2E7LC

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxic Tcell receptor
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 33
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7lC00
4M93C 2CPCA 1INEL 2HRLA 4F7MB 4HIEA 4L4VE 3WFHB 1DUZA 5B4MC 4WV1B 3HKFA 3S5LG 1AFVH 2LVEA 5KSUA 3EGSA 1K5NB 2B8OT 4FQ2H 1LEKA 1GGBL 5CD5D 4FQPA 4CN1A 1RZJC 4Z5RA 4XB8A 1E4WL 1Z9SA 3NCBB 3SCMB 1JNJA 3MXWH 4WWID 1BAFL 2X4RB 3X3GL 4D0CB 3X12B 1AXIB 4DN3L 1KG0A 1UZ8B 5F7HA 1ZK9A 1NCAH 3QIBA 1GJIA 4L4JA 3VFMB 3MBXL 3N85H 1NFKA 4JM4L 3VFTB 2CLZA 4WHYG 1I75A 3ULSA 3K81A 3U7WH 4XXDB 2CDGA 5GS0L 1T3FB 1YZZA 2DLHA 3BDYL 1JGDB 2CGRL 5K9QG 3IDIA 1XIWA 4LHUA 3KJ6H 2VLRA 5DD0H 2I27N 2VZ3A 4FMFA 3EYOA 1FIGL 4G9FB 4N8CH 4ZO9A 3WFDL 3QWOB 3KLHD 1P5VA 4HEME 4G8GA 4G8IA 4HF5L 4OTXL 3UYRL 4KROC 1ZS8B 2BC4B 1YQ2A 4ZPVA 2NY5L 4X0KA 5C0NC 4ZQKB 1W72A 2YPKB 2Z31A 3WHXB 1J8KA 3MSPA 4WFED 1PZUB 4PJDF 1TVHB 3D69B 3T2NH 4GRWF 4HXBH 4PR5A 4P59H 1J8HB 4WW2F 3VDBA 2Z8VC 1T6VN 4Y4FD 3X14B 4QRQA 2YC1B 3U0TA 1H5BB 2RCSL 3CUPA 3R0MA 2Z93B 4M8QA 3HI6H 4XGZB 5EN2A 3MBEC 1MAMH 3TBYB 1HZHH 4I4WB 3SJVD 5I75B 4ZXBA 3EDFA 5BRZE 4CAGA 1UC6A 2PO6A 4KUZH 1HXMB 1MFBH 4KROB 4QOKB 5JHDB 3MLRL 3ZT5A 5JORA 5CEZH 2APBA 2I26N 5I0DA 3K8MA 3CCHA 4ZG1A 3GMNB 2H6PB 4XHQA 2IH3B 1FCGA 1FAKT 3A67L 4QXTA 4YEEA 5FYJH 4RRPG 3TWCL 4HUUB 1RMFL 1KLGA 3SDYH 2VERN 4EIZC 3ZDYF 4YQXL 1CD1B 1KXTB 1SYSA 2NXZD 4XNYL 4YDVA 3RBGA 3WV0A 2J6EL 1XF2B 4PJDA 4K94L 3MBEB 5GGSY 4L1HA 2OJZH 4X9BA 1GGCL 1XMWA 4PUBL 5MEPB 1ZOXA 3O9WA 4WW2A 4LSPL 3OAUH 1SEBB 1E4XH 3QI9C 1GOHA 4PJ8B 3V5KA 3OQ3B 1N6UA 1QSFE 3MLWL 1BQHG 1EO8H 2FZ3A 5DJDB 4JHAL 1R3LB 