQCL 1UCBL 2A6JB 2XXMB 3GI9H 5IT2L 3FPYA 4JAMB 4PG9B 1LWHA 5LB1A 1JZEA 5DFVD 3FQRA 5IY5B 4AGPA 1A6ZA 4JLRB 4Q74A 4XC3L 4UQDA 4I3RH 1AYRA 1FORL 2LAAA 3B9KD 4AE0A 5MENB 1O7DC 1XDTT 3IS1X 3L3DB 3BRGC 3B8YA 4EXKA 4I8DA 1KBGH 4UT9L 1BVKA 2AJXH 4X6DE 4EDWH 1I7ZB 6PAZA 2YK1H 1F1DA 1GGBL 1SPDA 4F7CB 1G7JB 2VDRL 4ZNEA 3MUHL 1UWYA 5T3ZL 3GRWH 4IJ3B 3TA3D 3SGEI 4OCRH 3TIEB 3GBDA 3GS4A 3PE9A 4GKLA 4DP6X 4Z7QF 5J1AB 1YECL 2WOBA 1JGEB 1J8KA 1MIEH 4HIHB 4HT1L 5AVWB 2P26A 2OJEA 5LBSL 3QUMA 7PAZA 1E4WH 1G4RA 5J13B 4WUUD 4XI5C 3U2SA 4O2FB 4W6YB 4JFXA 3M1BA 2EH7L 2P5WB 4MMZA 3TP4A 4IGBB 5GJSL 4F3FB 3ASWA 5LHDA 2K3TA 4L8CA 1YEEH 5ANMA 2BSTA 3FQXB 5BV7C 3OKEB 1T0MA 2DOCA 4LVOC 3FQ2A 4X0KB 1LD9A 2ZWYA 3ARFB 1E28A 3ARYA 3VXSE 3TYFB 1KLGB 4JFFD 4BQ9A 1OSZA 3N43B 4FNSA 3HG1A 1FDLH 4PIRF 4C55A 3EHBC 2P80D 3PWPE 3WS6C 4DZ8A 3NN8A 4M6OL 3D30A 3NIGF 4MMZC 1SN2A 3HI6H 4RQQB 5FX3A 1UZ8B 5DJ6B 4TOYL 1A7PH 2NXZB 1OARH 2HN7B 3VGAC 1JDCA 1Q0XL 4ZMAT 4XT1C 5IHLB 2EH8L 2BSEA 1S9XA 3P9MA 3FXIC 4XMLH 4X4ZA 3TM6A 4BM7A 1QUPA 4D8PB 3LZRA 3VG0L 2YRBA 4KQ4L 4TM9A 5GS0C 1FL3A 3W56A 1A3LH 3QCVH 3PCYA 1J9SA 1O5DT 2MFNA 1MY7A 4HFUL 2F1BA 1AMXA 5DD1L 1JUFA 4GKZA 1UCTA 2IQ9H 2AJYH 4MGXA 5D70H 3MV9E 4YSTA 1WUZA 4P2YA 4K3JL 1GZQA 5A6MA 3P3TA 2XV2A 2WYZA 4PJAE 4EIUA 4HQQH 4X9YA 1QFWL 3BAEH 3MMEB 3RNQB 1UQSB 2F54A 3POHA 1C08A 5B7FA 3DMMB 1HL4A 1YSOA 2DD8H 1NC2D 4HZAA 2QMKA 5EO0B 2FTAA 3MNZB 1K5NB 2I07B 2OJZH 4G8GA 5GISL 4IYKA 3VXUA 3WG7B 3G6JA 1S3KH 5D2NA 5LUMA 2PMZA 3OAYH 3FQYA 3D69B 5FUOL 1RZ7L 2Q3XA 4G5ZH 4X4MA 3LN5B 4X6DF 3UZVB 3AVEA 3GSRB 3MROB 1MF2H 2DRUA 1U91B 4UT6L 1TQVA 2WXFA 4LXFA 3H0TB 2N1TE 4AZ8A 5HYSA 4NWTL 4H20H 2VLJB 