5SWZD

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
198
Chain Sequence
QQQVRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASETSGSWQLIFGSGTTVSVSPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKCANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 198
sequence length 202
chains with identical sequence I, N, S
ec nomenclature
pdb deposition date 2016-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzD02
1S7SB 4MX7B 2YOCA 1HYSC 3KPLA 5H35B 1UWXK 2BVOA 4Y7MA 5EUKA 2P1YA 2FEEL 5DK0A 3MXVH 4A6YA 5IHZA 3EOBA 2YPKA 4KQ4H 3UO1L 1K8IA 2V2XA 1PW3A 4UBDC 4AZ8A 5CMAB 4IBLT 4JN1L 3DUSB 2DMCA 4OKDA 1NMAL 2IBBA 1FNSL 4KZDL 2GJZB 1NEZB 4JFOA 3O4LB 4DWHA 3ALWA 3MJ9A 1Z0NA 1DE4A 1KPVB 4G9DB 1YN6A 3GBNL 1EFXA 5FYJD 2YA2A 5C08A 5DJ2A 3IJSB 2EYRB 1I9RL 5J6HA 5E9DB 3QDGD 2Y5TB 2ZUTA 1MCIA 4OAWA 2NLJA 1A0QL 3EOYG 1UQSA 4M4RA 1MLCB 4I2XE 4U33A 5I1HL 1QR1A 2HLFC 3VWKD 4AM0B 3D39D 5F9JA 1A02N 2FWOA 3DROB 5T3XE 5E6ZA 2D9CA 1TCMA 3KJ6L 2AJ3A 1LE5B 4J3XA 2VZSA 3WN5C 4IHOA 3V4VH 1ZS8A 3SO5A 1R3IH 1BVLA 1T1ZB 2V2WB 4FXLA 4V2CB 3SGEH 3BH8B 4HHAB 4XP6H 3KPSD 5EUOF 3ARFB 1G7QB 4NPYA 4JPVH 5DJZB 3CXHK 5FKAA 1LO4L 1NCAL 4Y5VB 2DQJL 2NY0B 5IHUL 1HWGB 5D72L 2C3XA 1S7SA 4MX7A 3VFWB 3FO1B 1VEMA 1EBPA 1NUGA 1S7WA 2Z9TA 3L3GB 4ZOBA 5KSAA 2CO6B 4Y4FC 1L4IA 1NL0H 3VFSB 2DQUH 3O2WL 5F7FA 1YECH 5CMAA 3DUUB 3KYKH 4GMSL 2FCBA 3WBDA 2AW2A 1O7VA 1CZ8L 1G1YA 3HNSL 2OR8A 4KKBC 2GJZA 1NEZA 3MJ8B 3VDCA 3O4LA 4P4KC 1RMFL 4JZJC 5GS1C 1KPVA 2KUTA 4G9DA 4YO0B 1S78C 5C0BD 5I8OL 2G9HB 5GRYA 3IJSA 2EYRA 5CLTA 4HJGB 5E9DA 2Y5TA 3MRIB 2QHLA 3GBMH 1CS6A 1MLCA 3IDMA 3VGGA 2CKBH 4WFGD 1T2QH 3RVTD 4GKNB 4AM0A 5SWQB 3QWOB 1CR9H 4ETQB 2FECL 5IHBA 1KXVC 3DROA 4U6VH 3DX6B 4OQTL 3JWOL 1LE5A 3BJLA 4OJFH 3W39A 4RGOH 4XP4L 4PY8I 3PDGA 1MAMH 2OI9C 3GMMB 1T1ZA 2V2WA 4UV7H 4LCYA 4HHAA 4RIRB 1IT9H 1LILA 2B1AH 3ARFA 1G7QA 4L3EB 2ZUSA 4NFDA 4Q2ZB 1R5VB 4ZODA 2X4TB 3IXTB 4WEBH 3FZUD 3GZKA 4PLKD 4L8SC 3V79C 1ERNA 4KJPD 3VFWA 3FO1A 3QQ9D 4P48A 2B1HL 4Q0XL 3WHE0 2H2SC 2Z8RA 1B0RB 3L3GA 5KSBE 3X13B 3VFSA 4PGJA 2GKIA 5EH1A 4QWWD 4PBVC 3DUUA 3OTTA 4OZIB 1IM9B 2E7LA 2R23B 3UTSE 1ZSDA 5D71L 1WEJL 2EE2A 5FGRA 3JTSB 3QJHB 4FQQB 1OGAE 4LHJB 4RGNB 1QSED 4YO0A 3B8SA 2G9HA 2VDLL 15C8H 5ILTL 3MROB 1KCSH 1XGRB 4HJGA 4RCAA 3RDTB 3QCVL 1G6RL 3IDUA 5INDB 4YLQT 3NH7L 1WWBX 4LVOC 3L5XH 3L9RB 4G6MH 3NAAH 5CILH 1DZBA 4MA7L 1SM3L 5AEAA 2PKDA 4JM4H 3R8BB 4ZPVA 4GKNA 5SWQA 3UYOD 3QWOA 4ETQA 1VFOA 4QOKD 1DBAH 3DX6A 4J8RB 5DC9B 3WIHL 1FGVH 1YEDB 4YHMH 1KCUL 4PPTA 1TZHB 3SOBH 2ZG2A 1OPGH 2J5LB 4ZFGH 5C08E 2VTFA 3RVWD 4DJMA 4OCMC 4HIIB 1NFDF 4L9LB 4RIRA 5SX5K 3VWKC 5T3ZD 4L3EA 3MRKB 4Q2ZA 1DFBH 5F3HA 5LAXB 1ZLVH 1DUYB 1F90L 1T6WA 3PXHA 2CDGB 4QGYA 3WLBB 1A2YB 4DZBB 1CR9L 4J12A 5EDXA 3BP4B 3X13A 1D5MB 1E4JA 5TJWK 2B8OT 4PG2C 3BOVA 2GSGB 4RGOL 5K9JH 1IM9A 2J6EA 3K2UL 4UV7L 4YFDB 2R23A 3G9AB 5CP3H 5T5NG 2B1AL 3JTSA 3QJHA 4IRSD 2HRPL 4FQQA 3E6FB 4CAGA 5BV7C 4K3JH 4PUBL 4OV6F 4DZ8A 2XWTB 3GSOB 5EOTB 5D6CA 4MJ5B 4EN3C 4NJAH 3WFCH 3MROA 4HIJB 4NQVB 1XGRA 3RDTA 2XQBL 4FQJL 4KK9D 1NC2B 5INDA 4M6NL 1BQUA 3L9RA 2YD5A 3ZYIA 1T1WA 4Z0BH 4WWID 5IFJB 4K9EL 1CFTB 2Y06H 3O4LE 3O6LH 1QQDB 3MV11 4J8RA 1YEDA 1DQMH 1TZHA 5C0RH 1BQHB 1IE5A 2BNUB 2OQJB 4HAGA 4PTTB 4Y8DC 4AL8L 1IC7H 3STBA 1HIMH 4XNUH 3RVTC 4HIIA 5E9DE 4L9LA 3ULVD 5GS0H 3HNTL 3VDBA 4LLVB 3MRKA 3QEGL 1FJ1B 1DUYA 4NZRH 2V5SA 5DD6B 3MV01 4G6ML 4XCYB 3NAAL 5JR1L 2VB5A 1ETZB 2CDGA 2NNAB 3WLBA 1YQVL 2IPTL 2YPLD 1CLOH 3FO2B 4NHUB 1A2YA 4CVUA 2UVEA 4X9IA 1QO3B 3BP4A 2X9XA 3MV8B 1FGVL 1D5MA 1TQCC 5KVGL 1WZ1H 2GSGA 5GGQL 3FZUC 5EA0H 3RJQB 4WFHD 1AC6A 1OPGL 4PLKC 1NAMB 2PTUA 2F8OA 3TNMB 4F7PB 5HVHC 4KJPC 3QQ9C 4X9GA 1HZHL 5BO1H 2P49B 4YR6B 3E6FA 5DLML 2G60H 2JJSC 2F5BH 3B9KD 1YJDL 5IMKB 4QWWC 3GSOA 5EOTA 4YHYB 5HHOB 4Y1AD 4MJ5A 1H3UA 5F7NC 5C86A 4HIJA 4NQVA 5ESVB 4PJGB 1NC2A 2NY1D 4XCCL 3P4OB 2J8UF 2MPAL 4UOW1 5GRZA 1ZXQA 3ZO0A 5K9JL 5I15L 1GPOH 5KVMC 1QHOA 5I16B 2E6PA 1CFTA 1KV3A 2WBWB 5IB2B 2RJMA 1QQDA 3U48A 3V6FB 2RR3A 1A7RL 5JNYB 3T2NL 1BQHA 3IS0X 2BNUA 2OQJA 3LD8B 5IJKA 1I85C 4H1LB 4ELMB 4NJAL 3VRIB 2C4FT 2KZ1B 4WUUB 3X3FL 3MLYL 2AXGB 1FJ1A 2UWEF 5GRWA 1RHHB 5DD6A 1B0GB 1QRNB 4AQ1B 1OSPL 1ETZA 3O45A 1U92B 3FO2A 4NHUA 1Z5LA 2OM5A 3RVWC 2Y06L 3N50A 3FKUS 4ZUWB 1QO3A 5B8CC 3EDEA 3ULSB 1I8LA 1MHPL 1DQML 2KBGA 1FQ9C 4HLZH 1YYMH 1X4XA 3RVUD 4F7PA 4XNUL 4MYWB 2FH8A 3WHE1 1NAKH 4L3EE 5GS0L 4YR6A 4EI6A 2IFFH 2X10A 2BSSB 2WWKO 5CEYB 5J12B 3B43A 5FK9B 4AMKL 7CGTA 5F6IC 3KPOB 5IMKA 5HHOA 1CBVH 5ELIA 4LQFL 1CLOL 1XT5A 5ESVA 1QSFD 4PJGA 1ZANL 2DLIA 4IRSC 3P4OA 4OZIE 2F54B 5I75B 4NGHH 3BHBB 4LARL 5I16A 3SGJC 1Z3GH 4U3XA 1VACB 2C1PB 5IB2A 5BO1L 1LP9F 4HKXB 3V6FA 1CCZA 2G60L 4RGNE 4FFWD 2NXYD 5JNYA 4KK9C 4NUGH 1IAMA 2R8SH 2VABB 1C8PA 1T20B 1NGWB 3QUML 4H1LA 3DHJA 3LCYA 4ELMA 3VRIA 2LAGB 3EDFA 4OI7A 2QSQA 1Y18B 1LO3L 2VRAA 2ZCHH 2AXGA 2WANA 1L0YA 1RHHA 4QRPD 1B0GA 1QRNA 5F7LB 4PV8B 1BBJB 2YEZB 1U92A 1E4XH 2B7DT 4DEPC 4HXBH 4DK6A 5HGDB 4OLXH 4ZUWA 2J8OA 5B39B 3S5LB 3ARSA 1UJTA 