2UWEE 5B4MD 2C7UB 2HVJA 3JV4A 5DDHA 4AIXA 1MCWW 5EOTB 4MJID 2FECI 3AAZB 4M61A 3DXAD 3MNWA 3MV8B 3S5LA 3CVHH 3LKOA 1F6FB 2FGZA 3R06A 4ZUUB 3IXTB 4NUGH 5C09D 2QBWA 3FONA 4Z7VA 2XQBL 2ZUQB 3IS0X 1G9NH 1KJ2H 2VDLH 4NQEA 2X89A 5DJCA 4EXPX 1TITA 2W9EL 2XZQL 3TBWA 2HN7B 3KWWA 1T7YA 1YN6A 3L9RB 3OKMB 4RWYH 5KOVC 4LLYA 1CLYL 1TJGH 2G5BA 5DQJA 5DFVC 3PP4L 2ICWI 2VE6B 5J8OA 4R4NC 2OM5A 2YPLD 4YXHL 1GIGL 3LRSA 2ZG1A 1TZGL 1ZHNA 3V6OA 3VMPA 4CVXB 2VLJA 4M7LL 3SO3C 2GFBA 3H6JA 3HC0B 2BNQE 4Y5YC 4QHKJ 5I71C 4FRWA 1X5KA 3Q2CA 1MEXL 3R0NA 2DQTH 1HH9B 1MWAA 1KENL 1FFPA 4XP4L 5GIRB 4MDJB 5AZ2H 2AS5M 1FYTB 1OSZB 1FRGH 4LKXB 4NZJA 4PRDB 2V9RA 4BQCA 5CMAB 3OAZK 2VDNH 2ID5A 4DCQA 1CK0L 1RFDH 1W8NA 2PYFB 1J1PL 2BVYA 3CSGA 5CJQL 3EO0A 4PJ5A 4KQ3H 2HFGH 1OLZA 4DGVH 5C0ND 1V3LA 5DFTA 4P46D 5HHMB 4GXUN 2F5BL 2V2WB 2L4OA 3SO3B 4PTUB 5DZOA 5I66B 1O7SA 1T7VA 4J8RB 5B3NA 5I71B 3ET9F 2D03L 4K3JL 1WBYA 4MXVE 2EKJA 5DFWH 2VNCA 5DVMA 4XPGH 3WUWB 2FR4A 3KYKL 1C5CL 3FB6B 3BQUA 3NCYS 1NCCL 1KFAH 4I9WD 1KGCD 3O3EB 4X7TB 5TF0A 3RVWC 5SV3A 4H0GA 4PJGB 1S78C 5D1ZA 5DO2C 5E8OB 4JO2H 4U1NA 4UT7L 3V52H 5L2KE 3GRWA 1NL0L 5D1XA 3LPFA 3X17A 1JUFB 2FB4H 1FL5A 3RIFK 5C0AB 3MV9E 3X3FL 5DEGB 1YDPA 4NPYB 2R2HB 1C1EH 1M4KA 5DI8B 1B2WH 3T65A 2A6JA 4LARH 5I30H 1N5YL 4LVHC 3G5XA 4ORGA 5EZLB 1ZHKA 1WT5C 4HHAB 3ILQC 4XAKD 4RRPA 1P4IH 5E6IB 4UV4L 1I7UB 4NZDA 3X11A 4XP1H 5FO7B 4HUMB 1QKZH 1I8MA 4I13B 4ZUSB 4FFZL 2BY3A 4TVPL 1ZLWK 4KDTA 3A6OA 4Y4HB 4OQTH 5EBWA 4P23D 2VXVH 1HI6A 5GZOC 1CDJA 5C0BE 3QI9D 5EU7C 5E2UH 5C0RL 4BYHA 3K0WA 3PGDB 5IG7B 5L88H 4LVNC 5J6HA 4FTVD 1XGQB 1GGYA 2XZAH 1DUYA 5GGQH 2A6KB 3QWRA 1BQHA 