2E7LC

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7lC00
1P4LA 1MI5E 4RGMC 3VFVB 4NNPL 2VSCA 4ELKA 4FQIL 3SE3C 4NRZB 3EDDA 3NAAH 1GIGH 4YX2H 4QTHA 1KJ3L 4CN6A 3TBSB 4KKCC 2HVKB 4LLVA 2VISB 3IDJB 3PV7A 2JIXB 1DQJA 3GMRA 1UWXK 3WIIL 2JCCB 4EQ3A 2E8ZA 2X4TB 5C0FB 4M7JL 4W4OC 2FRGP 3QEHA 1NBZB 1RIVH 4PRNA 3DTXB 4XHQA 2VE6B 4P4KA 4BFIA 4PJAF 3V6FA 4N9OB 2P49B 5JA9A 2ATPA 1KIQA 1UKSA 4PJXB 5B21A 1AXTH 1V3KA 2DQIL 3WE6B 1F4XL 3STZB 2I60L 1L7TH 3VXSE 4OBSA 4CMMB 2ZKHL 2OI9C 4YUEH 1IEAB 2QQNL 5E1AB 2J5LB 1PYWB 5C70A 3MRMB 3C60C 4YLQT 2VH5L 1L0XA 1XGPB 4U7KA 2FL5B 2QR0A 1JMZA 4XVSH 4IOSD 4C56E 4M9OA 1ZANL 1MLCA 1FVDB 3GSNL 4HWNA 4MMZC 5K9JH 1RPQA 4ORGA 4F9PC 4TVPH 1ZLWK 3IJHA 4NIKB 4UT7H 4RFNB 5F9WB 5KSVA 3GSVB 1MCCA 4PP1D 3PUCA 2Y5TA 4S1DC 3MFGB 3VFRB 1E6JL 2I9LB 5A2KH 5TE6L 1BQUA 1D5IL 4TVPE 1N59A 4FN0A 3T3ME 3WUWB 1KPRA 1IGJA 2YD2A 1TDQA 1U3JA 3HUJF 3AUVA 5GRJL 2FZ3A 2EYSA 4LIQL 1WZ1H 4J3UA 3T0VA 1KN4H 1FORL 4AL8L 4P4KD 3P4MB 3VXOB 1C5BL 4YPJA 2WW8A 4X6CB 1XF2B 3TM6A 4C59B 4UIMA 1D6VL 4OKVB 3BO8A 2FGWH 3F7VB 4PTTA 3F5WB 1NAMB 2R23B 2EYTA 4MCYA 4RGNE 1UH2A 2PO6C 4X99B 5CEXA 3ZTJG 4WY7L 1FNSH 4FQHA 4Q2ZB 4PJ9A 4NM8L 3ZYOA 5DA4A 3T3PF 4QXTB 4LVHC 2R2HB 1KLGA 2Y06H 4ZUTA 2W91A 2WBJA 4UQ3B 2VXTL 5C9JA 4MHHG 2AJUL 3R1GH 2PW2A 4JO2H 4PRDA 5EBLB 1G7LA 1NEZB 3RZCA 4J4PA 4LSVH 4X0KA 1CYGA 3BRDA 3B43A 4U0QB 4QYOA 3HG1B 3T04D 3BKYH 4RGNC 4HV8B 3X14A 4Y5XB 3B83A 3BHBA 4PJ5B 5DMGD 1A14H 3TC9A 3U46A 1OQXA 3DMMA 3QUZD 3QRGH 4OZIE 1ZA3B 3IRZA 3BH9A 5DJXB 4ZUVA 1Z2KA 2NY2D 5EB9A 1X3DA 1LDSA 1U93A 3BN9C 1IQWH 3LSOA 3OGCB 3LKOA 4XRCB 3HNTH 2AEPH 3BAEL 4OM1H 2E7MA 1CG9B 2ADGB 3WLWD 5FDWA 1TVHA 4UV4H 5EO0A 3W11C 4JM2C 5D7SL 5I1KH 4PBXA 3RL1B 1UJ3B 1TPXC 1G9NL 1HILB 4JDTL 1GGBL 4BK4A 2IPUG 4ZXBA 3HZVA 4NZUH 4IRZH 4F7EB 2LABA 4YHOH 1HZHH 4JB9H 4U7MA 2HLFC 5FYKH 4GS7B 3MLSH 4CRPA 4CVUA 5E2VL 1KN2H 2R0WL 2Z8VC 5ALBL 2BVOA 3F7QA 1VPOL 1Q9KB 4PJ9D 1AE6H 2KPNA 3FB6A 3GGWA 5HGBB 3WMSA 5GRWA 4P3WA 5EU3A 4P49A 2HRPL 1M7IB 4PY8J 1DQDL 1M05A 1XMWA 3QFJE 1Q1JH 4XH2B 5FYKE 4POUB 3RZCD 4J4PD 3TO4A 4C54A 5CP7A 2H32B 4TRPH 2OXHA 3JSSA 4J3SA 3K4AA 3KYKH 4APQC 4U1SA 4DKAA 3NZ8A 4IM8A 3QXDB 5DC0A 3DSFL 1B3JA 3CFEB 3S6CA 1UM6H 1XAUA 3MJ7A 3RNQA 5CWSB 4NQCE 3KPLB 3MLZL 3OXSB 5HYSG 3IU3A 3CGTA 3N50A 4FZ8H 1EV2E 4X6BB 3UJTL 5L6YH 1LQSR 1QFUL 5DUBB 4OGYH 1CLZL 3ARFC 1KIUA 2BMKA 4X80H 2V7HA 2YOCA 4E0RB 4LSSH 1NGQH 3TWCH 5IB3A 1A2YA 1NL0H 2AABH 2YXFA 5HVGB 5SX4I 1EMTL 2VOTA 3MLWH 4WGWB 4Z95L 2G9HB 4GG8B 2NY4B 3G6JA 1Q72L 4LSRL 2G5BA 4RSVA 4GQ9H 4JZNA 3KPMB 3NN8B 4QRUA 4YR6A 3PGDA 2H3NA 1EO8H 5L8JB 3JV6B 2P5WA 3ZSTA 5CSBA 4ZYKB 3KPSD 3O8XD 5HJ3B 5DXWA 1KB5L 2DWDA 3O0RH 4X6FA 5LGHH 2F58H 5DJZA 4Q6IB 3N1MC 3RL2A 1K4DA 1ND0A 4KRMB 3H9SB 4JKPH 5EC1A 6FABH 4BA8A 4EUPH 2BC4A 2QSCH 1N5AA 1C16B 4UAOC 4UOJA 3TO4D 1YMHB 3MLPA 5GGVH 3AXLB 4NN5B 4LCWA 3KJ4C 4M7LH 4WDIB 1DR9A 4KV5E 4OGAC 1QRNE 4R2GD 3U7WH 4Z77A 3KYMB 5I1LA 1SVZA 4FMKA 3WV0A 4U4BA 2AJVL 1GOGA 4L29B 4RWHA 5HGAB 3RGVA 1PZUB 5EUOE 4OCLC 3HPJA 2HFFA 4S10A 1LNUA 2NXYC 1TJIL 2W0FB 4GKZB 4JEGB 3RPKA 5EBMA 1K6QL 1SY6H 3FO0L 5DK0A 5KZCB 2A0LC 1KCSH 5J9PA 3I50L 4KK6D 4RAUA 3P0VH 4MWFA 5M94B 4WUUE 5I2IB 1AHWC 5TQ0H 4A6YL 1CR9L 1JGVL 5CEZH 5I1AA 4KVNL 2B1HH 1N7ML 1OPGL 1E4WL 3BE1L 4PGCA 3K74B 3GSQA 1AGEA 4K3EH 4HUWB 1OAXL 5EO9A 3ZKXB 4GRLC 3DO7B 2P5WD 4H26B 1NUDA 3PWLA 4TUOA 1A6WL 3NZHH 4Y19E 5FO9A 4ZD3H 1F2QA 5F71A 2Q6WB 4HJGA 1AQDA 4Q0XH 3MBED 4XMPH 1FZJA 1F6LL 3GRWH 4Z7UE 1F4AA 4XMLL 1QBBA 5IJVA 3MX0A 3S37X 4FQXD 3E6HB 5DEGA 1FFNB 1A3LH 3VG9C 4GUPA 1MPAH 3ZLQC 1CICA 1RJYA 3FHQA 3DVFA 1OTUC 4P2OA 5DC9B 4CU8A 1OP3H 1I9JH 4LCWD 4ZFZB 2DKMA 5F1IB 3OAYH 2IJ0C 1IAII 6CGTA 3MRHB 3LQAC 4BKLB 3VG0L 3VXUA 4WFGD 4QRPA 3CCHB 3CH1A 1U95A 2HTLD 5KVDL 3S34L 1F4YH 1NCCL 1DANU 5I8EA 3MACL 3I85A 3D25A 1JIBA 4X7SL 1KYOJ 5D7KD 3X13A 2XZCH 3N9GL 1WIPA 3EAKA 5TDPB 3S97C 4U6VL 3DETC 3D0VB 4C83A 3IDGA 3TT3H 2X70B 2JF1A 1SEBA 5HHXL 2OLDA 2BNQA 4K3HA 4X7TB 3HB3D 5D70L 3PWPD 5DS8B 1T1XA 3V8OA 3L3GB 3S98A 1QSEA 4EOWL 5DQ9A 3VGAB 1ZA6A 4RX4A 3RUGE 2AXGB 1ZS8B 43CAB 3ILPB 4LKCB 5ID0A 1MH5A 4EI5B 3GIZL 4DVRH 5CAYB 2GFBB 4R4NC 1TMCB 5F9OH 3GHBL 3D3VB 3FQWA 3TVMA 5KG9B 1CICD 1A9BB 5CGTA 4P2OD 3DO3A 3QA3B 2YN5A 5EOCL 3CAFA 4UDTB 5C9KA 1NCWL 1Z9SA 2ARWA 1Q0XL 5I1EL 1UB6A 2VN7A 2E7CA 1LEKA 1II4E 1PKQA 3GSNB 1CLOL 3WNMA 2CQVA 3HRZB 3AM8C 1XEDA 3VXUD 5J6GA 1IGFL 3QCTH 2EDYA 3X11B 2DDQL 2GJZB 2X4RA 4DQOL 1PG7H 4AIZA 3IDYB 4D0CB 4P23B 3H2WA 3BDXA 4MD0A 5F88A 1H5BC 1XGYL 2EDDA 3V6BR 1D9KC 1QFWL 3ILQC 3BIAX 1R5WB 4M6NH 3DUUB 3OJDB 2AI0L 2VLKD 4IJ3B 1UA6L 2NCMA 5D96C 3QCUL 2APVA 3U79A 3J8F7 1I8MA 3ULUF 1I9IH 4G43A 3V7AG 1BJMA 1YNLH 4OD3L 1F45A 1OARH 3LD8C 1T1WB 5FM5O 3WNLA 1OSPL 3LQMA 3PDGA 1WWAX 2Z31A 5B38A 1IMHC 5IW1B 2D0GA 3G6DL 1N5YH 4BH7B 3QQ4B 3U2SB 3VFNA 3V52L 4IHOA 4RZCB 1ZVHA 1QSED 2YZ1A 3KLSA 4L8CB 3BP7A 1EEZB 1JPTH 1MQKH 5DI8B 2VDRH 1L4IA 4LVOB 1V05A 4G8GE 4QTHB 5I74B 5KVFL 3TVMD 5C0DA 1Q38A 5GRVL 