4BGLA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
ELFQTADWKKEKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE REDUCTASE
publication title Superoxide Reductase from Giardia Intestinalis: Structural Characterization of the First Sor from a Eukaryotic Organism Shows an Iron Centre that is Highly Sensitive to Photoreduction
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 24
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bglA00
4D7PA 1VZGA 2JI2A 4BK8A 1DQKA 1VZHA 2AMUA 4BGLA 4BRVA 2JI3A 4BV1A 1DFXA 4BRJA 4BFJA 4C4BA 1Y07A 1DO6A 2HVBA 1VZIA 3QZBA 4C4UA 2JI1A 4BFFA 1DQIA 4BFKA
chains in the Genus database with same CATH superfamily
5KVEE 1T5WB 3HHSA 2GAZA 4J3SA 3WTUA 4LPWA 1KFGA 4C58B 5MHSD 2AXGB 3QP3A 4BWTA 4QHMB 5CEYA 4MBOA 2HWZH 4HYTB 5BS0A 5T5NG 3BIKB 4AYDC 1XD0A 4XNUH 4LGSB 3TO2A 5DJDB 5AOZA 4NNXA 4YEEA 3SBPA 4DGWC 4FQQB 5LXGL 1X5HA 3K4DA 4C59B 3HI5H 5HVHC 4GKZB 1RQ5A 2NY1B 4GO8A 2Y36L 2O5XH 3PXLA 5TH2A 2WXRA 4R4FL 3MKGA 4ETQB 4WTQA 5HGAB 2R8SH 4WEEA 1FNFA 1TJGH 4EDXA 4ZW3A 1G0YR 4JFVA 1E9QB 3VDCA 3QEGL 2PYEA 5FYLL 5CKGA 5I82A 4MJ5A 4F1SA 1WFMA 1CF8L 1MJ8L 2HLFD 3X13B 2WB1A 2BSBA 4FXKC 4IEFB 4E9XA 2CM6A 2AJUL 3P2TA 2R1YB 2WXGA 4LZKA 1KYAA 1CDCA 2BVTA 1KCVL 2XVKA 1JG9A 4M93B 1OP3K 3D2UB 3PWUA 2Y07L 3UBGA 3NCJH 4A6YA 4OZ4A 1IC5L 4XAWH 2Z34A 4N2AA 3BWSA 5F93C 4BBWA 1SXCA 1ROWA 1VADB 3HMWH 5DRZA 4PRAA 3ASOB 5KW9L 4P57A 2ZXGA 4QRRA 3S35X 4UYPA 4PRBA 1KY7A 2IEPA 3OXSB 4AMWA 2DB8A 4EI5A 1XH3B 3HB3C 4GG6A 3QIUA 4CU7A 2YRPA 4P5KB 3BI9X 4GSXA 4OLWL 5AALA 1VFBA 3GI9L 4YXHL 1PW3A 5IHUH 4JREC 5D7IA 5FO7A 1H0DB 3FCTA 1CXIA 3LH9A 2ICWI 4R90H 5EU6B 5T3ZL 3APMA 2XTLA 5I1HH 1LO0L 3BSHA 2KS0A 3F00A 3P4OA 4HUWA 1FJ1A 2BY2A 3EYUH 2EXWD 1IGMH 3O6LL 4YGVA 3ULUE 5EC2B 3D85D 4FZEL 1UASA 4OD3H 4BK5A 3ILPA 5FGCE 4CMHC 1NJ9B 1AGEA 2WBWB 4OFYD 4ODWB 2BSTB 2ITDB 4Z7QF 1XIWA 2JSFA 3MJ6A 2V5MA 2W94A 4HAGA 4PB9L 1LGVA 4KVCH 3W39A 1PZ3A 4M1GL 1JGEB 2IPKB 5BUPA 2HFFA 5IESL 5FGSA 1LEKA 3L4VA 4LARL 4MCMA 5F7FA 4H2AA 4ZAKC 3QJFA 1A1NB 4L1SA 2GBAA 4IBTA 4XWOD 4KWUA 2A9BA 1JPTL 3LEVL 2H8PA 2Q9OA 3S8WA 3PWNA 3SKOA 4B60A 1OOAA 2LU3A 3IB4A 3GJEB 3RIFF 1G9NL 4LCCC 3ARED 2DQDL 3ME0B 3K5SA 4JRYD 3N50A 3S88H 1P2CB 5EZLB 4KY1L 4BDVA 5KVDE 4QRBA 1NANH 1AZBA 4BUGA 3OG6B 1W0WB 4MJIB 1ZY9A 3L08A 5BV7C 3WNOA 4AZUA 5I8KL 1KCBA 5GS2D 5HHMB 3TO4B 4ONOA 2X4RA 3V6ZA 4AVJA 1PX8A 4JPWL 4M6OH 4XO4A 4MRBA 3ECVA 4GSQA 4WI7A 3QRGL 1HVXA 1RXLA 1S46A 4NO2B 4WI5A 1I85C 2X4QB 1BZ9B 4TL4A 3VFMB 4KXCA 2ADGB 2IDFA 3CDZA 4XO9A 3HG2A 4U49A 4JLRB 4WWNA 2ICES 5IGXL 1QQDA 1YECL 4HJEA 4L3EA 2LR4A 4K7FB 1NBQA 3U36B 4S0TD 4EKJA 1MW1A 4KJQD 1ODAA 1DQLH 2HFEB 2ZG2A 1IEAB 4KFZC 1BJ1J 5IB1B 2VDNH 5D4QA 1KTLA 2Q0ZX 3MRPA 3WAKA 4YPGB 1QR1B 4XC1L 2VITB 4OKVA 4BH8B 3JWNE 4QOKD 2X2JA 3BIBX 3HC0B 3BZEA 2FBRA 4NM4H 1QWUA 3QDJB 2YGQA 1QA9A 4FA7B 3QAQA 4Z77B 3JTSA 3HUJA 4L8BB 5D7LA 3MCKB 4ATTA 3P9MB 4NN5C 1OL0A 1PZ5B 4PRID 2M83A 3Q3GB 5CN1A 5E1IA 2Z35B 3ARGA 3WE1A 5JQ6H 4BFKA 4QMEA 2Z91B 5CFAA 2FJGA 4GUPA 3VFRA 4QXUH 5HDQL 4EKXA 3R7RA 5HSFA 1PFOA 3HS9A 4K3JL 2WYIA 3JT0A 1J0IA 1XT5A 3KM2A 2HLAA 2WQXA 1T6WA 1ASOA 2FR4B 1REIA 1F2XK 1BWMA 5DEJA 2ZQKA 1G9ML 5F71A 3BUPA 2VXTL 3QISA 1RERA 1W0VA 4W9FC 1JHKL 3SQRA 3NH7H 3UC0L 5FFLA 4FQIL 3ULVH 3ARBA 3QJUB 1IC1A 3BPOB 2YEVB 3U9UA 1WO2A 4MJIE 1P69B 2DQCH 5E1QA 3ETTA 3A4DA 3S96B 3B8YA 1KB9K 1OGAB 1BP3B 4HKJA 3B9DA 2JJSA 2NTFA 1A21A 3F7RA 4OZHF 3RWHA 3RI5K 3OJDB 4M7JL 4NZUL 5J3HD 4LPXA 1ML0A 2CUMA 5E2TL 1KGXA 3A6CH 5IZ7A 4G8FB 5C0IB 2A77H 5E1AA 2CH8A 2W91A 4UTBL 3FSZA 2PO6C 3KLHC 3KPSB 2IOOA 4RFEB 2WIIB 5C0EB 3FN0L 1C5DA 4Y19A 4NZRH 4ZI8A 1S78C 3Q6FB 1WCBA 3ZHLA 5BNXD 3L4XA 5AZEH 4U6VL 2IPUG 2XN9B 1R3IH 4IGBC 3EBAA 3HG1D 1WVZA 2OR8A 4X9FA 5AVUB 5B38G 3VFOA 2WTPA 4KJYB 4BWUA 1SGKA 2VJ0A 1TQVA 2VIRB 3BVNA 4YHKL 3B9VA 3UMNA 1BD2A 5DFVC 4BSWB 1FLRH 1SHXA 2JCCF 5DHVB 1XV8A 3BYTA 4F1ZA 2BRRL 3CFKA 4GAYB 2EECA 1IGJA 1HEJC 4KHTL 3UYRH 2B39A 2H3NB 3N85L 5H35B 3MZGB 2LHAA 5B8CB 1GPOH 5F21B 1HQRA 2EDLA 1H6TA 2GSGA 2AJXL 1I7UB 3DXAD 3TP4A 2EACA 4XH2B 4DOHB 1G6RB 3BN9D 3U9WA 1SVCP 1KLGB 1L9QA 4WHTA 1DBKH 2RFXB 5I5RA 5DD3L 1F1AA 3H2QA 5I76A 1UOKA 3F7YB 2FEDC 2WVTA 2FB4L 2Z7WA 4JQIA 1GKEA 3TEYA 1WICA 5DK2A 5AOJA 3V0EA 1WIOA 2K3TA 4X9YA 1NCBL 1C8QA 2I69A 5CZVH 5DRXB 1OPGL 3F62A 2YUZA 3MLYL 1ZV9A 3TYFA 5GGTH 3CDCA 3SE6A 5EF1A 4N2HA 3CQQA 5L7XH 2V17L 2P45B 3E6FA 3ZDYE 5AVTB 4M43H 1HWHB 1YC7A 5DS2A 3IETB 3BAEH 5I19L 5D1QC 1UM5L 5IM7A 3T0BA 1IE5A 2IDCA 4R7VA 3H85A 3RWFB 1EBPA 3UXFA 1ZAGA 1PY0A 1S9WA 2XYBA 1E6OL 2FX9L 4MB3A 3N5AA 3EOTL 4BE5A 4RGNB 3K6SA 2WSDA 1JNHA 1CXKA 3MO1A 4N0YH 1D7FA 3T77B 3BGMA 1GZHA 2EIZB 1PG7W 1ZOXA 5EIVA 4WSKA 1UOVA 4M61A 1F3RB 3WKQA 4I18B 4AG4L 4KRLB 1QTPA 5HYJE 1HL4A 3M7FB 5BZDA 3I50H 3CV5A 2J56A 1W72B 1QBMH 5EBLB 1CI5A 1N59A 4IBVA 3RVTD 3X12A 2XKNB 3O6FA 1JGIA 3BGAA 1ZMYA 2GAZB 4P8QA 3FQUB 1EXGA 4V2BA 4X7TA 4HV8B 2JJWA 3LS5H 5D2LB 5D5MB 2IWGA 5IG7A 4WTWA 4ZTEA 1NCUA 4Z0BL 3MXWL 3CFDA 2F8OA 4DOHE 4AT6A 5C92A 2IJ0C 1NC4D 3G3LA 3MNZB 5DC4B 