3HLAB 2F54D 4Z7NE 3VFGH 4BM7A 2P5EA 4LVHB 4W4OC 2CIKB 2Y25A 1AH1A 2CDFA 1FVDA 2XWBB 3DHMA 1IBGH 1UH2A 1MCWM 1MFEL 1VFAB 2F53A 4LPXA 4YHLL 2OTUB 4ZFZA 2YN5A 3KYOB 2DWDA 5FF6A 1K8IA 1FL3A 5L9DH 2IFGA 3SKMA 4EI6B 3TIDB 2CKNA 5GRUH 4NBXB 4LLWA 4DZ8B 2D7TH 2GJZA 5IT2L 3VXSE 1S9VB 3KPSD 4GAGH 4LCIH 3UTSE 3QRFM 4IDJL 2MCG1 3Q0HA 1MFDH 1VPOL 2W1NA 1TCMA 1UM6H 2DTMH 4LVNB 1XF4B 1JI2A 2P24A 3PF2A 4HUVA 1Q9WB 4EKXA 1F4YL 2F8OA 4N8VG 1J0KA 4X4ZA 1BFOB 4CKVX 5GGSA 5ERWB 2NXYC 4LK4A 1T03L 3LS5L 4X80L 4P5TC 1DEEA 1OTUC 1J1XH 4NCDA 3B5GA 3QJFA 2JCCF 1NGWB 1DLFL 1YN7B 1ADQA 1A7OL 1IGYA 3ZE2E 3P4OA 3L3GB 3GMLB 2NY3C 2W07A 4JFXB 2IQAA 3GMPB 4OD1H 1R0AL 5ACZA 2ZJSH 3D2UD 3F62A 4HIEB 4QXGL 3VXME 1ZXQA 5CZVH 5C0CB 5IBUG 4KDWA 4JM2D 5SWQA 1T0MB 3QQ9D 4OGXL 1QUNA 4F9LC 3ULUD 2ARJQ 1SVZA 3IDYC 4JGJA 1F00I 2NXYB 3EZ8A 4C4KO 3ROLA 4P5TB 5GPRA 5CEYB 1S9YB 5C7XL 3K1KC 2BHUA 2EIZA 3FOMA 3TJEH 1KG0B 2R1YB 1YY9C 2OYPA 4AENA 1FZOA 3QIBB 5I76A 1W0VB 5D2LF 1EXUA 1MFCL 1KF9B 2NY3B 5DYOB 3RVWD 5MHSD 3HG1E 4QRPE 1GC1H 3MGOA 1XF3A 1SJVA 2AJVL 3ULSB 1KC5L 4YFLF 3UTPE 4P4RA 3N1PC 1KIPB 3H7BA 5HDBF 1RAMA 1JBJA 4P49A 5H35A 3MRHB 3IJHB 3BP5A 2XN9A 1A5FL 1INEH 1XIWB 1JHTA 2VLRB 4D8PB 1G9NC 3IDYB 1WZLA 3EYOB 3ILPA 5IHLB 5F7EL 3FO9A 4H25B 2GIYA 3C5ZC 3S35L 3BESR 1GGBH 3KYAA 1DDHA 4OD2A 1E4WH 4NC1C 1Y18A 4BZ1L 4G8IB 1RI8A 5IB1A 1BAFH 3X3GH 4Q9CA 2VISB 1NBYA 4APQC 5CJXA 4DN3H 4HH9B 1K9TA 4X0KB 2Y7QB 4QRTA 4Q9BA 2FGWL 1WEJL 1YEIL 1I9RH 3MREA 1H0DA 5GZOD 1NGYA 1HK6A 1FNFA 1INDL 1MHHB 3KNBA 3MBXH 1AD0A 4JM4H 4PY7A 3PE9A 4FQJL 4UDTB 4I2XA 3F7YA 3RWEA 4JY6A 5GS0H 4QRQB 1H15B 5D2LA 3BDYH 1YEKL 2CGRH 1UB6B 