2XOTA 3IXAA 4U1GB 1WSST 5I73B 1DQJB 3GMRB 4P48A 5EORH 4NKIL 3I3BA 5IHUH 4PRNB 3VD4A 4X7DC 4BFIB 3V6FB 4CVWA 2CRYA 1FVCA 2XICA 4NGHH 4MNHA 1KIQB 1NFDF 3TJEH 2CMRL 1B4JH 2VUYA 3U9PH 1XF4B 1EERB 2QADB 5CJXC 5J1SC 1F2XK 3GHEL 1NUGA 2CIKA 3QUKA 4YGAB 2VZUA 3UTTD 3RIFF 1MFAH 1U6AL 4BYHA 4S11A 3WIFA 4JVPA 2QR0B 1T7XA 2YWZA 4ACPA 5IJKA 1ZHKA 1S7RA 4BQ9A 1PKOA 2GTWB 4Z0BH 1T7WA 1RUMH 5C0CE 4ORGB 1PZ5A 3CMOH 1BGXL 5BVJA 3IJHB 1E4JA 4NKMA 1FNLA 3MXVH 2W9DH 3EIFA 3VDCA 5KSVB 4G7YH 3C8HA 3MA9L 2Y5TB 4PRAB 3V5KA 3P3YA 2YBRA 1YEEL 2NXZB 2IG2H 5HGHB 1N59B 1ZXQA 2PYFA 4NC1E 1KPRB 4PRPA 3VFUA 2NY2B 4JAMA 2VC2L 2OXGA 4M1GH 3OKLA 2YD8A 1J7VR 2FZ3B 2EXYC 2EYSB 4XCEA 5CJQH 2JELH 4K7PH 4LSQH 2W07A 1V8HA 1MRDH 2OL3H 2AQ2A 3DXAA 1U36A 4FMFA 1QVOA 2K1MA 5L2KE 4S0TD 1VFMA 3GBML 1DBML 1KCUL 2APXA 3M17A 1KEGH 3WSQL 4Q9RH 1FO0H 4XVJL 3RVTD 2DL2A 4UIMB 5IFJB 3C5SA 5F7LB 4O2EB 3BO8B 3EOBA 5K9QI 4PD4J 2WLYA 4PTTB 4UV7L 3C2AL 2ZG1A 4XPTH 2EYTB 1KCRL 5CEXB 4RAHA 4YGVA 2VDKH 1NCBL 4P3CL 3WHXA 3H0TB 5GZOC 3SDCD 4FQHB 4PJ9B 2DQEH 3KXFB 4Z7WA 1AJ7L 1PY9A 3BIBX 5F7YC 1KLGB 4HKJA 3KLAA 4ZUTB 3W0WA 2WBJB 1JRHH 5C9JB 2DTMH 4JO3H 5JUEL 2PW2B 2PETA 4PRDB 4DKEH 2FEEI 5CD3A 1GGIH 4GMTL 4PJIA 4QYOB 1IAMA 3DRQA 1JZ3A 2MKLC 4NKQB 4F7PA 4MD5A 3CXHK 3X14B 2UV3A 4R0LC 1WIOA 3BHBB 4CDGC 3T2PA 2ZCHH 3U46B 3MODL 5D4QA 3UTQA 3DMMB 2RCSH 3BZDA 3MV7E 1REIA 4PRPD 3BH9B 4ZUVB 1HSAA 1H3PH 3LDBB 1U93B 1KB5B 4LDEB 5DUMH 3BD4A 3VJ6A 3LSOB 3LKOB 2C3XA 3IFLH 3RWGA 4LMQE 5IW6A 4PRHD 3MRFA 4OB5L 3JBG7 4G6JH 5E4IA 5E7BA 5FDWB 1TVHB 4XPFL 3MLVL 2X4PA 5FUOH 3BUYA 1JL8A 2EE9A 4LGPB 5DJAA 4I2XA 5MEPB 5HYFA 1WZMA 5I1CL 3O6ML 3FMGH 4ZXBB 5D1ZD 5T1KA 4Z76B 4HWBH 3QIUB 1EEUA 1GL4B 1KF9B 2A9NL 4Y1AE 3GO1H 1OLLA 4DVBA 1M6OA 3RIAK 3PP3H 2BVOB 2H26A 4QKXB 4PG2C 1BFOA 3KHOA 4XC3H 4KVCH 5EU3B 4XVTL 2H8PA 3W0WD 4WV1C 1M05B 2WQRA 4OQTL 1CXIA 3K3QA 1BLNA 3LY6A 3TO4B 5CP7B 5J4MA 3EOTH 2WUCL 1A7NH 3HFMH 4KZDL 4U1LA 5IOPA 3NZ8B 4CBPA 1QBML 4A6YB 1T7YA 3MJ7B 1DLHB 4NUGH 1RHHB 1KIRB 2YD6A 1U8PB 1E27A 5DD3L 5C0JA 3C09C 3BISA 1K3IA 4WHCA 1YECL 4XNUL 4HG4J 2A9ML 4HX1A 4QOKA 1ZT4A 4EN3D 5I1GH 4POZD 1A2YB 2XPGA 5IB3B 3AC0A 1RURH 5I76B 7FABL 1XGUA 4XP5H 5E9DD 4QHUA 1D5BA 5EA0L 1Q9OA 4R6UA 1B88A 3G6JB 2VZ1A 4HFUL 3O3EA 3RAJL 2G5BB 5C3TA 5TF1L 1CFVH 2YPLE 3IDXH 2COQA 5I19L 3C5ZA 4JZNB 4G8IB 4QRUB 5T1KD 3MRRA 4J12A 3PGDB 4YR6B 2H3NB 3MNZA 1RULL 1MCQA 3REWA 1G7QA 1I7ZB 4IOFD 3U1SL 2DWDB 3O11B 4X6FB 2JJSC 5KS9A 1OOAA 1J8HD 3K8MA 5L9DL 2FLBT 3LOWA 3MGTA 4KDVA 2NY3C 3QISA 4HUXA 3RL2B 1K4DB 3WCYA 3HC4L 1ND0B 2CKBH 5IFHH 3WNKA 3LKNA 5EC1B 1ZT7A 5DD0H 4L4VE 4RDQF 1KLUA 3ZKMC 2BC4B 1N5AB 5TDOA 5J57B 1WLHA 2VRAA 1FIGH 2CGRL 2VKWA 3QUXC 2G60H 3ZSSA 2QJDA 1AQKH 1NFKA 3X3GH 3MRNA 4E41A 1UWGH 2C9AA 5I1LB 1G1YA 1MCSA 4MD4A 4PUBH 5INCA 3VFSA 3RGVB 2PYEA 3V0WL 1EZVX 3QEGH 1MFCL 3HPJB 3MRPA 2HFFB 4IMKC 1LO0H 1LNUB 3HC0A 4NFCA 4G6FB 2D7TH 4G6AD 5EBMB 5JTWA 4QOKD 5FYLL 3EHBD 2WM0A 3SO5A 4AG4L 5J9PB 2X40A 1GVIA 4RAUB 5FYJD 2Z35A 4K94L 4J8RA 1XF5A 5C2BL 4M6ML 1NGZA 4NQSA 1IGMH 5BRZA 3ZHLA 2H2PC 1B6DA 5I1AB 5F7MC 2AAVA 1LO2L 3C5ZD 3QJFA 2X1QA 5EZIH 3ARDC 4MB4A 5K59E 3A67H 3GSQB 1AGEB 4KHTH 2PW1A 1CGSL 1A7OL 5EO9B 4G7VL 3PWLB 3TBTA 4TUOB 2EXWC 1DQLL 5FO9B 3CNKA 1IGIH 1AQDB 4N1CA 5ABDE 1FZJB 1MJUL 2GJ6B 1W8NA 3G5XA 5BS0A 2ZOLB 4L8SB 3S35X 5IJVB 2VLRE 4HPOH 4YDKL 1HSBA 1NGWB 5DEGB 3ZTJH 5FECA 4PJBF 5EOQL 5FYJL 4AEHL 1ZLSL 5JPNA 1T5XA 1RJYB 5ADPH 1P4IL 5MI0B 4P2OB 4G42A 3UC0L 4UINL 3L3KA 2VDNL 4P2RA 3ELAT 5DEZA 5T5FL 4Q97A 4OCMC 1I1YA 5EFIA 3SE8L 5EIVA 5DRWA 5J8OA 3EJZD 2F19H 4YHPA 4YHYC 2B2XL 4IMLA 5IVZA 1Y0LA 3VXUB 3OR6A 4QRPB 4YZFE 1H8OA 4HJJL 2L0DA 4JPKL 3CH1B 5D7JC 1U95B 3CSGA 3VGGA 3RWHA 4OCNC 4YWGH 3FN0H 5EZOH 5I8EB 2RFXA 3V79C 1IRAY 2XFXA 1O0VA 3L5XH 3X13B 2FR4A 5B3NA 3JZ7A 1NC4A 1YZZA 1UCBH 4KROD 3H3PL 5BRZD 3O6KH 1BOGA 4C83B 3IDGB 3DYMA 3SQOH 2DIJA 1QO3A 1SEBB 2E8YA 5E70A 2BNQB 1IAKA 4ELMA 4F57L 1CDYA 1T1XB 4X4YA 3BXNA 1QSEB 5DQ9B 3KPRD 4LL9A 1DVFC 3OHXA 3U9UA 3ET9F 4DFIA 1ZA6B 4XAWL 3DGGA 2XTLA 1S7QA 1EO5A 5ID0B 1MH5B 3WJLA 2KDGA 1KIPA 3FQWB 3TVMB 4YC2C 1MAKA 3N85L 1JP5A 3INUL 1RHFA 4P2RD 4RQQB 1J9CT 3SDDC 4XBEL 1FZMA 1MCEA 4NRXA 3MPCA 1UB6B 3V4VL 5AYUL 1LEKB 5DMJB 4I1NB 5IG7A 3X3FL 3TYGL 2R56H 2YUXA 5J6GB 1SBBA 4W70A 3L3OA 2X4RB 3WNPA 4AIZB 5HHVH 3UAJC 4WI8A 1MREH 2LE9A 5GJTH 5F88B 1N64L 2VTFA 1RUQH 1J05A 5CGYC 1FE8H 1MELA 1S9VA 2APTA 2E3VA 4GW5B 4JRYD 4N8CL 1XCQA 1A4JB 5K9QG 5E2JA 5B8CA 1I8MB 2NR6C 2P45B 4G43B 4FQLL 1ZEAH 3D2UA 3K81A 1MI5A 4X98B 3FCTA 4KQ3L 4DWHA 4PJAE 3SDAD 3EYSH 1OCWH 3GKZA 3JXAA 2Z31B 5B38B 5E5MB 2V5SA 3V0AC 4XVUD 5SX5H 4R8WH 4OLUL 4R4FH 3VFNB 1MRCL 4P9ML 4NZRH 3VI3F 2ZUWA 1BWMA 2MPAH 4XCCH 4PJ7E 2A1WL 1MFBL 3DOSA 1DN0A 3S37H 4S1SH 1IEBB 3JTTA 3OB0K 4JN1L 5C0DB 3S3JA 1VFAA 3IXAB 5IP4A 5AZ2H 4NCC2 1VFBA 2QQKH 1X5XA 3GSWA 1EEYA 5GS2D 4QHNA 4XTRC 3LKSA 4YNYA 4XX1G 1SBSH 2AK4E 2MHAA 2CDGA 4DEPC 2CLVA 1XIWC 1HQRA 2YD4A 1A3RL 4Y5VB 4PJFF 4ZSOE 2ZOKA 2D7NA 1FVCB 