4BGLA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
ELFQTADWKKEKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE REDUCTASE
publication title Superoxide Reductase from Giardia Intestinalis: Structural Characterization of the First Sor from a Eukaryotic Organism Shows an Iron Centre that is Highly Sensitive to Photoreduction
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 24
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bglA00
2AMUA 2JI1A 4C4UA 4BFJA 2JI2A 4C4BA 2JI3A 1DFXA 4BRJA 2HVBA 4BRVA 4BK8A 1DQKA 4BFKA 4BGLA 1VZIA 4D7PA 1Y07A 3QZBA 1DQIA 4BFFA 4BV1A 1VZGA 1VZHA 1DO6A
chains in the Genus database with same CATH superfamily
1EAOA 2R29H 1WWCA 3M1BA 3U0PA 3R1GL 2EEDA 4X9GA 2JQAA 5FYKL 3T0EE 1PX8A 1MNUL 5E6UB 1JK9A 1HHGA 4YFDB 3K80A 4A6YA 3WO4C 3DRQB 1A6ZA 5F7DB 4YHIA 4RRPM 2ARJB 2CBPA 3D9AL 1N68A 2C9UA 2VDPL 3LYRA 1P2CB 3DDGA 2X44D 3LIZL 5MI0B 1O9ZA 3DTXA 1KFGA 2VWEC 4UYPA 3TNNB 2A74B 2F6AA 3DXAA 1OGAA 1RJLA 3ARED 4HOXA 1G1YA 1T0MB 1BOGB 4J3XA 1CE1L 3IRZA 5AAMA 2AJZB 1T7VA 1X5FA 1KPUA 1RUML 3DX8A 3OTTA 4N2FA 4N86A 3RVTD 4G80A 1I3VA 3UDWC 4WI8A 2I07A 3PP4L 4NN5B 4ZZKA 5LUMA 2VH5H 4JLRB 1GS6X 5AW3B 5SWZB 2DQUL 3UTSE 4OW6A 2JCCB 1I9EA 3ECBA 4OCMC 3FQWB 3TCLA 2Q86A 4LEBA 1YAZA 3FQYA 4PRAB 4GO8A 5IB1A 4D0DA 5IJKC 3QRFM 1AGDA 3C2AL 3SDDB 2L7QA 1KCUH 4NT6B 1RZ8A 3GUTB 4A37A 3J8F7 3E2HB 3QIUC 2QDWA 3HAEG 2FBRA 4N2EA 4X80L 5JPMA 2DV6A 3DC0A 1CMOA 2DEXX 3AG3B 3LS5H 2W1NA 4XP5L 2QVKA 2ZXQA 4EI5D 2OXGA 1YSOA 1I7UB 3EYQC 2DIJA 3SDCD 5FCUH 4WSKA 4LNVA 5HHNB 2R0KL 4W9ZA 3ZHLA 5EFIB 3RUGF 2BY0A 1GA2A 2OLDA 3C2SA 4IKKA 4HEPA 5FDWA 2FAUA 4UV7H 2I85A 3EOTH 4HD5A 3LKOA 1X9UA 3F58L 1DUYB 1TYEB 1MCOL 2FJGA 1BMGA 3QQXA 1ZLSL 4G8FB 3IB4A 1LO4H 4FQCL 1P5VB 3CFBB 3OV6A 4JFEA 2R2HB 3VXSB 3TZVA 3WUWA 2VDLB 1E8XA 2YS4A 1UM4H 2H0EA 4ODSL 4OZIB 1G7HB 3RNKA 1KG0B 3F6JA 3HE6B 3I84A 3JTTB 3RVXD 1G87A 2J20A 5LG1A 5GGQH 5GGRY 4H8WC 4Q6KA 2D31A 5AB0A 3PPEA 4LB8A 1ZA6B 1ZKAA 1TIUA 1UT2A 4KXZI 1RIVH 3MBXH 4NNYB 2XX1A 3S35L 1OHZA 4F80A 5SWSB 2X4QA 1D6EB 2Y22A 4OCWH 4Q0XH 3RDTB 1IM9A 1UURA 4QO1A 4ABWA 5MENE 4XN2A 2J6EL 2NQCA 3GKWH 1L0QA 1SOSA 2FEDC 1KDIA 4Y2DB 4KZ0A 1NIFA 3U2SB 2KZWA 4KK9C 2BNRD 3CD4A 5IVNA 1SVZA 1Q90A 5BQ7B 2AABH 2HPOA 1FJ1B 3NRFA 2R2CA 3X3GL 2WZ5A 1WCBA 4M00A 5CGYD 1YY9C 3Q8FA 4GP8B 1NC4D 2GTZB 4LLYB 3U83A 4ETQA 1SLWA 4A66A 1AFVH 4ALAH 2FX7H 4RGMB 2X09A 2CLRB 3RJQB 2QT6A 4YXHL 2A5UA 3PIQB 4GS7C 5F7LB 4FZEH 1LNUB 3QIBB 4K3DL 2OZ4H 4NLAA 2H3XC 5IM7A 2PP7A 2GJ6E 2WWMC 2XZAL 4IU3B 1R3LB 2J1ZA 1EHLL 4S2SB 3GMQB 3UP1A 4Y19E 2F2HA 5KAQG 4YDIL 4ZX3A 4ODWA 1D6VL 4XPTH 2GIMA 2OMZB 3NIDB 3QZOA 4A6YH 5DQ9B 5J6HA 1W8OA 4MA1B 3SDXB 4G71B 3EF7A 4NYLB 4PG9A 3QDAA 3L4WA 3RX7A 3IEAA 3JVFC 1WFOA 5DRNB 3LN5A 3WD5L 3T3PE 3CPLB 4LP8A 5IG7B 3J07A 1WZKA 1TJGL 2BIMA 2C9AA 2Y7SA 4KK6D 1MVYA 3RL1B 2EVJA 4F37K 1FE8H 2DKSA 3ABKB 1D2PA 1GZQA 2X4TA 4OIBA 5HDBB 4LLWA 4D3CL 4DPAX 3ATBA 3FN9A 1TZIB 2ZWKA 4H1LA 4YGAB 3LRGA 1TCMA 4X50A 2EEBA 4B3VA 4IU2A 5DUBA 3X11A 1Z0NA 4PRPA 1KIRB 1S9XA 4X8JB 4KKQA 2EE2A 3VQMA 1HHHA 3QQ3B 2XQBL 1E27B 2GBTA 5FYKH 3CJJA 1OXYA 4UTAA 5KSBE 1I3GH 2VN5A 5A7BA 2LLNA 4FULA 4FTVE 4XZUB 1BQRA 4DO5A 3D9AH 2ZOOA 4G6AC 4W6WB 1B6DA 4LVHC 4O2FA 4CJ1A 5IJCC 2UWEA 5HDQL 4AIOA 3A6BL 3TEYA 1EBPA 1U8PB 3NDYE 5C0AD 3OBAA 5E8NB 3KJ6L 1UUNA 1D5MB 3NESA 4ZW6A 2PCXA 5J9PB 4KQ4L 4X7CC 2FX9L 4GLRH 3CU1A 4CKVX 1RUMH 1BG1A 3PP4H 3GMRB 1K2DA 5BCAA 1WD8A 1BXVA 3NYKA 1JNLL 1YEDA 3OLEA 2UZPA 2DWSA 3OSKA 4UT7H 4UWQB 2DQUH 5I2IA 3HNTL 1H6EA 2FJFB 2X7LA 4UNIA 1F6FB 4NNPL 1IC7L 4B6ZA 3PWNB 3V6FB 2BFVL 2BSRB 1C16A 1T2QL 4GKZB 4YHYB 5KUKA 2IDTA 3MRHA 3L9RA 4R7NB 1MRFH 3C2AH 4X0KA 4E5XG 5F6HJ 1SRDA 4OFIA 4P3CL 1E5ZA 3NFSH 4UQIM 5D7JC 5IQLA 4ZTEA 1ILUA 4B0MB 5MEQB 4QT5A 5I1CL 3RZWA 2RCSH 2AJVL 2QLYA 1J0KA 43CAA 4AVIA 5IESH 4WI0B 4HWEH 3BP5A 2CBMA 3FCSB 2R0KH 5FOBB 3BZDA 1AP2A 4N8CH 1BG9A 2MKLC 2ARWA 3CH1A 5H94A 2VDNH 4FKEA 3F58H 4WO4B 3VD0A 5E6ZA 3X1EA 5CJOH 3QHFL 4P2OD 5CFHA 1XQ4A 4KNSA 1VSCA 1E4XH 4UIMB 4JG0H 4G83A 2IANB 3SPGA 4KZCA 4G1MA 3MV7A 4M4RB 4ODSH 3UC0H 5EOTA 1AOHA 4XN9A 3ARXA 3V4VB 5KSAA 1HC1A 1Q0XL 1L4IA 4FF9A 5KYYB 1SLXA 5K39B 3WY3A 1AG0A 1BP3B 2W0KA 1C8PA 3K7UA 1D7FA 2QELA 1HOEA 1CF1A 5FKPB 3DX4A 3IJHB 1G7QA 3KEDA 2DQ6A 3DXAD 5CUSH 1OGAD 2YJQA 3T0EC 2A83B 3TN0B 4XGZB 1X5YA 3GQFA 2VSMB 4GSXA 3CZGA 1MI5D 3MLXL 5IMOA 3DJTA 4Z3JA 4NHUB 1MCPL 5FYKD 5J06A 2QGEA 2WTPA 4OLVH 2VXQA 4QYAA 3CXHK 5BJTB 1ETJA 1FZOA 4PVNA 3MACL 5I5IA 2AEOA 1GGIH 2NX5D 3REWA 1L6PA 3RX5A 1JHLH 2R1WA 2Z8SA 3C6SB 3NSJA 5GGTA 3AGWA 4PJDE 2B9BA 5AD0B 4QJ3B 4Q6YA 3VACA 5KYUA 1LP9E 2G5BB 1DDHB 5E1AA 1UWEL 4H1LH 1WTLA 1QVOA 1JTPA 2ED7A 4E9RA 2VDQH 4KO9A 2XZAH 1NIBA 2B39A 2VN3A 4NHCL 2Y1VA 2AXFA 5CZKA 2D7TL 2QGBA 1OP3K 4N2MA 3RURA 2JCCF 4UUJB 5HBBA 1D6VH 2O5YH 5C09D 4X6FA 5K1VA 4UTAH 2A9ML 4UANA 2X6AA 1QZNA 2EYTA 5JORA 1CBJA 3CSTA 1FZMA 2FT7A 3SE4C 4NKQB 1VPOL 2OTWB 1X9QA 1OSYA 1P4LB 1ZVHA 1I8KB 1JFQH 1TJGH 3KBEA 4CADA 3MJ8B 2WLIA 5FV2A 5ESVA 3TZVD 5TF1L 1MJUL 2AQNA 2PW1A 1JAEA 