5SWZD

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
198
Chain Sequence
QQQVRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASETSGSWQLIFGSGTTVSVSPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKCANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 36
structure length 198
sequence length 202
chains with identical sequence I, N, S
ec nomenclature
pdb deposition date 2016-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzD02
3IFLH 1R3LB 2G9HB 1ZLSH 5DO2D 4NYLA 4G6AC 4OLYH 1C08A 3ARUA 1V7ML 1F11A 3SDXF 4L8CA 1IKNA 2A74B 1KJMB 2OR9L 3VRLE 4XC3L 2F58H 4MGXA 2NX5A 3VXSD 3I2CH 2FJHA 3TESA 5JA9A 3BD4A 4HBCL 4NNXB 2CDFB 5F70A 5FOBB 4G3YL 4HF5L 2CDGA 4M9PA 1Z5LB 4F7MB 2DQJH 1D9KD 5E8EB 5HYJD 4WU7B 4YHPA 1MWAH 3LSOA 1KBGL 5C09E 1FORH 1MCOL 1NUGA 1P7QD 1MQ8A 4DOHE 2N56A 4Q6IC 4NO5A 1CICB 1MFEL 4KK9D 3P77B 2GHWB 4LARL 4NN5C 1WLHA 1I4FA 4JN1L 2EDBA 4OUOA 5TH2B 1PEZA 3G6AB 2BJML 4L4TA 5DD1L 1FBIL 1FFQA 3V6OA 1DQDL 1UJ3B 1IL1A 3HLAA 3LB6C 5DD5L 4HS3B 4ZXBD 3EIFA 5E7FA 1WCQA 2VLKB 3NIGF 5A3IC 4WU5B 3S3SA 1NL0H 2EDRA 4QHMB 1MJUL 3NIFF 3PABA 1Q9OB 2Z92B 4PJAA 4KY1L 5KVDH 1QBBA 1U9KA 4WJ5A 5DTFB 3EFDH 4MAYD 1C16B 1ZXQA 1HQRA 3M8OL 3S5LG 5EORL 5EB9A 1KENL 5GJSL 4CVZB 3WUZA 1XIWA 3T0EA 3BZFA 3QDME 1RHFA 3MLXL 1CT8A 1W8OA 1A6PA 4NZTL 2IBZY 3MGAA 4C56D 1NC4B 5LWYL 1U6AL 3HNSH 1G7HA 4A6YB 2X4QB 1JGLL 5ESQA 4NO0B 4LF3B 1AHWC 2MCPL 1CXIA 4H88L 4YEFA 4KJPD 1DBBH 5DJCB 1ZHBB 5KSVA 1A1MA 3LCYA 4V1DB 1JV5A 1IEBB 1UWGL 2X6MA 3IFLL 3K2MC 5IP4A 2BSSA 2CIIA 4EVNB 2BY3A 4JO3H 4TPRH 2NX5D 1QYGH 2Q7NA 2YPLD 4KI5C 1FVDB 1TQCC 4LASH 2WBJA 2YRZA 4X4ZA 5FUZH 2ESVD 3WD5L 1FNEA 1DN2A 2AABH 4UOW0 4JHAL 4L4TE 4XZUB 1JJUA 1MCOH 1LK2A 3D0VA 1OHQA 3V6ZA 5C2BH 5HYSG 1HHJB 3KYMB 3BSZH 1I7TB 3VFMB 2WNGA 5T3XE 5CEZD 2NTSP 5TDNA 1ZHKB 4L3EA 5HYQA 1FG9C 5GSRA 3T0EB 1JPSL 3GSXB 3GMNA 1KJVA 2R2EA 2BJMH 3CLEH 1QSFD 2ATKA 4JPWL 3M1BA 4U1JA 3LIZL 5LAXB 1UM5L 1JPFA 4UILL 3FB5B 2AEQH 2X89D 5KVFL 3DJ9A 4JZJB 1FAIL 3K1DA 3BJLA 3O3AA 5GZOC 1A7BA 3FOMA 2BRRL 1W0VA 1R5VB 3EYQC 4YHPB 4FQCH 1IEBA 2HFGH 5C0FB 3TFKC 5ECJE 5I6XC 4PYHA 5E8OB 5F6HJ 5E8DL 1WZ1L 2FIRT 1WK0A 4Z7WB 1U8NA 3UPRB 4HS3A 3HA0A 1UZ8B 3UTSD 4X4XA 5BZDB 4CU6A 2XFXA 1JP5A 4L8SB 1CLZL 4M62H 2DI9A 4MD0A 2GK2A 1YN6B 4NZTH 4N8PA 4FFWD 1J87A 1I3RB 1KCKA 1U6AH 3F7PC 3HNSL 5CUSL 3WHE1 2HMIC 2APWA 2KZ1B 3ARGC 1MRCH 4LFHG 4LSTH 5K9QI 4PJHF 1FZKA 3KJ6H 4PY7A 2GK0B 2N4IA 5JPMB 1RK1A 3RWDB 3OGCB 5F1NA 1OAQH 3CK0H 4DVRH 5DUBB 5FB8A 3RWJB 2Y6SC 3R0MA 4RGNB 3T3PF 3VFRB 2IPTH 4S1DC 2FGZA 2H2SC 4J3UA 4XXCA 1FGVH 3Q3GA 3VXNB 1MVUB 3QIUB 3G5YB 1BFOB 2FGWH 1A6VH 2XXMB 1LP9A 2NMSA 2GIYA 4JEGB 4F7PB 3L9RB 1J0YA 3MO1B 3AGVA 5FUZL 1T7WA 4JM2C 1T1WB 2XACC 3UZQA 4XNYH 3P77A 4UV4L 3C5ZD 1YQ2A 4UAOB 4NKIH 2A9NH 4K9EC 4XRCB 3V52L 4AZ8A 3BKMH 2ZUTA 3RI5F 4YFDB 3CFBA 5E6IC 1AO7A 4X9BA 3U36A 2CLVB 4LHUA 3IU3A 3LHPL 1KJ3H 4OCXL 4POUB 3MUGB 5C0AE 1V3MA 2DN7A 5CAYB 4BA8A 1KUMA 2ENYA 4LAQH 4MJ6B 4PJAE 3NA4A 2P5ED 4J4PC 5FM4A 3RL2B 2HT3C 5ADOH 4AL8L 2JCCA 5D93B 1OL0A 1K6QL 5CJBA 4P46B 4RDQG 12E8L 3RAJH 3DRQA 3I50L 5KAQF 1ZT7B 3O4LA 4MA1B 1WBYA 1VENA 4CW1A 3G5XB 3TYFB 3UTSA 3KGRA 2I07B 4YE4H 4H1LB 3HG1B 3F6LA 4S2SB 1TLKA 3BIAX 2IMNA 4M5YH 3VFPA 2HJLA 2W0PA 1X5ZA 5HI4C 4JZNA 1BBJA 2YOCA 5IROA 2J2ZA 3CD4A 5D1QC 5CLWA 1CCZA 4ODUA 5F88B 4HDIB 5D7LA 4CN4A 1HOCB 5IVXA 5HHQA 4Y5XC 4B41A 1EHXA 3U79A 4LSPL 4J3XA 2HWZL 4OF7A 3TT1L 5TE7H 1GVIA 1BEYL 1HYSC 4JJHA 3MLSL 2WLZA 4JFZH 4OLWH 3WDJA 4ONGL 1KB5B 2JB5H 1ONQB 2X10A 4NQVA 4FQLL 2JTDA 1RUQH 2ADIA 2MFNA 3UJIH 3UYPA 4HEPG 4MQTB 1A5FH 3O4LD 4UMGA 1KJ2B 4ZDHA 4CMMA 1F6LL 2JKXA 3VXRD 4OCSL 3QP3A 4JFEE 2GJ6E 4MJIB 5LXGH 2HJKB 4KZEL 3TN0D 2J8UE 4UV4H 4UQ3B 3T0EC 1OARL 2A0LD 2A1WL 2ICCA 4U49A 5EA0H 3VE0B 3ARGD 2X4RB 1PEWA 1Z9LA 3F6IA 4LNVA 1QRNA 3IXAA 1JGDB 3BX7C 4GXUM 2FJGA 3VDAA 4IRSC 4KRLB 4JE4B 1LE9B 3TZVC 2LTQC 1I1RA 1YEIH 5JW4R 1QLFA 3KPTA 4TSAH 4B50A 1UB5B 2D03H 1J10A 2Z8SA 1JGUL 4WHCA 1DLHA 3BDYL 4FHBD 2NY5L 2ZUQB 4ZD3L 2DB8A 2P8PB 5DT1L 3GUTA 12E8H 4MD5A 3MRMA 2BZDA 4Y2DB 2Y06H 1WICA 2R1XA 1TCRB 3HNVL 1G0YR 4KQ4L 3QZWB 4UB0H 4Q9QH 4WFHE 4C55A 4TUJB 4G6KH 5SX4I 1HCFX 1L7TH 1BX2A 5JIHA 3GGWA 1EXUA 3LZFH 1R3LA 1BQHA 2QV2A 2XKSA 1BLNA 5BXFB 1KJ2A 5AYQA 5F3HA 4RGMC 1D9KC 2LV4A 1PG7W 1EA9C 4PJBB 4ELME 2Y7QA 5ESAB 5ISZD 4LCIH 4K3DH 3B9KD 4PJ7B 2JJUA 4V2BA 1ZHNB 4JFZL 1N8ZA 2F54D 4MXQC 3RWIB 4BFGA 5KOMC 3L3OB 1TQBB 4LSSH 4LLUA 35C8H 4PLJD 1OSPL 4HHAA 4K8RL 4C59B 4ZUWA 1UJ3C 4HPOH 3VJ6B 3MRIA 1FVCB 4KZEH 3BZ4A 2B4CH 4XNXH 1OGAB 3T0AA 1G6RL 2ENSA 5F96H 5GHWL 4PJCF 4XPAL 3VI4F 3VWKA 5HHXL 2AJXL 3BVNA 3WFBH 2Z91B 3VWKC 4YPJA 5FIEA 1CGWA 4HWBA 1C5DA 3TN0B 1FO0B 3OBAA 1UXWB 1EBPA 5I1DB 3QHTC 4HW6A 4OGYL 1JNJA 3ARTA 3FO2A 2EDXA 4HIJB 3U9PH 4XPFH 2WUBL 3GMOA 1YQVH 4ONHB 5D1ZC 5IW3A 1IZJA 3QEGL 3MLRH 1S9VA 3S88L 2ADJB 5I75B 4D0DA 1EHAA 1YPZE 5CZXD 5T3XD 2EDFA 4Q9QL 5E6IB 5F1NB 4L4VE 4JZOA 1AD0B 1HHGB 3E1F1 4G6KL 1IT9H 2HLAB 4WHTB 5M95B 2E6QA 5DQJB 3HUJB 1W72B 2AQ1A 4ZNEA 3SKUD 3PHSA 4F7CB 25C8L 4NT6A 