3CFDA 5HYJB 4HV8A 4ODWB 5J0BA 3TNNB 4ZFGL 3C5ZB 2CO6B 3TO2A 4BKLB 1GPOL 3GMRA 4ZXBB 3PL6A 5ETUB 1FIGH 2PO6B 3DX8A 3VD7A 1YC8A 4KJQC 1U93A 3WFDH 4APQB 2EYSA 1IGIL 5IVXE 1G7IB 4OTXH 3UYRH 1MJ7L 1A4KB 4YO0A 5INCB 2NY5H 2HKFL 3CSBA 2WQ8A 1M6OA 1C16B 1ZVSA 3VFNB 5HGHA 4IHOA 1SYSB 2P5WA 4XCYA 3S3JA 3VW3L 4AJ0A 3WFZA 4N8VA 5A2KH 4ZFOA 2RCSH 5JDSA 4GRWB 4HCRL 4WW2B 4JLRB 5CEZD 1L0YA 2BX5A 3F7QA 3WFBL 1F2QA 5CHNA 2EDNA 1IEAA 3E3QE 1G7HB 4H0IA 1N3NA 4N1HB 5FYJD 4L4VA 2EDLA 4GW4A 2CIIA 3TIEA 3LKPB 3PABA 3MLRH 3VCLB 3C60A 3JV4B 3CDCA 4QO1A 3W0WB 4U3CA 3A67H 3GHEH 4LOUC 3S5LB 2X4PB 3TWCH 1RMFH 4OFVA 3CFIC 1I8IA 4E41E 3BJLA 4YQXH 1KOAA 4ZDHA 4XNYH 1D5XA 5DJCB 1K3IA 2J6EH 4D9RD 2E9IA 2FJGA 3TBWB 2CLVA 4K94H 1YY9D 5DQJB 1GGCH 4PUBH 1Q72L 4R3SB 5HVFB 5FM5O 2XWJA 4LSPH 3LRSB 3TCLA 1IAIL 3F7VA 1KCVL 2VLJB 1I8LC 5D7LE 2MNUA 4AEFA 4U2YA 2APXA 2GFBB 1KLFA 1CF8L 3MLWH 5I6XC 2FX9L 4PJAB 4JHAH 3I3DA 3ZYJA 4JKMA 4JR9L 1S7QA 4WFFE 4Z76B 3NZHL 5HD8C 4IJ3C 4L9DA 4X6FB 5DJZB 3QUKA 4JFDB 4LCWE 5D7JC 5JTWA 1JRHL 1WBXA 4FQQA 4HS3B 1FG2A 4YBLC 3VFWB 3EJZD 4NQDD 5FA4A 5EPMA 5CJ8A 2XQBH 3BMWA 4FQXD 5SX5H 3O3DA 4P4KD 2W9EH 2YD8A 2XZQH 3TYGL 5BS0D 1LEIB 4R9HA 4KUCF 1CLYH 2DQFA 3PP4H 4YAQB 1GIGH 1TZGH 4U6HA 2YS4A 2GJ6D 4BJLA 4M7LH 3G04A 1A22B 5DRXB 2DTSA 3D25B 1C12B 3WXWL 2FR4B 5T1LA 1CLZL 1T4KA 2OQJA 3BQUB 1QLRB 1MEXH 3QDMA 1T21B 2UWEF 5TJWK 2AXFA 1KENH 4XP4H 5BRZA 1YMMD 5D7JB 1EAPA 5D1ZB 4KKAD 4PG9A 4YBLB 5J12C 3FB8A 2WP3T 4CRPA 1FL5B 1CK0H 1ZGLM 3REVB 1J1PH 5CJQH 3LEYL 3F5WB 2NX5D 4MQTB 1VACA 3TVMA 3RDTA 3FN9A 4U1LA 1WCBA 3RUGE 3U82B 1I4FA 3IDNB 4KWUA 5F97E 1N59A 3KXFB 1ORQA 1A3RL 3F12A 