4JO5A 3RE0A 3T8XA 3RVVC 3OC8A 4OUUB 5EUOE 5ACLA 3HB3D 2NQCA 3CMOL 3MYJA 1TO5A 1XH1A 1CGXA 4L5FE 4B0MM 3HG5A 5CLXA 1CIDA 3ROLA 2Y5TB 3BHBB 1GC1H 4FI8A 2QR0A 3FT1A 3OR7A 2X1XR 4FNLH 3EJYC 4C4BA 2ERJB 3OZ9L 3V4VL 4YBQC 4LU5H 3HE7B 4L8CB 5GS2H 3MOBH 3GSQB 2Y1YA 4XB8A 5KS9B 2DLIA 3S3JA 2WINA 4LLDA 2EVHA 3P11L 4FNPA 2VR9A 3KL0A 2FLBT 3OPUA 1RIHH 2ZOUA 4QTIL 4RIRA 3OKEB 1RMFL 5IQOA 4JG1H 2BY3A 1BOGB 1UD5A 2EIJB 3KGUA 4LE8A 5E08L 2D3VA 3N42B 3C9NA 1HL9A 3LRKA 5DRZB 4EDWL 4ZAKD 5HYSB 1U9KA 2EDKA 1QSFE 2J12B 1KTJA 2OTPA 3KLLA 4DP0X 3VFSA 1FNEA 2H32B 3WJMB 5DS1A 4CAGA 2J25A 2X05A 2R51A 1FL5A 3UOAB 2WQAA 4NNYA 3E8UH 3IU3A 4BKTC 4B9CA 4NC2B 3W2DH 4D9QD 4CBZA 1K72A 3INOA 2EEXA 2VW4A 4FJZA 3VWJB 3V95A 4HALA 2NXZC 3EOBA 3IDIB 5A6IA 4EIUA 2E47A 2BNUA 4TNWF 2PN5A 3QZOA 4M1DL 1QFWL 5DJ8B 1IBBA 1USQA 3QHFL 4JO2L 2XZAH 35C8H 2HKHL 2HG0A 2NX5B 3QEUA 1T7VA 4XXDA 1JZ4A 2D7TH 4KRPB 4R4BA 5BS0E 4KX7A 4DKFH 2ZUXA 3BSZA 4ZUWA 1U93B 3B5TA 3CLFL 4Z6AT 2VQ1A 2E7LC 3BD4A 1ZLVH 1IEHA 3RJQB 2J20A 3DMMB 3W39B 4ODHL 1KCRL 1J86A 3WHE1 2OJEA 2FYYB 2HFFB 3QFJD 5D1XC 5AKRA 3D18A 2IH3A 2K70A 3H9HB 5C0JB 2IDQA 1GIGH 5IVOA 4BSJA 1CLYL 4TVPD 4OZGF 2PYEE 2Y24A 2BP0A 3PWNB 5DJ2A 5C7XL 3QXWA 1PZCA 4A67A 3DOHA 5M7QA 4JZOA 1BGXL 4WEMB 2OL3L 1EHNA 4OLXH 3QUMB 1BVLA 3SSGA 5HGBA 3P30L 5LG1A 4F5CA 1SMAA 2IBZY 3VG0L 3ZL1A 4G6FD 1R5WA 4JHAL 4LXFA 3VFGL 5FGBC 1LP9A 3HPJB 4X5LA 3RWDB 1BLNB 3SKNB 2ZCHH 4OW6A 3QUHA 4OZFH 3X17A 2OYMA 4HXBH 3QRFM 4XNBA 4LDCA 3CDGA 3ZZLA 1INDH 4QRRE 6FABH 3QFDB 2E4FA 1DQIA 4W9DC 1RZFL 1YMHA 2KLSA 5IOPB 5GRUH 1NGQL 4Y2DA 5JPMC 2FWUA 3OKNB 3F12B 4WDIA 2V7NA 4WEBH 1IAIH 4R9HA 3ZDXE 4JX0A 3LS4H 4GY4A 2UZIL 4G1MB 3QNZA 5D7IE 1BQRA 4XHQA 3DX6B 2K9UA 2NR6A 5GRJH 2XY1A 4TUJA 3FFDA 1YEGL 5F9AC 2YAMA 4WU7A 1KIPB 2FBJH 2IAMC 2OI9B 1MY7A 4NQEB 4JPSA 4OFQA 1Q9OA 4OB5L 2C9RA 1CL7L 1KLUA 2HKAA 3C08H 4JM2A 4YHPA 2JLPA 3Q8FA 3QO1B 1AKJA 1DSFL 1ACCA 1XSKA 4F33B 4A7GF 3NAAH 3GZOA 2PO6D 1O6SB 5AW8B 2EC9U 4JGUA 3CVHH 5FC9A 3KLHD 4M7ZB 2MPAH 3P1VA 2ZOKB 1S78D 4PJBA 3P3TA 3V7AE 1MWAL 1IVLA 1UZ6E 3ARGB 3EYSL 3T65B 5KBMA 3VW3L 3BH9A 3NSJA 1ZWIB 5E8EA 4IGBD 1TKWB 3ULSA 3IJEB 1D6VL 4B5ZA 4DP4X 3NDZE 4JM4L 5DFVD 4UV7L 1NC2D 4UUJB 1E8XA 1P5VA 3HMXA 4PVLA 2X6AA 4JQVA 3HAEH 1SQMA 2NY0B 4MQXC 2WOYA 5JOFB 1CD0A 1EEYB 2WLIA 3ZQ9A 4GBXB 4PGDB 1JPFB 1CYGA 4HK0A 1NAMH 4YNYA 5F96H 4GQ9H 1HH9A 1NOLA 1JFHA 4MXQD 4ODSL 5CILL 4Q9QH 4JPVH 3L3KA 3K72A 2HT3C 3GKWL 5GIRA 4PJHF 1K85A 2EZ0C 4QXTB 5TF1H 4CJ0A 3SE8L 1WIUA 1KTDA 4RMWA 5LDSA 2FEDD 4K3HA 2VYRE 4LCVA 4N2CA 3UO8B 2YGVA 1TVHB 4HFWA 1YNTA 5E1GA 1BMGA 4IRJC 2C3HA 1IGTA 1R34A 2YARA 1IAIM 2AQNA 4LNRB 4L3EE 2Q8BL 2F54A 1ZRUA 2F7QA 4AXWB 4D9LH 4ZXBC 3R06B 2HKFL 5ITBH 1HOCB 3BUYB 1A3LH 2WAHA 3BKCH 3WN5A 3S3CB 3DYMA 3T0AA 4LASH 3ZSSA 5KTEH 1L7IL 3WKMH 4MQTB 5ISZA 2JNZA 5D1QD 5I15H 4LGPB 3CFKB 1JGUL 5C6TL 4MMXC 1J12A 5EOCL 3IRZA 5D1ZC 5LBVA 1T21B 1JZ7A 3ESNA 3HUJE 1IQDB 2QGDA 3EH1A 5I30L 3L4ZA 3NTCL 5D7LE 2GKIA 4OCMC 4UM8B 4YN3A 5F3BA 1G7IA 1KWGA 3II2A 4K71B 2J2ZB 1OKEA 4XMXA 4X7FC 4YK4B 4JQXA 1U42A 4YLCA 4XO3A 2XN0A 2W80C 4PJ9A 3CSYA 1A14L 1CI3M 3EO1B 2WP3T 1B0WA 2RB8A 4FQXC 1EK3A 1RIUL 2NW2A 1I82A 3QR0A 3FBKA 5AW6B 3ZO9A 4Z7OE 4JGMA 3T6QC 4A04A 5DSCA 4XPGL 2FQFA 4H5SB 1I1YA 3VU2A 4UT9H 4KV5F 1X5JA 2JI2A 2ZNWA 3OGOE 3ARZA 5EF2A 3FSAA 1G1YA 1Y0LA 5J56B 2A4CA 3DBSA 2Y7LA 1YMMA 4F91B 5HYQB 5B39B 4BFRA 1IM3A 2Z0UA 4EBQL 1RK0A 1YPZB 4E41D 2W0LA 4X8XA 2WBJC 3EYOA 5FYKD 1HYRC 1RLWA 4L37A 3LQMA 4H40A 4M3KB 3CFCH 4TRPL 2ATPA 2YK1H 2QSCH 4KJPC 4ACPA 1N8ZA 1TDQA 3RVVD 3ZQWA 1JL8A 3K81A 4J3UA 4FFYH 1UATA 1FFNB 4OZIB 4IIQB 1VZGA 3LH8A 4KKLD 4Y19E 1AS7A 2FL5A 4QXWA 1LK3H 3V4LA 1KGJA 2G4GA 2R83A 3RNQA 3EJYD 1XZ0A 3NACL 4P59L 4F7EB 2ZJSL 4BM7A 3IJ8A 5EDXA 1MCQA 2BMKB 4IOFC 3W9DA 5I1CH 5J06A 1A7NH 4PD4J 5BV7H 3H0TB 4F9LC 4RX4D 3VVWA 3E9TA 4P4KA 4ZPTB 3MLSL 1IJNA 3IJYA 1E3XA 3BAXA 5F2FA 5DQJB 2PR4L 1EO8L 3K8KA 3L4CA 2MTPA 1MWOA 2FO4A 3V0VB 1QW8A 1QFUL 1MFEH 3VFNA 4APQB 4G5ZH 4AVKA 4Y1AB 2IVFC 3X1GA 4AQ1C 1VKXB 3QHTC 4CVWA 1CB4A 1H3PL 4G1EA 4KXBA 4HBQA 1RK7A 4FI7A 3DGGB 5JDSB 1GXEA 4UTAA 3WELA 2D3LA 4EUPA 2OYLA 3RPBA 4L4TD 1DBBL 4TVPH 1EAPA 4Y16A 4ZUSA 1AXIB 1TQWA 2YPVL 4J27A 4UNUA 2CK0H 4Z1PA 1EZSA 4PJGF 4TNFA 3CTTA 2OW7A 3BP7A 5SX5K 1SY6H 2G3NA 4YXKL 3ZGIA 1KN4H 4EF3A 1XAKA 2IPUK 1K4CA 3LKPB 5T1JA 2FSDA 2ZKHH 2Y2TA 3ISYA 5DU7A 2NXZD 4XCNB 3UTSD 1RFDH 3ZVVA 1GCFA 5FK9B 5DC0A 1URZA 2HVJA 3WD5L 3UBXA 2A6JB 5BRZA 5B3JF 1RSYA 4ZFFA 3L1EA 2GJ6D 5B1JA 4MAYC 4ZW5A 3I9PA 4PHZA 2HWZL 1FHGA 1XCTA 2I07B 4IOIA 3GMQA 2TSBA 4AWJC 1RURH 2KPWA 1AE6H 4MZ3A 4AQAB 1SUJA 4WUUB 1WJ3A 5EC1A 4RCAA 3FQWB 1JCVA 1WFOA 1L6PA 3QDMD 4R6UA 4ADGA 3M07A 4ZYKB 4HUNB 3LRSA 1JWSA 1I9JH 4MJ4A 2KHAA 1HYSC 1PX3A 3MSPA 1E4HA 2DTMH 5D1XD 4KVNL 3EGDB 1GVIA 2A38A 1CGTA 5IHZA 1U92B 1IZKA 2W60A 2AANA 3DI3B 4NQXA 2GPZA 1RUQH 2C9XA 3GRWL 2BS71 1JV2A 1GR7A 4G6AC 4HUXA 1DVFA 1IC4H 2AJSH 1TUPA 1HL5A 4JFEB 4P4RA 5T5FL 4BFBD 3TVMB 1IGIH 3EOBB 4RQQB 4TULL 3ZIYA 4GXUM 4CN6A 4P5RA 2N56A 4I3RL 4JDTH 3V8OA 3H42H 