3PWVB 4TN9A 4RBPH 2DQIH 2MWCA 4HSQA 3OR6B 1XGQB 2P5ED 3C60D 1QTYT 4QXUL 4G6JL 5EBLB 4JDVB 4MB4A 4U6YB 4KROD 4KHTL 5CEYA 1MCEA 3P3YA 3T4YB 1QLEH 3KPOA 4U7MA 4PJ8D 2VSCA 4L29B 4EQ3A 3KYAA 1IAOB 2V5TA 3TVMD 3FQUB 1EMTL 1MRDH 1UWEL 2F54A 3U7WH 3B9KC 2Q1EA 3LSOB 2OZ4H 3BHBA 3OHXA 4I4WB 4LASH 1NAKL 1VACA 2C1PA 3SKMB 1YEEH 2EDYA 2WWMD 4HKXA 3OX8B 1PVHA 4P99A 2VABA 4U3CA 1NGWA 1FG2B 4WFFD 4BJLA 1DQJA 3CLFH 1V7MH 2YD2A 1Y18A 1C5CH 4Y5VC 3VE0B 4JQVA 2GI7A 4JFFB 4YZFF 5GHWH 3UC0L 4P2RB 1BBJA 2YEZA 1NBVH 2DIBA 1N5YH 5HGDA 4FTVD 3ZDZF 5B39A 3S5LA 1IGIH 3LZFH 2XA8L 4YC2B 1MFAL 2F53D 1KCRH 4PJXF 1M7DB 1XGQA 3OR6A 3MA9L 5F8RC 5EBLA 4JDVA 2HFFB 4U6YA 1MH5B 1NMCC 1HEZB 2DLFL 1RZ8A 5LWYH 5K59E 4OQTA 5JO5B 3T4YA 1QFUH 2D7OA 1JP5A 5FCSH 4YWGL 4PGCA 1KT2B 2E8ZA 3WS6C 1E4XL 2H45A 3RVUC 4HXBL 4NN7C 3MV8E 1PZUB 4OLXL 5I18L 2VH5H 3NFPB 4JCMA 1IAOA 5DDHB 3FQUA 4NBXB 2HMID 3NIGE 4LSVH 3I3DA 2YPVH 3RWDB 2DQIL 3DVIA 3LSOA 3FB8B 4I4WA 2XRAL 3PWPD 4LF3B 3SKMA 4BFEA 1KNOB 5HI5D 5E8PB 4NYLB 3WXVL 5AG9A 4CGTA 1T2JA 3H8NA 3T3ME 3OX8A 3AREB 4Z7VF 5HHOE 1QLEL 4YK4B 4PJBB 3TF7C 1FG2A 4HPOH 3EO1A 5I71C 1GJIA 4NNXB 4PJGE 4S1QH 4XBEH 1OP5H 5F8QC 2NY5L 1J1XL 4KK6D 3VE0A 3P9LB 2FGWL 2DD8H 4JFFA 4FFWC 2NXYC 4ZD3L 1FNFA 5HYFA 3MRNB 2OZ4L 3CAFA 4W6YB 4P2RA 5T1MB 4LASL 2W92A 4OFVA 3RFZC 1LEGB 1AHWC 2FBJL 2M2DA 3ZDYF 2EDBA 4ELME 3F58H 1M7DA 5D7SH 1I75A 3CLFL 1V7ML 5DT1H 4TNWK 2HFFA 1WV7T 1MH5A 5FHAL 1NGPL 2BOCB 4KV5E 3OKYA 1QRNE 2QHRL 3WIHA 2Q7YB 3SBWC 1RHFA 3O9WB 5MEPB 1KT2A 5EB9A 4WFEE 1F4HA 3C60C 4DGVH 1U42A 1H5BB 1IGIL 5DDHA 3D0VB 3LZFL 4KROC 4OF5A 3SY0B 4HK3J 4YBQD 3MRFB 3RWDA 3DUHA 1KCRL 4WUUD 2JB5H 2XOTA 4RSVA 3FB8A 4PJ8C 4HLZG 4LF3A 1KNOA 5E8PA 2DN7A 1U3HB 2RIKA 3AREA 3TVMC 4PJBA 2VSDA 2HA1A 3LRGA 3OKEB 3BH9B 5GGUB 3TA3B 4NNXA 4YEFA 1RIVL 1UVQB 3N0PB 5I19H 2VH5L 4MAYB 3VXQB 3BO8B 3JTTB 2F54E 5I9QC 2WWMC 3P9LA 4F7CB 5J13B 3MRNA 1YY9D 4YHKH 5T1MA 1EUTA 4MDJB 3VGAB 1LEGA 2NMSA 4JRYD 4X6FB 1OAZL 3SKUD 2ADJB 5JA9A 3QPXL 4TVPH 2JJUA 3D87B 3X3GH 1AXTH 2V7HA 5AAMA 4OCSH 1KJ3H 3IAQA 1PG7X 4HC1L 5GGSB 5IR1B 3HPLB 4F2MA 2BOCA 3Q2CA 2DD8L 5TQ0H 3MA7A 5FFLA 2VLME 2Q7YA 2VWEE 2WBJD 3P9WB 3O9WA 5MEPA 3ZLQC 5J1AA 2IMNA 1DANT 3D0VA 3SY0A 3ZYZA 1IGTB 5F7MC 4JHWH 3ZKSD 3MRFA 1A7QL 2EDFA 3KG5A 4RAHA 3SEPA 4PYHA 4U6TA 1KGCE 1JGUH 4M00A 2UZIL 5D7SL 4J4PA 5DJDB 3H9HB 1YPZF 5I74C 1U3HA 4CDGC 4BSWA 3AMLA 3D5OF 4HWZB 4F15B 3LRSB 2HMIC 4X6DB 3H42H 3OKEA 3SQOH 2I9LA 3BH9A 4FHBD 4PJ7B 5GGUA 3TA3A 4LCWD 1P9MA 5E70A 1UVQA 2LVCA 4MAYA 2O26U 5EO9B 3BO8A 3VXQA 3JTTA 5HI5C 3MREB 4F7CA 3K1DA 5DHVA 3TEUA 3G6JB 3MLVL 3H9SB 4RGMB 1QOKA 4K7PX 4MDJA 1XGTB 1E4KA 5TPWH 4I0CC 4X6FA 1F4AA 5I1CL 5I1DB 2ADJA 3B9AA 2VE6B 5E2JA 4Z7WB 1CICB 3BP7B 3RWIB 5C3LD 2WLYA 3FAXA 4KK6C 1VKXB 4YHPB 1WQVT 5M95B 3V0VB 5B3JF 4I3RH 5GGSA 2AJSH 2ICWI 4OKVB 5IR1A 3HPLA 1T04B 4F7MB 4JFFE 2Y6SD 4P2RE 1CLZL 5MENB 2P8LB 2ZUWA 3QUMB 4IOIB 5FYKL 3W0WB 2R0LH 4TVPL 1IGTA 3T0BA 1JGEB 4Q58C 1GZPA 4TSCL 3X3GL 2E7MA 5B38B 5FEBA 4LDOB 5DJDA 4NO5B 3VWJB 1J7VR 4OCSL 3H9HA 1A6TB 2I5YL 1BWWA 3W2DH 4NRYA 4JGUA 3I6LD 4GLRI 5FHBH 4WENB 5TQ0L 2MKLC 4HWZA 2D7PA 3LRSA 4C4KO 1VB9A 4YBQC 1VEOA 4PGBB 3S8WA 4X6DA 4GRWF 3RZCB 4NZJA 1DUZB 2QQKL 4PJ7A 1CL7H 1UH3A 2CDEB 5EO9A 4CU8A 4C54A 4FQ1H 1JF5A 2VQ1B 3MREA 5IJVB 5DF0A 3G6JA 4OTXH 3SE9L 3H9SA 4QEGA 4XPGH 2JLLA 5C0CB 1JZ6A 2BC4B 5I1DA 2VE6A 1I3GH 4Z7WA 3ARBB 3EJZD 1CICA 3BP7A 4PJBE 3RWIA 5HGHB 3CVHB 1VKXA 4YHPA 4ORGB 2AJVL 4K55A 1EAPB 3H42L 3V0VA 1JNLH 5D7LD 2I27N 4HGKC 1YY9C 5C6TH 2F9BT 3UJIL 5C09B 4LPXA 1DVFD 1FE8H 4OKVA 1EZVX 5MEQB 1T04A 4BFIB 4F7MA 1KUMA 1NFKA 4S1DD 2M26A 2VDKH 4OCWH 3DPBA 5DD1H 1QYGL 4XHJD 3P9MB 2P8LA 3C5SA 4JHAH 4KKLD 1E27B 4IOIA 1L6XA 1J0IA 4P2OB 3W0WA 1X7QB 3QUXB 3STLB 2GJ6B 3UBXI 1J12A 4M9OA 4WUKH 3TC9A 1T66D 3KPQB 3SO3C 1JGEA 2NY6B 3VD5A 2WBJC 4ZTOH 5EZLB 4NO5A 5T1LB 3VWJA 2G5RA 4X99A 1JK8B 2AJSL 5J57B 3QQ4B 4JO1H 3SGDH 5C0DB 5HYJB 4X0KB 2N7BA 2DLHA 3RWGB 2UY6A 1DBJH 1H3WM 4PGBA 1OL0A 2ESVB 3RZCA 3REWB 1DUZA 4QF1B 5HYSB 2CDEA 5JIPA 4JQVC 1WUNT 2VQ1A 1F6AB 2F58H 5IJVA 1NH6A 4ODHH 3NCMA 2NXZB 3Q1SL 3QHFH 2XYCA 3E8UL 4ZSOB 3O8XD 2IJ0C 5C0CA 2BC4A 1RZJL 3SDYL 5E2VL 2VN4A 2MTPA 2NYYD 5FHBL 2CDFB 3OAUH 3CVHA 5D2LA 5GJTH 4ORGA 3RBGA 4Q9BA 3SE4C 1FLTX 4HH9B 1EAPA 3R1GH 1UA6L 4HZAA 3ZZ1A 3D2UD 3MUHL 4PJHF 4WCYL 5C09A 1TJGH 4ZXBD 1PY4A 2W9EL 5MEQA 4BFIA 3X12B 3JWOC 3UJJL 3M07A 1Q72H 3P9MA 1RZIA 2FL5A 4G8GB 2EIBA 1E27A 1MPAL 4P2OA 2AV7A 5GGVY 4LMQE 1X7QA 3STLA 3R06B 1X5AA 4R26L 2GJ6A 3V7MA 4PJFB 4GFTB 4P2YA 3KPQA 4ONOA 4AEHH 2Y6SC 1WZKA 1JNLL 3BUYB 5CBEA 1T4KA 4UUJB 5C6TL 5T1LA 3BKYH 3D3VB 3EFFB 2DQGL 1A1NB 3CX5K 1JK8A 2QQNL 3IRPX 3QQ4A 5C0DA 5HYJA 5D7IB 4X0KA 3T1WA 4HCRL 2H8PB 3RWGA 2VDKL 5DD1L 3MR9B 1I7RA 3R4DA 1QBMH 2ESVA 3CH8A 4QGTA 3REWA 4M93C 4JHAL 3VU2A 3QXAB 3QXDB 4QF1A 1ZGLB 5HYSA 3ROLB 3GJFB 3ZE0E 2WQRA 4P46D 1E28B 1M71B 3NCBB 5DJCB 4NNYB 2JCCF 4ZTOL 5EO0B 5IMMA 1J1OL 2OP4H 4ZSOA 1IEHA 1Q9OB 1KN4H 3TBTB 5IQ7L 1BJMA 2CDFA 4X6DE 1D5IL 2IG2H 2IQ9H 4PJ7E 4M3JA 4HH9A 4DKEH 