3IDYC 4E0RA 2J73A 1KFAL 4UTAA 4AVJA 2HFFA 1NKRA 1PJ9A 4JFXB 5GZND 2HKFH 5LGHL 5JIMA 4WFEE 5D1XB 3T3MB 1IM9D 3THMH 3BQUA 3PGFH 2WQSA 5JPMC 1OARL 4FDWA 2DW5A 3FBQA 2FLMA 4WV1A 2XC8A 2ZICA 3RAJH 3C6LA 1OQXA 3GXPA 2F7IA 1MCLA 3KL0A 4PCSA 1AH1A 2QADC 4G11A 2YMOA 3EG9A 1II4E 4QCIA 5F6IB 2W1NA 2LTQB 5FFLA 3CVDA 4FLOA 1TQTA 1H3XA 4ZO6A 1WK0A 3PQYA 4HSQA 3QRBA 1H3UA 1SYSA 2AQ3A 2OL3H 3M6DA 4FFVD 3UDWC 4PJFB 3C8DA 3JT2A 4PRPD 5I6OA 3LKNB 1MUJA 3HNSL 5JW5A 3OHXB 1OGAD 1KG0A 1BD2A 2GEQA 4HIEB 3TBTA 3Q5TA 2MOGA 2PP8A 2DDQH 2NYYC 4IOIB 4MXVF 2H7WA 3ARDA 4XBEH 5FYJL 1U8KA 4MYPA 4D9LL 2BK8A 4UNUA 3POCA 3STLA 1JRHI 2VN5A 3QRLA 4HFWB 1PBYA 4GKOA 5KBNC 3IGLA 4HCRH 1DZ0A 1TVHB 3S5LG 3V0DA 3ABGA 3PAVA 4H8WH 3S8WA 1BXUA 4UNVA 1P7KB 4JG1L 5TPWH 3UTQA 2NXYC 3EYFB 5I6MA 3QUXC 1YDPB 4D9QE 2FBRA 1MW0A 1LWRA 4APXB 5HPOA 3DOIA 1O7VA 1P84K 3VXMB 4QHKI 2YD6A 5HYFA 5J6GB 2EDRA 3BCFA 3DIFA 5SX4H 3PUUA 2OM5A 1AJ7L 3B4NA 3TNMB 5EZLA 1FNGB 3TBYB 4NNYB 5C09E 2YUVA 5TQ2L 3FPXA 5HYEA 4HKZB 4JM0A 5GXBB 5KSBF 2YD0A 2WCGA 4CC4A 3B6SB 4M62H 2WTRB 5D7JB 3VH8G 1OAJA 4FNRA 1ACXA 2FCBA 5DVPA 3WFBH 3IGFA 1I3VA 2L7EA 2JVUA 3QUXA 5EIQA 5HHXL 3ZKSD 1AD0B 4U1GC 1QSFB 3T4AC 3OSVA 4OGXL 2A7BA 3QJXA 5E2JA 3EYQC 4KRPC 5LWYH 5IJCC 4TUJB 4WEMB 1K6QH 1CFSB 3FFCA 5B1JC 5LQBL 1CS6A 3LZOA 4FFYL 1B0RB 4J8RA 1Z5LB 4NKMB 1IGCL 2N7BA 5KVGH 5CEZL 1TJIH 1OP4A 3VM5A 4FX5A 2JJSA 4E9VA 3PQYB 5HHNA 3QIBA 4PRPB 3QDGD 4XMPH 5AW1B 4ZMNA 4AENA 2X7LA 3LIZL 2RACA 2VDOL 5BS0D 3OXSB 2HPOA 3N55A 1LE9A 2X6VA 3ECBA 1OAYL 5HYJE 4YHOL 3OHXA 2WQWA 1F1GA 4JDZB 4J8QA 3P2DA 4HAKA 1X7TA 2VISB 1F8TH 2V4LA 1OEZW 4U6VL 3FN3A 3FTZA 4LEBA 4PW9A 2DMGA 4WW2B 2BNRE 2RHEA 