5SWZD

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
198
Chain Sequence
QQQVRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASETSGSWQLIFGSGTTVSVSPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKCANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 198
sequence length 202
chains with identical sequence I, N, S
ec nomenclature
pdb deposition date 2016-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzD02
4M5ZH 1YQ2A 3S36X 2YRLA 1NC2D 5J8OA 2UYLA 1NMAL 1RJYA 2ARJA 5A2IH 2CLRA 4RZCA 1T6WA 3O2WL 3TH3T 2C4FT 1C1EL 3VH8A 4UQ3A 1BAFH 2GKIA 4G6ML 4R3SA 4IDJL 3OKNB 4MZ2A 5DHVA 4BM7A 3IXTB 1VGEH 2W9EH 2UVFA 4Q6YA 5I66A 1VADA 1UEYA 5DUBB 3FQUB 1QBAA 4H88L 4H1LB 2ZCHH 1LO0L 5F6IB 2ZOKA 3BT2L 1T21B 4HCRL 3FRUB 3EYQD 2V5RA 3DYPA 4FP8L 4OJFL 5EO9A 4HS6B 3E2HB 1DE4B 4IOFD 4KXZI 1KIQB 1QBMH 3QA3A 3V5HA 4E5XB 2WUBH 4MHHI 4P4KD 2HJFB 3GO1H 4Z7VB 4MS8C 2DQIL 4PJBA 1XGRB 2D9QB 4NCC2 2E6JA 2W60A 4JY5L 3QH3B 1MCOL 4NRZA 5C0IA 3GEWB 5TQ0L 4HF5L 3IDJB 3HB3D 2AI0H 5KBNC 32C2B 3KWWA 2Z92B 2IFFH 4O2EA 3CZFB 3MBEC 4QRTA 3SE8L 4AL8L 5K9KB 4LEOA 4M93C 2AEPL 5HHQB 3MFGB 4I3RH 4J8RA 1S7UA 2PETA 3ECBB 5BOZG 1RUQL 1GCFA 1JUFA 1KCLA 3X11A 1BQHB 1EJ6A 5DVNA 5EO0A 2F8XC 2DQUL 3FKUS 4AEHL 4OAWB 4X4YA 1W0WB 3EJYD 2W65B 1XZ0B 4WNQB 2YXMA 3EO9L 1OGAA 1NGXB 3RVUD 3VXMB 4PY8J 1WTLA 1SJEA 1DUZB 2P5WE 1X5IA 1G7LB 1KIPA 4JR9H 1DVFA 2QKIB 4YHOH 1PG7L 4XXDA 2FNBA 4XRCA 4CJ1A 3P9MB 3VXSA 5IESL 1WFOA 4P9ML 3IU3A 4M4RA 1RK0A 3C6LB 3KPLA 4AMKH 4RGOH 5J7CC 3E0GA 3X12B 1QHPA 4I77H 1GGTA 3FOLA 2ZNXA 1V3JA 1T89C 1OAYL 1H5BC 3RA7H 3I2CL 1N8ZA 3IDMB 3OWEA 4LDOB 3NZ8A 1MPAH 3WIHH 4KRMB 2EDOA 3F7QA 4JRWA 3LVEA 5D1XB 2NY0D 3NFPA 2EZ0D 3S4SA 4JM2A 1F4YL 4HJGB 3HAEA 5HDQH 4WV1B 4S1DD 3MRHB 2D7QA 3OAYH 5HGDB 2D7PA 5EC1B 1CL7L 2QQNL 3MJ7A 4JANA 5BXFB 5FGSA 3FO2B 2J4WL 4YO0B 2FR4B 1JNHA 3BN9D 5D7LE 4HPOH 1DP0A 5HDBF 2VLRE 4CW1A 1RUAH 3MLTA 4JRXA 1RZ8A 3L6FB 3BD5A 1PEWA 4ODWA 4M1DL 4XCFL 2CPCA 1UZ6F 4PGEB 4G6JH 3RL2B 2NTSP 4W81A 2MQ3A 4OCXL 5JDSA 1YEFH 4QXUH 5TQ2L 3U6RA 5F96H 3V7MA 1N5YH 4X83A 1A6VH 4PJIE 3M07A 1ZLVH 3W2DL 5BS0B 4XAWH 1NGPH 3F5WB 3GM0A 3TO4B 1DEEB 4JRYD 4LSRL 4YGVA 2OLDA 2G5BA 3QXAA 2BVUA 2ZCKH 3E8UH 3LKPA 1H8SA 2HKFL 2VO5A 4JO2H 4MQXD 1RIUH 2C1PB 1WQVT 5I1KL 1IQWL 3IFPB 2WLYA 7FABL 3PDOA 1FHGA 2MTPA 4JHWH 1JPST 1FCGA 1I1YA 4OZFH 3O3AA 5CILH 1Z9LA 3D3VB 4Y2DB 5AYUL 4AYFA 3BP6A 1Q9KB 5MI0B 3DUHA 3CLEL 2AEQH 2A6IA 4GKZA 5D2NB 3KPMA 5IGXL 1R5WA 5L0QB 4P2OB 4JDZA 5I6XB 3IKKA 1P4LA 3S9DB 1BD2A 1F58H 4M6ML 4Z5RB 1GOFA 4LHJB 3CX5J 4OZHF 1HSBB 5IMKA 4L1HA 3OSKA 3OR7A 4OKVB 4FTVB 3MREB 5C8JA 3BW9A 1T1WB 4N8VG 4M7ZB 2N4IA 1A7NH 5D2LF 1NUDA 4UB0H 4GG6A 2AK4A 2B4CL 5EUOB 3QG6A 1MIMH 3EAKA 5AAMA 3QHFL 2V7NB 4QHNA 1MHEB 4K8RH 4UDUA 4NO3A 2NY2B 3LN5B 1JK8B 1OB1B 3DWTA 5K9OB 5GGSB 1NMAH 3QUZB 2GFBB 1KNOB 4D9LL 5IK3A 4R90L 3O2WH 1T66D 4RMWA 1O0VA 1C1EH 1MWAA 4LCYA 4WFED 2LQRA 2Y6SD 3UDWA 3DIFB 3ARXA 4G6MH 4IDJH 4XPAL 3F7YA 4ZQKB 4YUEL 4N0YL 3DX6B 5F9WB 1KJ3L 2GTZA 3PIQB 1XGUB 4H88H 2Q87A 3NN8A 1VFOA 1F6FB 4K7PX 2XV6B 3BT2H 5KTEL 4HCRH 1N2RA 1LDPL 4FP8H 1P7HL 1NANI 4OJFH 5TPWL 4QOKA 5E6IC 2X1WL 5C08E 4JN2B 1U8JA 4WO4A 4X7TB 4RMTA 4Y16C 2VJXA 1T1XA 2DQIH 1T0NA 3ZHKA 1IAII 1QSEA 4O51B 4JY5H 1S8DA 3FO9B 1MCOH 3KYOA 5TDPA 1HHIB 5TQ0H 3IXAA 4HF5H 1Z2KA 4EVNB 4WW2F 3S88L 5CJXA 4KI1A 1KV3A 4RX4D 2Q6WB 3GMLB 1FG2B 3SE8H 1CTOA 4AL8H 3BWAB 5ECJE 4UUJB 4D9QE 5I76A 4HZAA 2AEPH 3CZJA 3VMNA 5JQHC 2KQMA 3ZTJH 1RUQH 5IV2B 3KYAA 1GGIL 1VEMA 2DQUH 4O2CA 5ID1A 1ADQA 4AEHH 1KTDA 3U46B 4XCEB 1I9JL 2L4OA 5I1DB 1FZOA 3WIFA 4QHLB 3EO9H 4HX1B 1KLGB 4K7PL 5DVLA 4L4TD 3BZ4B 3M8OL 5HVFB 2GY7B 3OKLB 3JZ7A 2DLHA 2J2ZA 2W92A 3SDAD 2R2CA 1LO5A 4TQEL 5KANG 4EZMA 3MX0A 1AIFA 3LRGA 1HNFA 1JWUA 2DLTA 1PG7H 2BXYA 4PJ8B 5IESH 1IM3B 5J3HC 4QY8A 4P9MH 5BZWA 3GMMB 3GSWB 2X4UB 2XTJD 3L5XL 3DO7B 4P2RD 4OIAA 1ZWIB 3CC5A 4XWGL 3ULVL 1KJ2L 4IRSB 4ZTPL 1AGFA 1EJOL 1UADC 3I2CH 3LOWA 4KJYA 2XPGA 1VFMA 3JUZA 1G0XA 3CK0L 1JPTL 5DK2A 1CE1L 1REIA 3FO1A 1FNSL 3QO0A 3ULUL 5E1AA 4M61B 4ZFGL 5I0DA 1QFOA 3WUWG 1QOKA 5IFJA 1F4YH 4HIJB 2EXWC 5BO1L 2HLAB 2GT9B 2GTWB 3OPZL 4NQVB 2FL5B 1INDL 2BSSB 4BSWB 1FZKA 1BGXL 4BFIB 2AXFB 3HC0B 4TTDC 1CL7H 2QQNH 5ANMA 2IQ9L 2J4WH 1BF2A 2BVEA 5E00B 1QTYT 2YHGA 1KF9B 1RD6A 2X1OA 3QEQA 4GBXC 4OQTL 3MRIA 5C6WH 4M1DH 1C16A 2NXZB 1NANH 4XCFH 2VDOL 3AREB 5I16A 2Z4QA 3FB5A 4LLMB 3GJFA 3ILPA 3RZCD 1CE6B 5KZCD 3G5YB 1WBXB 4OCXH 1GPOL 2NZ9C 5TQ2H 4AEIL 4CRPA 2FX9L 3FFCA 1JGEB 3W2DH 4PTTB 2XFXB 1EGJL 1WWCA 4U6VL 4J3XA 4OFDA 3PXHA 1C08B 2JB6B 3WDIA 1I4FB 2FATL 4LSRH 4C54A 1ZHBB 3VXUE 4EDXB 1F6AB 2HKFH 1Z3GL 1FC1A 5KAQG 1X6LA 3D0VA 4FFWD 1Q9LA 3GKWL 5I1KH 1IQWH 4BQ9A 1EEQA 1XAUA 7FABH 1FC2D 3UTPD 1QFPA 2ZNWA 3U48A 1JWSB 1RMFL 2F9BT 4IOIB 5AYUH 3CLFL 3DUSB 5IEKB 1XCTB 5KG9B 3MXVL 3CLEH 1ITCA 4AQOA 1BF8A 4P4KA 3FO0L 4QRPB 4OCMC 1KPUB 5IGXH 2ZSWB 5JIPA 1I7RA 2VWEC 4HAGA 1HI6B 4NQDD 3STBA 3CFCL 1P7KA 3L7FB 4RAUA 5T1LB 3C8KB 1T3FA 4QRSB 4M6MH 1GGCL 3HE6D 2ZUXA 1ZA6B 3HS0A 2BC4B 4OF6A 1JV5B 4PBVC 