5FGRA 1MFBH 5EU4B 4MX7A 3OZ9H 2X4UB 1L9NA 3IFPB 3HE7D 4FQJH 5CEYA 5I8CB 1GC1L 4KJYB 3RKDD 1EO7A 1J9CT 3WLWD 5FM5M 3CPLB 1MJ7H 3T2NL 2ZPKL 4Z7WA 1S7QB 1K8IB 1CDHA 3GMLA 2P1YA 3HFML 4XCNA 1X5YA 2BNQE 1A6AA 3STBA 4ETQB 3T77B 4S1DD 3UP1A 8CGTA 2V9QA 3QEQA 1RZJC 3QPQD 5JHDD 4LBEA 5DJXB 1UEMA 4HUVA 35C8L 3TV3H 5A2JH 3WLBA 3FMGL 2G2RA 4E9LA 4IIQC 1NGQH 3L3DB 4JO4L 5J12B 2VN4A 4OJFL 3L7FA 4HK3N 4ONFL 4NZDA 5TQ2L 4DQOL 1CLYH 1HHIB 1JN6B 1G6RH 4ONHA 1ZV5A 2GI7A 4KVNH 3RHWK 1U91A 5JHLL 2NXYB 5GS0L 3GDBA 1AO7D 2VWEE 1ED3A 3F5WA 1CS6A 5JDJA 4NCC1 1IGYA 1YMMB 2R2BB 3TO4C 1HHGA 4OZFB 5IWLC 4J6RL 3V5DA 5JW4Q 2XTLA 3S97C 1RMFH 2GW5A 3TCLB 4M6NH 3MLRL 5CCKH 3O3BB 2GUOA 3D18B 4JFQA 4DGYL 1JZ5A 2YPLA 1T22A 2F74A 3N0PB 3ECBA 1DBKL 3N9GH 3ZL4H 3IDIA 2H41A 4HIHB 5DZNA 4L5FL 1WBXB 3HC3H 2Z0BA 5EU7E 4FTVB 4I3RL 5C6PB 3T4AA 1RJZA 4XPHH 4S1RH 5JZ7D 1FFNB 2FECL 1JN6A 4HXAH 1HH9A 25C8H 4Z7UB 2XY1A 3GMPA 4QRTB 3TO2B 5ID0B 1T21B 2Z9TA 1S5IL 4FZEH 3MREB 1MIML 1UKQA 2CXGA 3HE7A 3PGFL 4PGCA 3NCYP 5KSUB 4WHDA 1SMOA 2ZZUT 4XB7A 1HXYA 5DJXA 1I1YB 3SGJC 2AJYH 4PJEF 1JYVA 4RQQB 3KXFA 1CIUA 5CKAA 2EDOA 1PYWB 4YLQT 5IF0A 1BD2B 3QEQD 4HZLB 4GRLA 4GAYA 1A7QL 4HKXB 1JV5B 4NO3A 3L7EB 5SWSA 2D31B 5I17A 2BERA 4J4PA 1S5HA 1P84K 3BRFA 3MLTB 1FGNL 4PGEB 1GGCH 3PWLB 3QFDA 2XPGB 3DX8A 4QTIH 5DMKA 4XBEH 1B4JH 5E7BA 1CLYL 1DLHB 3N1GC 1RUKL 2YWZA 3OG6B 3UJTL 1S7WA 3QUMA 5DJ2A 2R0WH 5E2UH 5KSBA 4GSDL 5KS9E 4HUVB 5CLTA 5MENA 3OR6A 5FGCE 3RI5K 3LV3B 3HR6A 1CGSH 4NQVB 5C0GA 4UOJA 4NQSA 4WY7H 3T1FB 4PJFF 3L5XH 2IAMB 1NBVL 5B8CC 4ZPTB 4GW1A 4P59L 5K9OA 4PJ8A 2IALA 1JNNL 1I7RA 1OTUD 3UTPD 3MV9A 3GMQB 1CR9H 3WO4B 2YUZA 4F7TB 3H9HA 3SDYH 4MA1C 3KYNA 3EGSB 2DYPA 4N8CL 5I1HL 5A2IH 2WINA 4FQXD 5D93C 2APVA 4R7NB 4XPHL 2RFXB 5T1LB 4UUJA 2N7AA 1X5AA 1A6WL 3VRIB 4M7ZB 2CRMA 4YGVB 2IANB 3NABL 3CMOH 1OGTB 4OCNC 1QNZH 4L3ED 4KGLA 2DWEA 4CJ0A 5C08B 1OAZH 4JKPH 2GAZB 2IADA 3IDNA 4G8EA 5FYJL 3RIFK 3VFVA 3B9KA 1JWSA 4BSVA 2H32A 3HPLA 1WWAX 1AP2A 2R56H 4DKAA 4JFYA 1U36A 4WW1A 1NC2B 1N26A 3BJ91 1F3JA 1RJCA 1OP3H 2ADGA 4JFDB 3NIDE 4EZMA 4Z7UE 5CP3H 3I6GB 5JXEA 5K9KA 3FN0H 5E24E 2VZ3A 3HB3C 4PJAF 2E7LA 1OM3L 4S1QL 5FO7A 1IM9D 2Q76A 3H9YA 3KS0H 3FQNB 1CFTA 4JG1L 2JCCB 4MNHA 3WFZA 4HPYL 3UJTH 5FYKL 1MQKL 3BKYH 5EH1A 3OKEA 4NFDA 3HRZB 5D7JD 3UTTB 3EO0B 1MCIA 2EIDA 3MXWL 4NRYB 3Q1SL 2APTA 3PGDA 4GRWH 2DICA 3JWDC 4D0CA 4P2OA 3RWHA 1NSNL 3U0WL 1FBIH 4NQXA 1VFUA 3ET9F 4FQHA 1RZJH 4HS6B 5F89A 3DX7B 3BMVA 4U6HA 2DQTL 5DHYA 3BP5B 1OGAE 1AP2B 3O4OC 2FHFA 4KAQH 3ZO0A 2EIZA 1H15A 2BNRB 4MD4A 3NGBC 5HXMA 3K46A 1ZVSA 3C8KB 2ESVB 4F15C 4WI7A 1TJGH 1BFTA 4P3CL 3OMZA 1T2QH 3S37X 4P2RA 2VLJD 2X4OA 1AGDB 1XF4A 4FQIH 1Z0NA 5IB3B 3QQ4A 1BD2E 5FA4A 1KENH 3V4VH 3V6BR 3FN3A 3ZDZE 1EEUA 2DRUA 2X4NB 3NVQA 3ZKQD 3FRPA 3QJFB 4X8JA 1BECA 4OLXL 4LPWA 3EGSA 1O5DT 3VFUB 1JVKA 2ADIB 5AZEH 4X6CE 4F57H 3QBTB 2VZUA 3WUWA 1JI1A 2XWTA 4G9FD 5E2JA 1B0WA 4CGTA 3C8HA 3BEVA 1S7VB 3DI3B 3VW3L 4TPRL 2D4FA 5J9PB 2D31A 1DBAL 1EUUA 2DLTA 3CVHH 3SGKA 4ZTOL 1U42A 3NFNB 3UYOD 4M1CD 1BJ1H 4GRLB 5CEZL 1Y18B 3ULUH 3C6LC 5IHUL 3T4YB 1EHLH 3KPQB 3U2SA 3LN4A 3SDCD 1KJ2H 2HH0L 5KAQG 5IEKA 1RFDH 1N64L 1GGTA 1KB9K 2P8MA 1QPPA 1L0QA 4LNRA 3NA9H 3FOMB 4JFXB 1MELA 5D7JA 5H2BB 2QSQA 3BT2H 5AUMB 2DQFA 3EOAB 1ZWIA 2VDQH 3ILPB 3BSZL 5J11B 4K94C 5F9JA 4PBXA 4WTZG 4WI3A 5E8PA 4M61A 4X4MA 1IFHL 4ZFZB 3D5OF 3U0WH 3TA3D 4NWUL 2BC4B 1Z9OA 3MV7D 3NCJL 3MJ9L 3BGFC 1A14H 2D9CA 5E8NB 4M7KL 1IVLA 2ZCKL 2BVOB 15C8H 4P9MH 2BRRH 1I8KA 1IC7H 4GRLC 3IKCB 4KROD 2CJUH 4PRPD 5LGJA 1AD9A 5GRJL 4JRXA 4R2GB 5FXCH 2I27N 2GJ6D 2GITB 4MJ5B 4P3CH 1CZ8H 2Z31D 2GJJA 3V5DB 4K2UL 4XTRD 4K3JL 4PRHB 2A6IB 5EUOE 5GSRB 1U8MB 4OCWL 4RMVA 4LCWD 2NY3C 2F19L 5CP3A 4O51B 2DBJA 4PJXF 3AAZB 3KJ6L 4UIMA 1Q94A 1QZ1A 3PWNA 4MJ2A 1A6UL 2QQNH 4Y1AE 1ZLSL 1A3QA 2NY7L 5D5MA 1ERNA 1ZGLM 4RFOH 1QR1B 3SJVD 1UC6A 3KPRE 1AO7B 4N1CA 5I76B 5F9JB 5E2TH 1RK1B 5CSBA 3HKFA 4Z76A 3VRLF 2PUQT 4GQ9H 4PJEB 3ORJA 4TN9A 4DZ8A 1A9BA 3QIBB 3UBXB 5D7JB 4IRZH 3GJFH 2YMXH 4JFEB 1CICC 4MJIE 4BZ2H 4DK6A 32C2B 3MRRB 5E2WH 4MQ7A 1F6AB 1WAAE 1WBZA 2ICWI 2FH6A 1U8PA 3P73B 4YBQD 3LKPB 5BS0B 1D5BA 1CU4L 2R4SL 4Z5RB 2R23A 1P4BL 3QI9B 1MCPL 2UVFA 5B8CB 1BAFH 3MV8D 4NM8L 5IB4B 4NC1E 3WNNA 4LPYA 1KLUB 3RUGE 5C0CB 4QWWD 4F7EB 3SBWA 3WFEL 1LEKB 1T20A 4NQDB 5JQ6H 2H2PC 1OTUC 5ISZA 2G5BA 3IDYC 4HLJA 1KB9J 2RGSA 1A64A 4NO0D 1HXMB 3F7YB 3RNKB 3BKCH 3VGDA 5E6ZA 2C3HA 5I76A 3RVUC 5D2NA 4O5LH 3N06B 1A7RH 1YMHB 1QSFE 4PJ9B 4IDJH 3RRQA 3FO2B 2CKBH 4QOKB 4N9OB 2A6JB 1NFKA 4Q9CA 5C0AD 2ZOLB 4YAQB 4M5YL 5I1DA 4PB9L 2HTKD 3JWDH 1UA6H 2HG5B 2HYMA 5CP7A 3MLXH 7CGTA 3ZE1F 2G9HA 2RCSH 2VC2L 3QEQE 4HUXB 4EI5C 2MSPA 5C07B 1MI5D 4O4YL 4QHUB 2VL4A 4YUEH 1S9WB 2C3VA 4DZ8B 2PYEA 5CD3A 1KTDA 4U1MA 3GJEA 4Z76B 3CIQA 5FYLE 3WBDA 2QSCL 4BH8B 1NFDE 4LPUA 2ICWB 1BEYH 3RQ3A 5HGHA 1J0IA 1RULH 5DLMH 3MBEC 4J12A 3H7BB 2NQCA 1V5JA 3D2UA 4N0CD 3MR9B 4E5XB 1LE5B 3BPOB 4O51A 2X4QA 5I1JL 2PTUA 2WBKA 5MI0C 3MRLA 4OAWB 1A47A 2F8VA 5GGRB 1JNHB 1KFAH 3BHBA 2LAGB 5IQ9A 1X6NA 1XZ0A 