1I8KA

Crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
DIELTQSPASLSVATGEKVTIRCMTSTDIDDDMNWYQQKPGEPPKFLISEGNTLRPGVPSRFSSSGTGTDFVFTIENTLSEDVGDYYCLQSFNVPLTFGCGTKLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAI
publication title Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i8kA00
4ENED 4WW2F 3K8KA 3VFWA 4ZSOA 5B39B 4BQ8A 3QJFB 3L6FA 3HC3H 5GPRA 3A6CL 1CL7H 5TDPB 1X5XA 5F21B 5HDLA 4PJBA 3CVHL 1YA5A 2DTMH 5JDJA 2YZ1A 3FO0H 4BUHA 4MD4A 2XG5A 1ZLUH 3U7YH 3MOBH 4Y19B 2VISA 2XZQL 1HILB 1J18A 4PG9A 3O3AB 4XNMB 1ZTXL 4OTXH 4UT9H 4URTB 3UBXB 3TBYA 5EULV 3NFPB 3I9GL 4I3SL 3QUYC 4M48H 4ZFFB 5F9JB 5EG6C 4RQQA 3K2UH 1LP9E 5E1HB 4A2LA 2QKIA 1JNNH 2CUHA 4UINL 2ORBH 3VGAB 1R3HB 4QNPE 3B8YA 2XRAL 5I8EA 4HZLB 4LVOC 2BOBA 4H1LG 4LHUG 5K9KB 3T0EA 5E8PB 3ARPA 2Q6WA 2MOVA 3QFJA 4HWEH 4PUBH 1RJLB 4YPGB 4ZAKA 3SJVE 3HMXA 3ZKNC 2IG2L 3JTSA 4QWWD 5HHXL 3T65B 3QXWA 1NKOA 3MBXH 3QQ4A 4X6FA 5I1DA 5DDHB 3WFCH 1S7QB 3BUYB 2F19L 1K6QH 2NY1D 2ZPKL 4ZO9A 4PTUB 3TO4A 4HF5L 5C0GB 5I17A 4JGMA 3JXAA 3RL2A 5B39G 2UWEF 3NCEB 5E6ID 3ABZA 3BZFA 1YEDA 2R0ZL 1G9NC 2EDBA 2WINB 4PLNC 3KPRB 3QEUA 1YN6A 1TJHH 5GISL 2ITDB 4Z7OF 4PJEB 5J1AB 1R3JB 4V2BA 2PYEA 4M7ZC 5FFLA 4D3CH 3PWPB 1S7RB 3WDHA 1G7PA 2L0DA 2YEZB 3T0EC 1YEJH 1RZ8B 2NY2D 3DJ9A 1F3JA 4HEME 5K9QI 4OLXH 4G6FD 5CP7A 1YMMD 2D7OA 3KYAA 4ZAKC 1M71B 2BVYA 4GMSH 3UBXG 2VDPL 5ALBL 1KCRH 1YEHH 3OTTA 4HC1L 3HNVL 2AJ3A 1AY1L 1EJOL 1NGQL 4H25B 5KSVB 3UTTA 1R5IB 5D7IE 1KCVL 3BIBX 4HXBH 2FD6H 3H3PH 2AQ3A 1WTGT 1DUZA 3WFHA 3TO4C 4UILH 9CGTA 3HMWL 2B5IB 4OZFA 3FB6A 1NLBH 3MV8E 2M2DA 1JZ4A 4NNYB 3EJJX 2BNQE 2VLJD 1QPXA 1FDLL 4U1MB 1QFUH 3U0WL 1DFBH 1AR1D 3K3QA 4XCYB 5D96C 4WV1B 3PV7A 5C0CA 3GBNH 3V4VH 4ONHB 1SBSL 4TTDC 4F3FB 3C9NA 3RVTD 4HBCH 3ARWA 5F9AC 2EIEA 3F5WB 2C3WA 4XPTL 4Q6IB 1KN4L 2VDLH 4KY1L 4Y5XB 2NY5C 2DQTL 4G5ZL 1UXSB 4TYUA 3ARBB 3QDHA 5TQ2H 5C7XH 5EC2A 1FCGA 3EOAA 4MXWL 2XV6B 2XY1A 3ULUL 1AO7D 3CH1A 3QUMB 1KJ2H 4NUGL 4ONFH 4WHDA 4PJ9A 1D5ZA 5KSBE 2K9UA 1FZKB 1BFOB 4MD0A 4KQ3H 3ARTA 4PP1C 5B8CB 5IJKA 1KN2H 4PJGF 1MLCB 2GJ6B 1WQVT 3DURB 1Q0XL 4K7FA 3U30C 4DGIL 2DQIH 3OKYA 4I1NB 1QLRA 4Z6AT 3CCHB 2OP4L 2DS4A 1WV7T 4Y4FA 3H7LA 3N50A 5GGSB 2JB5H 4ELME 4ELKB 5E2UH 5I74B 2Z93A 2UZIH 4MQTB 5JW4M 2Q86A 4RGMB 1ETZB 5EO1B 3ZLQC 5I1HH 1KEGH 3TA3A 3WNOA 5AZ2H 3R1GL 1QNZH 1OSZB 3BP7A 4OCXH 4PJ9C 3VXUE 1CK0H 5BJTA 3MRMA 3PP3K 4UBDC 1KCLA 4AQ1B 4EBQL 4HJJL 2ARJQ 2NY0D 3WMSA 3G6JE 4GSDL 3C5ZA 4YHYB 4N68A 3VGDA 4HD9A 2IGFL 5DK0B 5FB8A 4YIQA 3NPSC 3F7VA 4ODSH 3QA3B 1BZ9A 3SE9L 1CF8H 1IE5A 4LLYB 5DD3H 1QSEA 4Y4FC 3HZYA 4MCZA 1NC2A 4QTHA 2HLAA 4PJ5A 2YR3A 1D6VH 2EH8L 1CWVA 4IS6A 5BVPL 1CU4L 2FIKA 1D5MB 5LQBL 3FQWA 3GSNL 4AY0A 3QZWA 2F53A 1ZSDB 4JN2B 4MGXA 4GRMA 4U1KA 4YQXH 2EDXA 4UU9B 4DZBB 1EO7A 4YFEA 4GLRH 4NZDA 3MRFA 5DA4A 5FKPA 3N9GL 5KZCB 3FFDA 3EYUL 3NPZB 4UDUA 2NZ9C 3C5ZC 5IF0B 1VFAA 4TQEH 4X5WB 4B5EA 3GSXB 5CD5C 3SDXE 4MZ2A 2EE3A 2R29H 4AENB 1W8NA 5F7HA 2VR4A 1NBQA 2A6KA 4X6CB 1I7RB 4U6VH 1RY7B 3GBML 1B0WA 1PDKA 3CJJA 3CLFH 1RUAH 1YEIH 1MCCA 2EC9T 3ZTNL 5CJBA 3MRCB 4E41E 3Q5TA 3WDJA 3GJFH 1QSFA 4P2OA 2B1HL 2XOTA 3A6CH 5BO1H 3BXNA 2OLDA 3QR2A 4RFEA 4ZS7H 3BQUD 2BRQA 2NXZB 3MLSL 1UJTA 5BRZB 3O3EB 1FC2D 3O9WD 1Q9LA 1GC1H 4PLJD 2Y6SD 1ZTXH 1DN0B 4J3OC 2JELH 3MLPA 4P57B 3K7UA 4ZFZA 3O6LL 5DD6A 5IVXB 1CICD 2V5MA 3MLRL 5HHMB 1W0WA 1KTDB 3DX8A 3LEYL 3FZUD 2EE2A 3BD5A 3O6FD 4OCYL 5AD0A 5KVEH 5C86A 1T3FB 4OCLC 4UINH 3MJ9A 5FUOL 4LSTL 5DUMH 4P2OC 2BVOB 4JRXA 2UYLB 1FFNA 3HG1E 3VXNA 1HSAA 5A2JH 3HAEH 1DBJL 2IG2H 3VFTB 3CZFB 5HHXH 2DQGL 1GZQB 3EO0B 5F3BB 4LLWA 1T5WA 3OAYH 1WIPA 3ARGA 4XNXL 4EUPA 4ZD3H 2R8SL 3GM0A 3MR9B 4OV5B 3RUGF 3VRJB 2B4CL 3BIKA 2RFXA 1CGXA 5BQ7B 1WICA 1A2YA 3MACH 2ATPB 3BO8A 43CAB 1TITA 4MX7A 2K7PA 2R0ZH 1CLOH 1K4DA 3P4NB 4RISH 4Z76B 1J7VR 4XXCA 1F4HA 4QRTB 2WAHA 4NKDB 4Z7VE 4LKCB 4LVHC 4MQ7B 2YMXL 2OK0L 5IROA 1RJCA 5GHWH 2X70A 5D1ZD 5C0EB 1E4XL 3BP6A 1XZ0A 1AGCB 4QF1B 2HJLB 2FWOA 4HXAL 3HRPA 4UDTB 1MHEA 4FN0A 3MNZB 3KJ4C 2VDPH 1S78C 2ADIB 4KMQA 3LKQA 3F12A 3ARGC 5ESAB 3ULUE 1AY1H 2R4SL 4C56A 5HYJD 1TCRB 3CK0L 1KCVH 5CZXC 2J8UB 2YBRA 3NCYP 5DURB 4PV8A 1IQWH 2CPCA 1XR8A 4EI5D 3IJHB 3ARFA 3BEWA 4HS3B 4BFIB 4RDQG 4FP8L 4XXCC 1CD1A 1QHOA 5JR1L 2VLKE 1KIRA 1J9CT 5IROC 3B5HA 3CC5B 3DROA 4CW1A 4TNWK 4RIRB 3UJJL 2OYPA 4ALAL 4FQ1L 1EHLH 2CO6B 2J5LC 1CZ8L 1I8IB 1SEQL 2BVEA 1C08A 1S7UB 1FL3B 4JFYB 4ZFOA 1LVEA 4R4FH 4L4VD 1CLYH 3AS2A 5FAAA 4BSVB 2JJSA 1CFSA 1WISA 1JWUA 4MXWH 1ACYH 1H3UA 5DVMA 3O8XA 5BXFA 1G7QB 1LHZA 3ULVH 2CD0A 3MRIA 5T1KA 4O58L 4KKBD 3G5XA 3ARFC 2GUOB 4JFDA 3DVNB 3KYOA 4GOSA 5JLZB 2F5BH 3VH8A 3QUML 2D7NA 1S7TA 3T2NL 4UNVA 2W91A 1WBXA 2EYRA 2Z31C 4I2XE 5DWUH 4OIBA 4P5MA 1NBVL 2Y9RT 3O4LB 5EPMB 4XNZB 1NGYB 2HVKA 3PGDB 3WL9B 4OLVL 2VL5B 2IQAB 3D3VD 4QRPA 2MTPA 3TBTB 4X80H 4AEIL 2FO4A 1FZJB 1T20A 1J11A 1BIIA 3O8XC 4KK8D 4WFFD 1A6TA 1U95B 4PJCB 3RL1B 1EHNA 1SJEB 1F4WL 6FABL 1PW3A 5H35B 3ROOB 3GSQA 1T66C 2Z92B 2W92A 1P69B 3GHEL 4TOYL 1P2CB 4KK5C 5D93B 4C57C 2XWBB 5EC1A 