5JNYA 1I85A 2F5BH 5T1DL 4KZEL 1GC1C 4OBSA 3CFEB 2D03H 5ANME 2GW5A 4K3JH 1NJ9B 4L3AA 4XNMA 1N8ZA 3FRPG 3KHOA 3KYKH 1C5CH 1NCCH 1MI5B 5JMOC 2A6IA 5J12B 2OK0L 1H3TA 2GTWB 2HLAA 1AHWA 1QSFA 4URTB 4Z7UA 1UENA 4UT7H 1HYRC 2UWEA 1NL0H 1LD9B 1OGAE 1OY3B 3CFBB 3X3FH 3T8XB 4Z0XA 1BFTA 4XNQA 3WS6A 5T1KA 2AKRA 2CDFB 4L4TB 4L8DB 4Y5VA 5ACMA 5JQ6L 4LOUD 1OTSD 2FH8A 5F89A 5TE7L 1N5YH 4JB9L 1N6QL 1QLFB 1K8IB 5JXED 3EW3B 3GIVA 2Q7NA 4LPWA 1IZJA 4UV4H 4CMMA 4MXVF 2GJZB 5D6CA 3W82A 4LSRL 4FFZH 3WYRA 2QKIB 4UQ3B 4TVPH 4HKZA 1QR1A 4JGMA 3G6DL 2P24B 1SQ2N 3HN3A 2BNQA 2P48B 5C0RH 1N6VA 2QSQA 1I1AC 1SHMA 1DLHB 3VE0A 4M48L 4FFVC 3QFDB 1D5BA 3D48R 2X40A 1UYWL 3QJFB 4TQEH 5F21B 5HD8D 1IGYB 4DVBA 1MFEH 4YHLH 3DUHA 5C0IA 2CO7B 2DMBA 2VB5A 2XV6B 4Z7WA 2MQ3A 4R2GB 4ZO6A 4H88L 4UOW1 2IQAB 3GBML 1P7QB 1MH5A 3IU3A 2BRRL 5C86A 1R3KB 1IM9D 1U92A 4RBPK 3ZKNC 3WIHL 4JDVA 4LLDA 3G08B 5CUSL 5KN5A 5IT2H 3O6KL 5GSRB 4IDJH 4LMQE 1VPOH 1HHKA 4TVSa 3I6GB 4KXZH 4KMQA 4L29B 1I1AB 5KOMC 1FFNA 1H3UA 3MRCA 3S88L 1EBPA 3AM8C 2GCYB 5HGAA 4RDQG 1F4YH 3ROLB 4L9LC 1A6VL 1FVEA 1Q94A 2DLEA 1XR8A 2YR3A 1F42A 3O6FD 1T03H 3LS5H 4ODVL 1OTTC 4X80H 1HXYA 2ADFL 3B6SA 3HTLX 4Z7NF 1T1ZB 5I76B 2BDNL 4MSWB 3JVGA 1IQWL 4H1LA 5HHOD 3RWJA 3PV6A 1DLFH 3N06B 3MV9A 3UBXG 1A7OH 1EPFA 3FOLB 3H7BB 3LQAC 2FEDC 4M6NL 2JCCB 5IFJA 4HJJL 3LCYA 1R0AH 2BFVL 4LNRB 2IAMD 1KACB 1GAFL 2YA2A 4QXGH 3JV5A 4JFFE 2APFA 4N0FB 1MLBA 4NO0A 2VTFA 4U6XA 1T89C 4GRLA 4OGXH 2OR8A 3FO1B 4L9LB 4MA8L 3ZO0A 1UCBL 1EEZA 1ZV5A 5EU6D 5IB1B 1BIIA 3SGDI 4XRCA 1YNLL 3WJJC 5C0BA 4U6VL 1T22B 5F7UA 3FRPA 3FZUC 1JK8A 1YEEL 3U9PL 1MFCH 3KNBB 3ZE2F 2IBZY 3BP6A 2AJVH 1KC5H 