3UYPA 4Y4FC 4BQBA 2VE6B 4ZUUB 2F53E 3UJIL 3HG1B 4LDEB 5F72S 5J12B 1R3KB 2B4CH 3QUMB 2GJZA 3WNOA 3QHFH 5DJ2B 4JKKA 4J23A 3W9EB 5EH1A 2NNAB 3GB7B 5D72L 3NIDF 4UT6L 5I1CL 4QRQB 2QR0A 3M1BA 5HYJE 5SX5H 4HUVB 3CPLB 4D9LH 1I8MB 4R90H 1MCQA 1L7IL 3MRMB 4XPAH 3S5LB 4YUEH 3ZHDA 2BOCB 1AXSA 1HINL 5HDBE 1KJ3H 2F54A 3HRPA 5JHLL 1NLBL 3TZVB 5KTEH 1OD7A 1L6XA 1MI5E 1SJHB 4J3UA 4MJ6A 3GK8L 1LDPH 1UZ6E 2P7TB 3FOMA 3GSQB 4HKJB 4X4XB 4BYHA 5TPWH 3MRKA 5J4MA 2I26N 2R0KL 1PZ5A 1RURL 3UYRL 4MLIA 4QF1A 3ROOA 4LVOC 1FVDA 4LRIA 3R0NA 1EEYB 4XZUB 5D7IA 3NA9L 2NY4C 4GS7B 4NNXA 1I85C 4WFFE 1EO7A 3FRPG 5KSAC 3S88H 3RWGB 5I19L 4NBXB 4PP2A 1KTLA 2GHWB 4V2BA 4CU7A 1MH5B 3RRQA 4KROD 1GZQA 4Z7OF 1GGIH 2HP4A 4Z7VF 3SDCC 1S9XB 3LQAC 2P8MB 1I9JH 1KC5L 4L3EE 2EIZB 4I3GA 5D6CB 4DZBA 5C9KA 1KT2A 1U8NA 4GLRI 3F65A 3PGFL 4K7PH 4NQEA 3U30B 2WMPA 3MGAA 3M8OH 4GJTB 4NKDA 4X9GA 2VN7A 3H3PL 4G42B 3EJJX 1JWMA 5I8CA 4TQEH 1BWMA 4G80A 4NSKB 4I18B 4OZHE 4F15C 3NBNA 4R4BB 5KVFL 2EC9T 1FG9C 1MHHA 2AJYL 3C60A 1MFAL 3EIFA 2A6JB 2YPLA 1ZT7B 3OF6A 3WFHB 2NY3B 2Y7QA 3VFGL 1NEZG 3L5XH 5KVGL 3VGEA 1F2QA 2CLZA 1T04B 4XWGH 2B1HL 4K7FB 2E7BA 4XNYL 3ULVH 1KJ2H 1C5CL 1HHJB 5E8OB 5DHYA 3QDMA 2PO6D 4ZTPH 5C0CE 5I8OL 3VI3F 1B88A 1EJOH 2AJ3A 3DROB 4N8VA 4KHTL 4WVRA 3HC3L 3CK0H 1JPTH 1YEIL 1CE1H 1A14L 5FUOL 1FNSH 3DV4A 2JJSC 3ULUH 4ZFGH 4HXAL 5BO1H 1T7WA 3EBAA 3VWJD 4WI5A 3OPZH 3LQZB 3DYMA 4KHXL 2JIXD 1INDH 1LD9B 1BGXH 4PRPB 3QUYB 3WKML 3NACL 2IQ9H 2EDRA 4HEPG 3WN5C 1AE6L 4O4YL 2D0HA 2OR7A 5J9PB 1NBZA 3DURB 5A16B 3TH2T 1G7HA 5FECA 4OQTH 1K8IA 2BP3A 2OJZL 2B4CC 2FHBA 2VDOH 3RJDA 4E42A 3V6FB 1BX2B 1GPOH 2D7NA 4AEIH 3QEUB 5H2BB 1A6TB 2FX9H 4PJAF 2FSEB 1EGJH 4MS8D 1W0VA 4U6VH 2X4TB 3UZVB 1UWXH 5CD3A 2FATH 4OFYA 3GGWA 3N1GC 1Z3GH 3B6SB 3VXNB 4NZTL 1NBQA 5CP3A 3CFDB 3GKWH 4FG6C 3VJ6A 2ICWB 1WBYA 3B43A 1YYLL 4GKOA 1DCLA 5CIPB 1TVBB 1RMFH 1RIVL 3CLFH 5IHLB 1AR1C 2ZWLT 3MXVH 2AJZB 2OL3L 3TGXA 1R0AL 5J6GA 1BVLB 3FO0H 4GLRH 5A2JH 4YDKL 2DIAA 1CICC 1U3HC 1KACB 4U2YA 3DGGA 3CFCH 1F4XL 1BQLL 4GG8B 5L7XL 1GGCH 3T3PF 4LPTA 4ZYKA 3AB0C 2H26B 1YC8A 4Y5YC 3VXTA 5DRNA 3PGCB 1CXLA 3KHOA 1TVHA 3UJIH 2YA1A 5JPMB 4JREB 3RX7A 1KN2L 2I9LB 2UYLB 3QP3A 2ARJB 1VGKB 4NO5B 4YPGA 3WFZA 3LRHA 3MO1B 4G8FA 3VH8B 1JBJA 3EDDA 4G9FB 4UQ3B 1ZHLA 4R3SB 5D72H 2LVEA 5I1CH 4UT6H 3UYOD 1ORSA 1CGYA 3BSZL 5E56A 4OLWL 5I66B 1L7IH 3DMMA 4KVNL 5JLZA 4BH8B 4Q0XL 1N4XL 1I1FA 1Q9OA 1WAAF 4B53A 4KDTC 4QNPE 1HINH 1F3DH 2J88L 5AG8A 1JF6A 5JHLH 1QSVA 4OI9A 5SWZA 1NLBH 4UMGA 3QDGD 2Z0BA 2A2QT 5SWSD 5SWQB 3GK8H 1J8HA 3I6GB 4PJBB 3P73A 3MCKA 2R0KH 1RURH 2W60B 4LPYA 3TCXA 3UYRH 4NRZB 1F45A 1Z6JT 1XF5A 1SJVA 2GSGA 5DVKA 3ULUC 3KWWB 4UBDD 3NGBC 3NA9H 4NM4L 4NT6B 4PJGF 3SDDA 2WUCL 1S9VA 4LEOB 2XZAL 3LKQB 4J8RB 2GJ6B 5I19H 3O4LD 1JUFB 5EO0B 5ESQA 5GGRY 4OI8A 3KHQA 3BN3B 1QPPA 1XFPA 4XI5C 2NPLX 4IMKA 2BVQA 3SQOL 2PYFB 1U2HA 1SJEB 4MLSA 3OHXB 5D1ZA 1KC5H 1KIPB 2VLJE 5ICZB 1PG7W 4JHBA 5KOMC 3TFKC 3EYSL 5IQ9B 3PGFH 4MX7A 3ORJA 5CS7A 4XXDB 1NGQL 5C0AA 3H3PH 3VXSB 1MFNA 4WUUB 3FONA 3IU3B 3KPLB 5KVFH 4Q6IA 3SBWC 5E8NB 4Y5VC 5CBAA 1B4JL 1JTPA 2AJYH 1OSPL 3JV5A 1MFAH 3TC9A 3QNYB 3HNSL 3VFGH 1M7IA 4BZYA 5KVGH 5DK3A 3DSNA 3DX9A 1N8ZB 1F02I 2B1HH 4XNYH 3FJTA 1FYTA 1C5CH 3MLWL 5TDNA 2YK1L 3BWUC 5I8OH 2XKSA 2YC1B 4QTIL 4KHTH 3S4SB 3F62A 1KYOJ 3BQUC 3HAEB 3HC3H 1YEIH 3OB0H 4NCDA 1A14H 5FUOH 4J4PC 5FA4A 3GBML 4HXAH 4U6XA 5IKCA 3MJ7B 4JANB 3H2WA 5C3TA 1FO0L 1T2XA 2R0ZL 4R7NB 2YD8A 4KHXH 5JIIA 1S5HB 3RVWC 1VFAA 4WI2A 3WKMH 4CW1B 3T0EA 3QUXA 3NACH 4JRXB 1RZ8B 3FT4A 5ICYB 1AE6H 4O4YH 1K6QL 3I85A 1FNLA 1A7QL 1IC4L 4GKSA 3U6RB 2OJZH 3O3EA 3V7AG 1DBKL 5E4EC 2X10A 2QBWA 3SO5A 1KB5A 4X0KA 2ZJSL 3U0TA 4RGND 4JFQB 5E6ID 2O26U 2VYRE 4F3FA 1XGTA 4JFFB 4Y16D 4EI5C 3P9LB 3H0TA 3QXAB 3O8XC 4MJ2A 4HK0A 3AMKA 1D5XA 3RHWF 3PJSB 5E8DL 3WDJA 5EU4B 4NZTH 5F7UA 4Z7VE 1UM6L 2CIKB 2LV4A 2DKUA 2ATPB 2CUIA 5BJTA 5I8KL 5KJRL 2A6IB 3PF2A 2PYEA 3KPMB 1FVEA 1RIVH 4HC1A 5T1KD 5C0FB 3OJDB 4UQ2A 1UB6B 1D9KC 4X9FA 3G6JF 1INQA 2OL3H 3HZMA 1R0AH 4PV8A 1P4LB 1UWGL 5LAXB 4YDKH 5ICXB 3MV9E 3OR7B 5CEXA 5GISL 4R0LB 4O2FA 1F4XH 1ZKAA 1J0JA 2WIIA 1BQLH 4YJZL 5C8JB 3BW9B 2DM4A 4XC1L 5L7XH 4ONHB 3HPJB 5JO5B 2AV7A 4Y4KD 4CAGA 2AK4B 3ZE0F 1N0LA 4PJ7A 3UZEA 3VI3E 3V0VA 3VXME 4UDUB 1HXMB 5INDA 4M6OL 1NEZA 4OBRA 4V2CB 3OKMB 4LSVL 1KN2H 4G5ZL 4XMPL 2E8YA 5IK3B 1CXKA 3P4MB 1I9EA 1MWAB 4MNGB 1SVZA 2V2TB 4TSBL 3ZO0A 1EZVX 1WWBX 3JTTA 4X9HA 1CVSC 2OJEA 4J3TA 2H2SD 2IANA 3BSZH 5LGHL 4OLWH 4M7JL 2GTZB 4KVNH 1ZA3A 2AQ2A 4Q0XH 4APQB 1N4XH 4NO0D 3CMOL 2EXWD 5ISZB 1MVUB 4H1LH 2WQ8A 3SO3B 1NFIB 3RDTA 3V4PL 2J88H 3TNNA 2X89A 2X40A 5C70A 2ZG3A 1I3UA 4TTDD 2W0FA 5C09E 4X98A 4GQ9L 4OM0L 4XVJL 3CX5K 2R2HB 1CK0L 3RFZC 4H26B 1WUNT 3PL6B 5TDPB 5E03A 3IXAB 4EEEA 2P49B 4PJAE 4GBXD 5FXCH 3LQMA 4PRHA 4X6DA 5MEPA 4NM4H 2Y07L 2WUCH 4RIRA 3RVXC 1F5WA 2X4NB 2XZAH 2NZ9D 1ERNA 4PRIA 1XR9A 1S7VB 5HHVL 3HKFA 3W0WB 43CAA 3QXVA 3PABA 4M00A 1FDLL 4LCCB 2PCPB 4ZFOL 3KLAB 3W5MA 5DDHA 1NFDB 4O2CB 4Y1AB 5CEYA 4JPVL 2YUVA 2ORBL 5HD8C 3RWIA 3WIFB 