2P5EB 4HUWA 2Q7NA 3BZEB 3OGOE 1A6UL 1BD2A 5GGSY 3QWRD 5CGTA 2D03L 3RZCA 4LP4A 1FE8L 1U3HA 4JPVL 4JO4H 2OR9L 3MREB 4NOBA 3DHMA 1XGYL 2EH8H 2HP4A 4JO2L 4LCWB 4PJDB 3TN0B 3Q2CA 1U3ZA 2C4XA 4D2NA 3PV6B 3VFOA 2HAZA 1E6OH 3SE3C 32C2B 5HVGB 3S96B 1FL5A 3WXWL 3BDXA 3D0LA 3MV11 3MRRB 2X42A 4QRQB 4ETYA 3JUZA 5IEKB 2EICA 4Y19E 5FM5M 3WO3B 3D69A 5KSUB 4IJ3B 3RGVA 3EYUH 5CBAB 1MCOH 3KPMB 4DKFL 4HDIB 3VWKB 2CMRL 4LBEB 3WHXA 3LV3A 4LNRB 4LSDA 4ZUVB 1Y0LA 3ULSB 4DZ8B 4RFNB 4JM2B 4F33A 3H3KA 4AMKL 2B8OT 3WO4C 1AD9B 4OZGA 1EFXD 3PP4H 1SVCP 3STLB 2B7DT 3MXVH 4PP2B 2G5RA 5E9DB 4ACPA 4YAQB 2HTKC 1UFUA 3RZCC 1T04A 1MIEH 1U3HC 3D25A 2V5SA 1NCWL 1IC7L 3PDOA 1TFHA 2ILLA 1A1MB 4KTEL 3P9WB 3I6KA 1Z0NA 3P2TA 3OJVC 3OF6D 3MLSH 4N1EA 4N90E 4HJGB 5KN5B 4M7KH 1YECL 4KTYA 3I84A 4AZ8A 5FO8B 1UM4L 3EUUA 4YHIB 5TDNA 4M4RA 2ZSWB 4XGZA 5A3ID 4LEOB 3JWNC 5LGKA 2O5XL 4X4XB 2ZCLL 5C0IA 3OZ9L 1CD8A 4YR6B 2YD5A 5F88A 3HC4H 4OLUH 4Y5VC 4L9DA 1MWAA 2R2BB 5D7LD 1N26A 1RU9H 3BN3B 4WTZA 3T04D 4JPIA 3WBDA 1HHJB 4MAUH 5FYJU 4LIQL 1NCCL 5FUOH 4WTWA 2LTQC 2IPKA 4NM4L 2APTA 3AS1A 1TZGL 4M5YH 3KPRE 3DIFB 4OCRH 4KHXH 4R3SA 4PJEE 1KPVB 7FABL 3S35H 4L4TA 3PWPE 4H26B 5EO0B 5KW9H 3HE6D 4Z95L 5A2LH 1MJ8H 2FBOJ 3BP4B 4S2SA 1MI5B 5EBMA 2D7MA 3U9UA 4DQOH 3HS0B 4HUXB 1IAKA 3O2VL 4CDHA 2B4CH 3IU3B 1KJVA 3LAFA 4OLZL 4LVEA 3GMOA 3LRHA 1ACZA 3OG6B 4U33A 3JTTB 4LQFL 5HYIA 3SQOL 3W39A 2YMXH 4G6AC 5EB9A 4G80A 4J8RA 1W8OA 1PY4A 4E5XB 1FVDB 5EIQA 5FOJA 3SCMC 5CD3B 4NBYB 3VFVB 4RMRA 3QUXA 3H9HB 2F54B 2VZSA 2A9NH 4WFHE 5ITFB 5J13C 2HTLD 5H37G 5DMGC 1O5DT 3PNWB 3QEGL 2HMID 3ARZA 3PG2A 1JHTA 2IAMA 1TNNA 3IAQA 4KK9C 4P23D 4M1CC 2X4OA 4X7TB 3LQAL 2O5YH 1UJ3B 1MJJB 2XNAA 3FONA 3BZDA 5EZLA 4EI6A 3K8LA 4DCQA 3T8XA 5T33L 1NGPL 3C5SB 1IC4L 3QXAA 5EWIH 2R0LL 1D5XB 1XMWA 1F8TH 3UJJH 2GJ6E 5JXED 4I18C 4NZUH 3MLXL 5ESQB 4WTXA 3UZEA 2GK2A 4YZFE 3TNMA 1XF5A 3BWAA 4UB0L 5T5NG 3OXSA 3QUXC 3D9AH 3IXAA 2D4DA 3RWEB 5DK2B 4CADB 1A02N 3VXMB 5GGRA 4GG8A 3U9PL 5F7MC 1GGIL 4OSUL 5ALCL 2MQ3A 2P8MA 4XB8A 3FO2A 4ONGH 4NWUL 4MJ6A 1N59A 1ZHNB 1JGDA 2PO6D 2IAMC 4ZUTA 4PGDA 2YN5A 2PW2B 1YDPB 4KKAC 3VFUB 4YJZL 3V4PH 1A5FL 4HS8L 4WO4D 4NT6B 1N2RA 5IVOA 5HHQA 1BFTA 4JDTH 4XMKH 1SVZA 1WCBB 5IP4A 1SY6A 1FFOB 2F58H 4ZYKB 2V7HA 3EZJB 5SV4A 4CMMA 4JPWH 1NBVH 4OLYL 1CXKA 1ADQA 1Z5LB 5IJVB 3BMVA 3P0YL 1J1OL 1FG2B 1KTRL 1YYML 5J12B 5JW5B 4JO1L 4HG4K 1GRWA 3FT3A 4N0CD 1JK8A 1I7ZB 4AEIH 2LVEA 3I02A 4ENEC 3GUTB 5C70A 3KLAA 5HPMB 4NSKA 1T7WA 1UEMA 3DVGA 1H3PL 3W5MA 1F4WH 1MVFA 7CGTA 1YEKL 2QHRL 1MCDA 4G9FB 3RX8A 4QGTA 2P5WB 3MLTA 3MSPA 4TOYH 3TF7C 3SO5A 4JZJA 1PX4A 2AJVH 1FGNH 4GKZB 2AVGA 5D72L 4U1JB 4JKPH 4HIHB 5I9QB 3HN3A 1EZVY 3BHBB 3CFEB 4GXVH 4I77L 1P84J 4X6CE 1K5NA 1FE8H 4C58B 3L5JA 3NIDE 1XGYH 5LBSL 1QLFB 1R0AL 3CFJA 1XGRA 3CFCL 3VD7A 1ZMYA 5E6IA 3WXWH 3RDTA 1A7QH 5IESL 1IGIL 2H26A 4N0RA 1U92A 2IPUG 1JPTH 4NCC1 4PG2A 4ETQA 3IDJB 5BRZE 1FFRA 1JGVL 5CIPB 4PRIB 4NBZB 4RWYL 4EJ1C 4UV7L 5JW4Q 3V0VB 4Q0XL 1JPFA 2ZUVA 5T3XD 4JGUA 4EN3B 1YMMA 3QXVA 1AXSA 3D2UD 4XP4L 1OT2A 1Q1JL 4QWWC 1C7TA 5AZEH 3JV4A 4LIQE 4PG9B 5IVXE 3P3YA 1T2QL 4X6DA 1ORSA 5EU7C 3QHZH 3MODH 1AE6L 5LAXB 5TE6L 4U6YB 5FGCB 3DX7B 3DUSA 3T77A 5DF0A 1XH3A 2V7NA 2NY1C 3OGCA 4YXKH 4IHOB 1R5WA 3AY4A 3MRPA 1FVCB 4WNQA 5E6IC 3MLVL 4MDJA 1B4RA 1KENH 1YECH 2YK1L 3N0PB 3EOYG 2VLJA 1G7HB 3C8HA 5IFJA 5GJTL 5IMKB 1F6LL 4PG2C 3AXLA 3IDXH 2HH0H 3QFJB 4F9LA 5EIIA 3OZ9H 4NO3A 4FTVB 3CUPA 1S9YB 4O9HH 4HKZB 1H8NA 1K8IB 2FHFA 1RUKL 3SEPA 2PNDA 3QCTL 2QQNL 1P1ZB 1UH4A 2VDNL 3LHPH 4Q9QL 4NRXA 3IDNB 4R97B 3UJIL 5D70H 2AJZA 1AO7A 1HHKB 1TJIH 3BW9A 1ZLWK 2C7UB 1JPGB 3AY4C 4OF8A 3ARYA 4XWGL 3LKNA 1RZGB 7FABH 1A9EB 1EAPA 3C87A 3T2QA 2P44B 3DARA 4OZIA 3JUYA 1HINL 3WFBL 2XPGB 5D96B 5DJDB 1NPUA 1AR1C 2H8PA 2CDFB 3UO1H 4APQD 3V8OA 5EFIB 1U8NA 5GGTL 2OL3H 1V8HA 4U1LA 1F3JB 1LNUB 1VDGA 3LKPA 3O2VH 3RVTC 5I73B 3QNZA 3I6LE 4K8RD 4Z7WA 4OLZH 3GNML 1F11B 5LGJA 2J8UE 4JN1L 4DGVH 4PRPD 4LQFH 1RD6A 4Z0XA 3HB3D 1TZIB 2DN7A 1JFQH 3WUZA 4WHTB 3D18A 1NCBL 1X3DA 3QI9A 4OLWH 4MJ5A 43C9A 3WFHB 2H32A 3T4YB 4FG6D 4P46B 3TM6A 4G9DB 1TQBC 1KYOK 3DGGB 1T7XA 5IQ7H 3B2VH 1IL1A 5JPNA 2VLRD 5HHNA 5EU4B 2H9GA 4M7JH 1DBKH 3RI5K 2C3HA 3SE8L 1IGFL 3MV8D 1FP5A 3NCJL 4P9HC 1F97A 1RZJC 4PJHB 2CKBA 2A83A 2WLYA 3JV5A 3P77A 4NQEB 4YDVB 4CVXB 4MB4A 1HOCA 1ZT4B 3QI9C 1NGPH 2Y5EA 4JDZA 5E1AA 3O2DL 4U1GC 3PJSB 5HDQH 4ZFGL 5IV2A 5GGUA 4W68A 4K3HA 1KFAL 4WFGE 5DUBA 4MD0B 4M62L 5SWZB 1WGOA 4MXVE 4U1HB 2NY0C 1PG7W 4KWUA 3LKSA 3O4LE 1E6JL 2YD8A 1OP9A 4XWOD 5HGBB 1WK0A 1WIOA 4FQXD 3A6OA 1NC4D 2WQRA 4NJ9H 1KJMA 2GT9A 1E4WL 4PJCE 5C0ND 2Q86B 1JIBA 5KJRL 4ODHL 5CSGA 3CSPA 2R9HD 5F7LB 4KQ4H 3BKCL 3O9WA 1J0KA 3T3ME 5FCSH 5BJTB 3TCLB 2EE9A 3PDGA 2EEAA 3OL2A 2P5EE 1AJ7L 4NJAL 2YA2A 5EDXA 1RZIB 1RK1A 1CICA 2FZ3B 2GFBB 5C9JB 2G60H 1KNOB 1NMBL 4YHOH 5DD0L 5HGAB 5CJQH 1QSEB 3NCCB 2BNUB 4LCWE 4PJDE 3P9LA 4PRDB 5C0BA 2W0FB 5GS0H 4QTHB 3MFFB 1DQDH 1KELH 1YEKH 1QR1A 4LVNC 2GITA 5HTSA 5DMYA 4IS6B 3HZVA 4KRNA 4RNRA 5HD8D 2CKNA 2CIIB 3BQUC 