1NUNB 5E5MB 3QWQB 4WI2A 5JXAH 1MY7A 3X12A 1AGCB 3QP3A 3RY6A 1I1YB 2F58L 3G6JE 3EJZC 3H9SE 4Y0GA 3C08L 4ODHL 5I30L 4HD9A 1XIWD 4G8GA 1YEJH 1YYLL 4LLWB 4Z7WE 3R06A 1K6QH 5E00B 1DVFC 3BQUB 4PJFA 4YHOH 2BOBB 5GJTL 2WSKA 1TJIH 3IFNL 4S1DC 3HZYB 3RGHA 3BUYA 5JHLL 3R1GL 4UUJA 3S3PA 4XHJC 5GS0D 3EFFA 1VCAA 2R1WB 3D3VA 2R1YB 1A1NA 3ARWA 4WW2B 1HWHB 1GRWA 4KKLC 3SE3C 1RURL 2WUCH 4DUVA 1AY1L 5D7IA 2H8PA 1VFBB 3MR9A 3PHOB 1T66C 1Q72L 5HDQH 5MENE 4Q9RL 3W81A 3ARUA 1KJ2B 3W0WE 4Z7OF 3QXAA 3NTCH 3QXDA 4X98B 1ZGLA 3ROLA 4L4JA 3GJFA 1I9JL 3RU8H 3O3AA 1XR8B 1E28A 1M71A 3DHMA 3GMOB 4HFUH 2CO7B 3EIFA 5DJCA 3HE7D 4JO4H 4NT6A 4NNYA 1EGJH 3ILPB 4ORZC 4FNLL 5EO0A 4R3SB 5TQ2H 1Q9OA 3HNVH 3TBTA 3L5JA 3ESUF 3KGRA 4BUHA 1LO0H 5MEND 3MLTB 1BOYA 1H8SA 4NKOB 5D7KE 2JJVA 3V4PH 5E5MA 1NMBH 4K9EC 3ZHLA 1OOAA 3O8XC 4TUKH 4MQSB 3BGFB 2X4RA 5D6DA 3EYFB 1I1YA 4KI1A 5FOBB 2NYYC 3IDYB 2DAVA 4IIQB 3PL6B 1HN1A 3GJEA 4XBGB 5C0CE 3EYQD 4LLWA 1BGXL 5LG1A 3UROR 5E8NB 1H5BC 1FZOB 1KC5H 2OS7A 4HWEH 1F58L 4ZXBC 5D2LE 3BQUA 3LIZH 1LEKB 2BOBA 1P4BL 2IQ9L 2R1XA 1FSKC 3HZYA 4DKEL 1EO5A 5KSUA 5C09E 2NQCA 4XC3L 2R1WA 2R1YA 3QNXA 3I6GB 2N1KA 4WW2A 2E9JA 2D7NA 4P5KB 5IVZB 1VFBA 4XT1C 4OGAD 5E2TL 3PHOA 4JDZB 4RZCB 5AYQA 3GGWB 3MGOB 1L0QA 2A9MH 1KJ2A 4EDWL 5ICYB 4HWUA 2NTSP 3ARBD 3LEXB 2Y36L 2WIIB 4L5FH 1EHLL 4BH7B 2GJ6E 4I5BB 1K6QL 3O6FD 1L9NA 1T7WA 3CSYA 2F19H 1XR8A 2DM4A 5ADPL 4X4ZA 3GMOA 3LY6A 3B8YA 2I9TB 3QUKB 4J3OC 1YJDC 4HEPG 3ILPA 1P7QB 4CUCA 1UCBH 1JHKH 1OP3H 3CGTA 5DTFB 5HYJE 1IKNA 3C5ZD 3CMOH 4Y4KA 4WU5B 1ZT4B 4KJWD 5GRVK 1C12B 1CN4A 3MLTA 2ESVE 3TZVB 3H2WA 2OLDA 4P46C 4R90H 1FV1A 4MDIA 4XMKL 5LGJB 3QUXD 2BSTB 3SGKA 3I50H 4QHMB 3NTCL 3MSPA 5KZCD 3MV9B 1RQ5A 1SY6A 3RU8L 4WWKD 4M6OL 4KDVA 3EYFA 2FX9L 5FOBA 3C8KB 1RK0B 2QSTA 3T3PE 4JO4L 4IIQA 2ITCB 3PL6A 5DSCB 4YFLI 1A6PA 4MVBD 4ZSOE 4P59H 6FABH 3NZ8B 4XBGA 1GYAA 3HAEB 4K8RL 5DURD 3HNVL 3CIQA 1FZOA 3QNYB 4GUPB 5E8OB 1OF2B 3U83A 4NUJB 1LEKA 4WI4A 5HHVH 2Z4QB 3U0TB 5D5MB 1WFNA 2NY4D 2FIRT 5FUOH 4XGZB 1MQKH 3ZMRA 3LQAH 1WBXA 3FMGH 1XIWC 3D1MC 1H9VA 4TUKL 5CJXA 4PJIB 4GAGH 5HDBF 5IVZA 3P11L 1TCRB 4JDZA 4RZCA 4G8GE 4MJ6B 3GGWA 3MGOA 4OFPA 2PW1B 5ICYA 3LEXA 2WIIA 4BH7A 4HWEL 1KC5L 5GS0C 4JO3H 4PJFE 4NFCA 4UU9B 3MBED 4JLRB 1ZT7B 5D96C 1UACH 2I9TA 3QUKA 3GSVB 5DRNB 5J0BA 5BQ7B 3D3VE 1CGWA 1P7QA 5DTFA 2X4QB 1KLUB 5D7IE 3S3SA 2DQCH 3BDXA 4JPKH 4WU5A 3FFDB 1ZT4A 1AI1H 1C12A 4XPFL 2QQLL 2A9ML 3MPCA 3HE7C 4X5WB 3AAZB 4QHMA 4NQSA 3MC0A 1BFTA 1AKJB 3MV9A 1Q0YH 4AEFA 2DJSA 5F70A 4DTGH 5L88H 2CJUL 1UYWH 1JWSB 1QPPA 3C8KA 1RK0A 4R4NC 2ITCA 1W8OA 5DSCA 1NGYB 1UCBL 3NZ8A 4WY7L 3VXMB 1GGUA 1YDPB 4NQDD 3OB0H 3QNYA 4GUPA 2WP3O 5E8OA 1OF2A 1EO8H 4NUJA 3TBVB 5D93C 4YDIL 1TETH 4R90L 2Z4QA 3U0TA 1IC5L 4XCFH 5D5MA 3PG2A 3FL7A 4XGZA 3ZE2F 5ALBH 5FUCC 4K7PY 2O93L 3EYQC 2ZJSL 1DR9A 3DSFH 3U9PH 4HUVB 1QG3A 1TCRA 2VKWA 5TDNB 1GAFH 4MJ6A 4K3DL 4XAWH 2PW1A 3AU1B 4P59L 6FABL 5DHVH 2QSVA 1YNKH 2ATKA 4OFYD 1ND0B 4UU9A 3TYGL 4JLRA 1EHNA 4Y16D 1ZT7A 4JY5H 5IKCB 3S34L 2AV1B 1EDQA 1A8JH 2YXFA 3GSVA 1WCBB 2C26A 1YUHA 3BZDA 4OGAC 5DRNA 5IWLC 2IC2A 3FMGL 1UG9A 43C9B 3DURB 5DQJA 2X4QA 1BEYH 1KLUA 2QL1A 1NC4A 3ARBC 4JKPL 4HJJL 3U7AA 1WAAA 3FFDA 3MLSL 2FBOJ 1CD1B 3O6FC 3C2SA 5KG9B 1PZ5B 2D7QA 4B53A 2F5AH 3QCUH 4KUZH 4X5WA 3LEYH 5CCKL 3AAZA 4OZIF 3VG9B 4Z7UF 3QFDB 3C5ZC 4NOBA 5EFIB 4BH8B 1CU4L 2I07B 2R2BB 1JWSA 2R29H 4KJWC 2ZUQB 2RAMA 2Z8VC 4D9QE 3KPRB 2AQ1A 4FXKB 3VXMA 1KB5H 3QUXC 4ETYA 1YDPA 2AXJA 4N68A 3R0MA 2DQCL 3NBNA 2QEJA 4JPKL 3TBVA 4JZNB 5IROC 4WWKC 1LDSA 5LXGH 3MUJA 4YXLL 3QEHB 4MVBC 4TQEL 1QFPA 1Q0YL 3QA3B 3CFCL 2P45B 1GGTA 5L88L 1OY3B 1UYWL 2VZUA 5TDNA 1ZHKB 3BI9X 3AU1A 2UZXB 3K8LA 1QRKA 4IDJH 4K3EH 1UT9A 2NY4C 3ZYOA 5I8KH 4P23D 1ND0A 1EZVY 2P5WD 5IKCA 3DWTA 1TETL 5I1JH 2XZQL 3OJVC 4XCFL 2CUMA 3SJVD 2V5MA 1X44A 4GRLB 3AS2A 2FH6A 43C9A 3DURA 5HHXL 3PGFL 1ZA6B 4FQXD 2HVJB 3WL9B 3HUJA 1PBYA 4N0FB 5FYLL 4XVTH 3MBEC 1MJ7L 5K93A 3U79A 1GAFL 3EYSH 3BWUC 4OM0H 1G84A 4ZDHB 4JJ5B 3QFDA 4TNVF 2HYMA 1ZOXA 5EFIA 4JY5L 4BH8A 2R2BA 5GGTA 1J05B 1I1AB 1MNUL 1N64H 4I3SH 1JRHH 4KI5D 4FXKA 4OGXL 4YHNB 3BDYH 3PABB 2VLKB 4O4YH 2ZSWB 5FYKE 2NY5C 4OUOA 4XAKD 1YC8A 2ICEB 4JZNA 4YAQB 3LKRA 3R0NA 4U1GB 2F5AL 5C7XH 2VDRH 3QCUL 4KUZL 3KWWB 3O3UN 1C16A 3MV9E 4Y2DB 1UJ3B 3QA3A 2HFGH 5DZLA 3NABL 4KQ3H 4N1EA 1ZHKA 4QRRB 1JTPA 2P8PB 4NKDB 1KB5L 3BKCL 3GFUA 4RWYH 1I1FB 3TZVD 4TNVK 1PD6A 4I13B 4TVPD 1MAKA 3FHQA 1FYTB 4GO6B 5D5ME 2R69H 2BSRB 1NLBH 3P4NB 1UADC 3QDJD 4KPHH 5LXGL 4GRLA 5L2KB 1ZA6A 4H25B 3M8OL 4N0FA 1PY9A 4Y16C 4OGYH 4LBEB 3EDJA 2NPLX 2V5YA 4JR9H 3QXUA 1J18A 5DMIH 2ZKHH 4ZDHA 4JJ5A 5IEKB 4DGYH 1L7IL 1J05A 1I1AA 4M5YL 5ISZA 2P47B 4YHNA 2ZG1A 3PABA 2YSSB 3MJGX 2VLKA 4ZYKA 2ZSWA 1WAAE 5DMKB 2ICEA 4EKXA 1X9QA 4YAQA 2A6IB 1FPTL 2AJXH 1K4DB 3KWWA 1A7OH 1H8NA 1IC4H 3C09B 4BFGA 4P5TB 1U2CA 4Y2DA 1J8HB 1UJ3A 5F7UA 5IGXL 4YDLC 4M8QA 3F6IA 4QRRA 1MAJA 3VXME 3QIUD 3IU4L 5F96H 4NKDA 4NQTA 1I1FA 1FGNL 1I4FB 1P69B 3QI9B 4O4YL 1IBGH 3L3HB 3ZKND 2EDOA 4M61B 5ACLA 4WVRA 1FYTA 4KHXH 