4LGSB 4EUPG 3SQOH 1V3MA 5BS0E 5IG7A 4IIQB 2HJLA 1SYSA 1I8KA 4XAKD 3MOQA 3MQIA 4FQXB 3EYSH 5E24E 1G6RB 1IEAA 5F89B 2VOTA 3D69B 1K8DB 5E0QA 1NGQH 4PLNC 1C5DB 4DVBA 4PJXA 3T3PE 2DTSA 4ETYA 3QIWA 1RIHL 3KPOA 3NFNA 4JFDA 3VFVB 3K4ZA 3G5XA 3CC5B 1NMBL 4WRLA 5E95B 4L4VA 4JHZA 4HHAA 5CKGA 5IFHL 5FGCB 3HNSH 3D3VE 3V0AC 1AGFB 4YDIL 2XPGB 5DK2B 3MLWH 2YK1H 5M95B 1OAZL 3QO0B 4F37K 5I2IB 3C6SA 3MOBL 4Y4FD 5I71B 4QTIH 4BA8A 4HIIA 5DURD 4LLYA 3SPVA 3V2AR 1GGUA 3L5WA 1T1YB 1YPZB 3CMGA 2IAMC 3PWPD 4U6HA 5EN2B 3GBMH 2DD8L 3BH9A 5FYJL 4FTVE 1FO0H 1WAAE 2R0ZH 3KPSB 2GUOB 4X99B 3KPRB 3D39B 2WLZA 2D0FA 5D93B 3BRDA 1OWRM 4POZC 4ZNCD 5EUOE 1RAMA 4X6BA 3MRIB 2YPKA 3LD8B 1K6QH 5FCUL 1OT1A 3GJFB 1A7QH 2EO1A 5ENWA 5A2KH 2F74B 2X9WA 1IC4H 5E94A 4PRNA 5I1JL 1M71A 1DBKH 3B2UC 2UZIL 4PJGE 2C4XA 2ZJSH 3STZA 1VKXA 4NZUL 4KK9C 5LGKA 3GJEB 3QXWA 1XT5A 2DQCL 1JRHL 2DM3A 1EHNA 3FB6A 4HDIA 5HYSG 1Q9LB 3LY6A 2NY4D 4HBQA 4JPIB 4PRAA 5E8DH 3DTXA 4U1LA 3BDXA 5KSAD 2NX5D 1G84A 2WM0A 1QSFE 3VW3L 1UM6H 2HFEB 1JHTA 5F97E 4AY0A 4OLVL 5I8KH 4OUOA 5KJRH 5SWSA 3K1KC 3AROA 3JV6A 4G8GA 5FDWA 2DIBA 1I7RB 3TBWB 1P7KB 3SGJA 5GHWL 1TZHA 2I5YL 3S3JA 2P8LA 1UWGH 5C0DA 3UJJL 5JW3L 4PJEF 5GISH 4XC1H 1U36A 4P99A 4TYUA 1T0MA 5L6YL 1ZHNA 5JHDD 1TCRB 5L2KA 3QUML 4PRDA 5KSBF 3WJLC 2H32A 4KGJA 4M6OH 4LSVH 1LQSR 2XXMB 1EH9A 4G5ZH 4XMPH 3ARGA 4HWEL 1A7OL 3LEYL 1X4YA 2V9RA 4TSBH 4L8BA 2DQTL 3HCVB 1JGUL 5CLTA 5LGHH 4M7JH 4BKLA 4ZO9A 1AKJA 4LLVA 3CMOH 3R0MA 4XCNA 1T5WB 1XEDA 3V4PH 1IZKA 4LCIL 4ZS6C 3B9AA 2C3WA 1YY9C 3LAFA 1FVDB 1C7TA 1ZVSB 3K2UL 4GQ9H 4OM0H 3MYZA 4X6CB 4XVJH 1CK0H 1GC1L 1T22B 1UQSB 4ZNEA 4KMTL 4HUMB 3IS0X 3IDUA 5E99L 4ZAKA 3RQ3A 4A6YA 1JRHI 1IGTA 2Y07H 1KTLB 5A3IC 4I0PA 1NDMA 5FYLL 5HHVH 3VFRA 1A7RL 5DVOA 1WICA 1IGIL 1FDLH 1UENA 3MUY1 4XHJC 5IB1A 1GZQB 1BZ7A 1IGML 2HKHL 4MAUL 2XOTA 4JPVH 2ZOLA 3DRTA 2R23B 3RWDA 1EK3A 4KJWC 4MA1C 1KT2B 2IH3A 1CLCA 4F58H 1GOHA 1U8NB 2G2RA 4XCCL 3G6JE 4NQEB 4LNRA 3DETC 1QLFB 4NC2B 1JNNL 3C09C 2M26A 5MEND 4GAJL 4XPGL 4NBZB 1U92A 3RGVA 1MHHB 3GHEL 3ARWA 1QRNB 1UKQA 5I75C 1RIHH 3BP7A 2ATKA 3THML 2X4SB 4L5FL 3RWEB 2CLZB 1NMBH 4HLJA 1CICD 2A38A 3ZE0E 3FQWA 5DHYB 3QDMB 3MV8D 1JN6B 5IFHH 4E0RA 1FBIL 2ED8A 1VDGA 1EA9C 4NKQB 2AJ3B 4N8VB 4YDIH 2EC9U 1WT5C 1WCBB 3SQBA 1OAZH 4MCYB 5DJ8B 3RWFA 3MOBH 4HKBA 4MNQD 2PF6A 5JQ6L 2EYRB 4I9WD 5F9JB 2VWEE 3D6GA 1FL5B 5T1KA 3LN9A 4P48A 3SE4A 3ZLQC 3QJHA 1XGQA 2DD8H 1YN6A 3HZYB 4AM0B 5T1MB 1II4E 5FYJH 5F8QC 3RWHB 5C2UB 3BMVA 4H0HB 1M7XA 1XIWA 3QXDA 1EAJA 3HG1E 4NCC1 4PJ5D 2VB5A 4U49A 5HYJD 4JVWA 1BPVA 2EE2A 4TVPL 3C5JA 5EBMA 1IZJA 5FCUH 4OUUB 2JELL 2P5WA 2YXFA 4XNQA 3T0BA 4E42B 2DJUA 2CMRL 2R15A 4ZFZB 1FLTX 4X6EA 5I1JH 4CMHC 4HIXL 1A6ZB 4UTBL 2A9ML 3ULVD 2X09A 2UZIH 4DGVL 4I0CC 1EXUB 4LHQB 4NZUH 4RFNC 4XNMA 3LV3A 4DKFL 5CD3B 1BFOA 2DQCH 1GIGL 1JRHH 4WI7A 3CFBB 4OIIL 2EKJA 4YBHA 5MERA 3ULUD 2BY3A 3VJ6B 1MFCL 1PFCA 3VMOA 1I8IA 4I1NB 4TUOA 3UTSD 5INCA 5E2TL 4URTB 4NN7B 3RX5A 2Z8RA 1CDUA 1IQDA 4MJIB 4OLVH 4X4ZA 1HDMB 4RFEB 2CKNA 1A4JA 4CN4A 1U42A 5GGVY 1IGYA 1B2WL 2I5YH 3UJJH 2C3XA 3AS3A 5JW3H 3UP1A 4P23A 5D7LA 3TFKD 5J13B 4ZYKB 2CJUL 2VLRA 2VABA 1U91B 3MZGB 4Y19E 3OXSB 1CFNB 4L8SA 4U1MB 4K3DL 1PKOA 5DRNB 1TVHB 2WBWB 2COQA 5L6YH 2WBJC 4LCWD 4LKXA 3QNXB 3F6IA 3BEVA 3B3IB 4NC0B 3QUMH 4PJIA 1L4IA 4YPGB 4NQXA 5EORL 4G8FB 1ZHLB 4YIQA 1VPOL 3VWKD 2Q76A 3QR2A 5DRZA 1MLBA 4NUGL 4HWEH 3WS6A 4XT1C 3G5ZB 1X5KA 1A7OH 3LEYH 4D0BB 2E7LC 1JNJA 3TV3L 4LAJH 4MD5B 3DMMB 5A43C 5ESVB 2FJFB 4D3CL 3WUWB 2DQTH 1GJIA 1Q9OB 1JGUH 1J0ZA 3EOYG 2EDFA 1J1PL 3QO1B 1HK6A 4P5TB 4ONOA 3ARDC 5BVPL 5F1IB 4HV8A 5DZNA 3UAJC 4HS3A 4BSVA 1XF1A 4LCIH 3ARTA 1OD9A 5B3JF 3MCKB 4DGYL 4KQ3L 3D18B 3FFDA 3SJVE 3ARBA 1XF5B 2OSLB 3K2UH 5DJ6B 2GSGB 4IRJB 2CO7B 5FYKU 2V5TA 1GC1H 1UJ3A 1CFSB 5IBUG 3SGKA 4KMTH 1PQZA 5E99H 4JFHD 2BVOB 2PTUA 5ESAB 4DCQB 2MMXA 1KULA 4BZ2L 3MBXL 2VDQL 3WLBA 3PP4L 1FGNL 5FYLH 5ESQB 1A7RH 2BNRD 3BIAX 1IGIH 4GRLB 5CUSL 3QEGL 4KWUA 3O8XD 1IGMH 3QI9A 2HKHH 3MGOA 4MD0A 4F2MA 4MAUH 4CVUA 2MKWA 2YEZB 3HNTL 5J1AA 5D1ZB 3K2MC 5DMJB 4LIQE 3GSOA 1KCRL 2EYSA 4XCCH 1BLNA 5C0AB 2B5IB 1ZHKB 1JPGA 4OSUL 1JNNH 4GAJH 4H25A 4XPGH 4BFEA 4AK1A 2XQYK 3GHEH 5D1QA 1V3KA 5CBAB 4F7PA 5I0ZA 1HNGA 4K3EL 2V2WB 1H3WM 3THMH 1M7IB 1NFDF 4MAYA 5J6HA 1ZGLM 4L5FH 2Z35B 3LEXA 2MNUA 5C08A 1FYTB 2Z31C 4WFGE 3FN9A 3ZKQD 1FBIH 3MLVL 3OTTA 5KSBE 2KL6A 1W2KT 2DMBA 3FT2A 3MJ8B 1CQKA 5FUCC 5HHNA 2NX5A 1QFWM 1CLZL 5DD6A 2YA2A 3O6ML 1ZGLA 4CU6A 4L8DA 5EG6C 4KKNA 3MCG1 4WY7L 3JV4B 5JQ6H 1X44A 1KIRB 5DMGC 3OQ3B 3T0XA 4L3CA 3FT4B 1OSZB 1NLDL 3HE7B 3SEPA 3JSSA 4P9HC 3G04B 3KNBA 3N85L 3IDXL 3QDJE 3Q2CA 4E41B 3P4OA 3EYFB 4YE4L 1X5ZA 3BXNA 5HGBA 1KCSL 4WUKL 1YNLL 4GKSB 4NQCE 5ACLA 4TVPH 1M05A 5FO9A 4FA8A 1M6OA 1IM9D 4YHML 2XN9E 3VXPA 2JELH 4G9FE 2CDFB 5JHDA 2CMRH 2IH1B 3TCLB 3UBXG 1EFXD 4HIXH 4NJ9L 4UTBH 2A9MH 4F3FB 4DGVH 1A9BA 3ARFA 3T2NL 3QG7L 4Z78B 1B0RB 4HK0B 1CXIA 4KTEL 1D5XB 5I1GL 1LE5B 3I3EA 2NY6B 4DKFH 3P4NA 1IT9L 1GIGH 2F8VA 5T3ZE 1CFTA 3BUYA 4OIIH 3D9AL 5JW5A 3WXWL 1TZIA 