1IQDB 1MSPA 3ILPB 1I3GL 5C2UB 1S5HA 2DI7A 4HHAA 3O9WC 5D72H 1MHHA 3WE6B 1XT5A 2YXFA 4ISVA 3MRFB 1MAML 2YC1A 4LLUA 4PLJC 4JY5H 2Y6SC 1K2DB 3U46B 1G9MH 4I77H 2F8VA 4M61A 4R6UA 4M8QB 4JKKA 3DO3A 1CICC 3NFNB 4FFVD 5E9DE 1CI5A 3EW3B 1R0AH 1S7SA 3OKDA 4NO2B 5FM4A 2DQEL 1CQYA 2VC2L 3LD8C 5ESVB 3FZUC 3O6FC 1T0MB 4OJFL 4IDLA 3KR3L 4O2FA 3MRQB 3OKNA 5BVJA 5D6CB 1QSFB 1Q9OA 4U7SA 4JRYD 1HCVA 4RWYH 4UV7H 1CDGA 4FQ2L 1Y6NR 4Q0XH 3EOTH 1DTUA 3B5TA 1FNLA 4MA3A 5JW4R 4LAQL 4LDLB 3MRHA 1UQSA 1Q1JH 1WAAA 2IH1A 5EH1A 3DTXA 4HQQH 4D9RE 2XTJE 5HYEA 4LPUA 3ARED 4OAWA 1EZVX 5HYJA 1UWXH 2JB6A 4YBQD 5TE6H 3UEZA 1T2JA 4RRPG 3SKOB 1ND0B 4EI5A 5AD0B 1PFCA 4ZUWA 3MLVH 1G7IB 2YK1H 4PGBA 1HIMH 2VO5A 3ARVA 1REIA 3IFNL 4LVHB 3QZWG 3ECBA 4HFWB 4HMEA 2Y36L 2UVFA 3U6RB 1OP3H 5D1ZC 3U0PA 3VW3H 4BQBA 3F7PC 3N85H 5J8OA 1MI5E 1CGUA 3HI5L 2DOCA 2ICWI 3GKWH 3L3HA 1Q72H 3AROA 2YWYA 5F70A 2A9MH 3VFPA 5MI0C 3CNKA 1H15A 4GAFB 4L4VA 4H20L 2QQNH 3N1FC 1OM3H 3RVWD 5J9PB 1SM3L 3UJIH 1AIFA 4LLVA 4NC0B 1A9BB 4EI5C 1U8LB 1K4DB 1I1RA 2XQBH 2VXVL 1DBAL 1HSBB 4XC3L 2X4UA 3BPLC 1CXEA 4ZNEA 1E28A 3NA9L 3S4SA 4BELD 2F54E 3BP6B 5GGTH 1H3WM 1HH9B 3WEXB 4D9QE 3IETB 3IJYA 3MRBA 5KAQF 2ZOKB 1MHEB 3FAXA 1HN1A 2DKSA 1MQKL 2CJUL 2QLVB 5F6IC 3AU1B 4EEEA 4XCFL 5C0DA 3D39B 3D3VA 2A77H 5EUOB 5E00A 5SX5H 1AXIB 4WUUB 5FOBA 3H3BC 3MLWH 4P48A 3B3IB 4PYGA 3OR6A 4KKBC 3E8UH 4KKCD 3R06A 5INDA 2M26A 2XA8L 1N7MH 3ULUD 5D2NB 2Z31B 4YXLH 1KIRB 3I2CL 3GSVB 3WN5C 3OKMB 3QWRA 3KS0H 4ODXB 5EO9A 3VXME 4EUPG 5K9JH 3ZSTA 2VLLB 1FG9C 1K8DA 4BQ6A 1ZV5A 3VFSA 4ZFOB 2D3VA 2FCBA 3DXAB 3V6OC 4KZEL 3O4OB 1BJ8A 2VLKD 3RWGB 5KBNC 3E3QC 5I1CL 2XFXA 5C0RH 1N64L 1CFSB 1W0VB 2IANA 4ZTOL 5JZ7D 3VDAA 2GSGA 2Z8WC 1CN4A 5ID0A 4RGNB 4QOKB 5EU3A 4KK8C 5FO7A 3O2DH 4M4PA 5DJXA 5KSAD 3G5XB 4I13B 1R3LA 3EHBD 4JCMA 5HYFA 3S5LA 3VI4F 2FH6A 2AGJL 4UTBL 4WHYH 4G8EA 4XNYH 1JVKA 1OAQH 2NR6D 1JTTA 2EYRB 4RGOL 4NC1C 2ICWA 1GGBH 1MVUA 1EFXA 3IJSB 3WIIL 3L1OH 3WIHH 4NQVA 4X7CC 5GS1A 3L7FA 2Q7YB 1A6WH 3IDIB 1LK3L 2AJSH 4QRPB 2BMKA 5IT2H 4XT1C 1BOYA 2ZP0T 3EFDH 5I8OL 2L4OA 4G9FE 4QRSB 3GK8L 2X4TB 2MNUA 5MEOA 2P5WE 3RWFA 4I0PD 1SEBB 5BZDB 2VE6A 2XKNB 2FGWL 3QCUH 1IJ9A 3RWHB 4NJAH 3W5NA 1TXKA 5I16A 3QFDB 4PREA 5I1LB 3QXDB 3RJDA 4UT6L 5HHVH 5D7LA 4UUJA 3WO4B 1CE6A 4F9PA 4AEHH 1X9QA 5J56B 15C8L 3DMMB 4DN4H 4X6DF 12E8L 4JKWA 1U3HB 3IKKA 5GS1C 1UM5H 5LWYL 4K7PY 4LDEB 4MQSB 1BQLL 3OB0K 4P3DB 5TGBA 4Q58C 2KBGA 2OSLA 5ANMB 1S7XA 4JG0L 5SWSA 1FL5B 2QSCH 1JYNA 3WSQL 1LE9B 4PRIE 1AGDA 4P3CL 4PJBE 4UIMA 5CP3A 1HHHA 3BEVB 3MCKA 3VH8G 3L3JB 3BPOC 3HE6A 1MAMH 3CFBA 5F96H 2MWCA 4XBPA 3LKRA 4NQXA 1A7PL 3DYPA 2IBZY 5A3IC 2Y1VA 1ZGLM 4OFPA 3LV3B 4Y5VB 4MXQD 3WJJC 4XAKE 2RQ8A 4K9EC 2DQEH 5FGCE 2VC2H 1F2XK 4OZGB 4F9PC 2VQUA 1HH6B 5JUEL 1SMOA 4OJFH 5JTWA 2LTQB 3FQNB 4HPOL 4U2YA 1M7IB 4ODTL 3IGAA 1OQOA 4H88L 2FJHA 3MOAH 1M6OA 2DDQH 2EDRA 5DLMH 4Y16B 1ZT7A 4QHUB 3BP5A 5JIHA 3FQUB 2NYYD 4X0KA 5CBEB 3QFJE 5DFWH 1EHXA 3HE6C 4FTVE 1QBAA 1YEGH 3UTQA 4AH2B 1NCDL 2UVEA 5FECA 2X1WL 3K4AA 1Q94A 3ZYJA 1DBBH 4LSUH 3RTQB 2FJGA 1MFEL 2ENSA 4JFQB 3MRDA 4KI1A 1KEMH 2K3TA 4HWBA 3TIDB 5CILL 4GBXB 4P23A 5BV7C 4Z7WF 3G9VA 1NEUA 2IALB 4NYLB 5GSVB 3M45A 1M05A 5ISZB 3GO1H 3LH2H 4JZOA 4H0GA 4HH8A 1C5DA 3MRNB 3PDDA 3SCMB 2WM0A 5JXEA 2HN7A 5IW6A 2BSED 5IK3A 1VKXA 2X5PA 4X83A 4R96A 2W60A 1QFWL 5J13B 3FB5B 1HXYA 4WU5B 2BC4A 4S2SB 2HTLC 4P2QA 3HZMA 4BZ1L 2Z91A 1IAKB 1XGUA 2A1WL 5CJ8A 2IPTL 1SM3H 4XCEA 2HMIC 3LMJH 1PKQA 1KYOJ 5TE4L 2PO6A 3PWPD 4KH2A 3QDJB 4Z7QF 4P23C 2WANA 4UMGA 2A6DA 1YPZA 4M7LT 5FYJL 5MERA 2YD4A 4WO4A 4XC3H 1GXEA 4PD4K 5HI3D 3BGMB 1HQRB 4J8RB 2EECA 5DUPL 4I18B 2FATL 2KH2B 3N06B 1ZHLA 4UT7L 5IFAL 5JXEC 1EHAA 1MCWM 5F7KC 4DEPC 4O02H 2ID5A 2V2XB 2EYSA 1MLBA 1BOGB 4G43A 4HK0B 1F4YH 3V0WL 4WTZG 5BMFL 4PJHE 1QFWM 1QKZL 4NQCA 1JZ6A 1Q9WA 4NQEE 1KLGA 4GAYA 2PO6C 5DD1L 1P7QA 2XNAB 3NTCL 4KDWA 3T3PE 4F80A 4PJAB 4MNHB 4DCQB 4WFHD 3T8XB 4WO4C 3UPAA 4XMPH 4NZRL 4WY7L 3NMEA 4ZUUA 5SWZE 1JTPA 1G1YA 3WUWA 1OD7A 3NIGE 1Z9MA 4KTDL 1JHLL 1G7LB 4K3DH 5F7EH 1GOHA 2C1OB 1FBIH 2D7QA 4DUVA 5F1KC 1MHCA 1JWSA 5LCVH 3OXSB 2XA3A 3GMPA 3ME0A 1I9JL 4LK4A 5J11B 3QPXH 3O41A 2CQVA 5HJ3A 4KZEH 1Q8MA 4N0CC 5I1CH 1MIMH 2P8MB 5IOPB 2OMNA 5FYKU 2ESVB 4X8JA 1FGVH 1MRDH 4WIQA 3BPCA 1LEGB 2Q8BL 1VGKA 2F15A 4RFOL 4U7KA 1UYWH 1ZVSA 2A0LD 2X10A 1JV5B 3SDDB 5IG7B 4KROB 3KYMA 4OD1L 4YHZL 3D2UA 3X3FH 3ZE2F 1I8LA 1YUHA 2O5ZL 4NO0D 3HR6A 1N6VA 3RU8H 5JNYB 1QSEE 1UB5A 3LIZH 3HFML 1LILA 3G5ZA 2ZG2A 4H5SB 1T5XB 2WIIA 4R8WH 3O81A 1JGEA 4O00A 1KB5H 2P7TA 1ZGLP 2PXYA 2D0GA 1FSKC 1TJGH 4FMFA 5B21A 3FRUB 5E24E 2XWTA 1KPRB 3D48R 3MROB 2PF6A 3VD3A 5L88L 4CU7A 4JHZA 2A2QT 3F7YA 3MLTB 4UT6H 1LP9A 4XRCA 4XNQA 1ZANH 1A7RL 1GJIA 1NAMB 1I8LC 1GSMA 1UKSA 2J8HA 1WAAF 15C8H 1PJ9A 3ROLB 3L3GA 1K5NB 1T22A 5I6XC 3V79C 1YY9D 5DEFB 1QP1A 1I7UA 2NY1B 4I4WA 1BQLH 2WUCH 4TUOA 5KZCD 4CN4A 5KG9B 1LEKB 3DYMA 1QSFE 3ZYOA 3BVNA 2YKLH 2DWEB 2RB8A 4S1QH 1F90L 4LSSL 5E99H 3FB7B 4XAWH 3C8KB 3CVIH 2DQHH 3K8MA 3FQRB 5I8KH 4JKLA 4Q2ZB 4APQA 