1I8KA

Crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
DIELTQSPASLSVATGEKVTIRCMTSTDIDDDMNWYQQKPGEPPKFLISEGNTLRPGVPSRFSSSGTGTDFVFTIENTLSEDVGDYYCLQSFNVPLTFGCGTKLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAI
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i8kA00
3WFBL 5DMJB 5ACZB 3VXUE 5IJKA 2C1OA 4TUKL 5E56A 3MRNB 4MJID 1OAZH 2H9GA 2DI7A 4LLUA 3V7AE 2WBJA 4PJCB 1S78C 5F6HJ 1KIQA 3SDCA 1EEZB 3AFLA 4MJ2A 5TF1L 4W81A 1P69B 1ZANH 3MRLA 4Y4KC 1AGFA 1EMTH 3VFTB 1IKNA 3QZWA 1CZ8H 3VD4A 2ZOLA 3RJQB 3SGJA 4AEFA 2E7LC 1GGUA 1MPAL 5IB5B 4NZRL 4YHYC 2FYYA 2E5EA 2HA1A 3QA3A 2R9HD 2QR0A 3DIFA 4Q9RH 2R8SL 2BDNH 1N59B 2R2EA 5E6YA 3RWGA 4HJGB 1MRFH 5F7LB 1EEUA 4ONHB 4XVTL 4F8TA 2VDMH 1RZKH 2DLFH 2P1YA 1ORQB 2H8PB 4TULH 1BQUA 3HZKB 4KY1H 1YC8A 1EFQA 3S8WA 1RQ5A 3BDBA 3DX9B 4HMCA 3O11A 1T0MA 4PLOB 1RIUL 1S7WA 1PYWA 3GSVB 2PO6A 4K3HA 5HGGS 4OKVA 3HR5A 5JUEL 2AJYH 4IEFB 4TVPE 1RUKH 4X4ME 5IG7B 3VWKD 4DK6A 3MJ9A 4KC3B 1YQ2A 3MRQA 1BZ7B 1BQHG 4KRNA 5IESH 3MA7B 5B21A 4U1IB 2J3SA 1FZMA 15C8L 3KWWA 3D48R 1LK3H 2NLJB 1J5OH 2ENSA 3SJVE 3IU3A 3FB7B 4F7MB 5HY9B 3RQ3A 1FVDB 5CD3A 4UOW1 4ZFOA 3O3DA 3NGBB 1EAPA 2HKHL 5K9QG 4RGOL 1QSEA 2GSGA 2R0KH 3IJHA 1YMHA 4M5ZH 1Q0XL 2BFVH 2CXGA 2Z35B 2J8UA 1CFSA 1CS6A 2IANA 4WEBH 1F58H 1JV5A 35C8H 4WUUA 5KSVA 5KVDL 8FABA 1O5DT 2JJWA 4TVPD 1DE4B 3UZVB 1RFDH 4DVBB 5BQ7B 3MA9L 2Y9RT 1KGCD 4LBEA 2DQGH 1T5WA 5IVZB 3I50L 2DB8A 1FNGA 4WNQB 3EOAA 4U33A 5KSBA 5I1KL 5D7LE 3PL6C 1TLKA 5MENE 2AK4D 1N0XH 3MRHB 2KQMA 2B20A 4RCAA 2B4CH 2P5EA 5K9KB 2MPAL 2X4UB 4NQCB 2AJXH 3HNTH 4JG0L 4BSVA 4OLYH 2BY3A 5CSZB 3QUZA 4K8RC 1J1OH 2DBLH 4EJ1C 3IDYB 5KJRL 2G5RA 3VE0B 3BP5B 2P46B 3TH2T 4RA0C 1JGEA 4PJFE 4AIOA 1UZ6E 3AGVA 2YC1B 5FO9A 1FFPB 5BS0E 2VL5A 4UUJB 4KK5C 4V1DB 5E8EB 5EO1B 3SJVB 5ITBL 3NOIA 4OI9A 3HRPA 4TSBH 2Q7YB 3QDJA 3G6DH 1SY6A 2HFGH 4N0UB 1BJ1H 5LXGH 2DQTL 1KEMH 5E24E 3MLRL 1YECH 1OD7A 3OKDB 1K8DB 2WW8A 3H3BC 4L3CA 5F9WB 3UTSE 4CU7A 1XGQA 3E6FB 1KTLA 4NQTA 3C5ZD 3GM8A 5J3HC 1KN2H 5I1CL 3FO0H 1P1ZB 3O2DA 4QXGL 3ZHLA 1YJDC 2OP4L 4HCRL 3MREA 2NY4C 5SWZB 2J6EL 1T2QL 4OFVA 4S1DD 3U9UA 1ZWIB 3LCYA 4XH2B 3V0AC 4Z7VA 4PJGF 4CDHA 3C8KA 4D0DB 1J1OL 5E1HB 1F4AA 2X1QA 1S7QB 4Y4HD 3RAJH 4KK8D 4Y5XC 3SDDD 4HWZA 2ITCA 4HPYH 4NBXB 5F7UA 2X4SA 4RMRA 1A7PL 2W9EH 3P9LB 3P0GB 5IVZA 2AABL 4M61B 1UM5H 2VLME 4G43B 1H3XA 2VLRB 4EXKA 3OB8A 2Z31D 1KPRB 2WLZA 3LKNB 2F19L 3PHQA 5DRZA 4N5ED 1CXLA 5DJ0A 3SY0A 2DL9A 3SDXA 1WT5A 1I1FB 1F97A 4UT6L 1OAXH 3JXAA 5FA4B 2GKIA 3B6SB 4HAFA 3B8YA 4HD9A 3D85B 5A2LH 1IILE 2MKWA 5A3IC 4K94H 3DGGB 5IROA 1U92A 4XC1H 5EOCL 5F7DB 5JA9A 3PNWA 3IRPX 3L9RA 4P2QA 1J9CT 3EDKA 3IGAA 4I9WE 4X7CC 5EZJA 1YN7A 4PGDA 5GSRB 5CBEB 1M7DB 2R2HB 3T08A 2QQLL 5IF0B 5JW3H 5DJYB 3ROOB 5GSVB 5FB8B 2NXZB 1KTDB 3G6AB 4Y4FB 1E6OL 5F8RC 2CDFA 3TCLA 2V7HA 3H9SE 3CPLA 3I3BA 4PJ7A 4IMLB 4D9QE 4XP5H 3P77B 4LSTL 5TDNB 5SWQA 4WTZA 3PJSB 4AENA 4QRRA 1YQVL 2YD5A 3CVHA 3LH2L 1NL0H 3SE3A 2R9HC 3BIAX 3F8UB 1JYNA 4NZRH 3QCTL 5DA0B 1W8NA 4Y5XA 3OGCA 1C12A 4NKQB 1A0QH 2D31B 3KPSA 4U1LB 4C56D 5L8LB 4MA7H 3HE6D 3PGCA 4ODWA 4KROD 3LKRA 3P9MA 1FORL 3T0EB 3MCKB 2IMNA 5HGAB 4YDIH 2EYRB 4DN3L 1I9JH 3PP3K 4FFZH 1Z9MA 3BW9A 1SHMA 1AHWA 5EZLA 5IFAL 5F3BA 2PTTA 3LHPH 3IU4L 1NC4B 1D7FA 3FTGB 1MJ7H 4EI5B 2EDLA 4GLRH 1N7MH 4APQD 4CMMB 4I0PC 3VFWA 5B39A 1AXSB 4E0RB 5CP3H 1NUFA 1PG7X 4OD1L 4X0KA 5ICXB 3WN5A 3W39B 5I76A 4HBCH 3TN0D 1R3JA 4OCNC 1IGMH 4P5MB 2AXJA 2X89A 3SBWA 4Z8FL 4EI5D 3W9EA 1OSPL 2JLLA 4XAWL 3MRMB 4IMKA 4M5YL 1DANU 1HHGB 4BQ8A 3D0VA 1J18A 4A2MA 2J8UB 5FK9B 5HDLA 3BZ4A 3TBTB 5BOPA 2VQ1A 4PJXF 3U36B 3QUZC 1NUGA 2DIAA 4HH9B 4Y4HA 3QXWA 5D5MB 2P4AB 4RAHA 3QUKA 3DX7A 4FZEL 1YEDB 1AGCB 4G6MH 2Q6WA 5J12B 3EJJX 1ACZA 3F7RA 3PL6A 4NZJA 3P0VH 1CFVL 4W4OC 4U3XA 4U1NA 3DX7B 3VRJB 1MFAL 4NM4L 1TQCC 3MGAA 5EOCH 4ZXBA 2A0LD 5JR1L 1E6JH 4U1HA 1K9TA 3H9SB 2HWZL 1KCKA 4Z7UA 5DQDH 4LVOB 1U8MB 4L3EE 1BGXL 1TZGL 4OD1H 3VXPA 4IM8A 1AD0A 4ZYKA 4JFHD 1ZXQA 2NNAB 2LVEA 3TA3B 3D18A 1RIVH 5JPNA 1XGRB 2HMIC 4YHOL 2WV3A 2NXZD 4FQJL 4TVPL 1N59A 2Q3ZA 4RMQA 1T83C 4WW2A 4YHML 4R90L 3ZL4H 5DZOA 4DZBB 3S34H 4X6DE 1CLYL 5D7SL 2APXA 2EEDA 1MLCA 3FFDB 4JAMB 4L8BB 4M03A 3HHRB 2GSGB 3Q3GB 4XC3L 5KN5A 4TRPH 2ZSVB 4RFOL 4EIGB 3PXHA 4X4XA 1L7IH 1YEFH 3G5VB 2GYSA 4ZTPL 1V7NL 2FHCA 4MD4B 2H26A 1IM3B 3UTTD 3S35L 1UH2A 3PWJB 3QXAB 5BZDA 1P7QB 3GKWH 5HYFA 3MACH 4JKPL 4JRXA 4Z8FH 1Q94B 1JN6A 5C0FA 4WO4A 2XTJC 5DJ8B 3IDYC 4FFWC 4JM2A 3RIFK 1P4BL 3GJFH 4KHXL 3P9WB 3QIBC 5JHDE 1SY6H 2JJUA 1YEHH 3MUHL 3O2WL 3HB3D 5ESAB 2L4OA 1FZKB 4KJQC 3MLTB 4XNXL 4EXPX 1HXMB 4KZEL 4DUXA 4X7EC 2E7LA 5DQJB 1L6ZA 4IRSC 3LHPL 4NFDA 3F7PC 4HS3A 2XA8H 3AY4A 1MI5A 1R0AH 4EN3A 5MEOA 4YLQT 2WQ8A 4QRRE 2H1PL 5INDB 1IGCL 3SDDB 5L88L 1W72L 1NGWA 4C59B 5KVGH 1BVLB 5ITBH 1F3DH 3RX8A 4CL7A 4YHIA 3N85H 1B9ZA 4S1QL 4JFEA 1F45A 3QHZL 3PGFL 4Z76B 5T1LA 2VLKB 3WKMH 2EKSA 4JB9L 5E5RB 4DKEH 1GSMA 4AM0A 5C09D 3QULB 2CPCA 2W9DL 5MEQA 2Y5EA 4WU5A 4XCYB 3EFFB 2BNRE 1I1AA 1U8HA 3PV6A 4QT5B 4XMLH 2XKNB 4BFGA 