4MNHB 4HBCL 1EHLL 1YPZA 3AFLA 1YQVL 4KKCD 1IGCL 5L8LB 5HGDB 4H1LH 2CIKB 3GMLA 5HVHB 2UY6A 3HKFA 3QQ9C 1J5OL 2BSED 1NCAH 5TFSH 3HUJE 4JFYA 4I0KA 4YDIL 3QHZH 5F72S 3P9LA 4MXWH 2V9QA 3WIFB 1BD2B 1U3HA 4MAUH 4BZ1H 4WU5A 1ZHKB 5D8JH 2NY7L 1S7RB 3D2UD 1MI5D 5DUPH 1IM9D 2ZCLH 4PRIE 1H3UA 3OGOE 5CINL 2FWOA 4ALAL 1PZ5B 5D2NA 2RGSA 5BVJB 1JYVA 5TJWK 4JFQA 2DQDH 4NKMB 2FHCA 3QG7H 5FO7B 3C60D 5EN2A 5DJCA 4NPYA 3PWNB 2XZAL 2F53A 5CZVH 2VDLH 4K71B 4EDWL 3V5KB 1V3LA 4FNLH 4C58B 2YBRB 4DN3H 3IAGC 3MLUL 2PYFB 5GRUH 4DK3A 4PRPB 15C8L 3T3PE 3VFUB 4PIRF 4JAMB 2AV1A 5H35B 3TESA 5IMLA 2C1OA 3DJ9A 3OKLB 4CVZA 4MAYC 4P46C 3EYVA 1FDLH 3VXSD 1IKFH 1S3KH 1A7PH 1CFNA 4XNQA 3DXAB 3HNVH 4MS8C 1QVOB 4S1DD 3T65A 3MOBH 1MFDL 1RJCA 2PR4H 3BW9B 2C4FT 2C1PA 3RPIA 1SMOA 3C5SB 1MNUL 4X4ZA 4M9PA 4OZ4A 3EOBB 3MXWH 3TZVC 4C56D 3ZT5A 4UNUA 4WO4B 3ZMRA 3QULA 2V7NA 3PIQA 1PFCA 3M8OH 2EIZA 2E9IA 5BOPA 2R69L 4EBQL 4YGVB 4N0YH 1U8OA 4Z7WB 1YEHL 1U3HD 3THMH 3MV8E 4GBXC 4C4KT 3RZWA 3R06A 4HKJB 4PYHA 4F7TA 3KLAB 3W0WB 3NIFF 1JZ4A 3QYCA 2AJ3A 3E8UH 4RRPA 4TVPD 2ADIA 5EO1A 5C3LD 4OZIA 3MQIA 2VXSH 5I75B 4TSBH 4RBPH 3I3DA 1E0OB 4PJIB 4KMTL 2DIBA 1L7TL 4F7PB 4MD5B 2D31B 4GW1B 2ADJA 2ZZUT 1YYLH 2P5EA 2OBGA 4Y4KC 2BOCA 4JPWL 1HSAB 3TEUA 4XVSL 5L7XL 3BDYH 3RY4A 1NH6A 3NTCH 5IW6B 3SCMA 4APQA 2IMMA 1IBGH 2W1NA 4TVPL 1JZ8A 3MRFB 5HHQA 4D2NA 4X6EA 3BPNB 4RGND 2GSGA 4NRYA 3CVHH 2X4PB 2DBLL 1A7RL 3BUYB 4BJLA 5DJAB 4I2XB 1EHNA 1KELH 1RUPH 4D8PA 3WO4C 3SKNA 1QFPA 2Z4QA 1R5IB 4JFZL 2OJZH 5T1KB 3OG6B 4DKFL 1KTKE 2VDOH 4OUUB 2VZSA 3QFJA 4CN1A 3O41B 4DVBB 3EKCA 4XWGL 3RVUC 5C8JA 3UPCA 3W11D 2H26B 2YPKA 2QTEA 1BFOB 2BXYA 4OZFG 2EDTA 3RKDD 1HYSC 3NMEA 3L5HA 2H8PB 4PJDB 1TFHA 4P5KA 4NQCA 4OM0L 2DQTH 4KHXH 5GRVK 1XZ0A 4HXBH 1GZQA 3TIDA 3BKCH 3DWTA 5C09D 5MERA 3GKWL 3ABZA 4U1LB 3BGAA 5E00A 5HDLA 5T3XH 4ZG1A 5IOPB 1UM5H 4D9QE 2X6MA 4XCNA 4JHWL 4H88H 3NFNA 3IDMA 1FNSL 1E27B 5C0JB 4OZHE 4HAGA 1YY8A 1LO5A 2ZNWA 3GMQA 4HX1B 2EDRA 5T3XE 4QOKB 1P84J 1ZT4B 5C0IB 3SCMD 4APQD 2XPGB 4R26L 2CRIA 1XGUB 4ODTL 2P42B 2UYLA 5C1MB 4PJCB 4QHUB 1D5BB 3AU1A 1Q9OB 3O3EB 3NA9H 2J88H 3VCLA 3TA3A 5T1MB 3C5ZB 4XPGH 3MRRB 1A0QL 1K5NA 1KJ2H 4QXWA 3MNZB 3QFJD 5FYKD 3LIZH 3REWB 1G7QB 5GPRA 5F3HA 4LRNH 4LQFH 5KS9B 2V2XA 4BFGA 3BX7C 4U1MA 3DVNB 3HNTL 1QRNA 2E6PA 4HIXL 3DX6A 2ORBH 2IMNA 4KC3B 3B6SA 4OCRL 1Q94B 4HUXB 1TQBB 1RZGA 4UV4L 4NQCD 3S88H 3ARVA 1ZT7B 1DBKH 5EUOA 5TDOB 4WW2F 1FH5L 4MSWA 2QBWA 4NZUL 4RFOL 2ZCKH 4Z78A 4KMLB 5D7IA 3CFBB 3WXVH 4E41B 2DL9A 4ZTPL 3TGXA 1S8DA 1NLBH 3GI8L 4X6DB 4MD4B 3ARYA 5INCB 3GNMH 3VFSB 1A6VL 3TBYB 3OKNA 1AE6L 2PYEB 1F90L 4F7MB 1QA9A 3I6KB 3MRPB 2HJLA 5ANME 5KJRL 5D1XC 1HH9A 4N5EC 5DQDL 4ENED 2DIAA 3LQZA 2YS4A 1OP9A 1RV6X 4FFVD 3DX7A 3PHQA 4GG6F 3L3IA 1KXQE 2R2BA 5AWNH 4M6OH 4LCYA 4Y8AA 4ORZC 2Z35B 2XIDA 4XP9H 4J8RB 1T04A 1XF5B 4KROB 1NGZB 1X5LA 4NQSB 5BRZB 3TA3D 4M1CC 4JKMA 4Z7UA 1UM6L 2NXYD 3QJFB 4TVSa 3GMPA 1EUUA 1L7IH 2PW1B 2V9RA 1EFXA 1OF2A 2IAMA 5L6YL 3TBTB 3W2DH 2A0LD 4M7ZB 1WC7A 4OGYL 3P0YL 4I9WE 5IM7B 3QEUA 1G9MH 4JFEE 4LSSL 1NGQL 1QRND 5SX4H 5BS0B 1F6AA 5FCUL 4NWTL 3MYJA 5KVMC 1HSBB 2VQTA 2PXYC 5FECB 2Y25A 1GC1L 2X9YA 5BZWA 1T5XB 5JPNB 4PGBA 3TO2A 4EQ2A 4GRLD 4HGKC 3RA7H 1TNMA 5C7XH 5GHWL 4G42B 1YYMH 3L3KB 1KFAL 4P2RB 1CFBA 4UTAL 4NJAL 1DLFH 1I1YB 2V6HA 2ZNXA 5EFIB 3S96A 5DRWB 1LO3L 1D3CA 2FX9L 4YHPB 4HUVA 2IBZX 4OD1L 3ZL4H 4IMLB 2WUBL 3QDGE 4KRPD 1Y0LB 3J7HA 2KKQA 2LU7A 5LGHL 1NCDH 3OR6B 4XP1H 4WUUD 2XQBL 2XZZA 3KVQA 2NYYC 1U3YA 1OTUD 2VB5A 5L2JA 1RIHL 4ZAKC 3GUTA 3RWHB 3OX8A 3GSOA 4JKPL 2RFXB 1NSNL 3C6LA 3JVGC 2QSCL 2HVJA 4L9LC 3VMNA 4Y19D 2XFXB 5GGVL 2FR4B 3VU2A 2J6EA 1NC4B 1G9MC 5B39A 1EJOH 4HS3A 2BVEA 2HFGH 3S5LG 2CJUH 4GRMA 1Q8MA 3QUMH 1BOGB 4NQDB 4OCYH 1AKJD 1XGTA 4K7PY 3PHOA 4OLWH 5JMOC 1QO3B 1T5WA 3TCLA 3MNVB 3L1OH 4CN4A 1H5BA 2VDML 5CCKH 4WCYH 4GW4A 4RMVA 4PGZA 4X5WA 1CFTA 1TXKA 1OM3H 2B0SH 4X4YB 2MKWA 3BXNB 4RFEA 1KCVL 3OHXB 3U9UB 1JNNH 3DGGB 3QDAA 2EECA 2AGJH 4N90E 1U41A 4YE4L 1KIPB 1YA5A 3ULUE 4LCIL 2HTKC 1BIHA 3HAEA 4WI3A 1FFOB 4NRXB 4Y4FA 5D2LB 4HULB 1NDMA 5HYJA 5IG7B 4ODUA 4Q0XL 2YA2A 5CJOL 4XMPL 1UZ6F 2FJGA 4UOW1 3I6LE 4R4ND 3AREA 1FZKA 5D5MF 3L3OB 4J3XA 3DX9A 1P4BH 1X5GA 1UC6A 5HYQA 5A2JH 4ZS6C 1OLZA 2BSSA 1J05B 4DGVL 3C6LD 5JA8B 4JGMA 4IRJA 5D72H 1JI1A 3QHFH 3VXME 2LTQB 1NDGA 4MDJA 1I9JL 3OJ2C 5B8CB 4FXKA 4FTVE 3CFJA 5MP6L 3VFMA 3D2UB 1IAIH 2EIDA 2IFGA 4UZGA 3FCTB 1XFPA 2IEPA 1KTDA 4FG6C 3QNZA 4HEME 3MCKA 3CVIH 2BVTA 4HC1H 2XT1B 4G8GA 5CBAA 1D9KD 3D18A 1OGAE 1T2QH 3QIBC 2NY1B 1BFTA 2YK1H 1MJ8L 2PF6A 1DBAL 3WFCH 4XXCA 1GGUA 3S35H 1N2RB 5DD1H 4N1HB 1EDQA 1CGTA 1DN0B 2J6EL 2AERT 3JTTB 1LP9E 1VFAB 3HI1A 4Y4HC 3CZFA 1PLGH 1EEYB 4QHNB 1NEUA 4M3JA 1IC7H 2XWJA 3JUZA 3G5ZA 3LKSB 1V3JA 4YNYB 2MHAB 1MUJA 1G84A 2X10A 2CDGB 2CLVB 1ZK9A 1HQRB 4BM7A 5IV2A 5FKPA 3ARTA 4YHKH 1YPZB 2X89A 3TP4A 2V17L 2PCPB 3QIWC 3GMLB 4P5TA 2Z8RA 2EE6A 4JFYB 1A9EB 1WT5A 3P9LB 1BOYA 1U3HB 1YEJL 3QG6A 5GGRY 3O6LH 5A3IC 4WU5B 4LF3A 4W68A 2AJZA 