4B7LA 1MFCH 3RVXD 1AR2A 4WHYG 3MMEA 1C7SA 4EN3C 2DWDB 4Z7QF 1MIEL 1RFDL 5E4IA 2APTA 2EDLA 4PV8B 3UPRB 1JYVA 4JFPB 5EU3B 4TNWK 1AC0A 3BESR 4O2FB 5EUKB 3UZQA 2QV2A 1B2WH 3UTQA 4FFVC 2CJUH 4KZDL 1DQJA 4NQUA 1QHOA 4F7CA 4K3DH 5K9QG 1NEZB 1HKFA 4NPYB 1S9WA 4Q58C 4NRXA 3AS1A 1CXFA 4C56B 4UZGA 4PUBL 3H7BB 2XACC 1YMMB 3EDJA 3S37X 2WQRA 5E6ZA 1B90A 3O9WA 1MWAL 4WUUE 1VPOH 4PY8I 3RNKA 5B8CA 3JTTB 4LBEA 4CKVX 4NUGH 1MCBA 2Q86A 3TV3H 5IIEB 3VXUA 3BPNC 3HMWL 4D3CH 5C92A 2HVKA 2MHAA 3QIBC 5FIEA 1J1PH 5IT2L 3ES6A 4Z0XA 2IAMD 3TNNB 3AFLA 2ICCA 5D7KD 1IGJB 5BVPH 2W0FB 2VLKE 5EU6D 4LLQA 2D7TL 2UWEF 4DGYH 2NW2A 5J57B 4KQ3H 1ZTXL 2C3VB 5HGAB 4G3YL 4L29B 3FQNA 3BHBA 4HWNA 3QWQB 4KRPB 2YN3A 4JDVA 1IAOA 3GMPB 2VZSA 2QHLA 4PGJA 2CK2A 4XP9L 2R1YA 3PABB 3PHQB 4BZ2H 3MBXH 1JJUA 4LCUA 2VDQH 2OBGA 5DDHB 3PP4H 2W07A 1FGNH 4KK9D 5GS0L 2F53A 3W5NA 5CEYB 4HW6A 4YXKL 3O6FB 5CUSH 2FWOB 3LN4B 2P5EE 3B9VA 3NPZB 4X6CF 4DKAA 3HNTH 5HYJA 1KCRH 3Q3GA 2OZ4A 5E08L 1H3PL 2A6DA 4JFFE 2FECI 2XY2A 3I9GL 5D8JL 5GZND 3P0GB 4P46A 2VRAA 5DD3L 4OSUH 1YJDL 3TESA 4JDTL 3KPOB 3NFNB 3O2DA 4JFDB 1KJ2A 1UT9A 2I60L 3TVMC 2OTUA 4K3EH 3TA3B 4L4VB 5C0EB 1XF2B 4HHAB 4U3XA 3S3SA 1MI5A 3SDYL 3STLA 4NUJA 3DX7A 1URLA 4OBSA 5C0BD 4WWKC 3MLVH 5TE7L 1JMXA 4HT1L 1OP5H 4X5XA 1CLZH 4JEGB 4RAVB 5D7JA 5C0NC 4OGYL 4Y4HC 3HAEH 2PXYA 4ZO7A 3OKEA 3O6MH 3JWDC 4ZOAA 1HSAB 4WY7H 1K5NA 1J05A 2R4RL 1CXEA 1LO3L 3EOAA 2C3HA 4YK4B 4YFLF 3SGDI 1AHWC 5I9QC 3IB4A 5HY9B 4P5KB 4PJFB 3BZFA 1NLDH 5ACMA 5JA9A 3L95B 4X6BB 5SV3A 3N85H 1A1NB 3IDXH 3OB8A 5B3JE 2X4QA 4LPVA 4XC3H 4L3EA 4WDIA 1MFBL 3BPCB 4YE4H 1WWAX 5ENWB 1KCSH 4WUKH 1YNLH 5E94B 2WK2A 4PRNB 1EGJA 1M71B 5T3XE 3LPGA 4YHMH 4MGXA 1P4IL 5DK0A 1JPFA 4MNGE 5TDOB 4EIGB 3JVGA 2APWA 3QFDA 4K3HA 4OZHA 1YY9D 1KELL 3EO1A 4NJ9H 1OF2A 4QT5B 2ZUSA 4PB0L 1BJ1H 3T2NH 3QG7H 3FB6B 4HDIB 5ISZE 4KTEH 4F57L 1T83A 5I1GH 5A2FA 3RBGA 1I7UA 4WFHE 4PRAB 1IT9H 4JZJB 4RBPK 5DJXA 3D9AH 3WXWH 5BV7L 3CX2A 5C0CA 4YC2C 1BM3L 2J8UB 3RTQB 2KZ1B 5A3ID 1BREA 1KENL 1F3DJ 1BZ9B 4G8GB 3TO2B 2MQCA 4XHJD 1MIEH 5I8EA 1RFDH 5I15L 1MEXL 1EHLL 4JFED 5HI4D 4XHQA 3CVIL 4KJWD 2DMCA 5GSVB 1Q0YL 4GKNA 4PGBA 5TE4L 4P0DA 4HGWA 5ALBL 5EFIA 1FGVL 1NFDE 1A9EA 1LK2A 4P57B 4Y1AE 4YNYA 4ZMAT 3FT3B 4KZDH 1ZHNB 3FQXB 5L2KB 1DR9A 3QIUB 4K9EL 3OMZA 3WDHA 4PRDB 2XIDA 2IG2L 4XH2B 1PY4A 3KDMB 4MDJA 3MRDA 4BH7A 4Z8FL 2LFGA 4WW2A 3RBSA 4MB4A 4PUBH 1AGDA 1P84J 1DVFC 1MWAH 2ESVB 4Y5XB 3ALPA 35C8L 4YHIA 1F6LL 2VISA 4Q74A 3D3VD 1DUYA 5BRZB 2DYPD 5DS8A 2W91A 3CVHA 1D6VL 3HMWH 1WJ3A 3H9SD 4NYLA 3SGDH 2ZUQC 3T0DA 5JA8B 5IW1B 1LO2L 5DJZA 4P2OD 5IT2H 3S35X 3HR5A 3OJ2C 3C5ZB 4NP4L 5H37G 1W8NA 3MXWL 4XCYA 3QQNA 5GS1A 1Q94A 3RWJA 1R3JA 4GRWB 2D7TH 4RDQF 3D48R 4M5YL 1WZ1L 1ZTXH 5TF1L 4G3YH 1YPZE 4JM2C 1ORQA 3SCMB 1WFTA 3WE6A 3MNZB 2RGSA 1XH3B 4A6YB 5B39G 8CGTA 3KPSE 2JJWA 3CU7A 1G7JB 2YD2A 3KPRE 3D39E 4ODXB 3WFEL 3UBXA 1EAPA 4KZEL 3QUZD 5EBGA 1NC4D 4XB8A 3JV0A 4XX1G 4MNHA 1XF3A 5GS0H 3BKCL 4R4NC 5DC4B 4YXKH 3DRTB 1FNFA 1G0DA 2X4PA 4Z7QE 3ARZA 2ZUYA 4LVHC 8FABA 4R2GC 3FMGL 3S35L 3IDGA 1AGBB 2ZUTA 1FAKT 3VXRB 1G9NC 5E08H 1H3PH 1ETZB 1F2XK 1J1XL 2HA1A 5F7FA 1HEZB 3I9GH 3CFJB 3RNQB 5D8JH 3VFNB 4P59L 3OR6B 4GXUM 2YZ1A 4QRRB 1UGNA 5DD3H 1MLCA 1YJDH 2O93L 4JDTH 3BP7B 5HVHC 5E8PA 3VCLB 4CDHA 2I60H 1BEYL 3BKJL 1I9RL 3IT8D 1I8LA 3ESVF 1MCRA 2EKSA 1A02N 1UWEL 3BI9X 4TRPL 2FJHB 1H9VA 3SDYH 4P2QB 2A73B 2BNQE 4HH9B 3S96A 4BUHA 1QQDB 2VTFA 3AAZA 3DXAD 3RWFB 5TE7H 4YAQB 4HT1H 5TF0A 4FQLL 3OKYA 5B4MC 4OGYH 1JZ6A 1YN6B 2D9CA 3KLHC 4LGRB 1NUFA 2R4RH 4JO1L 1LO3H 1Y18B 3L3IA 2P44B 3RVTC 4M48L 3QXDB 3RKDD 2V9QA 3HI5L 3C5JB 5EBMB 1I1AC 1UXWA 1RZIB 3ILQD 2UWEE 4PJ8D 4XNQB 1FNAA 1MFBH 1CF8H 4DQOL 3TJHD 2VLJA 3GJFH 2FHFA 3ARDD 1P4IH 2P1YA 3D0LA 3HFML 5HTSA 2BHYA 1MCKA 4RFOL 3IKCB 2YSSB 1RZFL 1GXEA 3UDWC 1KELH 5DEGA 1BFOB 2B39A 3QCVL 4PB0H 3GSVB 2FEEL 3GBLA 5MERB 5I73C 5MEOB 3VD4A 4F57H 4MHHG 1FFOB 2AKRA 1IGFL 3M17B 3B8SA 4JQVA 4YLQT 1I8IB 4HIEA 4NN6B 1HQRA 5INCB 2KZWA 1FFPB 1TVDA 5BV7H 1BM3H 2EYTB 4X6CE 3DUUB 5FHBL 5FYJD 3BRGC 1KPVB 2E9JA 4N90D 4WO4C 4HJ0C 4G7VL 1P69B 5JXEC 1KENH 1GH7A 5IEHB 2VC2L 5EU6A 1X5AA 3QXUA 4EUPB 1A4JB 3WFBL 1NCWL 5I15H 1MEXH 1EHLH 1IGYB 1S7QB 3L3DB 3TN0C 5DJAB 3B9KB 1IC7L 1SY6A 1ZEAL 2APBA 1QA9A 2C1OA 3CVIH 5CJXC 5D7LB 5IR1A 2VDPL 1Q0YH 3QHTC 5TE4H 2DKMA 5CJOL 1Q8MA 1U95B 5ALBH 1FGVH 1MQKL 4L8SB 4S0TD 1UB5B 2E3VA 4PJ9C 2ZG1A 3IVKB 5GS0C 5JUEL 3J8F7 1PW3A 4LKXB 3BEVB 4OI7A 3IAPA 4K9EH 1MCCA 4HBCL 2IG2H 4JGUA 1JI2A 3R1GL 4ZSOB 4CADB 1UVQB 2K1MA 3OKNA 4MVBD 1E6JL 3IXTA 4Z8FH 2Z31D 3MJ9A 3HUJF 3FQUA 5DJ0B 1QRNE 4H1LA 4A2LA 1FNHA 1ND0B 3TEUA 1U0QA 3FRUA 2A74B 3MV7B 35C8H 5DMKB 4HS6A 2PW2A 1DE4A 4Q9RL 1D6VH 4DKDC 4E5XA 4QRPD 4KK6C 2ENSA 1LO2H 4Z7VA 5HVWA 3JBG7 1CFQA 1INEL 3WNMA 5GGRB 5EZJB 5DMGD 4NP4H 1AGCA 2YD6A 4K7PY 4YHPB 3MXWH 2DQGL 3LKNB 1KJMB 4HSQA 1E4JA 3RI5K 2Z92A 1MRCL 1WIPA 2P8PA 4ZXBB 1JL8A 4M5YH 5K9KA 1WZ1H 5TF1H 1JPSL 2UZYB 2I9TA 4Z76B 2X7LB 5I1AB 3MV9A 2G5RA 4M02A 4YHKL 5HYQB 3ARSA 4KY1L 3WFEH 1S7XB 3A67L 2W65A 1XZ0A 