1B3JA 4JZJB 4PG2A 1JPTL 2OX5A 3UC0L 4G6FD 2XZAL 3GMMB 4ZFGL 2Q3AA 4MB5A 4YAQB 5FGRA 4Y4FD 1WSST 4HIJB 3SJVD 1I7UB 3FONA 4Y2OA 1ZLWH 3FL7A 1V3KA 3X3FH 1KB5L 4QCIB 2HN7B 3NABL 5EZOH 5JQ6L 1CDHA 4KJYB 1D5MB 1U8QB 1JWSB 3TA3A 3ZYZA 4POZD 4M5ZL 4NQVB 3S5LA 2Z8RA 4PR5A 3WFDL 4RWYH 4PP1C 5D7LB 1WEJH 1CTOA 5TDNA 5IB1A 4XP6H 1S9XB 3QHZH 3JV4A 3U30C 4Y4KB 1KNOB 2X1PA 1FG2A 1FFNA 1P7KB 2E7BA 2NY5C 4N8VG 2AK4B 5JDSB 5DQJA 4AL8H 4ZFOB 3UTOA 4QF1B 4ODVH 2MSPA 2WBKA 2FATL 2IANE 3BEVA 4R4FH 3GJFK 1UKTA 3ULVH 4X98A 1P5UA 4UT7L 4FFVC 4PIRF 3UYOD 1R3HB 5JZ7D 2EXWC 1LE5B 3IFPA 1FP5A 3DVGA 3RVWD 3REVA 2PO6B 4ZUVA 3C60B 1D6EB 1WAAE 2ITDB 2FECL 3LQAL 1A9EA 1J86A 3TT3L 2KUTA 1DBML 4J3UA 3I6GB 4UQ2A 3LS4H 2QSCL 5C0IB 5DJ0B 3SY0B 4L4TD 2FHBA 2DM7A 5DTFA 3ARDC 2MOVA 1AP2B 2CLVA 3TH3T 3X12A 1X5XA 3WNNA 2BSSA 3EYQD 4ODHH 3VXUA 4PJ7B 3GIVA 2Y6SD 4RFNB 2FYYB 3VWKB 3M07A 4JO2L 1U3ZA 4UILH 32C2B 3QEUB 3E1F1 3SKOB 4GSDH 3P4OA 5I1KH 2C3VB 1OW0A 5DLMH 1UJ3B 3QULA 3C5ZB 3AM8A 4EDXA 4ODVL 43C9B 1L7TL 1NAKL 5F7EL 2BOCA 3ZTJG 3MCLL 3ULVD 2V2XB 4JANB 4FNLL 3QRGH 3QUMA 4R7NB 1FNGB 2X41A 2B39A 3BRFA 4MNGB 4IDJH 4JG1H 3N1GC 5DUML 2BC4B 1S7SA 4OF3A 3QT2A 5GS3A 2EYRA 3ZYIA 3DX6A 3QNZA 2OTWA 5DQDL 5FGSA 5KOVC 2AXFA 1QLRA 2IAMB 4U0QB 5D71L 5EU6B 5AYUL 1XF3A 3SO3B 3OXRB 3ZKMC 4U1GC 2DOCA 5ILTL 2BHUA 2YN3A 1KC5L 4L9LA 3K2UH 5E9DA 5I66A 3G5ZA 1Q1JH 3O3AB 4NQCD 2ZUVA 1QLFB 5AYUH 4M6MH 3IFLH 1DZBA 3X11A 1IGML 4ODSH 2MHAB 3DXAD 4P3CL 2DWDA 2UZIL 5ESQB 3P9LA 4P49A 1BIIB 4MZ2A 4I18A 3CCHA 4EOWH 3H9HB 3DHJA 1T0PB 3I3DA 1MUJA 5HYJB 2BVQB 1ZWIA 3GSOA 1FLRL 2PETA 4ELME 2R69H 4HGMA 5IOPA 3MREB 4UV4H 5KVEL 1W2KT 1S9KC 5IJVA 2AQ3A 3OXSA 2XACC 3H0TB 4K3EH 2EC9T 4HG4J 3GMOA 2NZIA 1EEYA 3ALXA 1A4JB 1CIDA 4NNPL 3W5NA 2EYSB 4XHJD 4MNHB 1QR4A 3MJ6A 5GS2H 3SGKA 4XPGH 1U8PB 4TSCH 2IFFL 1MVFA 2R29L 4LP5A 4OTXL 5FHAH 4N9OB 4NWUL 4AIZA 3QDJB 2W0PA 4HUWB 4GRWF 1DBMH 1WAAF 1UCBH 2X4PA 4PJIA 3JVGA 2YMXL 2FNBA 4OZHB 4U6VL 4PJIF 3CSPA 4GBXC 2YPLE 4ISVA 1ZT4A 2VR9A 4NO0D 3GUTA 2NMSA 3TYFA 5GS0D 1KBGL 3QFJD 1FFQA 2CDFB 3FQNB 3OJMB 4EI6B 1G7JB 2XZQL 1TJIH 4OBSA 1MFCL 4LARH 3V6FB 4IJ3C 1BBJB 4HDIB 1U8NB 3C5ZC 5EOTA 4WI2A 5KSAD 4YHZL 1A6PA 2QQLH 4UDTB 5C1MB 3QUXA 3U9UB 1A7OH 5J13C 3EYUL 1U42A 1H8SA 4YDVB 2I60L 3GSNL 3TO4A 4PGBB 3VH8B 4X7FC 2Y7QA 4HSQA 1A64A 1E6OH 1HQRA 4WRLA 5E70A 3IDMA 1LP9A 5ITFA 2ZSWB 3NCEB 3KXFE 4XNMB 2XFXA 4D3CH 2H8PA 4P57A 3RDTA 4ONHA 5DUMH 1GOFA 2X6MA 3OZ9H 1CCZA 4YHOH 1F2XK 4LCCA 4LF3B 4KAQL 3EJYD 3JTSB 4MAUH 1IVLA 4NKDB 5F1NA 3V4VL 4MX7A 1HI6B 4U31A 1RPQA 3SDXE 3CZJA 4JN1L 4WFGD 1OF2A 2QL1A 4UINH 1CQKA 1MEXH 1UG9A 2DKSA 3DRTA 3QEHA 5DA4A 3BKJH 3SPVB 4KI1A 4WHYG 5C2UB 4LEOA 3LS5H 2E7MA 2WWMC 1LGVA 1YEJH 5C6TH 1U8OA 5DZNA 3FMGH 1BZ7A 1DQJA 3DRQB 2P45B 3BN9D 1A7OL 4CUCA 5F7YC 4LASL 1OT1A 4AIXA 1T3FA 3T3MF 1Z3GL 5I1LB 3FT2A 4AJ0A 3UDWC 2NY6D 3ARDD 3OGCB 4HFUL 2XWJA 3EZ8A 4OF5A 1ZLVK 4LMQI 4F9LC 3I9GL 1KJ2A 4ZTOL 3PWPE 4BQCA 3L7EB 3SDXF 1T5WB 4FZ8H 2O61A 3WO4C 1KCVH 1M05B 1KJVA 4CAGA 3MTRA 4L3ED 2W0LA 3VFOB 4ISVB 4XMPL 4R4BA 3RGVC 3QEQA 1AIFA 4FQXC 5B4MD 1MCWM 5D70H 5HJ3B 4HUWA 3WDJA 4I0PB 3HUJA 3TF7C 3MV8A 4WHYH 1ZT7A 2RCSH 4YDLC 3OHXA 4HF5H 2FEEI 3X17A 4BFIB 1Z6JT 2HT3C 1X5LA 2KZWA 2PYEE 2NQCA 4FMFA 5H94A 3RFZC 2BCKA 2Z8WC 5DEGB 3GK8L 2R0ZH 4LFHG 1P9MA 4ZXBB 1CBVH 2F9BT 3B5TA 4JLRB 5BOZG 1D5BA 4J4PC 3RTQA 3F6IA 4GKNB 2ZWLT 5E2VH 4NZUL 5FM5M 1Q72H 3F65A 5AZEL 3UTPD 1NUNB 4G8EA 3TT3H 1ZSDB 1YEDA 4ODTL 5D7KE 3MYZA 2HAZA 2V2TB 5CUSH 2OI9B 1CGUA 1P4LB 1CFQB 4NKIH 5DRXB 2VAAB 2DBJA 1NAMH 4KQ3L 2EO9A 4FTVB 2H6PA 5CKGA 4QHNA 1ZGLP 5T3ZL 1A1MB 3V4PL 4JO3L 5MEPA 2W65A 3MNVA 2C3HA 2JJSA 3LIZH 5FF6B 4L29B 2BNQD 3RUGE 5FA3B 3PGDB 5KVDH 1QBLH 1FDLH 1FGVL 4GW1A 2VXUL 2HKFH 2PR4H 3TYGH 3UTPE 2FD6L 1HH9B 5I0ZA 1TPXC 5IGXL 3OPZH 2HT4D 4D0BA 4OZHF 4D0DA 4N0FA 5C08A 1CE1H 4Z7VB 4L8DA 1FL3B 1AXTL 1J5OL 4NJ9L 3KPTA 3WS6C 1G7QA 1NBYB 4E9LA 2ESVE 3DTXA 2AV1B 3VJ6A 3VXRB 4X6BA 4WO4B 5E00B 4AT6A 5C0JB 1MHCB 4HV8A 1I9IL 1IGFL 1C7TA 3K46A 4M93C 4FQ1H 4NRYB 2Q87A 4GOSA 5JIIA 2AK1H 4XVUD 2FB4H 2KZ1B 5GS1C 2XA8L 2P8PB 3G5VA 4OCWL 1A6UL 3FRPG 3HUJB 4QRTA 3X14B 3B4NA 4LQ1A 4BH8A 2L0DA 5T5FH 3WD5H 5L2KA 3SDAA 5TDPB 2G75A 3TIDB 4AG4H 4M3JA 4LRIC 1QACA 4Q9RL 2R8SH 2EDYA 3OXSB 5KZCB 4KFZC 1PQZA 5DD3L 1Z9SA 1BF2A 1NDGA 4S1QH 1Z9OA 1UYWH 4UNUA 4TULL 2G2RA 1AGFB 5GJSH 5MI0C 2YMXH 4ZFZA 2GHWB 1ETZA 2D03L 3KNBA 2NY2B 4HQQH 3N50A 1UWGH 5T3ZD 3KYNB 4PGCB 4P3WA 3BPLB 3UPRB 3GDBA 3V79C 1CLYH 1DN2A 2KL6A 2ZPKL 4OD2B 4ORZC 3MSPA 2O5XH 1LEIA 3H9YA 2DWDB 5ESQA 3RVUD 1T1WA 5F6HI 3IKCB 5D1XC 3ORJA 4HX1B 3TBVA 2I26N 3FQNA 3IFOA 2A73A 3FOLA 2F53E 3MRRB 4NQEB 3MGTA 1IM9D 4JDVA 4LHUG 4JCMA 1CICB 4F7PA 1FFNB 1T89A 2VLMD 1NEZB 2BVPA 3DJ9A 4PYHA 5JTWA 1YJDH 1A6TA 1FNLA 4QRSB 5JQ6H 2PYFB 1OTUC 5E2UL 2YD3A 3BGFB 3V5DB 5AUMB 1EX0A 3IKCA 1QKZL 1X7QB 3TBWA 5D1ZA 3MRQB 3EFDL 3TC9A 4E41A 2PYEA 1J87A 3IS1X 2BOBA 3KR3H 2O26U 3CLFH 4QLRA 3FTGA 4ZNEA 5E08L 4OFYD 5GXBB 2EC9U 3U7WH 1U58B 5FEBA 4JY6A 3FMGL 1IQDA 4MQSB 4XPFL 