3F7YB 4JY6B 4PLJD 5D2LB 1FZMA 4XC1L 1S5HB 2F9BT 4HV8B 5GGTA 1A5FH 3DVNB 1FO0A 2VMFA 4ZUWB 1G6RL 1NANI 1P6FA 5FYKE 3TO2B 1OP5K 4PJHE 3T3ME 3VRIB 1PG7X 1DQQA 3GKWL 3GMRB 5JA8B 3ARDA 1X5HA 5F7EH 3OL2A 5I1CL 1AI1L 2AV1B 3SDCC 1EK3A 3UTSA 3DGGA 1T7ZA 3HE6D 3BXNA 5MP6L 4BZ1H 2KBGA 3PWVA 3QUYD 2NY1C 3H3KA 4LL9A 3CFKB 3T77A 2D0HA 4YO0B 3BZ4A 5GS0D 1I7TB 4RDQF 3TT3L 2FGWH 1WEJH 1YEIH 1ZVSB 1B6UA 4W68A 1DQLL 1ORSA 5HGHB 25C8L 2X44D 1INDH 4XCYB 2NZ9C 2WM0A 5CBAA 4FQJH 2HJLA 4N8VB 4BQ6A 3LV3B 2GUOA 4RWHA 5F7DB 1YEKH 1IGFL 3QXVA 1EVTC 3SDCB 5JIHA 4ZFGH 4X5WA 2IALA 3H3PL 1IEAB 2UYLA 4HKJB 5CP7A 4F8QA 4L4VB 3OXRA 4X6BB 1TIUA 1UVQA 2DI7A 4ISVA 3TIEB 1I1RA 1C5DB 1RUML 1IGIH 1VESA 4IMKC 3SDAD 1MJ7H 3LAFA 5F7WC 1BPVA 1XCQA 1BQUA 2HKFH 3FQTB 1AO7D 4DK6A 1FLRL 4J3VA 3AMLA 1K2DA 1MWAL 1S7VB 1X5XA 1U8QA 4ZDHB 2IGFL 1KTLA 2NCMA 4LU5L 4WU5A 3AREA 1A0QL 2CLVB 1HYSD 4QRPA 3WS3B 2B0SL 3RL2B 2DB8A 4EI5D 4HCRH 3VXPA 3KPLA 1BVLB 2XWJB 3QP3A 3D85B 4L3CB 1U3HC 3TCLB 3WFBH 4LF3A 1U8OA 5C0JA 2V7HB 1UADC 3JWDL 4ODUA 1HHGA 1MCEA 1IEBB 3WNLA 1BFSA 2HTLD 2VLLB 2AJXL 3BIAX 1L7TL 5D72L 5IVXF 3BMVA 3ZTNL 4HWBL 4KDVA 5IB5A 1S7QB 2E7CA 1D6VL 3VFPA 2DWEB 4MD0A 1P69B 1NC2A 2VLKD 4N90D 3RWHA 2BCKA 5CCKL 1OAQL 4FQQB 5EC2A 1HSAB 1OAKL 5FA4B 4NZUL 3GJFH 2X4QB 2P49B 1BF8A 2Z91B 1JRHI 3KG5A 1DQJA 4LFHG 2CJUL 5HHNA 5DQDL 2DM7A 4E42B 3QUZA 2SEBA 3ULVE 1U3HB 1T0NB 2QLVB 4MQSB 5E7BA 5IB4A 4JPWL 2D9QB 1Q72H 4YIQA 2JJWA 4X99A 5B39A 3C09C 1UKQA 1KCVH 5GZND 1KJ3L 3UZEA 1CT8A 4O5LL 3AU1B 4OF8A 1RJCA 3DLQR 3O41A 4PJ9A 1WIUA 1CF8H 1T4KB 2OQJB 3HPLB 3U4EB 2FX9H 4XCCL 4ZAKC 5BRZB 1CN4A 2HG5B 4JANA 4JR9H 2HT4D 3O11A 