1I8KA

Crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
b'DIELTQSPASLSVATGEKVTIRCMTSTDIDDDMNWYQQKPGEPPKFLISEGNTLRPGVPSRFSSSGTGTDFVFTIENTLSEDVGDYYCLQSFNVPLTFGCGTKLEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAI
publication title Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i8kA00
1QFUL 1QFHA 2VLJD 3MJGX 4PUBH 3UJTL 2E8ZA 4FABH 4Z7UF 3PL6B 3BN9D 1DQLL 3CFEB 3VRLE 2CDFB 2H32B 5H94A 3H42H 4KQ3H 4FP8H 1N7MH 5FECB 2WQRA 4TUKH 1I8KA 4I0CC 1QQDB 4FFWC 3ILPB 4R26L 1O7SA 3KPSD 1RV6X 5D6DC 4AT6A 3LDBB 1NLDH 1CICC 1YEKH 4YAQB 2KPNA 3Q5TA 1RZGB 4Z7VA 4LU5L 3NH7L 5DYOA 4N0YL 5GGTL 2GTWA 1K8IB 5C0EA 1CDCA 2JTDA 3BE1H 4JFFA 4QRTA 3P40A 1D5MB 3P4OB 2F19H 2HFGL 3LQMA 4PJIA 2D7MA 4ZPVA 4A6YA 1YNTB 3QDMB 2GSGB 2Q6WB 5TF1L 1HXMB 5ENWA 3VI3E 3WKNA 4ZS6D 3BRGC 3PQYA 3ILQD 3SDCC 4AL8H 3OKNA 5IVXA 3TFKD 35C8L 4ISVA 1G84A 3V8CA 2GSIB 1U6AL 3CVHL 4OF3A 1JWMA 3E3QC 1DDHB 4UTAL 4JLRB 1H3GA 2OTWB 3MRRA 5DUMH 4YZFE 2FB4H 4I1NB 3UJJL 2BDNH 1G7HB 4NRXB 4I4WA 4RGND 5C1MB 2EC9U 2IALA 3S3JA 3ULVH 3B6SA 4TSBH 5F7LB 2BC4B 2XN9D 5C0IA 3OAZK 5HXMA 2NY3B 3MLSL 3FO9B 4P23C 3LVEA 3UPAA 3UTOA 1FFNB 2DM4A 5SWSB 5BV7H 1KXVC 1MCQA 2A9MH 3P9LA 5F7DB 1BVZA 4XCNA 3VCLA 1ADQL 4LPYA 2DB8A 2BVOA 3WCYA 1RAMA 4YHZH 1QBMH 3ARQA 4X5XB 5ID1A 1EEZA 1UCBH 1M05B 4LSRH 4RMRA 4PRIA 2JE8A 1RMFH 1G9MH 4WW1A 1ACZA 3M8OH 3MGOB 4NC1E 4ODHL 5E8OA 1GHFL 1OAUL 4NWUH 3WS3A 1BAFL 4X98A 2CGRH 4MA7L 3MCLH 1NFDA 1RUKH 3KPRE 3QUML 5I75C 1R3HA 4FQIL 2X1WL 3KXFE 3ZE2F 1R5WA 4PG9B 1AE6H 1GC1L 1OTSD 4K94H 1CK0H 4MXWH 1HSAA 3AMKA 1HEZB 4RIRB 1NUDA 4JDTL 1CFQB 4H8WH 1U8IA 4QRQA 4WI3A 4OV5B 3MA9L 3MLRH 3GMMB 1NBZA 3U46B 4MNHA 4Q97A 5A43C 4U1HA 3L3KB 1WQVT 3KLHC 5FDYA 1MELA 1JNJA 2CKBH 1XR8A 1EA9C 5EOCH 3V95A 2DS4A 3O4OB 3U36A 3GI9H 5F9JB 4Y4FC 2DWDA 4XVUC 1NMAH 4Y5XC 4LRIA 5L2KD 1KJ2A 4QKXB 5DA0B 5EU4A 1OTUC 4LIQH 3E1F1 2F5AH 3PHSA 3WXWH 5CKGA 5IBTH 4DCQB 2GT9A 4J3OC 4KK5C 3VXOB 5C09D 4M1GH 4MNGB 3IF1A 2HLAB 4NKIH 3FZUC 3PF2A 2R4RL 3R8BB 4ZOEA 4AIZB 4R90H 3UBXB 2C1OB 3TO4B 2PNDA 1W0VA 2YUXA 3WNNA 1C5BH 5T3ZL 1CDYA 4N90E 4R4NC 2ADGA 5BZDB 1ZTXL 4OI7A 1WZMA 4H26B 1HHGA 1CTNA 2NY2C 2R1WA 4TYUA 1XCQB 3I6KB 1U0QA 2NPLX 5F3HA 3MXWH 3PDOB 5D7KE 4HXAH 2J8UA 4TSCL 3GHBH 4P2OB 4PV8B 3GI8H 4MNQA 5DD1H 5LGJB 3V0WL 3NVQA 3P9MA 3QDGB 1A7QH 4JY6A 4GQ9L 1TVDA 4EXKA 4POZC 3FO0L 1S7WA 4WEBL 3AB0C 4AEIH 1AD0A 4PJEE 3IXTB 3SPVA 1AXTL 2EIZA 1HINL 3MRKA 4Q9RL 1WBXA 3K4DA 1LE9A 1N2RB 5HDOA 1UWXH 3MBEC 4GJTB 5E94A 2NY7L 4UILL 1OM3L 3S37X 1B0WA 2DTSA 2Y9RT 1BF2A 2HJFB 1NBVL 3S37H 2FHCA 1ZVSA 2FHBA 4XI5C 2QR0B 5I1IH 1XGTA 3JWOH 5JXEA 1IGYB 5T5NG 3RVXD 1C12A 3BKCH 3F5WA 2ZP0T 2LU3A 1J1PL 3S6CA 2W65A 1YYLH 1DP0A 3F6IA 2ZSVB 4IS6A 4ALAH 5ETUA 3WFDH 2CPCA 3JVGC 4YEFA 3NBNA 3HE7D 1PZUB 4XNUL 3KPOB 3N0PB 1I9IL 3O9WD 1X5XA 3CX5J 1MRDL 5F1NA 3FQNB 1KOAA 1ZLWK 5IQ9A 4YUEH 3PWLB 4YHZL 3QNYA 1FNGB 5EU6B 2AW2A 3OR7B 1HKLH 1C16A 2XRAL 3STLA 1M7XA 5HDBF 2O5ZL 1E6JL 5EIIB 4G9FE 3F7PC 5GZNC 4GRLB 3OJDA 1CLOL 5GS3A 5CZVL 2Q3AA 4MQ7A 4QRRB 1QFWI 4N8VG 2XQYG 3BESR 5E4EB 1OF2A 1EPFA 2NZ9D 3KPQA 3BH9A 3EO9L 4QRPD 1GGCH 4N9GA 4OI9A 1LO0L 1UYWH 2ZOKA 4OF0A 5KBNC 5E08L 3MCLL 4KVCL 5ID0B 5BVJB 4MD4B 4Q0XL 5IVZA 3DHJA 1KCSH 4NOFA 4XP9H 3CCHA 2HLFC 1T7XA 4OD1L 5IEHA 1L6ZA 1FGVL 3V6ZB 1D9KD 4KVNH 2GTZB 5MP6H 2NXYD 3MZTA 3TPUB 1LEIB 1FZJB 1Q94B 2VDNH 3F7VA 1DQDH 3GJEA 4OKVA 3TA3C 1K5NA 1L0QA 4YWGL 3VGBA 3EO0A 5AZ2L 1ZXQA 5TE4H 2WK2A 2OZ4A 4RMVA 3BJLA 5EBGA 1FPTH 5GS2D 5E9DE 1BECA 1CR9L 4YDJB 4LSPL 4XAWL 3H9SD 1L6XA 2XZAH 1GAFH 4LOUD 4RZCB 2DRUA 3EOTH 3GI9L 2Z0BA 1HDMA 3FT2A 5D96B 5IG7B 3GRWA 4YX2L 1A02N 5EOQL 4JCMA 3R0MA 4GAGL 4ZO7A 1DJSA 2NX5D 1T03L 4JM2B 3OAUH 1XR9A 1XF3B 2LABA 4XXDA 1D5XB 4EDWL 2P8MA 5BXFB 4QWWC 1TDQA 1PX3A 4LVOB 4PJ8C 3HE6B 2E6QA 5ICZA 1QLEH 3O6KH 4EVNA 1DQMH 2F54B 1EGJH 3ARBA 1RUAH 5F9OH 5HHQA 3PV6B 1VEPA 1YMMB 3S36L 3VMNA 3K4ZA 3WDHA 2EXWC 1I7RB 4K9EH 4ZNEE 3HR5A 1UM6H 4M8QA 1J1OH 2PYEB 1YPZB 2D7TL 5KZCB 1XIWB 1FFPB 3MV9E 3QFDA 3W9DA 4MMXC 5JW3L 5HYJB 1CICA 5BV7B 1H0DB 3WJJA 2F58H 5IQ7L 4Y16B 3N9GH 1QLRA 1A3LL 2FJHA 3ZTJH 4G9DB 3UTTD 5DGQA 4OZIF 4QCIB 3HUJB 5E03A 1OAYL 1YEDA 6FABL 3LKNB 4K3DH 1FGNL 1FQ9C 2KKQA 3DETD 3GJFH 3QEQB 3VWKD 3QNZB 5C8JA 4PRHA 4PPTA 2DM2A 3QDJB 5EUOF 1BBDH 3WIIL 1MLCB 1ZEAL 5ABDE 4CJ1A 3KYNB 2VE6B 4BH8B 2Y25A 3BGMA 3DRTB 2BY2A 2W0FA 5HD8C 3IU4L 4HWUA 1ZGLB 3ROLA 2C3XA 4MJ2A 3WFDL 5D2NB 3MNVA 1C5CL 4Q9BA 4JY5H 4GQPH 3ZKSD 4HUUA 3LS4H 3HPJA 1MPAH 3Q6GH 2KZWA 1JPSH 4P23A 3WXVL 3SKMA 5IBUG 3DV6B 3VGFA 4PY7B 4P2QD 4X9FA 3VFGH 3I50H 2Y7QB 4MAUH 3TZVC 2CKBB 4PP1D 3ARXA 4PR5B 1JTOA 5EH1A 1OAZH 2MQ3A 1DLHA 3DVGB 1ZAGA 4JO1L 3HPLB 43CAA 15C8L 1DBMH 1DBBH 3MYJB 1QPXA 5CD3A 1VESA 2J4WH 5ACZB 3HI6L 3S5LG 3OKEA 4W6XB 1SY6H 3R1GL 1H3VA 2AGJH 3QG7L 3F7YA 1T80A 4NQDB 4M5YL 2NW3B 1UEYA 4HEME 3HNSL 3HZVA 1QBAA 1K8DB 1S78C 3CLFL 4PB0H 2X40A 3NPZB 2BY1A 2YD7A 5ADOH 4R0LA 1VADA 4GKZA 2DD8L 1EAPB 4KROD 1T6VN 1OAKH 1A6VL 2KL6A 1B0GA 2KH2B 2I26N 4O58H 4NZRH 1F8TL 3U0WH 4OT1H 4BA8A 4Y19D 