2CIKA 4Z8FL 4XAWL 2X10A 3RP1A 1ZSHA 1DYZA 2A0LD 4LOVA 1UJ3C 1RY7B 5FO2A 5T1KD 3CWGA 3U4KA 1TEYA 2Z7ZA 4R4BB 1SHMA 1PG7H 5HDWA 3JT2A 2HX9A 2DQEH 3C60A 1JBJA 2ZG3A 2DQUH 1QUNB 1Y07A 3EJRA 2YOCA 2XVLA 1DTUA 3NGBC 2Y23A 2OCCB 4M8RA 4MJJA 3VFWA 3RFZB 3HC2A 4LBAA 1I3VA 1DVTA 1S7TA 3PQYB 2JH2A 3U1QA 5FO8B 1S5HB 1BAFL 3D39D 3APDA 4YE4H 4R90L 5JIQA 3EJTA 3U1SH 4G59C 1RSFA 3B1UA 3AG1B 3UAFA 2GIXA 1IGML 1RUMH 3OV6A 3WY3A 5JQHC 2AXJA 2XZQL 3QJRB 1UTDA 1CDJA 3GHBL 3NRPA 3QJSB 4PN6A 3L54A 3ZKXC 1FGNH 1OM9A 1C1EL 3GFUA 1JVOA 2BWIA 1BVLB 4LMQI 4AJYV 4AYSA 1U8HA 5EO0B 4I9WE 4QCIB 4ZZKA 4KVCL 2VTFA 2BCMA 2OSXA 3ALWA 1DUZB 1A64A 1UM4L 1Y18B 3DUUA 3O9WA 4AE0A 5L8JB 1I9RH 1MFVA 2VLJB 4NO0D 4ZOCA 2G75A 3OLIA 1OSEA 1ZLDA 1MW3A 5C08B 3GTVA 4MS6A 3ZRCC 1VFAA 1ONQB 4O51A 2C4FU 3U1PA 3ZDZE 3HHRB 3JV4A 1HILA 1J1PL 1JPSH 3U48A 1J1XH 4H25B 2YAEA 4P2RB 3LYRA 1JGLH 1OP4A 3LKRB 2DYPA 3CU7A 4K5LA 3WKNA 4FRWA 4OY9A 3W57A 4MQXD 1EHLH 4DIXA 4ALAC 2GJZB 4KROC 1NIAA 4PG2A 3GSOB 2HMID 2RR3A 3V4VB 4OF8A 3I6GA 4NRYB 2F2HA 2OR9H 2ZD0A 2DYSB 3HC3H 2QQKL 3GMMA 1OP3H 4DVBA 3TJEL 4OFDA 4PJIA 1UWFA 3IDXH 4S1QH 2C3VB 1KC5L 3FONB 1MI5A 2HT3D 4M6OL 1DE4A 4FXGB 4XP4H 4NP4H 4YHLH 5GS0C 2EZ0D 4GSDL 4ZFGH 3FDWA 2CKBL 1T1ZA 2B2XH 3IGAB 1MVUB 3O41B 3QEHB 5F7LB 5ADPH 1TQTA 2P7TB 2XI9A 4UB0L 1CT8A 1VACB 4WW1B 3MCG1 1ZANH 2X9XA 5MENA 1U3ZA 2D2CC 5F6IB 2PWHA 3MA9H 4IRJD 5JXEA 1SXNA 4AW4A 4LVHB 4DTGH 4G42A 4ERSH 5JR1H 4I0PB 3NPSB 3V0HA 2AJVH 1AGBA 2HJFB 2LAGB 1LK2B 3RWGA 4P5TB 5I18H 1J5HA 3CQPA 1HE7A 1V3MA 5LCVA 4ZXBD 3MRMA 2FE0A 4PVBA 4KNUA 1OM3H 1TSRA 5IMMA 4PJ7A 1ZS2A 2FCBA 1HKLH 1LO2L 2B08A 5FYKH 3LNGA 3HHMA 3FT4B 4L3FA 3DBXA 1U8JA 4LOUC 1UKQA 3OX8B 1VZIA 4IHBA 4NN6B 3QUXA 5ESAA 4F5CE 1D5IH 3MJ9H 3P77A 5D1ZD 1LP9E 3O3UN 5LAXA 4WV1B 5E4EB 3VXSB 2IFFH 5J6HB 4NQVB 1E7VA 4Y7MA 5CJOH 2EDNA 3E9UA 3A47A 5IROC 4NSKA 2A9DA 4UBDC 5I1IH 4FQXD 1BZ7A 2MPVA 1G7MB 3KWVA 1AGDA 2VLKB 5E70A 5SWSA 4XB7A 4YR6A 4Z95L 4U1KB 4DO5A 2WKLA 2OCJA 3ULVL 2WWKO 3AM8A 3GIVB 3KJ6L 4TSBL 3JTTA 3QO0B 3N0AA 1WGOA 3BLKA 2DQCL 1RJZB 3M8OL 3WN5B 1OVZA 2LGNA 2PP9A 4IDJL 1NZRA 2EO1A 4HIQA 2WBJD 3SO3B 1H3UA 4RGOH 4D0BB 1S9VB 2DD8H 5C07D 3UMTA 2X70A 4NZDA 4XNMB 4BSVB 3ATBA 2OL3B 2WXOA 5BQ7A 1LE5B 5G4NA 3L16A 3KYNA 4KJPD 3SE4A 4QT5A 3O2WH 3ZPDA 1T4WA 4HK3N 4FE9A 3ZOAA 4IIZA 2OZ4H 3LXBA 4NZRL 1YA5A 4PWEA 1KCUL 4OCXH 1I4FA 2VXQL 4Y5YC 5I6OA 4PJBE 4KZEL 4ZMAT 5AZEL 1HCZA 1NDGA 3OHXB 4IOFD 2A4ZA 3KCPB 5JA9A 2YFNA 3O4LB 4XCFL 2KZ1B 5DMJB 5LBSA 5F9DC 2GK0A 4GKNB 2EDEA 2WJ7A 1NSNH 2L3BA 4FX5A 2IGFL 3GBEA 2K9FB 3FTGB 2B4CC 5K9OB 1BYPA 2HJLA 1KELH 1PAMA 2WUCH 4FFZH 1EPFA 3WTTA 3X14B 2DMHA 1G7LA 1R3HB 1R5VA 3H4FA 4E9QA 3RGVA 1JYNA 4L4VB 1OQXA 3DWTA 3D34A 2DWTA 4HWZB 3SD2A 3PS6A 3B9EA 1RVFH 3OKOA 2R29A 5LN4A 4N68A 2AHIA 4L37B 2UZXB 2YGNA 3CFTA 4D0CA 1HEZB 2KZKA 3E1F1 4HLJA 3VXSE 2C8NA 5H94A 2JXMB 4KKCC 2P9RA 3PLYA 4NENA 1C7SA 3FNKA 4WFGD 5JUEH 2F8IA 5KUKA 5HHPB 1QI3A 3C5ZC 2KERA 4I88A 1ZLWH 4UV4L 3OWEA 4JJOA 1MLCB 3QQDA 4QRPA 2XFXB 2F54E 1P7KB 1DJHA 3QAZB 1XB8A 4JAMA 5IW1B 3TZVA 2CRZA 2WXKA 4XMPL 4TLKA 5GGTL 4FTVB 4Y4FA 3GSRB 5L7XL 5KZCB 4G7SB 4CADA 3HKZA 1IT9H 4MAYD 3DROB 1ZT7A 3B3IB 3QZLA 3BAEL 4WWKA 5ISZE 2Y1VA 1LQBC 2DMGA 4XZ4A 3H54A 4NQSB 4TQIA 4BGLA 2YXWA 1T66C 4XVJL 1XF2A 1ADQA 1RUAL 4ICXA 3BGFC 4RBPK 3DSNB 2R69H 5AVRB 3VRJA 4FNQA 3FFOA 3DX2A 1KB9J 3WDHA 1U21A 2FUQA 1E28B 4K23L 4WSGA 1PU0A 3HA0A 1HYSD 3BE1H 3EYFB 1HHHB 1ED3B 4O2CA 3HVNA 5CGBA 1FFQA 2IH8A 4F92B 3L3GA 4N0YL 4NQQA 3PABB 1SXBA 3KGTA 4Y4KC 3KPOA 3H7LA 4NZ8A 5KG9A 4NWUL 3JUZA 3RVXC 3IXAA 4ISVB 1AQHA 1XGYL 4G6AD 4BH7A 5HHXH 3BCDA 4DKEH 3PPEA 2A83B 1XR8B 1XMWA 5GS1C 4CL7A 3DX8A 3UIYA 4HCRH 2FSEA 2WXMA 3PWJA 3SY6A 1YMME 2ED6A 4CU6A 3AAZA 4BQ8A 3Q5TA 3K2UH 1FGVH 3PWPB 1E2WA 4YLBA 4PV1C 4KMTL 2MMXA 4ZX6A 4QO1B 4XNXL 4IRZL 1JXJA 2YO3A 4V1DD 2XQBH 3IDGA 2P5WB 2B5IB 3PJSA 4LIQL 4NOBA 5AVYB 3APNA 1JWSB 3GMLA 4MAUH 2OMZB 4AGMA 2XRAL 2ORBH 4UZUA 1FAIL 1TQCC 5EZPA 2W8CA 3QG6B 2ENSA 1YUHA 3L3OC 1TJHL 1CK0H 3AW5A 4ODUB 5K33A 4L18A 1HHIA 4MNHA 4WCYH 3CQFA 2IALA 3CBKB 5KOMC 3CAFA 4CSZA 1X5FA 5ERWA 3CN0A 4KZDH 1WBYA 3B43A 3HZYA 3QI9A 4RRPA 1J1OH 2JB5H 4UQ2A 1CYXA 3DJ9A 2LE9A 4IBZA 5ETUA 1VPOL 4OCRH 3UIZA 4A66A 1S7QB 4XOEA 3T4YB 1CS6A 4J3OC 4CSPA 5EIIB 4JDEA 4DAGL 1CICD 2DM7A 1KBGH 4XPFH 4JG1L 4PHXA 1S2EA 3MRRB 2BZ7A 5HHNA 2VCOA 2V8LA 5AVVB 4E9RA 5JDJA 1TETL 5KANG 5EZOH 4YHYC 1F3JA 5C09B 4YC2C 1RH8A 5ES4B 4JO3H 1JD9A 1L6ZA 1WCQA 3TV3H 2PPEA 1ESOA 2K3HA 2BVPA 1H6FA 5EU4A 3ROOB 3TBWA 4LKXA 2YMXH 5H4ZA 1P53A 3CFEB 4PRPD 4I77L 3VD1A 3A4FA 1OW0C 5TE4L 1NGYA 3B83A 4X0KA 1G4MA 4KROD 3DGDA 1CLZH 1LD9A 2FH8A 2FHCA 3FRUB 3MOAH 2OM5A 1ORSA 2DLFL 1Q94B 5IBLC 1ZSDA 4X7EC 4U1LA 5BZZA 2FX8H 2NYYC 3L4YA 2KZWA 3DIFA 3LSOA 3TASA 1N6QH 4LL9A 1DCLA 5BRZE 5GJTH 2KYIA 1T0NB 3NJXA 5FYJD 5B7EA 3O4OB 5GS0D 2GFBB 1EIBA 2R2BB 4MHHG 5I2IA 2G4EA 2NNAB 3EH3B 3D08A 1A1OB 1VGKB 1YEIL 3GS7A 4WW2B 3TESA 3N3EA 4LSRL 2QQLL 4X5WA 4OLZL 4ZX4A 2P5WE 1S9YA 1YLBB 1HIMH 4G9DB 4H88L 3IPFA 4M4RB 4CVZB 2ENPA 4QHNA 