2W60A 4Q9BA 1A6ZA 3BX7C 5FUZH 5HHQB 3EOYG 1U41A 5I1LA 3O81A 2B1AH 2IJ0C 1AI1H 5IK3A 4DVRL 4JFFD 3N0PB 1F90H 3MO1A 2BVTA 3HNVH 3VXTB 2B1HH 5DTFB 5BV7C 5KS9B 3O6LL 4PRNB 2F54B 4OQTL 1CGSL 4Q6IC 4YXHH 3VWJD 2Z91A 3U0TA 1MCNA 3IXAA 1YYMH 4GG6A 1S78D 2D7PA 3TGXA 1N3NA 2PXYB 5JW5A 2VXVH 1S7VB 3MLUH 1WBZB 2GT9A 5KS9A 1OWRM 4RGNE 3V0WL 1E4WL 1G1YA 3FJTA 2C1OB 3PDGA 3L5HA 4JFZH 4PTUB 5TQ2L 3ABZA 5LJYH 3CK0L 3OAZK 5LGKA 2E3VA 4ZOBA 3D39B 5D1QD 2YN5A 3ARBC 1IL1B 1K5NA 1OGAD 4ZOCA 5JO5B 1TFHA 1U8LB 3G9AB 2W07A 4HIHB 4DEPB 3SQOH 5C3LD 4Z77A 1NLBL 5K9KA 4P3DA 1E4XI 3LDBB 3K7UA 4LLWB 3U7YH 2EDEA 3PNWB 3V9FA 4OZ4A 4AZ8A 5F7DA 5IWLA 3OF6A 4CRPA 3RZCA 4JZJC 1UKQA 4CW1A 1JHTA 2ZJSL 3IVKA 2W59A 4LPWA 5ERWA 2BDNL 3VXSB 2XQBL 4JPWH 1UWXH 4M62L 4L3AA 1CXEA 3MOAL 3O3AA 3T1FB 4DKFL 4MJ5B 5MEPB 5F1OB 2WWKT 2NXYC 4I3SH 1BF8A 3N1PC 5A2KH 5L2KE 4WTWA 4U7KA 3PL6D 3VGBA 4FTVA 3S3JA 1YEGL 3L7EA 5EH1A 4PLJD 2VAAA 3AREC 4LLVB 3QI9C 1ZMYA 4H26A 3T4YB 4GRWH 3VRIA 4NQCE 2CD0A 3TA3C 1T1ZB 3IU3B 4F7MA 5LGJB 1I8LC 1WBYA 5DFVC 4YDKH 4M6OL 4LP4A 5BS0A 4MNGE 1HOCA 5IGXH 2QQNL 1M6OA 1MY7A 5DHXB 5I30H 2EDOA 4RAVB 4ZUUB 3V6BR 3QCVH 3KS0H 1XIWB 4YBLB 5I19H 1RI8A 4JRWA 3BHBA 1UFUA 1YEGH 3L3KA 4HC1H 1OY3B 3NFNB 3VFPA 5FGBA 3BFOA 1AO7B 1DDHB 3LIZL 2BVQA 3GM0A 2ATKB 2UZIH 4E41D 4JPIB 2X70B 3WL9A 4D0CA 4ZO7A 4BKLA 4MWFA 4RX4A 5GRUH 2LAAA 2IEPA 2J88L 2ZUYA 4U6YB 2YD4A 2APVA 3CH8A 1N8ZB 3RHWK 1Q9LA 1LD9A 5EU5B 2X4NA 4ONFH 1RHFA 3BXNA 3ZE0F 1XAUA 5BV7H 1ZT1A 2EE2A 3HC0A 5INCB 1DEDA 4X9FA 4KTDL 2NY3D 2A1WH 5AG8A 3UTSA 3P11L 5E9DB 4P2YA 3LRGA 5F3HB 5HHMB 5C0EA 1T2QH 2EICA 3E8UL 5BXFB 2V7NA 1IT9H 3DYMA 3VGEA 4PV9A 1I7RA 2HVKA 3D69A 4L9DA 3T3PE 4PRDB 1T4KB 3L3HB 3V5KA 5B8CA 1NAKH 5F7EH 1WWAX 5IMKB 4CVUA 1IC5H 4IRSA 2VYRE 4Q97A 4JJ5B 2ARJA 3MODL 5CGMA 1I1AB 5ISZB 3H8NA 3HPLA 3QPQD 1A3LH 4WV1C 4Y16A 4OGYH 1CD0A 3BWAA 3GUTB 4WWKB 3QIBA 1VEOA 3S6CA 1EO5A 2P5EB 1KCUL 4IRSB 4OQ1A 4NO3A 5D9SB 4NQEE 3ISWA 3U79A 4EDXB 2CO7B 3QXTA 1BFOA 2XN9E 4JDZB 4ZUWB 5T1MA 1HYRC 2I24N 4OLXH 5GZOD 2JCCA 4CN1A 3ZKNC 3HTLX 4J2XA 4X8JA 1ZKAA 3MOBL 2CMRH 2V2WA 2UZYB 4X6DA 5I75B 1UEMA 3GBMH 3ECBA 3RNQA 4M02A 4YX2L 5GGVH 4W6YB 1IGIH 4NO5B 5GGUA 1QR1B 5E8OB 1F42A 4JR9L 1KB5A 2D9QB 3DMMB 5IM7B 5F93C 4G3YH 3UZEA 3BH9B 4BH7A 3IDNA 3KPMB 1GGYA 4JFHE 4XNQB 2C9AA 1T03L 3EOBB 1LDSA 1VGKA 1KFAL 5DJZA 4D9RE 1YDPA 1TJGH 4UB0H 4JRXB 1XH3B 2V5YA 3PWJA 5BZDB 4M48H 4HT1H 5BS0D 1OTSD 4MD4A 4LNVA 5I1EL 1QD0A 3W2DH 1UWXK 4RA3A 4NO2B 1A5FH 5DXWA 3NFSH 3L7FB 4X6FB 4OLYL 4H0HB 4FHBD 1HSBB 2DJSA 3BKCL 5IBUG 3CFBA 4BUGA 2ZUQC 4HJ0D 4N0RA 5KANI 4ODHL 2K1MA 4JY4B 1L0XA 3MRDA 1F6AA 5CKAA 3TJEL 5BO1H 3HMXA 3MOBH 5FM5O 3KR3L 4PD4J 4LCUB 4YH6A 3BP7A 1XCQB 3AREA 3ZT5A 1MCCA 1NC4A 3K4ZA 3FO2A 2FGZA 3JTTA 3QIBB 1IM9A 2FLBT 1NAML 1FJ1A 4YK4B 3S4SA 3MLWL 3Q5YA 4G43A 2G5BA 4LLDB 4L4VA 2ARJB 2FEEL 1MF2H 5IB4B 4KMQA 2VR5A 3DX8B 3RDTD 4NGHH 4NSKB 3V0VA 43C9A 3PIQB 4HC1A 4NQSB 4OZFG 5B38B 3OAZH 3ES6A 2C1PA 3VFMB 3O6FA 4ZMAT 4OM1H 2BFVL 2FIKB 1RUPL 4JKLA 3FHAA 1Q94A 1S9VB 1U3HD 3RZCC 4P4KA 5EO9A 2BNRA 4R4FL 4QRRD 2GTWB 4W6XB 1CI5A 1NDMB 2BERA 3CGTA 4PJHF 1IC5L 5D5MF 2EEBA 4JPVH 5FFLA 3QNYB 3X13B 1HCFX 5TDOA 2VSCA 4M7KL 4IRSD 4GXVH 3I6LD 1B0RB 4I48B 4M00A 1CYGA 4QRRB 1T20A 3IXTB 4QXWA 5DQ9A 5FK9A 2OJZL 3P77A 2N1KA 5FUOL 4HGKC 4L4TE 5LXGL 1BPVA 1JHLL 4LSSH 5FA3A 5ISZD 1RUQH 3WIFA 4B0MM 1ODAA 4JVWA 1XFPA 4DOHE 5GGTH 3CDGB 1RJLA 4YHLH 2ADGA 4HUKB 1VGEL 2FZ3A 2ZKHH 4Q6IA 2ICWB 1Q9KB 4Z0BL 1RU9L 4HKXA 1U95A 2YC1A 4WFFD 1MPAH 4UDTA 5BCAA 4LDEB 4O51A 4LMQE 1A1OB 4OGZA 2W60B 3K2UL 2IH1A 4BH7B 3F5WB 4UAOC 3PWLB 1J8HD 5CJ5A 3TO2B 3G08B 1IEAB 3EDDA 5FM8A 3P2TA 4DGIL 1RHHB 3MV8D 2FB4L 2YD6A 1MIEL 3T2OA 3NFSL 2AJVH 5T3XL 1PFCA 4TOYL 1ZLUK 5HYSG 3PWUA 4FQ1L 1RK1B 4Z0XB 2EDBA 3LZFH 4WFHD 3GKZA 4ODBD 2GFBB 4M43H 2H3NB 5CWSB 5IVXB 4YO0A 2BK8A 3HRZB 4DW2L 5GGSY 3TBYB 5GRXG 4BZYA 4Y0GA 2ITDA 4IRJC 3RBGA 4ODTH 4LBEB 3RL1B 4ZUSA 5F7FA 4P5MA 4WEBL 3HI6H 4CW1B 4JFPA 2YPVH 1FVEA 2UUDK 1LMKA 1EGJA 4ENEC 4NQDE 3DV6A 3R4DA 1AXSA 4E0RA 1F4WH 5HVGB 1VHPA 4R96A 3WHE0 1MCFA 1NGQH 4GKZA 3PV6B 3L5JA 3QIWA 5E99H 2OL3B 3JUZA 4N0YH 4QTHA 5D93B 4ZSOB 4ZAKC 5FOBA 3DV4B 4OM0H 1A2YB 3EYUH 1RZJC 2VDOH 2A73B 2EDXA 4LFHD 1FZOA 1U8MA 4JQXC 2ZNWA 4MA3A 5I16B 5IMKA 3C6SB 5DT1H 1X5ZA 4X4YB 5CHNA 1ZLUH 5IEHA 1RJCA 3MRPB 3CNKA 1M6OB 5EOQL 5J8OA 4Y1AB 3FQWA 2LTQC 4HWUA 4JRYE 2NW3B 4XXDA 3JSSA 3QEHB 4P23D 1ED3A 4WJ5A 4Y7MA 4LEXL 2P5WA 3QNXB 4H25B 4XRCB 4NKMB 4XC3H 2EE6A 4PJEA 3ZE1F 2CIKB 1I3RB 2PW1B 1LEGA 5CEXB 3OQ3B 2R1WA 1LEKA 5GRJL 4XCNA 1JUFA 3R06A 1YEKH 2P43B 3QUXD 2IC2A 3QNZB 4P99A 2V7HB 3JWDH 1RURH 4LPXA 4LRIA 4P4KC 1P84K 1XF4A 4QXGH 1JYXA 3FQTB 5HHMD 3D39D 1HWGB 3O6FC 1CLCA 3LAFA 3ZE2E 4OGYL 3L3GB 1JZ4A 1JPSH 1FLRH 5I1AA 1T66D 3WFDH 5SX5K 2A1WL 2HFTA 4FP8L 4PYGA 3IDXH 1DBBL 1NMBH 2NYYD 3PP3H 4CKVX 1QHPA 4NT6A 3WS3B 3HFMH 1HILA 1JRHI 4G8GA 4EN3D 4XWGL 3LN4A 4NP4H 4ELMA 3U4BH 1CE1L 3RIAK 4DW2H 4P3CH 3O45A 2RB8A 4K7PX 4LOUD 4Y5YA 4BSWA 3QCTH 1NBZB 5HVWA 1J1PL 