4WNQA 4KZEH 4PTUB 4QHKJ 1NGXA 5IBLC 1WIOA 3VXMA 5HYSB 3QI9B 4F2MB 5DQDL 3BKCH 4BFGA 4MMZC 1UCTA 3LB6C 2W9LA 5J1AB 3QDAA 1DQLL 4G6FD 1EEZB 1U8IB 2QKIA 1QP1A 1V7ML 4G6AC 2J8HA 3LIZL 4FQIL 1BLNB 4OT1L 1H3GA 2R9HC 3FMGH 3TZVD 3P9MA 1NDGA 2MQ0A 3ARPA 3S35H 2ARWA 4RISL 3C6LA 4FZ8L 4XGZB 1J1XH 4WTZG 2WW8A 4GH7B 5D1QB 3NCYS 4P59H 4NOFA 4F7PB 1NC2B 4LPUA 1UZ8A 3V79C 5J6HB 1BVKB 4N5UA 1BEYH 1TLKA 3BKJH 1I9RH 3NCMA 5C08B 1UWEH 3BGFB 1MCLA 4TRPH 3Q5YA 5C09A 5D1XA 5BV7C 2X05A 4HJGA 1TQCB 3FT2B 4LHUG 4RMVA 5HHNB 1Z9MA 1MFEL 5FYLD 3FN0L 4WV1A 4N1HB 3MRHA 3T65B 4PJAA 3UTTD 3RZWA 1ZGLB 4IOFC 5EC1A 4FQLH 4P4KC 3FO2A 4YO0A 3CAFA 1R3IL 2FR4A 2CDGB 3O0RL 4FMFA 3QT2A 3L3OA 4D2NA 4IHOA 1NCUA 1LHZA 4JO1H 1OVZA 5JW4R 1W8OA 2KQNA 4M48H 4PGEA 2YUXA 1ZXQA 3G6DL 3BIKB 3HI5H 3ZKXC 3BXNB 5CEZD 3IAGC 3D85A 2DB8A 1NMCC 3QIBD 5BS0A 2CRIA 4K9EC 2IMNA 1BJMA 3TYGL 4DQOH 1KB5L 1BECA 2NY3D 3F5WA 3TO4A 5DUML 4MJ5B 3HFMH 1EUUA 4PB9L 1A9BB 2XTLA 3RVUC 2AABL 4RFOH 1RZFH 3IFPA 1JZ2A 1MF2L 1FVCA 5GIRB 3QCVH 1CFTB 4U6YB 2AGJL 4PJFF 1TZIB 1T1ZB 3HI1B 3TIDB 5B39A 3D3VA 4Y2DA 4DFHA 1IGFH 1Q9KA 5DVMA 5JW4N 5CP3H 4UT7L 3MMEB 4KH2A 4DUXA 3KXFE 3P2TA 4PRPD 5FHBH 4HC1L 1CGVA 1OWWA 4YHLL 4POYA 4S11A 4G7VH 2FHCA 3T8XA 5ABDE 3I6LD 2VC2H 4Z5RA 5FUZL 3KPTA 4GSDL 1D6EB 1HSBA 1JZ4A 3WFBH 3ARVA 4OKVA 4TVPD 4FTVA 3ZT7A 1NCWH 1WAAA 3ZT6A 1T1WA 2NY0C 1H3XA 1IC7H 1ZEAH 2X9YA 3GI9L 4TNVK 5AZ2L 3X3FL 1W72A 4NHCL 2VDPH 1JGLL 5CJOH 2OP4L 5EUOA 1MQKH 2V7NA 4F9LA 2A0LC 4DK6A 2J8UF 2BX5A 1OB1A 2ARJQ 4AENB 5K9OA 5JUEH 1AO7E 1HQ4B 25C8L 1S9WB 1DZBA 4JN1L 2GFBA 4NRXB 3ARYA 1CDBA 3BN9C 4HZLA 4UV4L 4UAOB 2Q3AA 4HBCH 2BDNL 3DIFA 4HPYL 3R1GH 5DTFB 5SX5K 4PJGA 5B8CB 1E6JH 3RNKB 4LBEB 2HG5B 1CD1A 2Z91A 3FZUC 1Z9SA 4HUKB 1XGUA 4JFZL 4HKXB 3CSYB 2HVKB 4LRNL 4B7IA 3IGAA 1TENA 4N1CA 1ZGLP 2VDNL 5C0ND 3H42L 4Y4HD 3ES6B 4Z0XB 5IWLA 3C60C 2HFFB 4NKMA 5D96B 4Q9RH 4XBGA 2JB5L 3WFDL 5D5MF 1UXSA 1A4KB 4ONGL 2DTML 1QSFA 5IB2A 3L1OL 3N1FC 1TTUA 2W9DL 4LLQB 4O51A 1INEH 2I07A 2NW2B 3FO9A 4DUVA 1HHIA 4ODVL 2DQGH 4EVNA 3FQNB 3BEWB 4IJ3C 4Z7UB 1H3UA 2Q6WA 3GMLA 4V1DE 1FG2A 4DFIA 1JPSH 4DOHB 1WF5A 4QXTB 4LPCA 2R1YB 4POUB 4YHKH 5IV2A 4LCUB 2H9GB 4PGDB 4KY1H 2F53B 3G08A 2EEAA 4XCEA 3U46A 4JVUA 3WNKA 3WHXB 4E41E 1JMZA 1I1CA 3A67H 5IW3A 4P49A 5I1DA 3GSNB 3ZYJA 4HX1A 5L9DL 4Q9CA 1QSZA 3BPOB 2WSKA 5DQDH 3BZ4A 4GRWF 5HVGB 1DQLH 4JGJA 1AP2B 1FIEA 1IEHA 4XP6L 2A6DB 1V7MH 3LIZH 5C2BL 3X3GL 4FQIH 4OT1H 3ZE2F 2GK2A 3GMMA 1MY5A 2X4UA 4RISH 3DO7A 4OV5A 4FZ8H 5C0RL 1LGVA 3UCRA 3OAUL 4D9RD 2J8OA 5CINL 1FN4B 4KPHL 5DD5L 4IRSA 1MI5B 5FF6B 2Y6SC 5DJDB 1MAKA 1EO5A 2NY1C 2CR3A 1VB9A 3MRJB 2E7CA 4LU5L 2NW3A 3RAJL 4OF8A 4M61A 3T4AA 2XZQL 1OP3H 4HIJA 2HLAA 4KV5F 5I74B 1Q0XL 4HFWB 3UO1L 2GJ6D 3LS4L 5ADOL 2GTWA 1MFEH 3FN0H 5IMMA 2FL5A 4BSWA 3PWUA 4JO4L 3HUJE 2AXFA 5T33L 3GMOB 3GI8L 4XTRC 1K5NB 4O58L 1R3IH 4KMLB 1OGAD 1NL0L 1J0KA 3O0RH 2P42B 1FLRL 1LEKB 3BZFB 2D3VA 1HE7A 3AREA 4Z7WF 4HK3J 4LLMA 1MSPA 1CE6A 1GOGA 3G5YA 3G6DH 5D71L 1WBXA 4WDIB 5HHME 3VRJB 4CU8A 2ZSVB 3VXSD 4ONFL 3O81A 4MB5A 4MWFB 1HCVA 5T5NF 3BH8B 1YMME 3G6JA 5DK0B 1JPFB 2XFXA 2L7UA 3EZ8A 3K8MA 1JF1B 3TYGH 1KB5H 1K4DB 1C08A 2JB6A 5ALCL 4HUWA 5EBWA 5IJVB 4OZHB 2IQAA 3EO1B 5DUMH 3QWOA 3V95A 1ZHBA 4PB9H 1ZLSL 1F97A 4FXLA 2ZUWA 3QQ4B 2AABH 1H0DB 5IW6A 5D2LB 4WW1A 3KJ4C 5IBUB 1MF2H 3AY4A 4L4TB 4JM2D 1P4BL 4Y88A 3QRFM 1JWSA 2AGJH 3SDAB 3BVNA 5C0CB 3AUVA 3DUSA 5IEKA 3QZWG 1WTGT 3MUZ1 1JE6A 4UT7H 4HLZG 2GI7A 4FQQA 4GG6F 2ZSWA 5EWIL 2XTJB 4P2RB 4ZTOL 4HC1H 3P30L 1HI6A 4YHLH 3L7FA 5T1LA 1TTFA 3C8KA 4JRXD 4JKWA 4R4ND 4QRSA 2APFA 3MRRB 5FUZH 3AXLA 4GSDH 2BC4A 4CDGC 3SDDC 1JHLL 4GKNB 4M43L 3W39B 1JV5A 2DBLL 4U1JB 2VE6A 5AZ2H 3X3FH 3GI9H 4ZUUA 4NHCH 3HG1A 4LPWA 4R7DA 1JGLH 3NPSB 2OP4H 1S9KC 4EJ1C 5KOVC 4KUCD 4UDTB 5EBLA 5DJ2A 3U7YL 3W9EA 3KR3L 2HJKB 3GB7A 4IMKC 3VGAC 3U36A 25C8H 3C08L 5EZIL 3BD4A 4QRQA 4MDJB 3VGGA 4JN1H 1SQ2N 4HUVA 3CPLA 1I8MA 1NBYB 4UV4H 5CKAA 4YHYB 5HJ3A 5HI5D 2XI9A 4TSCL 1AGDB 2BDNH 2VH5L 4HPYH 1EEUA 3MRMA 1KLUA 1CGTA 3TBTA 2G9HA 4LHUA 2BOCA 4YHIB 4FN0A 2MPAL 3MUJA 3RZCB 3CVHB 5F9DC 4JFZH 4G8EB 1QBML 1ZVYA 4KI5F 1RUPL 2GSIB 4LRNH 4QYOB 1R5VA 4NYLB 4Q6IC 4HKJA 4X4XA 2P7TA 2VDNH 3GSQA 3SKMB 3H42H 3S8WA 3KPQB 4RGMC 2JB5H 5FA3A 3NIFF 3WFDH 1BD2D 4ONGH 1H15B 2DTMH 4XCYB 4DZ8B 4PR5A 5GRJL 3QFJE 3MRPB 1Q94B 3RWJB 3IF1A 4F8QA 2W9DH 1R3JB 5TFSL 1EEYA 4XZUA 3RVTD 3QCUL 4X6FB 2PTTB 2HAZA 3U9PL 4ODVH 2FX7L 3KPNB 3T2QA 3TM6A 1IAMA 3RWGA 2AK4D 1IEBA 2EECA 5J1TC 5F8RC 4A6YL 1XR8B 1MH5A 1D5ZA 4PJFE 4DN3L 3E6HB 3Q0HA 4Y19A 1Q1JL 1IAIM 2BERA 4MNHB 4M3JA 1U8LB 4XNXL 1Z9OA 4UIMB 3QUXC 2WWKT 4NOBA 1S9XA 1P84K 2P8MA 3T0EC 5I1HL 2EIZA 4NQDB 4JR9L 3HE6C 5D6CA 3SDCA 4I0KA 3BDYL 4LSSL 5L9DH 4OD2B 1YA5A 4LQFL 3T0AA 2EE9A 3IDYB 4QRUB 3T77B 2YD5A 1KTRL 3IDGB 4NSKA 4HIHA 1CDGA 1D7FA 4I18A 4PS4L 4XP6H 4R4BA 1B4RA 5C2BH 3X3GH 2XA3A 4QOKD 3OKKA 2A6JA 1ZT7A 1MLCB 3WFHA 4WO4D 4KKBC 4HJ0D 1J7VR 4Y2OA 3CH8A 5C0RH 5E8PB 1T04A 1X5JA 3OAUH 2CDEA 4K7FA 5F7NC 1QSED 5CINH 4XNZB 3OBAA 3DARA 4KPHH 5DD5H 2XWTA 