3QRGL 4XN7A 3U48A 4D3CH 1I1CA 4JFDB 5EIVA 1MCSA 4KVCL 2V33A 2P5WA 1AY1L 4EDXB 1ZS2A 4UDUA 3MRCB 3EYOA 5E08L 3QXAA 1ZY9A 3TBYA 5E2JA 3PJSA 3NP3A 1NCWL 1B0IA 3QORD 1MAJA 4NKDB 4NENB 5ICZA 2XTSA 4PJ8A 4HA1A 3SDAC 3WYRA 1IGCH 3B2UC 1YN6B 3CBKB 4K5OA 3U30B 2C7UB 5HDQH 1D5BB 1G0XA 1TVBA 3U9PH 3Q6FB 5AYUL 4N28A 3ISRA 3KJ6H 1NCCH 3I6LD 1LK3H 5AQ0A 4M8QB 1PFOA 3B6SA 3CC5B 4R97B 3IGUA 3A4FA 4G1EB 2BSED 1DP0A 4MNQD 2YMOA 3LB6D 1BF2A 5D7IB 2HJKB 3HNTH 2NY2D 5C0BA 3QUZB 5B38G 3CFJA 3FTUA 3RRQA 4DPCX 3FN3A 1AXSA 3FQRB 3MBEA 4G7SB 1KPVA 1RAMA 4LAJH 1ASOA 1VGKA 2DI7A 2R2EB 4J12A 3WKPA 2VE6A 4M7JH 3TOPA 2NNFA 2NRDA 4YPGB 2AJXL 2H32B 1GPOL 1CO1A 4H0GA 3T77B 3ZE1E 1KXQA 2PXYB 1TQWA 3QXWA 4MXWL 5DXWA 4N20A 2FRGP 1W0YT 2AAVA 2BX5A 4OBSA 1QSFB 4Y9CA 4U1HB 1UZ8A 1JMZA 3QT2A 3T8XB 3WFCL 1JGDB 1GGUA 3MDJA 1KY7A 1TTBA 2WUCL 1JNNH 2ITDA 1GXEA 4LE8A 4AMXA 1WHOA 3KYKH 2ZXBA 4WWOA 3C6LA 3VFVA 2H6UA 3QHFH 4JQVC 2JH2A 4YGVA 1HL8A 4YHPA 1A64A 3TT1L 3QDMD 4ICWA 5IIEB 5E4EB 5T5FA 3VXMB 4AGLA 4I3GA 1K72A 2QFRA 3NIDF 5D1QC 4N2DA 5EO9B 1XD1A 2IH9A 2VXQH 3GBEA 2XFXA 4MQSB 5C07A 5T1LB 4MD4A 4CU8A 1FYTE 1RZIA 3QZMA 4GFXA 1XR8B 3VU2A 5E23A 2GT9A 1GCYA 1T04B 1X5KA 3LS4L 4BZ1L 4OD3L 4J1UA 5GGTH 3B43A 4M61A 4MMXC 5E7FA 1RZKC 1NCHA 3GGWB 3QA3B 3DGGB 4X6CF 3UAJA 4EVNA 4KK8C 4LEXL 5EH1A 4YBLC 4N24A 1JZIA 5ICYA 1JPGB 1WA2X 1GYWA 3NCBB 2NSXA 3TBWB 3QXTA 3IPEA 3TFBA 2Y23A 3MLXH 1E6JL 4AZ8B 4JFQB 4YSSA 4HWBA 2LABA 2VDRB 3BW9A 4P2RB 2KI6A 3S8WA 1FNLA 4PJBE 4MVBD 3RBGA 3FHQA 5DQJB 5IB5A 1BPVA 3MACH 4P06A 4RAVB 2QSCH 2QQLH 2FUQA 3UACA 4YC2C 2ZUVA 1JV2B 3HZ3A 4NO0D 3KWVA 3CN2A 4OTXL 3K2MC 2K4WA 3ZL4L 5I71C 1F4AA 5I75C 1ETZA 3Q2WA 3ERXA 1JXKA 5DLML 1KCWA 4O51B 4NHCH 2NXYC 1N0XH 2CHWA 5F97E 2VLRE 3FRPB 3OQRA 4FFVC 3LAFA 5GSRA 3EYSL 3OKMB 3TGXA 1DVQA 2X1PA 1VB9A 3E7JA 3EIFA 1T1XA 4LIQH 4GW4A 3U6XA 2HRPH 3L5WA 3NFNB 3GLAA 1WBZB 4RMBA 5B1AB 1M42A 1DUZA 1MHCB 1JF5A 2FD6L 3ASOB 4PJIE 3VRLF 3MV7D 3RIAF 1NBQA 2IMNA 3VB9A 2EE6A 2QKIC 1MHHB 1JWSA 2O5NA 4RWYH 5KSAD 3U0WH 4KVCH 5TQ0H 5HVWA 4J4PD 4NP4L 1ZGLM 5E08H 3F01A 4MAUH 3F83A 5LG6A 4OGQC 2TRYA 4NCDA 1SHXA 4KV5E 4FN0A 4PJAF 1OQOA 3PQYD 3QCTL 3W2DH 2I7OA 5B3NA 3GDCA 3MROA 4ENZA 4GBXC 2K6YA 4KHTH 2DQIL 2WYHA 2IOIA 2GUOB 3KYMA 3OHMB 3IRPX 3OKLA 2WIMA 3U0TA 5FX3A 3HI1A 5BQDA 4AQ1B 3T6ZA 4PB9L 4PJHB 3BHBA 3KPQB 4X5PA 1O6TA 1QSEE 3K2IA 4QRQB 4K71C 1XF3A 2UXGA 1M6UA 1OTSD 1U8LB 3WS3B 4QRRA 3S88H 3FUNA 3UYRH 3TBBA 3NTCH 3DV6A 1L6ZA 1MREL 5DQDH 4KI5F 1E2ZA 1F2XK 4RWHA 2WXPA 2QVMA 1UXWA 3PV6A 1AGCB 2WKOF 1WFTA 5D93B 1KWKA 1UA6L 2GI0A 5J1AB 1AZVA 1RULL 2AXHA 1OCCB 2CJSA 5AOZA 3UH8A 1GPOH 2ENSA 3D05A 2BVQB 1FIGL 1JF1B 3L3DB 1SJEA 2CRZA 4KO6A 4NN7B 4B7IA 5IT2H 4NQQA 3L8QA 4HAKA 5L7XH 3NABL 4AOFA 2DQJL 1O0VA 1CXFA 2MWCA 3WS6A 5B4MD 5GS0L 1OSZA 3ZTEA 3WFCH 4HETA 1VFBB 5F1NA 5D2LB 2NXZB 1YO4A 3FKUS 3DWTA 4NZRH 1R9FA 4KJYA 3QFGA 2MRYA 1YYML 4GW5A 1U8IA 3X12A 1OKEA 3DUUA 4RVBA 4LCYA 4NKOA 4WTXA 3KPSD 3WEXA 1BM7A 2ZP8A 2ADFL 3H7BA 3HE7B 1IQWL 3OXSA 3D12B 1JDDA 1SXSA 4HXAL 3DUSA 3CQPA 3W39B 4WI9A 1VCAA 2FB4H 3MGOB 4ZXBD 5TF0A 2O93L 4FA8A 1Q9WA 3T6XA 3LQAC 5LCVA 5AEAA 3G6JA 3ULUE 1MJ7H 5C7XL 5FO8B 4R4FL 4HWBH 1EZVY 3BZ4B 4PJEE 1MRCL 4YSQA 3AM8C 4UM9A 1DN0B 2X2JA 3BDYH 2NY0D 4IBQA 4OUUB 3X1BA 2C3GA 4PJ8D 2J2ZB 3FTYA 3B9EA 3DNKA 4OD3H 5CEYA 2J4WL 4JNXA 5DJAA 2CBQA 1LEGB 3WIAA 4KRLB 1OTTC 4MDIB 2CK2A 1MFVA 4KRMB 3IRCA 3OGCB 4G70B 2AQRA 2CHNA 2AZUA 4KDVA 4TULL 4ZS6D 5H37G 2CO3A 4ZMPA 1KTDB 3GJFK 1WAAE 3IJYB 4JPWL 2R15A 4H44C 1QPPA 3LKQA 4XVOA 3QUKA 1YDPB 2VXUH 3KHQA 5DD1L 3TL5A 4L4TD 4XI5C 2P46B 4MAYB 1FL6A 2HUHA 2C1PB 2W95A 3QJUB 3D08A 4LL1A 3P4OB 5AVSB 4ZS7H 5T1MB 2NY7L 1NGXA 4GXVH 3ZL4H 3HBPA 2OL3L 3ROOA 3BPLB 4BUGA 4EMZA 4JDZB 1KOAA 1NUDA 3KYOB 1CE6A 3F6LA 3GNMH 3B7TA 4V2CB 3U4AA 1IUZA 4TNEA 4QOKD 5IBUG 4U2ZA 4WUKH 1T7WA 3U2JA 2O61A 2Y24A 2P8LA 3V4LA 3BP6A 1EH9A 4EBQH 2DI9A 4UM8B 4YAQB 3GJEA 2B7DT 1ANUA 1DLFL 3B7RL 3N5AA 4KH2A 1BZ7B 3TFKC 5C6WH 4LDLB 3TF4A 3NCJH 1NZRA 2A6DA 1LK2A 3O0RH 5AKTA 4MNGB 1XZWA 1XBDA 3T0WA 1RERA 2OI9B 4LSUL 2OL3A 3DLQR 5FYJL 2APBA 5GSVA 2XJLA 2OMWA 3SBPA 1PKQB 1GOFA 2MHAB 3RI5K 3FQUB 5C07D 1EHAA 1YLBB 2W9EH 1BJMA 1JI1A 3C8KA 3KPOB 1XIWC 1F02I 2BW4A 3VWJB 1P4BH 2JK5B 2HT4C 3FB6A 3OMIB 5T3ZH 1ZRUA 4UOZA 5TH2A 3DROB 1MF2L 2WGNB 4LOEA 5D4HA 2DQIH 1XTLA 1YQVL 5D1XE 3UAJD 2LTQC 3MA7A 5L2JA 3OKEB 1MLBB 2NY1D 4OSUL 4DOHB 4YN3A 3VFPB 1G0YR 2YBRB 5D7LE 3ZHFA 2FHCA 2K6WA 4ONFL 2AJYL 3ISWA 1MCQA 1T5WB 3BE1H 3HN8A 1LL1A 4PB9H 2CDGB 2R69A 2VM4A 2X1WL 4F7PB 4P46A 4R5VA 2XN2A 4G7QB 2L3BA 3MOAL 1JG9A 4PSPA 5EOCH 4YO0A 3HW7A 3WKNA 3KLHC 4JBSA 2FK9A 4W68A 3SGDH 3VGDA 1TTCA 3Q6GL 4F57H 2HTLD 4M5SA 4G2AA 4AMKL 2GSIA 3VXUB 2YPVL 1IMHC 4IIQB 3M7OA 4EDWL 3T4AC 1NFDA 5BPPA 2J8UA 3FTXA 4OT1H 2X28A 1CICA 3S96A 5FC9A 4DUWA 3NBNA 3ZKMD 4HU8A 5KN5A 3STLB 3P2BA 1KC5H 4FQHA 3KLKA 2YXFA 3ZQXA 1DO5A 2ICEC 3P30L 3TWYA 4XC1L 4FL4B 1ASQA 5LCVH 4HGKC 5ABDE 2FQFA 4OLUL 3MX0B 1UWYA 2HTKD 4ODTH 4S11A 4AQZA 1NEZA 2FCBA 3RVWC 2A6KA 4I0PC 2IPUG 4ELMA 3KHOA 2MCG1 2AKRB 