3RVUD 5CZVL 1XF2B 2AJUH 3X11A 5D7KE 4EVNA 4WWID 3QQ9D 3QO0B 4PJGB 1S7VA 1IFHH 2NY2B 5C0FB 1SHMA 5D7JD 1J5OH 4FMKA 1RV6X 5DR5L 4WDIB 1W72L 1DL7H 2VDRH 1OAXL 1MJ7L 2NXZD 4FFZL 2CRMA 2R56H 4P3WA 3RX7A 1NEZA 4O2EB 8FABB 3DHJA 3HRZB 4YBLC 4GUPA 3ZDZE 4K7PX 4H88H 3F62A 1EGJL 5I66A 5J0BA 5CJXA 1H8OA 5HHMD 4PY7A 2ZCKL 4LCYB 4NDMA 2VLRA 2E9JA 5D7IA 4HAFA 4APQC 3GSRA 3WS3B 4DKDC 2HG5A 2IFFH 3BH9A 2VIRB 2IBZX 3MV8A 5F71A 4OZHB 3E1F1 1ZA6A 4H1LH 4ZUSB 5KVFH 2YWZA 4K8RC 1KCSH 1ULVA 2BNQA 4D0DB 1A6VL 5I71C 1CXIA 1BBJB 3QIBA 5SX4H 1OB1A 2X4RA 3HB3C 4OCSH 1R3KB 3BT2L 5CJ5A 1MHPL 4TPRL 2YD3A 3PWJB 5DRWB 3BW9B 5F89A 4FG6C 5FHBH 3MO1A 4HLJA 3U4EA 3K2MC 5CJXC 4Z78A 1TQBB 3BSZH 3L5WB 5E2VH 4PJIA 5E08L 3EJZD 5IWLA 1XGPB 3PUCA 2LU3A 4YHKL 4LHQB 4RMWA 1QRND 1EO8L 3D39E 2A1WH 3GIZH 2Y07H 3KPTA 3LKOA 5I19H 5EUOE 1QO3A 4FQXA 2GSIA 2Y7QA 5LGJB 1NC4A 4WUUE 3MXWH 1IMHC 1HKFA 4PRNA 3QIUD 1NFIB 3MGTA 4XP5L 3W0WD 3GRWL 4U6XA 1XF3A 4D94A 4UV4L 1I9IH 2GJZA 4HUVA 2IADB 1YN7B 2GTWB 5JOFA 3UJTL 5D2NE 2FATH 3I6LD 4ODUB 4ELMA 2E8ZA 5IFAH 5MEQA 2AJYH 4JFZL 4PJ7A 5DURD 3SKJH 4FQJL 1P7KA 1EK3A 1IL1B 5FYLL 3IFLH 5JPNB 4BSJA 1IT9H 4G42A 5HHNB 5IMOB 5F1NA 1G0YR 4N8VA 4OI7A 1L4IA 4CVWA 4WGVB 1DEEA 3CU1A 2NY3D 1IM3B 4XWOC 3DXAE 3EYVA 3MUY1 3VXUA 4KFZC 1M1SA 4FQXC 4KUCF 2CKBB 1RIUL 3VRLE 3G6JA 4NQSA 4JG1H 2D0FA 4QOKE 4RGNE 5DMJB 3BPNC 4L8BA 3FN3A 5C0NC 3HZKA 4U3XA 4N0FB 1AH1A 1XF4B 1E4JA 2OQJA 2R9HC 3HR5A 4QXGH 1JZ2A 4OF0A 4EDXB 4I0CC 4JDZB 4OKVB 1DBML 4MA8L 3DX6A 4PB0L 1NUDA 35C8H 3CVHA 4L8SA 5LGHH 5ILTL 4PGCB 4QHLA 3TBSA 1EFQA 1RHHA 1DCLA 5IM7A 1FJ1A 3NZ8A 3HC0B 1JGUL 4UZGA 1UZ8A 1DLFH 2X4PB 3KPLB 1DZBA 5F7WC 3T2OA 3EFFA 4QRPE 1MFDH 1MCIA 3RVVD 5JXAL 5IEHA 4YXHH 1U3JA 4DUWA 5FA3B 1RK0A 4JFXA 2FX9L 3O11B 5D2LA 5FDWA 3O4LD 3Q5YA 4RFOH 4JVPA 3BQUB 3SDXA 5HD8C 3MPCA 3PABA 1LO5B 4HX1A 4JEGB 3VXOA 2EXWD 3O45A 4YHZH 5I8CA 3MRJA 3GB7B 4DN3L 5DJAB 3DGCR 3H9SD 2HJFA 4YDLC 1A7OL 3WFZA 1T7VA 3GJEB 2L7JA 4L8SC 3AREA 1CXLA 4HCRA 2A6JA 3PHSA 2V2WA 5LKNA 4FFVC 4CDGC 3VFMA 4J3UA 3MV7B 2BHZA 3SY0A 3MLZH 4UOW0 2DQFA 1TVHA 3O6FB 4K3JH 3H2WA 1UWGH 3P9LB 1NCAL 5ANME 4LEXH 3LS4L 4QHKI 3T08A 1FHGA 1AQKH 4YGVB 2GKIA 4HK3J 4XCCH 3IXTB 4NZJA 1LE5A 2DMKA 1RUQL 2VQ1A 4X7SH 1E27B 1OP5H 3RWDA 1U6AH 3MUJA 4G8FA 5FO9A 4BFBD 3TN0D 5HDOA 4AM0A 4NHCL 5DJ2B 2UUDH 1DQMH 4YWGH 3UC0H 3V5KA 3AREC 4OZGE 5B4MD 4YBQC 3HG1A 1KSRA 4FXLA 1JMXA 4QO1A 1N5AA 1BFVL 2A6IB 1NAML 4MMXC 4XVJL 1P4LA 1CFNB 1U8MA 1SYVA 3P30L 4HC1A 3TT1H 4G8GD 2OS7A 3ESUF 4OM0H 4TSBH 2ZCHH 5ABDE 5IB3B 3CX2A 5CZVH 2GQHA 3DPBA 5D1ZB 3KPOA 4GAGL 1E0OB 4LRIA 4OD2A 2JK5A 4X6EA 1QEWA 4PB9H 1QLEH 2YOCA 3K1DA 1YNKH 1W72H 2FLRT 1C16A 4J7RA 4Z7VA 3G5YB 1ZEAL 3QNYA 5CUSH 3GMLA 1GGTA 4PJXB 2VKXA 5HYJB 1CT8B 3ET9F 4JVUA 3VCLA 1I8MB 2N56A 3RVWC 4FQLH 1WSST 4Y4HA 3KLSA 2ZOLB 3KPQB 4WVRA 1EGJH 1T0PB 1KPUA 1Q0YH 1X5GA 1A64A 5ISZE 4GS7C 4GRWH 5ECJE 4D9RD 4QHNB 4G6KL 2RJMA 1YPZF 2A73A 4LGSB 3JWOH 1FNEA 3QJHA 3WNKA 3ECBB 3QO1B 2CRZA 3TYFA 3V8CA 1A4JA 4X98B 2PN5A 4P5KB 5F6IB 4F2MA 2DLTA 4PD4J 4GO6B 2C3XA 4FQHB 2VJXA 4ZPTB 2R1YA 2VLKA 3EOBB 3QDJE 1MHPH 2NNAB 3TVMA 4TPRH 4HKXB 3MNWB 1ZWIB 5KSAA 5FA4A 3UBXI 3B9VA 3M1BB 4KKCC 2DJ4A 1IEAB 2LU4A 4MB5A 1PKOA 3ULUC 5E08H 2VLME 3S4SB 1BLNB 1F02I 3EO9L 3WN5B 2NXYB 1VFOA 3NVQA 1B2WH 1OAZL 1NLDL 1MJUH 3D0VA 5GQBA 1MCQA 1FFPB 5CKGA 4M1DH 3GSWB 4RAUB 4IMLB 5JDSA 4DKAA 1N3NA 3QYCA 2RCSL 4QYOB 1FO0H 1I3VA 1S9VA 1AXTH 3L3KB 4I2XA 1INEH 4UV4H 3S34L 5JZ7C 3VXQA 4PJAE 1QA9B 3PWUB 1I8KB 2BVPB 1OAUL 4I0PA 2KPNA 3BJLA 4KI5F 5KSAC 3IDYC 4JFZH 1IAIL 1AKJB 4GRLD 3EHBC 3GSNA 3C6LD 4IRJB 4LU5L 1C1EH 5EN2B 2NR6C 2E5EA 5A16B 1U91A 1DQLL 3AVEA 3IVKB 1KIPA 4P59L 5KANI 2X4QA 4LARL 1A6ZA 2QHLA 2P24B 5TFSL 4ZTPH 2OI9B 2ADGA 4NKOB 1WBZA 2GK0A 4Z18A 2ESVE 2X89A 4A6YB 4Y88A 4DTGL 4R7DB 1NBYB 4C55A 2EYTA 2XZAL 4AIXA 3AMLA 4MA8H 3VXMD 1RUML 1BEYL 4I0PC 5E5RB 3S4SG 2NX5D 1S5IL 2NPLX 5ADOH 4YFDB 4D0CB 2YD7A 1BJ1H 4XPHL 5CCKL 3TBWB 5B39A 4YE4L 1IKFL 5B38B 5JORB 2X1OA 3QJFA 4XP1L 1UM6L 5TDPA 3VFGH 4XVTL 1LWRA 5CHNB 3MLYL 1J0JA 2HKHL 4QNPF 5HVFB 4G7VL 4Y19A 3VWJD 2JCCF 1HILA 1L7TL 1L7IL 2F8XC 3O3AA 3KNBB 4XNMA 2Z8RA 3PHQB 4HUKB 4J6RH 3UBXA 3RVXD 1EEZB 3QIWB 4GKOA 3H42H 3NFPA 5DZNA 1BF8A 4ZFFA 4OCWL 3BPOB 5IUSA 3SDAB 3BE1L 3MA7B 4RSVA 2VZ3A 4UOW1 4G6JL 3UZQA 5EU7E 5C3TA 1R3HA 4HZLA 4MXQC 5TPWH 2J4WL 1CE6B 4DVRL 5EBWB 1VCAA 2I25N 1IKNA 4R0LA 5K9KA 3OKEA 5E8PA 1N8ZB 3BH8B 4YPGA 1RJLA 1CBVL 2FJFB 3IT8D 3T65A 4LPXA 3QG7H 4N1CA 2V6HA 3X14B 4P9ML 5E6YA 2I27N 4NGHH 5DDHA 4KVNH 1PEWA 3H8NA 3Q3GB 2ZJSH 2NW3A 1T03L 1S7QA 1EERB 1RULL 1A0QL 4OF6A 4ZO6A 3BUYA 1AGDB 1FLTX 4UIMB 4PTUA 4HAGA 3MMEB 2VKWA 3TWCH 1J1XL 5C0GA 2VRAA 1BQSA 2NYYC 4PJGE 4EOWL 5L2KB 3ARRA 5B38G 3ALWA 5DJ8B 5D7IF 2WINA 5JQ6H 1S9WB 2HFGL 4PR5B 3VGAC 2ITDA 5MP6H 4PJEA 1MCHA 3QPQD 4M8VA 4JHBA 1R3JA 2J6EH 4YH6A 3PWPA 2Z0BA 1S7RA 3P4MB 1ORQB 3V52H 3P30H 1IKNC 1U42A 4R0LC 2H1PH 2YEZA 4F7MB 2IMMA 1RZ8A 4Z8FH 4NPYB 3B5GA 4EN3D 5E95B 4YDKL 4M7LH 1U8OA 2B4CC 2QJDA 3B8SA 4ZOEA 1OW0A 