4YFDB 2J8UB 4YO0A 4KZEL 2FWOB 1D5XA 4G8GD 2DQJH 5D2NB 3IFOA 2AJYH 4JREC 1BVZA 4I0PC 2GIYA 1NAKH 4JFQB 1QPXA 5TE4L 4YEEA 5AZEH 3B9KA 5EN2B 4TNVF 5HTSA 4U1IA 1NFIA 2F53B 3ARGC 3B2VH 3EJYC 3LKRA 4RA0C 3IETA 5EU7E 32C2B 2XTJB 1AI1L 4BSWA 4DUVA 4MB3A 2AV1B 3GSUA 5HHOA 5IMLB 3ZDYF 4AEEA 1I4FA 1S7UA 3EYVB 3HI5H 5ID1B 2NX5E 5IB2A 2C3VA 1YJDL 3RX5A 2OK0H 5LCVL 4IDLA 4G8FA 1CFNB 1C7SA 4XNQB 4HFWA 4R90L 5DGRA 3T65B 2IH3A 5IQ7H 2Y36H 3UJJH 2CR3A 4ZOAA 1URLA 4FQQA 2YRLA 4OT1L 3IAPA 2YZ8A 4XNXL 2XY2A 1FO0A 3RPIB 3MNWA 4PJGF 5FK9A 5GGQL 3QUYC 1G6VK 2E9BA 4FQCH 2VDRL 4OZ4B 3PWUA 2MCG1 1INEH 2W9EL 5EU7C 5C0CD 3FN3A 2EXYD 3D85A 2DQFB 4KKBC 3L5IA 3QULB 2V7NB 3HPLB 3PIQB 3WUWG 5E6ZA 2EIZB 4MNQE 5DA0B 4GSDL 1T0MA 1D6EA 3G9AB 2Q7YA 5EORL 4WHYG 1INDL 4Z7VF 4G6KL 4TNWF 3R06B 4L1DA 4JRXE 5JHDE 5H37H 1I7TB 4NDMA 3ZZ1A 4OCSH 2HFTA 1T20B 1BBJA 1ORSA 2H6PA 2I07A 3UTSE 2A38A 1S5IH 2W65A 1RZKH 2EE3A 3NFSH 4XC1H 3UXFA 5EC2A 5EO1B 1Y6NR 1ZHLA 4OZIB 1UYWH 4K8RL 4R7DA 4LHUA 5GZOD 3B9KD 5IBTL 3SE4C 4PG2A 2D7MA 2QSQA 3BSZL 2ADJB 4PLKC 3WN5C 2P5EB 3NCFB 4ZO7A 5L2KD 3NA4A 2BOCB 4N9GA 4NSKA 4HXAH 4NN7C 3EO9L 2NMSA 4HWEL 4JKWA 2XRAL 4JFFE 1BF2A 4AJ0A 3SCMB 2GAZA 5HHQB 1NEZG 1OL0A 4X6EB 5JW3L 4HS8L 2F5BL 2GSGB 5I1HH 2EH7L 4NRYB 4U3HA 4ZDHA 4F3FB 1CXLA 2XZQH 3CU1A 3FAXA 2W9DL 1QUNA 3QXTA 1S7VA 2UVFA 1ADQH 3NACL 3NCJH 4D8PB 4F33A 2GHWB 3SKNB 3D85D 3HE6A 1ZTXH 4AYFA 4GFTB 2I25N 4Y2DC 1X5AA 1RZKC 3QFJB 2H9GA 4K3GA 4Y8DC 4HJ0D 2EH8L 3QI9C 1QSZA 3AY4C 5JQ6H 5JOFB 5C8JB 1CXFA 3H7BA 2YPKB 4YQXL 3R8QA 4X7EC 2ADFL 4JFDE 1CGVA 4GO6B 1H15A 1HINH 1RQ5A 5EDXA 4OI8A 2E7LC 4G9DA 2X4UA 4P5KB 3KR3H 4NQCB 3BWUC 5INDA 4Q9RL 1FO0L 3MV7D 5KBNC 4AY0A 3W5MA 4NUJB 1I8LC 1PAMA 4PJ8C 5MERB 4P2QE 5E00B 1CXHA 4ODVL 3RIAF 4HWUA 2JJSA 2XA8L 4KJYA 1S78D 3FB5B 1R3IH 4XCNB 3NFNB 3VE0B 3IDMB 4QHLA 1X9QA 4N0CD 4RISH 2QHRL 5I71C 1I8KA 1FL3A 2VXUL 3L5JA 1YY8B 1LO5B 3GMQB 3RDTC 4ERSH 3QDME 1ZLUK 4LARL 1LEGA 2UYLB 4Y1AD 4L8BA 4MA3B 3AU1B 2ZSWB 4P57A 5DVLA 3RP1A 4H20H 2ENYA 3VCLB 3TA3B 5CSZA 3VXNA 1QBLL 1PDKA 4WTZG 3HCVA 2YMXH 3HE6D 3QWRA 1K5NB 2ZCHL 1A3QA 1HN1A 1VKXA 4OFPA 1CVRA 1S9YB 2PTTB 5DURB 4L4JA 1W72H 4L4VA 5IMOA 2ITDA 3H6JA 5F3HB 4UILH 2BNUA 2EKSA 4Y5YC 1YEFH 3HC3H 2V2XB 1MIML 4LCCC 1QRNB 3BOVA 3DX6B 1EAJA 2J1KA 4XX1E 2J8HA 3B6SB 3OXRA 1D5ZB 3LZFH 1MF2L 2CKBA 4M62L 5EUOB 3RTQA 2UY7A 1EGJH 3AROA 2JB6A 1Z3GL 2OQJA 5ADOL 2CH8A 4WNQA 4J1UB 1RZFH 1KBGL 3BMVA 2HMIC 2ZSVA 3MJ8A 4YXLH 3BKJL 4Z78B 2Y23A 5F70A 5D7IB 4QWWC 4OF6A 5F3BA 1S8DB 2JJVA 3GO1L 4LNRA 5L88L 2NY3D 1A7BA 1B0GA 5L0QC 2P46B 4HQQH 4KRPB 2GEEA 1QA9B 2HJLB 3ZKMD 2CD0A 1LK3L 4I3RH 1AO7E 2PUQT 2YPLD 4KVCL 4Q9BA 3QUXD 3LQZB 5B22A 3O4OC 4PJBE 3DX7B 3PHQB 4WEUD 8CGTA 1S7TA 5IUSA 3L3IB 3VRLF 2HJKA 1X5IA 3JWOH 2R2BB 1I1AC 1VGEH 4LCYB 3IDNA 5E2UH 2A74A 1T04B 3OJMB 3LAFA 3MFFA 4QCIA 5GGUB 4JGJA 3QO1A 3SKMA 3I2CL 1A1MA 2VLRA 1GYAA 3GMPB 5T3ZL 5HY9A 3QWRD 5IWLC 1EFXB 3D39E 5E5UB 2IAMB 4MJ4A 4L4VD 2JJTC 4PRBA 4U6TA 4E5XB 1WC7B 3MRCA 4U49A 4XNZC 3U36B 3QEUB 4OCWH 1I3GL 5IVOA 3VFOA 1G9EA 3MLYL 5I1GL 1HIML 1F6AB 1GZPA 4FQJL 5FGCE 2FD6H 5FCSH 3ARDD 3M07A 3MOQA 3T1FA 5BZWB 1UACH 4JHAH 4PGBB 3RTQD 1A1NA 4YK4B 3H3BC 1NLDL 1CFVL 1CVSC 4OFYA 4KTEH 4YXKH 3QXWA 1UQSB 3SDYH 1DVFA 4LU5L 3S96B 5JW5B 2CLRA 5IMKA 3JWOC 4HUVB 1IC4L 4PP2A 1J86A 3DURB 1VGKA 4HIEA 3RVWD 3V4UH 3WKML 5HI4C 4RBPK 2OCFD 4GMSL 4MLSA 5DJDB 2ITCA 5L2JB 3I84A 3LKPA 5EU6E 3OX8B 2CKBL 1PG7W 4JM2F 5IFHL 3C6LB 1FGNH 5E99H 5F44A 3WHE1 3M1BA 2HVJB 4P9HH 3BZ4A 5EOTA 2A6IA 4TN9A 5B39B 3UYPA 4HS3B 2BNRE 2MCPH 4M1DH 3X3GL 4GRMB 3WD5H 4YHMH 3ZKNC 1XGTB 2G75A 2VLRD 1JJUA 3PHOB 5D7JD 1ODAA 5BXFB 4XXDB 1T5WB 3TCLB 4NBYB 4C57C 5J89A 2CSPA 3VW3L 4GW4B 1XR8A 3HMWH 1A02N 3RHWK 3HZKA 1TZGL 1AD0A 4RFEB 5DMIL 3ZYJA 1MCPH 2VLLA 3BRGC 1MIEH 1AGFA 3OAZK 1DTUA 4G5ZL 4YHZH 3TN0A 4WHDA 2Y6SC 1RZJL 3WUZA 4OZFH 4RCAA 4OFYD 2FO4A 3HAEB 2ICEA 3A67L 4X9IA 3L5WB 4KHTL 5J7CC 1T4KA 1DVFD 3DROA 5J1AA 1YMMA 4Y4FB 4JO1H 3OF6A 4P9HC 2JE8A 5HYJB 1HCFX 5SWZE 4M00A 2FJGB 3VI3E 3NVQA 1T83C 3AREB 1FZKB 1DEEA 3DUHA 3DX9B 4BFBD 5HYQB 4U1JB 3MO1A 5AG8A 4PJAA 2BSSB 4H5SA 3SDDD 1MRFH 2YHGA 2E6JA 3BPLB 4IRJB 1IM3A 4MDJB 1WCQA 5I6XB 1YN7A 1N4XL 2Z8WC 5TE7L 4KAQL 4FXKB 2WV3A 3VFMB 1OGTA 1UWXH 4LVEA 1QOKA 3T0EC 3QNZB 2F19L 3MCKB 4HH9A 3QDJE 3UAJD 3PGFH 1CBVL 4PJFE 3CC5A 4G8GB 4N68A 1J1PH 5CGYD 3D18B 1N8ZA 1TTGA 3C8KA 5E24E 2OP4H 3NIGF 2R4RL 2NR6D 1L9MA 1T66C 4YWGL 1ZSDB 2AK4A 1JN6A 2ENSA 4ZS7L 2SEBB 3QCVH 3VWKC 3TN0D 5JDJA 4XCFL 3L5XL 2R0LH 4S2SA 2EZ0C 2BXZA 4ZSOA 2AJSH 3HI1B 3MOAL 3CZFB 4PTUA 3UJIH 3OAUH 2R2EB 3G5ZB 3RX8A 4HLZG 1PW3A 3MRKA 5D6DC 1CE1H 4S1QH 4YDLC 1KC5L 3HUJA 4FABH 1QHOA 5FKPB 3EZ8A 1ZLWH 1QFWM 1QFWI 1F4WH 3QPXL 2OR7A 4Q74A 4RMWA 3D48R 4LHJB 4LPYA 2QQQA 3OZ9L 4KK9D 4PRIA 4X4XA 4I3SH 4H1LA 3RU8H 5MHSE 4XTRD 4P5TB 3V5HA 5KVEH 4FQ1H 2VLJA 1JPFB 2F9BT 1T89C 4U2ZA 2HKHL 2ARJA 2FO1A 4QRRE 3QG6B 3N0PB 1TJGH 4LF3B 4K3JH 2AJZB 4M4RA 1SQ2N 4YO0B 4NQEE 5DD5H 4NM4L 5FV2A 1D5XB 2X42A 