1RJYB 4XMVA 4U1IA 4URKA 1BF5A 3D85B 4BKSC 4FG6D 2DQEH 1H15B 3AUWB 4RIRB 4C56E 1AGEB 1NA8A 2AANA 4BK5C 1MY7A 2A6JB 3PHOB 3VM5A 4HS8H 2BY1A 1A9BA 1IQWH 4DTGL 4G42A 1O6SB 4L9LC 4WFEE 2JXMA 3FUKA 1SOXA 3MRQA 3G7TA 4IGBC 5K69A 1KCRL 4Z77B 4NCC2 3KPRB 4XPHH 3MXVL 3NT0A 4Y4FD 1J05B 3H42H 2XNAA 1UOWA 1L7IH 3IN0A 4NC1E 1TCRB 1XDTT 1OAQL 4HMDA 3GSWB 2I26N 3OG6B 5BS0E 3VXPA 4X6DB 1CDYA 5E5MA 5HDRA 2HKHH 2NY6D 5AYTA 2NY3D 3L1OH 3LKRA 4TQEL 3FOMA 2N59A 2J4WH 3GPEA 1OGSA 3ZO9A 3VMPA 3QRLA 1N64L 3ARGC 3PWPE 1R75A 4I88A 4K5MA 3U46A 5DU7A 1UYWL 4PRBA 3AFLA 2F0CA 1U95A 3ZL1A 3S37X 1NUNB 1ZMYA 2CLZB 4OF0A 5KANG 2E7LC 1CIUA 4PJ9A 5KVFE 1P84J 3VI3F 2DTML 4GRLC 2GJJA 2GJZA 4QNPF 3T08A 4TULH 2GTWA 4UINH 4XMLH 4AYDC 4FXGC 2A9NH 3OL2A 3NSFA 4LPWA 3SKNB 4DKEL 3NGBC 4NJAH 3BZFB 1MPAH 4TUJA 1S9VB 4WSGA 4URTB 4X8XA 5JW4M 2X4RA 2RMNA 1ZVSA 4I3RL 5KUMA 4WKXA 1W15A 3KPNB 4HHAA 4ZYKA 3RX8A 4HIEA 3MREB 3QG6B 1E8WA 3LXAA 1U93B 5FHAH 3RWGB 4U6YB 3UJJL 2BVUA 3GSRA 4PV1C 2NY7H 2Q6WA 5AB2A 3WHE1 2P80A 2OL3H 3W81A 5CCJA 5CJQL 1QZ1A 3QS3A 2AQPA 1T89A 1HIML 5TE7L 1VDGA 4IOFC 4IBUA 5ITFA 3MV9D 3PFUA 1ZOXA 2Q7AA 3TWCL 2XWTA 4AUUA 4KROC 3ULVH 2YRBA 3S3JA 4F7TB 4QHLA 3T9WA 3FFCD 1A4JB 3RWJB 1NC2A 2FHBA 4L1SA 4IBTA 3FQNA 1DLFH 3BUBA 3ULUL 4M6AA 3L3OB 1HKLH 4U3SB 4LFHD 1BEYL 5KTEL 4HIQA 5AKVA 5H2BB 2H47C 4WNQB 1Z9SB 3ZRCC 4LSUH 4JHZA 5TPWH 2R69H 3VFUB 5JLZA 3MV8B 4OKVA 2NT0A 3HPLB 5HHOD 1A1NA 3QNZB 1JTOA 3O2VL 5DK3A 4ZUSA 1A65A 5DMJB 5GS0D 4DWHA 2DQDH 3NJKA 4XXWC 3HRZA 5BRZE 3GJFA 4RCAA 4PJFF 1KJ3H 2CKBL 4WWKD 4AKQA 4Q7DA 3VCLB 3V9CA 2HN7A 4JY6B 4Z3GA 4NRXA 3ZUNC 2HVKA 3SCMA 3F12B 3D06A 1KN4H 3IFLH 4E9TA 1G94A 1E5YA 3ATDA 3BSHA 3F00A 5HTSA 1N9PA 2XACC 4JE0A 4KUCF 2XCMC 4YFLI 3REVB 5DO8A 1BMWA 1JYWA 3MRMB 3Q48A 3RKPA 3VWKC 3RIAK 4XPAL 1RI8A 1SDDB 2G5UA 1HAWA 3FUFA 2J8HA 5E51A 1K5NA 3QUXB 3EDJA 3TO4C 3FSAA 3K5RA 4UI2A 3DRQA 1DVXA 5F7DA 2CU9A 3ZHDA 4XRCA 1OM3L 2GY5A 3OAUH 2FECL 4D9LL 3V8OA 1IAIH 1IL1A 1ZTXH 2H0FA 1T83A 4GMTH 2E76C 3TNNA 2BHYA 2KS0A 1NBVL 1BOGA 3AQDA 4WI6A 2GCYB 5A43C 1MWAL 2NTFB 3BEVB 3DX0A 1OARH 2AJZA 1WK0A 3ILPA 1PY0A 4R96B 3VSUA 2NOYA 1K3ZA 3QZLA 4KXCA 4AGPA 4JG5A 2NYYC 2MPVA 3UTPE 4NKIL 5I8KL 4C54A 4A2FA 1FWXA 2WXQA 2Z34A 2WZPA 1QMUA 1V7NH 3FQWA 4FDWA 2X6VA 3L3KA 1BA9A 2HT2C 1A3QA 4N8PA 5I1AB 2RTTA 2VDOL 5DJZB 2P43B 1IZJA 3QDGB 1TSRA 4NT6A 1YC7A 3GUTA 2XA8L 4LASL 3TO2B 3RAJH 2G5RA 5JYLA 1UWGL 5FM5O 1BF8A 2JV6A 2DJMA 5TK2A 1MQKL 3QR0A 4XTRD 1FNEB 1I7UA 5HJ3A 2WC7A 1XEUA 3MUJA 3QXVA 4JFEE 4XCEB 1AQKL 1UCBL 1OAQH 2VLJB 4PWEA 5HHNA 4PB0H 4QEGA 5DCCA 2HVJB 5JHDD 1EHXA 2J1YA 4PJCB 2VAJA 1G1OA 4J6IA 4TQEH 1A6VL 4R5TA 3ATEA 2WLLB 5DWPA 2GFBB 3FBQA 3W38A 1S78D 4G8FA 4BQ6A 4JHVA 3CFBA 2X87A 4Q2ZB 1D9KD 3RFZC 1PCXA 5F70A 5FYJD 4JRWA 1S5HB 1YRKA 3TH3T 3VGAC 4PTUA 2MPAL 3VXSA 2FO4A 1NCIA 2AJSL 3L1EA 3VMNA 5D1XC 2XWBB 1BCIA 2DTMH 3EJJX 4U3HA 3JTTA 3ZLQC 1E3ZA 3NA4A 3AMLA 4DKEH 4QMEA 5MP6H 4MJ5B 4LLUB 1LO5B 3BEWB 6CGTA 2X05A 5BV7B 1SMAA 1CICD 1IBZA 1LO0H 4QKTA 1WFMA 3ZZQA 2R7EB 3O6FD 5SWSA 2QZQA 4ERSL 3KYNB 1AOZA 1INQB 1G9NC 1SBSH 1YYCA 1GSKA 3QI9A 3GI9L 3V0HA 4EKXA 1MG3C 3ROLA 2XBZA 4GUCA 3U2SA 1T7YA 3EBAA 2ZWZA 2ZUTA 5TE7H 3QPQC 3PWUA 3C5ZD 3CH8A 5BQ7A 4HDIB 2NY4B 4XCFH 1FJ1A 2MQ0A 3ZE2B 3NA9H 2P5EA 3GJFH 5K9KB 1MHPH 5DMGD 3TWCH 5JZ7D 3F5WA 4MQXD 2PO6D 3HJEA 4LLYA 5FA3A 4OFYA 1XMWA 4MJHA 4Z7UA 4GS7B 1VIWA 4HAGA 4MYPA 5AOMA 1MAML 5C9KA 1KF9B 4LSVH 4Y7MA 2AEQL 3VW3H 4G9FD 1LNUA 3QIBA 2I9TB 1OOAA 1G6RB 4JS7A 2E6QA 1A9EA 2PR9A 1U8CB 4HC1A 3SEPA 3SD5A 1R3LA 4S2SA 1CVRA 3SY0B 4AMWA 1PD6A 5DYOB 5J12B 1XT5A 3QIWD 3H9ZA 2QBWA 3CLEL 1UT9A 3D51A 4GLRI 3X17A 5C8JB 4WW2F 3K5SA 4ZO6A 4NYLA 3SDXA 5AVXB 1GYVA 4WWPA 4G59C 1C12B 4IRSD 3ZZSA 1KGCD 4PRPE 4YDNA 4NC1C 2GB2A 1MCRA 4YEEA 1F86A 1MQ8A 3RL1A 4A7VA 3D0LA 4AGMA 1G7PB 1VENA 2PYFB 3EYFA 5I1HH 2VZ1A 1TZIA 1XGRB 4NQED 3VG0L 5GRVK 4WU7A 1X3DA 4X8JA 4YDMA 4FQQB 4OLZH 3FB8B 3FUEA 1E5BA 3CVIL 1EUUA 2O30A 2AMUA 3QEQB 3KDMB 3P0GB 3HB3D 3U7WH 4LVHB 1JPSH 1R3HB 2JB6B 3MGAA 1YEGL 1D7CA 2LW3A 1A5FL 2AK1L 3BIKA 5E94B 4WK2B 1JPFB 1UM6H 1P6FA 1N10A 4X8CA 3JVGA 4L3EE 5C70A 1U8PA 1D2OA 5JOFB 1NBVH 5HI5C 3TC9A 5J9PA 4GUQA 1PBYA 5ERWA 1E4XI 3QZWB 3KPLB 4ODXB 4AIXA 3CUPA 2NYZA 3QAZB 3AUVA 3BXNB 3UO1L 3GMRA 2YEZB 4P23D 1RUPH 4BQ8A 2OSLB 1U3NA 1CYGA 3AAZB 2ID5A 3LTVA 3PWNA 3V6FA 2WUBL 2EEAA 5KVGE 4NUMA 4R7NA 4ZUVB 3OMZA 3DOSB 5D5MB 2W0LA 4KVPA 4WUUA 4HQQL 2XA8H 4LASH 2VDMB 4OCLC 5GRXG 1F13A 2VZTA 2EIEA 2R4SH 4Y4KA 1FNSH 2YPLD 3RY6C 4U1LA 2OJEB 4YHNA 1MQKH 3ZSSA 4F7MA 1FZJA 3QBTB 4WI0A 1RZJL 3MRDB 3QO1B 2Z6FA 3FCSA 1I9RH 1UCBH 5FOBA 3UTQB 3G5XB 4Y1SA 2EILB 4ALAC 5A2BA 5KG9B 4DQAA 1PVHA 5D55A 1JGVL 1A6VH 1QASA 3P3RA 3LPFA 2ZOWA 4WO4A 3X1GA 4LSDA 2G0LA 4PIRF 4N85A 1T4KB 3B7UX 2RQEA 4UB0L 2IQ9L 1DVSA 4PREA 4UIMA 4XOAA 1JWMB 1OW0A 2W65B 3LJ3A 4C47A 2GC7C 4M4RA 2I60L 2X1OA 3RQ3A 1E9QA 1KBPA 5ALCH 4HPOL 1TVHB 2JJTC 4GIOA 3V4VA 4ZMOA 4LOFA 5KYYA 4A7GA 4LVNC 5K39A 1AHKA 1HHKB 2OYPA 4Z3TA 1LE5A 1PG7W 4LSQH 3ZGIA 4D0CB 4BFEA 1HYSD 1VACA 4B9IA 1ZLDA 