2HT2D 2J8UE 4U7SA 3DROA 4OF7A 5DMIL 1U2CA 3LKSB 3NA4A 4N8CL 1AGEB 4LU5H 3SJVA 1AC6A 3RAJH 5KS9B 2NY5L 2XNAB 1PBYA 2XZQH 3OB0K 4KGLA 3W0WD 3WHE0 3UO1H 3GMNB 1Q0XH 4H8WL 5ADOH 3LS4H 1H3VA 4U1GC 1YUHA 3LQZA 5GS0D 1QFUL 1C8PA 2ICWJ 1LD9A 4JO4H 3ZKMC 1CDHA 5T33H 3QUYA 3GI8H 1TQBB 4R97C 2EIEA 4O58H 5BZDA 3I3DA 1QLRA 1NL0H 1E0OB 5DFWH 3WN5A 5J9PA 3DURA 5I17B 1FLRH 4TUJB 5D5ME 3RUGB 3OKDA 5GRYA 5MHSE 4JQXA 3V6FA 5D71H 3MOAL 4ONFH 3QEUA 5C0JB 2AJUL 5H2BA 1L0QA 4KK6D 1FL6B 4YDLC 4LPXA 2FSEA 4KROC 3BKYL 2ESVE 2UY6A 5ALCH 3DSFL 4OZGB 5JOPD 1T4KB 1RZKL 3NVQA 1N3NB 4EIZC 1IC5L 1ZLSH 3VXNA 3CFEB 2IADA 4RBPH 3CFDA 2ICWA 1J10A 3AC0A 1P4BH 3S7GA 5CIPA 4HIEB 3M45A 3MRLA 1HQRB 1FSKB 1TVBA 1HHHB 3RDTC 1T0PB 3L5IA 5KSBA 1GAFL 2K3TA 1AD0A 4GRWE 4TUKL 5AZEH 3UTZA 1F3JA 2AJZA 3FQRA 3KPSD 1BVLA 4GW5A 1TNNA 5EWIH 4ZTOH 5IBLD 3P30H 1DN2A 2PO6C 1ZK9A 2LTQB 3ZE2E 4OLZL 3LB6D 3QEQD 2X5PA 3KVQA 2C1OB 1QA9B 5HGGS 2P45B 3TNMB 5D7SL 3B5GA 1JHLH 4G6AD 2H26A 4HWBA 4M43H 4N0FA 2DBLH 3PDGA 4K8RL 3FFCD 2OM5A 3PGCA 3VWJC 2EIDA 2JK5A 4Y8AA 5JPMA 2C7UB 2I9LA 4HJJL 3MRNB 4NQCA 3U1SL 4AIZA 1VGKA 4CJ0A 2JIXB 4NO5A 4GFTB 4OQ1A 3U7YH 2XN9A 3KR3H 4KV5E 3MO1A 2GK0B 4G9FA 2MCPL 4C83B 3C08H 3MLYL 5EZIH 2H32H 3VXRE 3T0VA 1PVHA 3F7PC 4LLWA 4TSCH 2JLLA 2VH5H 4IDLA 4BH8A 3RIFK 4QRRE 1DJSA 5F71A 1E4XL 2MPAH 2PW2B 1RJZB 4U2ZA 1EZVY 3QIWC 3K4DA 1RUPH 4XP4L 2IWGA 1PG7X 5SWQA 4U05A 4Z7WE 4P2QE 3I6GA 1CFQB 2ZKHL 1AGCB 2Y1VA 2EDYA 5GRJH 3C9NB 1MJ8L 1WGOA 1QR4A 5FYKE 1DBJL 4Y7MA 5HGHA 4OTXL 2LU4A 5TFSH 3QCUH 2P8PB 4NT6A 3U9PH 4J7RA 1RZGA 2FX7H 3LKQA 2I9TB 3QDHA 3MBEB 1BBDL 4M93B 4N0UB 3MV9B 3FTGA 1IARB 2GJ6A 3WUZA 4HGMA 2V5SA 1B0GA 2VQTA 2DM2A 4A6YH 3RWCB 3DHMA 3EYUL 1OTUD 2FD6L 2HTKC 2VERN 3RY5A 4DN3H 2LAGB 1Q1JH 4L1DA 2NTFB 5CP7A 4ZODA 2PYFA 1OW0A 1IAKB 4XNXH 3OHXA 5I1HH 4X7CC 1GGYA 3BDYH 5ICZA 4LSSH 3SKJL 2EDHA 1BZQK 4LQFH 5IQ9A 4ORGA 4XXCC 5LVEA 2F54D 4Z7UF 1NJ9B 1NDGB 4WUUA 5K59F 4PS4H 3ZKSD 5E8NA 2OX5A 3ALXA 2MCG1 2VDLL 1ZAGA 4UINL 1UZ8B 3QNYA 4AJ0A 3FL7A 5IP4A 1H5BB 1KXVC 5IVXB 2VLKA 4LK4A 5C09B 1BJ1J 3JTSB 2GQHA 2YC1A 5DRWA 5DMIH 5HXMA 4N8CH 2FDBP 3H9HA 3KYNA 1UM5L 1WVZA 1WV7T 3LH2L 4PJAB 4QWWD 2NY5H 3WHE1 4DW2L 2MSPA 5KVEL 4J4PA 2A0LD 4H8WH 4R7NA 3QDGB 4X4ME 4F80A 1QFUH 1JZ7A 1E4XI 1S5HA 4P3WA 3UTOA 4LP4A 4AH2B 3DV6B 2ZPKL 3DPBA 1CCZA 1HIML 3L3OB 4KI5E 4IHOB 2DI7A 5ICYA 4UBDC 1QFWL 4DEPC 4NQED 4PGCB 3FZUD 2OCFD 3NIFE 4JPWL 3I6KB 4FRWA 4O5LL 2P5EA 2GAZA 2OQJA 1WITA 3D85B 5F6HJ 1M7DA 2YWYA 3NCJL 1P6FA 3MRQA 4ZSOE 2ID5A 1TPXC 2C26A 4ZUSA 3C60D 3MOAH 5CBEA 2YPLD 3O4LB 3OF6D 4JFQA 2AJUH 4MA7L 2EE3A 4JFFA 3P9LA 1UC6A 5FM5M 3BKYH 5GS3A 3GM8A 4EI5A 3ARGC 5FHAL 5C7XL 1JYWA 3QDMD 2X70B 2Y72A 3DSFH 3MV7E 3PJSA 4HG4J 4YHZL 2FGZA 3OG4B 2Q7YB 4I4WB 1RZKH 1FVCB 5EU4A 1IC5H 3GMQB 1EBAA 4F33B 5B39B 3B83A 2CIKA 5AEAA 2ATPA 1SVCP 3VFPB 3K74B 5CAYB 1NCCL 4L9LC 5TJWK 4AQ1B 5C0FA 3OJDA 1GAFH 5IVNA 1UB6A 4TUKH 5BQ7B 5HHOE 2PR4L 1D9KA 3T8XB 4LFHG 5BCAA 5LAXA 5ICXA 1PJ9A 5DGRA 4WIQA 4R0LA 5C07B 3PQYE 4EUPH 4OLZH 5EOTA 4ZAKC 1S7SB 1CYGA 4ONHA 3HPJA 4OZIF 1IKNA 3BGMB 1W72B 5JO5A 4YR6B 4LLDB 5D7SH 3VFMB 4I0PC 3KYMA 3IJYB 2W0KA 5GGQL 5J11C 1HXMA 4NRYA 5DD0L 5FKAA 5KN5B 2BY2A 4EI6A 3OKMA 2BZDA 4HJJH 2K7PA 5DRXB 3U1SH 4HZLB 1I7ZB 3P4MA 2E9WA 4MNGA 4OFYD 2V2TA 1KEGL 3ZE1F 1OCWL 2MCPH 3WFCL 1CL7I 4PJGB 2NY1D 3MLYH 1X6NA 1QG3A 1WZKA 4NJAL 1CD1B 2Z91B 3WBDA 2NMSA 1FIGL 4APQA 3DVFA 2BCKB 5ISZA 3DVNB 1MVUA 1E4XH 3IGAB 3QPXL 3RGVC 1OAXL 1NFIA 3TYFA 1QFWI 2A1WL 3RY4A 4MJID 4NKMB 4RGNC 4XBGB 2JJTA 3K8KA 1UXSB 4XP4H 4XTRD 2WIMA 3FB8A 5E6IB 4LOUC 5DO2D 1QSFB 5IB2B 3JXAA 4Y16B 2H2PC 2R2HA 1CLOL 2A77L 4H26A 2I07B 3PL6A 2ZKHH 4LNVA 5JW4M 4YBLC 3WO4C 4AIOA 2YA0A 1MJ8H 5H35B 1A7PL 1DBJH 4OTXH 5E2WL 2NY5C 3TBVB 4EQ2A 4HS8L 4H8WC 2X4NA 1IC1A 1S7VA 1BBDH 1VEPA 2CIIB 3FB7B 3W0WA 3LZFL 1T5XB 4LCCA 2PCPA 3ARQA 4PBXA 3SE4C 1QO3B 3DECA 3KLAA 1PYWB 1NFDA 5EO1B 3DBXB 3VG0L 3EYUH 4Y1AA 4FQHB 3V6OE 2CLVA 2FD6H 3G08B 4ZFFB 2ERJC 5ITBL 1XIWC 2IPUK 4IIQA 4WHCA 3DMMD 4M9PA 4C4KT 3BJ91 4KTYA 3G5VB 2NR6C 3SKJH 3WJJC 2CGRL 3MC0A 4FQXA 1G6RA 2C5DC 4Y4KC 5F9AC 5F89A 3D69A 2D4FA 1K8DA 2OZ4L 4P5TD 1S78C 3U4AA 1C5DA 1KXQE 5SWZD 1VA9A 3KS0H 4UV7L 1HXYA 4MYWB 3VFVA 4OV5B 1J8HD 1QRKA 2VDLH 2E5EA 3FQTB 3O2DL 1NFKA 5CLWA 4RDQG 4UINH 1G6VK 2FGWL 4ORZC 4HXBL 1DEDA 2H2SC 3SDDD 4KVCL 3QPQD 2NW3B 5I2IA 4NN6C 3T4AB 3WEXA 4MA8L 2ICEB 5GJTL 4U1IB 4NO0B 3T2PA 1QBBA 1UM5H 1T1YA 1YPZA 5IMMB 3LH2H 3PWUB 4Y8DC 5EN2A 3K0WA 1W0YT 2ADJB 1ZOXA 4DW2H 5KVEH 1LWRA 1LEIA 4GRLD 2HT3D 3S3PA 3KPSA 4HWZB 2GUOA 4QGTA 4X99A 3KPRA 3D39A 2WINB 4JZOA 5F7LB 4KRNA 1HYRC 4DGIL 2ZPKH 4HKZB 5D1ZD 1HIMH 5EC2A 5EOQL 4WHDA 3V8CA 3RHWK 4PJDF 4P23C 3H6JA 1QFWH 5IBTL 4GBXB 4K8RC 4JPWH 2DJ4A 4L8SC 5C0AD 1YECL 2F74A 4O5LH 4GT7A 2WWMD 5KS9F 4P5MB 4MDIA 2CXKA 2DQJL 3G6JB 3NCJH 5GGTA 4XPBL 3PWNA 4WU5B 5HHPA 3QJFB 3GJEA 3GIZL 4HUWB 4MA7H 5EBWB 2IQAB 3GFUA 2BNUA 2W38A 1TDQA 3QWOB 2H45A 1SYVB 4TNWF 1FYTD 5C7XH 5FHAH 3U4EB 3WS6C 3BO8B 4YHZH 4AG4L 5IW6B 4JPIA 1MCIA 4WW1B 4RA0C 2W0PA 4WI8A 