3SKJH 1M7DA 5DTFB 4NN6C 3IFOB 3AS1A 3SBWC 1MCJA 2M1KA 3BKMH 4M48L 4F58H 4GKSA 2UWEE 4ONGH 3S36X 3B9KB 1SEQL 4ZFGL 4JCLA 4U1IB 1NFIB 1WBYA 5ALCL 2AK4D 2E7HA 2B8OT 4HLJA 3LKRB 1J0ZA 1QTYT 5J6HA 3IETB 1P9MA 4KPHH 2A77H 1OAYL 2F54B 3P2TA 4BSWB 1ZAGA 4JY5L 1G6RH 3GSUB 1ZEAL 1BIIB 5HHOB 2VR5A 4HK3J 3IVKA 1S7UB 4QXGH 3DECA 5GGTH 3NIFE 5I16A 3RQ3A 5IB2B 3R0NA 2C3VB 5CLWA 1E4KA 2IALA 2WNGA 4G8FB 4HFWB 2DQGL 2L4OA 1ZHNA 3GK8H 4PLJD 2IH3B 4R8WL 4FHBD 4FQQB 1BM3H 3FO1A 4Y4KA 2X4QB 1UM4L 3TIEB 1FO0B 1FPTH 5FK9B 1BBDH 3PWUB 4XCCL 1UWEH 4MAYD 4PRID 3D85B 3GBNL 2P48B 3QNYA 4MS8D 2V9TA 1MEXH 2Q7YB 4JJHA 2YC1A 4TYUA 3GJEB 5GGSA 2NW3A 4LSPH 1JGUL 5FF6A 3T2NH 1KTLA 3TZVD 3MGAA 4KDTC 1AD9A 1BBJB 1ORSB 2I07B 2O5XL 3MBXL 2W65B 4GAFB 1U3ZA 3FT2B 2IAND 5EC2B 1ZHLB 3VDAA 3TFKC 1OTSC 4MNGE 3ULVC 4CADA 2C3GA 4R7DB 4LHUB 1GJIA 1ZGLA 5I9QB 1YEGH 4QRQB 4ZUUA 4GBXD 4AMKL 4ONFH 3MLRL 1NCAL 1GGCH 3ZE0F 4N9GB 3P9MA 1G7PA 1BFVH 4U6YA 2VLME 5DT1H 5IF0A 3GJFK 1N0XH 2ZCLL 1F3JB 1FSKB 3DV4A 1DANT 2GAZB 1OW0C 4HDIA 3RUGF 4PR5A 4ZDHB 2YKLL 3O3DA 2DQDL 4Y4KD 1S7VB 3MV8D 2GY5A 3RWIA 4E42B 3BQUB 4FNLL 1MAMH 4OGXH 5I1IL 3HE6B 4L3EB 4QNPF 1H3TA 1JVKA 4ZUSA 4U3CA 4YAQA 2X4NA 2HG5A 3TYFA 3H7BB 3TH4T 5J11B 1J12A 5E8DH 4KJWD 5FYKU 5KSAB 3LRGA 1FDLL 5BJTA 5JHLH 1IKFL 2Y72A 3WEXB 1A7PL 2RR3A 1H15B 2DYPA 3HNVL 4G9DB 2OX5A 2X4UB 3S4SA 5JZ7C 4UTBL 4GAJH 3BPOC 1CK0H 3CMGA 4ZOBA 2BJMH 1VACA 3ARBA 1A47A 5GJSH 4UT9L 4O51A 3MXWL 3RVUD 4JHBA 4LLYA 3QQ3A 4KJYB 4YHLL 1HYSD 4N0YL 2FEDC 1IQDA 3UZVB 1H0DA 1WJ3A 4QHLB 4YHIA 2MQ0A 4NQVA 1BEYL 4K3DL 1WBXA 4UIKH 3FRUA 2O61A 1I8KB 2YD3A 5I1DA 4QHMA 5HHMB 2D03H 4B5EA 2K3TA 5FOBA 2IPTH 4K23H 2H1PH 1CTOA 1LEGB 2B1AH 1AGBA 4L8BB 2Y5EA 3RKPA 2BDNH 4P57B 3AS3A 1QRKA 1OAQL 3SGKA 3MLTA 3VXRA 5CSZB 1JWSA 4TSCH 3HCVB 3NOIA 5M7QA 1VKXB 4L4VB 5IMOB 2ITDB 1WV7T 5C08B 1YEIH 2BNUB 2EKSB 4UMGA 3REVA 1CQYA 4R3SA 1EZVY 4HPYH 4RGOH 1JWUA 4D9QD 1DSFL 3S8WA 4GG6E 4WW2C 3OXRB 5C07E 2DYPD 3KYOB 1M71A 1X6NA 1JPGA 3NH7H 5FEBA 2CKBB 3JV4A 1U8LA 5LXGH 1ES0A 3RTQB 2OZ4L 1INQA 1J0IA 1RZIA 2NW2A 5E6IB 1EK3A 4JQIL 2WBWB 3MLXH 3MJ8B 2EDEA 5T3XD 4OSUL 1YEDA 2VDOL 5DJ2A 4JZOA 3U7YL 3WBDA 4HHAA 5F3BB 4NZDA 4XPBL 3ZE1F 4LNRB 1B0GB 3PL6C 1FG2A 2GT9A 2PXYA 1HWHB 5FB8A 4OTXL 4X5LA 2DQCL 5JOEA 5FGBC 1FCCA 4NYLA 2DAVA 2HT4C 4ETQA 3FTGA 1S7TB 5JXEC 3HE7A 2HJKB 4PRHE 4LPWA 2FHFA 3W9EA 3L6FA 1QR1A 3IDNB 5IFAL 2A74B 1EBAA 2R8SH 3MV11 4RNRB 1FYTA 3AS2A 3MFFB 4JFEA 4QCIB 3WXWL 5IMMA 3QQNA 3QO1B 4OI7A 5D1XD 4N5ED 2VLRB 5HY9B 3G04A 3WJJC 2P8LB 2RAMA 5ICXA 1JYXA 2X1WL 4PRBB 5FXCH 1T0NA 2GY7B 3CFCL 1R0AH 1MLBA 3MRCB 2J4WH 4RIRA 1F3DJ 3HZMA 1R3KB 5TF0A 3VFOB 2EC8A 4DFHA 3F8UB 1GZPB 2FIKB 1BZ9B 1WVZA 4M1CD 5DRZA 3IAQA 3NCYS 3MRBA 3T1FB 2DTSA 3LH2H 4UNTA 4GXVL 4WHYH 5BOZG 1YNKH 2J5LC 2HJFA 4LP5A 4L9DA 1MJ7H 1S5HA 4ZTOH 4JQVA 3VGHA 2CLRB 3D69A 3GMOA 2XNAA 3L3DB 2PXYD 1CXEA 2UZXB 3CXHJ 1KG0A 3PHSA 1VGKB 4HIEB 1P7QA 5LBSH 4DGIL 2DD8L 3MTRA 4KTDL 2AK1H 1NAMH 1AFVH 2ITCB 1G7IB 5KSBA 1SYSA 3WFDH 1DBBH 4O5LL 5DYOA 2O26U 4JZJA 4RFNC 1Y18A 3M1BB 4RWYH 5F9WC 3T77A 4C55A 4FZEL 3BZ4B 5EOTB 2A6IB 5E9DE 4I9WD 4B0MM 4JFED 4G3YH 3MMEA 2R29H 2Y07H 3ALPA 2G75B 4S1RH 2CXGA 1NMBH 4I48A 4QTIH 3HS0A 4MQTB 1UZ6E 3UYRH 4ZAKD 3SGEI 1CFSA 1I9RH 5IESH 1BPVA 1ZHBA 1XR8B 1CIUA 3OKMA 5ISZB 3HZKB 2IQ9H 2DQHL 1AD0B 2CDEA 1T3FA 1OAZL 2VLLB 5IKCA 3SKOA 3QWOA 1AGFB 5IB5A 4L8DA 2YD7A 2VMFA 4O58L 3TN0B 4WFHD 2FLRT 1MVFA 4M6OL 4I18A 4HT1H 4CW1A 3B4NA 3QDGD 2IFFH 1Z9MA 5E2WL 2BVQA 2FO4B 3VH8A 2ICEB 5D1QA 3KPOA 1T4KB 3KJ6L 3DROB 5J1AB 1YMMB 1JF6A 1KNOB 1IVLA 1ZLVK 1WQVT 3VXMA 4K9EL 1MY5A 1P7QD 1FGVH 4XGZA 4Z7WF 4FTVA 1UT9A 3WFEH 5MEOA 1DEEB 1S9XA 5CHNA 3KPTA 3Q5TA 5E94B 1MCBA 4HK3N 4LPUA 3MO1B 3Q6GH 4PJAB 5J1TC 5GQBA 5GS1A 4H5SB 2LAGB 5CEYA 4Z5RB 5E8PA 4MYWB 4O9HH 3VGFA 1NFDA 1IM3B 5LQBH 3OQ3B 1YYML 2FH8A 1YN7B 2WANA 1OGAA 5CKAA 4Y5XC 3O2DA 1EVTC 1J10A 1X6LA 1K8DA 4HH9B 3QIWA 5E4EB 2R9HC 4HC1A 4N90D 1NMCB 5JR1L 2H32H 2EO1A 5LWYL 4W4NA 3ULUD 1A6UH 1EAPA 4XP1L 3ECBB 1CDIA 1J8KA 2FX7L 3OB8A 4BK5A 3C8KB 1DUZA 2LVCA 4TQEH 2A6JA 5ESVA 1HNGA 2AK4B 1JN6B 1GAFH 1CLYH 1UJ3C 1GPOH 4FG6D 1MCLA 3MSPA 5DR5H 4S2SB 1N6QH 4OIIL 4CJ0A 3KAAA 1HXYA 3I6LD 2Z91A 1NJ9B 2CJUL 4PTUB 3TLRA 4GS7C 3ULSA 1FV1A 1IT9H 1AGDA 1H8SA 5D1QD 4NWUL 5BMFL 3CDFA 1HHGB 5B38G 3ULUL 2BRRL 3MRKB 5CCKL 4WCYL 2DBJA 5DLMH 3VXMD 1OM3L 2OTPA 4N0RA 3A6CH 1BQLH 5DK2A 4FTVD 4OLEA 2D4FA 4LSTH 5KOMC 4X4XB 5BO1H 1DZBA 4NNXA 4AM0A 2WAHA 4PJDF 1T1ZB 3V5HB 2JTDA 5CILH 4J3TA 4JR9L 2VZ3A 2VLJB 4X9BA 5FKAB 1GCFA 1CZ8H 3ZDYE 4D9RE 5GS0C 3ARSA 2ARJB 1OGAD 1RUKL 3G08A 2X09A 1B0WA 5FHBH 1I9EA 4OZGB 1SM3H 5D71L 3P30H 1CCZA 1IC5L 1OT2A 2YN3A 3WNOA 5C0RH 1W2KT 4KXZI 5IBLC 4LQ1A 3KG5A 2EKJA 1H3XA 3QIWD 1RVFH 1QSFA 1M7DB 1HE7A 2ZUVA 3FQXA 4M5ZL 3WYRA 4NQXA 4OUOA 1YEKL 4PJGE 1T2XA 2DS4A 2X4OA 3P11H 4JO4H 2BHZA 4NFBA 4OJFH 4YH6A 3MRDA 3HZYA 2NX5A 1WBYB 2NY4C 4DW2L 3H9SE 1A5FL 5J6HB 1PBYA 4BSVB 1NKRA 1LMKA 1F3DH 1F11A 3NCYP 4O02L 2X4SB 3D6GA 5K59F 3O2DL 