4Z7VF 5EA0L 2K7QA 1B9ZA 4JANB 1MRFL 5C2UB 2D7MA 4G8IB 3MROB 4ORGA 5GRYA 3H6JA 3MRBA 1KLFA 2XKNB 3E2HB 5A43C 2Q20A 4KVCH 1YNLH 4YXLH 4IHOA 3UROR 3MCLH 1UM5H 1QSFA 5E4IA 2AEWA 5KTEL 3RU8H 5C70A 5D7IB 1P2CB 4G43B 3STLB 5ITFB 1UM4L 3W11D 5IB2A 4AYFA 3BDYH 4H26B 2WAHA 3FCTA 3WMSA 4N0CC 5IV2A 5SWSE 1IQWH 4YWGL 4ZD3H 5D2LE 3WSQH 3FTGA 3TVMD 5IT2L 5HHOA 2Y06L 1UXSB 1H3VA 4MMXC 3AY4C 4X4YB 2V7HA 2Y36H 2NY2B 2WINB 1AGFB 1D9KA 3D87B 1ZA6B 5DQ9B 4GXUN 3S6CA 3IB4A 3KPRB 1RZ8B 2PTTB 1MHPL 5D7IF 4ACPA 1EO8L 3OB0H 1FL3B 1UA6L 2VXUL 3L3KB 4PP1D 4QHLA 5F7LB 5GRXG 5D4QA 2RCSL 2VC2H 4GW5A 4YHIB 2I26N 3LS4H 4ODWA 3D69B 2H2PD 1QFWL 3SJVB 3KLAB 1VGKB 3M07A 4PTUA 4Y5XA 4F2MA 3SO5A 3QZWA 4LAJH 4BFIA 3ABZA 1MFCH 1J0HA 1AE6H 5FDWB 4MJIA 3L3IA 1E4XL 3QNYB 5T5FL 3RWCB 3TLRA 3CFIC 4N0FB 4UAOC 1RULL 5DLML 2IPTL 1HCVA 3RY6C 1YEFH 2HN7B 3PL6B 4S1SL 3MRBB 1NGPH 4JY4A 1FHGA 1G7PB 3WXWL 2JJTC 1FSKC 4QHMA 3QUYD 2X9YA 3O45B 3EOTL 4QT5B 3HG1E 4M6MH 4N5UA 3S3JA 2LU3A 3K4AA 3MBXH 5DK0B 1J1PH 4D0BA 5IFHL 4NKIL 1A4KA 3JWOH 4CN1A 2UWEF 3NFSL 5C1MB 5DJ8B 3CFJA 1JGEA 1J0JA 1CQYA 4X6EA 3VGFA 2CRIA 1PAMA 2EDJA 4RAHA 4E5XA 1LE5A 4HKZA 4QY8A 5I71C 4LVEA 5AYUH 4GFTB 2Q8BH 1YN7A 4KDVA 5D70L 3DTXA 4N1EA 1MNUL 1VERA 2P7TB 3BWUC 5EC1B 1F58L 1TZGL 4ZODA 3KXFD 4NO5B 5DRWA 2WP3T 2FWOB 1UKSA 3C6SB 3OX8A 1NAKL 4GRLD 1X7QB 3WFHB 4E41D 5BOZG 3QG6A 2K7PA 4XCCL 4PJGA 1YEDB 5ANME 5ENWA 3CDCA 3TBWA 1XF4B 2Y36L 3IJSA 4U1IB 1A7OH 4RBPH 3GBMH 3SGDH 2XKUA 3ARWA 5CJXA 4GUPA 1J1XL 1T1ZB 5BRZB 3VFSA 4PS4L 1B2WH 1Q0YH 2A77H 3QAZC 1GGBH 1NMBH 4TRPH 1A2YA 4UTAL 2P24A 4PJBE 2PO6A 2BMKA 3OKNA 3GJEB 5IEHB 2V7NB 5JORA 2V2WA 4JGUA 4K7PH 1A3LH 1UXSA 3BQUB 2NW2B 2E27L 3S5LB 4X6FB 5T5NG 1AE6L 5C0NC 1UM6L 4TVPD 3UPCA 5C0BA 2R29H 3C08H 3HFMH 3PGDB 3QULA 5I75C 2QQLH 4JM2A 5F7UA 3MRGA 4I4WA 1RUQL 5CZKA 1A8JH 1P5VA 3I6KA 3ZYIA 3UTQB 4PG2A 1UQSB 5ILTL 5T1KD 3EOTH 4LEXL 1TQCB 4YPGB 1XGRB 1OGTA 3IRZA 4YIQB 2XYCA 2XZZA 1S7RA 3T0ED 1HXMA 3F7YA 5T33L 5DF0A 3QXTA 1X44A 3QIBA 1A9BB 1HNGA 1PY4A 1YY8A 2DQHH 3ARGA 4LL9A 2I9LB 3LDBB 3MA9H 3TEUA 3ZE1E 1CBVH 1IAIL 3DROA 3GO1H 2PXYB 1FV1B 2EXWC 4N0FA 2NCMA 1CK0H 4YAQA 1U3ZA 4HT1L 2EZ0D 2W60A 3FB7B 4TSAL 4X6BA 2IWGA 1D5XB 1LNUB 2ZKHH 3FQUA 4WFED 1N6UA 4LCCB 3KPPB 1KACB 2HRLA 2P46B 2YKLH 3L1OL 1RIUL 4R96A 2IAMC 1KIPB 4G42A 5C0RH 5INCA 1MLBA 1R0AH 4RZCB 4OIBA 1I9IL 4U1MB 1I85C 4XCFL 1JHKH 1T66C 3SE9L 3O6LH 2YA0A 1ZLWH 3P0YH 1R3JA 5HYFA 4PGDA 3QUZB 4RMSA 3AS0A 1X3DA 4GMTL 3OR7B 1J1XH 4LCCC 3C5ZA 1SY6H 2W65A 4KRPD 1TNMA 3LZFL 4DUVA 1RIHH 3WS3B 3MLYH 5EBMB 3CFDA 3D39D 4W6WB 4UIMB 5BV7L 4NOFA 1INDL 5HYJE 4XCEB 2D0GA 4ZUVB 5B39A 4Z0XA 3VXQA 1TMCB 2N1KA 4TYUA 4ZFFB 5C0FA 4HC1A 5C71A 1SYVA 3L3JB 5D96C 1FNEB 32C2A 3RIAF 3Q5OA 1XGYH 1EFXB 3VU2A 4MXQD 1YPZA 4ZPVA 2UWEE 4Z77A 4AEEA 1JF1A 4K71B 2VR9A 4JG0L 1IM3A 2H8PA 5B4MD 5IVZB 2R15A 4JR9L 4MXVF 5LKNA 4KROC 1ZA3A 5CKGA 5I8KL 3DUSB 3LQAH 4OV6F 4QCIA 3SDDC 4HFWB 4U1GB 3IJYA 3BUYA 4HD9A 4ZO8A 4J3SA 4KTEH 2OL3B 5GHWH 3QNZB 5HVFB 5E4EC 4HHAB 2BHZA 2DQHL 3VWKD 3DPBA 3FL7A 4P4KA 3OJDA 3MA9L 5HGAB 2EEAA 3H9SB 4PJHA 2E9BA 2Z8VC 4NQCE 1ES0A 4JRYA 5ESVA 5J9PA 1DQJB 4NJAL 2Q8AL 3SDAB 1MF2H 2IH1B 1YEHH 3ZHKA 4HT1H 4GKNA 4OQTL 4P59H 5DSCA 3ZSSA 5E1HB 1F4YH 1G7JA 1PLGH 4XH2A 2NXZB 5EOCJ 3TM6A 3LS5L 4LNRB 2IAND 4FQ2L 4ZS7H 1CDUA 3UBXG 1SYVB 2VN7A 2I60L 5H37H 5FYLL 4HH9A 3VGHA 5BMFH 4LSVL 2HMID 3GMLB 4LVHB 5L2JA 4R9HA 4L8DB 3T8XB 4YGAB 3C60A 3CFDB 3RGVC 3FQWA 5TDOB 1OY3B 1F45A 4CJ1A 1LDPH 1A6WH 3REWB 3DXAB 4X6DA 3LAFA 5GRUL 4OB5H 1ITCA 3V0VA 2C3VB 4Z18A 4G8GE 1INDH 2YC1B 1P84J 4OZFG 4GBXC 2AJVL 3G6DL 4G42B 3LKSB 1R3IL 4L8SC 1IC5H 3FFCB 1MEXL 5FDYA 3BKJH 3LN4B 1K8IA 4P2OB 3RWHB 3OAUH 4OZ4A 1VHPA 4PJCE 4HUUA 4NRYA 4M5ZH 4BQ8A 1D6EB 4H25A 4BSWB 3PHOB 5AZ2H 2XWJA 1QQDB 1UVQB 3LKNB 4JR9H 3V7AG 4NKQB 2CIKB 5I8KH 2J88H 5DA4A 1DTUA 2CUHA 1KCSH 4DQOH 3AREA 1UXWA 3V0WH 1QFWI 4KHXL 5JHLH 5J1TC 2DJUA 1DEEA 1NCCL 4HIEB 3TC9A 2VDMH 4ZXBB 2ARJA 5HDOA 1YJDH 4Y16B 4OGXL 3TNNA 4BZYA 1QRNE 1T6WA 2W9LA 3QRGL 3UJJL 2ED7A 3DETC 1S7QA 3BIKA 3ZE0E 2I9TB 3CXDH 4D0DB 1M7IA 2HJFB 4O00A 1YEHL 3O3UN 2AK4A 5EOTB 5D1XD 1AIFA 1R5WB 1DN0A 2AXGA 4WV1B 5CILH 3PJSA 1I1AA 4ZFOB 1JTOA 1RUMH 4LSQL 3LN5A 3OXSA 2XNAA 3P9MA 3QUZD 3N1FC 2C26A 3G5ZB 1H3PL 3VI3E 1JPTL 2D4DA 1FL5B 4MNQD 4X80H 2HJLB 4L3AA 3TA3C 3VXME 5E94A 5C0BB 4OLVL 3OKOA 1T7YA 3O2DH 3BH9A 3TO4A 4ELMA 1ACYL 2VZTA 4XBGB 3TNMB 4PJ5D 3AS3A 1Y0LB 2AJUH 2J6EH 4EUPH 3FOLA 1P4LB 3NCCB 1AGDA 4LLYA 1CDGA 2ZNWA 4GG6E 2X1OA 3SKMB 3WKML 1DSFH 3MNZB 1DL7H 5KZCB 2PW1A 1F4XL 3CVIL 5J3HD 3MODH 3KR3L 4B53A 1MCCA 2DTMH 5ALCL 1CFSA 1XGPB 1FJ1A 4KZDH 1H15B 5E99H 5E9DB 3RGVA 3O3EA 3W5NA 2FB4L 1VADB 1QD0A 3SDXE 4XAKD 4DK3A 7FABL 3OKMA 3MACL 4YQXH 1MCFA 4JO1L 1OB1A 3K8LA 1S3KH 1INQB 4YFLF 1JWMA 1REIA 1QTYT 5AZ2L 4HF5H 4HKJA 2AXHA 1U8OB 4JLRA 1EMTL 4KK9C 1DUYA 2DLFL 1I7ZA 4HQQH 1AD9B 2F8OA 1C1EH 3OKDA 4UV7L 5DFWH 3JBG7 3LKRB 1RUKH 2VABA 1FORL 3LN5B 1FH5H 5EO0B 3DV6B 3UTPE 1UEYA 4LLUB 1MFAL 1UWEL 2H26A 4ZOEA 1CGSL 1F97A 1L6ZA 3B4NA 1AKJD 2CH8A 