3OG4B 1KXTB 2VDOH 2WIMA 1IVLA 2ARJB 2XZAL 3OZ9L 1RY7B 4M3KB 1WBZB 1GGUA 4L3EB 5F7EH 4QYOA 1LO5A 3NZHH 4Y4FA 2QQNH 2R2BA 3MRDB 3TNNB 4Q74A 1BOGB 5C0GB 4Y5XA 1UXSA 1NCWL 5DQDH 1HOCA 3BEVA 3TVMC 4D94A 1IC7H 3BVNA 2IG2L 4X6EA 1YC8A 4KI5D 1F13A 3L7FB 5FYLE 1A5FL 2VISB 4N0RA 2UYLB 1OP3K 3BT2H 3O6MH 2J88H 1A1MA 4S1DC 4HMEA 4OZ4A 3IDXL 4X4XA 1EUUA 1IGCL 2YK1H 2BMKA 4JZJB 4CL7A 1S7XB 5ERWA 1CT8A 3QXWA 4NQUA 2QKIA 3RHWF 4XP6H 4ENEC 3JBG7 3L3OA 2OSLA 4N0CC 5MEND 1CS6A 4RNRB 5D2LF 2YWZA 5GXBB 5F8RC 3VFTA 5DD6B 1BHGA 1Q9LB 4NO0A 1OP5H 4K9EL 3PXHA 4AEHL 1FIGL 3ZE0E 1RZKL 5FF6A 4HEPG 4WY7H 4XVTL 4YPGA 2JB6B 1UB6A 2RB8A 4DEPB 5IW1A 1RSFA 2BRRL 4P5TB 3RWHA 1FG2A 4PJHE 5DHYB 3WFHA 4QHUB 4PJ7B 5GGQH 3R06A 1MH5B 4NN6B 1X4ZA 1EERB 4E42A 5C08B 5ALCL 1MUJB 4P3CH 4N0FA 4R4BA 3NA9L 3CFBA 3K80A 4MJIE 4FTVE 5LQBL 3QXAA 4LPVA 5GZOD 3RTQD 5LWYH 5T1DL 5GISL 3JV0A 5HHNB 3RL2A 1NCUA 5FO8A 4LSQH 1ZHBA 1CFNA 4NQSA 4Z7WE 4MA3B 1WFUA 5CBEA 3MBEA 3DYOA 1CDJA 3JTSB 3NN8B 2FWOA 3T3ME 3BQUC 2ADIA 3ORJA 3IXAA 5F1IB 1NCBL 2PTTA 3QUXC 4JB9L 5FKAA 3MRFB 4ZO8A 4Z7NE 1C08A 3TH2T 2JIXD 3BSZH 4RBPK 1N5YL 1I85A 3ALWA 3ZDYF 2ADFH 1NDMA 3VFVB 2NY0B 2IBZY 1C5DB 2AXJA 5HI5D 3LQAH 5CCKH 4OCLC 3THMH 4FZ8H 4MJ5A 4PRPB 5LAXA 4OD3H 1TCRB 3JVGA 4LLQA 5JQHC 1HH9A 1QSFE 3TJHD 4RFNB 3B5HA 1RK0A 3IETB 1RIUL 3QPQC 4OFIA 1A7RH 3DO7A 3VFGL 1TZGL 3I50L 4Y1AD 2E3VA 3SKNB 3BKJH 4MAUL 3VG0H 4DW2H 1MCLA 4L8DA 3EO1B 3UZEA 5DMGC 1RZ7H 3TT1L 1R3KB 4OIBA 3LEYL 2Y5TA 5I1CL 2JCCF 5J9PB 4P2RB 4IRZH 5KS9F 1EO5A 1DBML 1T4KA 3IGAA 4LRNH 5F88B 3KXFA 4YEEA 1NGZA 1EHLL 4JZOA 3W0WE 3HNTH 4UU9A 1UM5H 1U42A 3BIBX 3BIKA 3BGAA 3CFCH 4QXWA 3ULSB 1X6NA 5DEGA 4YO0A 4EEEA 4AG4H 4BQ8A 2YEZA 2EDYA 1NCAH 3RWJB 9CGTA 1XF2A 3GSXB 4JN1H 2AQ2A 5I1AB 1KACB 1CFSB 3DX8B 4TTDD 4JFDE 4UT9H 1S7TA 3TA3A 1RJLA 4C56B 2FNBA 3Q3GB 3JWDC 1WCQA 2X4OB 4FXGB 5EC1A 1KPUB 3SGDI 1T1XB 3FT3B 1KYOJ 2EYTB 3BGFC 4UAOB 1Q72L 3SO3B 3V4UH 2HFTA 2VDOL 1KSRA 4P3DA 3LSOB 3X3FL 1TJHH 2W1NA 3OKDA 3VGEA 1W72A 3GKZA 2CRZA 1QFOA 2J8OA 1A3RL 4A2MA 5JIKA 3V7AE 2QQNL 4NQED 1MQ8A 3VRJB 1WWWX 4KKCC 4XX1G 3VXQB 2I27N 4X7TA 4HWEH 3O0RH 4PLJD 1P5VA 2NXZD 1NC2A 1P7QD 3U2SA 2B4CC 2DJSA 2WUBH 4JO2L 4B0MM 4Z7OE 1N8ZB 4IRSD 2QADB 1NLBH 1A6UH 3ZHLA 1R24A 4HS6A 2Y06L 3IFNH 4K7PH 3DARA 2HVJA 4WUUE 3NCBB 5CEYB 3GJFB 3DX7A 5IEKA 3MRLB 2G60L 4N8VB 4IBLT 1DN0B 1IFHL 1F6FB 4BQCA 5J7CC 1ZSDA 4JFZL 3BZEA 5LCVH 3GUTA 3LN9A 4ODVH 3SHSA 2EE3A 4IRJB 4KPHL 3MJ8A 4KRPD 1T04B 3DRQB 4RRPA 3MRPA 2QQKL 1B2WL 4L4VE 1IGIH 4ZYKB 3P11L 4WY7L 2GUOA 3PGFH 1I8LC 2OK0L 12E8L 1XT5A 5ANMB 4ZFOL 4BM7A 4PJEA 4X83A 5D1XD 4XZUA 1PSKL 5FA4B 5IWLA 1T0NB 1T2XA 1TZIB 3B9KD 5JOFA 2AP2A 4U3CA 2HT2C 3PP3K 4PJDF 5C07A 1MCFA 4WJ5A 4W4OC 3QDME 5GGSA 1A7NH 2H2PC 3RIFF 4P5MB 1UH4A 2HVKB 2HKHH 1HK6A 1KCRL 1JP5A 3NIFF 3QQ4A 1T1ZA 5JOPD 4TVPE 1B6DA 4FQXC 1F3DH 3HC0B 4NRYB 3RX7A 3U7WL 1HHIB 1Z0NA 2FZ3B 4G6JL 1F6AA 1UWEH 3D0VA 4RFEA 4JO4H 2R1YA 2NLJB 1T5WB 4GSDL 4ZUUB 1LK2B 2Z91B 4Y5VC 4E9LA 4P0DA 3LQAL 4ZDHB 1MJUH 5HDQH 2YOCA 1PYWA 3TCLB 4JPWL 3VJ6B 3AAZA 4OD3L 5HGHA 4S11A 4P4KD 5IMOA 3FONA 1UB5A 1FO0B 2XTJB 1CGYA 1FAIH 4N68A 2PF6A 4CW1B 2VZOA 4Y8AA 4G9FA 5FK9A 4FNLL 1ZHKB 5ACMA 1CD9B 1FVCA 1FBIH 4KK9D 1TZHA 3QIWC 3SE4A 3LKQB 4W6YB 3RJQB 1HNGA 4AYFA 2K1MA 3QUYD 3O6FD 4DW2L 1DTUA 2OL3B 1PG7W 1IT9H 5DRXB 1CXIA 5CJOH 5K59E 1TJGL 1BZQK 4ZXBA 4TVSa 1E4XI 5HYFA 3TZVA 2O5XL 2BFVH 5JR1H 4LARL 3MLYH 4LSTL 1KTKE 1OAQL 1X9QA 4U1KA 1T2QH 2DQGH 1CBVH 4I0PC 3VXPA 3MQIA 4WO4C 3F58L 4HGMA 3VMPA 1BQHG 1I9JH 4PBXA 5D5ME 4K8RH 1MWAL 4I8DA 4YHLH 3CFCL 1YA5A 5C0AB 2D0GA 1WJ3A 3HG1A 1IBGL 4R4FL 2E9WA 3CVIL 5B8CA 2RCSL 1HE7A 4KUZL 4RMUA 5IFAH 4GFTB 4OF6A 1U3HD 5E9DA 4U05A 4I3RL 4UOJA 4CKVX 4YHOH 3U4BH 1UZ6F 4JCLA 3TPKA 5DQ9A 2FX9L 1TETH 2I9LA 2A73A 3ZMRA 4FZEL 4PBWD 2OJEA 1MFEL 4HIIB 1EO7A 1QO3A 2FGWH 3MGTA 3W2DL 3DVIA 3MNZA 4KHTH 2R9HD 1WC7B 2VLLA 5HY9A 2IF7A 2AK4D 4YBLC 5D1ZA 4L9LC 2DQFA 1HQRA 5KG9A 1JGVH 4UDTA 3TBSB 3QWQB 4WV1B 1W2KT 3O0RL 1G7JA 1JTPA 5IBUB 3TVMA 5CLTA 3HMXA 4EXPX 3E6HA 4NUJB 4G5ZL 5TJWK 4YHYB 2XZCL 1TVBA 1V05A 2DQIL 4HD9A 3IFNL 3QWOA 4GAJL 4NRZA 3HLAB 1G7MA 3PL6C 2WIIB 3UAJC 3MXVL 5KOMC 4PJAB 3IYLW 3ULUD 5C0RH 5DUBB 3UO1L 5IKCA 3O45B 4MLSA 2XV6B 4EIZC 3QXDA 4ZNEA 3S5LB 1IM3A 5I9QB 3MV9A 5BRZB 1DQTA 3LDBC 4Y4KD 3U9PH 3I6LD 4NUGL 3RVWC 3R4DA 1FC1A 2VL5A 3ZDXE 5MEQA 1YNKH 1NKRA 3O41A 3NIGF 3UZVB 3TV3H 1QYGH 5K9QI 2DKUA 4N1HB 5B4MC 5MERA 5KSVA 4XPFH 3QDGE 1ERNA 3W39B 3V4PH 3BXNA 2W9DL 1GPOL 3RKDC 3U7YL 3DWTA 1WGOA 4OCWL 5EU3B 2X6MA 1IAIH 3MLXL 5KJRH 3QISA 2QHRH 2FIRT 1Q0XH 1A7BA 1J10A 1IL1A 2BHZA 4LKXA 3CZJA 3SGEI 3SGJA 2V2TB 3LHPL 4OF7A 1BVLA 3WO4B 3QUXA 5AUMB 2Q7YB 3B5GA 4UDUB 2NY3C 1C8PA 2XA8L 3U9UA 4P4RA 5EIVA 1II4E 1AQKH 1I3UA 4G42A 5HDQL 4M43L 3P0VH 5T3XH 2AS5M 1AGEA 4B7LA 4U6YA 3J7HA 3GSRB 3QXUA 3QPXH 5E8PA 4ZTPH 2P49B 4F33A 5EU6E 1CXFA 3IDGB 3MLTB 1FLRL 3I6GA 4X8JB 5JIIA 3ABZA 1AJ7L 4KK6D 1SJHB 2C3VA 4KI5F 3GHEL 3MOQA 3FN9A 1GGIL 1ZA6B 1H3TA 2XWBB 3C60B 1CQYA 4MMZC 4L1DA 3TJEH 5DXWA 