1RK1A 4MA8H 4PJCF 1KV3A 3HNSL 4LEXH 1S9KC 4I0PD 5KVGL 3IVKB 2PNDA 5LJYH 4MXVF 5I16B 3MCLL 5BV7H 3T4YA 4WWKB 1EIBA 3JV5A 2IALB 5GZNC 3WS3A 1ZHNB 3QAZB 3ARGD 2ICWA 3EJYD 4Q6IC 3FO1B 3P77A 4NHUA 1DDHA 4OKDA 4GAGH 3VFWA 1B2WH 4JRXA 5JHDA 3KPNA 1I8IA 3UTSA 5HD8C 4OLVH 4NN5C 5EIIB 1DP0A 3QNYB 3W81A 4YBQC 2X1XR 4JRYE 1P5UA 4MZ3A 2VXVH 1IC7L 2R2CA 3CIQA 5DC4B 1XCTA 3JTSA 3QB7C 4NCDA 2NW3B 5GGSB 5I1JL 5T33L 2J2ZA 1KTLB 3QUYD 2G2RA 1WEJL 3NABL 4Q9QL 1AD9B 5E8OA 3BEVA 4X6DF 4MMXC 4ZPVA 3FKUS 4GAYA 3FOMA 4YHKL 2ID5A 4I5BA 4M5YL 3QO0B 4NKOA 2WIIA 4CADB 5FHAH 1W0WA 1ZGLB 1I1FA 3F58H 2E27H 3FFDA 4IIQA 5ICZA 1JFQH 1UXWB 2NX5D 5IEHA 2APWA 4JG1H 1T2JA 2E7LA 3O3AA 3P9MB 5CP3H 1OTTD 4U6YB 1BQSA 1FLRL 5IF0B 2D3VA 3ZKXC 1OB1B 4NNPH 4IS6A 5C0BE 3DV4B 4FQIH 3DYPA 4R4BA 1F02I 1DQQA 1AH1A 1R3JB 4QEGA 3ZT6A 4HDIB 1KJ3H 4KQ4L 3S3PA 2AJYL 5EWIL 4ZOCA 4F37F 4MNQD 3JWDL 4PR5B 2O5YL 4PV9A 1CDCA 3O3DB 4UU9B 5JLZA 2K7QA 2GTZA 1A1OA 1ADQA 3RWIB 3WIIH 2BFVL 3STLA 1GH7A 3NPSB 3BZEA 1FVEA 4JFDA 4M7JH 4JRXD 5JHDD 4XP4L 2APBA 1BJ1J 4JFPB 2AQ3A 3UTSD 3LEYL 3SN6N 5HI3D 2BY3A 2IBGA 4YAQB 2HG5B 3TYFB 1Z9OA 4NP4L 1FJ1A 3K2UH 5BJTB 1F4XH 2I60H 3TF7C 2QQNH 3UJJL 3S4SB 1NGYA 3MRGA 3G5YA 4Y2DD 1WICA 1VACB 3ARBB 5LG1A 1QG3A 2VH5H 3QI9D 1LWRA 4O51B 3UEZA 4G9FE 1CE6A 2IQAA 2VQ1A 4LLYB 4Y5YA 4JFFD 4HBQA 3QQ3B 3GSNH 4QGTA 2QQLL 1FL5A 3D3VE 5EUKA 1LEIA 1IQDB 1H0DB 4YHIB 1DJSA 3PXJA 4HCRA 4NQVB 1WBXB 3FRUB 3NCEB 1LE5A 2O61B 5I1DB 1ETZA 3C5JA 2VERN 5EH1A 4LEOA 3RNKA 1JHLL 3EGSB 3AB0B 4Z9KB 4PJ8D 1WTGT 4TTDD 3ARRA 1E6JH 5FOBB 43C9A 5TE6H 3VFPA 1AGBB 1UYWL 3WFBL 3VGAC 2X1PA 3IFNL 2AEQH 1BAFL 2KZWA 4PJ7F 5GRJH 3U7AA 4QY8A 1PGRB 4KU1A 4V2BA 3VXRB 1CTNA 2EIEA 4EI5C 4HLZH 1JWSB 4JFDD 2AXJA 1MWAA 1F5WA 1FORH 2BY0A 3RDTD 2YEZA 3S36L 4AL8H 5E5RB 1C5BH 4HXAL 1W72A 4FXGA 1TVDA 3REVB 4P2QD 1D6VH 4R96A 2IBBA 4R3SB 3V6ZA 3MR9A 1JWUB 5CZKA 3MRQA 3VRLE 4HG4K 2YD5A 1G0XA 5D2LF 4EI6A 4K2UL 1CGXA 4WY7H 5IWLA 3JV4B 3IDYC 2ZUQB 4ZFOA 1U8LB 3TBWB 4P23C 1ADQL 4XZUA 4XAKE 1JTTA 1INQB 3B9VA 2NW2B 1RZIB 3NCJL 3QUZA 3UPRA 1AO7A 1KGCE 3QDMD 4IJ3C 1YEDB 4PJBA 5DJ2B 4F9LC 2ILLA 4JZOB 3ARZA 3P73A 5ITFA 1CL7I 2JK5A 2VXTH 4HHAB 2AJUH 4DN4L 3O6FA 1EUTA 1T0PB 1FG2B 1J1XL 1NGPL 2GT9B 5HGGS 5FB8B 1I3UA 2EDWA 2AEIT 1N6UA 3B8SA 1O5DT 4NYLB 5E8NA 2A6KA 2HMID 5ETUA 4NZTL 1HDMA 4ETQB 3FTGB 1MY7A 4U1KB 3D39A 3HE7B 2DLFH 5FDYA 1ZT1A 3H7LA 1HI6A 3L6FB 1QR1B 1PEWA 4LVOC 2Z0BA 1J0YA 2NY6D 1FYTB 4G8EA 3ZKSD 5I74C 5IMMB 3BIKB 3MJ6A 5I8OL 3BAEH 3G04B 4H0HB 4IDJL 4JPIA 4U1GC 5ICXB 5I73C 4HCRL 2BP3A 5D7SH 3L7EB 1T0NB 3R0MA 4YPGB 3CK0H 4RIRB 2IBZY 4X7FC 2ESVB 1I1AD 4AIXA 4HMEA 3HZMB 3SO3B 4JDTH 2FEEL 1SJHA 2MQ3A 4LDOB 1NMAL 4X7CC 5DRZB 1FQ9C 1HKLH 2XKSA 2R0WH 3MRBB 5E2VH 2MTPA 5ALBH 2QADC 1VPOH 1C1EL 1NBVL 1MWAL 1U8QB 1AO7D 2N7AA 1RSFA 2HJFB 1FFRA 1I7UA 5C09E 4ZFFB 3GIVA 3MZTA 4ONHA 1S5HB 5EOCJ 2HRPH 1JMXA 2WWKO 5EU6A 1RJLA 1DQDH 2NQCA 3GMMA 3D69B 3GMOB 2XNAB 3O6FD 2N4IA 5ESQA 5D93B 4J3VA 4A2MA 5IHBA 1KG0B 1P7QB 4FFWC 1OAUL 2DQUL 2HKFL 2VABB 2BNRA 4ZMAT 2GITA 1EA9C 3KPPA 3DSFH 1FAKT 1L0QA 2Z93A 2J8UF 5KSBB 1SYSB 3Q6FA 1HNFA 3E3QE 1Y6KR 3BP5A 3D39D 3CLFL 4JZJB 3T77B 1Y18B 1RY7B 1QFUH 1R5VB 1CLZH 3KPSA 3O8XA 9CGTA 2NXZC 4KGJA 1S7XA 3H9YA 1T83A 3MMEB 1QBAA 3SPVA 4V1DB 1P2CA 3B3IA 2E5EA 4PJHF 4WRLA 5HI4D 2NY2C 4I48B 3HS0B 1HHKB 1EMTH 5BVPL 4HQQL 1RMFL 4AK1A 1CFSB 2XN9B 4Z95H 3KXFE 4U05A 4DKDC 3WDIA 1Q72H 1ZHBB 1IEHA 3OKMB 4Z0XA 1DFBL 1CF8L 2H45A 1BJ1H 2CDEB 3WLWC 1T3FB 3KWWA 2F15A 3RVXD 2YPVL 4OLYL 3E3QC 4O4YL 2HT2D 5DO2C 5IKCB 3HN3A 3QWOB 1V3MA 4L8DB 5IB5B 3ZKND 2J3SA 4I18B 4CW1B 3LHPL 1KB5H 2BVPA 4JGUA 2BVQB 1HKFA 3H9HA 4K55A 3RWCA 3VH8B 4Z18A 4EEEA 5D1QB 3G9VA 3QR2A 2BY1A 3KPOB 4LGRB 2H2SC 5EU6D 3RHWF 4PJ9C 4PV8A 1AIFA 3VXMB 4JY4A 4UT6L 4OCWL 3NIGE 1MHCA 2WBJC 2Y6SD 4XGZB 3U6RA 4WIQA 4FTVB 2BNRD 4XBPA 5EPMA 1S9XB 5CHNB 5T1DL 4J4PC 1JBJA 4X8XA 5GS1B 3BRFA 3MV01 5CEYB 1VEMA 3QXUA 4PJFA 5E8PB 3DV6A 3N1QC 1UACL 2AJVH 2VDPL 1NFDB 5IROA 3E2HB 12E8L 3OB0H 5GRXG 2DWEA 1OGAB 3HR5A 3V2AR 3D5OF 4KTEL 1TJIH 4LBEA 5IR1A 1K6QH 2R4SH 3MBEA 1KPVB 3SDYL 2W59A 1K8DB 3DMMC 4OZHF 3BFOA 3FO0H 4CMHB 5C0AB 3LDBC 4NT6A 1JGLL 4FQXA 2NY5L 1EAPB 2MQCA 1JZ6A 2R1YA 1VFUA 1WZLA 4OF3A 4A6YH 3QJHA 1CR9H 1JGVH 4KVNH 1YUHA 1N7MH 5MEQB 1OPGH 2A6JB 5ESVB 4ODSL 1E4WH 3BE1H 1DBJL 1OAXH 2AQ1A 1A6WH 5ECJE 4FFYL 5SWZD 4ZXBC 4M1DL 3QIUC 1AGDB 2OR9L 4XMLH 5JW4M 1U8HB 3CDGA 4BQCA 5HPMA 3H42L 5F96L 3CSBA 2EZ0D 3FZUC 1X5KA 3BESR 5JDSA 3OKDA 4MDIA 2W0LA 3LQAH 4L4TB 4NHCL 3LEVL 3VA6A 1GXEA 4YHZL 3DLQR 3TO4C 2CXKA 3QDJD 4NNXB 1KXVC 3VXTA 3MYZA 4LOUC 4KH2A 1SJEA 1XF3A 1TTFA 3LEXA 5LGJA 3VG0H 1U92A 3G08B 1E4XL 1KB9J 3PWPA 4OI9A 1WAAA 4X4ME 1CFQB 3ZTNL 5KVDH 1FP5A 3S34H 1NCCH 1UADC 3MACH 5CEZE 1QSFB 4X7SH 1EHXA 3FQXB 4NQXB 2DM7A 3N9GH 2FDBP 2X4OB 1I3RA 1VCAA 1VADA 3MRDB 1HYRC 3HZYB 5F8RC 2ZJSL 2NX5B 3EO1B 3NIDF 1MRFL 5DZOA 4KUZL 4KK6C 4CDHA 3T8XA 1ONQA 5HHXH 1N3NA 3TNMA 3V6OA 4J2XA 5GSRA 3SEPA 1F11B 5D70H 25C8L 2VITA 1RK1B 