1YJDL 3GEWB 1LHZA 3MLWH 5DQDH 1S7VA 3PDOB 4O58H 2FL5A 2MKWA 5FA3B 4L4VA 2OM5A 2NTFB 4KRNA 5CGTA 4OD3H 1WEJH 4N8VB 2M26A 5C08D 4UNUA 4YC2B 2BVUA 4R90H 2P49B 5GRJH 3S9DB 1JZ2A 5FCUH 3PP4L 2LU4A 1AXTH 1TVBA 1HH9B 3MV9D 5ID0A 3PIQB 2YN3A 4OZIB 3F7RA 5KVDL 2BX5A 3SDYL 3BW9B 4AMKH 5E9DA 4GXVH 4ZAKA 1MH5A 4Z7VE 5EORH 1RV6X 4OD1H 2ESVE 3VE0A 4TVPE 3T1FA 5ICZA 3B2UC 3VFOB 3K4DA 4PYGA 4X6CB 4LCYA 4OZHA 3NABH 1QBAA 1GL4B 1AGFA 1BFVL 4GJTB 5KVEH 1U8OA 3SQBA 2WQ8A 3MOAL 1Q9WA 2AK4D 3QIUD 3ULUC 3FTGB 1INQA 3HG1A 2CUIA 4Q58C 4U1KA 5DJZB 2AS5M 3CFKB 2IALB 2J8HA 2BOBB 3MJ7B 7FABH 4HZAA 3SY0B 5IJVB 4JO3L 3BWAB 1HH6B 3U0TA 4L9LB 4P3DA 4WIQA 4KKAC 1WCBB 4GG8B 5EO0A 1XGTB 5GGVL 4BZ2L 1J1OH 1FPTH 3C2SA 3GSOA 1CXFA 4GKSA 3PF2A 1T1YA 2ED8A 1LEIA 5C2BL 3O8XD 4MXWL 3KAAA 1S7TB 1NGYA 4G9FB 5DHVA 1JF6A 1OAYL 1F4WL 1ZGLB 4MJID 5JPNB 4R7DA 2FO4B 5IBTL 4OD3L 3D0LA 4EUPA 4TULH 5FO9A 1SEQH 1XR8B 3GHBH 3NN8B 1DN0B 3QXAB 4HJ0D 3Q6GH 1UB6A 1JRHI 5EZJA 4GG6B 2VDKH 3ARZA 3ILQC 1HXYB 4NT6B 2Y9RT 1JTTA 1KTDB 3RWJA 5E8DH 3IDXL 2ICWA 4RBPK 5IB1A 4P49A 3SE8H 1EDQA 1AY1L 1LO5B 3BO8A 4HIXL 1FG2B 1JK8B 1DQLH 3WFCL 1T83A 4WI6A 1WTGT 1FSKB 1P7QA 2RQ8A 1G6RA 3NPZB 4NPYB 2MWCA 4P5KA 3W0WB 1HYRC 5FK9A 5EWIL 3PL6C 1NH6A 2W92A 3IDGB 4Y1AB 1EPFA 1WAAA 1X5HA 4YHOH 3X3GH 1X4XA 4MXVE 3SDDD 4Z7UF 4OQTA 5CSZA 4OCRL 1KXVC 3PDDA 4RGNC 5HHNA 1KC5H 2I25N 4F80A 3GI8H 4KKLD 4CDHA 1NFIB 1SVZA 2PXYA 1XR9B 1DBAH 1RHHA 4U7SA 4ZTOH 3QDMB 3TVMB 4DTGL 2GSGB 3G9VA 3TA3B 1IGTB 5GGRY 1G7LA 3ARGB 2YC1A 5ACLA 5GGVH 3SDCC 3SCMA 2BHYA 1BM3H 3KNBB 1A4JA 1T0NA 3LY6A 4HJGA 3P4NB 2ATKB 3N1PC 3QDHA 3OXSB 3P9MB 5IB4A 2XZCL 4QRRE 3LRHA 4U6XB 5CJOL 4F7MA 5EZJB 5KS9F 4LARH 4AIXA 1Q72L 4WRLA 3MRHB 4AT6A 3VFRA 4Y4KC 1F8TL 1RK0A 1S9XA 3LRSA 1T7VA 4MWFA 1FG2A 4RAVA 5IVXF 2CO7B 4YHKL 4DW2L 3V5KB 5IBTH 5C0CE 4N0YL 1J8HA 2IFFL 4QKXB 3ULVC 5I8EA 1WFNA 2VNCA 1OGAA 2CJUL 1GYAA 2V2XB 3F8UB 1IGFH 1XMWA 3CC5B 2FX7H 4YWGH 3V4PL 3REWA 2NZ9C 3U6RB 1MCHA 5F72S 2JJSA 1YC8A 5CBAA 3KHOA 3DVGB 2R1YA 3GBNL 1AY1H 3NGBB 5JPNA 1U8KA 3MOQA 4WI5A 2DIJA 2XZAL 4U0RC 4LVNC 5JHDE 4HFUH 1EO8H 5EBWB 4XZUA 4N5EC 3I02A 2GT9A 5D1QD 2UWEA 3LVEA 1RIVL 3LMJH 2F19H 3TBVB 3RVUD 5EU3A 3RX7A 2P5WB 4H88H 1CGUA 1VFMA 3AVEA 3EYUH 1A6UH 5DURD 5F1IB 4PJ9D 3H3BC 1NUFA 1P7HL 1YN7B 5JXAH 1PZUB 4XNQB 4G6FD 3VCLB 4ODTL 1PY9A 4S1SH 1K85A 2JB5L 2VRAA 1I1FA 1N7ML 3UJIL 3UTOA 2D0HA 3I75B 4NQCA 4YX2H 1A5FL 3WIFB 4PJGF 2DKMA 3ARBA 3MJ8B 1MHHB 3W81A 4Y0GA 1NANH 4JHAH 1MHCA 4YBQC 1S7TA 4XHJC 4OZHE 3VFTA 1FV1A 3WJLC 1MCPH 5DVMA 1JF1B 4Q0XL 4OCYL 2B2XL 1G1YA 1MPAL 4MCZA 3WHE0 4HGWA 3CLFH 4ETQA 1XCTB 3P3YA 5F7WC 4LSDA 1PSKH 1Q9OA 2Z92A 3GIZH 3OB8A 5C86A 2C3GA 3TWCH 1EGJH 1K2DA 5ANMA 2XTJC 3G08A 4YHKH 1VDGA 4Q97A 3HE6C 5HD8D 3BGMA 3QNZA 3MRQB 2IFFH 1A4KB 4A6YA 5J7CC 3RVXD 2DQDL 1KIQB 1NC4A 4KKCC 1TENA 4GW5B 2P43B 1C12B 4YHIA 3ZKMC 3QULB 5F6HI 4Z7VB 3QPXL 2DQEL 4JKWA 3QA3B 2AJ3B 4P23B 1YYLL 2OZ4A 1XT5A 4PJ7F 1KTLB 1FLRH 5E9DD 6FABH 2Y1VA 1GIGH 3D85B 4JFPA 1HZHH 3GBML 1JZ3A 4LLDA 4KUCD 4ZNEE 4J2XA 4JFDE 3JWDL 4BKLA 4M62L 1ADQA 4U0RB 3QUML 3K4ZA 1D5ZA 1MAML 4F9PA 5KSBF 1U58A 3LMJL 4M1DH 1HHKB 1IRAY 2LQRA 4P2RB 5IBLC 1B6DA 3VH8G 2YA1A 4YUEL 4XP5H 5GS1C 4XNZC 1ETZB 1UCBH 1A3LL 1BVLB 4Y88A 1IAIM 3D9AH 3QQ4B 5EZOL 2AAVA 1UJ3A 2VXQH 1J0KA 1ZVSB 3MA7A 5F9DC 2ICEA 1NCWL 2HJKA 2CKNA 3H7LA 4LCIL 1LO3L 1RQ5A 2C1OB 4RWHA 3EJZD 3AROA 3O6KH 4JQXA 1XF5A 4ODVL 1PFCA 3GSVA 3SQOL 1A6VL 2I07A 5F9WB 3AMLA 3MLUH 3IVKB 2E5EA 2EDTA 1QSZA 2M2DA 5ILTH 4APQA 4NQXB 1A22B 2CR6A 2X2YA 1UB6B 3FN9A 2K3TA 4WWKB 3I6KB 5FO9B 2J8UA 2J4WH 3JTSA 4QY8B 4XPTL 1J7VR 1V8HA 2UY6A 3B3IA 3RWIA 3D2UB 2JIXD 4D94A 1PSKL 4KVCL 5HGHB 5KG9B 3I3DA 3A6CH 3LOWA 2KL6A 4ZXBA 4UDUB 3MROA 4ORGB 3TVMC 2V9TA 3UAJC 2WIIB 1DEEB 1IAII 2ADFL 4LLQA 1YQVL 1NMAH 2RR3A 3MLPA 2ADGB 1RIUH 4JFDA 4QXGL 1W72L 1FC2D 1K6QH 2R2HB 1XF5B 4OSUH 4X0KA 1R0AL 1CFSB 1XGPA 4JFYB 4LU5L 4HK3J 3SGEH 3OAZK 3HMWH 2DYPD 1QEWA 2XFXB 2X70B 3RL2A 1PKOA 3O4LE 2OJZH 3CSYB 3KXFE 1NGXB 4XGZB 4Z0BL 1N8ZB 3Q3GB 4K23L 1YDPA 1BOGB 4UI2A 3DMMB 4P5TA 1MHPH 3FB6A 4XWOD 4YDJB 1IGIL 5F9OL 4Y5VB 4CBPA 2NPLX 1H8NA 4RISL 3Q6FB 3MLYL 3KYOA 1FIGL 4APQB 4DVBA 2W0LA 3TYFA 4NP4L 3UTSB 2IBBA 4AIOA 2J12B 4UUJB 5IK3B 3DV4B 1WBYB 2EC9T 3CZFA 3MJ9A 1DANU 3KYNB 1XGUA 1OAUH 3CFCL 1BF8A 3HI5L 3RWCA 4C4KO 4R4BB 4IM8A 1FYTB 3O0RL 4F7PA 4PRBA 3QUXC 4JHBA 1D7FA 2EYSB 2BSTA 4DGVL 4ZPTA 4U2ZA 4JG0H 3QH3B 1WQVT 1CGTA 4QF1A 4U1HA 4XP9L 4NQSB 2KH2B 3O9WB 3D69A 1G7IB 4M6ML 3WS6A 4D9RD 4B5EA 4PJ5A 1ZKAA 4IHOB 3MRRA 4NBXB 4A6YH 3FO0L 1M7DB 3JWOL 4AQOA 2FIKA 1SHMA 3W39B 1EHNA 4XPTH 4R3SA 4EI6A 3C5JA 5K9JH 1QVOA 4FXGA 5D8JH 3KPLB 4BZ1H 5SX4H 1MF2L 5EU6E 2OL3H 3EO9H 5DJ8A 3ZDZF 4TVPH 2MHAB 4NKDA 1I7UB 5GSVA 4M6OH 3MNWB 4NNYA 3ARXA 3MRQA 4GS7C 4LF3A 1I3VA 4BFBD 5D71H 3LKPA 3OGOE 5BS0A 5B3JE 2WBWB 3L3KA 4QHLB 3VXSA 5BMFL 2ZUYA 3WEXB 2OP4H 1NANI 5J3HC 3QWRD 2BNRE 3QJHB 2DL9A 1MWAA 4P2RD 1M7XA 4QRUB 5CFHA 3FO9A 4PV8B 4DKEL 5I74C 1U8HB 1XGQA 4EN3C 4YO0B 3OJVC 3SDAC 4YDVB 1F02I 1AKJA 1F90L 3HCVA 1FJ1B 3S34H 