3U7YL 3WIFB 2BSRA 3P4NA 5TDOB 2ZWLT 1AKJD 4D9LL 5C7XL 1KPUA 2VDRL 1D9KB 1JGVH 4UT9L 4X7DC 2X05A 4GG6B 2VDOH 3TV3H 3KPMA 4XMLH 5L2KA 3LQZB 4NC2B 4X8XA 5DXWA 2HFGL 4HWNA 4NOFA 1EEUA 4P9MH 4Y19B 1I1CA 4KQ3L 1JUFB 3MRPB 1W0WB 5C07D 5JHDD 4E9LA 3O81A 1JBJA 5IEKA 1MIEL 5HHQB 3S36L 4FQXC 2QTEA 1NLBL 1S7XB 3JV5A 4MJ4A 4OI9A 4A2LA 2Y1VA 4Q9QH 2YSSA 1CXFA 3MLZH 1H15B 4O5LL 3HUJE 4BZ1L 5DMKA 4MB3A 3PWJA 1QR4A 3QXWA 4DVRH 4ZO9A 4JRXD 2A6IA 3VFTB 4KXZH 4PLJD 2VO5A 3FOLB 4NWTL 1K4DA 3FO0H 5JQ6H 3FRPG 4M8VA 1F4YH 4JR9L 4KI5C 4J7RA 2ZKHL 4K23L 5HXMA 3T0ED 1AGDB 3AXLB 4EBQL 1BZ7B 5IP4A 1CQYA 1KF9B 1I4FA 3QI9A 5TF0A 1VFUA 1DN2A 3EYUH 4JFDB 3L3HA 3T8XB 3ARYA 3WDJA 4M61A 3IETB 1P84J 4CVWA 1OCWH 5ESQB 1SBSH 5BVPH 3EOTH 2BHYA 5TDOA 1D9KA 1G0XA 4K94L 1IC4L 4GG6A 2AQ2A 4J2XA 2BX5A 2CMRL 3LQZA 5E6YA 2QSCH 1A47A 1T83A 2D03H 3TZVC 4F80A 3KPRD 4Y19A 1UH2A 5EUOB 2HT4D 4POZD 1TVBB 4PB9L 3D0LB 5IESH 5F96L 1QBBA 1JUFA 3MLRH 4KTYA 1IBGL 4UILH 3Q3GB 5FM5M 1A6VH 2ZPKL 2GSIB 4LSSH 5HHQA 2B2XH 1N2RB 1RY7B 4EXKA 1CI5A 1S7XA 3CU1A 3D69B 1BD2B 1JGVL 4HIXH 3TV3L 4YNYB 1DBMH 2ADFL 1H15A 3OAZK 4LDEB 5JQHC 1MEXL 2CR6A 2O5YH 5J4MA 4HBCL 4OZFH 3VFTA 4M7LH 4FN0A 3DMMB 3FOLA 3PP3H 2OYPA 3ZL4L 1KJ2H 1AGDA 3V52H 4DVBB 3UPCA 4YBLC 3AXLA 4EVNB 5ADOH 5D70L 5LCVH 1MCDA 2QADB 2VLKE 3GM8A 5CUSL 4E41B 3VH8B 3LMJH 3KYMB 1FL6B 2VZ1A 2HLAB 3MLZL 5LBSH 1RIUH 2BMKB 4JFDA 1U58B 3VFNB 3IETA 4DVRL 5ESQA 1JPST 3DVFA 5CJQL 3OKLB 4NDMB 1N3NB 3QXTA 2DBLH 3P73B 5BOPA 3QIUC 2BCKB 4CN6A 4UT6L 3BRGC 3A0OA 3TO2B 2FYYA 5F93C 1IC1A 3ZKNC 4QRRE 5EUOA 1TVBA 3GSWB 4NQCD 3D0LA 4PTUA 5EPMB 1UM6H 5GGVH 1Z9LA 3Q3GA 1RPQA 3EYUL 3KS0H 4E42B 1FYTE 4ZFFB 2GSIA 2COQA 5DVKA 1VPOL 1SBSL 1N2RA 1U8KB 3D69A 1BD2A 5IW6B 1A6UH 1JMZA 2HWZH 3CX2A 3RY4A 3P0YL 5L2KE 4OFKA 4YNYA 2DICA 3OV6A 1SJVA 2QSCL 2DTSA 3B9VA 3U4BH 3VA6A 4NM8H 2CK0H 3VXUD 3ARDD 2DRUA 2X4NA 3SDCD 1CT8B 3DMMA 2AK4B 3U46B 4CKVX 3MLRL 4LPVA 3GMLB 5D2NC 3O2VL 2RCSH 4LHUG 5HDLA 4IDLA 3BGAA 1A6VL 4AYFA 3ZSSA 4LSSL 1RZJC 4DVBA 4PRPD 1IZKA 1NCDH 3ULUH 3L3OB 1NEUA 4EVNA 1MFDH 3GI8L 4PLJC 4E41A 3VH8A 3KYMA 1BZQK 1FL6A 1DBML 2D7TH 1CF8L 2HLAA 3VJ6B 5IBUG 2PW2B 1HI6B 1U58A 3VFNA 2YD8A 3T0EC 1FCGA 1Q1JL 1F8TH 4PRNA 2APWA 3OKLA 4NDMA 1N3NA 1TZGH 3P73A 3RTQD 1J8HE 2VUOA 2BCKA 4MAUH 3JXAA 4OCYH 3B2VH 4D9RE 5F1NB 1IGFH 1R5WB 3TO2A 1PQZB 4JG0H 1NFDB 5C0AD 3GSWA 1TPXB 5ADOL 5LCVL 4XPAL 5HYSG 1A6AB 3LMJL 1RZKL 5EPMA 4BELD 4TSAH 3GDBA 5C0GB 3M1BB 1RIUL 4ZFFA 1JL8A 5IVXF 4KKNA 3G5XB 4QHLB 3PWNB 5A2LH 5A2JH 4LFHD 4RMWA 1U8KA 3WUWB 2Z93A 4GG6E 4Q7DA 1J8HD 5IW6A 5ETUB 2HT4C 4POZC 5CSZA 4Z18A 3QT2A 1ZLWH 3S37L 3WKMH 1RU9H 1D6VH 1FNGB 1OQOA 4Y19E 4NC0B 3RGVD 1UZ6E 3UTTD 3HZMB 4B50A 2BRQA 4O51B 3LPFA 4U6HB 1CT8A 2AK4A 1PLGH 4PJDF 1IGJB 1ZGLM 3GMLA 5LVEA 4MLIA 1LDPL 3QBTB 3HR5B 1K3ZA 4ESKA 2VDNH 1ZE3C 3L3OA 4QXGH 3THMH 1UZ8B 1A6UL 2HWZL 4EUPB 1M7XA 2HT3D 4K8RD 3VJ6A 1N6QH 4BQCA 2PW2A 3WCYA 3U4BL 1HI6A 4M1GL 3U36B 2E8YA 4M48L 2XY1A 4X7FC 3L5WB 4DW2H 2AEQH 2VR9A 2FATL 1B90A 4N0YH 5JMOC 1BMGA 1IGMH 1S3KL 2VXVH 4PP2B 2RCSL 4XB7A 5F1NA 1VEPA 3GUTB 2YK1L 1R5WA 1PQZA 2DL9A 1NCDL 1MWAA 3EFDH 3GI9L 2A9NH 1C7SA 1NFDA 3GHBH 4V2BA 4RX4D 3VD4A 1JV5B 1IZJA 3P0VL 4LL9A 2DQEL 5GRUL 2C3HA 1A6AA 4NWUH 3S88H 4AEIH 5CEXB 4JFDE 1BVKB 5C0GA 4DAGH 3M1BA 3P2TA 1BVZA 2W60B 5I0ZA 1A6ZB 5C2UB 3BP5A 4QHLA 3PWNA 5FO9B 3GSNB 4U0RB 3WUWA 1PYWB 1TZGL 5ETUA 5IW3A 3FQNB 3TIEB 4MAUL 3QXVA 4OCYL 5L0QC 4LGPB 1IGFL 1T21A 1FNGA 3P40A 1I3RB 3E3QC 5EUOE 1NDGB 3HZMA 4JG0L 5LQBL 4U6HA 3UZEA 2X2YA 3ZE0F 3OR7B 1KEMH 3QRFM 2WQ8A 4QHKJ 1IGJA 4G7YL 1IFHH 1MELA 4TSAL 4ZTPH 3HR5A 2BDNL 1BD2E 4BZ2L 1UZ8A 3ARDC 3SDCC 1NGQL 4EUPA 1E0OB 4ONHB 2J8UB 4X6DF 1RI8A 1HINL 2H26A 3CSGA 1INEL 5DWUH 4Z77B 3QDHA 3U36A 1EVTC 4YEEA 3L5WA 4J3WA 3QAZB 3WJJC 1PLGL 1MI5B 4OZFG 5L7XL 1XMWA 4PP2A 4H8WH 2CD0A 1Z0MA 3GUTA 1OTUD 1A14L 4LIQE 4QXGL 3THML 4JM2D 1JYVA 2ZUVA 1JV5A 3DVGB 4E41E 3DXAD 3L6FA 3UJTL 5GGTH 3G5ZB 1OAQH 5CEXA 2UWEB 1BVKA 3RTQC 3QHZH 2EIZB 2W60A 1A6ZA 4KMTH 1ZHLB 5FO9A 1MCFA 4DW2L 3GSNA 4QRUA 4CVZB 3BE1H 3WO4C 1PYWA 1TTUA 2E7BA 4PJEF 4XWGH 3FQNA 2ZG3A 3TIEA 1IGML 5DMGD 3BGMB 3IDJB 4FQCL 1KIUA 3F7PC 1I3RA 3EFDL 3KXFA 1NDGA 2APVA 5DC4B 3B6SB 1D6EB 3C87A 3R8QA 4OZGF 4P5TC 3NACH 4NWUL 1U93B 4AEIL 1QBAA 1PG7H 3RGVC 4LNVA 2NZ9D 3ZKMD 4OGZA 2PXYD 4I9WE 3MRLB 4ONHA 1HHGB 2J8UA 4GMTL 3S35H 2GTWB 4YHZH 4Z77A 5J9PB 4IRZH 2X09A 1HH9B 2AK4E 1B0WA 3W82A 4F9PA 1LP9B 3IU3A 3HMWL 1TQBB 5A16B 1MI5A 4OCXH 1XF1A 4GAFB 4YUEH 1GGBL 2HT3C 4K8RC 4XNZC 3L95B 4WTXA 1IEBB 4XVJH 1MCNA 3QIBB 4OZ4B 4FFZH 2R56L 3DVGA 2BNRD 1NGZB 1VADB 2DQHH 4KMLB 4MQTB 3G5ZA 5A43C 4OCNC 2UWEA 3MJ6A 4NBZB 2AABH 1FBIL 1KCLA 4NC1E 3V6OA 4Z6AT 3TBYB 2DDQL 3GRWA 1ZHLA 2JELH 4CVZA 2X7LA 2FEEI 5ICXB 1EIBA 3ZHKA 1L0XA 4K7PH 3BGMA 5ERWB 4MJIA 3IDJA 5FYLD 3FFCD 3RA7L 1NFDE 1IAIL 4M1DL 1I9EA 3B6SA 1D6EA 3HHRB 1MRCH 1KIRB 5JW4Q 1Q9LB 3QWRD 4ZAKB 1U93A 3QZWG 5DHXB 4JHBA 1GHFH 3ARXA 4N1CA 4I0PD 3T2PA 3RI5F 4CMHB 1S9WB 2VJXA 3GSRA 4C57C 5HVFB 3BE1L 5ICZB 1J0ZA 1T7ZA 4I8DA 3V8OA 4MXVF 