1A4KA 5KSUB 4HSQA 4EOWH 4NOFA 5J12C 4AH2B 3CXDL 1G7MA 2Q1EA 1R3LB 1PSKL 5MHSD 3FRPG 4HK0B 3WS3B 5I17A 3GIZH 1J1PL 5GXBB 3GHBH 1U8NA 2C4XA 2HH0L 2NPLX 3DIFA 2ICWB 4FQ2L 1CD8A 1DQML 1TCRB 2VLKA 3P77B 4QRRD 2P8MA 3PDOB 4NHUB 1DDHB 3CJJA 4ODHL 5EOCH 3U4BL 3WIHA 1RUAL 4OIAA 3VFWB 3ALXA 1NCWH 4NJ9L 3ZE0E 1UKQA 2B5IB 5HHPA 5JHDB 4NQED 1JUFB 5I1EH 3FQRA 3ARQA 1PY4A 4KI5E 4TSAL 1I8IB 3UTSB 3GB7A 1CLOH 4FRWA 4YEFA 5IB1B 1FYHB 5JNYA 4UI2A 1IGFH 2DDQH 4DQOH 1HQ4A 1XCTB 2QHLA 4WI2A 3RGVC 4YDVA 2HT3C 1EFQA 3PWJA 2G2RB 1KENL 5D7IF 3BEVB 4ZPVB 3S3SA 1UA6H 1PQZA 2APFA 2VDQL 3FOMB 4I5BB 3PQYE 4MA1B 2WIIB 2GJ6E 3CLEL 5DHVA 1W0WB 4OD3H 4KI5C 2EEAA 4IIQB 4QNPE 3FFDB 3LV3A 5ICZB 1OSPH 3DUSA 3E6FA 5KVEL 4WHTA 4JQXA 2FX8H 3G6DH 4MCZA 1HEZB 3V52H 3KYNA 4Q58C 2KQMA 2WP3T 4U1HB 4M93B 1G7JB 1OTSD 2AP2A 4NCC1 3HB3C 4R4BB 3OBAA 4OCXL 2FNBA 3LCYA 4RRPG 1ZVSA 4PV9B 3F65A 4L1HA 4QRPE 4L8SC 5JLZB 3UTTA 2BOBA 2GTZB 1A1OB 4JRWA 4XB8A 1OP5K 4NKIH 3STLB 3BZEB 1FVEB 1K2DA 2LU4A 4JFDB 2UZYB 1H3GA 1JYNA 5MI0C 4P2OC 2I9TA 3V4PH 5CJ5A 2HWZH 5T1LA 4M3KB 4NZJA 4TTGA 2X9WA 4MQXD 2CMRH 4WENB 5JORA 2LQRA 1FJ1B 4LAJH 3MROA 3WS6C 1V5JA 1P4LB 2BNQE 3GK8L 5CBEA 1NGYB 4ELKB 3MRGB 5DZNA 3G5YB 3VGEA 2WBKA 3MV9D 4O2CA 3WIHL 3GI9L 1IFHL 2VLMD 1UWEL 5TGBA 2VQ1B 4LLVB 3RBSA 3WNNA 5IGXH 4DUWA 4XI5C 1MCIA 1FL5B 4ZUWA 5EUKB 2EC9U 1BGXH 1LEIB 3QEHB 5JZ7D 4P4KB 3T4AA 4TUKL 1ETZB 4DZ8A 3RNKB 4LEOB 2ATPB 4U0RB 1TITA 2NY0D 2GK0A 2MOVA 1YEEH 43C9B 4ZO8A 1RJZA 4FFZL 5HYIA 2VC2H 2X1OA 2FEDD 1MCKA 2JB5L 1DN2A 1YEGL 2MJWA 3BVNA 2NY6B 4QY8B 3SDCA 4NO2A 1I85A 5DJ6A 3ZE1E 3TVMC 4GG6A 1MWAB 1LP9F 4F8TA 2R0KL 5C07A 2YEZB 4IRSA 1MLCB 3GBMH 1DBMH 5T1LD 1KCUH 3WSQH 4XVJH 5JXEA 4FXGB 3RY6A 5C0GA 1EX0A 4R96B 3V6ZB 3MR9B 4UV7H 3C2AH 3MRQB 3IKCA 1KCRH 3BN3B 3IF1A 4P3CH 1NCBH 2VISA 4XZUB 4WTWA 1AJ7H 3QUZB 5HHNA 3UPRB 4YXHL 1IGJB 3A6OA 2X4TA 1AO7B 5CLTA 4PJBB 3CUPA 3DTXA 3P73B 2XWBA 5JUEH 1JHKL 4PRHA 3O6FB 1ZVYA 3DI2B 5F9JA 5FFLA 4ZQKA 5JHLL 2Z31C 4MA7L 4YHNA 5E8NB 1I3VA 1JPST 5ETUB 3P0GB 4ZOEA 3EOAA 1HHIA 5D1ZA 3MODH 5GJSL 2V5RA 1HI6B 2D9QB 4MCYB 4Y0GA 1YC8A 3NGBB 4F15B 3ARXA 2VQUA 4TOYH 4G8EB 4WEBL 2I26N 1PVHA 3W82A 3FT4A 5C07D 5FGCB 4HIJA 4JPIB 3PNWA 4XNYL 4IRSD 1FRGL 4KKLC 2P24A 3MLVH 1P53A 2HT4D 2CRZA 1BD2E 1ITCA 1JPSL 3UDWA 3KNBA 5ESAA 5JXED 3RZCB 2DJ4A 1G7LB 3GSVA 1DL7L 1IZKA 1KOAA 4X0KB 5I1CH 1QD0A 3O6MH 1SJHB 3OTTA 2HAZA 4K23L 4Y5VC 3RVTC 2A9NH 4OQ1A 3FB8A 4MJ6A 2EDJA 2JIXD 4Y16A 5HVHC 1GHFL 4KJQC 1I7UB 1NBQA 3GIVB 4ONHB 4XVTH 3P4MA 5EU6B 2X44D 1NUNB 3ALWA 3GMMB 4OQTH 4EN3A 5IJKC 1U8MA 5JOPE 1KCKA 1SYVA 2B4CL 5E9DA 5EO0B 1RFDL 2EYRA 3PJSA 5JXAL 4HPYL 4RAVA 4EVNA 4O2FA 4KZDH 2GITB 3F5WA 1YNTA 3KPPB 5SV4A 2Z93B 3DXAE 3NH7L 4WI9A 3HZVB 3BP5B 5DD3H 3U30B 2GK2A 5D5MA 4LAQL 4K71C 1YECH 4XNUH 4GRWF 1T80A 3O8XB 3KPSB 3JV0A 2A9MH 2R2HA 2ZUSA 1JF1A 1AXIB 3OMZA 1S7XB 2FB4L 3FB6B 1P2CB 3B3IB 1J8HA 3NFPA 3GGWB 1C5CL 3UTOA 1PEZA 2GUOA 4K7FA 5F89A 4MXQC 5EA0H 4Z7WE 3SGJA 4HFUH 4MVBD 1LO4L 3P4OA 4ZODA 3VWJA 5TF1H 1FHGA 4BQ8A 5I19H 1M4KA 3KWWB 4HV8A 4Y5XA 5I30L 4U1SB 4R2GB 4ZPTA 4N0UA 1DCLA 4KK8C 4HF5L 5F6HJ 1RULH 5FA3A 1HK6A 4WI5A 2R8SL 5ILTL 3RNQB 3A6BL 3U1SH 1MAJA 5B39G 2BVPB 3RRQA 4WO4C 1L0YA 1WITA 4Y16D 1HHHA 3IU3B 4QRSA 3B5GA 3H9HB 4WEMB 3RWCB 5L9DH 4FP8H 2BMKB 2V7HB 1F58H 1NANI 3HC4H 5I8KH 3PABA 1R0AL 1AIFB 2D0FA 1KEMH 4JY4B 5CUSH 4AEIL 2CGRH 4XBPB 5EPMB 5IVXF 1AC6A 1QFOA 5I75C 5A2IH 4PJFB 3DV6B 5CZXC 4MJIE 3SJVE 1Q9KA 3V0WH 2DLEA 4JFHE 2P5WB 5J12B 2DWEB 3HR5B 1YNKL 3HAEG 4LBEB 4NBZB 2Y9RT 5IR1B 3HHRB 3T1WA 2BY2A 3MBEB 5TDNA 5CSGA 5FYLH 4HAFA 5DJZB 4JM4H 4MQSB 3K4ZA 4BH8A 4NT6B 4AG4H 5LAXA 2H32A 4FQXB 4DAGL 5GS3A 3CX2A 5D9SA 3IRPX 4K94H 1ZMYA 1GGYA 3VWJD 4M6MH 4LPVA 4H25A 2GYSA 3QJHB 4HD9A 3BPNC 3CFEA 1LO2H 1YUHB 2ICCA 3K8KA 4PJDE 4WTZA 4LCWB 4PJ5D 1DBBL 5FYLE 3KPLA 4KKAD 3ARUA 4Z77B 1OAKH 1CGSH 1A7OH 4G7VH 2NTFA 4PJEA 3LMJL 1F00I 5IT2H 3E0GA 1DQLH 4MX7A 2FATL 4XNMA 4OF0A 4LLWA 1MJUH 4HUKB 2ED9A 3SGEH 1T22A 3BI9X 4EIZC 3FN9A 3UO1L 35C8L 4D0DA 2JJWA 1F4HA 4KRNA 1T03L 3CDGB 1FBIH 5EOQH 5IESL 4LCUA 5DK0B 4AEHH 1ZLSH 1Q9WA 1BVLA 5HPMB 4WU7A 4DTGH 1AXSA 1P4IH 1FN4A 3UC0H 5JDSB 5CS7A 5FO8A 3N1PC 3OKDB 4MDIB 4UINH 5C6TH 3MZGB 4MWFB 3V5DA 4LASH 5T5FH 3HI6L 4D3CL 3SE8H 3VD5A 3VXTB 5GISL 4H8WL 4PJCE 1SJEB 2B2XH 1XF3B 4PGCB 5J06A 5EU4A 1F42A 3LEXB 4K94C 4PJGA 2Z9TA 4G6ML 5D6CA 2ZPKL 4MXVE 3AMKA 1QNZL 5M95B 1U92B 3F62A 4PGDA 4JPKH 1IGYA 3PWPB 3ZKQD 3O2WL 4HJGB 3KPRA 1JTOA 3H9SA 3IU4L 3JUYA 5E0QA 4UB0L 1HH6A 4LSDA 1CGYA 2DM3A 4Z7VA 1I3RB 4GUPB 1AP2A 3H3PH 1CICB 4TULL 3ZE2F 1VADB 3ZHDA 4D9LL 5CJ8A 3K4DA 3O9WA 3MJ9A 2D0HA 3T8XB 1QLEL 3N06B 5IBLD 3ES6A 1RZ7L 5GSRB 4F57H 2D7QA 3C5ZC 5HDOA 2VITB 1A4KB 5EZLA 1NGXA 2DF3A 4XAWH 4E41E 4LDLB 2NZ9C 4X6DE 3W39A 5I17B 2PYEE 4KKNA 5A1AA 1U8NB 2A73A 3DIFB 2BVYA 4D9RD 3N85H 3D25B 4JRYA 2VLKB 2P8MB 3INUH 1TQBC 4TQEL 1QKZL 4GLRI 3K46A 4XBEH 2XXMB 5HHPB 3SDXF 4LLUA 4P59L 3K0WA 3FQRB 4H26A 5A43C 1C7TA 2Q8AL 3SDAA 4X9HA 5GZND 3X3FH 