3CBJB 2CNYA 2QKSA 2Z7YA 2F53A 1AO7E 3IJHA 3B8SA 2XDHA 4K9EL 2PWEA 4BH8B 4ERSH 2QQNH 1KYUA 2Z31C 4JAMA 4WCYL 5A3ID 2A83A 3GI9H 4U6XB 4YX2L 5AAMC 4Q4IA 4HD9A 4MHHG 5T1KB 3V6ZB 1NFKA 1ZCRA 1Q1PA 4HC1H 3C12A 3E8VA 1E9PB 4F9LA 1MWOA 2VYRE 4G7YL 7PAZA 1E90A 3IGAB 2Y7LA 2YK1L 5F9JB 4GG8A 3WSQL 2E7BA 5BJTA 3C60A 3AT9A 3F7VB 1E30A 2DQTL 3SQBB 2LU3A 1HXMB 1V8HA 2E9WA 2WQXA 3LCYA 4QXGL 4RNRB 1J9CT 3BPCB 1JWUB 5K9QI 3ZR5A 4M6NL 1RK7A 5AL0A 2NW2B 1MAMH 5LXGH 2V9RA 3HNSH 5JPMC 4YSCA 2G5BA 4S1SH 4NSKB 2FL5B 1AQHA 2ATPB 1XF5B 2PCYA 1SVCP 2B4CH 1PU0A 5SV3A 4FI7A 3EJYC 3Q06A 3IF1B 4HPYH 3MRPA 5IB4B 3KJ4B 2K9UA 4I3SH 1EGJL 4NPYB 4UUJA 3VNYA 4M6OH 2C5DC 2ZAIA 1F3JB 3BPOB 3MJWA 2K6ZA 2OTWA 3GIZH 2QADD 4BGDA 1P4LA 2HJFA 3D6GA 1S7UA 2MNJB 1FIEA 3VNZA 5HGAA 4FKKA 3MJ8A 3W9DB 5JW4Q 3TZVC 1J5IA 4LIQE 1HCYA 3IAQA 4K2UL 3OVUB 3DKHA 4TSCL 3MNVB 2V3FA 4GUOA 3NQKA 1GY1A 2CUMA 3ARFA 2H6PA 3BO8A 4JFDA 4P4KD 4Y89A 1Q9LB 2Y0SA 5HY9A 2XX0A 4PJCF 4JKLA 1I1FA 3KBPA 2K8MA 4RSVA 3F64A 4NENA 4V1DD 3VD1A 2X40A 4HLZG 1SZNA 1YN6A 4ZMWA 3LNIA 1A5FH 3UIYA 3BKJH 1H3PL 1D5BA 3PWJB 3QI9D 2MOQA 1D5IH 3H9SD 1MCEA 3QXDA 4BJLA 5ES4B 1N8ZB 4ZFOL 4PS7A 5C0BE 4JPVH 4JFPB 2GAZB 5DYFA 3CC5A 5BOJA 1HS6A 4DGYH 2X88A 4G1EA 2GYSA 2P5ED 3B2MA 3CFQA 1IVLA 3A5VA 3CN0A 4NQTA 1FFNA 1QQDA 2BRRL 3SN6N 1FCCA 3ZYZA 3OKKB 4K73A 3DHPA 4OFYD 5IVXB 4HS6B 5D7IA 2HJKA 3W5NA 1KXQE 1RP8A 1DVFA 3QUZA 4QLWA 4AUJA 3ZJAA 4CL7A 2J5LC 4PWIA 4PLJC 4TRPL 5I24A 2R2EA 2APXA 4TOYH 1JGUL 4YPGA 4ZFOA 3I6GA 1B9ZA 1CTNA 2DD8L 3T77A 4TNFA 3K6FA 4OGYL 3T0XA 5HI4D 1CFMA 1QSFA 3V4VH 4U1HA 4E9VA 3DPBB 4GSUA 3T8XA 4QHMB 1JGDA 5C08E 2ZCLL 5GGRB 3JWNG 2YAOA 3RA7H 3O0LA 4ZAKB 4GRWE 4V11A 1T20A 3EYUL 3W9EA 1ADQL 3QEHA 1ZEAH 2VLKD 1YEIL 3BLPX 5BW7A 4R7DB 4N8VB 3KWWB 5ELIA 1I85A 5EBWB 2B2XL 4IJ3C 1J0HA 2NY5L 3FUHA 4KKLD 2V3EA 4QRPB 4UB0H 5C1MB 4KDTA 5D1QB 4MJIB 2D0HA 4DO4A 2BZDA 1WH0A 3TVMA 1A3ZA 5IV2B 3MNWB 5JUEH 2QQKL 2G60H 1YEFH 2IAMD 4MA8H 1KGJA 1YN7A 4LDCA 5JQIB 1G9EA 1H6FA 3HI5L 3HRPA 2APTA 1TLKA 5DHYB 4DP1X 5T1LA 2EDJA 4OCNC 5A6LA 2FYVA 1XR8A 5CEZL 1T04A 4RGND 3K2UL 1R3IL 4UT9L 3HLKA 4HK3N 2XTJB 2J71A 2ZKMX 2VL5B 3QA3A 1EUTA 1JN6B 4WCYH 3T5WA 3FL7A 3NCXA 1R5VB 3K0YA 5E6ID 3FT3A 4YX2H 5AVYB 1JPGA 5MERB 4RFNC 3TBWA 1AR1D 2K1MA 6TAAA 5JW4N 5CJXC 1JDCA 2EDMA 1Z5LA 4R5XA 4HJSA 2XWDA 4OZHA 4B7LA 4FOMA 2W8CA 4BK8A 2HA1A 4AZ8A 1CGSL 4JFQA 2P52A 4G7YH 5KVGL 3F7QA 4DK6A 3FNKA 4APXB 4L8DB 4Z7QB 4OLXH 3W82A 4TF4A 3T71A 3GXMA 4BD4A 3WSQH 3PGFH 2YD0A 4KQ3L 5DQJA 4NM8H 4RAVA 2UX6A 5GGUA 3DK0A 1IBGH 4QHUB 4XP4H 5I71B 3H6AA 4WUUD 4QTFA 4XO5A 1JV2A 3MLSH 3MLRL 1KJVB 1U91A 1J8HB 1EZVX 2NXYB 3GXNA 1B88A 1DJYA 1AG6A 1ZLWH 3GIVB 4FE9A 4M8VA 2I9LB 1BBDH 5E5RB 5KYWA 1KUMA 4PVMA 4ANVA 2MNWA 4JVPA 2FE0A 2PYEA 1RLBA 1CLZH 3FRPA 3MMEB 5E8PB 1IEHA 4F8LA 3ULSA 2VSCA 2PCPB 2Q3ZA 2ATAA 3CZKA 1XB8A 2ESVB 1IC4L 5I30L 4NRYA 3HMXA 5F71A 5D5MF 5EUOE 3NFNA 2AJ3A 3R06B 2H1LM 1WBZA 1AI1L 3MR9B 1I8IA 5FM8A 3IAPA 4GIPD 4Y9BA 1HCVA 4L4VD 2PWDA 4EIZC 3MNMA 5F2FA 1N5AB 3WLBB 5F1IB 4CN6A 1AD9B 5HHXL 3H9HB 8FABB 4H4NA 4Z7WF 4N68A 1WTGT 3UJTL 4J3BA 4LDEB 1JNHB 5EORL 2MTAA 4FG4A 1TFPA 4OLWH 1UACH 1I1AD 4XB8A 5E00A 4QRSA 5T8IA 3UBXG 4QRRE 1LDPL 1CXLA 3N04A 4F27A 1HWHB 1FG2B 3N40P 3NZHH 1MY5A 2XSKA 5EOQL 1YVLA 2E27H 2YA0A 4AQ1A 4E41D 5T3ZE 4LCWD 4PJHA 3QJHB 1A7QH 3KPQA 5L0QB 3HZKB 3EUDA 4PJ5E 4CJ0A 1TQSA 3R19A 4P5TD 4E36A 4P07A 1RZPA 1T80A 2NZ9D 5CZVL 2KKQA 2R0LL 3C60D 5HYSA 2AXWA 3MRJB 1W8NA 1UH3A 4FLOA 1KYDA 3D52A 5SV4A 1TZGH 5C0JB 2B15A 4Q6IB 5LGHH 3DMMA 4MB1A 1AGCA 3ARUA 4AYEC 4YR6B 4ZJ9A 2HB0A 5J1AA 3DHJA 1F4YL 4OH2A 4PUBH 2BVQA 5EWIH 2DD8H 1JF1A 3OC5A 1JS4A 4FEIA 4K15A 5I1IL 4XP6H 4JJHA 4BINA 1CDBA 4HKXB 3NIFE 3F84A 4W9JC 2DQCH 2W0FA 3BVXA 4R7VA 1FSKB 1VFBA 1NWPA 3O9WB 5D2LA 1YC8A 3ATAA 4ONHA 1O7VA 5C0ND 1EEQA 2H7WA 3EYUH 4B60A 3PHQB 3WEOA 3G6JE 4N5UA 4I0KA 4ABVA 3SJVB 1WISA 3QWRA 5E1HB 4DZ8B 3VM7A 3HE7A 2B2XH 4IEFB 4CDGC 4NRZB 5I8EA 1CFSB 1P69B 5BRQA 3MGOA 5I76A 1U8QB 1DQTA 3ARFD 2BK8A 1DJWA 4K3JL 1GJUA 1LWRA 2QQKH 1RUQL 2R39A 5FO8A 2VDRH 2Y5TB 3BZ4A 4QRFA 2GW5A 4TUOB 1DN0A 1OQXA 4OUUA 2C34A 4P48A 1OAKH 3IGLA 2CK0H 3K6IA 3HC0A 1YG9A 2VDKL 3MLVL 4C4UA 1L6XA 5CEZH 2JI2A 2XKSA 3K2UH 3QQDB 3V5KB 2W59A 1TZAA 4MDIA 4G3YL 3JT2A 4FQXD 1ZT4A 1OM9A 2HZHA 3OGCA 3I74A 2OR9L 4JM4L 2YGPA 5IKCB 2QR0B 5JNYB 3DBXA 5CU5A 3QE5A 5GZND 2VO5A 1GZHA 1NM4A 5L2KA 4JFVA 1KCVL 1UASA 3D18B 2IWGA 3ZDZB 4DO6A 5CSZA 1KTDA 2HKFL 2LFGA 3IJYA 4AVJA 5L9DL 3S0PA 3KLLA 1YDPA 3LH8A 3HMXH 3MBEC 4NC0B 4HXBL 1RIUH 1AHMA 3A67H 3LV3B 2E59A 3CXHJ 1ONQB 3JTSA 3G5YB 3MLRH 3P4OA 1RSYA 3P0VH 4BSJA 2DDQH 5EUKA 2CO6B 3FZUD 1YNKH 4XMPL 5T3XE 3L5JA 2BP5M 3DVNB 4JDZA 4PCSA 4YJZL 2ATKB 2OMTA 4Z3HA 3ZE1B 3KMDA 3HPJA 3MKKA 4HFUH 4J8RA 3WY2A 4DVRH 3SO3B 2BP8A 3C5JA 4L05A 2ZOTA 1CN4A 4PGDA 5EN2B 3C6LC 4NBXB 1WGVA 1HL5A 5LLIC 32C2B 4NWUH 2NLJA 1A21A 1BZ7A 4FYQA 3VFTA 4DP8X 4WY7L 2FJUB 2IGLA 3ULVE 1URIA 2BDNH 1NCAH 5ESAB 3TVMD 1J1PL 4PI2A 1VZIA 4KJPC 2AV7B 4TLUA 3QDJA 3FF7A 4FQJH 1T2JA 2ZKXA 5HHXH 3EOAB 2G9HA 2CO4A 