4ZD3H 3VXTA 3HZKA 1KN4H 3OXSB 1BWMA 4JAMA 5FV1L 1TJIH 3QIBB 4NM8H 5IMMA 4JE4B 1NFIA 2GITA 4PGJA 1H5BB 5EBWA 3SY0A 1EJ6A 4LCUB 2YD4A 5C9JB 3CH1B 3QB7C 2G75B 4K7PY 4RFOH 1C1EL 3K7UA 1QTYT 2IPTL 1QFWL 4L5FH 2VTFA 3PGCB 2L7JA 5IFJA 3O81A 3QIUA 1FNEA 3JV4A 1KT2B 1AXIB 3CDFA 3QG6B 4OTXL 4PJ9D 4MQSB 4BZ1H 1KG0B 1QBLH 4OZGF 3O4OC 4R9HA 1DLFL 1XMWA 4YBQD 1Q9KB 1DVFA 4URTB 4K23H 3U30B 5J1AB 1OWRM 4HKXA 3O8XD 4OGZA 5F3BB 5CFHA 3MJ6A 1YECH 4GW1B 2W9EL 2LFGA 3REWB 2PETA 2X4SB 1VENA 3BD4A 4OB5H 1ITCA 3GSOA 3B2UD 4UUJB 2ZUXA 1HQ4B 5HYEA 3TO4C 3RY4A 1FJ1A 4PRDB 1A4KA 1AR1D 1NC4B 4ZFFB 1EXUA 2CLRA 4X7EC 1RUQH 5LXGH 2Q87A 4XT1C 5E95B 2CJUL 3LIZL 3S96A 3TBYB 3RWEA 4D9QE 2VDPL 1MCDA 5HHOB 2YRPA 5DI8B 5FKPA 3ESUF 4KDTC 2ZG2A 4AENA 2VQUA 4Z7UB 4QOKD 4QY8B 3FQRB 3CC5A 4A6YH 1A6WL 1K4DB 4PJHA 4DJMA 2BCKB 1AGDA 5J3HC 5T33L 5BQ7A 5DMYA 4GW5B 3MACL 4CADA 1ZHNA 5IW6B 2PYEE 1YPZE 4HWZB 5DURB 3MLWH 3TYFB 4MJIA 5GGUB 4FTVA 1ORQB 3CSPA 1ZT1B 3VGGA 3DUHA 2M1KA 1N64L 5HYJE 2IBGA 2CLVB 2HN7B 5IBLD 5EZOL 4Z7WA 5BZWA 5I30H 4X8XA 3DO3A 5GRJL 5I1HL 3RZCB 2DLTA 1IAIL 3A0OA 1NGYB 1DCLA 4Z77B 1Y0LB 1Q0XL 1E6OH 3QI9B 4HKZA 1KPRA 3QO0A 3CLEH 5D7IE 5DJ0A 3OR6A 4M1CD 5A2FA 5JNYA 1KNOA 1U8JB 3QDJE 1RVFL 4NHCL 3ALXA 2DBLH 1VFAA 1KPVA 2K9UA 4G8GB 1IM9A 2P24B 5JPMA 3P3YA 5DA4A 1UADC 3I75B 2IJ0C 2BNRD 1PX4A 5BOZG 4NJ9H 3VXRB 1CGVA 1QSFA 3C6LD 1S3KL 4R7DB 2EYRB 5IOPB 5FIEA 5D2NE 3SDAD 5I19H 2EDRA 3HAEA 1KB9K 3PWNA 1FDLL 4HGKC 3RWCA 2OQJB 4WDIB 2BK8A 4OLUH 1X5ZA 4GRLC 5E00B 4BFIA 5E4EC 2HJLA 4WHTB 1T0MA 4H1LB 4F37F 2KZ1B 4LKCA 1JV5A 3UTQB 2FIKB 1L7IH 3V5DB 3W0WA 2OR7A 4NWTL 4ZQKA 4AH2B 1M71A 5INCA 2AI0L 4Z7QE 5AZEH 5I71B 1FLTX 2DLGA 2LV4A 1NCCH 4I0PA 5DRNB 1KN4L 1FHGA 5L2JA 1JGLH 2D31A 3VXSB 1CIDA 5CP7A 4NQDE 4YE4L 1BIHA 2X2YA 4OSUH 3GSQB 1NGXA 1ZVHA 3T0EE 1QRNA 2AEQH 2CUIA 4JFDA 4C83B 2BXYA 1KJ2H 1LDSA 1RIVL 4L5FL 4E5XA 1R0AL 2HTLC 4CGTA 1U58B 4ODTL 3S3SA 2VLRE 3S36X 4M5ZH 5I18L 3ZLQC 1BFOA 1NEUA 3KGRA 4LSSH 3BP6B 3CX2A 3DPBA 5DD0L 5DQJA 3QO1A 1CICD 1MI5E 1VHPA 3EIFA 3EYUL 1Q9WB 3SGKC 5D96C 3KYOB 4IOIA 3RI5K 3OKYA 5KTEL 2HFFB 3O4LE 3LY6A 1ETZA 1P4LA 4HQQH 4JDVB 5I66B 3QR2A 2XNAA 4MDJA 4ZUVB 5ISZA 1JK8B 1DUYB 2QV2A 1GGBH 2FJGB 2FH8A 2PO6B 4L3EE 4OCXH 4JM2C 5GHWL 4X99B 4Z78B 4L9LA 4WU7A 4WUUA 1ZWIB 2PW2A 2W0LA 5F7NC 4N8CL 2CO7B 1OSZA 3SDCD 4NM4L 4LNVA 1SEBB 4LVOC 5E5UB 3HE6C 1VACB 3KPLA 3ZT5A 2XZQL 1DL7L 2FX7H 2X7LB 4NQXB 4ZSOB 1U93B 3DIFB 2R69L 4YXHH 4JJ5A 1CDIA 2DLEA 3PL6A 1HH6A 4XRCB 5EU7E 1JMZA 3MCG1 3OHXB 3T0DA 4JZNA 2H32A 3W9EA 2VR5A 3QUMB 4L4VA 1XIWC 3SEPA 3BKML 2DKSA 5FECA 1BQHB 1UWXK 2MKLC 2P8LB 2ZKHL 3UTZA 1QQDA 3X17A 1B4JH 3ILPA 4PJXF 5C0JB 4G8EB 4YAQA 5BV7C 3D18A 1Q9OB 1RZGA 4Y16C 2VXTL 5DTFA 5EZIL 2VXSL 4RWHA 1OCWH 1K8IA 4QTIL 3AM8C 4HPYL 5BS0E 1T83A 3B3IA 1D5MA 3VW3H 1INDH 1LP9A 5A16B 2DDQH 2Y07H 2H8PB 3ULUL 1YNTA 5DJCA 3QDMA 3REVB 5E8EA 1FAKT 1HXMA 2QSCL 3KR3H 1G9MC 5KVFH 1JNLL 5ADPH 1MY5A 1UWGL 1BJ1H 3A6BL 3BAEL 5FO9B 2L0DA 1CD8A 1DDHA 2EECA 2VLKB 2OTWA 3CLEL 2ATPB 4JLRA 3VFNB 2VMFA 4HJ0C 4JR9L 2X4PB 3TNMB 3C5ZC 4JY4B 3VD5A 3X12B 2HKFH 4CN6A 3KLSA 1B4RA 2OTUB 5D2NC 1F02I 3D39A 4LPWA 5K9OA 2BC4A 2PCPB 2DL9A 1T1YA 5CZXC 1WZ1H 1ZVYA 3PABA 3FO9A 4HKJB 2PR4H 2APTA 4MHHI 4RISH 5ESVA 1MJ7H 3FAWA 4WW2F 2FL5B 2Q8AH 4HCRL 3ZHDA 4HBCL 1QSEB 4H5SB 4PRPE 5HHMB 1Z3GH 1AIFB 3O2DA 4GXVH 1AQDB 3I85A 3KLHD 4X5XA 3PWVB 5I73B 4EN3B 2H6PB 1BBJA 2P8PA 4XVUD 1G9NL 4DN3L 1V3JA 5FYJD 4ZAKA 2ESVB 5C0ND 3MGOA 5IVXF 5IVNA 1GH7A 3NTCH 4OLEA 4FQCL 5JORB 3IFLL 2A1WH 5D5MA 3DSNA 4HFWA 4LASH 2DL2A 3LRHA 4KK5D 5I1KL 2OZ4H 4K3EL 1QZ1A 4G43A 5J6HA 3MROB 3FZUD 5DK2B 1KEGL 2X4RA 3ULUF 3WNLA 2ILLA 3EJZC 1TNNA 1UM4H 3MJ7B 1INEL 4K3GA 1WAAE 4NKDB 4YDKL 3IJYB 4Z76B 4O4YL 5KSAC 5IESH 1ES0A 3EUUA 1HEZA 2NY2D 3Q2CA 3IDUA 1I9RL 1CFQA 4NO2A 3GRWH 4PJFF 1A6ZA 5HHPB 3SDXF 1D5IL 4Z7VB 1Q38A 4OV5A 5DYOB 5FOBA 2GTWB 4DGYH 2XQBH 4QRTB 4LBEB 1XH3A 4KXZI 4PJIB 5F6IB 4OM1L 4PS4H 2J2ZA 2R0ZH 5DF0A 4YXLH 3SE9L 4C56E 4HLJA 5L6YL 3ARFA 3G6JF 5LGHL 5F9JA 3PQYB 4POZD 5FUZH 3G04A 3FJTA 2F53E 4MA8L 4HQQL 5FDWB 5JA8B 1J0ZA 3NPSC 4OAWA 1JHLH 2EE9A 4U1LB 3W81A 5TGBA 4EQ3A 2V2WA 4AY0A 2VR9A 5FYKD 1VFOA 4AIZA 1MCEA 2FHFA 2UY7A 3X13B 2C1OA 3TO4A 4JZJC 3ZT6A 5L9DL 1V7NH 1WK0A 5BZDA 5FXCH 4XI5D 2E9IA 5C0IB 4TUOA 3JWOC 4LDEB 4X9IA 5TF0A 1WTGT 3P9LB 1INQA 1RJCA 1XCQA 3I6KA 4BH7A 1LO4H 2WSKA 4R8WH 2IMMA 5GRXG 4DEPC 4P2OA 4P5TC 4NQCD 1EEZB 4PV8A 4XBEL 5ID1B 2VQ1A 4LFHG 1WF5A 2MJWA 5IMLA 5F7HA 3GJFK 4G6FB 2JJSC 4O2FA 4WWKA 4NN6C 2XQYK 3WD5L 3VXME 2MWCA 3QDGA 2JJWA 1FYTD 4J3VA 4X98B 3L3DA 4F3FB 3IXTA 4UT7H 1QNZH 3KPRD 2VZTA 4DKFH 5GZND 3MV7E 1N2RA 2GHWB 4EBQL 4J3SA 4NCDA 5TDPB 3KXFD 4OZIB 2HJFA 3ZE1F 1S9KC 4F15B 1HSAB 3DROB 3LPGA 3QCUH 3SDDB 1I3VA 2P45B 3BDYL 1YEIH 3IDJB 2EEDA 2EDFA 4KMQA 1CE1L 4L29B 4FXKA 4LLDA 5EUOB 3NCJL 1BGXH 2VAJA 1MHPH 1KGCE 2CDEB 5DZNA 1NBZB 3BI9X 3GSUA 2DLHA 2LVCA 4MNHB 2NY0C 2HLFD 2YD5A 4U1HB 4P46A 4LCWD 5AWNH 1XR8B 4ONGH 3LPFA 1BQSA 3KS0J 1IKNA 4WI2A 5DFTA 5D7JA 1LO3H 4OZFA 1JF6A 