5C6PB 4H5SA 1I75A 1RK0A 3KPPB 3BZEB 4NN7C 1INEL 2DQEH 4TOYH 5DD0L 2XRAL 4PJGA 4LPVA 2GIYA 4NKOA 4OD3H 1QSEB 4RZCB 1XIWD 2KH2B 3L7FA 4X6FA 2BY1A 3PQYB 1MJJA 4GG6B 4XAWH 4MJ6A 5E6ZA 2CKBH 4OCSH 4KDTC 3BT2L 4OFKA 1RU9H 4L1HA 4GMTL 5JW3L 3OKLA 2YPLA 4OKDA 5E7BA 4N5EC 1FGNL 4YHNA 1DANT 1U8KB 1ACYH 4WI6A 1FO0A 4EUPA 1DEEB 4PGEB 3T65B 1AC6A 5I1JH 3CPLB 4QHNB 5E2UH 4X80L 5HHVL 1IBGH 3CFJA 4RMVA 4Y4FA 1G9NL 1OGAE 1G9ML 5JIKA 4GQPH 2MQCA 1FZJA 4OLUL 1P53A 4TNVF 5I30L 3D2UD 1HH6A 3LV3A 4XGZA 5D1XB 1QUNA 3S35X 1J0JA 3K4DA 2V2WB 5K9OA 5D1ZD 3QP3A 4ZG1A 2YRPA 1XGPA 3FOMA 3BD4A 4E41E 4DUWA 1FFOA 1WTLA 2CO6B 1MCJA 5HYSB 4PRHE 2AV7A 4RBPK 5D6CB 4XHJC 4OFYA 3JWDC 1QVOA 1Z5LA 3EYOA 4LCYA 3VFNB 1TJHH 3O3EB 3AMLA 4N0UE 4XXCA 3G5ZB 4QRSA 4QCIA 1IC1A 1LO3H 1OAQL 3MUGA 3MC0A 4LNRB 2Q8AL 3L95B 4GT7A 4HKBB 4R7DA 5GGVY 5LQBH 1JI2A 5C0JA 5DVLA 4P2OC 2CK2A 3RY5A 1E28A 3SGJC 2EC8A 4UV7L 1JF1A 1MJUL 3FOLB 3MRRA 4AQOA 1JHKL 5B8CC 5I8OH 5LCVL 1IC4L 3CX2A 3VXNA 3BDXA 3HG1E 3KWWB 2BJML 2VUOA 4GAGL 2YZ1A 1ZEAL 5F7HA 1RMFH 5E9DE 3VWJB 4HFWA 1CZ8L 1QRKA 43CAB 1IAKA 4M7JH 2CH8A 1MFNA 1PYWB 3V6OA 1O0VA 3DROA 3UTSB 3LEVL 4KKNA 4NO0A 3B9KD 5CJOL 2I9LB 4CVXA 3TCXA 1M1SA 4GRLA 5AUMA 3UBXI 1S7TA 2QADB 4ODXA 4TUKH 3U46B 1U8LA 5C0NC 4CVZA 3NN8A 2HTKD 2X4NB 4H20L 3T0AA 1B0GB 5SWSE 4X5XB 3ROLA 1YYML 3VWJC 2VUYA 3P3YA 3RVVC 4PJ8A 4XAKD 1PJ9A 3QRFM 3QDME 4KWUA 4PRIA 1LO0H 3BE1H 1CFVH 2IH3A 3LEXB 4NIKB 4NDMB 3UBXG 2NY1C 4RISH 1AGDB 1D9KD 3F7VA 3RVTD 1PY9A 3ZLQC 1QFUL 5CIPH 2LE9A 3WJLA 3TBVB 5HGHB 4R4ND 1JF6A 5J6HA 5D6DA 2VXQH 4XP1L 2DQCL 2VIRB 4HIEA 3VXTA 3DLQR 1EHXA 4WUKH 3ARFA 2GJZA 4HS8L 4HS6B 4UT9H 3UEZA 3GRWH 3SHSA 2BRQA 3L3DA 3A0OA 5FGCB 5DMKB 3BH8A 3QI9A 3R0NA 3CD4A 1TJIL 3B6SA 1GGIH 4PTTB 4BA8A 3QUXC 5L2JA 4FQLL 3BJ91 4MXVE 5FKAB 4QXUL 3SE8H 1ORQA 1DUZA 1RSFA 3MLYH 1JZ5A 4X6CA 1WIUA 2QKIB 1AGBA 4RMSA 3UJIL 4JQVA 3IDIB 2F8XC 1EA9C 2VDKL 4WW2B 4HIIB 3DUHA 5MEND 3TBWB 2XNAB 4NPYB 2H2SC 2F5AL 4KGJA 4NM8L 5C92A 4DTGH 1Y6KR 3WHE1 5IWLC 2OQJA 3JVGC 4RMWA 2H2SD 4M7ZB 5DC9B 5DJYA 4ELKB 5ADPL 3QG6A 3H42H 4LHJB 3VFNA 5EBWA 4IRJB 4OCMC 3HRZA 2NTFA 3H7LA 1YEEH 3KPQA 1EO8L 3VXOB 1QA9B 3WIHL 1UYWL 4IOIA 1F8TL 2AQ2A 4XCFL 3UP1A 3C5JB 1EEYB 2GJZB 4UMGA 3O8XD 4LSQH 3U4EA 4I0PD 2FH8A 4PJHE 2Z0BA 3M17B 5A3ID 3W81A 4FFYH 1K4CB 3MJ9H 2BVOB 2QQKL 5A16B 3ILQD 1H3UA 2Q86B 5CJXA 1JE6A 4NCC1 3ZKSD 1D5XA 2GAZB 1FFRA 3HLAA 3SCMC 1NANH 1TQBB 4ZS7L 5AD0B 3KPNA 2WANA 3EYSH 4HWEL 4PJ8B 2H32B 1YMMD 2UYLB 1EH9A 2Z91B 2X1OA 3U0TB 3ROLB 1JI1A 1UCTA 3MRJB 2OQJB 3EDJA 5GHWH 1IGJA 4MA1B 1A7QH 2P24A 3TJEH 1I1RA 1T6VN 3KGRA 2K7QA 3BP4A 3ZHKA 4F7EB 3M8OH 3VH8A 1JF5A 4M1GL 3VFWB 5B39B 5F8QC 5DMYA 1OAZL 4QRQB 1IRAY 2NY4B 4PJEB 1DBKH 1AI1L 4EDWL 2XZCL 3KPPA 3BZEA 2NTSP 2Z31A 2B8OT 4P23A 2X4UA 1WITA 3HI1B 2AI0H 1A6VL 1ES0A 3S88L 4NQXB 3GB7A 2YD1A 3N9GL 4LCIH 2BSED 3QDAA 4NN6C 4JJ5A 4N5UA 1NFDA 5HYIA 1D9KC 2H41A 5HGAA 1RZJH 1C08B 4HJJL 5B38A 5DUPL 4M6NH 4L3CB 4L4VB 1J8HE 4M62H 3D9AL 2NTFB 5IP4A 1U36A 5J1AB 4Y2DA 4F7CB 5E6IB 3DRTB 2ED8A 1OD9A 2A9ML 3NH7L 4RGMC 4ZOEA 5LQBL 32C2A 1XCTA 3U0WL 2OZ4H 1YUHA 4FQPA 4KVNL 4P5TB 2XNAA 3GJFB 4PB0L 3RZWA 1I7ZA 1BJ1J 4R0LA 4OAWB 1QZ1A 4NN5B 3R06B 3S37L 2E9WA 5K9OB 2LV4A 4FXLA 5DR5L 5GGQH 2IG2H 5D1XA 3MJGX 3R0MA 4XMKL 3B2VH 4F37K 3QQ4B 2R0ZL 1VGEH 4PG9B 2FWOA 1CD9B 4XI5C 1RJYB 3ROOA 3SO5A 2WIIA 1NGYA 4AEHH 1Y6MR 1MVUB 3RZCD 1PX3A 3ARUA 1DDHA 2GI7A 1MAMH 3PF2A 1XR8B 3RWFB 1BAFL 3NFNA 3ULUD 2X7LA 1LE5A 4MB3A 4NZUH 4PV8B 3KPNB 5TE7H 2H1PH 1OM3L 2JJVA 2YEZA 3MOAH 3WFBH 1UH3A 2XWBA 3HPJB 3QXDB 1MQKH 1RHHA 2FATH 2YWZA 2WIIB 4B41A 1MREL 3KJ6L 4YR6B 3T0XA 3B5HA 2YA2A 1R5VB 5AZ2H 4XP9L 4C4KO 2BVOA 4KI5C 5HHVH 5F72S 4MQ7B 5FYKL 1V7ML 1AR1D 2OMNA 4G7VH 3DXAE 4LKCB 2VERN 1U95B 3OB0H 1YN6B 1HHHB 3CXDH 2V9TA 1OSZB 2LABA 1C5BH 2ICWA 3HE7C 3GJFA 3RPIA 2YUWA 3GSXB 1OPGL 3OKOB 3NACH 5L7XL 4XPFH 5C6WH 1T21A 2APWA 1VSCA 1S7TB 4ODXB 3OGOE 2JELL 1UXSB 1KC5H 3RUGF 4JQIL 3VGAC 1BREA 3KPRD 4N8CH 4OGXL 2VNCA 7CGTA 3REWA 1ZA3A 5FYJD 5ACZA 3AUVA 1FH5H 2AEQL 5E2WL 3ARFC 3WS6A 4YO0B 4NO3B 1G0XA 1B0RA 1CDBA 3QWOB 3MA9H 2DQFB 4JN1H 4WWKA 3OB0K 4OIBA 3CSYB 5DJXB 1BBJA 4OJFH 4BZ1L 3VXQB 4LSVH 2YZ8A 1VEPA 1BZ9A 3MCLH 1A6VH 4EQ3A 5MHSD 2BNQA 4GAYA 4MSWB 1I1AC 3BZFB 4G80B 5IFJA 1C5BL 1OCWH 2CUHA 2R1WB 2MMXA 3F12A 4JFYA 5DEFA 5ICZB 2ICES 4N0CD 4PJIB 4NM4H 2JJSC 2HG5B 4LSVL 5FF6A 4LL9A 1FNHA 1ND0A 5EU4A 5KSAB 4I77H 4XXDB 4GG6E 2QLVB 1N5YL 3LKPB 4G8GE 4XT1C 1OTUD 1R3KB 4UIMA 4M43L 4MX7B 5EO1A 3SDDA 5EBGA 1UM6H 4OZFB 3PHOB 2Z93B 1OL0A 4GUPB 3IXTA 4GG8A 5GIRB 2D03H 3DOSA 1IEBB 1LVEA 3C2AL 4NN7B 3AAZB 2VDML 4PBXA 3QDJD 4QGTA 5TDOB 1CE6A 2I9TB 1QSFB 5ESAA 3BKYL 1U58A 5FIEA 2VZUA 5JDSA 4QHLA 1K2DB 4PFEA 5FOBB 5CINH 43CAA 4TSCL 3JV4B 2CJUL 5F9JA 3FN3A 2OL3L 3EYQC 3S35H 4RAVA 5CP3A 2V6HA 3RL2A 4N8VA 1G84A 2PW2A 3MV9A 1L6XA 5T5NF 1S7XB 3RGVA 4O4YH 5FYLH 1UB6B 1CL7H 5I8CB 2Y72A 2IGFH 4XP6L 2P48B 3QUYD 4XPGL 1A14L 1G7HA 1F02I 2EZ0D 2MFNA 3EO0B 4OLZH 2YPVL 5DZLA 5F9AC 1UB5B 1AY1L 2WP3O 1I85A 1AQKH 