1QBAA 4FXKA 1RFDL 4HVBA 4KC3B 1FNAA 2BNQE 5EORH 4D8PB 3UO8B 4DN4L 3KPOA 1IVTA 4JN2B 4APQD 2JK5A 2LTQB 3Q7JA 2GY7B 2JKTM 5EOCJ 2UY6A 3C09B 1W72B 1WFUA 1LD9B 4JM2C 2H1PL 4ZTOH 3SE3C 2P5PA 3T3PF 1GH7A 2V5YA 1A02N 4KMLB 2WVVB 2NY1C 3GSVB 4KKCC 2YBRA 5TE6L 1HYRC 5LKNA 1XGUB 1T5WA 3UJIH 1L7TH 2BSBA 2EIZB 3KWTA 4JO5A 3FO1B 1NFDE 1JK8A 4F7PA 2J8UE 2ITFA 4AM0Q 3NP4A 2W07B 4KFZC 1OT2A 4QTIL 5I26A 5T1DH 5CZVH 4RH4A 4JKNA 5I6XC 3T4AB 2HLAB 2GSGB 4JFUA 2HTLC 3U82B 4FQ2H 3VXUA 5CEZD 4N9GB 4XVUD 4HEME 5KSBF 1GTFA 5K93A 2R0WH 1YY8B 1USZA 5ID1B 1K6QL 1Q0YH 1UKQA 3CXDL 4ELME 4FP8L 3WV0A 2B0SL 1OP5H 3STLA 4H0HB 4RRPA 1RV6X 3QCUH 1FH5L 1A47A 2R9HD 4LRIA 4S1QH 4AYMC 4B97A 4Z7QF 1RQ5A 1U21A 1BVKA 3QNYB 4O02B 2AKRA 1RJYA 3MLYL 2YEVB 5IROD 4XC3L 1WPCA 2ENJA 1CJYA 1MLCA 4Q9QH 2ED9A 4PGCA 3HC3H 3ZIYA 1H15A 2E5EA 4RIRA 3EZ8A 2J5WA 1GGBL 5LWYL 4C83A 4B9JA 3B7SA 3PPSA 1O6SA 3N41B 1KN2L 3LXBA 3V79C 4R0LB 4X7DC 5DO2C 4TVPH 1NTDA 4KMTH 2P1YA 1S9YB 1RUQH 3OX8A 4N2NA 1J05A 1INDL 4Z78A 1OEZW 1TCRA 4AY0A 5CSBA 5F7FA 5C92A 5GGSA 4F1ZA 5DTFB 4QHNB 3GSWA 2X10A 4X6DA 3IVKB 3HBGA 4NQXB 4FQIH 1BXUA 2NY6C 3E3QE 4YIQB 5HHMB 3NPSB 1TDQA 4KFMA 2Q8BH 2XIBA 4HIHA 4U6VH 1BX2B 1ZANH 3DGDA 3MOBL 4G3YH 4OZFB 2MQGA 2WAQA 4YHMH 4KGLA 4JEGB 2CLZA 4JM4H 3V0IA 4TNWK 1WZ1L 4FXGB 3GLEA 3VFMB 1PD0A 4KY1L 2WO3B 4TSBL 5D7SL 1TU2B 4KRPB 3WXWL 2BO0A 5FPIA 4WW1A 1YYLL 3AWGA 2FLMA 3SKNA 3O6KL 1YMMB 3OC8A 2VR7A 4WEEA 1S9VA 3UTOA 1C5BH 3DMMD 2PPFA 3GXUB 5JHBA 3F7YB 1KJ2B 3MREA 1MCLA 1NDMB 1IGMH 5HGHB 3RWGA 3E1F1 2O5ZL 1DQIA 2Q2EB 4KH9A 3QZPA 4XMPH 1XTMA 3WGUB 1QYGL 3SYPA 3WS6C 1VESA 3IJ9A 1YQ2A 3PY9A 1CYXA 2BH0A 3QJFB 4WENB 3J7HA 3AITA 3BPNB 4M7LT 3VI4B 1N18A 4AENA 2DQGL 4YVUA 2K78A 4M02A 2NUTA 3I9GL 5C0DA 3BWSA 3CCHB 5FECB 1ESOA 3QNXB 2GQHA 4PCKA 3QWRD 3RWJA 1M1XB 3X14A 3QFJE 5HJDA 2X0WA 4PJDF 4M1CD 3K6SB 1GTNA 2ZYIA 2AGJH 4H8UA 4U3SA 1NMBL 3ZUCA 1LP9F 2X6UA 4JFHE 5H2BA 5I0ZA 2P8PB 3CBRA 1Z9SA 1P7BA 3S2AA 2J57A 3A0OA 3VFUA 1K4DB 3MV8A 5C3IA 3HPLA 2C9RA 3QNZA 3JT0A 4N0FA 4DGIL 5HD8C 1RFDH 2DB8A 3F05A 3II3A 1C5DB 3HUJA 1KIQA 5JW3H 3Q05A 3O2WL 2V2WB 2H5UA 1CF8H 1JL8A 1H3VA 3S98A 1N3NB 2ZONA 3HTLX 4IRZL 4GI6A 4R8WL 1JXDA 3VCLA 5G2NA 5I5JA 1J9SA 4HIPA 4PJ7B 3GS0A 4QAWA 3BRFA 1J7VR 4BK4A 1OZTG 1KXVA 2EADA 4GKNA 2ZJSL 5DZOA 3VG9C 3VXOB 3F12A 5DEGA 5F7EL 3QYNA 2VLME 1NL0L 1EZUA 1YEJH 5TE6H 3TCTA 3IPBA 4MMZA 1NMCB 5SX4I 2WGXA 3REVA 5KSVA 4OJFH 3H56A 4B50A 3H1ZA 1S7VB 3MRMA 5IOPA 5L2KD 1HSBA 4HUWB 4BXVA 4QTIH 3L81A 5EBGA 1SDDA 1U4FA 2ZWSA 1U6AH 1QLFB 2MIZA 5AVTB 1HXYB 3LPPA 3QUXA 4PY8J 4IRZA 1BZDA 1SHWA 3JYBA 1KEGH 2F54A 1KIUB 3TS8A 2HCZX 1ET8A 1FDLH 1YECL 3H3PL 1MCIA 4RDBA 3AREB 3RDJA 1XXFC 3M45A 5MHSE 4OZ4B 5SWZE 1BYNA 1TETH 1XGQB 5CZXD 2JCCE 1FH5H 1Z7JA 1BZOA 5EIIB 5KW9L 2GCYA 5DZAA 2IO5A 5IHZB 1KZQA 1FCGA 4K7PL 4P2QA 1ZAGA 2DN7A 1S7TB 3P73B 4FD0A 1BREA 4A2GA 3UPCA 5DD3H 1ACZA 3B1UA 2Q3XA 4FFYL 3VVWA 3HC4H 3JV5A 3L6FA 1YNTA 2J88L 2H2SD 4EIBA 2F5BL 4Y1AA 5B8CA 2AVFA 2BERA 2B77A 5IZ7A 4ODBD 1MCHA 1WO2A 4XPBL 4NP9A 5DJZA 1UGNA 5IWLC 4KNQA 1MXDA 2Z4TA 3CHRA 4WI2A 2VSDA 3QDJD 4LF3B 2IOMA 3ZE1F 4EI5B 4HIIB 1JXFA 4K3HA 3E6FB 2QPUA 3SDCB 1WDAA 2ZXCA 2YKLL 3IJSA 2WLYA 3FO0L 1FNEA 3DURB 3K1DA 4JDTL 5GRYA 3ULVC 4TV3A 2Y07L 1EFXA 2VLJA 3WFBL 3VXSE 3Q13A 4OZIE 1TUPA 1RP9A 2CUIA 3L7EA 1RUKL 3RFZB 4YL4A 1QPXA 1WFNA 3MOBH 4E42A 1UH2A 1FN4A 1T22B 4PRNA 4Q2ZA 1CFQB 2GTQA 4MZ3A 1S5HA 4KTGA 3V4PL 5D7HA 4PJXA 3LNGA 4P46C 5SWSE 2VIRB 1QABA 2XWBA 5D7SH 4GO6B 1UM5H 1QI5A 4DFHA 2BSDA 1EEYB 1YYLH 1EJ6A 1LWHA 4HUUA 3FHEA 3CZSA 5AOLA 4L8SB 3O6KH 4DW2L 4MJ5A 3ARBA 3BEWA 3BD4A 3OXRA 3S5LA 4E9QA 5KJRH 3OD3A 2DLIA 1FFOA 4KPHL 4UIKL 3UFIA 3CFCH 1DO6A 1INQA 3SZ6A 1P1ZA 2BNRB 3AXIA 4N0CD 2DQHL 4GB9A 3BSZA 3VFSA 2IVFC 2G0KA 4XH2B 2D2OA 3V4PA 3KXFD 3KH3A 3MI6A 5INCB 2B1HH 4OJCA 4N2GA 2BP3A 4LPUA 4TKWA 1NGZB 1D3CA 4HDIA 4PYGA 3TA3A 2EYSB 1P0SE 2ADIB 1H0DB 4P4RB 3OPZL 1UD8A 5K9KA 5DHVB 3F85A 3I9GH 1OK8A 4MGXA 4MQXC 5IR1A 4I9WD 1CB4A 1TEGA 4EIGB 1T4WA 1OANA 4PGEB 3Q8AA 4XNUL 3GTNA 3WMSA 2XPYA 3KGSA 5IY5B 1ZGLB 4C56B 1E4HA 3CN4A 3NQIA 2YQGA 1NMBH 5JMOC 2AC0A 3IFOB 3SDXE 4J2QA 3DPDA 3RWFA 2I9TA 1RZ7H 2EO1A 2MQCA 2VR9A 3WNKA 2Z8RA 2LFEA 4B95C 4AM0B 5I17B 5I1DB 5DMKA 1Z9NA 1KEML 2YMXL 3FSVA 3FO2B 4HIJB 4X2UA 5DYOA 5FHBL 3O2WH 5HDBE 2CM6A 3W0WD 2R56L 4BFBD 1NUFA 3V95A 2CR0A 5C8JA 3EFFB 2XZQL 4IRZH 1CLVA 1C12A 3LHPL 4UQ2B 2G3MA 4G11A 1WV7T 1QLRB 4WHYG 1DLHB 1FO0L 3A4DA 5F7EH 3SE9L 1JZEA 5C2BH 4PJIF 1F6AA 1SN2A 3G5ZB 2HX9A 4PJ9C 4AZUA 2VXSL 3E3QC 4PLKD 2Z35B 1NLDL 3GEFA 1C5CH 2GHWB 4J3WA 1Q9OB 3RJDA 3MNZB 3JV4A 3D34A 2FLBT 1R3HA 4GKOA 3I2CH 4KV5F 3UBFA 2CG9X 1OAZL 3HJ0A 2B9AA 4XNQB 5C0AB 4QXWA 4QTHB 4UU9B 5C0GB 2FIKB 2Y5QA 1JPFA 3GSOA 4XCCL 2BRQA 4X6BB 4IOIB 5CJ8A 3W3BA 1FNGB 1QLEB 1C08B 2Y7QB 4KZDH 3QUYD 4LAQL 5JOFA 1V55B 3LHAA 2HT3C 5KW9H 1T89C 2V17H 1R5WB 3OF6A 4K7PH 4YXLL 4PCYA 2OPCA 3LEXA 4ODXA 4BHUA 4DPRA 1OAXL 4ZFQA 4N2CA 5T33L 4G7VL 3D2UD 2YEZA 5J13C 4JRYD 4KOCA 3NDZE 3IDMB 2J88H 1PY9A 1AH1A 3OAZH 3MLUL 1ZHBB 1E8ZA 2A4ZA 2DM3A 