4M02A 4XWGL 3ILQD 3MRLA 1B4RA 4RFEB 5KVFH 1HHGA 4L3CA 5SV3A 3DIFB 4NNPL 2GTWA 3QHTC 3T04D 5J9PA 1L7TH 3IVKB 1MJUH 3QQNA 1C7TA 4DN3H 5BZDB 1HH9A 5E6IB 4MNQB 2J8HA 5FM4A 3NA9H 7FABL 1KTDB 1LP9A 4KTDH 1Q9KB 4I3GA 5A16A 3ARPA 4YBHA 3OJDB 3MBXH 3T3PF 2FLRT 3L95A 3BSZH 3Q6FB 1IEBA 2J7LA 2BFVH 3QIBA 4UV4L 4OZ4A 4MXWH 1E4WL 4HULB 4GJTB 1A21A 4NRZA 5C2BH 3O11B 1GOGA 4PJ9D 1NGZA 1VADA 3V6ZB 3F7RA 4QNPF 1I9IH 3MRJB 3QUZD 3BISA 3TBYA 3RI5K 3KHQA 1OTUC 3GIZL 5T5FL 5ICXA 1E6OH 4JM2C 4OCXL 4HZLB 5FM8A 4YUEL 2R15A 4PJXB 3QEQB 1YNTA 4XVJL 4FFZL 4LRIA 2R2EB 2E9BA 4OFIA 1KIRA 5F9OH 1Q9LA 2DQHL 4ZAKA 1WIPA 4Y4HB 1NCWL 3BD3A 1MFBH 2K9UA 2AABL 3S6CA 3X11B 5DMGC 2GJJA 1YEHH 4U3HA 3VFUB 2JELL 1S9WA 1HDMA 3D6GA 1T2XA 5D7IF 5ICZA 4JFZH 4WV1B 2QADC 4FQLH 1MCPH 3JWDH 5JW4M 3EGSB 4JEGB 2X70B 2B20A 4RFEA 1G7JA 4K7PL 3DIFA 1DBBH 4ZFZB 1JTOA 3KXFE 4C4KT 3IVKA 2AI0H 4Z7QE 5C1MB 5BZDA 4ONGH 5E6IA 4IMKC 4LVHB 1MRCL 1KTDA 3WDHA 2NZ9C 4Y8AA 3ZKMC 1U91B 3OJDA 3FJTA 1FHGA 2PXYC 4QTIL 4OB5L 5DQ9B 3X14B 5BV7L 4JY4B 3Q6FA 5HVWA 2UY7A 2PO6B 3DOSA 2A38A 4AQOA 2E27L 2J8UE 2H1PL 4OIIH 3TO4B 5DYOA 3V6ZA 2GK0A 4N8CH 3MRDB 4HT1H 3MRJA 1YY8B 5F1KC 4JFED 4MD5B 3O2DA 5BS0B 1MI5E 1XFPA 4KTDL 5EC1B 3MBXL 4MS8D 2VXQH 2JJTC 1U2HA 4HZLA 4XPHL 3TBSB 1Q0XH 2GFBB 4PJXA 3RBSA 3QEQA 25C8H 4HW6A 2MCPH 1FNAA 1FFNB 2R2EA 4D3CL 1A7BA 1JF6A 2FSEB 2LV4A 1PX4A 5DQDH 2FHBA 4KFZC 4EOWH 2UWEE 4LLUB 1CG9B 2BVYA 2NY3B 4Y4HA 3V6OE 1FC1A 3X11A 2VLJA 3AMKA 3VFUA 1HE7A 3ZTNH 5EWIH 5D7JD 5DEFB 4NKIH 3EGSA 2DIAA 3WDIA 2X70A 5C70A 2XWJB 5HY9A 4MJIE 3ARVA 4RRPG 4ZFZA 5JXED 3WIIH 3S4SB 2X4OB 1FORH 4I0PC 3TT3H 4C58B 4EI5D 4LHUD 3TN0B 5F9OL 5E4IA 1U91A 3HMXL 3KYNB 3ILQC 4ERSH 2DL2A 4Z7VA 5DQ9A 3X14A 4JY4A 3LDBB 3EYVA 2PO6A 5INCA 4YDJA 4Z9KB 2B5IB 3GEWB 4FQLL 4Y5YB 1MCPL 3JWDL 4I77H 3PDOB 1FNLA 3TJEL 1U8OB 3MRDA 1DBBL 1B88A 1WF5A 3NFSH 1YY8A 4KDWA 2A77H 1J88A 4S2SB 2AI0L 3RY5A 4MD5A 5I8CB 2AGJH 3P4MB 4QCIB 1LP9E 1A1OB 5E8EA 1D5BB 4JFXB 3TBSA 4PJ9C 1CGVA 1FFPB 3LS4H 2QV2A 4OD2B 2LTQC 1U3JA 2GFBA 3HKFA 3QUZC 2V6HA 1QUNA 3LOWA 1XH3B 2NCMA 2FSEA 1OP5K 5EZIH 3MZTA 5CD5D 4LLUA 1CG9A 4N8CL 4HT1L 4LIQH 1JPFB 3H3PL 2VQUA 5E94A 4F9LA 5DEFA 3OF6D 2EZ0D 4NO0B 2NX5B 4YJZL 1Z2KA 4EJ1C 2XWJA 3FT4B 1MCWW 1UB5B 3S4SA 2MCPL 2X4OA 1YPZB 3MLUH 1T7VA 5DQDL 3TN0A 1TENA 4EOWL 3LN5B 2I25N 3KYNA 3UXFA 2VC2H 1IM3B 3JBG7 3SKNA 1LVEA 5EWIL 4KC3B 1FIGL 1MF2L 4Y5YA 2HJKB 3RNQB 1LD9B 3WN5B 4WHCA 1HXMB 2R4RH 1FVCB 1LO2H 1TITA 2JIXB 3PDOA 1KEGH 1DJSA 1U8OA 4HK0B 4W6WB 4S2SA 4W4OA 3WV0A 4MNQE 5I8CA 1FORL 3P4MA 4QCIA 2BERA 1A1OA 3HI5H 5IM7B 3FAWA 1RJCA 1K9TA 1WBYB 1D5BA 4JFXA 1FFPA 4OD2A 4LVNB 5SX5H 4F7EB 1SJHA 5HHMD 2OJZH 1OHQA 2D4DA 1GGIH 4Y4FB 4HS6B 1S5IH 4Q6IC 1XH3A 1EJOL 5I6XC 5C71A 3QISA 2WNGA 5H94A 3BVNA 2EDNA 5IFHH 1N6UA 1G9EA 4YZFE 3OPZH 1ZHNA 4MS8C 3NFSL 1V05A 3GHEL 2IAND 4P4KB 2AGJL 4JZJB 3ZDZE 1EHXA 4PJIF 4LMQI 5SWSD 1SMAA 1N0LA 4NO0A 5CEZE 1A3RL 2NX5A 4X80H 3IDIA 3FT4A 3LS4L 3V5DB 4PJXE 3ULVL 1YN7B 2I60L 2KL6A 3QEQE 4HWBH 1UB5A 4GS7C 3BKML 4DOHB 1TLKA 3QNZB 3HC4L 4XCEB 5GGRB 3OG6B 4KAQH 4JB9L 1U41A 2CR3A 4XMPH 3AGVA 2W0FB 2QKIB 5DJXB 1U8HB 1YPZA 4QRSB 5D7JC 1MWAH 4QRQB 1SJXA 3LN5A 3S7GA 3E6HB 3HG1A 4V1DB 1W72B 1ADQL 2VLJE 4CADB 1G9NH 1IM3A 3MNVB 4GRWB 1VFAB 1G7IB 1WIOA 5JXEC 4N8VB 3B2UD 4OLWH 4UDTB 3RNQA 2HJKA 3WN5A 1LD9A 4Z95H 4LSQL 1HXMA 5FYKU 4KTEH 1FVCA 4EI5C 4K2UL 4PJCB 2JIXA 2CRIA 2OI9B 3CD4A 3MNZB 1OT1A 2C7UB 3MMEB 2O61B 1RIHL 2ERJB 5DFWH 2B4CH 3W9DB 4NSKB 1FNEB 2XTJB 3MLUL 4F57H 5IM7A 4R4BB 1WBYA 3ABZA 4KZEL 4IJ3C 4P2QB 2HFTA 1AD0B 4F7EA 5EORL 4YX2H 4M7ZC 2VC2L 2L7UA 4Y4FA 4HS6A 3G08B 1LO2L 4LCCC 1KEGL 3MOAH 1O7SA 2OCFD 2X89D 5DEZA 2HG5B 3RWCB 3FQRA 4P4KA 5BS0E 4JZJA 4U7SA 5GS1A 2HKHH 2VZTA 1FFOB 2K3TA 2W9DH 2YN3A 1TNMA 2Y7QB 3V5DA 5CD5C 1FN4A 1YN7A 4LP5A 4PR5B 1OAYH 2BHUA 1BWMA 35C8L 3QNZA 4XCEA 5GGRA 3GNMH 3DRQB 4LSDA 4RAUB 4UQ2B 3TO4D 4LVOB 2W0FA 5DJXA 3VGFA 1U8HA 4QRSA 5MHSE 3BZ4A 1UM4L 4QRQA 1XGYH 2EZ0C 4ACPA 4V1DA 4G7VH 1W72A 4NN6C 4CADA 3MNVA 1P7HL 1VFAA 1G7IA 4G8FB 1XGPA 3QDGB 4YE4L 1K5NB 4N8VA 4UDTA 5FF6B 2GYSA 3RNKB 4PJCA 4X5LA 1AO7D 3MNZA 1BECA 4HWBL 2C7UA 4BYHA 4FZ8H 1CTOA 4O9HL 3VWKB 3D39B 4GLRH 3MMEA 2O61A 2Y4SA 4KAQL 3W9DA 5KAQG 4NSKA 3GKZA 1FNEA 3C8DA 4L8SA 3WFDH 3WSQL 4R4BA 5J1SC 1WFUA 3CXDH 1EEQA 1NCUA 4P2QA 1AD0A 2YUXA 5J11B 5DVLA 1JZ2A 3KPSB 2Q6WB 3ULUD 3G08A 4YQXL 4HKZB 4OLWL 1T1XB 2A6JB 4Z95L 1CFBA 1CLYL 3FN0H 2NTFB 4GKOA 4FMFA 1KXTB 2F74B 5I1EH 4N9GB 4BQ6A 5GISH 2HG5A 3RWCA 2B4CL 5BV7B 1T5XB 1WZLA 3CPLB 3SDDB 5JOPD 1A64A 1FFOA 4GXVL 3BPNC 3PWUB 1GXEA 5FV1L 4PR5A 5F9DC 4Z8FL 3DRQA 4MA3B 4RAUA 5E2UL 4UQ2A 3F62A 2W59A 3BKJL 2OXHA 1CDHA 1KENH 5C0BB 1RUQH 3CCHA 4FQIH 3BEWB 4DFIA 2NR6D 3BIBX 1WGOA 3QDGA 4HXAH 5EBGA 1K5NA 2VDQH 1HCVA 3LN9A 2NX5E 2VISB 5FF6A 3VH8G 2HKHL 3GRWH 3RNKA 1G0DA 4ODSL 4JPWL 3VWKA 3D39A 2EDHA 2JCCB 2D3VA 12E8L 1PGRB 1YPZE 3H3BC 5EOCH 1CGUA 4Y5XB 3PDDA 3B2UC 1BIIA 2FD6L 1XGYL 3W9EB 3MRBB 3VRJA 4I18C 2AEWA 4CRPA 3KPSA 2Q6WA 1A4JB 4M62L 4HKZA 2LABA 1T1XA 4PG2A 4PJHA 5KVEH 