1I7TB 4RFNC 4HX1B 4QHKI 1XZ0A 1RI8A 5JLZB 1MY7A 4M4PA 1YQVH 4KHXH 4NC0B 5E56A 1RUML 2XYCA 3PWLA 1UACH 2YBRB 1DANT 4ZOBA 5EU6A 3SOBH 1YEJL 2GT9B 2XTJE 3IF1B 4GS7B 4QF1A 4GRLA 2V9TA 4M48H 3OF6A 5GJSL 1HCFX 4XBGB 1CGWA 1N3NB 2OI9B 4X6CF 1CL7H 3LZFL 4MXVF 1NJ9A 3QNXA 1HHGB 3QA3A 5CUSL 5TE6L 5CJQH 2FH6A 1RFDH 3MJ9L 3G9VA 3E0GA 1SYVA 1RZJL 1XGUB 2VLJB 3T77A 3GMNA 4MXQD 3RVTC 1UH2A 1A7OH 2L7UA 2E27H 3QFJD 4MNQB 4QWWD 2GYSA 4G8IB 4PJ8D 2GTZA 5GJTH 2XKSA 3RX5A 5FA3B 1IC1A 4GUPA 3P9MB 4I3SL 5C0AE 3UMTA 1OPGH 2RIKA 3TPUA 5IESL 1YC7A 3GRWL 4NDMB 1U8OA 1E4XL 4J7RA 1S7WB 1G6RL 3LB6C 5JDJA 1AD0B 1MJJB 4UAOC 3SO3C 3F62A 2YXFA 2EXWD 4HJGA 3WFCH 1BFVL 2IFFL 1Q0YH 3FB7A 1P1ZB 4WRLA 3HRZA 3UYRH 4AZ8A 4LGPB 3PP4L 4X9GA 1S8DA 3QRGH 4J1UB 3MOAL 5GRUL 1C12B 5FCUH 4QXUH 4UOW0 2QADC 1VPOH 3WDIA 4DUXA 2Y36L 3BMVA 4U2ZA 2W65B 2PW1B 1OP5K 2XZZA 3V5KA 3IFPB 1BEYH 4LCCB 3S98A 4BSVB 5BXFA 4LP5A 1IQWH 4KK8C 3ARVA 3B83A 3PIQB 4IRJC 5BMFL 4WI8A 2YN5A 4RGNB 1MJ8H 4TNWK 4WI9A 2VH5L 5HD8D 2CK0L 5F1NB 2B8OT 3BUTA 5IQ9B 2GI7A 4XNQA 1TTUA 4PJAE 1BX2B 3C8KA 3QNYB 5I15H 4N1CA 2R0LH 1ZANL 3WJLA 3STLB 1I7RA 4DK6A 5D2LB 2PYEA 32C2A 3LKPA 5BRZE 2H9GB 4AIOA 5HYJA 1OF2B 2WUCL 4I48A 3BH9B 5DHVA 4K55A 2LAAA 1H0DA 1GXEA 4GMTH 4GT7A 2DJ4A 4RRPG 4OF8A 1KJ3H 3LKSB 4G9DA 4LL9A 4UT7L 2FDBP 5IVZB 1JN6B 2DQHL 4QCIA 3TZVD 4GLRH 3SDYH 3MRNB 1XGRA 3CCHB 1KC5H 2J5LB 3LKNA 4MQXD 4BFEA 5IEHB 1X7QB 5D7IA 4D3CL 4NBYB 3MODH 3QDJA 2N7BA 5FFLA 1MLCA 1EDQA 3GJEB 2NY5H 1K5NB 3KYNA 2VE6A 1F4XH 4DN4H 3DRTA 1KBGH 1ZGLA 1S78D 2X09A 4MS8D 5EORH 4P9ML 1KLUA 1NCNA 2AXGB 2F8VA 2IFGA 4PJGF 1HI6B 5ITBL 2C3WA 5D2NA 2XTJC 1HDMB 4J6RL 1MFCL 3HI5H 2W9LA 2E7MA 3BP4A 1JPGA 3GIZL 3DV6A 4PY7A 2X5PA 3MRCA 1Z9SA 1QR4A 3SOBL 4HIJA 1I1RA 2ED9A 4KY1H 3WN5C 4E41E 3S88L 1W0YT 5E8NB 3RIAF 4PR5A 4TQEH 4M6MH 2P8MB 5KVDH 1BQLH 4IMLA 3MYJA 2NTFB 5ICZB 5CGTA 5ACZA 4NNPL 4EVNB 4I18A 3GBML 2DN7A 5KS9B 1PG7H 3E8UH 3GO1L 3ARBB 4NQDA 5FHBH 1V7ML 4WTWA 1O5DT 2NW3A 5CJQL 2QBWA 3T0EA 1RFDL 4XNZB 4Z0XA 2W60B 3UPCA 1KELL 4ERSL 1U92A 3QFDB 5I8CB 3FQTB 3W9DB 5F9DC 1W72H 1OTTC 1EAPA 2VKXA 3MV9D 4ENED 2VLRA 4N0CD 5TQ0H 5KAQG 2V5MA 2AJVL 4JFQB 5FYJL 4X4ZA 3S34L 1FH5H 3HNVH 1MI5A 3AREA 3FO2A 1UKQA 2CIKB 2FJHB 1CZ8L 1OAXH 1AY1L 1KCVL 1F90L 3O4LA 1KJMA 3MUHL 1L9NA 3LV3A 2DYPA 5CEZE 1OQXA 4OQTA 1WBZA 4XVSH 4GKOA 4L3EA 5C8JB 1GOHA 1KENL 3LAFA 5GGRA 1BD2D 3TNNA 3MRDA 1JI1A 1BOGA 4K2UH 2C3GA 4WV1C 5C0GA 2YHGA 4NO3B 4L4TD 2R8SH 3MPCA 4N0UB 5IB4A 4YHYC 2W0FB 1OVZA 1MF2L 3L7FA 1CIUA 2VISA 4ACPA 1RJZB 5JQ6L 2PXYA 4G6AC 3GMQA 3MNVB 2NY1B 4JZJA 3GKWH 4OIIL 3BQUD 4HUUB 3HPJB 1X4YA 3VXUD 2H26B 5BW7C 4JHAH 4R2GB 5F7KC 5I9QC 4FMKA 4PJCB 2BZDA 3SKMB 2W91A 2VC2H 4RNRA 1KN2H 3OPZL 1K2DB 4UBDD 5F97E 2QEJA 3GEWB 4J3XA 4KTDL 1TQCB 4Z7UE 3BD3A 5EO9A 3ZO0A 1RHFA 2JB6A 3RL1A 1S7QB 4NJAH 4NZUL 4P5TA 5HJ3B 1DLHB 3BDXA 4UOW1 5FYKL 2HWZL 5BS0A 43CAB 4LCIL 3FFCB 4XXCA 1MH5A 1J0KA 4ZUWA 3QPQD 1F3JB 4GMTL 3V7MA 3PWPE 3B2VL 3IJSA 3F7YB 1UGNA 4EDXB 5E99H 1S9YA 4WWID 2R2CA 3HZVB 3WKMH 4YHKH 5ESAA 3NMEA 4MA3A 5TFSL 4CUCA 3AMLA 1F2QA 1RHHA 1MFNA 2XI9A 1FRGL 4XC1L 3JTSA 4R0LB 1VADB 3NN8A 4JHBA 1TTGA 3WO4C 1B0GB 4LGSB 3FOLB 2XOTA 4G6KL 5SX4I 1MCJA 3ZL4L 2FEDC 2OR9L 2DWEB 4G8GE 1C5DA 1RK1B 1H3XA 3HMWL 4F57H 4RWYH 4EJ1C 3TT3H 3I3BA 3T1WA 1T7VA 4PRPA 2IPUK 2GFBB 1LO5B 5A1AA 1FNSL 2R2BB 4J3UA 4HF5L 2EH8H 3IETA 1HOCB 1D3CA 1AKJA 1UFUA 1EO8H 4DZBB 3NAAL 4DVRL 1DN2A 4KKAC 1EAJA 3EO1A 2WZPD 2UWEF 1R3KA 3S35H 4OZHF 1OB1A 3VD4A 1A1MB 2CMRL 3C60C 5JDSA 4OZ4B 4XBPB 5DD5H 1LEGB 5J9PA 4X4XB 4H0GA 1ODAA 3NABL 1BQLL 2BMKB 3O3DA 4UIKL 2IWGA 25C8L 5F88A 5ERWB 4GRWF 4P59L 2QKIB 4WHYG 2DQCH 2HTKC 5DJDB 4XCEB 3P0YL 4OGXH 1IGFH 2EXYC 2OSLB 5JHDA 3QIBC 4G7YL 5T5FL 1QEWA 1MIEH 4HHAA 4LVHB 3RBSA 1WAAA 2ZUSA 3ULSA 1H5BC 3VFTB 5I1EL 4NO0B 3GMPA 3LMJL 4RQQA 5GSRB 3P73A 4YFDB 5F96L 4YPGB 2COQA 4OCYH 5IW1B 3RWJA 3RWHB 3VXSE 3BPNB 3GSXA 3ZE2E 3CMOH 3LKRA 5MEOB 1RZ8B 4G6ML 4B41A 4C56A 4N0FB 1CGSL 2UZYB 4R4BB 3CFBB 5IK3A 1ZT4A 1I9EA 4O9HH 1PGRB 1X5LA 3U30C 2JELH 3QXAB 3FT3A 3D69B 3IB4A 3DYPA 2R0KH 3MMEA 3HMXH 1KEMH 2J3SA 4MJID 2F53A 5D7SH 1CLZL 5KVEL 1ZHBB 1CFNB 4NQSB 3LN5B 2EDKA 5J06A 5EZLA 4MB3A 5CSGA 2FWOB 3QWRA 1ONQB 2B5IB 5C71A 2HT2D 2ADIB 4JEGB 2ICWA 2JB5L 3T4AB 1A7PH 2PTTB 1OW0A 4ZOAA 5FKAB 5HPMB 1JYWA 3A67L 3JSSA 2LAGB 3O11A 5HGBB 4MWFB 3P2TA 3DJ9A 2GIYA 1OD9A 2H2PD 5CEYA 3EDJA 3MRLA 4MVBC 4N8VA 3QH3A 3GKWL 3H6JA 1DN0A 2HH0L 2P5WE 3V79C 4JREB 1EMTH 2VXQH 4FQXD 5DRWA 4C54A 4LQ1A 2W0KA 4XCFL 3MYZA 1SEQL 2XIDA 1OD7A 3FQWB 1EUTA 2VC2L 5HHVH 2YPLD 1T04A 2FYYA 3DRQA 3DO7B 2RR3A 5DJXB 4XCYA 3VXMA 3QULB 1MWAB 2FATH 3C08H 4IMKA 1XF5B 4ZYKA 4PGCA 1W8OA 2Y5TB 4DQOH 4M6OL 4Z0BL 5FA4A 4OLVL 4HIXH 5IB5B 3IGAB 5IF0B 1T0NA 4UQ2A 1TZIA 4OGAC 1NGZB 43C9B 3MV7A 1GL4B 1GOGA 3QIWD 4NSKB 3W5NA 3B9AA 3RZCC 4UU9B 5C9KA 1AI1H 2CRMA 3BIKB 4BQ6A 3DX6B 3L1OL 4YHKL 3MR9B 4PJ5E 5FHAL 4YO0B 4OLYH 2YEZB 3EYQD 5EUKA 1XF2B 1E4WH 2AEPH 3N85H 4WO4D 4GAFB 1RIHL 2I9TA 3MUJA 1ZE3C 4CU6A 4HWBA 1NAMA 4FQ2H 4K8RC 5JZ7C 