2JIXA 1H3XA 3QG7H 4P48A 1MIMH 3ARFA 1BPVA 5LG1A 2P44B 1MIEL 4NQCB 5EU7C 4IBLT 2ZOLA 3EDKA 3S37H 3PV7A 2C9AA 3CX2A 5C0JA 1HI6A 1YEEH 5CBAB 3E8UH 2ITDA 1R3IH 2Y72A 1IC5L 4PJ9A 4U1GC 3ECBB 4HWEL 4XNZB 1FVEB 1A7NL 2WW8A 3H9ZA 4KK6C 4Y5YC 1LD9B 3T3PE 2H8PB 1QVOB 2QQLL 4J8RA 1HQRB 4NWTL 4QRRB 3IXTA 4NUJB 4PJDE 3W39A 1AGBA 3GM8A 3QWOB 3X3FL 5JOEA 3TBVA 4Z9KB 5C07A 1U41A 3X14B 1EERB 4QTIL 5JOPD 1NEUA 5DD3L 3ULVD 4XPGL 3V0WL 4A6YL 2OJEA 3B8YA 1HHJA 3ISWA 5F96L 5LQBL 2RIKA 5IROC 3SHSA 1YEJL 4HS8H 2JJSC 5HHXH 2BNQB 5HHPB 2MTPA 4D9QD 5HYJB 3GO1L 4KKBD 43CAB 1HQ4A 4BZ1L 2OZ4L 1KPUB 5HYSA 1H5BB 2OL3L 2MNUA 4POZD 1CXEA 3JXAA 3TJHD 1MWAB 3QEQB 8FABB 4N5ED 5CGMA 2F53E 3OSKA 3TJEH 1BMGA 4LSQH 5IQ9B 3EYOA 3BRGC 4PRPA 2X44D 2KUTA 3QJFA 4LHQB 4MD0B 4CVUA 4PJXE 5JHDB 3HAEA 5FHAH 2Z31A 5KSAB 2SEBA 5FEBA 5L7XH 2R8SL 4NZUH 1UJTA 4FFZL 3U30C 5IB3A 3VXNA 1PKQB 4MNGA 1BWWA 3GMMB 4YBLB 4BFEA 4B7LA 3EZ8A 5H94B 2FHBA 3BEVB 5K59F 3P73A 2CRZA 3QEUB 1RSFA 2AK1H 3PXJA 3ARFD 4NQEB 3X14A 3L6FA 3CZFB 2VDPH 3FT3A 1MUJA 1OAZL 2A6IA 4FQJL 2L7UA 2YA2A 3IXTB 4NUJA 5JNYB 1I3UA 3SKJH 5BVJA 1WWCA 2Q6WB 2YEZB 4RMRA 1WFUA 5JXEC 1MJ7L 3T2NH 4KKNA 2PW2A 3E8UL 4R96B 1DANT 1WC7A 2O5YL 3E3QC 1R3KB 1A7NH 3OF6A 1LO4L 4WV1C 2L7JA 4NM4H 1DFBH 1P6AB 2OSLA 3IGAA 2BNQA 2IF7A 3MCKB 1R5IA 4DCQA 4Z95L 4PLKC 1BVKA 5IW6A 1CFVH 4PUBH 4LVNB 2ZG1A 1TETL 5TH2A 1KIRB 5ITBL 1EMTH 5IVXE 3UPAA 4JO4H 4NHUA 4HQQL 2OK0H 3IDMB 2BNRA 1UG9A 1U93A 2QR0A 3BVNB 4NPYA 1SJHA 3QIWC 5D2LB 1N4XH 3QXWA 1MCDA 3FO1A 4FTVD 3BKYL 1QLEH 3AFLA 3J8F7 1RZ7H 4ZQKA 4XAKE 1YY9D 5E6YA 2VH5L 1NC2A 4IOFC 3Q1SH 1WWBX 3QDJE 4GH7B 4V2CB 1KV3A 2ZUWA 4FNLH 3O6MH 4JRYB 3P30L 1XFPA 1F00I 4D0CB 3IAQA 3B83A 1SYSA 4U33A 4HBQA 2MQ0A 1WEJL 3D0VB 3TPKA 3OKEB 4NO0A 4WI4A 4U4BA 2OJEB 4CUCA 2DQIH 4F58L 5CD5D 2EC9U 3MRDA 1SBSL 4JFDD 2FZ3A 5JDSB 4FZ8H 3L3OA 3CXHJ 3AS2A 4JN2B 3MFFA 2IANA 5JA8B 4UT9L 1EUTA 2QL1A 2AEPL 1HH6A 3F7VB 4JFOB 1RURL 4IS6A 3OX8B 4DGIL 2XT1B 5L7XL 1TJGL 5FYLD 4FFZH 4PJGE 1GZQB 3WL9B 4O2EA 1OSZA 4KUCF 1YA5A 2E9IA 1LILA 2OQJB 3B6SA 3RTQD 5KSAD 3AMKA 2APBA 4OB5L 1S5IH 1IGCL 3G04A 1ZVYA 2NLJA 4RGNE 2DM7A 2ZUVA 3MRMB 1VESA 4F57L 1BF2A 5TDPA 4MNQB 3GSRB 3PIQA 5F7KC 4OLYL 4CVZA 3K2UL 3CU7A 4A2LA 3DSFL 4PRNB 4PFEA 2OX5A 2Y5EA 1KGCE 2DYPB 4QO1A 4PRPE 2VLLB 3TYGL 4TQEH 4KMLB 4RAUB 4ELKB 4MSWB 4ZMAT 4HS6A 3MRPA 5F89B 2YPVL 5L6YL 5L8KB 2HTLC 4GAGL 1KIQA 4PLJC 1F2QA 3DGGB 3ARED 5FOBA 3BQUD 4M9OA 2AKRB 2DJSA 1JUFA 5SWSB 2ATPB 1NPUA 1I1FB 1J8KA 1AQKL 2VDLL 2E6PA 2EDKA 2GCYB 4K7PX 4KTYA 4XNQA 4XI5C 4XVTL 4WY7L 1JE6A 2R1WB 1OF2A 3U82B 4PJXA 1DQDH 4CVXB 3WL9A 3WNMA 4WW2F 4XNMB 1E0OB 5F7DA 1M7DA 2AQ2A 2DQIL 1VSCA 1KCVH 1MY5A 1X5GA 4X5XA 1I1AD 4QXTB 5KSUA 2VDKL 3BDXA 4PJDA 1K5NA 3EKCA 3O2WL 4IIQA 3QWQB 2COQA 3SJVE 1DVFB 2FDBP 4Y5VA 4QRTA 5TF0A 1M71B 5GZND 5I15L 5B22A 2ZCLL 1BZQK 2EECA 4GRWF 4PGZA 5IB2B 3HRPA 1CE6B 3KLHC 3ARBD 4LRIA 3V6OE 4ZAKC 4WW2C 1NFDA 3CDFA 4CMHC 3IDJB 3MR9A 3HRZA 3B5TA 1HKFA 4NC1C 1BD2A 5IMKB 2OMNA 2VB5A 3CZJA 4OCWH 4GBXD 9CGTA 2JE8A 2YD3A 1U8QB 2ZUSA 1D9KB 1PG7H 2WM0A 1SJXA 3VD9A 4KUZH 4CW1B 4X4YA 3RJDA 3ZKNC 2NXZC 3VGAB 5ALCH 5CD5C 2OBGA 2VLJB 2V5SA 5FYJH 1IZKA 1JNHA 4XCYA 5GJTL 2VAJA 5JQHC 1U92A 4ODXB 1EZVX 5HYEA 5DEZA 2RJMA 3MRHA 4APQC 1IEAB 1S3KL 3MA7B 3UTZA 3OXRA 2YHGA 3FQRB 1BVLA 2MMXA 4FG6C 4LASL 3IDIB 1DE4A 3DMMC 4P57B 2ESVA 5K9OB 4KMTH 4YHZH 4MJ6A 3EYSL 1BM3L 1GGIL 2DLFH 3QFJE 4QXUH 4MAYC 2JB6B 4LKCB 5INDB 4JG1H 2DDQH 4JANA 1TTGA 3ZT6A 2D0FA 5FYKH 1KN4L 4Y2DC 5D2LA 1WIUA 3WLBB 1MFAH 4L3EE 2L4OA 1CN4A 5F9AC 3E3QE 4HUNB 43C9B 5D6CB 1T2XA 3CCHA 5JIIA 5DQDL 4F7TA 2VZVA 4LKXA 3WFEH 1JYXA 3VWJA 1JPSH 4F7EA 1CFQB 3ARPA 1U8KB 4WUUD 3EUUA 4LGPB 2HP4A 3LPWA 4DW2H 2DF3A 3QI9A 5KJRL 4OLUH 4OF6A 1F13A 2J1KA 1LP9B 1HHIA 1E4KA 5MHSE 3GSWA 1VFBB 3FFDB 4V1DD 4MCYA 1YEGH 5FK9B 5EO1A 5BVJB 1A7RL 2IC2A 1G6RB 1CLCA 3P9LA 4XP1L 8FABA 5HI4D 5AAMA 2CKBL 3HUJA 1X5FA 3IAPA 1RZIB 3QAZB 4HXBL 2AXJA 4HFUL 1JTPA 3L3IB 4BSVB 5KVMC 3W82A 4PJCA 3FFCD 3ARBB 1PG7L 3RJQB 4QOKA 3JV5A 4CMHB 5CSZB 3AM8A 4KUZL 2E3VA 2YPLE 1MRCL 4LSRL 3WXVL 3ARDC 3TBYB 4O2FA 1IC4L 1RJZB 3MOAH 5TDOA 3TZVA 1D5BB 5AZEL 1MCQA 4NCDA 3OKLB 1I85A 5HHME 3TBSA 3SE3C 3SCMB 5IMOA 3GSNL 4LKXB 4PG2C 2DMCA 2GEEA 5EUOB 1T04B 1M05A 4ODTH 5D5ME 1VKXA 3T2OA 4QRRA 1CDIA 1AGEB 4NQEE 4HBCH 3H9HB 4OIAA 1SMAA 4PTTA 1K8DB 1KJ2L 2HH0H 4JY5H 3FB5A 4ZS6C 1FPTL 4Y16D 4GKNB 1TJIL 3PWUA 4X7FC 2UWEB 4I0KA 4IMLB 2IGFH 2IH1A 2V17L 1T5WB 3O6FB 3UMTA 1KN4H 3L7EA 4PRHD 3V52H 5IW1A 2AI0L 4DAGH 4Q0XH 3GRWL 4PBVC 1BWMA 4HKXA 2FECI 4YHNA 3STZB 1WVZA 4F37K 1KOAA 4LLMA 4IRJA 5L2JB 4Q7DA 1T1XB 5GGSA 5GIRA 4Y4KA 3I9GH 4FFYL 3VFNA 4EDWL 2V2XA 3A67L 4NWUH 2YWYA 3HPJB 1LMKA 5C0AB 3OR6B 4LAQL 3EOAA 2VXTH 3JTTB 5DJYA 1S7WB 3QUMB 4F9LA 5ADOL 4C56E 4XMLL 4RFNC 4PJFB 2APXA 4G8GB 4EXKA 3BHBB 5F93C 1EAJA 5IT2H 4TUKL 1I8KB 5EBWA 4K8RD 5MEQB 3MNWA 3QDJD 1YYLH 3S35X 4K3JH 2V9RA 3NZHH 1ZGLA 3QXDA 2EYRB 5IF0B 2BVEA 1ORSB 3RTQC 3O6FA 3WHXA 1XIWB 1SJVA 4P2QD 1Z2KA 4PRHA 3CFKA 1MAMH 3MV8A 4PJBA 4JFHD 2NY2C 2XTJD 