5DA0B 2EDTA 4Y89A 1W0YT 2OL3B 5SWZD 4BQ8A 2NTFA 4O2FB 1IEAA 1MFCH 2F74A 3MJ7B 4LSTH 2P43B 5HDOA 4WV1C 2YZ8A 4PRDB 4CL7A 3OXRB 1T5XA 1G1CA 3CPLA 1E4XI 3RQ3A 5IIEA 2Q20A 1WWAX 2K7PA 3TFKD 3DLQR 5C0EB 3PWUA 5EULV 3TPUB 5MI0C 1BQSA 2APXA 4ZUTB 4EN3A 3HN3A 1RZKC 1F3JB 4N90D 5B3JE 2D2OA 1BFVH 4ZS7H 1T80A 4OT1H 2N56A 1QSEB 1NBQA 1RVFL 1KTKE 3FN0L 1EA9C 1KLFA 5C0BA 4JANB 1CE6B 2J2ZA 3L3IB 5GISL 2JK5B 3BEWA 1HK6A 4DGIH 1AGEA 2X42A 2VISA 4OF0A 5F97E 2JKXA 3TO4C 3VXSB 4XC1L 3PGCB 1FAIL 4DOHE 3T0WA 2JCCA 3AUVA 5DJYA 4QOKB 4POUB 4PRID 2HH0H 4V1DE 3WS3B 3EZJB 4O2EB 1J11A 2CKNA 1ZLSL 3W9EA 3MRBA 1ITCA 4EDXB 1RUQL 4GRWE 4MHHI 1F4XH 4FQIL 5B8CB 3JWNC 1A4JA 4PBWD 4HXAL 4LCIL 2YWYA 3UX9B 4GKZB 4PJCE 2YD4A 2M1KA 2OL3A 5DUPL 4O2FA 3HZVB 1AE6L 2ZZUT 3HMXA 2JJSA 3WUWG 1LNUB 2XTJE 4PJ5D 4PRDA 4XP5H 5EOCL 3ECBB 3ULUC 1FZMA 2EDQA 3UTZB 5F6IB 3LHPH 3P30L 4P2QE 1CVSC 4ZUTA 1F3JA 5T1DH 3HE6B 4IRSB 3ARZA 3OMZA 5L2JB 1KELH 3NPSB 1F02I 5L8LB 4UT7H 3BMWA 1QSEA 1FAKT 1S9YB 5BVJB 1INQA 4JANA 2Z0BA 4PS4L 4GG6F 1CE6A 3FB5B 3L3IA 4DQOH 1C08B 2PTVA 3U4EB 4DN4H 2W0PA 1AQKH 3GIVB 4M7KH 4MZ3A 5AYUL 2Q8AL 4NIKB 4XHQA 1I85A 4NZUH 3PGCA 3MXWL 1RZ7L 1KBGL 2RFXB 2EKJA 5CEZH 3LV3B 4QOKA 1BFVL 2NR6C 5KJRH 2W9LA 1NCBL 4KGJA 5L8KB 1GC1H 5AWNL 5DEGA 2VZ3A 4O2EA 5FYJE 1I8IB 3SPVB 3OG4B 4DEPB 1UEMA 5DVNA 2V9RA 5TE6H 3QDGE 5DZOA 5B8CA 4IOFD 5GQBA 4DGIL 3K7UA 1NCCL 1BOGB 5JIKA 1MCOH 4GKZA 1XZ0B 1T7XA 4CNIB 5JZ7D 3TT1L 3PQYD 4TSBH 3D39E 3HZVA 2YPLB 2WW8A 3HC3H 5TGBB 4YPGB 4TTGA 3ECBA 2J1KA 2J3SA 1CDYA 3DGGB 1OSZB 3UTZA 2HH0L 2IPUG 3LH2H 2PYED 4K07A 1G7HB 1JPTH 4ODVH 3KPSE 3VD7A 2BVTA 2ZCLH 4IRSA 4PJHE 1VGEL 5L2JA 1FO0H 3B9KB 4ZOEA 5DFVD 4ODTH 3SGJA 2P24B 3TFKC 1S9YA 3QSKB 5BVJA 4Y1AB 5JDJA 3KYOB 4UZGA 3WLWD 2VXUH 3FB5A 3T08A 4P0DA 1C08A 3U4EA 4XP5L 5JPMB 2NY1B 3GIVA 3VI4F 3WUZA 4MD0B 3LHPL 4OBSA 1U6AL 5EG6C 5DUBB 2AEPH 2RFXA 1AD9B 1BBDL 3F7YB 5E08L 3TWCH 3OXSB 1IRAY 1LK3H 5CIPH 4EEEA 5H35A 4PB0L 3IRZA 1G9ML 4LVNC 5C0BE 1I8IA 1LO5B 5CZKA 1ZTXH 3SPVA 2D9QB 4L3AA 1F4WH 3SDDD 1A22B 4DQOL 3E0GA 2ICWJ 3NA4A 4DN4L 2P4AB 5BMFH 1R0AH 4JQXC 4LLDB 3UBXG 3DUSA 1HYRC 1XZ0A 1FLRH 4PRAB 1TJHL 4WFGE 1JZ8A 4XNYH 4NZUL 4MWFB 3K0WA 3VXRD 4F33B 3QG7H 2YPLA 2JCCE 5EBWB 1NMCB 4JG1H 5TGBA 2NY7L 4YPGA 1ADQA 1AIFB 1IJ9A 5KJRL 3DGGA 1OSZA 1RD6A 1KJMB 1GC1L 4G6FD 1R6VA 1G7HA 3MXVL 4NN7B 2N4IA 4KQ4L 1T3FB 4C83B 4G9FD 1HILB 1RZGB 1MCOL 3B9KA 5L9DH 4H88H 3VRLF 3B3IB 2P24A 3VGBA 4Y1AA 3KYOA 3HC3L 1QSFB 1K4CB 3HS0B 1XF2B 5JPMA 4MD4B 5D4QA 4MD0A 1RUKH 2AJUH 3LH2L 1EX0A 3BH8A 5BRZD 3BFOA 4J23A 1JPTL 5I71B 1UC6A 4ODVL 5DJZA 3JV4B 2ERJC 5DUBA 3C9NB 5DR5H 4Y5VA 4BSVB 2ZCLL 5TE4H 3F7YA 2XTJC 4OZHB 4XP9H 1F13A 1QSEE 3OXSA 4H0IA 2NXYB 1WBZB 3NIFF 4HUUB 5GZND 3AM8C 4RMRA 5C0ND 3UYRH 4ODTL 1EUUA 1UH4A 1LO5A 1MCQA 5EIVA 1AHWB 1JE6A 2YUWA 4Z7NE 5C0FB 2DTMH 4Z7OE 3JZ7A 5CP7B 3PJSB 3MOBH 3V4VL 3VXSE 2ZUYA 1R3IL 3A6OA 4LLDA 1GGCH 5CJ5A 2XKUA 4Z7UB 4PRAA 4QRPB 4XP6L 4L4TD 4MWFA 5CD3B 4F33A 4JPVL 3MJ8A 1KIQB 3U30C 4QOKE 5FCUH 1AIFA 1IVLA 4IOFC 1LK3L 5E2WH 1KJMA 2Z31D 4LKCB 5CJBA 5ITBH 3Q6GH 5KW9H 2XFXB 2MHAB 3CVIH 4NQED 3WS6A 4YXHH 1A9BB 1XEDA 2P5EB 3C60B 5I0DA 1F4WL 1UXWB 1NL0L 2EXWD 3MRIA 4LHQB 2DQUL 5T3ZE 1T3FA 2NW3B 1YECL 3VXSD 4KROB 1D3CA 4U7KA 3KYKL 1MHEB 1RZGA 1WSST 5CJOH 5HYQB 1OWWA 5EOCJ 1P84K 3B3IA 4XNYL 3ZE1F 3BYYA 4PJAF 1DBKH 4PJ8B 5F9WC 2JTDA 4LQ1A 1QSFA 1BLNB 1K4CA 3HS0A 1XF2A 4N8PA 3TVMB 3OB0K 3GMMA 3PGDB 4ZUVB 4O02H 1K85A 4XXCC 4U1MB 3PP4H 5DFVC 3JV4A 1R5VA 2X4TA 5FGSA 3IXTA 5I9QB 3WLWC 4MSWB 3GBML 1I7UB 4S1RH 3HFMH 1CWVA 2GAZB 3V9FA 3BRFA 2CKBL 4HUUA 1T2QL 1WBZA 4H88L 3VFPB 4BZYA 1J8KA 5K9OB 2IH3B 5J11C 1B0RA 1N7MH 1T1YB 1WTLA 4U6VL 1FH5H 1AHWA 5C0FA 3BD4A 4HGMA 3V7AG 5CP7A 4OJFL 4OZIA 5IB1B 2OJEB 3PJSA 1MAML 1T7YA 1RUKL 4Z7UA 2AJUL 1NUFA 4QRPA 2YRLA 1WWCA 4W81A 1IT9L 3HE6D 5CD3A 1A6WH 1OAKH 4LRNH 1KIQA 2XQYK 4WEBL 4HF5H 1KPRB 3SDDC 5TE4L 4X9BA 4FTVB 9CGTA 1H3XA 2FJFB 3WEXB 1S7RB 3T77B 3SBWA 1DLFH 4LKCA 3HCVB 2F53B 1YEFH 2Q8BH 2MHAA 1DQLH 1MCSA 3L7EB 1A9BA 2P5EA 3C60A 1UXWA 3ULVE 1X5YA 4KGLA 3LS5H 2NW3A 3VMNA 1W72H 4WI8A 1MQ8A 4NZDA 4GRWH 5J8OA 2Y5EA 5HYQA 1JVKA 1CIUA 2YPLE 4AG4H 4PJ8A 3BZEB 5BW7C 3U4AA 5I74B 2RQ8A 1YNLH 5JLZB 1BLNA 4KH2A 1UKSA 4MB5A 4WHTB 1U8NB 3TVMA 1QPXA 15C8L 5E2WL 3BXNB 5LGKA 5ITBL 2BP3A 3PGDA 4QT5B 4WFHE 4ZUVA 1Z9SA 1CQKA 1KCSL 5KW9L 4CN1A 1XCTB 4U1MA 1F3DJ 2ITDB 5LAXA 3PWPB 4MSWA 3L5XL 1I7UA 4Y5XC 3KVQA 2GAZA 4JFQB 2FHFA 5CILL 3VFPA 5CJOL 4JM4L 3X17A 3U0WH 1KOAA 5HDBE 5K9OA 4DZBA 2EEBA 2IH3A 4KWUA 2VR5A 4Y1AE 1T1YA 1DBAL 2EDEA 1Q8MA 4YHML 4O58H 3SOBL 3BAEH 5IB1A 2OJEA 1TVHB 4ZFGL 2XZCH 1QLRB 2K1MA 5GZNC 4Z7QF 5DD0H 5C0NC 4EZMA 1DFBL 5T1KD 5B21A 4L9DA 1KPRA 4U1HB 5GZOD 4FTVA 4S1RL 1I7ZB 2XWTA 3WEXA 2YA1A 1S7RA 3VD9A 4X7SH 3JWDC 3K4AA 3HCVA 2F53A 3LAFA 3L7EA 1FH5L 3A67H 4OF8A 2LU7A 4OLUH 4PRHD 5IK3B 1PKOA 4NRXB 5HJ3B 5FYJH 3QCTH 5IFJA 3O6MH 3C6SB 2Z31C 5JA8B 3BZEA 1OAKL 3CLEH 4LRNL 5JW3H 4PG9B 4H20H 4K3JL 5E95B 1K2DB 5JLZA 2EXWC 4RFNC 1F2QA 4PTTA 4WHTA 4G8IB 1EJ6A 3BXNA 3LPGA 