4HUUB 5DHVA 1KJ2B 2ATPB 4OQTH 3WFZA 3MUZ1 2P7TB 4K7FB 4M1DH 4URTB 3HC4L 5F88A 3BH8B 1J0YA 2E9BA 4D9LL 3I9GH 5D7IA 4Y4KD 1FYTE 2PW2B 1FNAA 1UQSA 4ZFFA 1BOGA 4OF8A 4ZUTA 4FS0A 4HUXA 3ARFB 1U9KA 2MNUA 1E6JL 4ONGL 1CR9L 4H8WL 4HS8H 1S7RA 3I02A 5EU7E 4LSTH 1T7YA 4OT1H 3TVMB 3VMOA 4HXBL 4HW6A 2EE9A 4KDTA 1MQ8A 1ZLVH 4E5XA 4BQ6A 3HPLB 1BVLA 2I5YH 3SKOA 4M4PA 5J0BA 4IOSD 4UQ3B 4CJ0A 3HNSH 4Q58C 2YUXA 3V5KB 1DVFD 4OIIL 4QNPF 4G6FB 2MCG1 5DGQA 1XEDA 4HXBH 1DL7L 3E3QE 1DQQB 3CUPB 3HG1A 4K3GA 4XBEH 3X3GH 1TXKA 4FQIL 4ACPA 1R3KA 4RNRB 5GGTL 1F6LL 3QIUD 4WHTA 2PW1A 3B9DA 4Z7QF 5SWZE 4Y4HC 5D8JH 2XY1A 4X8JB 4K9EC 4Y2DB 4TTDD 4PLNC 5I66B 2BNRD 3CXDL 4GKOA 4OV6F 4RFNC 4BZ2H 5LBSL 2FEDC 3LEVH 2Z92B 3UTZA 3JZ7A 4ZS6C 3N85L 1TETL 5EUOF 1TJGL 4H5SB 1X4YA 1SQ2N 3EDEA 5J3HD 2FLRT 3UPAA 3VE0A 3V6ZB 1YEHL 4MA3B 3U9PL 1U8HB 1KLGA 4UBDD 5I1DB 3P4MB 4GBXA 5CEZE 3ARBD 4DTGL 1RZIB 4MDIA 3KDMB 1ORSA 3EKCA 5D7IF 1NFIA 2AABH 3FQXB 3GSRA 2E6PA 4PB9H 4XBGA 4O4YL 3QAZB 3BPLC 4P2OB 1IGIL 3JUYA 1H8NA 2VZOA 3NZHL 1TVHA 4GKSB 4WHCA 5JXEA 3BRGC 1I3VA 5GS0L 3KPLB 1KV3A 5CFHA 4R97B 4RGMB 1QRNA 5F96H 1BZQK 1MLBA 3TJHD 1HDMA 4YPGA 5I73C 4NNYB 4GQ9H 5I1GL 5AWNL 4MNHA 3RL1A 1NL0L 4DVBA 1X3DA 2FX9H 4NO2A 4PGZA 5DFVD 5KBNC 2DM2A 5HHPA 3LQAH 2XTLA 2Z35A 3ZTNH 1Q0YL 3F58L 2A9MH 3NH7H 3MV11 3SE3C 3U0PB 4D94A 2Y23A 4OM0L 4KRPB 4XPBL 1HHHA 2NXYD 3V4UL 4U1MA 1NGZA 1LE9A 1FYTA 3DYOA 2X10A 1IGYB 4OCRL 1D6EA 5LGHH 4ZD3H 3MBXH 2R0LH 1S9YA 2GEEA 4FN0A 4I18B 2EYTB 3CMOH 4WUUD 3T8XB 4U1MB 4AL8L 5IEHB 2FIKA 2EKSB 3C6LC 5ALBL 3K1DA 3MLSH 4WI8A 2C7UA 3HR5B 2GY5A 3DX8A 3X3FL 3MLVL 3RWFA 4BZ2L 4JFEE 1J0HA 3WKNA 4UTAH 1KN4L 4IRJA 4WI4A 3FB6B 1V3JA 1HIMH 4WFHE 4JRYA 4D3CL 4GRWE 5IQ9A 3C09C 3QXUA 1DCLA 4HMDA 4K71B 4IHOB 5DUBA 4AMKL 1LILA 2IMMA 1MI5E 1IGTB 3BN9C 4JHAL 1WCBA 4NJAL 5A2FA 1EV2E 3VRIB 4JM2D 2OTWB 4XNYH 5J9PB 25C8L 2VLKD 2YRZA 3T0BA 1A6AB 1K6QH 3GZKA 1DUZB 3RVTC 7FABH 3CH1B 4NQDD 1Y6NR 1HIML 3KDMA 4F57H 2Y25A 1BD2B 4KXZI 3PGFH 4IDJL 1QP1A 3KLAB 4JG1L 3CC5B 1DSFH 4OCXH 4KZDL 5FDYA 4HUVB 5FCSH 3STBA 1V7MH 3AM8C 3ZTJH 1CK0L 4RX4D 2OJEB 3UROR 2ZCLL 1BJ8A 1J05A 3CDFA 1MQKL 3W0WB 1N64L 1UGNA 2CRZA 4S10A 4HUVA 2IH1B 1AKJA 3RVXD 5CJOH 2CLRA 1JTOA 2VN7A 3VXUB 1D5ZB 3ZKND 2XTJD 3FZUD 3QCUH 4HKXB 3OX8B 1JRHL 1EFXD 5I1CH 1AQKL 3QEGH 5ANME 3QO1B 3FZUC 3W0WD 3GSWB 3NCJH 1PKQA 1QLEH 3HZVA 4F7EA 4NC0B 2RIKA 4Q9QL 1HHGA 1U3YA 4G6AD 3WE6B 4UDUA 4N9GA 4HXAH 1VENA 3UTTB 3MV9B 3WHXB 1VA9A 1RZGB 4N8VB 1AD0B 4KVNH 4ZYKB 4GBXD 3RA7L 3HR6A 2ZSWA 3ULUF 4UU9B 3T0VA 2DD8H 1FLTX 4Z7UB 3H3KA 4C4KT 3C87A 4TQEL 1E4KC 5D7JB 1GIGL 1YPZA 4DUVA 1CICA 4MB4A 4HFWB 1UJTA 3Q1SL 2C26A 1UQSB 4ZFFB 2LFGA 3BAEL 1AKJB 4JGJA 1KPUB 5GIRA 4GKNA 5DSCA 2A6IB 1QYGH 4LSPL 2MQ3A 2D0HA 4TUJA 1NEZG 2VXQL 4XP1H 5L0QB 4ZUTB 2FJHA 4P5KA 1G9EA 2X5PA 3W2DL 2BCKB 2Q20A 4HAGA 1NMCB 3LY6A 3FQUA 1CVSC 3EO1A 1S5HB 5SX5H 5TQ0H 5DMGC 1PVHA 5GGSB 4OZIF 5C71A 3FO2B 4FQIH 1KPVA 1JNJA 1Q0XH 1F11A 5ID0A 2X4SB 4FP8H 1AGBB 5E4EB 4IMLA 3GMPB 4FQXD 3SKMB 4LLAA 2B1AL 4KUCF 1F4YH 2K3TA 3MV9D 2EDHA 3EYSL 2IF7A 3OR6B 3WIHA 3VXQA 5FO8A 1T7VA 4YK4C 3B83A 1G9NC 1OWWA 3VGFA 4PJXA 1CFNA 4LU5L 3BEWA 4XH2A 1G7MA 4XNUL 3U7WL 4OZGB 1A7QL 2X4TA 2ZNXA 4OFDA 4X9IA 2VITA 1FYHB 5IMLB 4XVUC 1XH3A 1J1PH 2LQRA 1I7RB 3D69B 4AT6B 2LAGB 5IR1A 2QSCH 2VLRD 4IJ3B 5DJZB 4HLZH 1CGWA 1LO2L 4P59H 2AV1A 3VXUD 2V5MA 5DDHA 1BLNB 1JGLL 4Z7OE 1YPZF 4LSQL 5MHSE 3PDOB 5HDBE 1NGWB 5FECB 5GRWA 3CFCL 4M93B 2FSEA 4OUOA 1V5JA 1NC4D 5B4MC 4L8DB 1N6QH 4EN3C 3OKEA 4CMHB 1NAMA 4PP2A 2KPNA 5GS0H 1UA6L 1YEEL 1SBBA 3T4AB 3QXVA 1JHLH 2DQDH 3BOVA 1CDYA 4Y4HB 4PJGB 1OSZA 5J1TC 2VXVL 2VQ1B 2LVCA 3LKOA 1NAMB 4PP2B 5CGYC 1NFDF 3S36X 1D6VL 1RURL 2Y6SC 1WBXB 4KKCC 1W0WA 4L3EA 4K7PH 1QFPA 2WZPD 4JM2B 3T0EC 3QZWG 2AGJH 3OAYH 1IKNC 1MREH 1A6WL 3QJFA 3LVEA 1SVCP 3EGSB 3FRUB 5DRWA 4D9RD 1GYAA 2IG2L 5T1DH 2ZPKH 4F15B 3ULUL 5IB4A 3IGAB 1MHEA 1KT2B 2DBLL 5IVXE 5K9QI 2G5BB 4LLDA 1YQVH 5IBLD 5IJKC 4AEHL 4DJMA 5GJSL 2C3VA 3DGGA 1H3PH 1I3UA 3D25B 3UTQB 3HAEA 1P4IL 2VAJA 3QEUA 1G6RA 4KZDH 1IAOA 2GK0B 1N0XL 3V6ZA 3T0DA 5FA4A 4U6XB 3BI9X 5ID0B 1KJ2H 5CCKL 1U91B 4HUUA 4J8RB 2WK2A 5BXFA 1XCTB 5C9KA 1SBSL 3MROB 5DJDB 2VDRL 5CILH 3U4AA 4XP4H 3ARFD 3MRFA 3EYOB 3QG6B 4ZAKD 2A2QT 3ARGA 3SKJL 3N9GH 4LCIL 3WLWD 3Q48A 1JGUL 5FGBC 5LAXB 3WLWC 5D7KD 3B8SA 1J8HA 5D71H 5EU7C 4W4OA 3MFGB 3WFHB 3K0WA 1BLNA 3MBED 4YHPA 2B0SL 1BVKA 5DUPH 4JDTL 2NY0C 3O9WC 2AP2A 4KKAC 5IR1B 3U6RA 5IKCA 1A1MA 1S7QA 2DRUA 4D0CB 1S7WB 4J6RH 2VC2H 1I7TA 5IESL 1ZE3C 1MRDL 3HPJA 1HKLL 4NWTL 1VADA 3FHQA 4OIAA 4FQ2H 2B7DT 3GIZL 2DQFA 3VMPA 4JDTH 4B7LA 5CJ8A 2YK1L 5D96B 4OFIA 1HSAA 3CAFA 5C3TA 1ZVSB 5LGHL 2FHFA 4RDQG 1CT8A 1U6AL 5KS9F 2FD6H 1CL7L 3TPUA 1CDCA 2P24B 4NC1C 3S5LB 5H94B 1CICC 2WBWB 1E4KA 3CVHH 2F19H 3OHXB 3JWOL 4NC2B 3WN5C 2X4RB 3ARGB 4JPKH 4C83A 4I0PA 1LO3L 1OAQH 2RHEA 2P8PA 1CVRA 1VKXB 2IANB 5DC0A 2BVYA 1GGBH 2DQHL 2DQUL 1RZ8B 2IH3B 2ESVD 3ZE1E 3PP4L 4EQ2A 3QEQB 2D7TH 1EAPB 5T3XD 1FVCA 3PWPA 1M7IA 4Y5YB 4MJIA 5ANMA 3C5SB 2AK4E 