2XRAL 2ZTBA 3NACL 3P3SA 4MS8D 4X98B 4XPBH 1BDYA 4OB5H 2W9DH 4ZUVA 5JYMA 3A47A 3W1ZA 1E67A 1WZMA 4BRJA 5JQ6L 3ETBJ 3AC0A 4G82A 4JREC 5GS2D 1Q94B 1BJ1H 1IAKB 1VGEH 3IMTA 3QQNA 1OGPA 5I16B 3MU3A 1PZ2A 5I0YA 1WZLA 3VXRA 3HRZC 2OJEA 4PRIA 4Z7IA 3IJ7A 3IPFA 3G6DH 3QR2A 4Z7VB 1HEJC 2IANE 2Y07H 3DI3B 1UB6A 2Y36H 5ABAA 4H20L 3BSGA 4XP9H 4XBPA 3H8NA 5BV7H 5KG9A 1KLUB 3PAUA 3LKNB 3SCMC 3F04A 3IETA 1YPZB 2VR5A 2QL1A 1T4KA 4KAQL 1FRGH 5C0CD 5A7EA 1TTUA 3BSZH 3TASA 1ZV2A 3OZ9H 1FF5A 3V4PH 4E9SA 1EK3A 1JK9B 3LKPB 4LVNB 4A6YB 1A6ZB 2F5AL 1AGFB 5D7KE 5EU6A 3VGEA 3WG7B 4B96A 4AW7A 3DX2A 2PWHA 1LEKB 1HHKA 3SKOB 3V5DA 2RQ8A 2JF1A 4DW2H 2VM3A 5F0MB 2F54D 5JOPE 2DWTA 3ZDYB 3DXAB 3RTQD 1OGAB 2UXTA 3KLSA 3E0GA 5MI0C 4GINA 1T83C 1IGJB 4KPHH 3AWEA 4UIKH 2QTVA 2VERN 2A74C 1DBAL 5A3IC 1KPUB 3VD3A 3GSXA 1L3NA 2I7SA 4P2QD 4JGNA 5FUOL 1MN4A 3B37A 4W9HC 2UZXB 4XAKD 2X42A 5T1KA 1DQML 3KVPA 3UTZA 1QFUH 2JJSC 4Y16A 3KNBA 4NN5C 4OF7A 4ZSOB 3TCLB 3TONA 3IGAA 2ZXAA 3NSXA 4GP5B 2VDPB 1JRHL 5DK0A 1WAAF 5IB1B 3ISYA 5F9JA 2IV8A 2IFFL 3EOBA 4M48H 4Y1AD 5JIDA 2V37A 3E1ZA 2KLSA 1GL4B 3S36L 1F11A 3SQBA 3EJQA 3BGFC 4RNRA 3T0AA 3BPCA 3TLRA 4GUPB 4PAZA 3D09A 5IBTH 2X2UA 2ZP0T 5KVMC 3VJ6B 4NUJB 5IB3A 4LARL 1CDCA 2ZOLB 4NSKA 2FEEL 2ATPA 1XF5A 4Q9BA 4JR9L 4ZX6A 2VDLL 5C09B 2YMXH 4DN3H 5JDJA 4L8CA 3H85A 5FDWB 5DFVC 2WOYA 5E6YA 4NPYA 1ZS8B 3NCFB 3MRGB 1I3UA 1G7JB 1WBXA 4JFDE 1F3JA 3BGMA 4CAGA 2HUEA 3TZVB 4ZOAA 2EO9A 4FYRA 2JQMA 3GSNL 4LLDA 4NO5B 4F3FB 5KAQF 2XG4A 3U4BL 1IAMA 1S7QA 4XMKL 4X99B 2XICA 3HE6C 1Q9LA 3U4EB 3VFGL 1INEL 2HWZH 2F58H 3CNKA 3QORB 2X4SA 4W6XB 4N1HB 2GEQA 3I9IA 2YGNA 2VDNB 2X4QB 2R4RH 3ARBD 3S3BB 3P40A 5H8DA 3SGEH 4N0UB 3LNFA 3L17A 3M86A 1DBMH 3FMGH 4ZMAT 4YSOA 5J6GA 3MRNA 4OCRH 4DUXA 3GHPA 2Y6SD 4WJ5A 3QI9C 3MXWH 1ED3B 3NZSA 4U0QB 2FIRT 4LLVA 4Y2DC 3C6EA 3DVFA 5D7IE 4BWTA 1MZYA 4KY2A 3H2QA 1E40A 3CHXA 4JFPA 1WCBB 2AI0L 2GAZA 3CVHL 4MNQB 2WV3A 3X2QB 4YXLH 3TA3D 1EXHA 5A1AA 2MEJB 1HILA 4RQQB 5CR1A 2NY2B 5JIHA 4G7VH 1WLHA 2JIXA 3OKKA 3ZMEA 1GGTA 5IVXA 4F5CA 1IE5A 4MWFA 4HIXL 1Q9KB 3ZR6A 1NAKL 4RGMC 1QBML 5LN8A 2BJML 5DJYA 1QSFE 4AXWA 3BWAB 4X0NA 5CO1A 2FR4A 3QIBC 2EDXA 3G5WA 3GMPB 1UEMA 3V5HA 4E0RB 2PF6A 4ODWB 3T0BA 4I7ZC 3CVHA 4HWZB 4IRJD 4NAQA 3PUCA 5J6HB 3BAIA 4GKSB 4W9FC 4PG9B 1Z5YD 1IGIL 3DPBA 1A4KA 3DETC 5K9OA 2ZG3A 3TJHD 4HKJA 4QHMA 3DTUB 1II4E 2ZNXA 4M62H 4MA1C 4XE0A 4J6RH 4HMEA 5DC2A 4ZOBA 4ZAKA 5AZEH 3T2PA 3VXME 3SQOL 2ERJB 1WWBX 4UTCA 5I1KL 1GZQB 3QPXH 4LLWB 4H1LB 1TNMA 3LDBC 3QDMB 3GHBH 3QG7L 4ZRGA 4IU2B 4NGHL 1ID5I 3X11B 4QRPA 4MCZA 2B4CC 1A6AB 1HHHB 3RL2A 3IU4L 1KTCA 3A23A 4N3UA 4MJIA 3EJCA 4HCGA 4UILL 2AJUL 2DL9A 2L7EA 3AACA 4S1DC 1O9WA 3GB7B 2JKIS 4N2KA 4L3AA 4NM4L 3L2LA 3ZTJH 5IHLB 3W37A 4FMFA 1BD2A 3AY4A 3MLWL 1MW2A 2UWEB 4O2FB 2Z7UA 3BISA 2F7OA 3OKDB 1EEZB 3D4GA 2KZ1B 5J1TC 1X5ZA 4LQFL 4JKMA 3LZPA 2ZNWA 1CI5A 5TE4L 4P2RE 4WFGD 2WM0A 2YAHA 4JFYA 3JVGC 4R2GD 4NN6B 1AXTH 4RFNB 2ODIA 2VL5A 4YWGH 1DBAH 4Q97A 3SE8L 1R5VA 3CSYB 4I87A 4A63A 1LYQA 1OE1A 4I4WB 4RESB 5FUOH 4PLNC 5I2IB 1DQMH 4GI8A 3SYQA 2DM7A 3V9FA 1DSYA 1KTKE 5CD5D 2ZPKH 2Y5EA 2MCPH 2YAQA 4JB9L 2IFFH 3L9RB 4X0KB 3TPUA 1PG7L 1A7NL 4Y5YB 3SDYL 3LZNA 1PSKL 3PCYA 2ZCKH 2PW2A 4NO0B 4YDKH 4ZMNA 3QCVH 1DANU 4U6HB 4X5LA 4ZX4A 2PYEE 4NUQA 1OWRM 4QT5B 3BQUA 1VFOA 1KJVA 1NICA 1J8HA 3KLQA 3ZY7A 2E86A 4LARH 5E2WL 2GG1A 1L9TA 4DJMA 4JR9H 3PXJA 3GIVA 4Y4KC 1DBBH 3VXRD 5I0DA 5DURB 3IXTB 1B4RA 2WWNA 5I1GH 1OPGH 2OXHB 3MZTA 4A2EA 4AEFA 3CH1B 3BUYA 5I73B 4L9DA 1NBZA 5DD6A 3PL6D 5E8PA 3POCA 3RPIB 3PF2A 5BMFL 3KAAA 3ES6B 3HR5A 3LH2L 3D3VD 3BAJA 2COQA 2ESVA 3MJ7A 4WI4A 2ZG2A 4WO4C 5AAPA 5E24E 2OYMA 5ACLA 3R06A 2PR4H 4G1MB 3MV7B 1DJXA 3MR9A 4F7CA 3QJZA 4LRNL 1OW0C 3DJ9A 4IK6A 4L0PB 5KSAB 3U4BH 1N5AA 3WLBA 4NQSB 5F1IA 4R26L 5IQ7H 4Z7VF 5EZIL 3O3DA 1ZLUH 2EVFA 2VN4A 3VFGH 2YZ8A 1G7QB 2ICWI 3PQYB 4DKFH 1JIBA 3P1VA 2HJLA 4KVNH 4JL2A 1L0PA 4PJHE 4JPIB 1MW1A 5HI3D 4N90D 1OLZA 4YHKL 3BN3B 2EXWC 3P4MA 4X9HA 3CHPA 4QCIA 5KVEH 3CVBA 4H5SA 3TN0C 1FG2A 3KVDD 1JZ5A 5TDNB 1XBRA 5E56A 2V8LA 4OCYH 2WKLA 3QZWG 4QYOA 2WKOA 3LEYL 2N0KA 3QJHA 1OB1A 3CVHH 4W4OA 4OF5A 4F9LC 1UWXK 2A9DA 4BFJA 3VXNA 1FZOB 4FZ8L 1F97A 1HNFA 1XAUA 2QVTA 3P3TA 3ZDYF 1ZIBA 2VTFA 2R1WB 4HBCL 3MRJA 5JW4R 1DQLH 3BCFA 4A67A 1SQ2N 4KJQC 4X42A 1K9TA 4OZGB 5C0JA 4Q6IA 3BVVA 1QBMH 1J5OL 4EN3D 3CK0H 1LO2L 1ZDSA 2XZCL 9CGTA 5D2LE 3S6CA 2GK0B 1LQSR 1XH2A 1LMKA 4OD1H 2UZIH 3MTRA 3E9TA 3SYCA 5GZOA 3TYGL 1IAOB 3IMVA 4X6FB 4HKXA 1YEHH 2JJUA 4WFHE 4MA3B 5JORB 3QULA 3M46A 1DE4B 1MFUA 5E5UB 4GNKB 3RWCA 3HZYA 3HHSB 5CEXA 2WLIB 3SQOH 3WFZA 5ESVB 3PHQA 4IHOA 5I1KH 2PW1B 4GSQA 3SJVA 4DZ8A 4Y1TA 1E4JA 2DMHA 4NGHH 1X5MA 4NRZA 2P5WB 1CFSA 2C7FA 3MSPA 5IUSA 3WMPA 4ZQTA 1U8QA 3EBIA 3IU4H 2P9RA 1NBCA 3QXAB 3TBYB 1IKFH 2D7PA 2FVNA 2ZXEB 5BVPL 3GS4A 4YQXH 5K9JL 1XXDC 4UILH 1XMEB 4NAMA 5ECGA 1A7OL 1J11A 2Y5TA 3BN9C 4PJ8B 4TUOA 3T8MA 1HZHH 1KBGL 4RMUA 5FYKU 4BCYA 1MFEH 4AI7A 3BKCL 5F9OH 4GMSL 3U30C 1GC1C 1AHWB 5GQBA 5TE4H 3V5KA 3SBQA 5DVOA 3STBA 3D39D 5AG9A 3SE8H 5ISZA 4U31A 