1S7TB 4MDIA 1RJLB 3HC0A 1DBKH 1HHIA 2FZ3A 2NY4B 4QHMB 4XPTH 5EC1B 2NLJA 1T5WA 2ZCHH 5E2TH 2Z91A 1KFAL 5I8KH 4P3DB 4D8PB 4ZDHA 4ZS7H 3TCLA 3VJ6A 2NYYD 1LK3H 3K3QA 1YYMH 3DSFL 1FO0A 1KXQE 2ZJSH 4Y4HA 2OJZH 2IC2A 5T3ZE 3KYKL 4X7TB 1ZHKA 2B1AH 1I8IB 1AD9A 1NC2B 5HHME 5I1DB 5D7LD 2OL3A 3WE6A 2BP3A 3HFMH 4HPOH 5DRXA 4P9HL 3U1SL 4CU8A 2HVJB 4RMSA 4XPAH 4N5EC 5HBBA 3LD8B 2OMNA 4LEXH 2EDLA 3HAEG 5I71C 2ESVE 3P77B 3DXAB 4XWGH 5DK0A 2YSSB 4HZLA 3GUTB 2DQCL 3K2UL 2YUVA 4DGIH 2YKLH 1T89C 4HFUH 4HS3B 1BZ9B 1TVHB 3OL2A 1LDPL 2ZPKH 3MRPB 3JWDH 3KHQA 1A64A 5C0AA 1VEMA 3SN6N 3T2NL 3L6FA 4TN9A 3PL6D 3UAJD 2R39A 3MUY1 2IQ9H 4JM4L 4OFYD 4ETYA 4XZUB 2P7TB 5D72H 5HPOA 3VE0B 3MRBA 4UV7L 3EYSH 1IEBB 5C0FA 2V9QA 3HZYA 2DQTL 5FYLH 1YEFL 4LNRB 4M62H 5CEXB 5C2BH 3GSNA 1CDUA 4P57B 5C07B 3RVWD 5BO1H 1J18A 1QG3A 4KKBC 4HH9B 1T66C 2B4CH 4OZGB 1QP1A 5FM8A 3CZFA 4L8CB 1U91A 4PJBF 3HTLX 5B4MD 4ZMAT 5B3JF 3K1DA 3RTQB 4YHMH 5GGSY 2ZOLA 3QDMD 4WFEE 3RKDD 1T1ZB 2XA3A 2ZCLH 3TBSA 1A7PL 2WLYA 4S1QH 1A14H 1N4XH 1ZKAA 4KC3B 1F6AB 4RFEB 4NUJA 2R1YB 1HXYB 1HHHA 3BKYH 3V7AG 3WFBH 3L5HA 1XEDA 4JN2B 3MLZL 4NZTL 4LSVL 5EN2B 2EC8A 2FLBT 4DGVH 1PYWB 3L5XH 4PJAA 5HGHB 4V2BA 2N4IA 4X6DF 1LNUB 5IMOB 1HYSC 5HVFB 2VXQL 1UB5B 3O45A 4MA1B 5F7UA 5H35A 4U6VL 3S5LA 3V6OE 1RQ5A 5IGXH 2MHAB 3ARGB 5CSZB 5FK9B 5BW7A 5BRZA 1JZ5A 4OIAA 2NY3D 4O02L 3LN4B 1GC1C 1NUFA 5SWSD 1X44A 1JWSA 1M7DB 1TIUA 3HS0A 4UZGA 5FB8B 2WQ8A 5CP3A 4ZXBB 1W0WB 4L4JA 1YEHH 3F6LA 3GMOB 2DIAA 1JNNH 3VXPB 1HHKB 2ZCKL 3NCEB 1GJIA 1CDHA 4TSAH 1I1AB 5IT2H 4LHJB 1FNAA 1F42A 5KN5A 5I0ZA 2B20A 3HG1B 3KJ4B 2V7NB 2YC1B 5B8CB 1EX0A 2ZG1A 2VDKL 3WSQL 4OZIE 1MNUL 5E9DB 4XMKL 5TE7L 3IDMA 4WTZA 1CVRA 2V2TA 3IS1X 1C7TA 3HAEH 3TM6A 4FQ2L 5BVPL 5TDNB 1P4IH 1FCGA 5CJBA 5EUOE 2I9LB 5AUMA 4WHDA 2GJ6B 4Z18A 2OJEB 1EEYA 1VFBB 1KJVB 1CF8L 1HWGB 3TEUA 5DLMH 4KGJA 1HNFA 4MJ6B 1J8HB 4ZFGL 5HY9B 5B22A 1EJOH 4NOBA 2HFEB 3GBNL 4E41A 4IOFC 2OJZL 4POUB 2C9AA 4OKDA 3T65B 4EN3C 5I73C 3CSYB 4S1RH 1PFCA 1Z9MA 3FKUS 4XGZA 1G7JB 2JJTC 3T2PA 3O6LH 4AEEA 3HFML 3MLTA 4X8JA 4NQEB 4XP1H 1SJHA 2CR3A 4DKEH 4NRZB 5CGMA 1K6QL 4M1DH 3RZWA 1EEUA 4MAYB 4MJ4A 3CH8A 4Z8FL 2P47B 1P7QB 2XWBA 5EO1B 3NIDF 3WNMA 5LBSL 5F21B 2DQEL 4IRSB 4OFKA 5IKCB 1JGEA 3UTSD 3IVKB 3QXDB 1XGPB 3OXSA 4U49A 2I60H 4QHKJ 3HC4H 5CHNB 4OLZL 5F9WB 3QIBA 4JFEB 4ELKA 3GGWA 3MA7A 1OSPH 2B0SH 2CK2A 5C70A 1MIML 2VLJE 3GSWA 5C9JA 2G75A 2APXA 2I24N 4KRPB 5D70L 3SGDH 3BRDA 3H3PL 2QQQA 4DKDC 4EZMA 4MNQE 3PGCA 3T08A 4GBXA 1KB5A 2VUYA 3EYSL 4LHUA 4NKOA 1KT2A 2VITA 4LLVB 5F6IC 2W92A 2BVTA 4WNQA 3BXNB 1KG0A 2O93L 4HIEA 1ITBB 5L88L 1Q9KA 4XNYL 3EYVB 3QDGD 4R7NA 1L7TL 5J3HD 3D9AL 3KPSE 5D1XB 1U8HA 5J1AA 3B9VA 4LSUL 5F3BA 1MFAL 2DIJA 1SYSA 2MPAH 2YD1A 1U41A 3REWA 1E27A 5ESQB 2X4SA 4LKXB 3IFOB 5D71L 5H8DA 5AYUL 2H32H 3PNWB 3T0XA 4UMGA 3VXNA 3C2AH 1HQ4A 1NL0H 4OCSL 4RAVA 5TPWL 1OARH 2F15A 2BSTB 2EH7H 3V0AC 4QHLA 3A6CL 3U9UB 1OQOA 2YR3A 5D1QD 2BSRA 4HK3N 1CN4A 5SV3A 1I4FB 3TBYA 4U6YB 2VRAA 4LPTA 3V52L 4PTTA 3ARDD 4Z7UA 2Q76B 5CJ5A 4RGNE 1RURH 4JQXA 1GGTA 3FQRA 4UINL 1K4DA 5DWUH 5E8PB 3HC3H 1QACA 4ZTOH 4YR6B 4Y0GA 1PQZA 4IIQB 4EI5A 4P4KB 2XN9E 3FN0L 4GW5A 4YXKL 1AO7D 4FQQB 3KLDA 2C3VB 4I77H 5D2LE 5IW6A 2V5RA 4K71B 5GGVL 3PWPA 3TYFA 5EU6D 4TVPH 4EOWH 4RMQA 1ZT1A 5FUOL 5GRWA 1MRCH 2KUTA 4KJYB 4JKPH 4GRLD 3VXTB 4QRRD 2UV3A 1IKFH 1A47A 4JO3H 2YMXH 4F15C 3UYPA 4JAMB 3TBTB 1NGYA 5C6TH 4AIXA 2RBLA 4Z77A 1Y0LA 3SDDC 3SCMD 4M7JH 5T1LB 4FQJL 2GITB 5EBWB 1CG9B 4S2SA 4FS0A 3QI9A 3L3JB 3L5IA 4ONFL 3QIUB 1U8JA 2WP3O 4XPHH 1FFOB 3O2DH 2ENSA 3CFDA 5FGSA 3QDAA 5K9QG 4XH2A 1V3KA 4G8GA 1G1CA 3EOYG 4FFYH 1DVFB 2A0LC 2VXVH 2GY5A 2EYRA 3WFEH 3C5JA 2X89A 5DR5L 3ZDYE 3BEWB 3DECA 1EJOL 1PDKA 5C3LD 1NCDH 1BZ7B 3GSOB 4JHWL 4GS7C 4WDIA 4Z7WF 3WIHL 1YJDL 2ZUQB 1A4KB 4WHTA 1OLLA 4H1LA 2OI9C 4FHBD 1KIPA 2AK4B 3T3MF 4HAFA 1JZ7A 2RFXA 4PGEB 1UEMA 4OZFG 2CLRB 5L8JB 4DKEL 2NY6B 3RU8L 3UTQA 2FIKA 4JG1L 5HHXL 3MFFB 1YDPA 4F58H 4JM2D 3ZTNH 4AH2A 3U82B 1DSFL 4M7KH 5FKPB 1E28A 5GGTA 1MREH 4U1SA 2JCCE 4PB9H 5DRNA 1UQSA 5INDA 2XTLA 4QTHA 5KS9E 1GZQB 3CC5B 3HE6D 3VXSA 2FEEL 4DUVA 4GRMA 4W68A 4X6FA 3GSQA 5ALBH 2F54D 2MKWA 5BQ7B 4WCYH 1TQBB 1ZHNB 2R4SL 1QVOA 1YMMD 5C7XL 2FR4A 4JPKL 5J0BA 2VZVA 5CILH 4PJFB 1W8NA 3SDXB 2PYED 5KZCD 5DT1H 3CVHA 1XIWD 2EKSB 3QQNA 1CFTA 1MOEA 3BW9A 1YNLH 5BZWB 3BP6A 3C8DA 5HYJD 1V8HA 1Q9WA 1DQQB 4M6NL 4Y16D 5I66A 5C0DA 3EHBC 4P49A 1JK8A 4QXGH 4HKZB 2FJGA 1KPRB 2VXUL 2PO6A 4S1SH 4ZS6C 5GGVY 5B39B 3OR6B 3ILQC 4MX7B 3DMMB 1UJTA 4PRNA 4YDIL 2J6EL 1ADQA 1DBAH 3QEQD 3LKOA 4LCCC 4N0UE 1SJVA 2MFNA 2P5WA 3LH2H 1ND0A 2X7LA 1U93A 3QEGH 1DBJH 1HHJA 1FYHB 4HJ0D 5E4IA 5FUCE 2VDLH 3FB6A 3C5ZD 4HC1L 1F00I 3HAEB 3QUMA 3PWNB 2AV7A 4S10A 1MRFL 4PJCE 1S7UB 3T09A 4BKLA 3T4YB 5C0JA 1S5IL 4G8EA 4PTUB 5AAWA 2X4TB 1S9VB 3X3GL 3P4MB 3SQOL 4KJPC 5SV4A 4LKCB 4L3CA 1JV5B 1H15A 3QAZB 3W0WB 5EU5B 2BNQB 4ZQKB 3TO2B 4F7TB 4Z7OF 3FFCE 5INCB 4LVEA 3EYOB 4PJ5A 4KV5E 2J5LC 2NZIA 3FMGH 3QCVH 4CAGA 5JW4M 4XPBH 3REVA 4U1IB 1IKFL 5B21A 2D3VA 