3HAEB 3IJSB 4OF0A 1YYLL 3EFFA 4UT7H 5J6GA 5CSGA 3MLUL 4J3OC 4NUJB 2AJUH 1HKLH 2DTML 4Z9KB 2HJKA 5FYLL 4Q6IB 4HCRH 4K94C 4TVPH 2VZVA 2AJZB 1K2DA 5HSFA 4Z77B 5FYKD 4HKZA 3H9ZA 4LAJH 3V6FA 4MQXD 1CXHA 1L0YA 3ZZ1A 3CVHB 4KRPC 1L9NA 4PG9A 3AAZA 4XPAL 4JY5L 2XI9A 4YFLI 5T1LD 3VFVA 3WXVH 4MJIB 2APFA 1E4XL 3ARSA 1EBAA 5JOEA 4TVSa 3IDIA 1CG9A 3DI2B 5CEZH 1ONQB 4Z7WE 1II4E 2HTLC 4KPHL 4KKBC 3QNXA 3CFCH 4XRCA 3DYPA 5DWUL 5SWSB 5CD3B 1JNHB 4Z78A 5DVMA 3STLA 5BZWA 4TRPL 1NMAH 1FZKA 3SGDI 4L1DA 2YS4A 2NW3A 1BX2A 1JK8B 1IZJA 3IFOB 3KPRB 5D7IE 1JBJA 3L3KB 1QEWB 3BMVA 3Q6FA 1JPTH 2C7UB 4MCYB 3GMOB 4N8CL 3RP1A 2Q1EA 3FO9A 3FKUS 5GRVL 1JN6B 4KKLD 4C55A 3BKCH 2E27L 2XQYK 5D1ZC 4MHHG 4M5YH 1YJDL 2X4TB 1RIHL 1P84J 5D4QA 5IHZA 3TLRA 1TENA 4ETYA 1SJVA 1FV1B 1G7IA 2VXSH 2R0KL 4LRNL 4Y19A 5A43C 3MRCA 5B3JE 3ARGD 1HNGA 4QRUA 4HBCL 1BEYL 4U7SA 4PPTA 1WIPA 4AEEA 4EUPB 2R4RH 2R2EB 1MCLA 3GBNL 3EOAB 1QSFD 4MXWH 2MHAA 2AJUL 1R24A 4ZO9A 3RUGB 4KI5E 4PP1D 1QFWL 4IOFC 3MRJA 3RZCB 5TE4L 3KLDA 1H3GA 1PGRB 3OJDA 1JHKH 1XMWA 2JIXD 3GI9H 1Q8MA 2HJKB 1KLUA 1B88A 3LD8B 4U0RB 1IAII 2WMPA 4JFFE 4P2RB 3MOQA 1T1YB 1PZ5B 5HGDA 3VRJA 1QLRB 3MBEB 1Q38A 1VFAB 5L6YL 5EN2B 4OLVH 2Z9TA 3WD5L 2X1WL 3STZB 1A3QA 4BFEA 1RUPH 1BFVL 4YXKH 5E8DL 2ZCHL 4ZAKB 1MFBH 3U0WH 2EDQA 1MJ8H 5FO7B 2A6KA 1RULL 3SDAC 4FXKA 2RJMA 2X9YA 4XP9H 4X6DF 3CX5J 4LGSB 1RZFL 1FIGL 2X4QA 2OK0L 4JFEB 4FQCL 3O11B 2V9RA 3IXAB 4OF7A 1OB1B 4K9EH 1HKFA 2ZP0T 2JCCB 4YHMH 4G6JH 4LVNB 4MQXC 2VLJD 5I17B 4CMHC 2FRGP 2NW2B 1CGSH 3TNMA 3K8KA 3VGAB 3K1KC 4GH7B 2F5BH 5HI5C 5BV7B 4P48A 3CSBA 3OZ9L 5J12C 5DGRA 1A0QL 3ARYA 1KELL 1YUHB 3VI4F 5I1EH 4GRLB 1ZTXL 1KACB 3DECA 3LH2H 2QHRL 2HWZH 1CD8A 1IQWL 3STZA 2RR3A 5I71B 1IAKB 3I02B 3GSNB 1A8JH 2YHGA 5DVKA 2QJDA 5B22A 1GJIA 4U1JA 1E28B 1T4KA 3CVIH 3L3HA 4MMZC 2OLDA 4X83A 2APTA 4PJ8D 4ODWB 1FGNH 3MRKA 5DEGA 4OB5L 4X5WB 1NSNH 5C07E 4YFDB 1JF1B 5ICYA 2D2OA 3DXAA 5SV3A 2DLHA 2E6QA 5EB9A 3ARZA 3VU2A 2Y1VA 4FG6D 1OP5K 4YEEA 1FCGA 2JELH 4I3RL 5EBMA 3T04D 4QRQA 3P4NB 5DJ6A 3GMPA 3SKMA 2XRAH 1XF5B 1AR1C 5GS0C 3O3DB 5GQBA 1U3JA 4JCLA 1AP2A 2CLVB 5IJVB 5DJAA 5E5UB 1KJ3L 2IBBA 4XWOC 3MNZA 2W38A 5EPMA 2A38A 1JGDA 1XZ0A 4L8SB 2ZG3A 3D0LA 4CVWA 2HH0H 1GHFL 4IRJD 4LKXA 3QG7L 4PTTA 3LQMA 1BQLL 3IDMB 4YFLF 1C5DA 1EGJH 4JVPA 2EEAA 4AH2A 1S7RB 1F00I 1UXWB 3SGEI 1T7ZA 2XT1B 3L3IA 2DLIA 3HMXL 5MENB 4B5EA 1DP0A 5D72L 5FDWB 2V2TA 1KYOJ 4YUEL 4MXQC 1WJ3A 2M26A 2FWOB 1WGOA 1AGCA 1Q9OB 1FAIH 1N5AA 1NJ9A 4YNYB 3BYTA 3I75A 4LLVA 3C5JA 3GBLA 4PBVC 3QFJA 4FQLH 4Y4KA 2GTZA 4J3TA 5CS7A 2NZ9C 2Q76A 2EIZB 5C86A 4PJAB 5KJRH 5EU4B 5KSAA 4J23A 4EIZC 4ELKA 1KB9J 3NN8B 4RBPH 4XCFH 3WIFB 3O0RH 3TO4D 1A3RH 1AKJD 1Z2KA 5DEFB 4HWNA 3W39A 4R7NA 3TT1L 4M6AA 1X5FA 4U6TA 1LWRA 5ADPH 3MCG1 5D7JD 5C70A 4UOW0 4XGZB 5DT1L 3WUZA 5GGTA 3ZL4L 2XN9D 1NFIB 4OSUL 4MDIB 3TN0A 5HYJA 4TNVK 2IPUG 3EAKA 1NC2A 4WI5A 1PY4A 3O3BA 2MCPL 5I1JL 2NX5D 5DS8B 3FT2B 5ANMB 3B3IB 4LIQL 4ORGA 1H3TA 3WUWG 4NZTL 5E8NA 4LCCC 4JJHA 4WWKC 3ZDZF 2YPKA 1EFXB 2VISA 1OAXL 1QBLL 4KROC 1HQ4B 5CAYB 4LLYB 3O4OB 3ZTNL 4BK4A 2R1XA 2KDGA 1ND0B 3EO1B 3NTCH 2DQCH 3AS3A 1DQMH 5KS9E 1YY9D 1QQDB 1UVQB 1NCAL 4N68A 1OLZA 5GRYA 3MO1B 2F53A 3ZDXF 1FIGH 1MNUL 1K4DA 4JY4A 4ODUB 4RISL 1AE6L 4O00A 1OLLA 4YX2H 1FL6A 1J10A 4XVJL 5IOPB 2BVEA 1RUAH 1JWMA 3O8XC 4PRHA 3HZYA 1HWHB 1JNLH 1MUJB 1O7VA 5F7KC 3L3IB 4XAKE 3VMNA 1PAMA 4FABL 1TITA 5CEZD 4Z5RA 2IPUK 3TZVB 2BP3A 3M1BB 3VI4E 4MNQA 3BUYB 9CGTA 2HFFB 4FFVD 4XCEB 4F2MB 1IKFH 5D1QA 4KVCL 1TMCB 1T0NA 1NKRA 4YGVB 3HUJF 5DK0A 5TPWL 3SGKC 3DHMA 4XB8A 4UV4L 1A1NA 1RAMA 4WU7A 3CFDB 1FYTD 1JUFB 2DWEB 1QPPA 1TVDA 1NBVH 1XF1A 1C16B 3A67H 4HIJA 5CEXA 3SKUD 2JJTC 3ECBB 5GISH 3FB5A 4QRUB 4R97C 4MJ5A 2BNQE 2PTUA 5FKAA 5TPWH 1NLDH 3WO4B 1TVBB 2VLRA 1PG7W 4NJ9H 2A9NH 2HT2D 2J8UF 3VXSA 1KB5H 4X80H 1ADQH 5MP6H 3IJYA 3L3DB 5DMKA 5GRZA 3KXFA 4G9FB 4F2MA 2E6JA 2B0SH 1FZMB 4XMKH 1NKOA 2HP4A 1T1WB 4GXUM 2NXYB 3TZVA 3CJJA 3SKJH 3NTCL 3RRQA 5MERA 2E27H 2OCFD 3SPVA 1GC1L 5IB2A 1H5BC 3HI1A 1WICA 2O93L 4O2FA 1RZIA 3UTSD 1Z0NA 1VFUA 1KTKE 5F3BB 2XPGB 1RJYA 4ZOAA 5ISZE 2CQVA 3KYKH 1LO4H 1WBXA 4MZ3A 4X4ZA 5ETUB 1KN4H 4ODUA 2XN9A 1AQDA 1CF8L 1PKQE 5C08D 4FG6C 4EN3B 4PJXE 1KELH 2G75B 3HI6L 2Z31C 1NC2D 1GOHA 4CDGC 3NA9H 4WFFE 3G5YA 4N0CC 2GQHA 5E95B 4LLYA 1Z0MA 2XICA 4G8FA 3ARBB 4R26H 4QOKE 1MJJB 3IDXL 3BXNB 1H5BA 4YBQC 3C60A 1LP9F 1DLFL 4X7DC 5C07B 3L5IA 2WBJD 3HG1B 3IRZA 2AJVL 3QUXB 4RRPG 4G80A 5IFJB 4DGYL 3PABA 3DO7B 3E6HB 4XP4L 2I07A 3QNYA 1U8NA 2C3WA 3DSFH 4M1CD 5EOTB 3PIQA 3X13A 4UQ3A 5I1IL 2F54E 4O58L 3UO1H 1NDMA 4I13B 2R23A 2VE6A 5GHWL 4YZFE 3TFKC 1ZOXA 1I8MB 1S9VA 5D70L 5JHDB 5I6XC 3IETB 4HLJA 1FVCB 3DV4A 4PJ7F 2C1PB 2B2XL 2FGWL 3NIGE 2Q8BH 1FG2B 1P7KA 3EJZD 4JE4B 3SE4C 5CP7B 1EHNA 4EUPG 5HHOB 5EUOB 3DVFA 5E8PA 5I1AB 2F53D 3LRSA 1W0WB 4QOKB 3V5DA 1UM6L 2NNAA 2Y06H 2JCCE 4L29A 1AFVL 1OARL 3FT3B 4K7FA 4Q9QH 3PHSA 1MIMH 4MNQD 5DJ2A 3LKOB 1JGVH 3KPRE 3RWCA 2Q76B 4X99B 4GS7B 3QSKB 4I77L 3GSXA 4P5TC 3EZJB 4CBPA 1B4RA 4K3DH 5C0AB 4HBQA 