3WFCL 1DLFL 4QT5A 1YEFL 2Q8BL 1XCTA 2ITDA 4LLVA 3S4SG 5CAYB 3BT2H 5TH2B 3LS5L 3PWPA 4JPIB 3ZE2E 5ANMB 4XCYA 4Z0BL 4JFQA 2NNAA 1J0KA 3HZKB 5J3HD 3O6LL 1QSFE 3MV8A 4OQ1A 3RKPA 1P1ZB 1FDLH 1HCFX 5C0RL 2FJHB 2X4UB 5T3XH 1TVHA 3EO9H 1IC7L 1NAMA 1QLRA 4UOJA 1HIML 4W4NA 3TNMA 4RDQG 1JNNH 5IB4B 4GAJH 4U1HA 4JRYB 4ODUB 4NZRL 1I7ZA 5I1GH 3GKWH 4G8EB 4CN4A 3HE6C 5IK3A 4O58L 1JZ3A 3NPSC 4NRXA 1WZ1L 4KRNA 5HJ3A 5GPRA 1U8IB 5EA0L 4Z7UE 2XZCL 3SO3B 4QRPE 3WFEH 3AB0C 3C6SA 2WBJB 3MRCB 3VD3A 2CXGA 2D7MA 2F5BL 1K2DA 3BPCB 4R97C 4YHLH 4HDIB 1V3KA 4G8IA 2SEBB 1A5FH 1LMKA 4OF6A 2P5EE 4WUUA 1DSFH 3A67L 4FZEH 3W11D 4ONFH 3CFDB 5LKNA 2OXGA 2YS4A 5TH2A 3MLWH 4JPIA 5GRJH 2VKXA 5ANMA 1GPOL 1QFHA 4BUGA 1F00I 3PNWB 4GW1B 2YUZA 3QUYD 3ULVC 1AGBB 1CD0A 3ULSA 1P1ZA 4LCWB 4GXUM 4H20L 2FJHA 3AS1A 4G6KH 2R4SH 2X4UA 5K9QG 1AFVH 3B9EA 1MIMH 2W91A 3EBAA 5IB4A 1BJ1H 2X1QA 1INDH 2BSSA 3A6BH 5I73C 4JRYA 4ODUA 3OZ9H 5FK9A 3QJFB 2APFA 4G8EA 1KCKA 4OD3H 2H32B 2OSLB 3QIWD 5C6PB 4WFFE 2C3WA 3H9ZA 1VFMA 3VA2C 1U8IA 1CD8A 1YYML 3RVVD 1MRFH 5GZOC 4JFYB 3EO9L 1IAIM 4LP4A 5L6YH 2KKQA 1CFVH 2BY1A 2WBJA 3MRCA 2IFFL 2AVGA 4FTVE 5JIHA 1UXSB 1Y0LB 4JVUA 2YD6A 2NY1C 3BPCA 4HDIA 3GKWL 1T20A 4YGAB 1CBVL 2SEBA 2F53E 1I1RA 4P3CH 3QRGH 3DO7B 3TM6A 4M93B 3CFDA 5CINL 5DGRA 3LRHA 4LSUH 4A6YH 4NGHL 1UWGH 2VIRB 3WHXB 4PV8A 1Z3GL 5T3ZH 3PNWA 3EO0B 4NKQB 3CSPA 5EOQH 1AGBA 3IFLH 4LCWA 1ULVA 4N8VG 3PWVA 1JYNA 2Y23A 4NUGL 2R8SL 2YBRB 3H3KA 1G6RB 4Q74A 1VA9A 1QZ1A 1A5FL 2IBGA 3SE4A 3MJ9H 4PGEB 1DSFL 5J3HC 1Z6JT 2ZCHL 3PWPE 2EH8H 3MLWL 2QLVB 4ZPTB 5GGSY 5GRJL 2HT2D 3QJFA 5DJ0B 4S0SD 2Z8SA 4L29A 2H32A 2OSLA 2EDLA 2BZDA 3ARQA 5D7LB 3MCKB 4LSRH 3BDBA 1DVFB 4G6KL 4OD1H 4JFYA 3N9GH 4WIQA 2J88H 1WFTA 2CKBB 4BKLB 4TNWF 1FL3B 2F15A 8FABB 4UDUB 1INDL 1P6AB 4UB0H 1UXSA 1Y0LA 4HBQA 4JDTH 4WJ5B 3D9AH 2XG4A 3DO7A 4X4YB 1DEDA 1MJ8H 2R0WH 3V5HB 1MRDL 5M7QA 5IF0B 3PP3K 3U7WL 3RIFF 2B4CC 4N5UA 1RJYB 2VIRA 3WHXA 4ZO6A 2FLBT 1OT2A 5ABDE 4KKCD 3PIQB 4NN5C 3EO0A 1YEEL 4WTWA 1QKZH 3W11C 3QFJD 4HIEB 3VXOB 4WGWB 2YBRA 2A74B 1G6RA 2OR7A 1JHTB 3BW9B 3QRGL 4WUUE 2AAVA 4OBRA 3KJ4C 1Y6KR 4PGEA 5IVXB 1BPVA 1C5CL 1P5VA 3QDMD 1HEZA 4URTB 3O8XB 3QUYC 4QHUB 4ZPTA 5ANME 4A6YL 5JO5A 5DJ0A 5IMLB 2VLRD 5GHWL 1R3HB 3TH4T 2C3GA 5AZEH 1NBVL 3U82B 1N5YL 2AP2A 2JF1A 4M6MH 4OF7A 4JFHD 3NFPA 5D7LA 5EOQL 3MCKA 5E0QA 2IAMD 3D2UB 5D1XD 4R7NB 4ZXBB 1DVFA 3MV7D 4UINH 3RIFK 3BPOC 4PJDB 5EU6D 3PWLB 1FSKB 4BKLA 2CKBA 5IBTH 1FL3A 8FABA 2BNQD 3QIWC 4NYLA 4UDUA 4JRYE 3SE3A 5LWYL 4LPUA 1QFUL 2ICES 3BESR 4APQD 4XXDB 4WJ5A 3KPTA 1LWRA 3CUPB 3RVVC 5TFSH 3UPRB 3D85D 1GSMA 3H0TB 2FB4H 3V5HA 4MA8H 4LSRL 4WI7A 1KCVH 5IF0A 4LSVL 5C8JB 2YPVL 3EHBD 4OD1L 1RJYA 3C2AH 4U05A 3IGAB 2J88L 3OKOB 3UTPD 4D0CB 1BJ8A 3SKJH 2JJWA 4AEEA 4HIEA 3BMVA 3VXOA 2EE3A 2A74A 2Z8WC 1OM3H 3BW9A 1JHTA 4HPOL 1S5HB 4P46B 3U1SH 2G2RB 1LE9B 4S1QL 4XBEL 5IVXA 2XNAB 1MJ8L 2UUDH 5HI4D 4DUWA 3RX5A 3RWFB 3O8XA 4QHUA 4LSPH 2W65B 5IMLA 2KH2B 1R3HA 5SX4I 4GAYB 4X5XB 2QR0B 3S35X 3RPKA 1NFIB 1I8KB 2FX8H 4AIZB 4LCWE 4AY0A 1QKZL 1H5BA 3D2UA 1KFAH 3ORJA 3KLAB 4ZXBA 2L4OA 3FTGB 4PJDA 3F58L 4R6UA 2HT2C 3PWLA 3BX7C 4X6CB 3OGOE 4IS6B 4FFVD 3WYRA 4TOYH 5DT1L 2R9HD 2FO4B 1XIWB 1A7PH 2AQ3A 2DQDH 3AVEA 3OAYK 4XXDA 1ZLWK 3T2QA 5AZEL 2A1WH 2CUIA 2ZCKH 3ZHDA 4M6ML 3UPRA 4DGVL 3H0TA 3SCMD 2J12B 4X7CC 2VN7A 3NOIA 5C8JA 4UINL 2O5ZH 1ZAGA 2JB5L 5D96B 2EDDA 3FT2B 3IGAA 3OKOA 5EIIB 2M8XA 4XPBH 1OLLA 3V5KB 4D0CA 2J6EH 4JQIH 5I1AB 3IDXH 5B4MD 1HSAB 1YMMD 3E1F1 2XT1B 4P46A 3EJYD 2G2RA 1LE9A 4ZQKB 3J8F7 5I19L 3HE7B 4KKCC 5CP3A 1JFQH 5D1QD 3RWFA 2DLEA 4C56D 4POYA 1KCVL 2WUBH 5FA3B 2W65A 4Z78B 3I6LE 4PJEB 1MCHA 4Q97A 3HLAB 3BWAB 4LLQB 4ZUSB 4YHKL 3Q5OA 4GAYA 4X5XA 1K3IA 2NZIA 3HPJB 3KR3H 4X9FA 4LEXH 1NFIA 1I8KA 4AIZA 1WTGT 5ALCH 3P77B 4IRJD 4OZGB 1F42A 4KRPD 3FTGA 5D93B 5KS9F 4X6CA 2PR4H 1AXTL 3U1SL 5A1AA 3NIDE 4IS6A 3I75B 4KMQA 2VDPH 5D1ZD 1KJ3L 2ARJQ 4HUMB 2FO4A 3RWHB 1XIWA 2YD1A 2RGSA 5F89B 2EYTB 2IAMC 5D1XC 3JVGC 1OW0C 4KUCF 5D7LE 3QO0B 1S8DB 3RAJH 3PV7A 4PJCF 1OTTD 4JHWL 5KSVB 1OB1B 2UVFA 3TP4A 1R5IB 4L1DA 1TFHA 3H6JA 1JGLH 4KDTC 1JGUL 3FT2A 4R0LC 4APQC 1FFRA 1XGTA 5EIIA 2YC1B 5ECJE 3V5KA 3EZ8A 1BZ9B 3O3DB 5AUMB 1A7PL 2EH7H 1HSAA 2DQDL 4I2XB 3O6FB 3SQOL 3EHBC 4HPYH 4JKKA 4ZQKA 4ODBD 3HE7A 1KIPB 3NZHH 3CSBA 4WU7B 5FA3A 5KANI 3MQIA 4PJEA 3C5ZB 2ORBH 3HLAA 3VW3H 3BWAA 4LLQA 4ZUSA 1CLCA 2XA3A 3I6KB 5MENA 3MLXH 4XPBL 4JVWA 5E5UB 5CLWA 3QUMA 3HPJA 5EU7C 1D5XB 5TPWL 4L4VD 1Y6NR 1S7UB 4OZGA 5KZCB 1MFEH 5EU4B 4DKAA 4WWKB 1XR9B 2DIJA 4KK5D 5B38A 5IVXE 4I3RL 3I75A 4X4XB 1ORSB 1NEZG 1G9MC 1A6TA 1JFQL 1N59B 2WUBL 5DURB 4WO4D 2EYTA 1NBZB 1QFWM 3ARGD 3FQTB 1GIGH 2BVEA 1NKOA 3QO0A 1S8DA 3BPLB 4LEXL 5HYEA 2APBA 2R0LL 4FFVC 5ALCL 2NY4B 2R9HC 3T0DA 5KSVA 1VENA 2CRZA 4PJDE 1R5IA 1EAJA 4ZMAT 4M1CD 3T0VA 1EV2E 4HEME 2K7QA 4MA1C 5IT2H 1G7MB 1AP2B 2VDPL 2YC1A 1GC1C 1CD9B 5IWLA 3BEVB 1NAMH 2XN9D 3W2DL 1BZ9A 3O3DA 5AUMA 3ARBA 3SCMC 5HGHA 1ONQB 3FONB 3O6FA 3MBEB 1CL7L 1KIPA 2EKSB 4FQ1L 4C59B 4WU7A 4QHKI 3C5ZA 1JGLL 3HR6A 5B4MC 4OTXL 