1G7QB 1R5IB 3OJMB 3TWCH 1QRNB 4NQDD 4OZFH 1DFBL 5F89B 1OTSC 3IJHA 5JXAL 2ATPA 1F4YH 3O2VH 3VFNA 2VSDA 2HJKB 4HK0A 3U0TB 3TNMA 4PD4K 4JY4A 3EJZD 1KV3A 2YA1A 4D9LL 1UH3A 4FFYL 4H0HB 1BFOB 1WEJH 3F8UB 3V8OA 4G3YL 5DQJB 2HT4C 5KSAD 2PCPA 2B2XH 3NIFE 3MNWB 1BM3L 2A74A 4DTGL 3N1FC 3MTRA 1ETZB 1P4LB 4HKJA 5ACLA 5EFIA 4HT1L 2XNAB 4HJJH 5ISZB 2FL5A 4IM8A 4ORGA 2HG5A 4H5SA 1ZS8B 4NGHL 1AIFA 1AQDA 4FQHB 2AJSL 1IEHA 5HGGS 2P42B 4L3ED 4MZ2A 3MO1A 3LRGA 3H9SE 3PWVA 2J8HA 2PW2B 4WUUB 3VDAA 2DQDH 1I7UA 5DZLA 3LS5H 4UV4H 1F11A 4HBQA 1OGAD 3PXJA 2ESVA 3KPLB 1NEZG 3M07A 3VH8B 4TPRL 2F5BH 4Y2DA 5JORA 2DIBA 4IDJL 4JJ5B 4KQ4L 5EWIH 3ARBC 5SWQB 1HH6B 3KYMA 2V7HB 2CSPA 4XNZC 4JZNB 1D6EA 2NX5E 3MROA 5DK2A 3W9EB 2EE2A 4L4VB 2VDQL 4OUUA 4B53A 2A9NL 3S4SB 3UTZB 3V6FB 3MJ7A 4NKDA 3IJYA 4Z76A 5JW5B 1IC4H 3I2CL 5HHPA 3I84A 3WJJC 3D18B 2CDGB 4QOKB 1IGTA 4RGOH 5DTFB 5IFHH 1U36A 2GEEA 4LBEA 4NT6B 4OGYH 5DS8A 1GIGL 3B3IB 5DFVD 1MQKL 1LP9B 2QTEA 4F7MA 1RD6A 5CINH 5DJCB 1NSNH 5E8EB 3WEXA 3MRMB 4LQFH 3MRJA 3PWJB 4U1JA 1RUPL 5C08D 4HGWA 2ENYA 2FSEB 3LEXA 5FDWA 5J1TC 3JV5A 2OX5A 3DI2B 5JUEL 3INUH 1MHEA 3TCXA 3WHXA 3BH8B 4U1LA 5E6IB 2BJML 5I2IB 1N6QL 2BVPB 4S0SD 5ILTH 3O3BB 2UUDH 4AMKL 4KDVA 3M17A 4HLZG 3RVXC 3X13A 1H9VA 2NY1C 1NUNB 3D39B 5HGAB 5K9OB 5D8JH 2HMIC 2G9HB 1IZJA 4D2NA 2F9BT 4XCCL 4B7IA 3CFKB 2R0WH 1T1YB 4R2GC 4XP5H 1OP9A 3PABB 4ORZC 5ESVB 4KZEL 3V6OA 2AK1L 5DHVH 1KLGB 2P5EB 3VGDA 1MAMH 1ZT7B 3LRSA 1F4WH 1CLYH 2EDTA 2HRLA 2NY0D 3QEUA 3B43A 1TQCC 3MRGB 3TN0B 5I1GH 4PRPD 4UNTA 1VSCA 1CE6A 2APVA 1BBJB 4TOYL 2P8PB 2WANA 3C9NA 5JW4Q 2N56A 3O2WH 4ZAKB 3CFIC 5DMJB 5E6YA 3DX9A 1F97A 3L9RA 2AJYH 3ARUA 3TYGH 5F8QC 2ORBL 3JUZA 4XMPL 1M1SA 4HFWB 4JRYB 5D5MB 4NN5B 4F3FA 3G5XB 4P2QE 4YNYA 3T04D 4G43B 5J6HB 2DI9A 2X4RB 2X1XR 4P2RD 4JRXD 4APQA 4LAQH 5TDPA 4OZIA 4R0LC 3DROA 4JHZA 3SDDA 5J1SC 1ES0B 4L8SA 4NO2B 3IAGC 1CFBA 1A6ZB 3IDJA 1U8KA 4P99A 4L29A 1J7VR 5EUOA 4XVJL 4O5LH 5FOBB 2CDEA 3ZDXF 4TUJA 2EIEA 1XH3B 3RVTD 1XCTB 4X7FC 3G6DL 1MCPL 3LEVH 1J5OL 2LU4A 1NFKA 1Q1JL 3ARFB 2VLMD 3R8QA 2QQLH 3G04B 1I7TA 4HX1A 3LB6D 5JLZA 3KJ6H 4HJJL 4OAWB 5JW4N 1SJEA 5TGBB 3AFLA 1RU9L 2YBRA 2V2WB 2Q1EA 3ARRA 4EUPA 2R56H 5E2UL 3G5VB 4XPGL 2FX8L 1WIPA 3D2UA 4XBGA 4BYHA 1N3NA 2A6DB 4TUOB 4D9RD 1WWAX 4HUMB 3W5MA 3O3EA 3JUYA 4PUBL 5IIEB 4FABL 2QADD 5DD3H 2BHUA 5L0QB 4LVHC 1QR1B 1INQB 4YDVB 2H41A 4BH7B 5J89A 3DXAE 1XGUA 2VLJA 3H42L 4KQ3L 4FP8L 1N7ML 2WP3T 4TUKL 3BPNC 2VQ1B 5IMLB 5GS1A 1WV7T 2ZUVA 4G8IA 3C87A 5FA3A 4OQTH 2PKDA 4IRJD 1NLDL 3BZFA 4O2FB 4WWKB 1YEKL 2BHYA 2V2XB 3QZWA 4AQ1B 4NDMA 1Z2KA 1DZBA 5MENE 1MJJA 3L3DB 3VFPA 3BE1L 3KPSA 2WM0A 4OGYL 5GIRB 2F19L 1NMBH 2W59A 2G5BB 4LGRB 1NSNL 1DE4A 2AV1B 1P1ZA 2AXFB 1IC5H 5C07E 2EIDA 4TULH 4UB0H 1BWWA 2I5YH 2B5IC 1LO2H 4AL8L 2Z9TA 4LVNC 4OZGE 3BX7C 4J1UA 3V6BR 4FXKB 4LLDB 2V5YA 5DUML 2F8OA 4GOSA 1I85C 2FB4L 4UI2A 2DM7A 3GSUB 5IUSA 2BDNL 3KNBB 2PW1A 2A6IB 1MLBA 2C1PA 4P46B 3K8KA 2OBGA 3ULVL 3IFPA 3ISWA 1UVQB 5KSBF 1A6AA 4TSBL 2ZNWA 4LCCA 4FFZH 5D8JL 4JREC 3T1FB 4BSVA 2NY5C 4ELMF 1QLFA 2Z31B 5D7JB 1UXWB 3PIQA 4OZFB 1NGQH 1XZ0B 4PRAB 2XPGB 5BV7L 3ES6B 3QEHA 3UYOD 2A9ML 3HZMB 2ED8A 1R3IH 1BX2A 4NC1C 1QBML 4ODXB 2XN9A 2IADA 5KW9H 5D2LA 1UCBL 4QF1B 4LSRL 2XTJD 4U0RB 1A0QH 2H9GA 4KMTH 1RMFL 1G9ML 3RVVC 4OM0H 3M8OL 3RUGF 4NWUL 4GMSH 2CGRL 1NJ9B 2ED7A 3D48R 3QA3B 3QNXB 1RUKL 4WI6A 5LJYH 2N7AA 3LKSA 4Y1AE 1JN6A 2OM5A 4JM2F 3MRNA 1MCWW 1KB9J 1SYVB 3T77B 1IZKA 3GMNB 3VD3A 2A83A 5C0CD 1AE6L 2XWTB 1X7QA 3NCCB 2GJZA 4K94L 1CK0L 4X7CC 4K7FA 4MXWL 4XC3H 1OGTA 4GUPB 2IBBA 4D0CA 3H3BC 3HG1E 4H8WL 3UCRA 3WMSA 1U8OB 2WWKO 2NY4C 4CMMA 1BLNB 3P0GB 3MLRL 4LDOB 1P84K 2LE9A 4X80H 5I1JH 4HJGB 4LMQI 2FBJH 4U1NB 4Z5RA 4XP4H 3ULVF 5TDOB 1YPZF 2AXGA 5ECJE 5F1SA 1HI6A 2CKBL 3TP4A 5H2BA 3FB7B 5EOCL 1WFNA 1SVCP 1MSPA 1OTTD 4OD2B 1BF8A 3HRZB 5EOCJ 1ZHLB 2GJ6E 3EKCA 1MCWM 1NMAL 4BQBA 5A2KH 4U6TA 1S7VA 4O2EB 1S8DB 4LIQL 2F5AL 3WXWL 1K9TA 1J8HE 5IBTL 3HUJF 4M1GL 5TQ2H 5IHLB 4NKIL 4JVUA 5E8NA 3QHFH 4R90L 3V5KB 3LD8C 1JWUB 1DUZB 1C5BL 3VFWB 3BFOA 2ATKA 3GMRA 2UWEB 5DRZA 2NTFA 4NQEE 4OZHB 2JCCA 5JO5A 4U31A 5KS9A 3NZ8A 4WFHD 2E7LA 1IAII 4XNQB 3RAJH 2CIIA 1UJ3A 3C8KB 3SQBA 3MXWL 2W60A 2E7BA 4G6AD 3X11B 1P53A 3CU7A 5JHLH 4HXAL 3GHBL 2DICA 32C2B 1XGYH 3LKPB 3GI8L 4M61B 5DD1L 2X9XA 3FQTA 5HDLA 5I8CA 3H7BB 3MUZ1 4JFEE 4KXZH 5IWLC 1EFXB 4H88H 4CU7A 5IR1B 1A7QL 4I48B 5D6CB 1UKTA 2BY0A 5DHVB 4JFQA 4NQCB 3MV8D 4AEIL 2GK0A 2OR8A 2IGFH 3X14A 2CIKA 1U3YA 3CFJB 1G7IA 4N5UA 2ADJB 2DQUH 3GM8A 2NW2A 5E6ZA 2CUMA 1XGRB 5L7XH 1FFQA 1FYTB 2O26U 3BUYB 4YH6A 3RTQC 5D7IB 3CXDH 4HDIA 3S37L 2VYRE 2O5YH 4HMCA 3G6AB 2YXMA 3UTPE 4XWOD 5I1IL 3H8NA 4NO3A 4NPYB 3JWOL 4N0UA 3BKCL 2R1XB 4LPXA 5JA9A 1YYLL 3C8HA 1KLUB 4MZ3A 1RJZA 5E5RB 3SKUD 4ALAL 4BELD 2R29H 2A6KA 2E8YA 2IH1A 2EICA 3RI5F 3AC0A 4XNXH 1NEZB 2H26A 3BP4B 3ET9F 3ARGC 1JPGB 4KJWD 4PJCA 1ORSA 1P9MC 1NGWB 5GS0H 3SE4C 4JGUA 1ZK9A 4YUEL 2FEDD 1K2DA 3MRCB 5IMKB 3RDTD 1HKLL 3HE7A 4HIJB 3F65A 4ZXBC 3UJIH 3O9WA 1AXSB 2BSSB 1S7QA 5HJ3A 