2LOEA 1L9NA 4JUTA 3VA6A 3JWDL 4ZTPL 2D3LA 3US9A 1E5UI 1PFCA 2A77H 2QR0A 3BI9X 3WLWC 3N42F 1I9IL 5C0RH 5AAWA 1G7LA 1FFQA 5AALA 4L4TB 3MBEB 1A4AA 1BM3H 1KPVB 4JB9H 1VGKB 1DVFC 3QUZC 1PG7H 3SDYH 3L16A 4OGAC 1QFPA 2AMGA 2ZP9A 4JZJA 1U3YA 3VX0A 3LV3A 2JSFA 4ATTA 2FQDA 2E8ZA 3MKGA 4JO3H 1A3LH 4O2CA 4D9RE 5AENA 4NQDA 1IX2A 4NCC1 1SXBA 1UZ8B 3HI6L 3MN8A 2CO6A 1KLFA 2PXYC 3S34L 3OWRA 1PJWA 2ATKA 4ZD3L 2ITDB 1F90L 5IJVB 1PZSA 3NUKA 2PLTA 2WLKA 2KMWA 2HMIC 1T1YA 25C8L 3C6LB 3AS3A 1AZZC 1EO7A 2EICA 1AIZA 4BELD 1J0ZA 4D7PA 4DHLA 2HXAA 3FAXA 1MZZA 4YGVB 5BW7C 2BMKB 4YHPB 1T03L 3OKYA 5EN2A 3F7RA 2GABA 3RGVD 2WCPA 1PKQE 4NWTL 2BSTA 4O00A 5FGRA 3CSBA 2DMBA 2R59A 4KDTC 3D5OF 5E4EC 4X9BA 5D2NA 5ESAA 4UOW0 4WAFA 2AV7A 3QJVB 3QZNA 2XFXB 5C07B 4DFIA 4MD4B 1CL7L 5EZIH 1TENA 1ZWIB 4H7VA 5IGXH 1JXGA 1BD2D 4DOHE 3AG1B 3TX4A 3UGXA 4K23L 2VC2L 1U3JA 3L4VA 1KBKA 1NPUA 4M61B 3ZE0B 3BP7A 2WKGA 4M03A 2JLLA 2YO3A 3SBWA 3PABB 2NY1B 5DWUL 1RUAL 1W72A 5ICYB 1LD9A 3MA9H 4YHKH 4XNZB 1S8DB 2CHXA 3GSVA 4HJGA 3VXUE 1XGUA 4QRUA 4AIZA 4MXQD 3FO1A 3IDGA 5GGSY 3QNFA 1RIHL 2ADGB 2YMTA 3Q1EA 5LB1A 3EUUA 4JHWL 5IB5B 2W07A 2H0PA 1ZHKB 2ZXWB 3S4SG 3VO0A 4MB3A 3JWOH 3VYNA 2GSGA 5M94B 2FZ3A 3V7AG 1CDUA 4N9GA 4PD4K 2EH7H 1YY8A 1EAQA 2IXQB 1GMIA 2XETA 1ETZB 3BQUD 2HFGL 1CWVA 1OTUC 1OY3B 4P9HH 4J7RA 1NGWB 2RFXB 4IOSD 1FG9C 2ZWYA 4K8RH 4UOW1 4XWOC 2WP3T 3TYGH 4M43H 2K0RA 2Q7NA 4EO5A 1TQCB 3N9GL 3K8KA 4MD0B 4GW4B 2B5IB 4JQXC 5AOJA 5FUZL 4H88H 5F1OB 3HIZA 4XNMB 4KU1A 2PABA 5A2LH 4UBDC 1UHVA 1PYWA 3FH8A 5KBKA 2WTRB 4N8VG 2XUWA 3HS0B 2KC0A 3ARDA 4C4KT 2F74B 5FGSA 5BUPA 5I1EH 1GGYA 5DEJA 2Y3NA 1NSNH 2C4FT 1WQVT 3ML9A 1MJJA 4X6DE 4Y4FB 2IPKB 4R0LA 3EYVA 2AXJA 3OQ3B 5BVPH 1KBVA 2G2NA 2V0AA 4GXFA 1ADWA 3U2IA 3K8MA 3CHSA 1S3KL 4EUPG 1S9YA 4PRDB 3BAYA 5LBSL 3MROB 2YHGA 2EVHA 2NY6B 5ADPH 5DTFA 4QHNA 1F58H 4AK1A 3G5VA 3BKML 3VI3A 1TJIL 1X4YA 4XOBA 3OKLB 1HAUA 4NQXA 4KI5D 1H3GA 2NNAB 3QW9A 5EZJA 2FWSA 1BGXH 1KCBA 3BHBB 1BX2A 4FNUA 3D48R 2TSAA 4OZFA 3R0NA 3ZKQD 1R1CA 3GBMH 1YNLL 2XXCB 4AQ1C 1GGCL 3ZPDA 1X5IA 4PWHA 4ZTPH 3APNA 1AIFA 2F7RA 3G04A 3N85H 1G5GA 3VFMA 5F9WC 1TU2A 1GVIA 4X7SL 5KS9B 4QI3A 2EJ1A 4BA8A 1BAFL 3FCGA 1GHFL 1Y18A 2OM5A 5M95B 5IW6B 1OGTB 3DMMC 4ZMVA 1ZE3H 2ALAA 5D93C 3F7YA 1ACYH 1BQSA 5HGHA 2DLGA 3LEVL 2PUQT 5CKGA 5GZOD 1XSIA 4YE4L 1NGQH 3HI6H 1JGLL 1OSZB 4BFKA 1A7RL 4NN7C 4ZFGL 3I02A 5F1NB 3S34H 1P7KA 1XZ0A 4AUYA 4DESA 2SEBA 3MV9B 4JKPL 5B39A 3QS2A 1U92B 4MD5B 3K8LA 4KJYB 1B0GB 4TQ8A 3CHOA 3MLZH 5HDOA 2XKUA 1I75A 1A6UH 3QJFA 3FTGB 4YL9A 2NXZC 1TJMA 5ANHA 4LCYB 3FFCB 2VQ1A 4LESA 3VI4A 2QSTA 4XBEH 5BZWB 1BQUA 2F68X 5FS5A 3CCHA 3Q9QA 1PGRB 3DUSB 3MV8E 3QNXA 2CCVA 2SODB 4U4BA 4QXTB 1W72H 5G55A 1M1XA 3HE7C 2PWGA 5DZLA 2CO7B 3HUJE 4MTMA 4R90L 3K6SA 4H0IA 1E9OA 4WGVB 4K3GA 5HHOB 3L3HA 4LSPH 2YPKB 2Q8AH 3U1PA 4ES9A 2P8PA 2DYRB 3C5SB 4JO8A 4BZ2A 5JR1L 1N5YH 4JRXA 3KL5A 3QQ9C 1B4TA 3BCDA 1BLNA 2QDVA 4KJWD 1O7SA 2RR3A 1ORSA 5DD0L 1MKFA 2WZ6A 4AT6B 3GSUB 2APWA 5J3HD 2WXKA 5JHMA 1IT9H 1G4RA 2ZIDA 4WWKB 1C5DA 1TG8A 4F24A 2CR6A 2J25A 15C8L 2VC2H 4X5XB 1LHZA 5DJAB 4BFRA 5CP7A 4F2EA 5L8JB 3U7AA 3V0AC 2IDFA 1QBLL 1SN5A 4PJ7A 3T1FB 2R8SH 4A7SA 5CGTA 3X13A 5CJBA 1EWHA 3HR6A 2WLNA 2ETWA 5A2FA 1CFVL 4K7PY 1G7IB 1SEBB 3SYOA 2DLFH 3CX2A 4JO2H 2H3KA 5L4MA 1MNNA 5B21A 4GAJH 3ZU8A 3T4YA 1S7VA 2CHZA 5DUPH 3RIKA 3VRIA 3LKQB 4HUWA 4MQTB 4NFBA 1J8SA 5KVDL 2ORBL 1F2QA 1H8LA 3VD4A 1VZHA 1DFBH 1FL6B 1QLFA 3WDIA 2NZ1A 1HXYA 5FUCE 2RGSA 4HT1H 3FQXB 2FLRT 3OAWA 1R19A 5AVVB 5LGKA 4LSRL 2Z7ZA 3WBDA 2IIJA 1HWGB 1KIUA 4LCUA 3BZ5A 3AREA 5IVZA 4HMCA 4NQDD 3QJSB 1PZAA 5CXPA 2XLLA 1CE6B 2ICES 4QXUL 3Q2LA 4XMUA 1P7QD 1CDGA 2HH0H 3UTTA 3ZVVA 4S0HA 1UWXH 5CINL 1CD1B 3N9GH 1S7TA 3E6HB 3P73A 5GISL 1EDQA 3E8UH 3CXFA 4XX1G 3OLGA 4DEPB 4F37F 3QDGE 3A24A 1E5CA 4FTDA 4C59B 3VD5A 3NIGB 1AKJD 2VRKA 2FGWL 4JRLA 3LVEA 3CQQA 4K7FA 1LK2B 5ANMB 5CJ5A 1DN2A 5EU4B 3DSFH 4R3SB 2OL3B 5LQBL 4OZFH 3R7RA 2MSPA 2VLJE 4MB4A 1Z3GL 2OI9C 2X4OA 3RU8H 5AOIA 1QFWL 2O26U 4LF3A 1U3ZA 2VMDA 1UCTA 1RKRA 3FU8A 3C8KB 4FXKC 4UYQA 5D1ZD 3SDCA 4AX3A 1KFAH 3FB6B 3Q1SL 2ITCA 1EA9C 5TH2B 5HJBA 5DFTA 3IMBA 5AW1B 3FHAA 2N01B 3MA7B 4HCRL 3V52L 1S9WB 3ZGHA 2CJUL 3B2VL 4E68A 2DYPD 2J8OA 5HHVL 2K70A 3EO1A 4UQDA 4WGWB 4F58L 3KLAA 2CKNA 2ZUSA 2CMRH 4JANB 3NAAL 1D9KB 2ILLA 1P4IL 1TPXB 3C08L 3DX7A 4MZ2A 4RGOH 1EMTL 3BYYA 3O2DL 1U3HD 5AW0B 4YO0B 1CFQA 2F9BT 5D96B 2BSSA 3W11D 3B9KD 3KR3H 1ACCA 4P2RD 4JM2F 4TYUA 4LU5L 5IQNA 1SY6L 4FQ1L 2UUDH 4JDEB 1KB9K 1DL7H 3WTUA 2J8UB 1X5HA 2XXFA 3S96B 1CICB 5D8JH 5JXED 4L8SA 1LXMA 1GHFH 1WGOA 1X4XA 3ZZ1A 3UZEA 1WITA 1HHIA 3ZE2E 4B5EA 2BS71 3QDHA 3ABLB 4JN1H 3OB8A 2A6KB 2A99A 3MLPA 4BZ2H 4FL4C 4LRIC 4ZFGH 4DUVA 4XAWH 4U1IB 3PWLA 5INCA 1J1OH 4JKPH 4IKNA 2PKDA 3VTAA 1CFTB 4DKTA 1NGZA 3U4KA 2EYSA 1FLTX 2PO6B 1H0DA 1NC4A 4P4RA 4Y8DC 5F1KC 4HJ0C 4L5FE 1W0WA 1A9BB 5DHVA 3SPVB 3WU1A 2KUTA 2EDNA 3S7GA 5D9SB 3ARDD 4MLIA 4OR1A 2Z7WA 2WNKA 4PGEA 1TR7A 1BZ9B 3TNMB 1QRND 4DGVH 3QVAA 4G9FB 4HGWB 4WW2A 5CILL 5KOMC 1ZGLA 1AVAA 3ZBMA 2EDLA 3IFOA 