5DDHB 2DI7A 1RZKC 4Q2ZA 3C5ZB 3X12A 4QHKJ 1DBBL 3ZLQC 1Y6MR 5H8DA 3EFFB 3VFNB 3QQ3B 4WO4A 4LP5A 4EIGB 3GI8L 4IRJB 2Z93B 1T2JA 1NBZB 1P4IH 1BX2B 2D3VA 4POZC 4YXHH 2BSED 1A02N 1K9TA 2EICA 2CK0H 2GJ6A 4KJYA 1MCRA 1D5XA 1LNUA 2WBJD 4ELMF 4JRWA 5HDBF 4PJCB 4OI9A 3ROOA 1A4JB 1T0NB 4HJGB 3O2DA 1D6VL 1H0DB 5HGBA 2C3WA 2P5WD 4RNRB 4XI5D 3HTLX 1GGUA 2Z35B 4OKVA 1G7LB 4OV5B 3DUUA 2W59A 3U46A 1LO2H 5J57B 3QDMA 3BRDA 5E6IA 4OLZH 1HSAB 1ZSDA 2Q8BL 2CDGB 3FT4A 3BPOC 4D9LH 3FB6B 4YDJA 3A6CL 3OG4B 3CLEL 1KIPA 2B5IB 1E4KC 3KPSD 2MQCA 3QCTL 3MBEB 1FAIH 2ADFH 4MA8H 4ODUB 5F88A 1HEZB 2ERJB 2D2OA 5J12C 4HLZH 4NBZB 3SGDI 1AJ7H 2DD8H 5CMAA 2FNBA 5KW9H 2WZPD 2HT4C 2J8OA 3V7MA 1RAMA 4ALAH 3BP5A 4WENB 4WDIA 5FF6B 5C0EA 4HAGA 4LBEB 2XZQH 3D39B 2VLJA 1A7OL 1F3JB 3DIFA 2Y4SA 3T0BA 5D5MB 4PB9H 2C1PB 4OCLC 5DWUL 1A3RL 1DBMH 2NY6B 4GBXA 1QO3B 5DYOA 2NXZD 5I9QB 2R0ZL 3SN6N 5HSFA 4MZ3A 4XGZA 4DKFH 3GSOB 4MNQE 4DWHA 3GSUB 4O4YH 2M8XA 1J88A 1ZLUK 1YNTB 2E27H 3FQNA 3RVVC 5CINH 5I1IL 5EOCL 3KPSA 4PB0L 3W2DL 1U3HD 3RZCD 5DHVB 1X5IA 4YEEA 3NZ8B 5DJZA 3VXTB 1FGVL 4CRPA 5C6TH 4HGKC 1FL6B 2FGWL 2HT4D 2VKWA 2H9GB 4ZQKB 1NJ9B 2R9HC 1MJ8H 5F3HB 2V7NA 5I1JH 4NOBA 2V2TB 2E8ZA 4LRNL 1CDJA 4QLRA 4WGVB 3K80A 2C3XA 3ALPA 5IHBA 2B4CL 4XNXL 4GAJH 2HRPH 5E0QA 1LE9A 3OKKB 2EH8L 5IHLB 2AJXH 2AJSH 4DCQB 3VG9B 3T2PA 3CSPA 3EDEA 2F5BH 1MJJB 1BQSA 4OIIH 1NCDH 5TFSH 3JSSA 3HN3A 1YEDA 2X41A 4JO2H 2Z93A 4Y2DA 3GHEH 3AS1A 2EO1A 3O41A 2Z91A 4WO4D 2H32H 2DQFB 4JGMA 4XXDA 4LDOB 4ETYA 2F5AH 3UEZA 5BZWA 2Q86B 2WUBH 2EKSA 2PXYC 5CGYD 3TPUA 5BXFA 1RY7B 1S7SB 3RVXC 3L1OH 2WBJC 2X1WL 3B2UD 4JRXD 5AD0A 1N3NA 2IAMD 2DD8L 2FEEI 2ICEB 5SV4A 5C0RL 5DFTA 3VFOA 5IKCB 1TTFA 2A6KA 4NHCL 4MVBD 4ZFOA 2OP4L 4MNQA 5F7YC 4M03A 3OAZH 3MRKA 3FQWB 4L9LC 1AIFB 3ULVF 4RSVA 3HI1A 2HJFA 1S8DA 5CGYC 5IJVA 1TJHH 4NC2B 1A3RH 5DK0A 4QRPA 5LCVL 3LKSA 4WEBL 1Q9KB 4LCWA 4DKFL 2NYYD 2A9MH 4WDIB 4WFHD 3U9UB 4MLIA 4WWKD 3O3AB 5DHVH 5HI5C 4G6ML 1P53A 4D3CH 4RGOH 3UBXI 3BOVA 3PWLA 5GRVL 1RJLB 2XA3A 4DFIA 1AQDB 1LO3H 2FATL 1Q9LB 4YZFF 1FFNA 3N1MC 2W9EL 1BJ8A 4H25B 2GY5A 4EJ1C 3H42L 5FGSA 4E41E 3TV3L 5IJKA 2JCCE 3OKKA 2X4SA 3QB7C 3MYJA 4WCYL 3ZE0F 1TVHB 2ZJSL 3PUCA 4IJ3C 5LXGL 2C7UA 1HK6A 2IPKB 4JDVB 3QCUH 1NLBL 2B7DT 3QDGD 5EC2A 4HFWA 5AWNH 5TQ2H 4XPGH 3TPUB 3B6SB 1AGBB 5IVZA 4OZGB 5D1XB 5MP6L 2FJFB 4N68A 2EXYD 4ZUTB 1CDCA 2A2QT 5DR5L 3GJFB 2FH8A 1CGXA 4PPTA 3QXUA 5HYIA 3IFNL 4X9FA 1LP9E 4HULB 1FZJA 2YXMA 5EG6C 4JDTL 1KN2H 4P46A 2EYRA 5GGUB 1H3GA 2H26B 2IPUG 2WV3A 1F4YL 3TJEL 1XH3A 4MQSB 3HI6L 3T0DA 3WKNA 3X11B 3NAAH 2AJZB 3FOLB 3PWJA 3LEXB 4I3SL 1AKJB 3HCVB 4JZNB 4TNWF 3HMWL 3ZL4L 3DIFB 2CLVA 4LHUB 3JTTA 2I24N 5C0AA 5T3ZE 2AXFA 4QRSA 1PGRB 2XN9D 1CG9B 1BQLL 1H8OA 1IGJB 3BPCA 1VADA 3QQNA 3IRPX 1YNTA 2P42B 4JRYD 3RZWA 1L9MA 2A9ML 1NGZB 3DVGA 4Y2DD 2VLKA 2WP3O 1OCWH 1RU9H 2B1AL 5KANI 5CJXC 1OD7A 1PDKA 1CXKA 4XAWH 4Y4FD 3P4LA 1K3IA 1G9ML 4I77L 3KNBA 3QQ9C 4LQFL 3MV7A 3O4OB 2SEBB 2G2RB 4HWUA 1LK3L 3AREC 3MUZ1 3P0GB 2P5EE 3DVNA 3B9VA 1AGEA 2H1PH 1NC4D 1OSPH 2NY6C 1J5OH 1V7NH 2HVKA 1S9XB 1MUJB 1ULVA 1N5YL 3IU4H 1JYNA 1JHTB 1NGWB 2V5RA 2HFTA 3RTQB 4EUPG 3GSWB 3NCBB 1T20B 4W4OA 1LEKA 4YIQA 1GC1C 4YPGA 3FB8B 1N4XL 2IMMA 2QHLA 2VZ1A 5FYKD 5HYQB 5MEND 2GJ6B 1RZ7L 1UCTA 2EE2A 4MLSA 2QSTA 3MC0A 2W9DL 1PZ5B 2ERJC 2VH5H 2ZUXA 3W0WA 2X1QA 3D25A 3QDJB 1N5AB 4G9FE 3RDTD 4OUUB 4MA7H 1A9EB 3MUHL 5C09A 5I74B 5ID1A 1CL7H 1YY8B 5TJWK 3MNVA 2NY4C 2ED9A 2VL5A 2P5WE 4JDZB 5DRZA 3NBNA 3B9EA 5BS0D 2ARJQ 2NR6C 2NX5E 4HAFA 4LPVA 4JFHE 2DM3A 4X80L 2YD2A 3MV7B 5IMKA 5HBBA 2CDFA 3WE6B 1IGML 1GGYA 3VFMA 2ZUUA 3SKNB 4KDTA 1CFQA 3MLZL 1SEBB 3BUYB 4RQQA 4M7JH 3UYRL 2J5LB 4P9HC 1U2HA 1OWRM 1UACL 1IC1A 5ACMA 2DQCL 3IS0X 1W0VB 1IGCH 4R97C 3WKMH 1DSFL 3VWKB 3VG0L 3P9LB 2EYTA 5T3XL 5T3ZL 3MODL 3KR3H 3WO4C 2XY2A 4AENA 3MRNA 4D2NA 2X4TB 4RRPA 5MEOB 2E7LC 3SKOA 4HWEH 3GGWB 3EYFA 4PRIA 1T3FA 5A16A 2FX8H 4X4XB 4PD4K 4ZUVA 5B39B 3U7YL 4MDIB 2OTUA 4UIKH 1HWHB 4LMQI 3IU4L 4HH9B 3X3FH 5TGBB 4XBPB 5EIIB 2YPVH 2JIXB 1G84A 2Y7QB 5KBNC 4YDVA 1W0YT 1NFDF 2FJFA 5F44A 5GS0C 1P69B 4X5XB 5E2VL 5DFVC 4RAUA 2LE9A 5F97E 5IR1A 2Q1EA 3FRUB 2MCG1 4MB5A 3W0WD 4ZFOL 3BD5A 3MLWL 1L6XA 3VXOB 3TH2T 3F5WB 2ITDB 4RZCA 2EIEA 1NSNH 5HGAA 3T09A 1A1MB 4X9IA 1Z5LA 4IMKC 4J6RH 1T0MB 1CFNA 1VGKA 4PTUB 1RMFL 3T1WA 4FQ2H 4ZS7L 1JRHL 3LKOB 4KFZC 4M6NL 3WV0A 1OT1A 3ROLB 2I60H 4DGYH 2VIRB 1K8DA 5FHAL 1ZTXL 3WIHL 1FVDA 3G6JF 4I2XA 4NZUL 2PTVA 2NTFA 4TTGA 4GXVL 5I1LA 4GRWB 4BK4A 1YPZB 1Z9MA 4ZPVB 2JELL 4P5MA 3V4VL 4ONOA 1CVSC 4P2YA 2FL5B 3GSQB 4ZUUA 2CIIB 4ODSL 5I30L 5K59E 2PO6D 3LQMA 4OF8A 4R4FH 3RBSA 4Z0XB 1AHWB 3PGFH 1JFQH 3VG0H 1I9EA 3BW9A 3C60C 3RDTA 2F15A 5CZXC 5DMGC 3LKRA 2W60B 3FB7A 2AGJH 3HG1D 5HY9A 1KJMA 1TNNA 3VWJB 4PREB 2R4RH 4QT5A 3HC0A 1CIDA 2XG5A 5E00B 4NUGH 1W72A 1TDQA 3RWGB 5D6CA 4PP1C 1E4WL 2BDNH 3ARBC 3WUWB 1L4IA 4M5ZL 4MS8C 4S2SA 3VMOA 2UUDK 3B2VL 4HEME 2R69H 4UIKL 2HT3D 3QT2A 4PUBL 1N6QH 1INEH 1ZAGA 2VJXA 1MLCA 3PDOA 3BPLC 3UX9B 5D2NC 5DC9B 1J8HE 3HS0B 1U8JA 1VFBA 3VWJC 1KCSL 2BNRD 