2VDKL 3FOMB 2CLRB 4XAKD 1OGTB 4H25A 1DQJB 5KSVA 1R5IA 1WEJL 3GSUB 4JPKH 1U8HB 1G6RL 4AT6B 1NL0H 2WSKA 5D7SH 3GI8L 3ZKMD 4OZHE 3N1GC 2XN9B 4NNYA 3W11D 3MC0A 3MBEB 2CRIA 5FGBC 4AG4L 1CFQA 2UY6A 3HI6L 4PBWD 4U1MA 1T21B 4XCYA 1MCJA 2DM2A 5FXCH 5KSBF 2I5YL 4F3FA 3O0RL 2J12B 3VXPB 4L3ED 5FF6B 4G6KH 3F5WA 5DHVA 1M05B 5HI3C 3OJDB 4Q6IA 4FZEL 1OW0C 2Q8AH 4U7MA 1UXSA 3ARBA 1F4XL 1GH7A 3MTRA 4ELMF 4M00A 3QUMA 4R96B 2AV1B 3HPLB 2B5IC 5MEND 5T1LD 1DLHB 3S3PA 1HXYB 1FZKA 4UQ2B 2ARWA 5B8CA 4CMHC 3P11L 4K3EH 4D8PB 1YEFH 3B9AA 1MLCA 2GJ6A 3OSKA 3VD4A 3DURA 4X7EC 1B6UA 1YQ2A 1YJDH 5IW1B 2BSSB 1WT5A 3CCHA 5E2TL 4JDVB 3G6JF 2Z8SA 1F3DH 5L2JB 1AQDB 2EO1A 3RHWF 4M3JA 4ELKA 3EIFA 1MCPH 4Q6IC 4RZCB 5IMMB 1JN6B 1ETZA 2E9IA 5EO1A 3THML 5IHUL 4X9IA 1WBYA 1LDPH 1NLDH 3I75B 4FQCL 5L0QB 1XF1A 4P46D 2AI0L 1OSZA 5T5FH 3E2HB 1X6LA 2EDKA 5TF1L 2PYFB 2ZWLT 1BF2A 4FRWA 4RA3A 4S0SD 5DK0A 5H37H 3QA3A 5HGGS 5EOQH 5INCB 3NFSL 4LLYA 1WT5C 3EYSH 1I9RL 1PBYA 3MZTA 4YHML 3KPPB 5F7NC 3T0WA 3V6ZB 3O2WL 2A0LC 3RQ3A 3WUWB 1D6EB 2A74B 5I74C 1KTLA 1MEXH 4FNLH 3TH3T 4NQED 4RGMC 4IEFB 4D9LH 1D5MA 1M7XA 3KG5A 5TFSH 4O2CB 1ZSDA 4JN2A 4PRHB 4UU9A 4DZBA 1QQDB 3I6GB 1Q38A 2BP3A 2I9LB 4Z7NF 4W70A 1HQ4B 1KC5L 4F7TB 2AXHA 4YHYC 5IF0A 4DWHA 2XZAH 3GSXA 3O3DB 2DQDH 3JWDH 1RUMH 5JHDD 1P6FA 1D7FA 2BFVH 2OZ4H 3EYQD 4KZDH 4X6CA 1I7RA 4MSWB 2CGRH 2W9EL 4A6YL 3RY6C 5CCKH 5CGMA 3RNKB 3ZDXE 3MRCA 4OIAA 4TRPH 1JRHH 5D7JA 4WW1B 5EOCL 1RIVH 5L9DL 4S0TD 4CJ1A 3QRFM 3FQTB 4NO5B 1RSFA 3MV7E 2HKHH 5BRZA 3WFDL 3O3EA 5C6WH 2CR6A 4OFYD 1YY9C 2VXQL 1DN0A 4Y7MA 3VG0H 3ZHDA 1TQCC 4P57A 1WZMA 3MCLL 5DO2D 3FOLB 3F8UB 3LQMA 1KBGL 5FYKL 4YEEA 4JLRB 1MRFL 4OCWH 3OAUL 1RJYA 1BZ7B 1PLGH 1KTDA 2EIBA 2QQLL 1XIWD 3WUWG 3NCBB 3NABH 1T3FA 3RVUC 2EIZB 4G6JH 2KDGA 1MNUH 1CDBA 2QSTA 1LO0H 3QQ9C 4XRCB 4WUKL 2OXHA 4M6NL 4DVRH 5D7JC 2V5RA 2AABL 2BVOA 2UYLA 2P8PB 1RZFL 2R0WH 2VDQH 2DJUA 4OF5A 2NXZC 4Z7VF 4GG6B 3VFTA 3CZFA 25C8L 3RWCB 4L9LB 1GZQA 3EO0A 4YBLB 5F3BA 4TUKL 2E6QA 4TUOB 2Q87A 2VITB 1UCBL 5F6HJ 1EEQA 1RULH 4OV5A 2WBJD 3FT2B 5BQ7A 5E8NB 4IIQA 3GSOB 3QUKB 3MA9H 4QKXB 1PGRB 43CAA 3PXHA 4M43L 4Z76A 3CMOL 3P4NA 3VMPA 1H0DA 1S7VB 5ICZA 3A0OA 2P45B 4QRTA 4NKDA 3BGFC 4LKCA 5AWNH 5GGQH 1UZ6E 2APBA 4MQ7A 4PJXE 5HYJE 1LDSA 4FHBD 5C0EA 5I71B 1G1CA 1FYTB 2VABA 4PRPB 1AGCA 1T1WB 4QF1A 2HJLA 3HTLX 5C9KA 4TTGA 3KYKH 2HYMA 3DV6B 4UDTA 4MQXD 4FQQB 3MNZA 4YDKH 3QH3B 3GMQB 2ADIA 1N5YL 4OKDA 1V7ML 1H3VA 2LQRA 1TCRA 4X99B 1OTSD 2OTUB 4L29B 2E7LC 2J8UA 2AEPH 1WZLA 1G6RH 1NGWB 3ELAT 4YUEL 1FIGH 3GI8H 1KJ2B 1J8KA 2VLRB 3IJHA 4IIQC 3EJZC 2R0KH 3B9KB 4HS3A 4HIIB 3OXRB 4BFIA 3GSRB 4GQ9L 1C5BH 2LU7A 3HI6H 3BH9B 3NAAH 5C8JA 3MRLB 5FCUH 1ZA6B 4OQTL 3S36H 3LY6A 1VPOL 4RIRA 1CDYA 3O0RH 3EYFB 4CBPA 3QIUC 2ATKB 5D1XD 4TULH 4M9PA 1N4XL 5E2WL 3S6CA 1S7UA 1FL3A 4K3GA 3MO1B 3BIAX 3S88L 3AUVA 3LQAC 4BSVA 5FYJD 3L5HA 4OM1L 5AUMB 4Z78B 5D6DA 1P4BL 2HWZL 1YQVH 5CJOL 5JW3H 1G7QA 4PJIB 1Z3GH 1EBPA 4PLKD 3F6IA 2MKLC 4LSPL 3UYRL 5AAWA 4PLOB 2GUOA 2X44D 1RFDH 4EIGB 3DVNA 1RPQA 2ICES 2NY3C 4KUZH 4L4JA 4JRWA 3V6OE 5JLZA 4IOIB 3B43A 3D3VE 3E3QE 3V0AC 4NM8L 1CLZL 3ZE1E 1NC4B 2B0SL 4M5ZL 1UB6B 5IIEB 3BPNB 1RQ5A 5E0QA 3O4LA 3RIAF 2WWKO 1NGYA 1TTFA 3WL9A 1EEYA 2ZNXA 1K4CB 2VL5A 2IQAA 3G08B 2DLFL 5IHUH 4JJHA 3NZHL 3KDMB 4YHLH 1XGQB 5ITBH 1FZJA 1G9NH 4NC1E 4PJ7B 4WUUD 4LSRL 3MJ9L 1U95A 2Z4QB 2VSCA 5H35A 1MFCH 3V4UL 3ROOA 5CKAA 1QVOB 2Z92A 4JHWL 3EYOB 1EVTC 3DETD 2CLZB 1YNLH 1JHKL 1UADC 3HMXH 3VXRD 1P2CA 5L6YL 2XWBA 3FKUS 1AFVH 3RVVC 2P5EA 3VJ6B 3RKDD 4NQSB 1VACB 3BZEA 3VA6A 1DSFH 3P0VH 3DI3B 2YPLB 3HCVB 4PYHA 3HR5B 4XNZC 2H2PD 3MREA 3VXSB 2EXWC 2V2TB 3DXAD 5EZOH 3GJFB 4LCWA 4PJDA 4RAVB 3TN0A 1VFMA 5ACMA 1IGJB 4YDLB 3PV6A 2W65B 32C2A 3S96A 4L8SB 4L1HA 2ENYA 2ZZUT 4RGND 4PGEA 3S37H 1E4KA 3MRRA 4IRZH 4QRQA 3QEQD 1HYRC 3CDFA 3HC3L 5IEKA 2ITCB 5C6TH 5GGVY 5KSUA 3TT3L 5CBAA 3TPKA 3FO0L 3KPMA 4IDJH 4HDIA 3VWKA 1LEIB 4LBEA 4LNRA 3U7YL 3MOBL 4ZUVA 4DZ8A 3ULSA 2WUBL 4JM2A 5IQ9B 3DUUB 1RK0B 2BSTB 2NY5H 1BPVA 1AD9A 1A4KB 2HFTA 2Z35B 4JFFB 4LPYA 5D2LB 2HRPH 4UT9L 4JRYB 2W9EH 3QDMB 5E9DA 5IHZB 4YAQA 3L7EB 4TN9A 1ED3B 4M48L 5IB2B 1MY7A 4NN6C 4OZFH 5I1EH 4M93B 3K2UL 3TN0C 5EOCH 4JGJA 2IQ9H 5L9DH 5DHXB 1A1MA 1OOAA 1JZ3A 1JNNL 5H2BA 2ORBL 2AEQH 4HJGA 3WFDH 5KN5A 1EA9C 2A6JB 1E4KC 5B4MC 4YHIA 4G7YH 5K9OB 2ZSWA 5SX5K 3MCLH 4LEOA 1TVHB 4X4XA 4GT7A 1MRFH 4YR6A 4HWEL 1JMZA 2R2BA 4RFNC 5A40E 2EDHA 4Z7UB 3MBXL 3HNSH 3DMMD 5J89A 1HHJA 2GJJA 2HRLA 4U1NB 3WFCL 4CGTA 2YSSB 3Q0HA 5L2KE 5DQJB 5D1QB 1R5VB 2X7LB 1K6QL 4K71B 4M6NH 3IYLW 3JBG7 3DIFA 1RZFH 1OVZA 4C83B 4CRPA 1FN4A 1DN2A 3V5KB 4KXZI 1TJHL 25C8H 5EO0A 2ZKHH 3DSFH 1N6QL 4XPAH 3QXUA 1N5AB 1L9NA 2WP3O 4D3CL 4KJPD 3T0BA 1U8MB 3BP4A 1MI5A 1YEJL 1VFUA 1IGCH 3HS0A 4HUXA 3IU3A 2WWKT 4GMSL 3H0TB 3MJ8A 1JUFB 1YEHL 3JTTA 3KPOB 2AAVA 3SBWA 1SYSB 1UH2A 2W0LA 1UWEL 4HXBL 2FD6L 4WWKD 2XN9E 3H3PL 4ZNCD 1CFVH 2VDMH 1JE6A 2HT4D 4NKQB 5GIRB 3C09C 1NLBL 4E5XA 1FVDA 5CLTA 1YC7A 3GMNA 3SN6N 2UZXB 1VGEH 5CD3A 3GMLB 2J3SA 2MPAH 3VFVA 