4Z6AT 2MSPA 1I9RL 1KTLA 4JFOA 4JKPH 1A8JH 1L0PA 3LNHA 2DLIA 4OD1L 2VDQH 3QIBC 1S7WB 2YK1L 4FQQA 5D71H 3AMLA 4BE5A 1MUJB 1ZTMA 3US9A 4BGDA 3N85H 2DBJA 2WZPA 5DXWA 2VJ8A 4XXWC 3KJ4C 1GS6X 3ZJAA 5BO0D 1L9PA 2B9BA 4RIRB 2AAVA 1KYFA 4HIXH 4M4RB 1KACB 4ODWA 2F58H 3M07A 3QQ4A 4K71C 4OBSA 5D7HA 4DJMA 2GK0B 1FNGA 1CO1A 1I3RA 1CN4A 5FKAA 5BQDA 1MJJB 3C2SA 1TZIA 2FWOB 3BIKA 2K7PA 3ML8A 1AXIB 1T2XA 4HJ0D 1INQA 3KLLA 2GJ6B 5EU7E 3GHBH 4AYBA 1YDPA 4IHBA 2NY4B 1VFAA 4G8FB 2Y6TE 3CBJB 3PNRB 4HUWB 1Q9OB 2G2NA 5EBMA 2BVUA 2XQYA 3FO9B 1NCAH 1BAFL 1A47A 2J8UB 5IROC 4L8CB 1A02N 1KXTB 1V3KA 5LWYL 3BO8B 5IW6A 2H32H 2G4EA 3NCEB 4NKOB 1S7VA 1B9ZA 1D7DA 1FYTB 1L6XA 2C3VA 5F72S 3QEQB 1RUQL 2C26A 5IQLA 4FA6A 4Y1AB 3ZDXE 4XBGA 2HFEB 1M71A 1J9TA 3CFKB 1QUNA 3L7EB 5T1MB 4AIZB 1VKXB 4ILDA 1EXGA 3ABKB 4ODUB 5IFJB 1BVNP 5C7XL 1BIIB 4O2EB 4ELMF 3KPOA 1H3PL 5T3XL 2FGWL 1KGUA 3VYNA 1R0AH 4LCWE 3RTQD 3LPFA 2ZYIA 5C0AB 4XCFL 3FYEB 3MJ8A 3OAWA 2C8NA 3KW7A 1DVTA 2GUYA 3FQUB 4G1MB 4LPWA 2Y5TB 4A7GA 2EIMB 3GSOB 2A9DA 4GO6B 4PRAB 5ACLA 3HJ0A 1AKPA 2PTTB 3MXWH 3O6FA 5E5RB 3OKOA 1PZ5B 1U8IA 1VF5C 3Q7JA 5SWZE 2Z0BA 3WFHA 3C60C 3VGFA 1YEJH 3PNWA 1WGOA 4XMWA 3U7YL 4YLCA 2ZQKA 2LLLA 3EFFB 4WUKL 2ESVA 5GRVL 1RUPH 4HPOL 4XVSL 4L4VA 1NDMB 4YDKL 3RRQA 4X6DA 2CXGA 3WKPA 2AJ3B 1IE5A 5BO1H 4LLAA 1YQVH 3UEZA 4E5XA 2ZOWA 1AZBA 3HRZA 1ET7A 4I2XA 1N2RA 5K39A 3MRJB 4GP8B 4B50A 4K3JH 4CU6A 3H9SD 3PU7A 2ZUUA 4R26H 5L8KB 2M26A 4MLSA 2QZQA 1D5ZB 5FWRA 4KZEL 1YEIL 5FO7A 1BPLB 1LYQA 1XEUA 4OCWL 4RZCA 2VRQA 1Q0YH 1MFVA 3RTQC 1GCFA 3N40F 3QAQA 4JHBA 4MJ2A 5HDRA 3X14A 3DYOA 3CSFA 5DTFB 2GK0A 2HRHA 4AE1A 5HP5A 2FL5B 4K7PX 3MO1B 3LKPB 2HRGA 4WJKB 5I5MA