3SOBL 5CHNA 3D0LB 1MJ7L 5SV3A 3IE9A 3IGLA 2YAPA 2YLHA 1XSIA 4CRPA 1BQLL 3CFJA 3NJMA 4FTDA 1B9KA 3KH3A 4OJAA 1P4BL 1PD6A 1V7NH 2EIKB 2NZ1A 3B2PA 2XN2A 4AIZB 1EUUA 5T1DL 5E51A 4AJ0A 4LOUD 4H1LH 4E5XB 5E5MA 3E2HC 1E42A 3V0FA 5E24E 1BECA 3VRLE 5D8JH 1T2XA 5EO1B 4N1HB 4ZUTA 2Z6FA 2ZWZA 3VI4F 3CX2A 4Z7IA 1F8TH 4HXBL 3E6HB 4MD5A 4HJJL 4B27A 5C8JA 1KGYE 2O72A 1IUZA 3SCMB 1XD1A 5IROD 3AREA 2RALA 4UBDD 2B7DT 5DUPL 5FUOH 2ZP0T 1JVLA 3IYLW 4X6FA 5GRUL 2GI7A 4OM0L 2FWOA 3FQTB 4M02A 2C26A 4WEBL 4G8GD 2NXYC 4DPBX 3LS4L 1A4KA 1XCXA 4G80A 3KPRB 1ADWA 3SDXF 2OXGB 2AJ3A 3MLUL 4GYBA 4N9OB 5GRJL 3N1MC 2XV0A 3S98A 1TZHA 2FBJL 5EZJA 1KJMA 4OGZA 1DP0A 5HGHB 5EEUA 4TQEL 1RULL 4PLKC 1T4KA 2YD6A 3C08L 5E4IA 5F1NA 4CNIA 3D0AA 1O7DC 4A7UA 1J8RA 3MRGA 4BKLA 5KSBB 4N8VB 4PR5A 3NAAL 2BVEA 4U7KA 4CSSA 3DVFA 1ZA6B 3I85A 1MLBA 2VISA 2CUAA 1T04A 3FT0A 5E03A 3WTWA 1PLGH 2OSLA 1PCSA 4RMQA 4A39A 4WO4A 3IKKA 3I6LE 1OT4A 3MJ7A 2FO8A 2F53D 2ZOOA 5ACZA 1UVQA 2B9AA 5MERB 1MQKL 3VXUD 1ZS8B 1NBZA 3LZPA 4JN1H 4YJZL 1SFHA 5ICXB 5J12C 1JHLH 1NMCC 1AGDB 2JJTC 4K73A 3NDYE 4MD0B 3EFFA 3L5HA 1EGJL 2J71A 3EO0B 3OPZH 4J5VA 5A2IH 2IH1A 1ASQA 3U9PH 2BXYA 4Q6YA 3QDGA 1F3DH 2CDFB 1YQ2A 1NAML 4XC3H 1A5FL 5JHDB 2MNJB 4GQ9L 3G6AA 3LNFA 1F90H 1C5BH 2XIBA 2X89A 3UTTB 4JPVL 2WXNA 4PREB 1ND0B 1MI5E 3FCGA 1WA2X 2AKRB 1BBDH 5ELIA 3KYNB 1A65A 3Q48A 4XPBH 2C9AA 4KKCD 4PP1D 1OAJA 5CBEB 5CZRA 3MLXH 3I9AA 1G7JA 5E6ZA 5MENE 1JI1A 3JWNC 3TWCL 5B22A 1R5IB 3WXWH 3FO0H 4S0SD 4FGMA 4J3OF 5E8OA 2F1AA 2JELL 1INEH 3BFQG 1AR1C 3DK0A 1K8DA 2CUIA 4U3CA 3BT0A 3CVBA 5I0DA 1A3LL 2WYZA 3FF7A 4PJ7E 1MFDH 4LASL 1BJ8A 1IM9B 2YEZA 4UQBA 2OMTB 1IE4A 3BKYL 5C2BL 2F5BL 5E99L 1TPXB 3M46A 5BVJB 3IRPX 5MEPB 5GXBB 4XPAH 4XPHH 1U8QA 2R2EB 1T66D 1GTFA 4O5LL 4JDVB 1J0ZA 3C6LC 3FRPB 2WK2A 3UZEC 2EO7A 2GI0A 3QYCA 1M4KA 3NSYA 1AMYA 4XOCA 1TQBC 1V54B 1EFXD 3K80A 4LVNC 4U1SA 4MCNA 1JUFA 3BFOA 4PRNA 5DWUL 1WTGT 4LLWB 4NXSA 5GGUB 4OQTL 5J89A 3EKCA 1GY1A 3BISA 2FNWA 3HG1A 4IQHA 1H6EA 5KSAC 5IQMA 3S8FB 1NMBL 2YS4A 4Y4KD 5FGRA 2EDBA 2R1WB 3S37H 4HUUA 1P5UC 3IMWA 4OGYH 5M95B 5CWSA 3RVXD 5C9KA 1SVBA 4GSUA 4DP6X 4G5AA 3GMRA 2Y7QB 4MSWA 5SWSE 4N1CA 1U8LA 3MRHA 2F15A 4UT9L 4OJCA 1E4XI 1A7QL 4LLAA 4PTUB 3QCUL 3S9DB 2GJJA 1I7TB 2J1WA 2VUYA 4JAMB 4PSRA 5JIPA 2KPNA 4GMTH 2VDNB 3L5IA 3TT3H 3DXAA 3WU1A 2YGPA 2HH0L 2JKSA 1UB6B 4KZCA 1FZOB 2ZSWA 3UTTE 3DRQA 5IB3A 1MSPA 3CFCL 4YAQB 3MV9D 5D9SB 5KVGH 2EQDA 2FIKB 3FQXB 2QSCL 4GS7B 1OAXL 2JI1A 4UTCA 3KYOA 4QJ5B 3FAXA 3WO4C 1J11A 4DK6A 1IQWL 2X2HA 4FFYL 4ZD3L 3RU8L 1ZVHA 4JJ5A 1QVOB 5DJAB 3PL6A 2C7UB 3FB7A 5LNDA 2MQ0A 4AYFB 4ALAH 1KLFA 1LK3L 1WBZB 3OZKA 5BW7C 3K8LA 5I1CL 3SPVB 2E9BA 3C8DA 2E9JA 1NIEA 3KPOB 3BAKA 1JN6B 2UXTA 3CPLA 3RX5A 2PYFB 2F7RA 3BAYA 3WEBA 5FYJH 4BE6A 2LU5A 4ZMZA 1CLOL 1CBJA 5D7SL 5GS0H 2DYRB 2I26N 1MFEL 1TO4A 4G5ZL 4NKDB 3KJ4B 4P2OC 3DYPA 4LHUA 1NCIA 3MRLB 1FC2D 3KDPB 2FEEI 4J3OD 4Z7UF 1M05A 4MJ6A 2V9UA 3RL2A 2IBBA 2IADA 4X6DA 1MRDL 1QKZL 5KSUB 1NWPA 3SPJA 1SLUA 5IOKA 1PX4A 1URIA 2YOAA 5ESVA 4OZHA 3FUFA 1THAA 1B90A 4N2KA 4XBMA 1H5BB 5JA8B 1BV8A 5ABAA 5IFJB 4TVPL 1NGZA 3GYRA 3I74A 5IHWA 2CK0L 2ZICA 5E0QA 4FXKA 4U4IA 4B96A 5DFTA 4QLRA 1T1XA 3CSTA 2AAAA 4NFCA 2DICA 3CLEH 3FOMA 3HZ3A 3V4PL 1PMYA 2NUTA 2RD0A 2ZUVA 3CFUA 1UH2A 3Q1SL 2CRYA 4HU2A 5LGYA 2WVVA 4P2QA 4N9GA 5ICUA 5K59E 1RFDL 5EWIL 2B3IA 2MOQA 4JKNA 5F7DA 1JS4A 3L13A 5IBLD 1S7VB 3HN8A 4E2OA 1OLZA 2NYYD 2I60H 1PNCA 2JCCA 5ERWB 2GTWB 3L9YA 3WHXB 2DLHA 1WBYB 2JKXA 5AOKA 1JF1A 4ZQKA 1G6VK 4H0IA 4JHWH 1RURL 3L3JB 4MQ7A 3DO3A 1N3NA 3ABMB 4G8EB 2E74C 3BXNB 4HS3A 3UGUA 2WLZA 3P3YA 4YUEL 5GSVB 5JHAA 1U95B 1I9JL 4K5NA 2XTJE 1F3JB 5T1MA 2DTML 2OJ1A 4BUQA 1U3JA 1TQSA 4UOZA 5IREA 4L05A 5IK3B 1KB3A 4UF7C 1BM3L 2D4DA 2DZEA 4RMTA 2E6JA 4JY6B 3O8XC 4F8OA 4ADIA 3LIZA 4DW2H 4F24A 5DMKB 2AJSL 2Y6SC 3TH3T 4NS0A 1A6WH 2Q3ZA 4HIXL 4J7RA 3WMSA 5CJQL 4X42A 4XBEH 2QPSA 2QZ5A 4JDTL 3U7WH 2F19H 2RA1A 4PLJD 2OSWA 3RLSA 1ZHLB 2C9SA 5DA4A 3HC4H 1IIIA 1FSKC 3N44B 5F9OH 4U1GB 3R1GH 1PZUB 3H7BA 1EDYA 4DCQB 5K9KA 1S9XA 4BQ9A 25C8H 1GZQB 3BEWB 4U6HB 4CU8A 3VCLB 1I3GL 1PAZA 2YSSB 4MA1C 3UEQA 2CNZA 2F74A 3ULUD 3MV8D 1OAYH 1P4LB 4GH7B 1RZPA 4S0HA 3MRNB 5GHWH 2E75C 1IAKB 2IDUA 1EJOL 1N64L 4JFPB 2NXYD 2XACC 3RNKB 3WFDH 3GXNA 1FORL 1KJ2H 4PY7B 4MGXA 4Y5XC 5DJCB 3RBGA 4Y2NA 4F8QA 4LSTH 3GXTA 2QADC 3D85B 2DKUA 4HGWA 4GKLA 4EVNB 3DECA 4JE0A 5LQBL 3IDYC 3FXIC 2EIDA 1VFUA 4X7SH 3D30A 3SEPA 3U6RB 2JIXA 1I85A 2VL5B 3NIFF 3WTYA 4AEHH 2YFOA 4I8DA 3Q8AA 4TTGA 3NZSA 3PP4L 2CR6A 3EJUA 1Z9SB 3TBYB 3V55A 2OMYA 3B9KC 4UILH 1W6LA 3SQOL 4YDVA 1S7RA 5LNGA 1RHHA 2B3RA 1TTFA 4YDJB 3H4HA 5KSVA 2GY7B 2L7UA 3MLPA 2Z93A 3IDNA 3NVQA 1J1XL 4NQUA 3KLQA 4JRYB 2B59A 3OKMA 4PV8B 5ITFA 1A6VH 1JGLL 1MF2H 1VIWA 1ZT1A 5CCHE 1EHLL 5AZ2H 4I5BA 5BCAA 1HHKA 5F9WC 4N2LA 3W0WB 5GSRA 3LD8B 3GWJA 1MH5A 4RGMC 4X8CA 4X6EA 1KIQB 4LAQH 1G7HA 2BNRB 4S1DC 1U58B 4S1QL 2CE6A 5DD5L 1E6JH 1PZAA 4MWFB 4ZOBA 2ZUQC 3N04A 4XP4L 1NBYB 2E9GA 4WJ5A 2SEBA 4YHLL 1MHHA 4FQHB 2R7EB 1KCSL 1ID5I 2VC2L 3ZE2F 2ZKXA 1CGUA 1WIPA 