3AY4C 4XPGL 3I6KA 1MSPA 3EJYC 1D5XA 4JKLA 3QUXA 4O2CB 1I3GL 1S7UA 4X6BB 5CINH 5CSBA 4FABH 1RSFA 2EH7L 2DM3A 5D1QC 2BRRH 2FIKB 3GBLA 5EU4A 5IROA 4WWKA 1XR9A 1L9MA 4HV8B 5EZLA 4X4XA 1ORSA 5EU5B 5GXBB 1FE8L 3L7FB 4H1LH 4U1IB 1N59A 1JJUA 4OCWL 4IRJC 4NQDB 4PP1D 1NBZA 3ZDXF 5I17B 2Q76B 3VW3L 5FYJU 2X41A 4KRPC 1FNSH 4KZDH 3DVNB 4XB8A 3BJ91 1MVUB 4XH2B 5D1ZC 2FZ3B 1AGFB 1XF5B 1X5XA 4WUKL 1ORQB 1F6AA 3FRUB 3GB7B 4X6CE 4LU5H 2GW5A 1KLGB 3N1GC 5IHZB 1DTUA 2EICA 1G7MA 1WFOA 1AP2A 1A0QH 2V2XB 4UIKH 4JO1L 1S78D 1DQQB 4P2CG 2P7TB 3NCEB 1OTTC 1DBJL 1ONQA 4ZO8A 1WT5C 2EEAA 5I1HH 3FONA 4PGDB 4B7IA 4DUXA 3MBEA 4Y16B 5GS2H 3OJMB 3KJ6H 4L1HA 1IMHC 1OGTB 2EKSA 1QNZH 4QXTB 4OIAA 1EFXB 3Q5TA 5ID1B 2A6KB 5CGMA 4I0KA 1FVDB 5CGTA 3ZT7A 4TRPH 3QHFL 1LO4H 1NCAH 4O2CA 1XGUB 4X6BA 5D72H 1DLHB 2VDMH 3OAUL 2FIKA 2X1OA 3K81A 1A9EB 4HV8A 2OZ4A 2XZZA 4WRLA 5EU5A 1TJGL 3L7FA 4IEFB 2EE6A 4U1IA 4PJEE 2XICA 1MCJA 4NQDA 5I17A 2Q76A 1CZ8H 4W70A 2OTUB 4Z7NF 4RAVB 4YDLB 2OMNA 4KK5C 2G75B 1MVUA 4XH2A 2VYRE 2FZ3A 1AGFA 1XF5A 4OZGE 1OD9A 4FABL 1UKTA 1ORQA 5I8OH 2BRRL 3UTQB 1S7WB 3FRUA 3GB7A 4AEHL 4WO4C 3K80A 3L3DB 5KSAB 1KLGA 3ARGC 1NDMB 3BKYL 3ET9F 3F12B 5FUCE 3C6LD 1HHIB 1SYSB 2XI9A 1DQQA 1T03H 4GW4B 2GUOB 2P7TA 4P23B 4PGDA 4OFYA 3CDGB 1QBML 4Y16A 2P5WB 2GEEA 1ODAA 4M1CC 4OQTH 3JWOH 1OGTA 3SJVB 3VXPB 2C4XA 2H32H 4XP4H 3S96B 4QXTA 1AGCA 5A2FA 1FIEA 2PF6A 5ID1A 1U36A 2A6KA 4FQXB 2DS4A 4LU5L 5DVMA 1FVDA 2HP4A 3SE8H 2OP4L 1EK3A 4UIKL 2DWDB 1KN4L 4NHCH 1XGUA 3ZT6A 5E00A 2W1NA 5JDSB 1DLHA 4NBYB 3IDMB 4J3SA 4JY6B 2B1HH 4Q0XH 5EU3B 2IG2L 3BIKB 1QACA 2DYPD 2Q7NA 5KAQF 1A9EA 5E4EB 5CHNB 2IWGA 2BY3A 3IDNB 5JXAL 3W39B 4HMEA 1QNZL 3E2HC 1RK1B 1FVEB 4LCYB 5D71H 1WEJH 2OTUA 1I7TB 2L7JA 3VXTB 4RAVA 4TRPL 1YEJL 5JZ7C 4M6AA 4X98A 4G6AD 2G75A 1F6LL 2D0GA 2VDML 3ROOB 4HC1A 3SDAD 4YHOL 1ROWA 2VDLH 3UTQA 5ILTH 1TJIL 5T3XD 4PP1C 3L3DA 4S11A 4R3SA 3QCVH 4PBXA 4FP8H 1NDMA 1G6RH 3F12A 1HHIA 1SYSA 3NH7H 1BQHG 2WUCL 4MXVE 4GW4A 4EN3D 2GUOA 4OIBA 3LKNB 5JOEA 4ZNEA 4KK8D 2GHWB 4MA7H 1SM3H 4P23A 1ZSDB 1B3JA 1JWMB 3CDGA 5HDQL 4NKOA 2D4FA 4JCLA 2P5WA 3ULVF 2CLVB 1NLDH 3WIHH 1AJ7H 1KCUH 2MQ0A 3QDJB 1ED3B 1K8DB 4UOW0 3SJVA 3VXPA 4GW5B 3QEUB 3S96A 4HFUL 4FQXA 1EGJL 3WJLC 2LU4A 2F8VA 1QP1A 1WIUA 5TQ2L 3UMTA 5E8NA 2AXHA 3RZWA 2DWDA 1F90H 4WI6A 4GKSB 1T03L 5JDSA 2R2HB 4KVCH 4F3FB 1LO0L 4JY6A 4ZPVB 5DRXB 5EU3A 3BIKA 4QNPE 5B22A 4K3GA 2MSPA 5CHNA 3V4PL 2V5RA 1NMBL 3O6KH 4H0GA 1LHZA 3I6GA 3IDNA 1A3QA 4P5KA 1TTFA 3K2UH 1RK1A 1FVEA 3NGBC 4U31A 4YBLB 4LOUD 1I7TA 3VXTA 3SE8L 2HRPH 2PCPB 3VI3E 5F3HB 1CDUA 1MCWM 2APTA 4I5BA 4PUBH 4NHCL 3QB7C 3ROOA 1Q94B 3LIZL 3I3BA 4LK4A 5EBMB 2X40A 3UAJD 3T0AA 2XQBH 5BCAA 4FQJH 1J0YA 2AKRB 2DM2A 4M6NH 1EFQA 3QIUB 3IFPB 4NQDE 4WTZA 1OARH 3LKNA 2ZUXA 2H6PB 4RMQA 3TZVA 4H1LG 4K9EH 1JWMA 3WE6B 5LGJA 2GTZB 3GK8H 1YC7A 2BSTA 2CLVA 4BM7A 4L5FL 3DYMA 3QDJA 1ED3A 1K8DA 5BOZG 4DZ8B 3D48R 4GW5A 3C6LC 3QEUA 3RWJB 2F19L 5D6CB 5LGHH 4AL8H 4XVSH 3CZJA 3HNTH 4FP8L 1JHKL 3S36X 3HAEA 3QEGH 4GBXD 5KOVC 3CMOL 1ZHBB 3QG6B 4GKSA 5K9QI 2R2HA 1M7IB 1T1WB 3UTSD 2VLLB 5C07B 4F3FA 5JR1H 5JHDB 1P6FA 1YQVH 2IPTH 4P9HH 5DRXA 1HH6B 1OGAD 3I50L 1NLDL 1AJ7L 1HXYB 5KVGH 5D2NB 5GGQH 4PJIA 1V3LA 1HZHH 4FFYH 3AROA 3UP1A 2PCPA 4JRXB 5DLMH 3OKKB 1YJDH 4LEOB 4KVCL 1Q94A 3RHWF 5HHVL 1NGXB 3DTXB 5EBMA 1B9ZA 3T0EB 1WZMA 2FRGP 5BQ7A 5FUOL 1I8MB 3BIAX 1MQKL 4OZHF 4B41A 3LQAL 3O6KL 2AKRA 3FOMB 4XCCH 1EFXD 2MPAH 3QIUA 4G6AC 5C08D 5GIRB 4WI3A 3IFPA 5SV4A 4GAGL 5I15H 5H37H 1JWUB 2H6PA 5IMOB 3SDAC 2EECA 5FDYA 4H0HB 3WE6A 2GTZA 5IB5B 2E6JA 1T22B 4HX1B 1A7RH 2YA0A 3T2NH 1AKJA 4JO3L 3RWJA 3WFZA 1B4JH 1UACL 4KK8C 2ILLA 3KNBB 3X3FH 3MLYH 1NGYA 1SJEB 2X4PB 5B39G 3S5LG 1IAII 1ZHBA 3QG6A 4ZNEE 1M7IA 1B6UA 1OARL 2VLLA 5C07A 4DKDC 3J7HA 1AI1L 1OSPH 5JHDA 1R3LB 3RHWK 3LVEA 2P5WE 4CVXB 4H26B 1HH6A 1PSKH 3GK8L 5JUEH 4M3KB 1U3ZA 3SJVE 1MHPH 3F5WB 1HXYA 5D2NA 5LGHL 4DTGL 3MYJB 5KSAD 4HUVA 1FL5B 4XVSL 2GCYB 3MCLH 3WMSA 5FGBC 3BPLC 3CFKB 4JRXA 1D7FA 2DF3A 3RKDD 2CQVA 3GMQB 2BVUA 4HLJA 4X7TB 1MCCA 5JMRA 5DS8B 4AMKH 3OKKA 1EO8L 1WISA 4LEOA 3CFEB 3O45B 4J3VA 3VGHA 4P9HL 4LQFH 1NGXA 3O4LD 3DTXA 1Z5LB 3T0EA 2AV1A 1WCBA 1ZANH 1I8MA 2BVPB 3ALPA 4LOUC 3FOMA 5ALBL 4KI5E 1JGDB 4QYOB 5GIRA 3DSFL 3U9PL 5E9DD 1CD1A 4LARH 4AENB 1JWUA 4XAKE 5IMOA 1T89C 4RMTA 5KG9A 1PZ5A 2DKMA 3LKSB 2J4WH 3V0WH 4XAWL 5IB5A 4FFYL 4EI6B 2P44B 5FKPB 2A0LD 3UAJC 1T22A 1YNKL 4HX1A 3Q5YA 3EJJX 3QUMH 2I07A 3M45A 4HCRA 3KNBA 4UQ3B 1LO3H 3KPRA 2IADB 5JPNB 4K7FB 1SJEA 2X4PA 4NQCB 1BEYL 4HJ0D 5L0QB 3ARFD 1R3LA 1FNHA 4TVPE 3G5YB 1CXEA 4CVXA 2ZNWA 2Y25A 4H26A 2CLRB 2NY0D 2Z92B 3LEYL 3QDJE 1EPFA 3QEHA 2IPUK 3F5WA 3I3EA 1P7KB 4U1LB 4GBXC 4P3WA 3MYJA 1UFUA 1B4JL 2R29L 4N5ED 2WZPD 1FL5A 4QXUH 2GCYA 4G6JH 5HI3D 5CKAA 3VXUB 3ARDB 4KHTH 3UDWC 3CFKA 2EDXA 3SDCB 2AERT 3GMQA 4UNUA 4HUXB 4X7TA 5DS8A 1A4KB 1X6NA 3CFEA 3QYCA 3Q0HA 1PSKL 5DZNA 2WK2A 5JUEL 4PRPB 3KLSA 3CVHH 2BVPA 2EC9U 1EMTH 4IMLB 4XPTH 1UWEH 1LQSR 4PJIE 1JGDA 2CXKA 4QYOA 4K71C 1OTSD 2WAHA 2HVJA 3WL9A 1OAXH 1Z9MA 4G42B 4AENA