3BKYL 5GS2D 3VXTB 1QFUL 2F54A 1DFBL 4MJ2A 2H41A 1IILE 5BW7A 4HGWB 3GBNL 5ITFA 4L8CB 3V4VL 3PHOB 5E56A 4HBCL 4YZFF 3U4AA 3PNWA 3RTQD 2FSEB 4ZO7A 1FVEB 4TSCH 3IKCB 3QJHB 4GBXD 4KJWD 4X7TA 3C6LA 1WFTA 5BS0B 2VDLL 3TYFB 1UJ3A 1MJJA 4GQ9H 1WZKA 3VGHA 5TQ2L 3SBWC 5C7XL 4UQ3B 1AI1L 3K4ZA 5HXMA 1CE1H 4JREB 5ISZD 3QQNA 3C5SA 1KJ2L 4ONFL 1MRCL 2R1WA 1I4FB 1K9TA 1K3ZA 2DL2A 2BRRH 4KQ3L 5GZOD 3CD4A 1G84A 2VN7A 1JGLL 3PP3H 4GXUN 4XXDB 1KN2L 5E2WH 5DK2A 5E4EC 1BBDH 5BW7C 2OJEB 4JM4H 4UTAH 3IF1B 4F7CB 4EKXA 3Q6GH 3VXMA 3S88H 2DQIL 2HWZH 2EDDA 4CAGA 3WKNA 2EIDA 1VEPA 4GRLC 2JB5L 1HWHB 5JOPE 1ZHNA 1CDCA 4EIZC 3QDJD 3C6LC 2PW2A 1BQHB 1YDPA 2R69L 1UJ3C 5I1HL 1O0VA 1KEGL 4NT6A 5E5MB 5AZ2L 1QNZL 3WJLA 1IGYB 2FX7L 5FYLD 4X9HA 4EXPX 5DQ9B 4NM8H 5JDSB 2B0SH 4I48B 2I26N 1WWBX 1CK0L 4ZYKA 2VLMD 2NY6B 3MFGB 2R15A 2DD8H 1NSNH 1OAKH 2EDNA 4RA0C 5FUZH 1NDGB 5TE7H 5IJVA 1TETH 1CDJA 5CMAA 5C0JA 1FG2A 4IM8A 5JW5A 1TVDA 2YUZA 1CF8L 3ZO0A 1I7ZA 5HPMA 3LRGA 4LSRH 3MJ9H 1SJVA 1HKLL 2G75B 3GSNB 1MELA 3UYOD 2WBWB 3NIDF 4X4YB 2JLLA 5GRJL 3V5DB 1D6VL 5L8LB 2FH8A 1FZOB 4HWZA 4DK3A 5DGRA 4PRHE 5F7DA 2H3NB 3WJLC 1WFUA 4XP9H 3WNMA 1X4XA 4XC1H 3EBAA 4GKZA 3VWJC 4YQXL 5C07D 4XHQA 4U1JA 2WP3T 3BYTA 4HIHA 1WBZB 2GK0B 3BHBA 2PUQT 3CFEA 4RMTA 4XBGB 3C6SB 4EUPH 4FFYH 3E6FA 4P5TB 3RVXC 3CZJA 3QULB 1OL0A 4TQEL 2D7TL 5J12C 5IVXF 2R29L 3SHSA 6CGTA 3STZB 5KS9A 1YEEL 4L3CB 1J1PL 2BX5A 4NQDD 4YHNB 5DMKB 1ZHKB 4QRRB 5T3XE 4U6VL 4QT5B 4QGYA 1BQHG 3CLFL 1RUAL 5DVLA 1YEIL 2ESVD 2HT2D 4JFOA 2N4IA 4W4NA 5M95B 3IDJA 2FL5B 4M6OH 2E9WA 5BO1L 3DUHA 5CIPA 4K23H 4PRIA 4ZS7L 3TT3H 4RDQF 4DJMA 4FXGB 3V0VA 3SDDD 4HUMB 4KROD 4EN3A 2WUBH 1CFTB 1NANH 1GC1L 4Y2DB 3GFUA 5I9QC 2JELL 3QDGB 4AL8H 5LAXA 1VESA 4U6YA 3DX7A 1UC6A 5MEPB 4IHOA 2EXYD 5ID1B 3QB7C 4ZPVB 2C5DC 3R0NA 1D9KD 3RFZC 5KVEL 1FVCA 4CUCA 3BOVA 4J4PD 3IRPX 5CEYB 5DUML 1G7HA 4TUJB 5IMKA 3MOQA 4B50A 4GG6E 3QPQC 4R0LB 4WI5A 3CSGA 2VZVA 2VXSH 3OKEB 4FTVA 1S9YA 3M8OH 4EN3C 4HKZA 1K8IA 5T3ZH 2D9QB 3ZDYE 1F6AB 4S11A 2DJSA 4G8IB 2NW3B 1WC7B 2G9HB 3FO9B 4ZD3L 1P1ZA 3SOBL 4P4KB 3IDNA 1HHKA 2J8UF 2C7UA 3MACL 1JPGA 2Y06L 5MENA 1U8JB 1EUUA 2DIBA 1UXWB 4TVPH 2CK2A 3ZKMC 1D5IL 3QT2A 1RZGA 1A9EA 1CLOL 3G6AB 4RISL 3W11C 2F8OA 4PRPE 4WJ5B 1N6QH 2XPGA 5E4IA 5DJDA 2AK4B 2CDFA 1TMCB 5GHWL 3J7HA 4P4RB 5EFIA 3RJQB 2DM7A 5EBLB 1KXTB 1LNUA 5IBTH 1ADQL 3DX9B 5I76B 1U8OB 2VSDA 1F11A 1XR9B 5CGYD 3FO1B 2VLRE 1DQQB 1TZIA 1UWEH 4WHTA 5D5MB 4R97C 3T4YA 1IQWL 2WZPD 4P46A 4DVBB 1JYWA 4LMQE 3BRGC 3MGOB 4G9DA 5BOPA 4NQUA 1DEDA 4CMHB 1PG7X 3BKYH 4K07A 3DGGA 3OKKB 1CFQB 1KJ3H 1FNAA 4X9BA 4QEGA 1W0YT 5EU4A 5HYQB 3R8BB 2QL1A 4MXVF 4G3YH 3BKJH 4E0RB 1WWWX 5I73C 1EHLL 1MFNA 5DHVB 4PJHA 2AJXL 4R4FL 1VENA 1D3CA 4NQEA 4PJIE 1CLYL 5DI8B 2VQTA 4YDVA 4CVXA 1AI1H 1ODAA 3OHXB 1MF2H 3AAZA 1ACYL 1ZT4A 2AV7B 1DUYB 3ULVL 5KANG 4P46C 1MRCH 3PJSA 1WTLA 4PJCF 1DE4B 3UTPE 5SWZA 3QNXB 5FUCC 3RAJL 4U1HA 2F5BL 2AS5M 1JGLH 3KHQA 5E5UB 3T3MF 3TO2B 3UTOA 3GHBH 5LXGH 4RMSA 1INQB 5CS7A 5DWUL 5HGBA 4JJ5B 1PY9A 3Q5OA 3ARDB 5C0AB 3MJ7B 4HIEB 4PJ7E 4F7PB 2R69H 3L5XH 3RA7H 1I3RB 1WBYB 3VFNA 4J23A 4X80L 1HEZB 3DECA 4NO0B 3S9DB 2FX7H 5JO5B 4NHUB 1QFWI 5I75C 3TCLA 4KU1A 3MZGB 2YN3A 4X5XB 5I0DA 2YUWA 1I1AB 2H6PB 1RZIA 1YNTB 3W2DL 1MUJB 1MWAH 4PIRF 1IEHA 2FZ3A 2YPLE 2GFBA 5C9JA 1KNOA 4JM2F 5HGAA 3EYQC 2VUOA 3VXSE 4X9GA 2BNUA 3TH2T 4RRPA 4BZ2H 1HKLH 4PRDA 2W0FA 4KRPD 4JO4L 1S9XB 3MFFA 4LGPB 3ORJA 2X1XR 1KTLB 3C2AL 5GRJH 4BKLB 1BVKB 1T6WA 4MNQB 3E0GA 4KRMB 1E6OL 2CIIA 5J7CC 1IQDA 5DRZB 3ILPA 5CINH 1BAFH 4F7EB 3WE6A 2WMPA 2IJ0C 1TQCB 1K2DA 3U46A 5CEZH 5EUKB 1TIUA 3LN5B 4M8QA 4WGWB 1MCOL 4JFFE 5DO2C 5D2LE 4DUXA 2D7TH 4JRYE 1NANI 3NFNA 2R4RH 3QDME 3QP3A 1YEEH 4NO2A 1J1PH 1RUPH 3O6KH 2W9DH 1FAIH 1XIWC 3PP4L 1IC1A 5ESVA 5I30H 2R1XB 5DYOA 3MXVL 3D85D 1T0MA 4LKXB 1DVFD 4PV9B 5JA8B 1MIEL 1MAKA 2E6JA 3MRQA 1P84K 5D6CA 5DTFA 5D7JB 5GJSH 3GMRB 2EDFA 3W9EB 3PGCB 5ICYB 3TBVB 1MFBL 1URLA 2PTVA 1ONQB 4M7KL 4JHAH 1JZ7A 1GPOH 1AR2A 4F57H 1EH9A 1Y6KR 5HYSB 3BRFA 4MVBD 1MQ8A 4Z7UE 4HWNA 5FIEA 3MNVB 3KS0J 5T5NF 5KOMC 2WBJC 3HC4L 1GHFH 1JWMB 4OLUL 1RJYB 1ND0A 1KGCE 1RU9L 1A1OB 2E7MA 3MV7D 3SKOA 3QWQB 5IHLB 2FR4B 5ACLA 2YS4A 2P47B 4MAUL 5C3LD 4YFLI 1AP2A 5F1IB 1G7IA 1X7QB 3BGFB 2V17L 4M5YL 2E7CA 4HFWA 3IU4H 5FKAB 4OCRL 4KHXL 3U6RA 4ZQKB 1A3LH 4KV5E 1X5ZA 3S35L 1GOFA 2FYYB 4R26H 4MQXC 5D1XA 5KW9L 2OM5A 4BJLA 4PJFF 4FS0A 1MJ8L 1JPST 4BH8A 4XNUH 4F58H 3C60D 1XGTB 3SOBH 4DQOL 2COQA 1OTSC 2FIRT 3VGBA 5J9PA 2EDWA 5JIPA 5DC4B 1PZ5B 2QQKL 4IIQB 1A9BA 1MCNA 2QV2A 2Y06H 2ED9A 1U8LA 1BVLB 3FT4B 1D5IH 1ZVHA 1H0DB 1QRNB 4C4KT 1HSBA 5ICZB 4AIZB 4UI2A 3T0VA 3MYJB 3VMNA 4N9GB 1BWWA 2GAZB 3KLHD 3G5VB 1Q9KB 1SY6H 2IC2A 1R24B 2VABB 3QIUB 1HH9A 1IVLA 4X9FA 2VAAB 3W0WB 3IETA 3WEXA 5HYSG 1ADQH 3LPGA 2ZOKA 5J1SC 5D1XC 3AU1A 4YDJB 2A9NL 2Q76B 3D39A 1NUGA 5EUOA 4CKVX 5BS0E 3ULVE 2DQJL 1A6AA 4WUUA 3K81A 3QHTC 5DRNA 2EDEA 3B3IA 3FRPA 3RBSA 4LSQH 1TCMA 4PLKC 3U4BH 1IZKA 1HI6B 2O5YL 4YX2H 3DBXB 2AQ1A 2EEBA 2NY3B 4XPBH 1QFHA 4J3TA 3KXFB 