4U1HB 4KHXH 4ODHH 3T65A 4KKBC 4Y5XB 3WFDL 4F2MB 4PJ5E 5D6DA 4MXWH 1MI5E 3BT2L 4LFHD 2NY3D 3ELAT 1W0WB 2HFFA 3JUYA 4IOFD 4R4BA 5I1CL 5ENWB 5D1QB 5I16B 2PYED 4D8PB 3O3DB 4FNLL 1FDLL 1OAYH 1NCBL 2X7LA 4BK5A 1WC7B 3GNMH 4Y19E 5TF1H 5I1KL 5KZCD 1T5XB 2BCKB 2VITA 1S78D 4JAMA 4TULL 5DZOA 1MREH 4M7KH 1KLGB 2F54A 4JM2F 4AEIL 3S36H 2ZP0T 2P24B 3CDYA 5GGQL 4HK0A 1JRHH 1EEYA 5DK2A 1Q38A 2XQBL 4C4KT 5ALBL 4QOKE 1I8IB 2NY0C 3GSUA 3RUGA 3E6FA 4BUGA 3PL6D 3ZKXC 1BZ7B 5EOQH 5GISH 4L8CB 3O8XB 3HE7C 1CFBA 2CLRA 5F1SA 1WITA 1JWUB 4R4FL 3D1MC 3D39A 5D7LD 5I8OL 1JZ8A 3VGEA 2CDEA 1U8LA 2OTWA 1IC4H 3O81A 2CRYA 2EYTB 2EDYA 1NBQA 1KTLA 4MQXD 3IETB 4G6JL 4OCRH 4JHZA 3REVA 4RA3A 3VGAC 3D85D 3QA3A 2FB4H 3ESUF 1E27B 5ERWB 1ZMYA 2E7HA 5I16A 1QKZL 1IAKA 3P4MA 2ZSWB 5MEPA 3DSFH 5BZDA 4ZNCD 2VQ1A 4JO1H 5EU6B 5BJTA 5ACZB 4LGSB 1CQKA 1C5CH 1PZ5A 4AG4H 4HLZG 2ILLA 2H45A 3T65B 3TYGH 4IRZL 5BW7C 3VXRA 4EKXA 1C5BL 4MAYA 3TNNB 4GW1B 2CKBB 2X9WA 1ZHLB 1K2DB 3P4NA 2V17H 1NUDA 1XIWD 2XZCH 5CJOH 1A6TB 4HPYH 3IVKA 1QUNA 1HKLH 4PLNC 4JY4B 1T5XA 3S96B 2KDGA 4PRNA 1S9KC 2R2EB 3BYYA 3QRFM 3AXLB 4QGTA 1NFIA 4XVTH 3JV6B 2XRAH 3MXVH 4L3EB 2R39A 3TCXA 5C6WH 1WF5A 3QFDB 1TQBC 4JPWH 1JGEB 2CR3A 1QOKA 4I48A 4PGEA 3V6OC 5DEGA 4N0YH 4Q9RL 1I8MB 3KLAA 2AP2A 5JW3H 3H0TA 5E95B 4K7FA 1UH3A 3DOSA 5FCSH 5HVWA 4KAQL 1N59B 5I6XB 5MENE 1J05A 4TNWK 1WGOA 1AXTL 4BKLB 2XQBH 1U8MA 3D39E 2GTZA 3U48A 3INUL 4IDJL 4M7LH 1KB5A 3RNQB 1YN6A 4UOW1 1H5BA 1LD9A 4H20L 1YUHA 1N0LA 5A2LH 1ZT1A 3DLQR 4NGHL 1C8PA 3B43A 1MI5A 3FCTB 1KEMH 4OLXH 4X7EC 3ARDA 4XVJL 3U4EB 1JIBA 4TUOA 5HHMB 4IRSD 1JHLL 4F9PC 4YHLL 3JVGA 4YDLB 5I66B 3WE6A 1BBJB 2D7OA 4DVRL 1ZA3B 3RX5A 1UH2A 5KANG 1V7MH 1P4IL 4CAGA 1KIUA 2F58L 3MRNB 5CEZH 5DTFA 5IMLA 2VYRE 4IS6B 5IOPA 3HAEH 4AEHL 5D1ZD 3V5KA 5LJYH 1N64H 5HYJA 5L2KA 1MHEB 3G6JE 4K3GA 4U3XA 5J13C 1FAKT 4BQCA 1HWGB 4ZTPL 1N59A 1MWAL 4AQ1B 1KIRA 5D96B 1ZHBA 5KSVB 1SY6A 4Y19A 4QF1B 4XCEA 3HE6A 2A9NL 5B3JF 1I8MA 3T4YA 3CXHK 2O5ZL 2O61B 1LO2L 2QQKL 1D5IH 2ZSVB 4BM7A 5A16B 2FR4B 3WIHA 4NRZA 3GMRB 4BQBA 2B20A 5TQ0L 3SBWC 5DD1H 3RNQA 3ULVE 4FOMA 3FQTB 3QCTH 1ZWIB 1AR1C 2G5RA 1A14L 5JW3L 4XVSL 4DOHB 2DQDH 2MKLC 3OKLA 5F7FA 3TVMA 1YEGL 4NBYB 3WSQL 3ES6A 4J4PD 3I50H 2X4NA 1TVHA 2DQEH 2YN5A 3EJYC 5F6IB 4PP2B 1BFOA 1KLUA 4XHQA 4F37F 1Z0MA 3EFDL 5J6GB 1FLRL 3DRTA 4BUHA 3H7BA 4P9HL 4UU9A 2DIBA 3ULSB 2LFGA 1U91B 3WFCH 4K7PY 3VI4E 4F33A 5DUBA 2FHCA 1DBML 5FB8B 4BH8A 1WIOA 5F7EL 2PW2B 4EI5A 4OT1H 3UDWA 2Q6WA 4Z8FL 1KEML 3CVHB 1QFWH 5AUMA 1QFPA 4Y4HC 1RUPH 5EBGA 1AXSB 3VXSB 2AXFB 4P46C 1UWGH 1FNLA 1S7RB 1S7XB 4MB4A 3BYTA 4NRXB 1NDMA 2R0LH 3MLVH 2AJZA 3PWJB 5HHVH 1MCNA 2X09A 2YK1L 4LRIC 3UPRA 2VQ1B 5EU6A 2FD6H 4L4TB 3WXWH 1MJ8L 1QPXA 4KXZI 4U6YA 4GRMA 3W0WE 1VEOA 4NYLB 4U6TA 3MRCB 5IKCA 2EDLA 2R2HA 2AABL 4X0KB 1R3HA 3LPFA 5FAAA 4X6FA 2HRPL 3BPCB 5K9KB 3UC0L 3TN0A 4G9DA 3DARA 5IFJB 4O9HL 3ESVF 1A6TA 1BD2D 3GKZA 5FGBA 4NM8H 4I9WD 1HIML 1AD0A 4OQ1A 4JM4L 1NLDL 3GSVB 4GW4B 5DD0H 4DEPC 2VLKD 1U3YA 1QFUL 4RWYH 5TE4H 5C0CA 3CFEA 1DQQA 3BZ4B 5B38B 4RMQA 1KB5H 4OFKA 3A67H 4KTDH 3QYCA 3E6FB 3V8OA 3QQ9D 2HKFH 5B21A 3LD8B 4Y1AA 4DUWA 1NMAL 4OGAD 1FE8H 3I6LE 3BKCL 3BP6B 5GRZA 2FX7L 3V4PH 4Y5YA 4O5LL 1IARB 4TUKH 4U1NA 5E8PB 4UB0L 1O0VA 4GBXB 3QISA 2CDEB 4XNUL 3A0OA 4M6AA 4KHTH 5HJ3B 4QRUA 3DETD 4R97B 1NMCB 1KG0A 1RD6A 2BNUB 5EC1A 1TFHA 2DLHA 2O93L 4X9GA 2FLBT 4XX1G 1TJHL 5CBEB 1GJIA 2BVPB 2OTPA 3MUY1 1YJDC 1QHPA 4FN0A 2H32B 3HPLB 4OT1L 3N1QC 5D1QA 5EC2B 1NMBL 2OMBA 4TRPL 4WEBH 4I9WE 1SQ2N 3VG9C 4E0RB 1QEWB 3T0XA 5E8NA 1I1AB 4D0BB 3F62A 1WIPA 1YYMH 2VDNH 4BH7B 3EZJB 5J89A 4K55A 3BZFB 1BHGA 3HI5H 4F3FA 5T1LA 4H8WH 3H42H 2YK1H 3MV9E 1NCUA 5T1DL 3WYRA 2DQGH 5D7SH 5T1KA 4JREC 5LGKA 4WCYH 2ZJSH 3TF7C 2PYEE 5I18L 4Z7OF 1OLLA 1W0WA 2HFFB 3ZT7A 1JMZA 5DGQA 2CUMA 1F5WA 5CMAB 4EBQL 1RVFL 3CFJB 2YD6A 4HV8B 3ALXA 3HZVB 3I3EA 1S5HB 3NACL 4OZHF 1RZKL 2XWJB 5GGTH 3ZKXB 2BSTB 1QLRB 4KDTC 5DR5H 4JM4H 1D5ZB 4OM1H 1OP5K 3U0TB 3U1SL 3QO1B 4JQVC 1U3HB 3IFNH 3LHPH 3RZCB 4ZSOE 4P0DA 2R1XB 4YXLL 5C92A 2HA1A 1C7TA 1N3NB 4KK8D 3MCLL 2EIZB 3ZYOA 4CMMB 3RU8L 1FCGA 2FIKB 3P40A 3TN0C 5IR1B 1IILE 3F58L 2FEEL 5C3TA 2C1OA 2YKLL 3LPGA 5EU3B 3VXMB 1NBYB 3Q6FA 3VA2C 1CDBA 4PD4J 5I1GH 4XCFH 4QWWC 5I17B 3SO3B 3BGMB 2R2CA 5E08H 4OF0A 2EXYC 3G08B 2X4RA 2Z4QB 1FYTA 1WFOA 1C08B 1BQLH 3L5HA 4JPIA 3NCMA 2PTTA 4WO4B 4CDGC 4K3HA 1FNHA 1FLTX 2X4TA 4M1DL 3FAWA 1QA9A 2A0LC 3OZ9L 4UQ2B 3MV8E 3PQYE 4P23A 2OTWB 5F9WC 5CZVH 2OQJA 5HHOE 4X7TA 1DUZB 4LPXA 1T89A 5CEXB 1XF2B 1A0QL 3N85H 5C0EB 5FF6A 1P1ZA 2NY5C 4U1LB 3HPJA 1FFPB 3K0WA 3GMPB 2DQUH 1E4XH 3RPIA 3W2DH 3DHMA 4YDIL 3I75A 4ODVH 4OGZA 5A3ID 3BGAA 1VA9A 4LLVB 4QEGA 4U3HA 5C0DB 1SM3L 3RBGA 3B9DA 2JF1A 3HUJF 2CQVA 3W9EA 1ZK9A 1NGQL 4M3KB 2XKNA 5TE6H 1TIUA 5L2KD 3BEWB 3MUGA 5ICYA 1J1PL 3K81A 3HE6D 2A1WH 5LQBH 4R7NA 3SCMC 2LABA 2X42A 3NFSH 1OT2A 2JJTA 1PW3A 3JUZA 3G5XA 5LGHH 1HILB 4S0SD 5E94B 5TFSL 4NJAH 2ZWLT 4ZOAA 1FL5A 4XWOC 3H9SE 1SEBA 3R4DA 4Z78A 4U1SA 3W9DB 4JKMA 2IADB 2QQQA 2IH3A 1B0GB 5JW5B 5I2IA 2F5AL 1F4HA 