1I1CA 3PGCA 1AS6A 3PV7A 1OK0A 2QL1A 2HG5A 4U2ZA 2VN4A 2O6FA 5IIEA 1NM9A 4IBWA 2HRPH 3MRKA 3FHQA 3B56A 4DTGL 2XA8H 2XZZA 1XB6A 2HN7A 4RMRA 4OGAD 4Z23A 3T6ZA 2LLLA 4WO0A 4AYID 2CR3A 3VFPA 1ZIAA 4EPSA 3KBPA 3S36H 3GJFB 2X09A 2WLYA 4DKDC 4QOKB 2Z3FA 2IMMA 4MBRA 3OAYH 3P9LA 1HSAA 1KENH 5AWNL 1BF8A 1M7DB 2Z31B 3IDMB 4PWHA 2BERA 4XZUB 3C6LD 4TNGA 1AMXA 2LLNA 3KWXA 3RURA 2CPCA 3ZDYF 5A40E 3QIUC 5AKSA 2X3AA 4FP8H 4PRIB 4ZMVA 1AR2A 4KQ3L 4PI0A 4ANKA 4HULB 2DAVA 3IEAA 1EANA 2JK5B 3P73A 4PV9A 3GIZH 3L1FA 3M1BB 1K4DA 2BSRA 2YN3A 3MPCA 4WI4A 5D7JC 4MLSA 5E94A 5KSAD 3NFSH 4NHCL 4TUKH 4JFYB 1PQZA 4XNZC 1F6AA 3F5WB 3RTQC 5I16B 4KX9A 4W1TA 3BUIA 2YIHA 1XF5B 3Q2WA 1E43A 3O3DB 2VABA 3GRBA 1CE1H 1N8OE 4GIOA 4YDIL 3VE0A 1KIRA 1OO2A 1RK1A 2EAEA 3HPLA 4NJ9L 4L1DA 3WFHA 4ZMPA 4J3OH 4QAMB 4A7QA 1XIWC 4OZGA 1GZPA 5IHBA 2XHNA 4K5PA 3THMH 1URLA 1QLFA 4YHIA 2Y3NA 4XN1A 2A99A 8FABB 1O9VA 3T8MA 4FMFA 4DZBA 3KZ8A 4DGVH 5J6GA 4WY7L 5KVEH 5FLVA 4YO0A 5JXAL 4W9ZA 1XL6A 2W65A 4ABUA 1OAKL 3LEYH 3WHE0 1ZHBB 4W9IC 4LCIH 1A9EB 2OZ4L 4WK4B 5F7YC 3UPRA 5E8PB 5ALBH 1VLXA 4OZFB 1AD0B 4IHOB 5SX4H 3BMVA 3DO4A 5IV2B 3WENA 3C8KA 5CN3A 3MNDA 2QKIA 3SPIA 3KG5A 4U6YA 5FHBH 4P04A 4S2SB 4HF5H 2AXWA 1WZLA 1UEMA 1J87A 3S2AA 4NKIH 3US9A 4NLHA 3ZLQC 4JG5A 5AUMA 2R0LL 2X4NB 4X5XA 4P2OD 1T1WA 3COOA 1QLEL 5JPNA 3VMPA 5CEXA 4WIQA 3QDGE 1BIHA 3ETBJ 3LXUX 3TEXA 2CO3A 4YSCA 1F6LL 1YY8B 3QZWB 1MFMA 2J6EH 3F6IA 2DWEA 4XN4A 1A3RL 2ZONA 1KGWA 3F04A 4ZO8A 4EN3A 1DN0A 4AKPA 3TH4T 4PRIE 1WZ1H 4YE0A 3HZMA 3MRFA 4MYWB 4LRNL 3BP5A 4PJAB 4UQ3A 3MRCB 4Z7QE 2GSMB 4I4WA 4A7GA 1JTOA 4DEUA 1BZEA 2NYKA 1SBBA 1GAFL 3CVHB 3OD3A 5G4OA 1AXTL 1IBYA 2V2TB 5TDOB 2WLMA 2R39A 4LLUB 1P7QD 1H15A 2GJRA 3KYMB 3RGHA 4PIBA 5JUEL 1OHZA 3IF1B 4EOWH 4OFIA 1FO0H 5C0AA 4GEIA 1V5JA 1FRGH 5D7HA 5DJXA 3V0WH 3QRLA 4E41A 2I9LB 3ZT6A 2BP3A 2JTDA 1ZXKA 1Q4NX 2CJ3A 3HAEB 3MRDB 3QJTB 1CFTA 5AAMA 1MCWW 3HKFA 1NDMA 4O9HL 5L2JA 3TX4A 4TVSa 5DJ0B 5FYLE 4O58H 1ACZA 4TPRH 2X9ZA 3EDJA 3ULUH 1NAMB 2BFVL 5HVHB 4OCLC 3IFPA 3MJ9A 1I7RA 4DT2A 5JOEA 4AMXA 3QJXA 3B6SB 5HYJD 3FCSB 3PGDB 1VJSA 3JYBA 3VFVA 1RL1A 1H8LA 3QCTL 3L1OH 2XXCB 4PJHA 4PJXF 6PAZA 5E00A 2CQVA 1KB5H 2EXTA 5HGGS 4J1UA 4PVMA 4RX4A 3HG1E 1UYWL 5JIMA 4HC1L 3EXJA 2PPCA 2NY2B 3HCVB 2G9KA 1LO4H 4PB0H 3U79A 3WGUB 3OVUB 2P26A 3BO8B 3D3VB 3SE9H 4WGVB 1QBAA 5HHXL 2CDGB 2WLNA 2GYSA 4LSDA 1YQVH 2VDKL 2HYMA 2Y6SD 4DKEL 3VDAA 2H1PL 4HEMA 2H26A 3GSNH 3LPOA 2VR7A 5DUBA 5DEFB 4I2XB 1TTGA 2O6EA 4HCRL 3LNIA 3ESPA 2M26A 1X44A 3CDYA 5IBTH 2H3KA 4ORZC 2XCMC 5CU9A 5KVDH 3DXAE 4GRWE 2C9QA 2DLTA 4JVPA 4PWGA 2RBLA 1NC4B 5DK0A 3KNBA 4EIGB 3HB3B 4K7PL 3VXPB 1UA6H 2IQ9H 1QEWA 4HS3B 4HWBH 3FRPG 3QNFA 5IMKA 2EO9A 3SKJH 2O61A 2ICWA 4FOMA 4IKLA 4TOYH 4N2EA 1FCCA 1HHJA 3GXMA 2B0SL 4WRLA 1FNGA 4XWGH 2ETWA 3LRGA 3WS6A 1CU4H 3AU0A 4AMKH 2BSED 4WCYL 2A6KA 3W9EA 4GG6F 3B34A 1B2YA 2QADD 3RWEB 1ECZA 3T0EA 5F88A 5K9QI 2OXHB 1MWAA 4CMHB 4KZDL 5F9JB 2CIIA 4DPAX 1QSFD 3O45A 5D7IF 3HN5A 5FO9B 4JNXA 4OCRL 3QFGA 1IAOA 2E7LA 2A74A 3QDMA 2VDQH 5HGDA 4APXB 3DRTB 1UEYA 3EG9A 5J1AA 1PKQB 2EC9T 3UCQA 2YD1A 4LLMB 2K4WA 3JWNH 5E2VL 4NUGH 2R0KH 4ZAKB 3TN0A 2EVIA 1G7QA 4U05A 3B9KD 4JG9A 4RBPH 5EZOL 4DESA 1X9QA 2QQQA 2FEEL 1XH0A 3D0VA 1J0YA 4OZHE 4NP9A 3LIUA 2HLEB 4L9LA 3QVAA 4NO5A 1FNSL 3OL2A 1K6QH 5F1IB 4LCCB 5PAZA 3RAJH 1E27A 3VXTA 1YJDH 4YSQA 1JF5A 1N4XH 3OF6D 1I8MB 5DT1H 3FT3A 1UD2A 2VERA 2XQYA 4IU3B 3KL3A 4KGJA 1NPNA 1MCLA 3LEXB 1ZGLM 1D5MA 1MFAH 2GT9A 3FUEA 4Y4HC 4ZO9A 4BFNA 5BS0D 1BQ5A 4P2QE 3W82A 2ZUWA 5BV7B 1FG2A 4C47A 4JO1H 5FGBA 5DEZA 3FU3A 4YQXL 1IEBB 4LCWA 1VENA 1NPJA 3KGRA 2X5PA 4S1DD 2H0EA 1JE6A 3CHOA 5GJTL 3MUHL 1BIIA 2JCCE 3NZ8A 1ZHNB 4PUBL 1MZZA 3V8CA 1DEEB 4NX0A 2BSSB 3C6EA 3OM3B 2HTLC 4KXZH 4LPVA 1LE9A 1GZHC 5AZUA 4Z9KB 3WUWB 1ZVSA 4ZZFA 3QFJB 1WV7T 3OJVC 2WW8A 2DWYA 4R83A 1HIML 2G5BB 2W95A 4Z76A 2GY5A 3QT2A 3SDAA 3LPGA 2E46A 2MH4A 3HRPA 4OLVH 5HJ3A 1A7OL 1JDDA 2AZAA 4PJGA 3O6FC 2D0HA 2IAMA 3WIHA 7FABH 1LNUA 4P48A 3V4PB 3VFTA 2W9DL 2OMBA 2XWJA 4CC4C 3RX7A 3EXLA 3IJSA 2KUTA 4QRRD 4WUKH 3TNMA 2VOTA 5JMRA 1F02I 4W4NA 3L3DA 4EI5D 2VE6A 5EA0L 2EEBA 3QIUD 4NN5B 2C3XA 2V2WB 4NO0A 3GXIA 1R47A 1BM7A 3L2LA 3DIVA 4R0LC 3FU0A 4P46C 1FE8L 1MCOL 5D7JD 1A0QH 1RZKL 5AB2A 4X4XA 4YBLC 1A4JB 4W93A 3RTQD 1JHTA 3CNKA 1P7BA 2GK2A 1XGRA 2VM4A 1KFAH 3WFBL 4R7NB 1LO5A 2CBOA 4Z7NF 1K2DA 2E5EA 5FOBA 4D9QE 5C0GA 1K5NB 3N1QC 3K5RA 1A7RH 1I8KB 2NSQA 1AQDA 2I9TA 1NKOA 1XIWD 1T2JA 5FA4B 3IMUA 5E4AA 3NEEA 1XR9A 2RIKA 3ZR6A 3QIWA 2WUBL 5DHYB 2DQ6A 2EUVA 5DZLA 5IFAH 3MRBB 3S35H 5CP3H 1W2KT 3Q6GH 2VDMH 4QHLA 4RVBA 1ZA3A 4F15C 5I0VA 1JFQH 2GBTA 3FU9A 4E36A 2PO6B 1AIFA 3JUYA 3L9RA 2GTZB 4DWHA 1M2VB 3HNVH 4LK4A 4R26H 5D7KE 5ANMB 3V4UH 3RVUC 1QI4A 4U0QB 1TU2B 3AS2A 5I8CA 1PLGL 2VDLH 4LPYA 1R3KB 2RMNA 2N59A 4DF9A 3QFJE 2P3YA 1WS7A 4IGBB 3VGFA 5KBKA 5HDOA 2AZUA 4A37A 4KO7A 3S4SB 5EBMB 2Q86A 4HWNA 2D8KA 1NC2B 4QYAA 1YEWA 4YFDB 5T3XL 4LO9A 3L95A 4PJDB 2WGNB 1YNLH 2VABB 5C6WH 1GA2A 4HK3J 3EJQA 3FO1B 3HBQA 4PRDB 3OPZL 5A2JH 5DRWB 2Q3AA 3U9PL 1KPRA 4MZ2A 