3RUGF 3BVNB 4DTGL 2YKLL 1RULL 3GHBL 5IOPA 2HFEA 2XICA 4JRYE 4MQ7A 5LCVL 3WNPA 3MA9L 3VRLF 4FQQB 1NCCH 5E2JA 3TWCL 4CVZA 4DWHA 4Z7UE 3CSPA 3TBWA 2PR4H 3QUXD 3ARBC 3T0ED 3HE7D 3NCCB 4JJHA 5AG9A 5AWNL 4OZGF 1OL0A 4DOHE 1HN1A 4W6XB 3AXLB 2CH8A 2J12B 1UJ3C 4ACPA 3SGKC 1VACB 4Y4FB 4W4OA 4R7DB 1TNMA 3NMEA 3OV6A 1TCRA 4M6NL 1LDSA 2FRGP 5GGQH 5D4QA 5EBLB 2V2XA 5DD0H 2BVYA 2IJ0C 2UWEA 3PWPB 4KKBD 2E8ZA 4JFOA 3U36B 3OX8B 5HJ3B 3HZVA 2L0DA 1KEGH 2BY0A 1OCWH 1KLUB 3WFCH 3TBTB 2G9HB 3BP4B 4R9HA 3HCVA 4LHUB 4NJAH 5JIHA 5KSUA 4NN5C 2BOBA 4XMKL 1FIGH 3CVHL 1R5VB 3QPXH 2PYED 1OAXH 1OARL 1T5WA 3QQ3B 5E7FA 2A1WH 3LEVL 4WFEE 1MCFA 3ZKMD 4D8PB 1RI8A 5FA3B 5IQ7H 3RU8L 1KEML 4MAYC 5D70L 4M1GL 3U82B 1ZVSA 4KTDL 4PR5B 4X6CA 5ELIA 5JNYA 2AQ1A 4PLJC 3IF1B 4LVOB 1CLOH 2A77H 1T22A 4U6TA 1UQSA 5IFAL 4WHTB 3SKNA 2YRZA 1CGUA 2NY4B 1A7PH 1TMCB 5IB4A 5E2WH 4UNTA 5KSAB 1ZLUH 1HOCA 1IEBB 2APXA 1HILB 4HS8H 3MJ6A 1YDPA 2HMID 5LGJB 1L9NA 2WP3O 3BYYA 1U8PB 3X14A 2X2YA 1G7PA 3NOIA 3LZFH 3QAZC 1D5ZB 1G1CA 4Y19B 3VFWB 1UA6L 3F58L 1TJGL 3VG0H 4C56D 3B9DA 1YMMD 3WD5L 2R23A 5ITBH 5CJBA 3SDCB 1TXKA 3OKOA 1WLHA 2IAND 4Z18A 1YNKL 1QLFA 1TITA 1B6UA 3L7EB 2OXGA 1IVLA 2VLMD 3QISA 4HIHB 5CHNA 2CGRH 3RDTD 2OZ4H 2X89D 4F15B 1QRNA 1S7WB 4PD4J 3OKKB 5FGBC 5JXAL 3SN6N 3QHZL 4OZIE 3H9YA 4UV7H 3G6AB 2X4SA 4ENEC 3RWEA 5D2LE 3DX8B 3ARFC 5FV2A 3N50A 4LSTL 4L4TE 2CDEB 3H3KA 3HPLA 3O2DH 3D1MC 1JN6A 5A40E 2FGWH 2XWTB 1NCNA 4PRHD 5H8DA 4HXBH 1JGDB 3LSOB 2P43B 3C8DA 1WCBA 4KVCH 4MCYA 3SJVB 1N7ML 5DJ8A 1PD6A 2XTJE 1WT5A 4P2RE 4PRID 3RP1A 3ZE1E 4MA8H 1AD9A 5GJTH 2EYRA 5F9JA 1YUHB 2BSTA 1FL5A 4KAQL 4M4PA 5JPNA 3ZMRA 2DWEB 4AM0A 3HZYA 5T1MA 2IPKB 3N0PB 3RWHA 5BZDB 1Z5LB 1QLRB 2P24A 4YPJA 1F4AA 3VXOB 2H3NA 3WN5B 4DGIH 5EOQH 3SKOA 5IVXF 4OUUA 5IBTH 5HPOA 3OKDB 4NZJA 3H8NA 4M8QB 3LKOB 4LGPB 3WXVL 2YPVL 1YECH 4ZFZA 2EH7L 4CVXB 2CKBA 3QIWD 1A6ZA 4JFDD 2DQJH 1YEKL 4LF3B 4XPBH 1EXUA 4L4VD 3VD5A 1U58B 1A2YB 1NAMA 3GIZH 2G75B 4G6KL 4Q2ZA 4ODHL 4PJEB 1HCFX 3O9WC 3CFBA 1PLGL 4R26L 2IADB 3UBXI 4U1HB 4HUXB 5GGVL 2E6QA 5E2UL 4AG4H 4EQ3A 1F4WL 3MRLB 4CN6A 4DTGH 2YKLH 5MENB 1RULH 3GHBH 5CSGA 5KSBB 4S1SL 1AD0B 4MJIA 4QXWA 3TP4A 3UTZB 5LCVH 4N0CD 3WMSA 1F3JB 3FQRB 3E1F1 2OK0L 2HTKD 1HDMA 3MA9H 4GW5B 2D31B 3TWCH 2F58L 3MGTB 4RFEA 1OAUL 3L3HB 1CICB 1JTOA 4U0RC 1U3HB 5B38G 4HULB 5F21B 5AWNH 1SY6L 4OCNC 1U91A 1E4KA 4N0FB 3DRQB 3OXSA 1CFNA 4U1MA 3AB0B 4I2XB 3EDEA 2X4RA 1AI1L 4ALAL 3QDJB 2JK5B 2FO4A 2Q1EA 3HMXA 4Y5YB 4NQDE 1EDQA 4MNQB 3V9FA 4M6NH 4CL7A 3QNXA 1VFUA 3B3IA 4NQCB 2WBJA 4AIZB 4G8IB 2XN9B 3NTCL 1CGSL 3WLWC 3OAZH 1FPTL 2AJVL 2FIRT 3HLAB 7CGTA 1CLYL 4G43A 2ENYA 3G5ZA 4LLWB 4D0BA 4MD5A 3MJ9L 5ESVA 2FJFA 3WUWA 2DAVA 4WTWA 2E7LA 5C6TL 5DMYA 3CXHJ 4KJPD 2FH8A 3QO1A 5CZXD 4Z7NF 4P5TA 4P46C 4XMKH 1HYSD 5F1IA 4PJDE 1F11B 1KGCD 2QSQA 3CVHH 3VXQA 3MRBB 3ULVC 4G8GD 1OARH 3ABZA 3LEVH 1TIUA 3RU8H 3D18A 1KEMH 4MQSB 3KXFA 5D70H 4M1GH 5KS9E 4KTDH 2OSLA 1DL7L 5DJ6A 2D0GA 4RQQB 1ES0B 4IRJA 5HGHB 3NIGF 4R8WL 2N7AA 4PJCF 1CFSA 1MUJB 5IFAH 1K85A 1RZGB 3NGBB 4B0MM 2BVOA 2GCYB 3FTGB 5ESAA 1BIIB 5FOJA 5D7JC 1IBGL 4DCQA 2HVJB 3UTSB 5L2KD 2PXYC 1B0GB 2IMMA 1KPRB 2A6KB 1TJIL 1YNTA 3FAXA 1F3RB 1OLLA 4RA3A 4X8XA 4GRLA 2N7BA 3RUGE 5CFHA 1UA6H 3F58H 3O4OC 1TJGH 3ARGD 5CP7B 3ROLB 3PNWB 2YEZA 3WD5H 1AO7A 3VRLE 1DN0B 3BPLC 4ORGB 5BRZD 1YEDA 1JZ3A 1AKJD 1YNKH 3NCYP 1JCKA 4FZEL 3QZWB 1ZHKA 4OZGE 4JLRB 2VZ3A 4WHYH 3JVGC 3I84A 5SV4A 4U1SB 3C5ZD 4Y5VB 5JXAH 2V2WA 3BD3A 3QHZH 4OD3L 1HHGA 2UY7A 4M7LL 2Z35A 4LSTH 5DFTA 5T5FL 3U0PB 3VWKC 3MZTA 5HSFA 1T83C 2VLKB 5DJYA 4WI9A 1F8TL 2Z93A 4QHUB 4ZAKD 2Y25A 5DRWB 2QL1A 3MJ8A 4C58B 3NIDE 3H9HB 3KYNB 2RR3A 3BQUB 2E6PA 1N7MH 4I0PD 1OP5K 3JV4A 4TULL 4V1DA 2RFXB 4KAQH 4QKXB 1SEQL 3X13A 1KIRA 1D5BB 2LAAA 4BELD 1G1YA 3HE7A 1OSZA 2BRRL 3G04A 5J89A 4BFBD 5SX4H 3U79A 4E41A 5T1DL 1Z0NA 2OI9C 3EYFA 3ETBF 3T04D 1SM3L 2P5EB 5E1HB 2QADC 2GAZB 2OQJB 4XB7A 2JCCB 4CUCA 5ILTL 3RGVD 3N9GL 1M7DB 5CJ8A 3MRQB 2CDFA 1F42A 5E4EB 3WXVH 3LS5L 2IH1A 2YPVH 3QNZB 4LVNB 4ZUSB 4S0SD 5CBEB 3TCLA 2AEIT 2EH7H 3IU4L 4AT6B 3WNLA 3CGTA 1BFSA 3K3QA 1UEMA 4LOUD 1YEKH 4Z78A 1B0RA 3ISWA 2H2PD 5IROA 4EI5B 4WW2C 4LLAA 1LE5A 3O8XB 5FOBB 4G6KH 4ODHH 3ZT5A 4RWYL 4PP1C 1PLGH 3FRPA 2Y23A 4Z7OE 4R26H 1HHKA 3GIVB 1OGTB 3PDDA 5GGVH 3K8LA 5E2UH 1SJXA 3PHOB 5LG1A 3BRFA 3HC4L 1F4WH 3EOBB 2DWDA 4JFXB 2VR5A 5HYIA 4ELMF 1NGWA 4S1SH 2H1PL 4WCYL 2OK0H 3TIEA 3VMPA 5GS1C 1D9KB 3UPRA 3S97C 4JFPA 2F58H 3HUJA 1B0WA 5EU3A 1OAUH 12E8L 1XIWD 2EDKA 2DL2A 4N0UE 2BY1A 5EUKA 3GRWA 1E4WL 3VFUB 4F8TA 5EOTB 5DSCA 3BZEA 1I3GL 1ODAA 1T7YA 4HFUL 2VKXA 2NR6D 3MRFB 5DHXB 3B8YA 1SY6H 2P5WD 5FYJU 4NHUA 1W72L 2VXUL 1NPUA 5T5NG 1S78D 3HRZA 4QCIB 1U8KB 1KFAL 3KYMB 3QEHB 5CMAB 4NRYB 5FKAB 1AI1H 4ALAH 4F7MA 5HYEA 4EI6B 4NPYA 15C8L 3RPKA 4C56A 4HG4K 2B1AL 3H7BA 1HWHB 1YMMA 3V6BR 3NTCH 4NO2A 2NXYC 4QHKI 3DVGB 1CGSH 2FH6A 1P7QA 1FPTH 2AJVH 1MJJB 1CQYA 5JZ7C 4DVRL 1CLYH 2FB4L 2EDWA 4OF3A 4M3KB 5IIEA 2EDNA 3MJ9H 5MP6L 3WSQL 5I1IL 5C6TH 2VL4A 3TYFB 1IM9B 2GJJA 2IALA 3NFSL 2UV3A 4RMRA 