2EH8L 4LSUH 4NN5C 4IHOA 3ILPA 4DGYH 1IT9L 2P5WD 2CIIA 3PQYD 3BVNB 4F7TA 1NGQL 5JW4N 1QSED 1WEJL 3W9DB 3IFPB 3DMMA 4XMPH 4KQ4L 2Z8VC 2EDWA 5DDHB 1BIIA 4WW1B 2NY5H 2YEZB 3CLEH 4J3XA 2ICCA 5BJTA 1R5IB 1A9BA 3ARED 5F1IB 5IW1B 4IOFD 2ZUWA 2DIBA 3RBSA 3CFIC 3RX7A 1CXIA 3PWPD 4PJ9B 1KB5B 2EZ0C 3MV8B 1C7SA 4YBHA 5HDQL 5KAQG 3ILPB 4WTXA 3R8QA 4LDLB 2AK4A 4U3HA 2ZUTA 1CDUA 3ARPA 4OGXH 1Q9LB 4LHUD 3NBNA 1AIFB 1FGVH 1HEZA 3OKMB 4G8GD 3UO1L 5IHBA 3A6OA 4UT9L 5DD1H 4NJAH 4L8CB 1AQDB 5L2KB 3QDGE 4BSWB 2B4CL 4CMMA 2CKBB 4A6YH 5EA0L 3RU8H 1W72A 2VB5A 5T1MB 3GI8H 1BP3B 4Y16B 1IFHL 5DURD 1EEZA 3CFKB 3TN0C 1CQYA 4PJ8C 1K8IA 3S97C 2VISB 3VCLB 1KT2A 2EXYC 4IRZH 4KXZH 4L5FL 5J4MA 3ETBF 5D9SA 3V4VH 1HNFA 1MCQA 4FNLH 2AVGA 5ALCH 2GW5A 4MCZA 2PUQT 1DVFA 3QHTC 3IU4H 1NLDL 4HEPG 5L88H 1FE8H 3FN0L 4U1KB 4HIEB 4P46C 1DBBH 4Y1AD 1LNUA 2B4CC 4TTDC 4YDKL 4XCYA 4NQDA 5TE7L 1T1XB 5HGBB 5CBAB 1E4JA 3IDGB 3QEGL 3QWOA 4GAJL 1A6AA 1UH4A 3QCUL 4WW2F 2OR7A 4LHQB 4XX1G 1FN4A 3VFRB 2BY2A 4MS8D 2CMRL 2JCCF 1REIA 4P2QE 4MS8C 2EH7H 1IAMA 2AJYL 3RDTB 1YYLH 3ILQC 5DO2C 4APQA 1AGEB 3SQOL 3AS0A 4UAOB 8FABB 1TZHB 3BGAA 2X4QB 5INDA 4JM2C 2QBWA 4XXCC 5DQ9B 4X7SH 3HZVB 4XBPB 3EO9L 2OTUA 3H9SA 2PXYC 1R6VA 3V7MA 4ZNCD 5C0CE 2BXZA 2Q8AH 4C57C 1YN6A 5D7SH 1RVFH 3I84A 4WW1A 3WV0A 4OI7A 1CE6B 2BY0A 2YK1H 5HY9A 4L4JA 1AO7A 3U2SA 3VI3F 5FO8B 2NY0B 3O9WB 5EIIA 4P9ML 4FTVE 1SYVB 4K2UH 2EDJA 1R3LB 4P9HL 1S9XA 2AXHA 2FIRT 4WWID 5C6TL 2FBOJ 1XGTA 3O2VL 1EXUB 4GJTB 2HJLB 1T83A 4WW2C 4NRZB 4AMKH 1JZ3A 5AAMA 3BJLA 4QXTB 3TBTA 2NY0D 2AJ3A 3NPSC 1N64H 3LKNA 1WFOA 3O9WD 2IFGA 4KKAD 5DRZB 3K4AA 5EC1A 3CFEA 4JGMA 1H9VA 5C7XL 3VFUA 2ZUXA 4OM1L 3GMRB 1U8PA 1MFEH 3BQUD 1FE8L 4EOWL 5DK2B 3MLSL 1W72B 4J6RL 5D2NA 3C6LD 4WCYL 1XCQA 1PQZB 5CILL 3CMGA 5CZVL 4OZIE 5ABDE 3PWUB 3DETD 5DD6A 1PEWA 4CADB 2ARJQ 4AEIH 3KHOA 1XF5A 1R3LA 2OTPA 5I8CA 3ESVF 1EIBA 4ZFGH 2YD2A 4NBZB 4BKLB 3F62A 5JA8B 2DN7A 3MLZL 1G9MC 5DWUH 2VR4A 2D7MA 3FB6A 4HIHA 1GVIA 4I4WA 4L4TA 1CR9H 2WUCL 3NIFE 5EZJB 5M94B 3H7BA 3OKNB 4PRDA 3EGSA 3FRUA 4P2QB 4WFED 5DRWB 5FCUL 5KG9A 1NQBA 3UYRL 1P5VA 3T8XA 1MHHA 5BRZD 3D5OF 5C07A 1S9YB 4P5TD 1WBZA 3QIWD 1IGYA 3MXVL 2EDNA 5LVEA 5I8EA 3JWOC 5CSBA 5AAWA 1MCBA 3O6MH 4GLRI 1W72H 1QQDA 1UVQA 5E1AA 1ONQA 4U2ZA 1G1CA 5B38G 4NKDA 1HYSD 1YECL 1HZHH 4H20H 4NKMA 3FB8B 1H8OA 5CZXC 1J0ZA 1HYSC 1EUTA 4Y16D 4OLWH 4X8XA 2OK0H 3FQRA 3QIBD 5C0CB 3FRPA 3QB7C 4WFEE 3MV7E 4Y1AA 1U3HC 1AHWC 1VPOH 3QWQB 1OTTD 3GBML 1EZVX 5JMOC 4K3DL 4TSAL 1ZVYA 4QXUH 3QDHA 3H3PH 1ZHLA 2P8LB 3ZT7A 4HWZB 2J6EA 4I2XA 4J1UB 1A6ZB 5HHQA 4KI5D 4HEME 1XIWA 5FCUH 2HT4C 3A6CL 3KLAA 5EUKB 4X7TA 4LAQH 2RAMA 5HTSA 4PJIE 3CVHL 1KCVL 1AHWB 3EYVB 5EZLB 4L8SA 1U8JB 5HXMA 1LK2B 5JLZB 5KSUB 2MJWA 2HLFC 4ETQA 2P7TA 3IT8D 2ATPA 4G42B 4KMTL 4OZHA 3UJTH 3MRGB 3VXME 1OGTA 5T5FL 1IGFH 4BFIA 3OKDA 4ZUSB 2V9QA 5DK2A 1Q1JL 5IQ9B 2C5DC 4XPTH 2GSIB 4PJ9A 2UVFA 1ZANL 5ICYB 1ZT1B 3LKSA 2G60L 5INCA 4MAUL 3SN6N 5F97E 4E42B 4ZUVB 1KXTB 2N4IA 2B1HL 3I3EA 1UZ6F 3V5HA 1N8ZA 1P2CA 4H0GA 3I75B 1OVZA 2P8MB 1MEXL 4LGPB 4M9OA 3MJ8B 1YY8A 3E3QC 4M48L 5T3ZE 4K8RH 1KPUA 1V05A 5ADOH 2Q6WB 2VC2L 5I75C 1VEMA 5JQHC 4HZLA 4OGAC 3ULSA 4XB7A 4E5XB 2VDRH 3QDGA 1Q9WA 4RIRA 5HHOD 2VKWA 1OP3K 1ACYL 2YUVA 5KVFH 4D0BB 5EOCJ 1FL6B 1DJSA 2BSTA 4PGCA 1DEEA 3QUYC 3T65A 3EFDH 4K9EL 2XZQH 3C2SA 3ZYOA 3JV0A 1XGQB 5JXAL 4M1CC 3LKPA 1NANI 2P5EE 1D5MA 5A1AA 4H8WH 2GJ6D 3S96B 3AMKA 4QRPD 4YHZH 4YDJA 3QCVL 4LVHB 3U7YL 3A6CH 4G7YL 4PRIE 3WLBB 3MNWA 1JL8A 1A6TB 4S0SD 4OTXH 4M8VA 2WBJB 4PJCA 5C07D 4Z0BH 4RGND 4GQ9L 2GUOB 2YSSB 4LLQA 3MX0A 1M4KA 5ACLA 3BESR 1A6WH 3BWAB 4NKIL 1GC1C 3OAYK 5J89A 4GRMA 4QNPE 3FCTB 5BRZA 1I8MA 1L7IL 1NCBH 4F58L 3F5WA 4G6KH 1U8JA 1K4CA 3VGDA 4NRYA 2IPKA 2PXYD 4I3SL 1A1OA 1MI5D 1WUNT 4XPHH 1LHZA 4MAYD 5JXEC 2OJZH 3VXRA 1QHOA 2F54D 5CJQH 4K55A 1TQBC 2IAMC 2FZ3B 4JO4L 4Z7UE 4E41B 1T0MB 1ZT7B 3GGWA 4G8FB 4Y5XB 2EH8H 4LSUL 4OV5A 3DX9A 1TETH 5TE6H 2O5YL 3OAUH 4P46D 2CUMA 2IADA 1T21B 4P46B 3VW3L 1IFHH 4LPCA 3WNPA 4RWYL 3BPCA 1KJ3H 3B9KB 5JZ7C 4Z18A 3IF1B 1KJVB 2FCBA 3MRDB 2YSSA 3GSUB 4LIQE 3B5GA 4WUKL 1NUDA 3U48A 5IB3B 1T04B 1HXMA 1WFUA 1FVDA 3CFEB 5I74C 2AJ3B 5D6CA 3HNSL 2ED9A 3KYMA 3CU1A 1Q9OA 2NY2C 3BKJL 4XTRD 5HDQH 3DURA 5IW3A 3UC0H 2F8OA 2Y07H 1FBIH 5FDWA 3BO8A 3QXDA 1MHCA 2XV6B 3H0TA 4JVUA 1KIRA 3PQYE 1FIEA 4MCYA 1PW3A 4O58H 1BOGB 3RWHB 1ZSDA 5DFTA 1FZOB 3CMOL 1N2RB 4PJXB 1KCRL 4BSVB 1CL7I 4IS6A 3ARGC 2HLAA 4QRPB 4P2RA 3ZT6A 5FV2A 3VW3H 4JHZA 3MRHA 5C9JB 2XWTA 2HKFL 2VWEE 1JNNH 4N1CA 2E9JA 3E2HB 3VXMA 5JW4R 3JV6B 4P9HH 2N56A 4O5LL 4WU7B 5D1ZB 4PRBA 1Q0YH 1MCWW 1DQDH 2N7AA 3F58H 3MUY1 3THML 1OGAB 1CLOL 5CJQL 2VRAA 2OMBA 5D1QB 3WXWL 3DUUB 2NY2D 3Q1SH 4XTRC 1KXVC 1LP9B 4JFXB 3VFOA 1I85C 5LCVH 2AJZA 4H8WC 1CLZL 5FYJH 3U83A 5CP7A 3MUJA 3VFGL 5A2JH 4G8IB 5C0ND 1QBMH 3L6FA 4NUJA 4JFFA 1GPOL 2P5WE 3EHBC 1I8IB 3L1OH 3EJZC 2AXGB 3OBAA 5AZEH 3VG0L 1UM4L 3DBXB 4O2CA 5E2VL 2VDQH 3K2MC 1BWWA 4AY0A 1VDGA 1T3FB 4WGVB 4AM0B 2NY1D 5DYOA 1JTTA 4JFFB 3UAJC 1PKOA 2AGJL 3MRIB 