3TYGH 1A7QL 5JNYB 2CK0L 2N7BA 1IT9L 3EJZC 5TPWL 4BZ2L 3CFIC 4RA3A 1FIEA 4YDVB 1MCNA 1QQDA 2BZDA 3EYFA 3PWJB 3OPZL 3H9SD 4XWOD 3EYOA 4N8CH 5DWUL 4NC0B 4TPRL 5DHVB 4FQLH 5BS0E 5E1HB 4YBQD 5FUZL 5IK3A 1S7SA 2XKNA 3SE9L 4KQ3H 4ZNCD 5C0BA 3DUSB 3O9WD 3Q1SL 4WHTB 4KROC 1JNLL 1CZ8L 4BKLA 1LDPL 1CDHA 4MCZB 4OLUH 4F80A 1PKQB 4PB0L 3SE3A 5IW3A 4KXZH 1MRCH 1CN4A 5C0RL 1K3ZA 1UENA 1IL1A 4M43L 2NY0B 2P4AB 3PP4L 4M7ZC 5DVMA 2A1WH 5F7EL 1MFBH 2YRPA 4MD0B 1FC2D 1JGDA 4JN1H 3W9DA 4W4OA 3KGRA 4LHUG 3B5HA 3UTTB 1E6OL 2BOBB 1L6XA 3MJ9L 1CT8A 1IM9A 2ZG2A 4I8DA 3VFGL 4M4PA 2I9TB 4X7TA 1G1CA 1A3RH 2P44B 2F74A 4LEXL 2YUVA 1EHLH 4G9FA 4EXKA 5JORB 4NQDE 5BV7L 3S7GA 3SOBH 2OMBA 4IHOB 3MROB 3C60A 3TBVA 1OD9A 3BP7B 4EI5A 2GFBA 1ZLUH 1J5OH 5E56A 1X5ZA 4QLRA 3T0BA 3C08L 4QXUH 1OD7A 4YDIH 3EO0A 1Q0YL 4F9PA 4P4RA 2NY7H 5TGBB 4LPXA 5C0BD 3AAZA 5CINH 4ALAH 4ZUWB 2AVGA 3VXSA 1UH3A 5HDQH 3FONA 4P23A 2XZAH 1WFNA 4EDWH 2V2TA 2A83A 5D2LE 1KCLA 4C56A 2GK0B 3UTPE 2O93L 1RJZB 3QUKB 1R24A 4Q9CA 3B9AA 2YA0A 3Q5YA 3KS0H 1A6PA 1LGVA 3BVNB 3F58L 3SDCB 3WJLC 1T1WA 4I77L 5DJ6B 2VSDA 4GXUM 3ARPA 4GG6B 5C07B 4LVNB 5IW1A 1KLFA 3QH3A 4X8JA 4CJ1A 4IRSB 1CGUA 1XGQA 4QF1A 4BH7A 2AJXL 5F6IB 1MNUH 4G9FD 5C0GB 4F8QA 5DI8A 2PO6A 3DX8A 4XP6L 5FM5M 1JGEA 3IKCB 4EI5D 3D3VD 4PBVC 1GOFA 2R69H 3IF1B 4EBQH 1CD1A 5EBGA 5CFHA 1YEHH 2IANE 5HHNB 1V7NL 4XCEB 3CUPB 2LTQC 2XWBB 5B8CC 4PRHB 1BQHA 3FAWA 3LB6C 1ERNA 5F9JB 1XF4A 1UGNA 2IH1A 4UNVA 3M17B 3K2UL 4ZQKB 3IS0X 4KMTH 2VAJA 4P23D 1ZGLM 4YHNB 2KUTA 3VGDA 2UWEF 3EOAB 1HHIB 3NAAL 5D1ZB 1GIGL 4OLXH 1B4RA 4YX2L 5SWSE 2NY1C 5J0BA 1BJ8A 1WF5A 5ACMA 4JPWH 1YPZE 3VI4F 5L7XH 2GTWA 3WHXB 3I75A 4JM2A 4WI4A 3FT4B 4M03A 4HIJB 3PNWB 3VD7A 1RIVL 2P24B 3FQTA 2DBLH 3KNBB 1A7RH 5ESAB 4XAKD 3RWEA 2V2WA 2J8UE 2PO6D 5CD3B 4PRAA 1AXTL 5C09A 1A64A 3A0OA 1KGCD 1TLKA 4JFZH 4DKFH 3DRQB 5D2NE 3ME0A 3BYTA 5HGHA 4YUEL 3KHQA 3FB8B 3ULVF 1CD9B 2AEQL 4MJ6B 1NCUA 1B90A 4XWGH 2RB8A 1LVEA 5DFVC 3UTQB 4Y16B 4PJHE 2F53E 4J3WA 2OJEA 4ODXA 2YXMA 3VJ6B 2KZ1B 3UCRA 2QV2A 3V8CA 2UUDK 5A16A 3RWGB 4OM0H 2XTJE 1U3HC 4EN3B 5K9JL 5GIRA 1U8MB 5C6PB 1SYVB 5IFJA 3OSKA 4P2CG 4O2EA 5E9DB 4PGEA 2R15A 2EYRB 3PJSB 2QADD 3GKWH 4RAVB 4EVNB 4O2FB 4UT7L 4W6XB 5D2NC 1YNTB 4OZGF 4JVWA 4R97B 4JHWH 3OAZH 4QRTA 3BN9D 3ARFA 3H0TA 1VHPA 3KXFA 5D5MB 5ERWA 1MFNA 1M6OB 1CL7H 1JF1B 4YBLB 4FFWD 4JM2D 4BSJA 1WZ1L 2XTJC 3OKEA 5E8EA 1J8HB 2EEDA 3NFPB 1KN4L 2ERJB 2GUOB 4R26H 4ODTH 4K7FB 5F89B 2FSEA 2BHYA 1BLNB 3P4OB 2HLFD 1BVKA 3VWJB 4HZLA 3ARWA 3MUJA 4LLAA 1IJ9A 3L9RA 2FGWL 1VA9A 2NXZD 3O81A 4ZPTB 1A0QH 4LRIC 3KYAA 4N0UB 4N8PA 2DLFL 2IGFH 5FA3B 1TQCB 2EDHA 3FQNA 5E6YA 1KB5A 1HHHB 2DM4A 4QRSB 4PB9H 4HIXH 2WQ8A 3V7AE 5F7FA 2P5EE 4OCRH 2Y06L 1FNFA 5DO2D 3PABB 3R1GL 4LLQA 5J13B 3CK0L 4JO2L 4HUNB 3RKDC 3TJHC 3BGFB 5K9KA 4LSVL 1FH5H 3AGVA 5MEPA 3X17A 3KLDA 4OF8A 4U7SA 3VMPA 4Z76A 4RFOH 3TV3H 3QIUA 3V9FA 4ZTPH 1HKLL 2I5YH 3BKYL 4QO1A 3GI8H 4N8VA 2P7TA 3ARFD 2H2SD 1A6VH 1A14L 4JG0H 3KXFD 1F90H 4M7KH 3QRGL 4MGXA 4Q7DA 5KJRH 2RQ8A 5DQDH 2HP4A 1RU9H 4R9HA 2WBJD 1IQWL 5TDNB 2AEPL 5HI5C 2MWCA 4OM1L 3GSRA 3MGTB 1AHWA 4BH8B 5LAXB 3DI3B 1S7WA 5D9SB 5I1KL 5L8KB 1BREA 3LKNB 3SCMC 1KLUB 1U0QA 4EUPA 4GRLA 4H25B 4A6YA 4F2MA 1DLHA 1RHHA 4IRZL 1KIRA 4YHOL 4PS4H 1HZHL 4JB9L 1U8PA 4NC2B 5ACLA 3DMMD 4KK5C 2NTFB 5FYKL 4PJEB 3MRNB 1TNNA 3MLSL 2YRZA 5BQ7A 3LS4H 2EDOA 1KN2L 3P0YH 4MX7B 4XNMB 1YY9C 4LLWB 3O3UN 3RVVC 2W38A 1U58A 4WUUA 3HC0B 1T22B 5FCUH 1Z5LA 4NWTH 4D0DB 5I76A 1FLTX 1FAIH 4LCUB 5HDBF 1GC1H 4OGAD 1Q1JL 1SY6A 1Q9WB 1BVLB 4JANA 4WU7B 1AXSB 1CQKA 3RBGA 5GHWH 4Y19A 1FN4B 4L3AA 3NIDE 4TRPL 5FO8B 2I24N 4ZXBD 5EG6C 1KFAH 4X4MA 4G8IA 3V5DB 4GT7A 3KYKL 1FFPA 4UTAH 4NJAH 5I15H 3QIUD 1H9VA 1LO3H 2FX9H 1I7ZA 1AKJA 1VERA 5BCAA 4OD1H 1U42A 5EU4B 2WUBH 3O11A 4PJGB 4BQBA 4KJPC 5D6CB 4FZ8L 3GM8A 4PGDB 3ZO0A 2XQBH 1IGYB 5JPMA 1W8OA 3FZUD 4X80L 2E7BA 1RIHH 2D2OA 3KPRB 3DHMA 3HRPA 3TNNA 3G5XB 3TWCL 5I18H 3GRWA 2JCCF 1NL0L 2AABL 1NSNH 4J23A 3BDBA 2FBOJ 4Z7NF 3HTLX 1HH6B 1X4YA 4ENEC 3BJ91 3MLWL 4LOUD 4Z7VB 1AP2B 4FFVC 4BUGA 2EDLA 1TZIA 1CDBA 4KFZC 1UJTA 2E6QA 4H1LG 1PX4A 4PJXF 4GQ9L 3O9WB 1GC1C 4L5FH 1EO8L 2VDMH 5TQ2H 2X9XA 3ES6B 3TA3C 4M7LT 4WFHE 3CDYA 5KN5A 4XCYA 5EZLB 1NGXB 3O0RL 4BUHA 2R4SL 5IVZB 1KCVH 5D7IE 2F58L 1VFOA 3O2VH 1EEQA 5BV7B 3FFCE 4AENA 3MA7A 3W39B 4YE4H 2A73B 4LCIH 6FABL 4AIOA 2BSRA 4JRYB 1U8KA 3UBXA 1A6ZA 4WUKH 4M7LL 3AM8A 1KSRA 4LLUB 3U7WL 1XR9A 3RUGA 5CEZD 2HN7A 2CO7B 3EBAA 3SDAB 2MFNA 3V95A 3ZYZA 3FO2A 5CJOH 3TPKA 4V2CB 1IAKB 3PQYA 2GJ6A 1D9KA 3B2UC 3QEQE 4ELMB 2ZOLA 4L8SA 3GJFH 5EZJA 1NGWA 1QQDB 3EYFB 4KRPC 1SY6L 4DGVH 1IGTA 1MHPH 1XGRA 1S7QB 3EYOB 5EU5A 1KCSL 3DETD 2Q3ZA 3QZWA 2LU3A 2PTVA 3LQAL 3P0VL 5MP6H 5IK3B 4X6CF 1S7SB 5TQ0L 2XKNB 5CEZL 5C0BB 2B1HL 1IAIM 3PE9A 3RGVD 4K3EL 1FZMB 4U33A 3VA2C 3WS6A 2HT3D 4RGMB 3NZHL 1P1ZA 4ZD3L 4G6FD 4EZMA 1BP3B 2W9LA 5IQ9A 1MJ8H 2AKRA 1DBAH 3WO3B 1IL1B 2IAMC 3GRWL 2FCBA 4KI5D 2NZIA 2J6EH 1JGDB 1A3LL 1MPAL 3W9DB 3FHAA 1S9VB 3RX7A 1XCQB