4I9WE 3FFCA 4FN0A 4IMLB 4NNXB 4KTEH 3KAAA 1GGCL 1JVKA 1UYWL 1F3JA 4HWBH 4PJXE 1NAMH 4I18B 4ZOCA 4YHIA 2IMNA 1I1AC 2K3TA 2VN7A 5K9JH 4KKAD 5IB3B 4WEUD 4EDXA 3T0EB 1KCSL 3KJ4C 4NP4H 4Z0XB 5B8CC 4OFVA 3C60D 4XP9L 4PRBB 3NACH 4YFEA 3N50A 1U92B 2BOBA 5EIQA 4KVNL 5MP6L 1HZHH 2CLZA 4ZUTA 1RZFH 1T20B 2HTKD 1BFTA 3QHTC 2VDNL 1DQDL 2P43B 3GMLA 1FO0H 2EXYD 2VLRB 1JGUH 4JFOB 3QIBD 3FOLA 5TE4L 1F58H 4X80L 1FPTL 2WBJB 1MI5B 4PJ8B 3AREB 3FO2B 3EDDA 2YWYA 2V5TA 2XFXB 4DKAA 3O4LB 1KJMB 2DWEA 2OL3H 1RK1A 1XAUA 3LV3B 2DYPB 1GAFL 4XB8A 1MCOH 3EOTL 3SBWC 4PJ7F 4Z9KB 4ETQB 4QRUA 2GFBA 4JG0H 5D1ZC 3WLBB 4WTZG 5GGRB 1VKXA 4Z6AT 2FO4A 2JF1A 3H9SA 5GGRY 3ZKNC 2XY2A 1U8NA 4DZBA 3EZ8A 3RY6A 5IB4B 4DFHA 3QQ9D 1YEGH 3CUPA 2ID5A 3OAUL 4UIMB 1HIMH 4TTGA 4MAYC 4U2YA 1DQJB 2PXYB 3GMQB 3RBGA 4XBPA 1LEGA 4M4RA 5CMAA 4WFFD 4IRSC 1PLGH 2B39A 3MLUH 5HYQB 1AGCB 2NX5A 2AK4E 4K3JH 4JQIH 4ZFOA 1QLEL 3O6KL 1FCCA 2A6JA 1DQML 3CK0H 1NC4D 1EGJL 4XCEA 5DJDA 5F9WC 2CQVA 2HAZA 1RUAL 5F9OL 3GSNH 4HS8H 5KOVC 3UPRA 3CDCA 1JE6A 4QGTA 1SHMA 1PD6A 1ULVA 2EDOA 5GSRA 5CKAA 5J12B 1UM6L 1J1OL 4KRPC 5HHOD 3DUSA 1XGYL 5EO9B 4MVBD 3RL1B 4ODUB 4H88L 5CJXA 3ULUE 5BS0B 4KZDH 2AJXH 5MEOA 1HILB 3BWAB 1RZ8A 1ZLSH 2J7LA 2O61A 1EHXA 5D93B 3QJHB 5EG6C 4ZUWB 2Z4QB 2F58L 3N9GL 5D1XC 1BIIB 3IJSB 4DAGH 3G5ZB 3SE8H 4PJFE 3D69A 3SDXE 3I6LE 2EDDA 5DURD 1S9YB 3ARZA 5I76B 3PHOB 5ESAB 4Y8DC 3LN5A 4UTBH 3ZKXB 4K3DL 3PV7A 1RHHB 2Z93B 1F3RB 4Q58C 1NKOA 4I2XA 1GZPB 3SGJC 5IV2B 1U95B 4LHUG 4OGAD 1BBDL 1PY4A 5LG1A 3OSKA 1ONQA 1RULH 5C0BD 2VSCA 1FNFA 4K07A 3RZCD 3T4AA 2EE6A 1BQUA 3G6JE 3BOVA 1LVEA 4M02A 4XAKD 3VWKA 5HPMA 1DEDA 4U7KA 4B5EA 5HGBA 4MWFA 3MCKA 1U8MB 2APBA 5CP3H 3G5YB 2WBWB 4JY5L 5JZ7D 4K8RD 3SKJH 2VABB 3LS4L 1MPAL 3D3VB 3DNKA 3Q6GL 3QJFB 1JPSL 5FCSH 3FQWA 4X6DB 5T5NF 3HR6A 2CUHA 2D2OA 3VXRD 1AKJB 4IIQC 4P4KC 5DJXA 4HIHA 3QULA 1MWAA 3QHZH 1XF5A 4K71C 5SWZB 4FQLH 1YY8B 4ZG1A 1JCKA 1OAZL 4KK9C 1OB1B 5JDSB 4X7SH 4JFXB 4P2QA 3O3DB 1DBBL 5IB5A 5IF0A 2J4WL 43C9A 4QNPE 1SY6L 2AGJL 3ZYZA 4NSKA 2DQJH 2BNQE 4X9HA 5JHDB 5K9JL 1CYGA 1QEWB 1FZOB 2AAVA 3QCTH 4HHAB 2MSPA 1F5WA 3DX6A 2R2HA 2FECL 3GMPB 3MR9A 4LPUA 4N5ED 4RQQB 4Z95H 4PB0L 3T0BA 5KANI 3P73B 3DVFA 1FE8H 1O0VA 3EFFB 4OLWH 2PTVA 5E1HB 1MFDH 3QIUC 5ADOL 3LKRB 1QRNE 1OAKL 4O58L 3ZE1E 4NZRL 2AJUH 4ZO9A 4QHMA 1DVFC 5IK3B 3U0WL 1ZT4B 5C6WH 1QSZA 4OT1L 4BSWB 3EGSA 1MFBH 4JKLA 3MMEB 1WBYB 3SE3C 2F53B 4JJHA 1VGEH 4Q2ZB 1Z5LB 3L5WB 3ZKMC 5DFWH 4D8PA 4R6UA 5EZLB 2AJ3A 3VWJD 5F7EL 1HSBB 1T3FA 1EH9A 2GY7B 3NZHL 3V4VH 4LP4A 2QSTA 2SEBA 1JHKH 3ROOA 2ICWB 5DQDL 2ZUQC 5ISZE 3U79A 1I8IA 4KKBD 5EA0H 2W38A 5AEAA 1IC7L 1NH6A 1T66D 2RAMA 5I1DA 1YEGL 1SMOA 2NY6C 3N1MC 3GSVB 3O11B 3BT2L 3O6ML 5JMRA 4L4TB 3FRUB 2J88L 2A38A 2KQNA 4D0BB 1A6PA 2YK1L 3QH3B 3S9DB 3P77A 3OV6A 3DXAA 1KB5H 2YSSA 4XP6L 5DRWB 1KCUH 4KRNA 2FCBA 3DURA 3P30H 4HS3A 1BZ9A 2DLFH 3GIVB 5T1KD 5CEZH 1TVHA 5DUPH 2FYYB 4X6CE 3D85D 4H1LG 2Z35A 1TQBC 4MXVE 4XCYB 3VXMB 3VXUB 5J4MA 4PGCB 2WW8A 5I1LA 1Y6KR 1URLA 1J1XH 5MENA 1NGPH 1E4KC 5F71A 2FD6H 1HYSD 2P7TA 2QHLA 5GGQL 3VE0A 3BJ91 3OAYH 1IEBA 3SJVB 4UQ2B 5E2VH 3MV7B 4QOKE 4LNRA 4P3CL 7FABH 5CEXA 4ODWB 1M7IB 1PZ5B 4P57A 1CD1B 1U2HA 2DTMH 4U0QB 5C3TA 5LWYL 2Q8BH 4HH9A 3MLVH 5T3XD 4YC2B 4OZGA 4LSQL 2YPVH 1LP9E 3TBWB 3KPMB 4BZ2H 1WLHA 4L8CA 5EUKB 4KMLB 3DMMC 1KIRB 3RTQA 5F9AC 1N0XH 2I9TB 3VFRB 2NR6C 1NAMB 1AHWB 4J23A 2PUQT 4ODSH 5DEFA 4BUHA 4MDIB 3S97C 1Q8MA 4FXLA 1IRAY 3VRIA 1CU4H 1VEOA 3BSZL 1HXYA 3T0AA 1G9NC 2MCPH 2ADFL 2VLKD 4JN2A 4U33A 3BO8A 1QSVA 5EN2A 5IHZB 5CCKL 1G0XA 3IAPA 2OP4H 3THML 4FZ8L 3RWFB 3D39E 4KDWA 4BK4A 3GK8H 1TMCB 5I74B 4HUVB 2VQTA 1LNUA 2Q20A 3SKJL 2Y6SC 1P4BH 4UT6H 4HUWB 4Y4HB 4PFEA 2YD8A 1AGFB 2MHAA 2P5EE 3ARGA 5CSZA 1XF4A 3VMOA 1I8MA 1A7RL 1AD9B 1P9MA 2BNRE 2ZSWA 3UC0H 1WWCA 3LN4A 3BKJL 4QRSA 3VG0L 3QBTB 3WE6B 2P44B 3QHZL 1QSED 1M7DA 3QAZC 5FB8A 3PUCA 1RZ7L 5HHMD 1W0WA 1KTRL 3L95B 4X9BA 5HI3D 3L3GA 4LLWA 4IRZL 2D0HA 4Y1AA 4IOFD 4EN3D 4LRNL 3GMOA 3QRFM 4HMDA 3DTXB 5DK0B 2VDRH 3I9GH 4HZLB 1FL3A 4TNWF 1HHKA 2H2SC 5E2WH 2VAAB 1R3JB 3HNTL 2ESVD 3C5SB 1UM5L 4JRYE 2K7QA 1I1AA 1JHTB 5F7WC 1SM3H 1H3WM 1ZLUH 2EZ0C 3Q0HA 3L6FB 4WGWB 5J13B 2V7NA 2YC1A 4AG4L 1KLFA 1NCAL 3MREB 1YEEH 3FQXB 1QFUH 2VKWA 4JN1L 4WU5A 3MRBB 3UJTH 4JFPA 5C0FB 1ZMYA 3HZYB 1G1YA 4UT9L 5AAMA 2EDHA 1AP2B 5TDNA 2AJUL 1DQLH 3FQUA 3RNKB 3GSNB 4V1DB 2QLVB 2GJ6A 1I75A 3V4UL 4H1LH 2MTPA 5F44A 5EPMB 3CZFB 1VFBA 1KJVA 4R26H 1TJHL 4JFFD 3FT4A 5GPRA 1U91B 1S7SA 4KUCD 4CNIB 4MJ6A 1J8HA 5GRYA 3SBWA 3V4VL 2ZOLB 2HFEA 3T65A 3NH7H 5GGTH 3CSYA 5F7FA 4HWEL 3PQYD 4M7ZB 4PREB 2WUBL 5IJKA 1A4JB 1HHHB 1NLBL 1A6UL 4NQEA 4K7PL 4CN1A 5TF1H 3V5HA 3BD5A 5EOTA 4MAYA 2AEIT 4GW4B 5DDHB 1P7QA 5EO1A 1WUNT 5J6GB 1K3IA 1X5HA 2VJXA 1A1OA 4KRLB 35C8H 4IRSA 4M7LH 5H35B 4RSVA 5LCVL 1U6AH 3CVHH 3E6FB 4ODVL 3IVKA 4UTAH 3H9YA 4PV9B 5IHUH 1XGPA 4P5KB 5CHNA 3UJJH 4JFEA 5E2JA 2QL1A 1JWSB 4FQXB 4CBPA 1IGIL 1WIUA 3HS0B 3PGFL 3E3QE 1J1XL 2YPLB 1T83C 4GG8A 3MLSH 1PAMA 3ECBB 4AK1A 5ITFB 1EIBA 4LLVA 4G6FD 4PRID 