4M8QA 1A4KA 4APQC 1JFQH 2VIRA 5HVFB 3DSFL 2X4PB 1GL4B 4B7IA 1RZ8A 4EUPH 3RA7H 4I2XB 4HH9A 1QO3B 4J1UA 4DQOL 2E8YA 2RFXA 1SMOA 3KNBB 2CK0H 1XGUB 5ESVA 2DTSA 3VFSB 4EKXA 1BBDL 3MRMA 2YWYA 4XZUA 1M71B 1CFTB 3SDCC 2FR4A 2CKBA 5KVFL 3LEXA 1CLOH 4NNPH 5IMOB 3AXLA 1R3JB 3G6DL 4L8CA 2PCPB 2R2CA 1EGJL 4U6YA 2DLGA 5TDPA 1MI5B 3QIUC 4Y19E 3TO4B 3F6LA 3SE8L 3RVXC 1A7NL 1BGXH 5J7CC 5C0AE 3T4AA 3S9DB 4RDQF 2CSPA 2XPGA 3MLTA 2HFEA 5ITFB 3OF6D 4OCLC 5IVXF 2OR8A 5IQ7L 4G7YH 5TH2B 3FT4B 4HPOH 2JB6B 2BRRH 4JFQB 3SEPA 4B53A 3WNOA 4OD3L 4MD0B 4DEPC 1WZLA 1KXQE 1SBSH 2AJSH 2YBRA 1VFBB 3BGMB 4FTVD 1NBYA 3FT4A 1I4FA 5GZND 3C5SA 4XVSH 1IJ9A 5HBBA 2F58L 3V8CA 3I6LE 5C0BA 4D9LH 3F7YA 1MRDH 3CSGA 3FB5B 1DR9A 1KJMA 4KPHH 1NCCL 4R7DB 2VL4A 1OTSC 1HI6A 4J8RA 3MUGB 4WY7L 3OXRA 2Y5TB 3EBAA 3HKFA 1D5IH 3MRBB 3O3EA 2FJGA 4ETQB 3OSKA 3DX6B 1OAUL 4YDJB 3D2UA 3ULUH 1INQA 5CIPB 5EORH 5TGBB 4Q0XH 1ZAGA 4CNIB 4XNZB 3T2NL 4GXVL 3I85A 3GK8H 1TTUA 5KZCD 3MNVB 3O41B 4G7VL 2FO4B 3KLSA 2MCPH 1FDLL 5FKPA 3GSNH 4JO4H 3Q2CA 4JPVL 1KG0B 3MXWL 2EIDA 3HS0A 1OQOA 2HJLA 1IGCH 1FHGA 1NH6A 4QHLB 5F7MC 4JZJA 1PZUB 1IEAA 4LCWE 4WI7A 1EVUA 1QSFA 2J12B 4S2SA 2YD7A 3TM6A 1MFDL 5T3ZH 4LSRH 1S7UA 3BH9A 1JK8A 3TT1H 4H1LA 4GRMB 2CR6A 4NGHL 3RWIA 3U6RB 5IKCB 4KZEH 1NGZB 4R9HA 3QPQC 3ARVA 1AGDA 2DICA 4KKLC 4YHNB 1EO7A 3MGOB 1J11A 2D7TL 2Q8BL 1S7VA 3MR9A 5EBMB 1V3LA 1Q72L 3GO1H 4I1NB 3T0EE 3ARBA 3LS4L 5GZNC 1CIUA 1E27B 1N5YH 1B0GA 4F37F 3VFVB 1F8TH 3VGHA 4PRNA 2HTLD 5HD8C 4NNYA 5JXAH 4LU5H 4Z7UF 4JDZA 1FAIL 3D3VB 1C08A 1FPTH 2NPLX 3B9KA 1KULA 2V2XA 2NYYC 4OZ4B 3RKDD 3RWEA 3HE6C 4PJBE 1A3LL 4G9DA 5F1SA 4U6HB 1B2WL 4Y8AA 5TH2A 4HJJH 4OFPA 1I9RL 4RWHA 5JR1H 1OAKH 2HFEB 3QDMA 4KKCD 4TSBL 1GCFA 1LO0L 3IAGC 5CGYD 2R4RL 4IRZL 3LKRB 3P9MB 3T2NH 3FO9B 3VFMA 2AKRB 4PY8I 4NQVA 4LLQB 3GSQB 3WEXA 3U1SH 3EHBD 5ENWA 1K8DA 1D5IL 2VKXA 2PR4L 4GO6B 4DFHA 5BRZB 4OJFL 5F44A 1M7XA 4Z7NF 1RZ7H 4N0UA 3BPOC 1I7UA 4P9MH 2PNDA 4WHDA 2GUOA 1YNLH 2IBZX 1OSPH 2JIXB 3B43A 1MHPL 5EG6C 4S1RH 2FJHB 3IS0X 4MQTB 4P5KB 4CU8A 1FFPA 1ZA6A 4HWEH 4X6EA 2I5YL 3LSOB 3L3OB 4XX1E 4W70A 1N5AB 4PRAA 1XGRA 5T1KD 3MLVH 4XMLL 3DVGB 1S7UB 3V7AG 2VMFA 3WJJA 5DJCA 1R3HA 3CLEL 4QF1A 1MJ7L 4X7TB 4X4MA 1QG3A 4U0RC 1A9BB 1T6WA 1E4XH 4ZD3L 1H3WM 3C08L 4OZIA 4ZUUA 2VH5L 1CBVL 1CU4L 3FFCA 5GS2D 6FABL 2N7BA 1ZHBB 3KLHD 4LHUB 1VACB 3WE6A 1GZQA 1JZ6A 2BXYA 5BW7C 1KEGH 4LPYA 3OTTA 3PWPB 4OZFH 3PQYA 3JWNC 5LWYL 4X6CB 2ZUSA 3C08H 3NMEA 4BFBD 3OX8A 1INDH 4JRXD 5AWNH 1G7HB 4OCYL 2ZCLH 1KPRA 1UWGL 1HCVA 2GSIA 3UJIH 3VA6A 1MF2L 4O02L 2H2PD 3DXAB 3C2AH 1LNUB 3MXVH 1JPFB 5FHBL 2NY7H 3SE9L 4Z7OF 5LWYH 2ICWI 2NR6C 3P40A 3ME0A 2CKBL 4I4WB 3U9PH 1ZHLB 3NIFF 4O51B 3KJ4B 5H37H 1DQLL 3QJHA 2IAMD 2XY2A 3A6BL 1K5NB 5JO5A 5I15L 4DGVH 3NCFB 4QOKD 5F1NB 1EZVY 5HPOA 4Y88A 3L5WA 1FNSL 4I2XE 1AGEA 2XKSA 4NP4L 1DFBL 1WTGT 2J8UE 3WJLC 1CD1B 4BYHA 2P5ED 4F3FB 2XFXB 2WUBL 3HAEG 4DAGH 3S88H 1CGVA 4OCXL 1IMHC 2J8OA 3BIKA 5JHDD 1FQ9C 1GGCL 1K85A 4CU6A 1KUMA 1F90L 3FQWB 1I1AD 1AD9B 4YHYB 4PGBA 1LD9B 5EU5A 5AD0A 4F15C 5F89B 4AQ1B 5E8NB 4FXGB 2ICWJ 1A4KB 3RGHA 4M7LH 4QWWD 4DOHB 3VWJA 4ORGB 3V4UH 4ZS7H 2PTVA 1MJ8L 4X6BB 4WEUD 4WI3A 1WZ1L 5DS8A 4K2UL 4L4TB 4HPYL 1AO7E 2X89D 1G7QB 4GRLC 5E9DD 1JIBA 3AB0B 3GNML 1J05B 1I8KB 4DKEL 3RWJB 5L2KD 5IMMA 2VDPL 4ZO8A 3U1SL 3TWCL 4G8GB 1OPGH 2AEQH 3N1QC 5E2WH 4BELD 4MNQE 3C60D 5L6YH 3T0WA 4M7ZC 3WFCL 1JWUB 3PWNB 4OGAD 5FKPB 1T22A 4AIZB 2NR6D 2OSLB 3OL2A 3QJFB 2DLEA 3LQAC 1U92B 3K8LA 4XWGH 1RZKL 1JPFA 2DLFL 1MLCB 4JAMA 5HHXH 1C1EH 5F7WC 3AREB 3D87B 3NA4A 1CGTA 1HDMB 3MBXL 3MBEC 4YPGB 5I6XB 5J06A 5IT2H 3WN5B 5DD6B 3JV5A 4F9PC 1AO7D 6CGTA 3OKOA 1HEZB 3OKMA 2GTZB 4GKSA 2BSTB 2H6PB 1MCPH 1RK1A 4Z0XA 5D93C 2HLAB 2P5WB 1L0QA 3TVMC 2ADIB 3HC3L 4D8PB 3TJHC 2A6IA 3H42L 4PJBB 2EDFA 2L7UA 2I25N 2R15A 4PUBL 3LB6C 2HVJB 5E4EC 1FL5A 1KIRB 3PGCB 1U2HA 5BVJA 3RI5K 3RY6C 4F9LA 1P2CB 4MA8H 4HUMB 4PV8A 5EBLA 3SDDC 3NAAL 3PL6B 1H5BB 3UDWA 5DRNB 4LVHC 5D96C 1DL7H 1IEHA 1C5CH 2OR9H 3LKSB 1CF8H 1J88A 3BVNA 3WFCH 1FYTB 3HC0B 3HI5H 1JGLH 3VXSD 4P59L 1S5IH 3UYRH 1JGDB 1XZ0B 1DQML 2BMKA 3I50H 4Z7VF 5CEYA 4UTBH 4JKWA 1RUML 4XCCH 4K23L 3DV6B 3THMH 1GC1H 1L4IA 5DJ2B 5C0RL 5DD1L 4RAUA 4PR5B 3M45A 5IB5A 1KPVB 4I48A 1YY9C 2BC4A 1KIUA 4Y1AE 3O2DL 4ZFOL 1N6VA 1UJ3C 3KPSE 4KJPD 4M7LT 5EUOA 4AEIL 5I2IA 2FH6A 1GGCH 1TVHB 3LPGA 1A7BA 4S1DC 3IFNH 3MCKA 3O2VH 2EDDA 3PDDA 1ORSB 2W0FB 3UBXA 4OSUH 1I8KA 5J6GB 3TO2A 5A2IH 1A02N 4PJCE 4S11A 4JGUA 1NC2B 2AXGA 3CC5A 4CJ1A 2NY3C 1A14H 4TTGA 4K8RD 1BD2A 2ORBH 5IBTL 2BJMH 2FX8L 4HK3J 3T3PF 1Q9KA 4JQIH 4M7KH 3SQBA 3PUCA 4HMEA 4NRXB 2I60H 3PJSA 4AENB 4Z76A 4X99A 1MWAB 3CFKA 3O2WH 1YNTB 4N8PA 4XCCL 4PJDE 1I3GL 3SO3C 3WKML 2NX5B 2X2YA 2UWEF 2COQA 1NLBH 1EVTC 4PRBB 2VZSA 1A7NH 3BPNC 3JWOH 3L1OL 5KSVB 4IIQB 4R2GC 3NZ8A 5IFHL 1S9WB 2XN9B 1FNFA 4KMLB 4UI2A 2ZZUT 4G9FD 4ZTPH 3CK0H 4O02H 4XVTH 3L3JA 1FC1A 1P4LA 3NPZB 1Q9WB 2PKDA 3IETA 4RIRB 4YC2C 4ZNEE 1NJ9B 3NCMA 3MGTB 4H1LB 3RWIB 2CDEA 2EH7L 1M7DA 2R2HA 2XQYG 1U0QA 1ITCA 4PRAB