2H26A 5JR1H 5DFAA 3FT4B 1SM3L 1EDHA 4JFFA 1JHTA 5I1DA 3ENEA 4Z76B 1R34A 1AKPA 3QIWB 1Z3RA 2IFGA 5DC0A 3FO2A 4HIJA 5EEYA 4ONGL 4JFZL 1G9MH 4XWGL 2IOOA 4IRSB 2WXRA 2Y69B 3FOMB 3T3MB 4OAWA 1T66D 3EFFA 4FEMA 4PS4L 4OIIH 4JFOA 4F9PA 2JB5L 3U46B 3UAEA 1KXTA 5HGDB 3MCLL 4PRBB 5F6IB 2L04A 1SOKA 5EUOF 2YLHA 1U95B 3HLAB 2Q0ZX 5C71A 1QLRA 1DLHA 1HNGA 2F1BA 2N1TE 3QEQE 4K5LA 4NQEB 5EC1B 1ZHLA 2C9QA 3N1PC 1IQDB 1KTLA 1HKFA 2OCCB 4Z23A 3DRTA 4N22A 3QB7C 4PG2A 1E3XA 4PJGB 3BP4A 4TUJB 3HB3B 3OWEA 4LSSL 5KVDH 2OK0H 2AEIT 1GY2A 2UYLB 3B9DA 1PIFA 1HZLA 4ZYKB 3CFDB 1IBDA 2WO2B 1G1KA 4HIEB 2IWFA 4CU6A 2CE6A 2GITB 4XNQA 4ZMTA 5KSUA 1REIA 4MBOA 4UU9A 4QTHA 1BAGA 5C0GA 2FIKA 4X6BA 1FNGA 1RZGB 1C08A 3GO1L 1RJZB 3T2NL 2XWTB 1R5WA 5CINH 4P23B 3WHXB 4ZOEA 4QHLB 1V3MA 2BVPB 3QO0B 1TTGA 3QJXA 5D5ME 1BJ1J 1Q0EA 4HFWA 2AQ2A 3K71B 3Q9PA 1O9VA 3CZNA 3EDKA 3L5XH 4I18A 4NFCA 2BS8A 4WRLA 1DVTA 1SHSA 3L3OC 4X98A 3IFPB 4R9HA 5JLZB 4N0YL 1AE6L 3M1OA 4OKVB 4RX4A 3ECQA 3HAEB 3F8UB 4ZUSB 3T04D 4YE0A 5K33A 3BAKA 3MUY1 4JRXD 3VDBA 2YPLB 1MCNA 1IAKA 1QFWH 3SGJA 2YA2A 4YOKA 1WAPA 1WSST 3MYJB 3ZHKA 1XF1A 2Y2TA 4KUCD 3QGVA 2XQYA 2OW6A 1XGZA 3KLDA 1CU4L 1ERNA 1JFHA 4NRXB 3LMJL 4FLHA 5DZ9A 1IJNA 2HVKB 3V52H 4UQBA 2Y9RT 5MEOB 1V27A 4DQOH 3ZIMA 3QK0A 1Q1JL 4I77L 4LPYA 2EZ0D 1CD8A 4KX9A 1E8YA 3G6JF 4GQ9H 4P2OA 4F58H 3LKNA 5CF3A 1EAPA 3MFFB 3BKYH 1YPZA 2J1XA 1UKTA 1CC3A 2OMBA 5FKAA 1KGWA 5FAAA 2IEPA 1VADA 1GAFH 4Z95L 4Q9RL 1K5NB 5EMYA 4AJVA 1MFCL 2CKBB 3LKPA 2AHIA 3RP1A 4QRAA 1AGFA 1WZAA 2HPTA 1QRKA 4TVUA 4XRCB 3OGOE 4YH6A 3QUXC 2A1WH 5DC4B 5DHVH 3FUMA 1IL1B 3KCWA 2VXVL 4K94C 1LEKA 3SKOA 4DP7X 3S48A 4WEBL 2HFFB 4Z0XB 3WIHA 2FBOJ 5HYJA 4UDTA 3BJLA 5HVGB 5DRXB 2CIKB 2D03L 4LHUG 2OFQA 3LSOB 1XH1A 1IGJA 5I5MA 3O4OB 5AZUA 5CD3A 3JYCA 3ILPB 1UZ6E 4LSTH 5FUCC 3UTTD 4FQLL 2H6OA 1MI5A 2W94A 1MCCA 1ZA3A 3K6DA 1J48A 5BO1H 2UZXA 1AQ8A 1NDTA 1IGFH 3ILQD 5I1LA 3EADA 1PPIA 2MJWA 4MB5A 1D7BA 1GZPA 4ZSOA 1U42A 4XO9A 3HG1D 2X70A 3B9AA 3K3QA 3L3KB 4L1HA 2BVTA 3MRFB 3BGFB 2NX5A 3DECA 3LIZA 2QV4A 4BHUI 4J3OG 2AERT 3ECWA 5DLLA 5ALBL 3SGEI 3RZCD 4S10A 4YK4B 3FT0A 4GUPA 3RILA 4OKDA 1MWAB 1OCWL 5C9JB 3VJ6A 5LVEA 4NUJA 1FORL 2ZOLA 1FPTL 4JHAL 3ZDXB 2XV6B 3NJXA 4R83A 5HJ3B 1CBVL 3LD8B 1COBA 2H0JA 3B9VA 4BUQA 5C09A 3QRBA 1XCTA 4H8WL 2JKRM 3BAXA 2YC1A 3O8XD 3VWJD 1ZS8A 2VDOB 2QADB 4PS4H 3MRGA 3ZMRA 1G7JA 2JB5H 2BIQA 2FH8A 1H8SA 2WP3O 3V0VA 1QW9A 4KTEH 1ZV5A 4PTUB 3FSWA 2FO4B 4O9HH 2IBZY 4BA0A 1QLEH 3FS9A 2VZ3A 3ULVF 4NO5A 1KGXA 3SPIA 2X9YA 5AW8B 4F3FA 1TXKA 4R4ND 4Y4HD 3P9MB 5F44A 2KZKA 3O6MH 4X99A 1ZGLP 4NZJA 4U2YA 1HL4A 3L9YA 3U4EA 3EH3B 4IS6A 1QAWA 3QORA 4K5NA 2N7BA 4V1DB 2FBJL 3LPGA 5DMIL 1MFBL 1JZHA 1S5IH 4N0UA 1Q8MA 1FHNA 1L9QA 5BV7C 2E9IA 4HWUA 4Y2OA 1CXIA 3QI9B 1L0XA 2D0FA 2D7OA 1U8JB 3H9SB 3O11A 1I1YB 3ROLB 4M93B 5I5RA 3UAFA 1IM3A 3WXVL 2XN9D 2NUPA 1ED3A 4XHJC 5IVXE 1YCSA 3PWUB 5EIIG 4F5CE 3GO1H 5BOZG 3TA4D 2N7SA 4XO8A 2CIIA 2P5EB 5I0VA 1F56A 2BSEA 1XSOA 1NFDF 4MNQA 3V7AE 2IC2A 2J8UF 3Q5OA 3F5WB 2NY4C 5BZXA 5FA3B 4I2XB 5KVEE 5AZ2H 3CVDA 4Z7UB 4PV9B 4RQQA 2ED6A 2YAMA 4TPRL 2QMJA 3CZLA 1Q9KA 2GIXA 4B5ZA 1PEWA 4A2DA 2J6EA 1R4XA 5FR3A 5LJYH 1UXSA 4LOUC 4OCSL 2Q20A 4ELMF 5FK9A 4CU7A 5I19L 2EXSA 4NQCD 1A9EB 3BWAA 4RBPH 4WTZG 2EDQA 2X6CA 3PDDA 4JFFD 3GMPA 4KGJA 5AUMA 4E0RA 4OU3A 4ETYA 1QI3A 3KPRD 4HWZA 5FYJU 4GP4B 4GKSA 5ECJE 5J12C 3TF7C 3RKDD 1JYNA 4HULB 3A6OA 3FFOA 12E8L 4QRPE 3R7QA 5I18H 5IEHB 3VFWB 4KK5D 5L8KB 2WQSA 4H0LC 2VLKB 3S5YA 5D1QE 3LDBB 4FKHA 4MJIE 4EXKA 3WIHH 3D0LB 4ADGA 2QHRL 3EYFB 4I77H 1JRHI 3BH9A 1RMFH 4OV5A 5FV1L 4D9QE 1NGPL 4FNLL 1L3WA 1OCZB 3QDMA 1IEAB 3P11L 1JZ6A 4CRPA 4WU7B 4QUOA 1PS3A 1SUHA 3D87B 3FSZA 1ROWA 2RB8A 1A6AA 1TO5A 3HKFA 1IC5L 3TIEA 4RA0C 2IAMB 3R1GH 4Z95H 1CGVA 1MNUH 1NQBA 1NIEA 3AS0A 5D4QA 1AACA 5IBLC 5JW3L 1TFHA 2FEEI 2BLFA 4YSPA 2XTJE 3BAEL 3GB7A 2R0ZL 3B3IB 3I85A 4NQUA 5ETUA 2VDPH 3BIKB 3ZQ9A 4RGNB 2VXVH 3GHEL 3LIZH 4WEBH 3V8CA 3OKDA 5F0LB 1EEZA 3SKJL 2BCMA 2ZX9A 4W9GC 2WVUA 5KJ7E 1O75A 4XCYA 5E6IB 1CE1H 2ICCA 3PWVA 4YDLB 3BVDB 5ERWB 1T5XB 1AR1B 3G9VA 4Z7QE 4ZBJA 3O4LD 1A1MB 3V4UL 3CUPB 3CSYA 4O4YL 4MCMA 4UT6L 3RNQA 2X4UA 4I4WA 3AQZA 4W4NA 1ZLVK 1RPQA 2EC8A 3QAZC 1A14L 3LRHA 4POZC 5JIKA 1J8HE 4UMSA 4H8QA 4YHOL 2BP0B 1F41A 3L4UA 4JMNA 4Y5YA 4GOSA 2OMNA 4NO0A 3MUZ1 4WUUB 1Z6JT 4M5TA 2VERA 5ALBH 4B9KC 4KQ0A 4U6HA 4X80H 4RX4D 2CDEB 3LZQA 3X1NA 2WQ8A 4YVNA 4W9EC 2JKJA 4BFOA 4Y4KB 2YD9A 4XP5H 2GEEA 4EKJA 1AQMA 1SDYA 4U1LB 1SYVB 4PSRA 4YHNB 3TJEL 4F7MB 1FZJB 4OCXL 2ESVE 5JIQA 4WFFD 5LAXB 3KBHE 2H2PD 1QO3A 4ECNA 3GRBA 2CM5A 3IXTA 5J0BA 2OXHA 5HHQA 2YSSA 5FYLL 4WV1B 4P5MA 3RPIA 1OOWA 3ES6A 1MCOH 3ZKND 5AVWB 3FW6A 1ZLSH 3L9EA 4Z7WA 5JA8B 1PF3A 4FQCH 3FQ4A 4PREB 5IQ9B 1DZBA 3CQFA 4L4VB 3QJOA 4E9XA 3RB5A 3D50A 5EBLA 1QFOA 2NR6C 2WBJA 1E9QB 3K4AA 4WK0B 3MPCA 3LN9A 2QVFB 4Q14A 2YD2A 5E1QA 4FFWD 4A2HA 4J4PA 4NQSA 1U8NA 1YUKB 1LE5B 2CJTA 3TYFB 3U9WA 1VCBC 4Q8BA 1VACB 4GG6B 3IAGC 2CUAA 1CYWA 2F53B 1AJ7L 2FBJH 5DMIH 3S35H 3MJ6A 3RJOA 3PQYA 1MFBH 3QEUB 2BOLA 4GSDL 4JAMB 5HYJD