1ADQH 2EDQA 1OLZA 3EYVA 5D1XA 1JRHH 5KN5B 2Y4SA 3EOAB 4NKMA 4AM0A 3B9KA 3NFPB 1BVKB 5E6IC 3GM0A 4HULB 1A7NL 2VZUA 4ODHH 4PG2C 5ESQA 5IHBA 3IFOA 1GHFH 1OAUH 1BAFH 3IDMB 2IAMB 2HKHL 5E70A 4MA7H 3PNWA 1RPQA 3BN3B 3QUMH 1FIEA 4JPVH 5EZJB 1F3DJ 1UWEL 4FQIH 4M1CC 3IT8D 2BSTA 1QHOA 4JO4L 1JF5A 1D5BB 1CL7I 1FORH 4JDZA 1EEYB 3LCYA 1GC1H 4F7CB 4KH2A 1MJUL 1I4FA 3VDBA 4JDTH 3TN0C 1WZKA 1FAIL 4UT6L 1UG9A 4E41B 1FFRA 2Q76A 3MA9H 1GSMA 2WNGA 4BK5A 1FBIL 4XGZB 1JZ4A 4ZAKC 4YR6A 4IIQA 4P4KA 5DJ2A 1IT9L 1U2CA 5CJOL 1OT2A 5FM4A 4FQQA 4PJXA 3T3PE 4NN5C 2BFVL 2BX5A 5JR1L 3MLYL 4ODBD 1I3GH 8FABA 1T2QL 1QFWM 2DQGL 3QUYA 4KJYA 3O6FA 5D7LB 1CBVL 1JGEB 3KG5A 3OX8A 1I9JL 4K8RL 7CGTA 3BYYA 3TBTA 4U6HB 4YHLL 4ELKB 3GGWB 3MA7B 5FYJE 2R4RH 5T1LA 4I0KA 1CG9A 3GSWB 2C4FU 2V6HA 3L3JA 5T3ZH 1YEEL 1YN7A 1ZTXH 5IFAL 5J11B 5JPNB 4GBXB 1KB5B 4NKOB 4LHUB 1FFOA 3OKOA 2VITB 2WAHA 3W11C 4MNQD 4RX4A 4YHOL 3U4BL 4MCZA 4WNQB 4HIEB 1TETL 2EDXA 2UZIH 3ARFC 4R7NB 1U3HA 4KU1A 1U8HB 2C7UB 4TSCH 2FGWL 3K1KC 4DWHA 3SE3A 5A2JH 1NANH 3L3HB 1XF1A 3V0WH 1SYSB 4KHTL 3L5JA 3AXLB 3BEWA 1E27B 4GQ9H 3FO0H 4WW2A 1BZ7A 4K3HA 4WEBH 1JGVL 4R97B 3VXNB 1AXTH 4RAVB 3H0TB 1HINH 5B38G 2FGZA 5JTWA 4Q9RH 2OTPA 2AK4A 4PGEA 2WV3A 5JXED 3EHBD 4QHLB 2NY7H 4UILH 1OM3H 2Q7NA 2BSRB 5FGRA 5L0QC 1NBVH 3MFFA 4AQOA 4F2MA 3EJYC 4ZUSA 5C0RL 4MD0B 4GLRI 4M7LL 5CJ8A 1T21B 2UWEE 4PTTB 4EUPG 3U48A 4OZHE 5FYKE 4CVWA 4P2OC 5IHUL 5CIPA 2DLIA 5A2IH 1GZQA 1J1PH 4HXBH 3U9PL 4GRWE 1F4HA 4WWKC 1IAIM 1PQZB 2YPKB 4EI5B 4W81A 3QDHA 1YNKL 3FB5A 3FHQA 4BZYA 2X4QA 4HW6A 2J1KA 3PWPB 2ZZUT 3TV3L 1QYGL 4XNUH 4Y4KA 1E4KA 4PJFA 1I9IH 3SDXA 4TNVK 3D1MC 3DHMA 4XPFL 2UUDK 1MRDH 2EKSA 3RJDA 3V4PL 3DOSA 4NQCE 2CRIA 1MCCA 1JRHL 2XRAH 1DQQA 4KJPD 2O5ZH 1E6JH 5KJRL 2QHRL 3QZWG 5CZVH 1CLOH 4GAYA 1FZMA 4S2SB 3M45A 5F93C 1FYTE 3G6JA 4NKQB 2VIRB 4P48A 5B39A 3EO9H 5MHSD 2OXGA 4MX7A 3DMMA 1HN1A 4HCRA 1LO0H 4P46C 5E08H 3CSBA 3CFDB 4KVCH 4XH2B 3K4AA 4JPVL 3KLAA 3D87B 4Q0XH 3IDIB 3CXHK 5DSCB 3QUZB 1IKNC 2Z31C 5D7JC 3EDEA 5CS7A 1FORL 4G8FA 4OD1H 2BXZA 3N1PC 3VA2C 1AQKL 1FGVH 3P0VL 5T3XL 1I7ZB 3C5JB 4KRMB 1LE5B 5CD5D 4WFGD 4YWGH 1NDGB 5AZ2H 4PGZA 4LCWE 2D7NA 3T2QA 3QPXL 2GK2A 2HT4D 1CR9H 4HKBA 4U0RC 1S7UA 4ZTPL 1G0DA 2BVQB 4LSPH 3T4YA 5B3NA 4PTUA 2CXKA 4XAWH 2X4TA 1KIPB 1S9VA 2RFXB 3P4MA 3MGAA 3I02B 4ZO6A 5EU5A 2BNQA 5DC0A 1YDPB 3TO2A 1I3GL 3TJEL 5C0NC 4F7TA 4YX2H 2BNUA 4ZD3L 3BZDA 5EOQH 1E28B 3EYOA 5FM5O 4U1SB 1QD0A 1UQSB 5INDB 4GAGH 4QTHB 4U1IA 1T03H 4CVZB 1WICA 1TJIL 3KVQA 1G7QA 4GRMB 4X6FB 4NM8L 1R5IA 4DZ8B 3DVNB 2BOCB 4QLRA 3RKPA 3UTSB 3ARBD 4EDWH 1YN6A 3MZGB 1QVOB 4RFOL 5F89A 2FR4B 3EDFA 3JTTA 2HJKA 3U0TA 4JFHD 1IEAA 3CVHB 3OBAA 4GG6F 3IKCB 4BZ1L 1X5FA 4EUPH 3EZJB 4FFWD 1QBLL 1CFTB 3BW9B 4ZODA 5BJTB 2UZIL 3S36H 3QFJE 4K23L 2WWMC 1LWRA 3MNWA 1P2CA 3ZHKA 1FN4B 2D7TH 3OKLB 3WNOA 4PJ9A 1YECL 5C0DB 1JFQH 5JW3H 3DYMA 3EOBB 1ZS8A 5DO2C 5C2UB 2VNCA 4OB5L 2UY6A 4PRNB 3WNKA 4FQHA 5E24E 3BP5A 1FNLA 5IQ7H 3O8XA 1NQBA 4PRHD 1A3LH 3WIFB 3LKOB 2JLLA 1OAYH 3OKKB 6FABH 1CGXA 2HT3C 2P5WB 1RUQL 3VH8A 5LXGL 1DEEB 1ND0B 1FGNH 4O2CA 3CNKA 3WNPA 1OL0A 3MRIB 1HHJB 3WIIH 2Q86A 1ZEAH 5SWQA 4Y5YB 4X6CA 3FB6B 2V7HA 1REIA 4PIRF 3WJLC 1FL5B 4NO5A 1IQDA 4OFDA 4JFYA 2AV7B 2NY1D 5D1QB 3DGCR 1JL8A 4HXBL 3IU4H 4A6YL 2VB5A 3AS3A 3S4SA 3V6FA 2HMID 4Y88A 1KIQB 1MVUB 4BKLB 1TLKA 5HVHB 4R2GD 5I17B 2EDBA 4P23D 3ARDB 5JW5A 3G08B 4N8PA 2YZ1A 4L3CB 4QOKA 2CDGA 1C5CH 1H15B 3MLWL 1VERA 4PP2B 2DI7A 4NT6A 3CAFA 4CRPA 2EC9T 3WXVH 1A6TA 4PJ5B 3ZTJG 1AO7B 4X5WA 4M93B 5I30L 3FFCD 3MRMA 3PWJA 2D9CA 1BP3B 2RQ8A 4NHUB 4PGBA 3G9AB 1IAOA 2FSEA 2IEPA 1E6OL 5EO0A 4JO1H 3BH8A 5E6IA 15C8H 3IJHB 5I2IA 4J3TA 4HK0B 3HI6H 2BVPA 3R1GH 4PG2A 2DBLL 4KGLA 3O3BA 3QG7H 3SCMB 3ZT7A 4PJBE 2DAVA 2IBZX 4M5YH 4YHPB 5B3JE 2Y5EA 3HNSH 5HGAA 1J88A 2G9HA 1DANU 4NJ9L 3CLFH 2A74B 4HZAA 3CFKA 4N1EA 5KSBB 1N26A 5ICXA 2AABH 1KLGA 4Z7VF 5EFIB 2P5EA 2H3NA 3D25B 2DD8H 2HG5B 1ZT7A 4ORGB 3ZDZF 4ELMB 3E2HB 2BNRA 2YUZA 3R0NA 5I19L 1A6VH 1H8NA 3AUVA 4OF5A 4YGVA 4CDGC 5BOPA 4KUCF 3AY4C 3MRGA 3TN0A 4NZJA 1FVEA 3D3VE 4PJIF 1F8TH 4OLUL 2M2DA 3C6LA 3MO1B 1R5VA 1I7UB 3MJ9A 4X6DE 2X05A 4Y4FD 1F11B 5DGRA 5F1OB 2DOCA 3SDAA 1YY9C 4RGMB 4LEOB 1IGMH 3OZ9H 4I18C 5SWZE 1EHAA 1L7IL 1OTUD 4Y2DB 2AVGA 5DMKA 4JRYA 3UZQA 4F7PB 3RUGB 2OYPA 3CDGB 3G5XA 3KYMB 3T0EC 3J8F7 2A2QT 1D6EB 1G6RA 1OT1A 5AZEL 1NCWH 4LFHD 1NCCL 1AFVH 3C09B 2OLDA 4OUUB 2IG2H 3CGTA 2IPKB 1JGLL 1H3UA 4R4ND 5JHDE 3RGVB 2HA1A 1A5FH 4OSUL 2F8XC 2AEQL 4M8VA 3IDXH 4MXQC 1IGCH 3WBDA 1IGTB 3VFOB 2WBJC 3HRPA 1KJ2L 1TXKA 5CGYC 3AREC 3DV4B 4NO0D 3TLRA 2Z92B 4EIGB 5DS8B 1OHQA 1XCTA 4M5ZL 4YDLB 4F7MB 4LSSL 5IB2A 3WEXB 2VZ1A 3MRJB 1A9EA 3DBXA 4U1JB 4AEHH 1FIGH 1RZKH 2IANB 5DJZA 4HGWB 4XVTH 5SX5H 4PJGA 1JTTA 2BRRH 3LEXB 5DC9B 1TFHA 1PY9A 3NGBB 1JFQL 2G2RB 3H3KA 3MRQA 1MHEB 3WHXB 1EK3A 1GGBL 1NFDF 3MV01 5D6DA 3PGDB 4OCXL 4KKLC 3UX9B 5ALCH 5DC4B 2F74A 3NA9H 3MBED 2PXYC 5LQBH 3M17B 3G5VA 5DVLA 5T1DH 5GISH 3HA0A 5EU7C 4M9OA 1U8LB 5JIPA 6CGTA 1BD2E 2A6DA 2FX7L 4YXHL 4J4PC