5I1JH 1OTTD 1LO2H 5D2NA 5C8JB 3VXRA 2Z31A 5EWIL 3U7WL 3WKMH 2ZUSA 3GSVA 5I1GL 1F8TL 4JZNB 4NZUL 4LPWA 1U8PA 4BQCA 2DI8A 1KT2B 3LCYA 3OKMA 4ODXA 2VLLA 2NTFB 3D9AL 2AJXH 4FXKB 3DXAA 3RGHA 3RWGA 4XP6H 1T6VN 1INDH 1W0VA 1OP5K 4ONGL 3PGFH 2YPVH 4QOKA 2KZ1B 3QWOB 3AGVA 4MS8D 5DHYB 5SV3A 3QISA 3QEQA 3V4PL 1CLCA 2XZCL 4Q97A 4LL9A 3RAJH 4BM7A 2PR4H 3DETC 3G04B 5D2NC 4JDTL 4XMKL 5TJWK 3KVQA 2NXYD 3STBA 3IRZA 5DT1H 2F58L 3RKDC 1CGWA 5DJZB 3IJSA 4JPWL 3KJ6H 3SGDI 1ZAGA 5CEXB 4PTTB 1XCTB 2Q7YA 3IDIA 1EEYB 1WZ1L 4QHMB 2H2PC 4H8WH 3O4OC 5J6GA 3SE3A 3H9SB 3SDYH 1X5FA 1YYLH 4YLQT 4QRSA 4RGNC 2VWEE 4XVSL 1C5CH 2X4TA 1ZLSH 5HVWA 4OF7A 1I85A 2FBJH 1SEBA 5BZDA 1RZKL 1AKJD 2XKNA 1B0GB 3RWHA 4R4ND 3WNPA 3W2DH 4PJBF 3QFDA 5I1LA 3QXDA 4IRJD 3L3DB 3WXVL 4DGYH 2AJVL 1FGNL 2VAJA 3EO1B 5FV2A 4JKPL 4JY4B 4GXVL 1JNHA 3DMMA 2BVQB 3VFRB 5DVOA 1ZS8A 2Y25A 4QRRE 1P53A 1CTNA 3C2AH 4NN6B 4P3DA 4LCIH 2MHAB 2DQUH 5ANMA 4WI3A 1NGZB 4U6HB 4PGEB 1LE9A 1A7QL 4MMZC 4NN5B 4WU7B 1JPTL 3BEVA 4OBRA 3L3JA 1I85C 2F5AH 5EZIH 3DRQB 3TP4A 3B83A 2P48B 4ZOCA 2ZUQB 1F13A 4Z7QE 4G8GB 3CFKB 3OX8B 4P9HH 3QDGE 4Y5VA 1RZJH 1L0QA 4WEBH 5AZEL 1X5KA 1EV2E 2WW8A 3U36B 1HH6A 5DD5H 3DMMC 3QHZL 3DI2B 3MODL 5FYKD 3RNQB 4HWUA 4FFWD 1ZLVH 3B6SB 3FQNA 5GS3A 3QHFH 1M7IA 2H32H 4M1GH 2EDQA 4OUUB 1OPGH 5DA0B 3IFOB 4YXKL 5FGRA 1A8JH 1P7HL 1MFBH 2DQCH 4LCCA 1ZLWH 5H2BB 3QIWD 4Y16A 1KENL 4QHUA 3ARSA 4BZYA 3FQUA 1EX0A 4PRAB 3VI3F 5CBEA 4GQPH 3SDAD 3IDXL 2C3VB 4LLQB 3TZVB 2PKDA 4AH2A 1CGYA 4KJPC 2HH0L 4OGYL 2DWDB 3RTQA 4JFQA 4O9HL 1S8DA 2CKBH 4ESKA 3TIDA 1AC0A 4GBXA 2IALA 4NYLA 3LHPL 5GSVA 3SPVB 1X44A 2V17H 4LLMB 3MLUH 4WWKC 5D70L 5ISZA 2LFGA 1TJIL 3UCRA 4I9WE 3MRNA 2HT4C 1QYGH 3C09B 3DVIA 1FN4B 1HCFX 3MGAA 2AK4E 4LASH 3SCMA 4LCCC 3TA3D 5KVGH 1QFOA 3SGJA 4WEMB 4J12A 4Y16C 5CFHA 4NKMB 2FECL 2OMBA 2BZDA 5L2KD 3FMGH 3UO1L 3FB5A 4N0YH 4OLEA 4WU5A 2BY0A 3QG6A 2OL3L 3GRWA 3T2PA 3RTQC 3TJEL 3MJ8B 4P2CG 4OBSA 2QQKH 5B22A 4M02A 5DJ6B 3QDJA 5D5ME 4GBXC 2VZTA 4KJWC 4XVUD 4DGVL 2Q20A 4PJHF 1M4KA 4N0UB 1JFQL 1UA6H 3BGMA 1T83A 2CXKA 4V1DD 1NC2D 4OLWL 3RWJB 4PJ5D 4OFKA 1HQRA 2E8YA 2ICCA 3MQIA 4BH7B 4I18A 3GMNB 1NJ9B 3SGJC 5TF0A 2JCCB 5GZOC 5IQ7L 2F53D 2CK0H 3B2VL 4MAYD 4I3RH 2V9RA 1U36A 2V2XA 5E4EB 1BOGA 3OV6A 4GKNB 2BNRB 4HK0A 3RY5A 1BZQK 2XN9D 3FFCB 4M7JL 3ZL4L 3NCMA 2HFEB 3MBED 1DBKL 4JFPB 2DQJH 4C59B 3SJVB 5HGHB 4GRLB 3CAFA 4YHPB 1F42A 3C6LB 4Y1AD 4PJAA 4MNHA 2PCPB 4CU6A 1IC5H 1T83C 2AK1L 4X6BB 3U7WH 1M7DB 5HDQL 2R1WB 5I1GH 1G7LA 1SBBA 3QUZD 5J06A 2C1OA 2J1KA 1OTUD 4GMTH 3RWIB 2N7BA 3FN0L 2JJTC 5CSZB 2E9BA 4JR9H 1T1ZB 3TEUA 1B4JH 5C0AE 2DLHA 3GKZA 4J2XA 3HUJB 4O51B 2NX5B 1J05B 5IOPA 4NP4H 2ESVA 4NJ9L 2BDNH 4MA1C 1U2HA 1LEGA 2XZCH 2HT3D 1TZHB 3QBTB 5E8DH 2PW1B 1JV5A 4KQ4L 3SDDA 5IG7A 3AM8A 3VWJB 2D31B 2V9QA 5JOPD 2CRYA 3OG4B 4N8PA 1V3MA 1BX2A 1F58H 4NWTL 5CMAB 2GCYA 5BZWB 5C0JB 5C92A 5JNYA 1WZ1H 2NLJB 2QADB 5J11C 4H5SA 1T5XA 4IRSB 1BMGA 2OJZH 2G60L 4YHOL 2MJWA 2HFFB 5CJQL 4LHJB 4J4PA 2D2OA 3EZ8A 4NRYA 1AGFB 4MNQE 1FZMB 4XVSH 5GS0L 5KTEL 3FRUA 1Z9OA 2HT2C 1DQDL 1KPRA 3MROA 4WHYG 1KELL 4HWZB 1RZKH 1VEOA 2D0HA 5F7DB 4WCYH 2I07B 3SDDC 3WXVH 4KROC 3AM8C 4RWHA 4KJYA 1NAMA 4JY5L 4W4OA 1G9ML 2P46B 3ROLA 3E6FB 1TDQA 5DJCB 4PRHD 5DEFA 5C09D 5KS9B 3P73B 1X5IA 2EXYC 1R3IH 5KG9A 3MV01 1LEKA 3WHE0 4C56D 3PWLB 1IAII 5D9SB 1D9KC 4YC2B 2DWEA 4J4PC 4ZOAA 1UVQB 3FB7A 3C8KA 4JFOB 4ZODA 2Q3AA 3FQRA 3ZT7A 4Q2ZA 2OBGA 4S1RH 3ZDZF 5MHSD 1XF2A 1IRAY 4OI8A 3QO0A 1U8QB 4PJGA 3EOTL 5TQ0H 5C0FA 3LVEA 3VE0B 5D4QA 4J3XA 1RVFL 4HQQL 4OUOA 4WDIA 5HHME 4W4OC 2OTWB 1CGTA 2DIAA 1IEBB 3OMZA 2CDGB 5F9WC 8FABA 4O2EA 2XXCB 1JZ8A 3HRZA 2B1AL 4LRNL 5T3ZD 4KMTH 5M94B 3C08H 4JY6B 3LQZB 3BKMH 3C5JB 5GSRB 3O8XD 1HHIB 1HIML 4LCYA 5HHOB 2O93L 4XMLH 1UGNA 3PIQB 4J3VA 4ZDHA 5HDBE 4TVPD 4JFDD 3WS3A 2YPKB 4OGYH 3VW3L 1F2QA 4L3EB 2NY2C 2VIRA 3N85L 3FL7A 3L3IB 4OZHA 2VR9A 4ZUSA 3GKWL 4KDTC 4D0DA 1I3UA 1Q72L 4BQ9A 2A9ML 1BBJA 5SWQB 1MFAH 2IEPA 4HZAA 5CGYC 2BVTA 1R3KA 3ZYIA 1OM3L 5EUOF 2Y72A 5BOZG 3S97C 3PWJA 5DRWA 2VH5H 4HKJA 1QRNE 4F15C 4AQOA 5MENB 5T1LB 2GW5A 3L5WA 1GGCH 1H5BA 2XQBL 1UH3A 2AXFA 3W0WE 1XGPA 5F7UA 4GW1B 3UMTA 3FHQA 3LSOB 1FV1A 4JANB 3TJEH 2HA1A 1KV3A 4YK4C 1NMCC 1FYTD 1OGAD 1YJDC 1NFIA 1BD2D 2A77L 5IKCB 3DLQR 5ETUB 5CWSB 4QCIA 2D4FA 3MLWL 5I2IB 2IADA 1YN7A 2GTWA 3HE7B 4YFLF 3VRLF 5L8JB 4K2UH 2R2CA 4ODUA 3S8WA 3E8UL 3KWWA 4B53A 4HFUL 4MJ4A 3T1FA 1H5BC 1Z9SA 1N7ML 1DJSA 3KPSD 5IMOA 5HHPB 1ZK9A 3B9KD 2FX8L 4YXLL 4K9EH 3ZL4H 5IR1B 1OSPH 1IM3A 3RGVD 1KG0A 5K9JL 4OIIH 5EU6B 1J86A 2AXGB 3QQ3B 4NN7B 2DLGA 4TNWF 1NGXA 3VGFA 2EC8A 3DV4B 1KCUL 4XH2A 5EU5A 4N0FA 5C0RL 1XF4A 4MYWB 5C6PB 3AAZB 2AK1H 4LLAA 5CP3H 3CXHK 4LFHD 3LEXB 4EDXA 4OKVA 5I75B 1CDUA 2XKUA 1FLRL 4PGCA 3FN0H 4XNYL 1KLUA 5FHAH 5FK9B 5D71H 3HC0A 1OAQL 1FNGB 2X4PA 3KPLA 5BV7H 5JHDB 2KZWA 1FRGH 2HKFL 1KB5B 1GGBL 3WIHL 3L1OL 3CLEH 3D85A 1DVFA 1L0XA 3UTPD 3H9SE 5LG1A 2RHEA 1A6WL 4KRPC 2JE8A 5FA3A 3BAEH 3KHOA 3O11A 2AJSL 3RX5A 3VFNB 5IT2L 1ZGLB 4MCYB 3BQUA 1U8KB 3AC0A 2QSQA 1DQTA 