2PKDA 1EEQA 3FS9A 3GRGA 4XC3L 4XRCB 5SWQB 4NERA 2LTQC 4OU3A 1E9OA 3WIFA 1F90L 3IKCA 2W9EH 2UXVA 4L8DB 5HDBF 4HUVA 1CD9B 4L3ED 4J3WA 1ILUA 2FDBP 2IDSA 3L5XL 3V6FA 1QX1A 1ZJBA 1BBDL 2GUOA 1T83A 2P8MA 3UO1L 4IBLT 3LB6D 2E8ZA 1A7BA 3UYPA 3U7YL 1QACA 3ARUA 2BY0A 4GFXA 3MLXL 1D5BB 1OAUH 5KBNC 3N9GL 2ROYA 2XVBA 5ABZA 4ZMXA 2APVA 2HRGA 4P23A 1U6AL 1ZGLP 4LLVA 5ENWA 4HS6A 1S7UA 4F7PB 2VLRA 3IFOB 5IJDC 1RUKH 5KYXB 2ENQA 1PIFA 3JZ7A 3OMIB 1A6TA 2VDRL 2WBJA 4AQEA 1C7TA 1MFDL 1Z9PA 4IKJA 4DK5A 4GUQA 5L2KB 4QF1A 2A9NL 2BFGA 4QJ3B 5D7LD 2JF1A 4HJGA 3MLWH 5D1QB 2RHEA 3O2DH 4TSCL 3LZLA 5HHOA 3QA3B 2EEFA 3PWVB 4TUOA 5AVSB 1GSKA 2A4EA 3QCVH 4H1LA 1VZHA 3HZKA 15C8L 3GRWA 4N8CL 5CEXB 1BQHB 3FO2B 1DDTA 4R7DA 5M94B 3POHA 4K3GA 1X5MA 2WVSA 4PIRF 1BG1A 1KUMA 5J6SA 1WC7A 3QRBA 2GSIB 2ITCB 3T2NH 1F18A 2O6DA 3POCA 2H2PC 4JRXA 4PP2B 4Y2DC 5EU5B 5IJVA 3L7FA 1IVTA 1ZHKB 3VXRA 3BYYA 3BP5B 1TIUA 4F9LA 2VC2B 2YJLA 1T22B 1A7PL 3LKQB 3O11B 4H8QA 1V7MH 2E27H 2NR6C 3NCMA 1WYJA 5D6CA 5C0FB 4L0PB 3QG7H 3NOIA 1WD8A 2XV2A 4JZNA 3JZYA 2X0VA 3O3EA 2WQ8A 1ET7A 4PGBB 4Q58C 4MFHA 2NMSA 4NDMB 4JM2C 1E67A 1S7WA 5TDPA 1HHGA 1PL3A 5MP6L 3ZKNC 2BDNH 4OZGE 1J0JA 4I1PA 4WKZB 1OZTG 2QHLA 4F20A 1RJYA 4C57C 2PW2B 1JPEA 1DJWA 3NA9H 4U1NB 3K71B 1CE6B 2KMWA 4Z3EA 2HFGH 4Y19D 3UC2A 5B3NA 1UFUA 4IKIA 1MFNA 3VGDA 2XJLA 3LKOA 3GB7A 2VH5L 3OGCA 2X1OA 5KVGL 4K3DH 1NDTA 4XVTH 1AHMA 1MAMH 1Y6NR 3P4NA 1HH6B 2ED8A 2DMBA 4RA3A 3BKML 2WWKT 2KI6A 3UJIH 2FQEA 2X7LB 1BD2D 4CSTA 4QD2E 1ROCA 4JFFA 1SM3H 2P8LA 4XN9A 5T5NF 3ARFA 3KPPB 3WKPA 2X4OA 5E6RB 2DKMA 2XNAA 1JRHL 2H2SD 1SXAA 4IK6A 1G0XA 3STZB 5G2NA 3PIQA 1Z5YD 3HS0A 5KBDA 3T2PA 1FDLH 5E5UB 1B4LA 3I9GL 2OMWB 3IPEA 5I17B 2WVUA 4PGCA 5GS0L 3SHSA 4WI0B 4F7TB 3MLRL 4K07A 4PJFA 5JW4R 4YHML 5JW5B 5LWYH 4HFUL 3NSCA 3HR5A 4FFWD 4B9JA 2CLRB 4N0FA 3QQXA 4GIAA 1FFPA 4L4TB 3ECUA 5HPMA 2FJHA 1BX2A 1I9IH 1BW8A 4K94L 1CFSA 3V5DB 4A6YH 2Y7OA 1ETJA 3S5LA 2O61B 5K39A 4WNQB 3ZXAC 4S1SH 4RAVB 1FFOA 3B7RL 4MCZA 4OZFG 1S5IL 3QWQB 3QZPA 3UTSB 2Q7YA 2CKBA 2VO5A 3ZDZF 4Y4HD 5HHQB 4FA8A 3HW7A 1GHFH 1HXYA 4J23A 3RPIA 3UDWA 5FEBA 1E9PA 5C0AE 1WF5A 5EZIH 3FU7B 3WO3B 1WFTA 4HWEL 4BGDA 2C1PA 2GJ6B 1UJ3A 2I60L 2N01B 4E41E 2P8PB 1P1ZA 2EKSA 5FYKE 4QRQB 3VI3F 4HSAC 1NFDF 1U3HC 3MROA 1ZE3C 5IEKA 2AEPL 2ZX5A 5DJ6A 2NY3C 4AH2B 3EYVB 2HTLD 3NJIA 1D7BA 1PZBA 2O5NA 3VACA 4MB5A 2F1BA 5HGDB 3WCYA 4J3BA 4QTHB 2X40A 4PJ9C 1CDYA 2OLDA 3QZWG 1MCDA 1DLHB 2ZAIA 5D1XB 5F7MC 1G7QB 3K74B 5EUKB 1NH6A 2DIEA 2FGZA 2UZPA 1L5GB 1ETZB 3JVFC 2VDOH 3U25A 4PJHE 2MCPH 5CZXC 5ICZB 3Q7JA 4JPKH 5EN2B 4ZFOA 2ZOLB 3O6FD 4PJ5D 3T3MB 4ZMYA 3VB9A 3I02B 3T4AA 4XMLH 3AQXA 3H8NA 3NQIA 2D7QA 5EF0A 5BUAA 3SY0B 3V6OA 1A6WL 4XBEL 4Y2OB 2OQJA 4MNGB 1KY6A 4HEME 3P0VL 4IOSD 2NSXA 2C4XA 4ELMF 1NOFA 2EH8H 2Y0SA 3F01A 2W0PA 3RUGA 3H9ZA 3RZCB 2YD4A 4X0NA 1E5BA 3BKJL 5T1KB 5TK4A 4YBHA 5L6YL 3IGFA 1MFCL 4O4YH 5CD3B 3LDBC 5LB1A 3RWJB 1UH4A 1XCQA 4L4TE 5CCJA 2VW6A 4LEXL 5D93C 2XXGA 5AW1B 3KPMB 2G5UA 4I48A 3VB8A 1NMAL 4HUKB 2UZYB 4P4KC 5I0ZA 1DVYA 1OAYL 5DD0L 5JPMB 3ZK0A 2BP8B 4KGLA 3VDBA 1DQJA 3ZE0F 3II1A 3D39B 4YHOH 4I13B 4IMLA 4B9KC 4HKXB 2P80D 3LZNA 2FD6H 4I9WD 4TTDD 2YPKB 4LSTL 3ZTJH 2C1OB 1LNUB 4I3GA 2YLKA 5C0CA 2XWJB 4R5XA 1U91A 2VXQA 3T0EE 5FA3B 5D72L 1GGBH 5D55A 1DVXA 1IGFH 2G2RA 3IFNH 4Y7OC 1BXAA 4JANA 4KV5E 1B4JL 4OJFH 1MVFA 3QS3A 4Y16C 3QQ3B 1T2QH 4U1IA 4EEEA 3T3PF 3NZHH 3QDME 5L9DH 2CRMA 1MAJA 3DV4B 3RVUD 4DP1X 4DZ8B 4Z7VA 3RYMA 1OSZB 1RUPL 3QUYC 4KK9C 3VX0A 3RL1A 1XDTT 4NKOB 1RZ8B 2DQFA 4AYEC 3INUH 4JM2F 1V55B 3MBWA 1BEXA 2VKWA 3DX3A 4JFQB 4P9ML 1TLMA 4ELKB 5IR1B 4M8UA 5TK2A 4LQFH 4EZLA 1JHTB 2VZVA 4LDEB 5JW3H 4OAWB 1MCWM 4P3DA 2BC4A 1MF2L 4KQ0A 1UD6A 3HLAB 5B1JC 4BFFA 43CAB 3V0GA 1MRCH 3PU7A 5EEYA 1AD9B 5D96C 4G6KL 4A2MA 1FL3B 2VSMB 1KTRL 2QEJA 5F6HI 1A9BB 3MV7A 4NPKA 2XVGA 1H9DA 3SKMB 3OMZA 5EB9A 1GMEA 1O9WA 2D31A 4HG4K 2DWDA 2E6QA 1UD8A 4BCZA 4LCWE 3QW9A 1AANA 4Y9FA 5AYQA 1OCRB 1R24A 1UT2A 3RWCA 1RZIA 1KJVA 1TT6A 2YBRA 1EMTH 2JMRA 5DUJA 5FW6A 3VO0A 1QFHA 5IROA 4FL4C 5D7EA 1RZ7H 3WFCL 3G6JA 3VD3A 4Z3GA 3CN3A 4KJWC 5AENA 2IOIA 4IRJB 5CMAB 3MNVB 4M7KL 1D9KA 4M1CC 1H3VA 2XA8L 2ZPKL 3DI2B 4OD1L 3GQFA 3T5WA 3OR6B 4P5MA 4KKZA 4EMZA 4ZXBB 2Y06H 1NEZA 5ID1B 4NWTH 4NT6B 3S36L 3PUCA 4LVOC 4PJGE 1L9OA 1J48A 1CGSL 3M6DA 2ZKYA 3D51A 3EGXA 3NJGA 4J12A 1IFHL 2YMOA 1OE2A 3REVB 5E8NB 4JFUA 5E4OA 3R4DA 4BFOA 2NDGA 3U0PB 4MMXB 3LN9A 2J55A 4NIKB 4G6JL 4UT6H 3MXVH 3QJVB 3WS3A 3DX7A 4LSPH 5D1ZB 1XF4B 3R18A 3FHEA 4XNYL 2PTTB 1GRWA 4FP8L 1ZDSA 5B3JE 3WE6B 5IVZB 5J9PB 2H2PD 4KUZL 4Y2DD 4C56A 1DFXA 1F86A 4KX8A 1CGVA 1X9UA 1BFTA 4XBPB 3ZMRA 1NAKH 5ID0B 3CSFA 2B1AL 4D2NA 4TUKL 4JPIB 1BFOA 1Q9WA 4FQXB 2NR6D 1M42A 4TS6A 4CKVX 5A3IC 2HT4D 1YYLH 5BOJA 1ZT4A 4UYQA 2V5SA 4Q9RH 1N0XL 3DOSB 4OQ1A 2XPGB 3TXAA 1HI6A 4QWWC 1KJ2A 5DJYA 1YZZA 4JM2D 1XCWA 1T7XA 1WDAA 2OW6A 4LCYA 3FUMA 3WIIH 5AD0B 5HI5C 2DOCA 1AKJD 3ZKND 1BFVH 1QEXA 3I3EA 3RHWF 1E5YA 1JZJA 4JQIH 3WJJA 5KJRH 1ACXA 3NFPB 3LH2L 1ZV5A 1V3KA 4WEUD 5C07B 1KG0A 3O9WC 1QYGL 3Q0HA 2H7WA 4JB9L 