5IW1B 3GSNA 3MO1A 3L3HB 3OPZL 4QYOA 4NJ9L 4OFDA 1G6VK 3SKMA 2YPLB 5MEOA 1T5WA 1U58B 1I9RL 1P4LA 1I8LA 2IAMA 4LDEB 3QHFH 4ZO7A 4P5KB 3FHAA 4DEPB 1Y0LA 3Q48A 4XMPL 3C60D 1S7XA 4X83A 3OR7A 4L5FH 2GKIA 3MV7E 1IE5A 4MJ4A 4I3RH 4GOSA 3QEHA 4BSJA 1FP5A 3VMNA 2UYLA 4NN6C 5MHSD 3MV9B 3V5HA 4PG9A 3VFVB 2ADJA 1SBBA 4LOUC 4PRIE 1NQBA 4IRJD 3MRCA 3DX9A 3FQXA 5T3XH 3KS0J 4UU9B 2Z31B 4HIJA 5DEFB 1BOYA 1W8NA 3BPNC 5J6GA 2XN9E 4HCRL 1A0QH 1U8PB 3N85L 2YUWA 3W9DA 2AJYL 4ZYKB 4MQ7B 2DQUL 5CS7A 5GGTA 2FATH 1NGWA 2RFXA 3KXFB 4HKBA 3CSBA 5K9QG 2DKUA 4P4RA 4QTHA 3GIVB 4M43H 1HILA 1QBML 3BO8B 4LSSL 4JZOB 1IBGL 3LRSB 1OP3K 4G6AD 4JZJA 4MDJB 5IFAL 3FONA 4LEXH 3ROLA 4BQ6A 5EO1B 2J5LC 1GGCL 1X5KA 4JFFD 5A2KH 1B4JL 4JQVA 2FEDD 3FO0H 5F3BB 4P57A 1MY7A 4V1DE 5E2UL 5C0IB 5MP6H 4FTVA 2ZSVA 5F71A 2VQTA 1T03H 4HUUB 1ZLUH 2BFVL 4CNIB 2AQ3A 1OW0C 3F7QA 4KWUA 2D7QA 1LK2B 2F74B 4WEMB 5C0GB 3S35L 3P30H 3U7WH 3UBXA 1NDGB 1CK0L 3VWJD 1BZ9A 3EO9L 3TA3A 2P5EA 1NGYB 3DUUB 3NOIA 3MGOB 2G60H 5C07E 4Y1AD 3UXFA 1QR1A 3ULVL 5KVGH 1MHCB 3F12A 3PHQA 3HI6H 5D71L 1JNNH 3MV8B 2EDNA 2PO6B 3OKNB 5LAXA 1RZGB 2EEDA 4X6DB 3X11A 3GMNB 4WW2B 3I02B 4FXKA 4DGIH 5LVEA 1XF1A 3WIHH 5ICZB 4XMPH 3WIIH 1B0RB 4OLVH 4M8VA 4NO3B 2VR5A 2VOTA 5I2IB 1S78C 4R7DB 4X5LA 3VRJA 5DO2C 3UO1H 4GMSH 2RHEA 1IM9A 5EO9B 1JGVH 4XWGL 4L8BB 1FZJB 2DL2A 3SKOB 3SO3C 3SY0A 5J8OA 1G7HB 1N0XL 3HC4H 3HNTH 4FP8H 1MSPA 3RFZC 1N2RA 3CAFA 3OJ2C 4K94H 1F90H 3VFWB 5E56A 5E6ID 5KS9A 5KSBE 4AENB 3ILPA 3WFHA 1BIIB 3PWPA 3CVIH 1OAXL 1MIEH 4JY6A 5FV1L 3TZVD 3WEXA 4JFXA 5IESH 4KRPC 5JUEH 3L95A 2BXYA 2VSDA 1CLOL 5FGBC 1G7MA 5E99L 2BP3A 4QRQA 5CJQL 3A6OA 3HR5B 2ZPKH 5GIRB 5E9DE 1UT9A 1LK3H 2R1WA 3CNKA 5FGCB 5D6DC 3T4AB 4ZG1A 3WJJA 3BXNB 3VXQB 1L0XA 3KPPA 1BGXL 5F3BA 3TBYA 1V7NL 1E28B 4OTXH 4PJ7A 4PLOB 5JOFB 5FO8A 1SJEB 5IGXH 4H5SA 4GT7A 1C7SA 4FABL 4GAGH 3DUSA 1C1EL 2BRQA 1HSBA 1HDMB 4QCIB 4UV7H 1NBYA 3LKQA 1QFHA 2OI9B 4ODHL 4KVNL 3WFDH 1ZT4A 3MGOA 3GI9L 43C9A 2W9DH 1BLNB 1C16A 3RA7H 5DK3A 2VUOA 2F53B 4PJBF 4LQ1A 4O58L 3KPQA 3BAEH 3FFDA 2HLFD 4FFVC 2WMPA 3RVTC 2G60L 3F65A 2X4UA 1KCVL 3ULVH 3LH2H 1I1AC 3RWFA 4HV8A 5EBMA 5GGQH 1WZKA 3EYQD 4GRWE 1MCBA 5I15H 1FO0A 1L0YA 2CD0A 2EH7H 4ZOBA 1E27A 1FL3A 3U0PB 1T2QL 4ZAKD 3REVB 1LO0L 2I9LA 4JQXC 3UO1L 1ONQA 1CICA 2J8UF 4OF5A 4OD1L 3MLZH 5GRVK 1TPXC 4P2QA 1N0XH 1QACA 5FECB 3O6FD 3C5SB 3CDGB 3HI1B 2VQUA 5GRUH 3RVWD 3RGVB 5D2LF 2CLZA 4O2FB 1T7ZA 5TPWH 1BBDL 2IBZX 4PJ9C 1X5JA 4IOIA 3FQXB 4OZIA 1YDPB 3HB3D 2VABB 1DEDA 5GQBA 4OFIA 3VXRE 1I7ZB 5DS8B 3RY5A 2YZ1A 5FKAB 2RB8A 3UCRA 3IS1X 4PJ8D 4YNYB 3QIWB 3UTTE 1FCCA 5DHYB 5E5MA 1XF2A 5D2NE 3ULUL 3SE3A 1QHOA 1RUAH 4W4OC 2GTWB 5DD6A 4KMTL 4YHZL 2J88L 3RIFF 4ODBD 4OF3A 4U2YA 4K9EH 2NY2D 3QI9C 3L3HA 4QYOB 1IEHA 1QLEL 4GRMB 3RHWF 4KV5F 3O6FC 3GI9H 2X5PA 2Q3ZA 3SE4C 1UADC 4MQXC 1FC1A 2F54E 3OHXB 1NDMB 3VMPA 3I6GA 1OLZA 3QRGH 2XRAL 1CDYA 1TZHB 3GJFA 4BQ9A 4R2GD 1YECL 5EZIH 3VGBA 3QG6B 3SOBH 4TSCL 1RZFH 2D7TL 3MZGB 5DD5H 1OVZA 4OZGA 5D1XA 2ARWA 2V2WB 5CILL 5E70A 2Z35A 3BUTA 5SWZA 1S9WA 4RX4D 5DMJB 1SBSH 4HGMA 4M93B 4P9ML 1ZT7A 4X8XA 4Y4HB 1X9QA 2JB6A 1A2YB 4LKCA 5INDA 5DJAA 1NL0L 4J1UB 5DUPL 1MJUH 3DXAA 2DJ4A 4JB9L 2FJGB 3IDXH 1CZ8L 3CJJA 4FMFA 3INUH 3R06A 4XP1H 5MERB 2H3NB 3SE8L 3PHOA 4XC1L 4M7LL 5I1HH 2GY7B 5L8JB 4HIXH 5E03A 1KPRA 2FSEA 3BZEA 4R0LB 3DGGA 4ODSH 5I30H 2EDEA 3MZTA 3DI2B 3QHZL 3QQ3A 3VDBA 5LWYH 1Q9WB 1R5VA 4Z7QE 4URTB 1U3JA 3VXSE 1JGLH 2Y25A 4LSRH 3WXVH 1VFOA 4QHKI 3V0AC 2IQAB 5DMGD 2QLVB 3EHBD 2GQHA 5HDQH 2OR7A 4D9RE 1EXUB 5HGDA 3RGVD 3CH1A 2NNAA 3MACH 4RMWA 4GKOA 3QO1A 4OM0H 1XF3B 1TITA 5TDPB 4RX4A 1A6ZB 3PNWB 4YQXL 5DZLA 3EOYG 1UZ8A 3B2VH 5BW7A 3BIKB 5ITFA 3LQZA 4DJMA 3M45A 3WD5H 3ES6B 3K8KA 5BCAA 4MCZB 1DUYB 3LDBC 4H0IA 3VXMA 2IGFL 2DLGA 5ADPL 4EIZC 1CU4H 2R4SH 2BVPA 3MV01 2VXVH 3GB7B 5I1EL 1ND0B 5SX5K 2P48B 3R1GH 5IUSA 3K7UA 4I0PA 4EI5B 4PRAB 4RMUA 3GSXA 4JQIL 1DDHA 3VXUE 4X7SH 2QADD 3F7VA 4JFOA 5EO9A 4Y4FA 1HYSD 5EZIL 4EDWH 1EAPA 1QLRA 4WHYH 2DM2A 1OTTD 5JDSA 1JUFB 4BYHA 1U8NB 3EJJX 4FQPA 5D7LB 1MFDH 3QFJA 4XMLH 3SJVA 4EN3B 4KQ3H 2NLJB 5BQ7A 4XVSH 4POYA 3WJJC 3IGAB 3UDWC 3ARFB 4NQED 5JMRA 3N50A 2ICWJ 3HAEG 2Q7YA 3PP4H 4EQ3A 2O26U 1KCLA 2WUCL 3PQYA 3RY6A 2ZCLH 5CBEA 1G9EA 2AERT 3RWEB 4HC1H 1FRGL 3CUPB 3ZYJA 5J0BA 3IYLW 4CADA 4WTWA 4WFEE 5SWQB 3EO1B 3C87A 1M05B 1VKXB 1V05A 1NCNA 1BQUA 1CLZH 3OWEA 1AO7E 3DRQB 4HMEA 3C09C 3L3GB 4DN3H 5I66A 4JRXB 4DUXA 3L3JA 2D7PA 4XBPA 5EIIA 2XNAB 5LGJB 4R0LC 3PJSB 4NNYB 1RUPL 2J7LA 3GMMA 3SKNA 2JJVA 3G5YA 3MMEA 4NKOA 1NEZG 1MHEA 2YUXA 1OAQL 3G5VB 1DQQB 1AGCB 5CWSA 3RKDC 2GFBB 2VWEC 4OZGE 5IOPB 3JV6A 4YZFE 5JXAL 4HUMB 1KELH 3MLVL 4B7IA 4XC3H 3RL1B 1DCLA 2DS4A 1H3WM 1UWXH 3I2CL 1N7MH 1NCAH 2JCCF 3B5HA 3C5ZC 4G3YH 3SDAA 4FRWA 4XCNB 5FUCC 4NDMA 1RFDL 2G5BB 4YHYC 4Y5YB 2DQJL 1GGIH 1A9EA 5C09B 5ID1B 1P9MA 3OJDB 5GGRA 4KK5D 1N5AA 2CIKA 3NA9L 5CEYB 5I8CA 4AT6B 1OOAA 2XICA 3BKML 5FKPA 5I1EH 2OSLB 2BY1A 4JHWL 3IKKA 5JMOC 4OLZL 3L3DA 1FZMA 1K4DA 4JQIH 1KJ3L 4ESKA 3KWWB 3WDHA 2NNAB 1ZSDB 2JJWA 2ARJB 1O7VA