2VB5A 2E27L 1LO5A 2E3VA 3EFDL 1FFQA 4L8DB 3W9DB 1A14H 3KGRA 2D9CA 3GB7A 4PS4H 4OGXH 5DJAA 4S1SH 4XCNB 2G5BB 2F9BT 3SGEI 4GKSB 3GJEA 3QCUL 3F6LA 4L4TD 4O5LH 4NWTH 5I15H 1ZA3A 5HHVL 3F65A 2FDBP 4HWBH 4Q7DA 4TSAH 3MV7A 5HGDA 2J88H 3UTZB 1XIWB 4AEHL 4ORZC 1P6AB 3O6FA 1Y18B 2WV3A 4OZGF 1Z6JT 4DN4L 1W2KT 3CH8A 1DVFC 5KTEH 3PWNB 1QBMH 1UM5L 5IB5B 4YGVA 4HLZG 1B6DA 5KVMC 4Y5YA 3IXTA 2YPLD 1CD0A 2WWMD 4OB5H 2QSCL 3CPLB 2H45A 1E27A 3VXSD 3TV3H 1NMAH 4POZD 1IM9B 4G8GE 4H0HB 5DJ2A 5F96L 4MVBC 2JJVA 1JPSH 4EQ3A 3N1PC 2WBJB 4MNGB 3IDMA 2A6IA 2BCKB 1CFNA 4HH9B 5J1TC 5DYOB 1R6VA 1O7SA 1JNLH 1HDMB 4JFFD 5DTFB 3L3OB 3NN8B 5IB3A 4MDIA 5DEGB 1H3XA 3KPNB 3QDMD 1RZ7H 5D1ZA 5DC9B 4FQIH 4Y5YC 3MOAL 4O4YL 2DDQL 5DLML 1GIGH 1IGTB 4CNIB 1RVFH 5CLWA 4H1LB 2R39A 4LHUB 1YEGL 3G5YA 1TTGA 1NCNA 2ZUYA 3IB4A 4PJXA 4AK1A 1CT8A 3C60C 1I8MA 1DBBL 4LSUL 1J0ZA 2B1AH 4LRNH 1KEML 2ZOLA 3KPQA 1U93B 4DKEH 1AHWC 1AP2B 4QHNA 1NH6A 1U8IB 2IBGA 2L7UA 4DAGH 1KB9J 2HVJB 5FGSA 3GO1L 2VDOH 3LH2L 3QO1A 5L7XH 1ZHBB 3KLHC 1UCTA 4KPHL 3CDGB 1T0NB 1KGCD 4X98A 1ITBB 3SKUD 4LPCA 5D1QD 4P2YA 4M6MH 1BJ1J 4P5KA 5D1XB 1NQBA 5HSFA 4BH8B 3WIFA 4FQHA 3UTSD 4ZPTA 1EMTL 3EOBA 4L5FH 2NNAA 2PETA 4N0UE 3LMJL 4HKXA 3MNWA 5AG9A 2MCPH 5JQHC 1ZWIA 5ADPL 4PJ8D 3M1BA 1KOAA 1IEAA 4J1UB 2LABA 4PJAF 1OLZA 5T3XH 1OTTC 1BWMA 2CR3A 1BLNA 2JCCE 3LN4B 2FGZA 3WN5A 1QBLL 4QRUB 1TENA 2BNRE 1IGMH 1PG7H 2GIYA 3FFCE 1FFPA 3LS5H 4DW2H 3GSWA 4HCRL 4RAUA 4CN6A 4IMLA 4O02L 1VSCA 3REWB 2G2RA 3V6OA 3TJHD 1F4YL 5T1MB 3SDCB 4QYOA 1BM3L 2C1PB 3L3KA 5DJ0B 1A6AB 4Z0BH 1QA9A 2QEJA 1V05A 3PWUA 1I8KA 2BVPA 3EDDA 5DRNB 4MS8C 1IAMA 4HFUH 5AYUL 1PSKL 1AKJA 3RDTD 4XMPL 3EGSB 1BGXH 5BS0D 3ULVD 3M17B 3TLRA 3VXRB 3HPJB 4EDWL 2FX8H 4IRJA 5EN2A 2O61B 2NXYC 4K3DL 4BFEA 5A16A 1OWWA 5F7EL 3IVKA 5JPMB 4ORGB 1U8PB 3IDUA 1FBIL 2EKSB 5A2FA 2P24A 5LCVL 3HUJE 3ZHKA 2NX5E 1MCKA 3QPXL 5F3HB 1KCUH 1OLLA 3X13B 4NKOA 5I1IH 4JQIH 4Z5RA 3RPIB 3SKMB 2I60H 1MIML 5IBUB 4NCC2 1FL6B 4R4BB 4A6YA 2CUIA 2MQCA 3OKOB 4R7DA 1NBYA 4M6AA 2YD1A 3QCVH 1YY8B 1FGVL 1MRDL 3QEQB 5C2BH 1FLRH 3DNKA 4P2RB 1UYWL 4D0CA 4HK3N 5GRVL 5J3HD 4R4NC 3TBWA 5B38A 4IRJC 2I24N 2WQ8A 4K8RH 5JORA 4NKIH 3R4DA 3X3FL 2HKFH 5E8OB 5CHNA 4R7NA 4KHTH 5EOTB 1U58B 3RU8L 3LIZL 5IB4B 2BJMH 2OI9C 3KNBA 4R8WL 1X5LA 2NY6D 1KB5L 3PHQA 5C08D 5J6GB 4JFHD 3FRPG 2W59A 4BK5A 1EEZA 1PYWB 2DKUA 2E27H 3OF6A 3QIWA 1TJGL 4U0QB 1KCKA 3SDAA 3MA7A 1NDMB 2EH7H 2GY7B 1NFDB 1RAMA 4OGZA 1I1YB 4RAHA 5I18H 3WJJA 1ZANL 4OZ4B 1RIHH 4JO3H 5EBWA 5EORH 2BSRB 1JNHB 1N8ZA 5KS9E 2VXTH 1ZS8B 4NCDA 3BH8A 1GCFA 2FJFA 4FFWC 5IBUG 3OAZK 5C71A 2WUCL 3X14A 4U6TA 3Q3GA 3BWUC 4P5TD 2YKLL 4JFEB 4S1QL 1LO4H 5E99L 1WWAX 1F3DJ 3QI9D 1CD9B 1WWCA 3QIWC 4XAWL 3CVIL 4PFEA 3MMEA 1FORH 1A6PA 1X4YA 5IFHH 2DQHL 3IFPB 5I8KL 4QRRD 3U82B 5L2KA 3SDAC 3ZE0F 1W72B 2AJUL 5DJ8A 2GY5A 2VXUL 1S9WA 4PR5A 1IFHL 1LMKA 1KTKE 2XWJB 4JB9L 3H7BB 5ENWA 5IJKC 2NW2B 4AJ0A 2R2HA 1J5OL 1V5JA 3P4MA 4OZHF 1ORQA 4PBXA 1DL7L 2VDRL 4F7MA 2R56L 5DGQA 4GRWB 5H94B 4NPYA 4B0MM 1P4IH 4WWKB 4ONOA 4V1DA 4Y2DD 2P8LB 3QDGD 5HHOE 1N0XH 3WFEH 3FOMA 2CLRA 2VZUA 3RPKA 1OGTA 4LCCB 4O4YH 3BISA 1KULA 1DQJA 3GSUA 3TA3C 4GW5B 1ZT1B 1U8HA 1YMHB 4AT6A 4MAYA 3FTGA 4OCMC 4OZIF 1XEDA 1HZHH 4L3EE 4OQTA 1CL7I 1J12A 3TNNB 2XN9A 3OB8A 3MBEA 3ZTJG 1CGSL 1OD9A 2IFFL 1GAFH 1T21A 4QY8B 1S8DB 3NGBC 5KVFL 4ODWB 1KCSL 3O3UN 1WF5A 4XVUC 3UAJD 4Y1AA 3VXPA 5FF6A 5I1AB 5MENE 4OCSL 1AGEB 3OJDA 3OR7B 5FHBL 2XIDA 4KPHH 3QUZA 1JJUA 3ZZ1A 4P4KD 3BSZL 3CVHH 4YDIL 3WLBA 2AEWA 4Z7NE 2YRLA 2Z9TA 5E2VL 2AV1A 3HPLA 4MAYC 2XZQH 3B4NA 3BESR 1DLHA 2DIJA 4UQ2A 5HVHC 1EMTH 3QG6B 1DANT 4PGJA 1FO0B 4I9WD 3MBEC 1F6FB 3BDYL 4Q6YA 3GIZL 4D8PA 2Y07L 3PF2A 5I19L 2AK4D 3I9GH 4I3SH 1PZUB 4WW2B 5IW1A 3MXWL 2BSSA 5ADPH 5TH2B 4JDVA 5C0BD 1AQDA 1KF9B 4EXKA 5L2JA 5FUCE 1I9IL 2XRAH 4RZCA 5IMMA 1QBLH 1JN6A 3QUZC 4MJIB 1ITCA 1ZLUK 3MUGB 3I75A 2AJYL 1NUFA 1OTUC 3SKJL 4HCRH 3IFLL 1L9MA 1IT9L 4ZXBB 4Y4KB 1GZPB 5EU6E 2B39A 3NBNA 2PYFA 3CXHJ 1BM3H 1IAOA 3GI9L 4LNVA 3F58L 2YRPA 1QSZA 2NMSA 2F19H 4WI9A 2ZPKH 4HF5H 5INCA 4MA1B 5KVDL 3RI5F 3HI1B 4JG1L 5AYUH 1PSKH 5EZJB 2HT3C 3KPPA 3V6ZA 2JF1A 4QXGL 1D6EA 2A74A 5GISH 4EDWH 4EQ2A 1H8SA 3DYOA 4CVZB 3U1SL 5C07B 3OKLB 2YZ8A 35C8L 4ODVL 1AGBB 3UYPA 4XHJD 5JHDE 5LGHL 5L0QC 4O2CA 3ZDXF 5DZLA 4OFVA 4BSWB 4PRHA 1N0LA 3E2HC 3MRGB 5ALBH 5C09A 1QQDA 1DLFL 2W38A 1NBZB 3I6GA 4V2CB 4NQDB 4HC1H 3HNVH 2I9LA 4HBQA 2ZNWA 1EJOH 1NGQH 1HQ4A 2F74B 1HNFA 4Y8AA 4F7TA 1MFDL 1EVUA 1VADB 4KKNA 3O3DA 2UWEB 4YXHL 3HMWH 4MSWA 1PX3A 3ARDD 5C0AD 3OWEA 1FDLH 3RNKA 3U0WH 4YNYB 2LAGB 2AKRB 5IVNA 4LCUB 4WW1A 1SBSH 1SJHB 2ZG3A 4LMQI 3FQTA 4NO5A 1BX2B 4FZ8L 2GCYB 1TLKA 4AEEA 2JJUA 4XPTH 3I3BA 3FAWA 2EZ0D 1KN4H 4KY1H 4MHHI 1B0RB 2DQTH 1CIDA 3MLZL 4G5ZH 2XY2A 1I1AD 1D9KB 3FOLA 4K3JL 3REVB 3SO3C 1UWGL 1JP5A 2C9AA 4JLRA 4NRYB 5ICXB 4LEXL 3ULUH 4NUGH 1BZ7A 1WITA 5A2IH 1AQKL 4XCCL 5K33A 4UIKL 5TDOB 2EIZA 3RZWA 4D0BB 2ED7A 3FCTB 4X7SL 2I9TB 1U6AL 3PQYB 3PWVA 3GGWB 4KJYB 1Q0XH 3D87B 4MNQD 2P8PA 4DGIH 5L8KB 1QD0A 1DQML