4XPTH 4JFZH 3NIDB 2OMVA 2F5AL 4OIAA 1GW0A 5KVEL 4JDZB 2AC0A 4HIEA 2R2CA 4ZUUA 3KM1A 5JOPD 1F4YH 3LEYL 1YN6A 5IFHL 1PJ9A 2NY1C 4UWQB 3V2AR 1KIUA 2XWBA 2ZYIA 1AI1H 1WC7B 3VI4A 3QYMA 3KPNB 3OKYA 4N6RA 5ALBL 1RD6A 3C5ZA 3NFNB 4NO3A 3MRIA 2ZCKL 3LVTA 1CQYA 5KJ7E 3T2OA 4TF4A 1L9RA 4TNVK 1GGCH 3CH1A 5BZWB 3U46A 1DL7L 4D8PA 4QLWA 2WWNA 2DQJH 2CJUL 4ZOAA 1BEYH 5IEHB 2DDQH 4MA3A 3VXNB 1M6OB 4OCYH 3MODL 1DQML 1WFJA 3VAEA 1TJMA 2PNDA 4AQ1B 1FV1B 2WKGA 3HR6A 1X7SA 3MV11 3SDXA 3CN1A 3PHOA 2FGWH 4F27A 2ZWLT 4JFDA 3WEXA 3L7EA 3L6FA 3B7SA 3MA7A 3V52L 4NZJA 5C3LD 5LGKA 4LF3B 2QJDA 1P9MC 2AQSA 3FT2A 5KYWB 2E7BA 4XMKL 5F89B 2YAQA 1UWEH 3IBEA 4NIYE 5E6IA 5T33H 4AJWA 6CGTA 2ITEA 2PCFA 3D4GA 3MREB 2XG5A 4OKDA 5CSGA 3TBVB 1PNDA 3MGTA 4LBEA 1AVAA 5KYUA 4A55A 3AXLB 1SMOA 3WLBA 1ZJAA 5C0BA 4BXSV 3AG3B 4LLYA 2J57A 5ISZD 5GS1A 1WK0A 1AZZC 2W07A 2GEEA 4G43B 4HJSA 3FUHA 1FRGL 5T1LA 1LEGB 3QUXC 2XX1A 3EH5B 4OIIL 4URKA 4X6CB 4Z7WB 1UQSB 4MAYB 4RAUA 4IS6A 1HXMB 2QSTA 3V0IA 2GHZA 5F72S 3FSVA 1U3HD 3MV9A 5AOIA 5IB2A 1Q0YH 3OHMB 1WFIA 3HI6H 4PYHA 5HHOE 4AM0A 4O58L 4DN4H 2NY3D 3ULUL 4XBGA 1Z3GL 4O2FA 4PJ9D 3JV5A 5AW0B 4OT1H 1B0GA 1U8IB 3KW7A 4X98B 3VD2A 3UAAA 1VERA 3QNXB 2CGZA 1AO7A 4JRXE 4M62H 2MKLC 4UU9B 4G7RB 3L3OA 1KB5L 3VXRE 5CZXD 2XA3A 3FCBA 4XX1E 3AM8C 3SE3C 1M1XB 2JI3A 1N7ML 1HS6A 2IXQA 4NCDA 4ANVA 3O3AA 5B4MC 1KTKE 2XIDA 5J1SC 3N1FC 4UOW1 4HT1L 3C5JA 1Q90A 3OB0H 1MHCA 4L3CA 4MJ2A 3GSNL 4IBQA 2H9GB 5I0YA 3DHPA 2YKLL 1OZUA 1E9PB 5J1TC 3SE4C 3WDIA 2H0FA 1NCJA 4NRXB 2O5ZL 1TYRA 1XO8A 3TO4C 2DIBA 3F58L 3HFMH 4JS7A 3ZZ1A 2G9HA 3ETBF 2F18A 1CZ8L 3SGJA 2UY7A 3BVUA 3GZQA 1IFGA 3LZOA 4J2QA 4Q0XL 5DR5H 4F8NA 1IL1A 2EDRA 2Y5EA 1A4AA 1FVCA 3UTZB 1JV5B 3VJ6A 4V1DB 4FJYA 3TBCA 4FHKA 2J8UA 1BQHG 1IBFA 3TL5A 4P4KD 1F11B 3NGBB 4YIQA 3FMGH 1F4WH 3IT8D 3SKJL 1WEJL 1HC1A 1UM6H 1UADC 5J11C 2R0ZH 5CU5A 5HJBA 4WFGE 5CS7A 4JKLA 3QNYA 4ZSOB 4CW1A 3CSPA 2W88A 4JFFE 3G9AB 2HT2C 3NJKA 5CIPA 2IO5A 2F58H 4F2FA 1SJVA 3RY5A 2WXJA 3BSZH 1XB3A 2YBGA 3FF8A 5LNEA 3UG3A 4NHUB 4XCEA 4DVRH 3P9WB 5ALCH 1BREA 3ZKXB 12E8L 4WI8A 1CR9H 5DURD 4NRZB 4QGYA 3LPFA 2QVTA 5I6NA 1C16A 4Y16D 1CICB 4HIJA 1C5CH 2ICEB 2NY7H 4FYRA 3UZVA 3UCRA 2Y2WA 4L23A 2VKXA 3U4EA 3BWAB 4JBSA 3QUYD 4KK9D 1CTNA 4U1HA 4WSJA 3ZRFC 1KWKA 2EILB 5I1JH 3QBTB 3SPGA 3JWDC 3X11B 4I85A 1AZUA 4B53A 4LP8A 3PJNA 1BVNT 4L1BA 1JZ6A 4PRPB 3RAJL 1DHKA 5FM5O 3TZVC 5F0MB 1YJDL 3PDDA 4CN1A 5BRZD 4Y4FC 2YPLA 1DQJB 5AB9A 4HMEA 4G2AA 4KROB 4O02A 5D2NA 1ZLVK 1DFBL 4WWKC 1Z5HA 1FO0A 4IMLB 1F1DA 2X0UA 1EEUA 2L8AA 2Y7SA 5DDHB 4YSSA 4G9FD 4JO1L 1ZEAH 4KDWA 1FZJA 4PY8J 5DEGA 3CSGA 5HP5A 3MR9B 4DH2A 4FQJL 2C34A 2AMUA 4XVUD 2VN7A 1AQKL 5IW6A 5LXVA 1U8NB 2G2RB 4QDGA 3RIFK 1MCJA 1HL8A 1S4IA 1YNKH 1A6UH 4GXUN 4Z7UA 2E4TA 4U7MA 2HCZX 3CZEA 4YXLL 4U1IB 3UX9B 4OSUH 4OD2A 3QPXL 2WB7A 3MBEA 2H1LM 4TSAL 4OF7A 4KJWD 1EZVX 3MJWA 5FW8A 2X88A 4PJIF 3FUKA 4L29A 1CDHA 2QELA 1D5RA 1NIBA 2EE2A 2QV2A 3SQBA 2RTTA 4M1CD 3TNNA 5I8EA 1BA9A 4QYOA 1I1FA 1QO3A 3WIAA 1HZKA 2AQ1A 3BDBA 5CGYC 1P4IL 3RIAF 4G3YL 3WSQL 2JQZA 1GS8A 2HJKB 4PPTA 5AL0A 3J7HA 5GGRB 1DBAH 2ZX7A 7FABL 4DGYH 2ARJA 4ILDA 2X9WA 1C08B 1II4E 5AEAA 1OWRM 4JKWA 2SODB 1N5AB 1ZGLA 4H26B 1C12B 2EYSA 3N1GC 4IU2A 3CFIC 1CCZA 5FOJA 3V6OE 3HS8A 5CN2A 4WUKL 3KYKH 3II3A 5JHLH 4A1RA 4GINA 1RU9L 2DWDB 4N2DA 1NLDH 1UACL 2EDXA 5IB2B 4DNLA 2DQIH 4N0UB 1T0PB 1RZIB 4Z5RA 3BVDB 4AIEA 4XX5A 2ZXBA 4J28A 4J3VA 2ZUSA 3EBHA 2FTAA 4L4JA 3GDBA 1OGTB 2BOBB 2R27A 3ZT7A 1DZBA 3V5HB 2BINA 5L88L 5A3ID 1KXTA 2PPDA 2IC2A 2JJTA 1BMWA 4G8GB 4U6XB 1QSEA 4GAJH 3SDDC 4BRJA 4AIOA 5BMFL 4BINA 3A6BL 5IHLB 4QWWD 4J3TA 3U0TA 2VAAA 3QI9C 5FDYA 4UIMB 5LG6A 3OAUL 1UJTA 2BOCB 2XWCA 4HCFA 3PWLA 4W70A 2BP5M 4LEEA 3I6KB 4LT7A 1OLLA 3AY4A 5ACMA 4QY8B 5I1GH 3WYRA 4BZ1L 3CBRA 1MJJB 2BJML 4F7MA 2R2HB 3O9WD 4HH9B 3I6LD 3P69A 3VFUA 1AFVH 5FYJE 2V5TA 1A1MB 2N7AA 1ZLSH 5KANI 2Z8RA 3Q6GL 4DP5X 5FKAA 5F7NC 2IG2H 3QULB 3ECBA 3UAJA 3I75B 1MREH 3PGFL 3HNVL 2B1HH 4JFTA 2NY1D 4XAKD 3V4UL 3PDOB 1ZVYA 4KOBA 4Q4EA 3UEZA 2VM3A 4Y5YB 5B1AB 1H9VA 1SHWA 2F53B 2DYPD 5F7AA 3Q9QA 3ZO0A 3ZHNA 4RGNC 4ZS7H 1LEIA 3Q2VA 3VXUB 3ZZSA 1U2YA 1JWUA 1MIEH 3R8BB 1E5CA 3PXHA 5E9DA 5IWLC 1FZMB 1JZFA 1KEGL 4PMEA 1YNLL 5CNHA 3TYGL 4CMMA 1JXFA 4H8PA 1ZE3H 2EIBA 1MI5D 1QLRA 4DERA 3EOAA 1FPTH 2DJSA 2AQPA 8PAZA 4ZUVA 3P2BA 1M71A 3MV7E 4QIRA 3TCXA 4AENB 4AGQA 2H0PA 1M7IB 4GAAA 3HI1B 4MHHI 3RWIA 4DKAA 3ZZQA 3ATFA 5MEND 2E76C 4NZTL 4FABH 5HPOA 4BHUI 2D7MA 4J8RB 5JXED 3NCYP 3CBJB 4HOMA 4IW4C 2VQ4A 5KSAA 2DQMA 5AYUH 3RY4A 3KLAA 4XTRD 1CFMA 5DMGC 4DUWA 1RP9A 3NN8A 3TA3A 1YVLA 4ONHB 3VI4B 1ZLEA 1KJ3H 1PY9A 1G6RL 3ESVF 3FQNB 3FW6A 4G8GE 2FQDA 4WU5B 1KBBA 5IQ9A 4HP5A 3LN5B 5E7FA 2FJFB 3F7QA 3VGHA 4L5FL 3PAZA 3QUXD 3X3GH 1PYWA 4D7PA 4G8IA 4YSAA 2YQ2A 4WF7A 3LN4B 4KNTA 1DQKA 2EH7L 3O2DL 2G60L 3SDXB 4JUSA 4V11A 5G5DB 3BGFB 3F83A 5TQ0H 3ES6B 5D71H 3H9SA 1S7SB 2Y5QA 3LVEA 1VSCA 1EFXB 4GRMA 1OPOA 1NCWL 1SDDB 2NUPB 5HDRA 3SDCB 1N67A 4RDBA 1XGQA 3U0WL 4QHPA 4F58H 5BW7A 2WSPA 4YHNA 1E3FA 3GSXA 3KS0J 4AVIA 5CP7A 4Y4KB 