1IGJA 3IJHA 1RHHB 5IVXE 5FAAA 5F3BA 3FB8B 1EFXB 2J3SA 4S2SB 1I8LC 1ROWA 1M4KA 1T20A 3O41B 2C3VA 5HGAA 4L29A 4NIKB 1DL7H 3T2OA 4P23D 5D7LD 2RAMA 3MLUL 4GW1A 4R8WH 1GSMA 3NH7L 2VLRD 5JMRA 3ELAT 3GMPA 3QDGE 4K8RD 1CZ8L 5I30L 5SWSE 3P9WB 4NKOB 1IBGH 3PHQA 1X5XA 1FRGL 1U9KA 1TJIH 1J5OL 3TBYB 1M1SA 1RPQA 2CLVB 1D5IL 3BDBA 1PEZA 4GMSL 3O6FA 4ZPVB 2FWOA 3LN4A 1MNUL 2CO6B 3EO0B 4F58L 1T03L 2VNCA 1DQDL 3WS3B 1YMHB 3O4LE 3B9EA 4HQQL 5F93C 3IETB 4KKCD 1B9ZA 4TVSa 4FZEH 4MA3B 1HXYB 3K81A 1UH2A 4ZS7L 3TA3A 3CFKB 5C0EA 1XF2A 4JO3L 1WBZB 3ARBD 5FV1L 4OD3H 4M7LH 4ZOBA 4D0DB 5CSZB 4PLKD 5T5FH 1FFNA 3SDXF 3VG9C 2VLLA 3W9DA 4X7FC 4X5WA 4XBEL 4UT9L 4JQVC 1F8TH 3QFJA 4YHNA 5GJSL 4WWKA 3WEXB 4XX1E 2HRPL 1FQ9C 1BQSA 3ZSSA 4RAVA 1JF5A 4K2UL 4OFKA 4EDWL 4LSDA 5FO7A 4MCZB 1CI5A 1EHXA 2IAMB 1HSAA 5EDXA 1LEIB 5C07E 3GKZA 4TULH 5DI8B 3BP5A 4X7EC 2ADIB 3HR6A 1SEQH 3QWRD 2K9UA 4Z7NE 2X1QA 3QI9D 4JZOB 4OV6F 3P0YL 5DYOB 4CN1A 3F12B 5HY9A 4P5KA 5EC2B 1R5IB 4PJFA 5GS2H 3L95A 2BRRH 2I27N 1A1NA 5T1DH 3BPCA 1SM3H 4H0GA 1EFQA 4L9DA 2K7QA 5F44A 1V5JA 3LDBC 4MDIB 5ILTH 3NIGE 3N9GH 5TDOA 5HI3D 5D1QD 3GJFK 4PJCE 3LS5H 4JZNA 3PWNB 5HHPB 1CG9B 3IU4H 2YD7A 4MAYD 2BNUB 5EPMB 4QT5A 1ONQB 4YEEA 5H37H 4Q97A 4PLJD 5C08D 4LAQL 5KSVA 4TNVF 2AW2A 5F6IC 4RWYH 2OMBA 4JZJA 1U8QA 3HTLX 3EW3B 4PG9A 2HN7A 4RGNE 1KB9J 3RTQA 3E2HC 2J8UA 3B2VL 5IOPB 3T09A 5GZNC 1KCKA 1FL3B 2BNQB 4MQ7B 3WIIL 3HC4H 1R3HB 1BZ9A 4D9QD 2Z8SA 3TO2A 1R24A 4CVZB 4FHBD 2H1PH 4XNUL 4WCYH 5E9DB 5GRXG 2E27L 12E8H 5GSVA 2W0LA 5F7EL 1E4WH 2VAAB 5C0BB 3C87A 5IVZA 5JOFB 1I3GH 3S36L 3QYCA 5E5MA 1CD0A 4P57A 3KLDA 4HFUH 1U8HB 2W59A 3FT3A 2PN5A 1W72H 5D5MA 2VXUH 3FQXA 3Q6FA 1KFAH 5K9JL 3QIUA 1KUMA 2V2XB 4ETQB 2ITDB 4XH2A 2UWEB 2JE8A 3KDMA 4ENED 3U9UA 2LE9A 3ARFD 15C8H 4JFOB 1O5DT 2NLJB 1QEWA 3VD7A 1DQQA 4UU9B 2B1AH 4OZ4B 3HZVB 2PKDA 1SBSL 1X5FA 2O61B 1PX3A 2ESVA 4Y5XA 2YBRB 4U31A 4DVRH 2FB4H 4X80L 1X7QB 5BRZA 5GQBA 5KSUB 2BOBB 1KCUL 4XPHL 3WYRA 2MFNA 3KPPA 5MP6H 4BK4A 3WSQH 5I1IH 3C6LC 3OXRB 1S5IL 5IW1A 4CNIA 2V5YA 4PJHB 3CDYA 1K9TA 4G9DB 3NFSH 3C5ZA 5FK9B 3LCYA 5F7KC 5J1SC 4K23L 2LU3A 3BOVA 1A3LL 1OAQL 5JNYB 2B7DT 1IFHL 2RB8A 3O11B 5D1XC 2VL5A 1FORL 3SCMA 3SKNB 3F7VB 3K80A 4NDMB 3MLUH 3MNZA 5IB4B 1XH3A 3NH7H 4WV1C 4JY6B 1SBBA 1HOCB 1CZ8H 5I30H 5DT1L 1G7JA 1YDPB 1VFBB 4ODXA 3DYOA 1FO0B 1K4CA 3X14B 1G7PB 3KAAA 1KTKE 1FRGH 5D6DA 2EDJA 3MLPA 5F7MC 1J5OH 3GNML 1D5IH 3ULVF 4GMSH 3L3JB 5HI4C 3O9WD 2R29H 4F7EA 1MNUH 1WIUA 3OKOB 1O7VA 4ELME 4JFEB 1T03H 1DQDH 1S9YA 5CGYC 3LQAL 1RUML 4MA1B 1ULVA 3NZHL 3VD3A 3VXUD 4KXZH 2IPTL 3KGRA 1AGBA 4TN9A 5FDYA 3VXRA 3ULUF 4HQQH 1ETZA 5CHNB 2DQFA 3RNQA 1HEZA 1IAIL 3CFJA 1Z0MA 3C09B 3S6CA 3VFNA 4WTXA 3OR6A 4QRRA 4C57C 3TO4C 1CT8B 1LK3L 3ZHLA 5I75B 3VCLA 2DLIA 4ZS7H 3HPLB 2XKUA 1P2CA 3CFIC 4XAKE 3BIBX 2V7HB 4JO3H 2FJHA 5AYQA 2P48B 4Z7WA 3DNKA 4P2QA 2R69L 3ZTNL 1DLFL 4P4RB 2A73A 4HH9A 2X41A 1QQDA 4EOWL 3RIAK 4Y2DC 4X5LA 3NAAL 5MI0C 4OGXL 4XBEH 4UT9H 4YAQA 2BHZA 5GJSH 4GUPB 4QEGA 5C0GB 2DYPB 2HRPH 1AD9B 2VDRL 5IHUL 5D2NC 1Y6NR 2BSTB 3H9SB 4OIBA 4P2OC 4X8JA 4K2UH 5JPNB 5I6XC 5L0QC 1HH9B 4EDWH 2HYMA 3CUPB 3BYTA 5EU7C 1ZS8B 2F53D 3CH1B 1N6VA 4X7DC 1Y18A 4PRBB 2P24B 3WLWD 1KCVL 4P3DA 3P0YH 2H3NB 4Q9QL 1DLHB 4M7ZC 1K3ZA 4XWOC 3D2UA 3SKOB 2YRPA 3CIQA 2EDEA 1RZIA 3PWPE 2FEDC 3CCHB 1I1AA 4F9LC 4P46D 4PD4K 1MCWW 2AXGB 2Y06L 1AH1A 2NY2C 2CKBB 1WFNA 4LIQL 3MFFA 3QUZC 3WL9B 4CMHB 3HA0A 3MCLL 1MI5D 1NC4B 2YSSA 3IKCA 1NAMB 1GYAA 4JKPL 4Q2ZB 4RFNB 3GSVA 5MEOA 5F9WC 4LAQH 3Q5TA 1FFOA 3MLRL 3ZDXF 1G0YR 3M17A 3U7WL 2R1WB 1JTTA 2D2OA 1LO0H 1FFPA 2FCBA 5D7JD 1G9ML 5IWLC 4ZPTB 2PXYD 2EYTA 3B2VH 3IJSB 2DL9A 3DUUA 4XPFL 2JCCF 2F19L 4WFFD 5JTWA 3WIIH 1KPVA 1I7TA 1BHGA 5IEHA 2GEEA 2H8PB 1L9MA 5JXEA 4EUPA 4XNUH 1GRWA 4Y0GA 5B21A 1NSNL 1S7QA 3L3DA 2NX5E 4PY7B 4X4MA 5DJAA 3B9KA 4MB3A 2E27H 1QYGL 3TN0A 1KBGL 5F7EH 4L3ED 1U95A 4LASL 5DQJB 4AEFA 4NNYA 1UB5A 4HWBL 3DXAB 1EPFA 3S36H 2X4RB 5FKPB 1GL4B 1N5AA 3IVKA 2FO4B 3EDKA 4ZFOB 3SDXE 4PJ9A 5E8EB 2YD1A 2CSPA 1CBVL 3W11C 4N9OB 1U3ZA 2WBJB 5EOCL 1RSFA 5K9JH 3H9ZA 3EUUA 1WWWX 4IMLA 4ZSOA 1E6OL 3IFNL 1P9MA 4CADA 2R2EA 3RX8A 1UVQA 4G43B 3RKDC 3PE9A 2V6HA 1WK0A 3RL1B 4MSWA 1SBSH 5DJ0A 5JHDE 1ND0A 4QHMB 5HBBA 2A74A 5CCKL 1FE8L 3ILQC 3MV7A 5DMKA 4X80H 5C0CD 2Z9TA 4PJ8C 3MLSL 1KCUH 3TJHC 4XPHH 3K46A 1K3IA 3AU1B 2XKNB 5T3ZL 1S5IH 3VXQB 3ARDB 3OJMB 1YY8A 1QUNA 3K1DA 5DJCB 2P47B 5GGRA 3KS0J 4IRSC 5EZJA 1FNGA 3KLSA 4YHPA 1OLZA 1U3JA 4K23H 3EFFB 4Y89A 3KXFB 3LKNA 1A3LH 1OAQH 43C9B 3ZKNC 1KJMA 1OAYH 3DJ9A 1OT2A 1IFHH 4GRMA 5HHOA 4ZXBA 2FBOJ 3VFTB 3TPKA 1FORH 4Z76A 2X7LA 2QADD 5I1AA 1NGYA 2DLGA 4OM1L 5HYQA 3PQYA 4F7TA 5DT1H 1YNTB 2H6PB 3ARRA 2ITCB 1S7XA 2FLRT 2ICWI 2AV1B 2XWBA 4PTUA 1QR1B 3QWRA 1X5LA 5HYSA 1QD0A 4QNPF 3GNMH 4LL9A 4XBPB 1AO7B 4JCLA 2NXZC 4PP1D 1EEZA 1U8IA 3I75B 1N6UA 1U3YA 1IKFL 3AREC 5FGRA 5M94B 3CXHK 3LQAH 1YEDB 5CWSB 1RUMH 4YX2L 1MQ8A 3NZHH 4N9GB 4PIRF 2IPTH 4XGZA 4PJEE 1IAIH 4K94L 4GO6B 1NC2A 2KH2B 2XA8L 5CZKA 1LK3H 3HZKB 1HHGB 1BVKA 2VIRB 5DLML 4MVBC 5BVJB 2ZUUA