2IANA 3JV0A 3V5KB 1AAJA 3QORB 1V7ML 1CBVH 1XGUA 2E27L 2EUWA 3WNJA 1TJIH 1G5GA 3A3YB 3DNKA 4UI2A 5DYOB 1OWWA 4MXVF 5B4MD 3P4MA 1BZQK 3QS2A 3SPHA 4L3AA 3HOGA 4EUPH 4JCLA 2DY2A 2LFGA 4K55A 5J13C 3ASNB 3FH7A 1INQB 1YEDA 4AV4A 3MGOA 1RZQA 1JNLH 1ZTMA 1JZHA 3TO4D 1OF0A 1RZJL 3EJJX 2DBLH 1ZIBA 5FCUH 3BZFB 1TXKA 2NQDA 4WO4C 3NP4A 2WLKA 2P5PA 3MI6A 1W72L 3NJLA 3R0MA 4XNQB 1I53A 5EIQA 4Q6KA 2AK4A 2D7NA 2WN3A 1UWXH 4XBGB 3ZKMC 2QVMA 4E9SA 1YDPA 2AV7B 1NGXA 1QBLH 3DMMC 5DK3A 5HD8C 1I75A 3PHQB 3S5ZA 1IBHA 3QJOA 3BP4B 3OKLB 1F58L 1TQCB 4FNUA 3VI4E 4EZKA 1MRFL 2AXFB 2UWEB 3TA4D 4JCWA 4QKXB 2HT2D 4XP1H 1MHEB 3GSWA 2DIAA 3DPBB 4Q6IB 1X7QB 3VSTA 2N0KA 3RGVD 4M4PA 3L3IA 4X4MA 3VXQB 4ZPVB 3X1EA 4JJHA 3FOLA 4K5MA 4TQHA 4AL8C 1FFRA 3G5YA 4GP5B 1T0MA 3TIEB 5JO5A 5C0NC 1H6UA 1U3YA 1B0RB 2CBTA 1DVSA 4GW1A 5MEQA 5ICYB 1M7UA 2YA0A 5HYIA 1NKGA 4N0CC 2YR3A 3KHQA 3SDXE 4KQ4H 5CCKL 2ZWSA 3WAJA 4WFED 3FL7A 2WNKA 4HX1B 2G9HB 3K6FA 1SJHA 3MLTB 3NBNA 3FFCA 1EXUB 3U4BL 3DTXA 2Q6WB 5EG6C 1AJ7H 3KEDA 3MUGA 4C4UA 2EYTB 1D6EB 2OMUB 4H1LG 4CJ1A 5ECGA 5IP4A 3GGWA 4L0YA 5EOQH 2QSVA 1J0KA 4Y5VA 3U83A 4QRPD 1JOIA 1FBIH 3CCHB 1I9IL 3TZVD 1NGPH 3O8XA 3DHUA 4OFPA 3EHBD 4Y4FD 4KUCD 5ESQA 4DPCX 2Y7MA 1VEMA 4MD4B 4S1SL 4LEOA 4ETYA 5LGHL 3BVXA 4MX7B 4MDJA 3N6YA 4JRWA 3K91A 2HRHA 4WWKD 1QNZH 2ARJQ 4XX1G 3T08A 2IOMA 2YUWA 4H44C 5TE7L 4PJCA 1FG9C 1NBVH 5BO1L 1CFQB 4KO9A 4CVXB 3FB8A 2XTJD 2APSA 3AXIA 1JZDC 3TPUA 4U3SB 3BLBA 4XXWA 4J3XA 5DI8A 3AUWB 3MV9E 3TT1H 1U8OB 3W1ZA 3ZE1E 4Z78B 2P5EA 4JG0L 3LV3B 2D7PA 3G5VA 5DTFA 4B50A 2VZ1A 1EHXA 3BEVB 3GNMH 1M7XA 3BP6B 4X99A 2V7HB 1SLXA 2AI0H 5GGVL 2V6HA 1NFIB 1AO7E 3C2AH 2VZOA 1ZDQA 3BH8A 1O6VA 2OMXA 3EBIA 3IJHB 5D2LF 5FDWB 1F0LA 5D5MF 5LKNA 4R97C 5CSBA 4RFNB 5AW2B 3IXTB 3MCLH 3CVCA 5DS8A 2NY0C 1FN4A 3P3SA 1SYSB 2HP4A 2D03H 5E2WL 3E2HB 3UZQB 4GBXC 5IJKA 2X4UB 2YRLA 3AVEA 1F97A 2N0MA 3ARDA 3C12A 4HHAA 5FF6B 2X4SA 1QZ1A 3DK2A 5IHHA 1H3GA 1PZDA 2AQQA 1QFWI 3B9KA 2CZNA 3J27A 3PL6C 4GQQA 4ANWA 2FZ3A 4CVUA 4MNQA 4NUJB 4FQ1H 3ABZA 3QUML 1CD1A 2XWTA 5IY5B 4LL4A 3A67L 3CC5A 4D0DB 1MIMH 3MV8B 4XCYB 4ZDHA 4HQQH 1DJZA 4CC0A 2J8UE 4WWOA 3OF6A 3GBNH 4HIIA 5KS9F 2VMCA 1Q0XH 4OGXH 4Q56A 5FGCB 2NXYB 3SDDD 4QRUB 2F68X 2Z8VC 3U30C 1QNIA 3SBWC 1NCAL 4PJXA 3QI9D 3TCLA 1KB5B 4JFXB 3ZU8A 2UY6A 5AB0A 4WFHE 4RNRA 4LOEA 2HVKB 3OKKB 4MMZA 1G9NC 3ARSA 3N42F 1IBGH 4KK8C 4TMPA 4AQZA 2H6PA 1QTYT 4LMQE 3GM8A 3I9IA 3IJ9A 4JKMA 3QWRA 1GGBL 3IVKB 3FB5A 1YUKB 4K4KA 3GSNB 1CG9A 4X9IA 5L4JA 1J9QA 1ORQB 2Q1EA 3C5SB 2BVQA 2EDOA 2FQGA 3B7YA 2W0FA 3DLQR 5LCVH 1T2QL 4F2MA 4XP5H 3KWWB 4OLUH 3NZHL 4P2YA 2ROXA 3GM0A 3NJVA 1UB5A 4LCUA 1T80A 2N3JA 3GXPA 3CVDA 3OXRA 3PAYA 1DJGA 4RGND 3A4EA 1OCCB 3HZVA 3P02A 4HW6A 4KAQL 1OCWH 3NP3A 4FN0A 2ZUUA 3O6MH 3BW9A 1SN0A 5K1NA 4LQFL 5J12B 1ZLUH 3D7PA 1NMCB 3STLA 1H8OA 2HAZA 5JW3L 5DLML 1OF2A 1JPGA 3MACH 1RZGB 1CFVH 5INCA 1I8IB 2YPLE 3E8VA 1OB1B 1I1AA 3GZPA 3KAAA 5DQDH 4HMCA 4OCWH 3BVVA 1OV8A 4JY4B 3F05A 4AOFA 7PAZA 5HDLA 1UUNA 5EBWB 1FL6B 3GBMH 1SUHA 1EH9A 2YKKA 1JWMB 3MRQB 4QGTA 1TZ8A 2VLMD 4EAEA 1DQQA 1LO3L 3MJ8A 5IBUG 2A6DA 2NLJA 3CK0L 2E7DA 5D7JA 2XKSA 1R3LB 1CDIA 2FECL 1CL7I 1T5XB 4LSSL 4DEWA 1BBJA 3RTQA 1LYQA 4Z7UE 2WBXA 1IGCH 5DMGD 3MV8E 4JFOA 1AZCA 2YMTA 4HH8A 3QXDA 4UDUA 1MXGA 3KWTA 1TVBA 4X5RA 1SEBA 3JV6B 3NESA 1T1YB 1MUJB 4C55A 2OTUB 4KTYA 5GISH 2QMKA 4FKHA 1FVDB 1B88A 2Y06L 5BJTB 2ZCLH 4PCKA 4AQOA 4BCYA 5I1EH 4NWTL 2XLLA 1U30A 4NPYA 3DURA 4X6BA 2X1WL 2XG4A 4YLQT 1FA4A 1YAZA 2YGOA 1HNFA 4APQC 1EO5A 2ZKWA 5DJZA 1WWAX 1O7DE 4HC1A 2NZIA 5FPIA 1VB9A 3FTSA 3C6LB 5LGJA 3DVIA 3MXVL 3B5GA 4KK5C 8CGTA 3GC3A 3AADB 5LBSH 1H3WM 1TQBB 5IJBC 4LVNB 3HNTH 2ENJA 2QQNH 3H1ZA 3WL9B 4AYBA 3M45A 4QHUA 4Y2LA 3G5XA 3QJHA 3EIFA 4OTXH 3RY6A 1P5UB 5I0WA 5HJGA 4KITB 4Y0GA 1I8LA 2F0CA 1YYLL 3KMDA 2GUYA 3K1DA 4Q9RL 3FTWA 2R29H 3N43F 3OSVA 2PW1A 5FKPB 2DH2A 5B3SB 5IMOA 1DUYB 3VXOB 1QSEE 5C3IA 2EYRB 4UM9A 5IF0A 3NCXA 4JR9L 3LKNA 1L7TL 4JL1A 5TGBA 4JQIL 3CGTA 3RA7H 2YC1A 5CZKA 3TIDA 2OCFD 1BVKB 4HKBA 5L8KB 4ENZA 2WV3A 4WO4D 1FYTA 2XN1A 3JWDH 2IGLA 3AT9A 1FH2A 3LMJH 3LZRA 4JFZL 3WO4B 1QAWA 3BOVA 1U8CA 5DRNA 1FVEA 1CC3A 2X44D 4LKCB 3ZKMD 5HD8D 4CA4A 4HG4J 3DMMD 3QPQC 4GRWF 4QPEA 4PTTA 4EI0A 2V2XA 1Y1UA 4PW9A 5CBAB 4N4YB 5AW7B 3L5WA 4HIHB 4JHVA 1F13A 2IQAA 1ES0A 3F8UB 3F7VB 3GMPA 4JE4B 1KPVA 3ZE2B 1MPAH 1ADQH 3VD9A 3QDGD 5FHAH 2D9CA 2DQJL 1QHOA 3DUSB 1XXDC 4OF0A 5E9DE 2DDQL 3NSDA 1MG2C 5ADOL 3DKHA 5GGQH 5KN5B 2X89D 5C0ND 4P2OB 1WHOA 2VLLB 4C83A 4OM1L 2WAQA 4ORGA 4BQBA 4K2UH 4HKZA 3KCWA 4N0CD 1X3DA 4ODTH 1CFNB 4DN3H 3KLKA 3W81A 1ZLWK 4P07A 3Q43A 1OCOB 3P3UA 5CINH 1T3FB 2XIIA 1SJXA 4M5ZL 3KHOA 3UPAA 3VH8A 1OAQL 2A9MH 3G5ZB 2VDMB 1UWGL 1R9FA 2AEOA 1KPUB 1U4EA 4DO4A 4PG9A 1SYVA 3NIFE 5IVNA 3ZDYB 4X6DF 2Q8AH 2FATH 1P7QB 3RJOA 4N87A 3QUKA 4FQLH 4CILA 2VDLB 4DO6A 2X4PA 4UDTA 4KHXL 3RIKA 1SPDA 3VRIA 2XXMB 3GINA 4XGZA 3GSWB 5FYLD 1XVSA 4KDVA 3SPCA 3BQUB 2FX7L 4NB7A 5DMIH 3BRGC 1UZ8B 3U6XS 3LKSA 4OIBA 2B1OA 3AU1B 2L7QA 1V3JA 2OX5B 3GXUB 1HSBB 3FB6A 2CDEB 3G5YB 4RZCB 43C9A