2HTKC 3NZHH 3B8YA 2W91A 4OV5A 5JIKA 3WEXA 4PG9B 1G9EA 3SBWA 5GS2H 5IVXA 1KLUA 1MJJA 1JRHH 2XACC 1NC4A 2ZG3A 1HH6A 2R1XA 4MB4A 1UKSA 2NY1D 1I1CA 1UQSB 1NUNB 1VACB 1PFCA 4PY8I 3RDTB 3TYGH 1I4FB 2R23B 3TFKC 3VFRA 3GIZL 1EGJA 4YGVA 3F12B 1PQZA 4HIJA 3RTQD 4PRHD 4QCIB 1D9KA 4M3KB 1IAOA 4Q6IC 4IMLB 1PEZA 2KQNA 1Z2KA 1EHLL 2DD8L 3U2SB 1QHPA 3WXWH 4XNMB 4XP6L 3UEZA 3CSYB 1CLZH 1UB5B 3D0VA 4M1DL 4J12A 4TNWK 2HLAB 5EU5B 2VL5B 2YD9A 4NGHL 3MCG1 3UJJL 4P2OD 2OS7A 2UWEB 4YHPA 3D6GA 3CDGB 4W70A 3B9KA 4Z0XB 4XNQB 2AKRB 3LEYH 4JQXC 4Y5VB 4AT6A 1PDKA 4KRPD 4NC2B 5F89B 4P2RA 3EYSL 3RKDC 1NGQL 4E41A 4Q6IB 5MENA 5ICZA 3GIVB 4KPHL 1A3RH 2MWCA 2DQHL 1T0PB 5T1DH 5IMKA 4KZEH 4CMMB 1CGUA 5DR5L 1AQDA 4I0PA 4GKZB 1L4IA 4WEBL 2JK5B 3FQRB 4GRMA 3HZKA 5DJ2B 4PS4L 5D9SB 4F2MA 3NGBC 2AJUL 2ZPKL 1J88A 3EYVB 4FP8L 3DX7A 4WTWA 2OK0H 3H9SD 3Q3GB 2A2QT 4LLUA 2BNQB 3D18A 4B50A 2E6JA 2AXHA 4JZOA 2ADIA 3E1F1 4IRSC 1VEPA 3STZA 2NMSA 2FYYA 1S9KC 5MEOB 1KELL 5IHBA 4LCWA 1FORL 4JQIL 3OR7B 3B2VL 4KJYB 3RUGF 4DVBB 5JQ6H 4LQ1A 2ESVE 3ROOB 5TE7H 4TVPD 1PEWA 1D5IL 1MREL 1U8MA 4JB9H 4K3EL 5D7KD 5F93C 1N6QH 5EC1A 3TF7C 1L7IL 1OVZA 5HI4D 5LAXB 4PRAB 1U92B 4ZO7A 3NGBB 1TZHA 1BD2E 1U3YA 1TTUA 1TTFA 4LSRH 3U4AA 4HMCA 4C57C 5EIVA 3HUJA 1U8PA 4C55A 1FFNB 3G6DH 3O3AB 1EFXB 4IRSB 5HGAB 1MSPA 2OR7A 1RHHB 4GUPA 3EYFA 1FVEB 2PYEE 3U79A 4M48H 4PG2A 5IFHL 3QHFL 5EOQL 2MMXA 1HXYB 3B6SB 2E7HA 1AR1D 1R5WA 5C07E 5IROC 1OM3L 3DWTA 1UYWH 4ZAKD 5ABDE 3RZCA 4U6YB 5L2KB 1CXKA 4CVUA 4WW1A 4R90L 5DK3A 4ETQA 3UZVB 1QRND 4BSWB 1MOEA 1ZT7A 5KSVA 1F11A 5LGHL 3VFOA 2VJXA 5ITFA 4H88H 3ARYA 5DRNB 3WHE0 3GBMH 3NVQA 5DURD 2OJEA 4XVTL 1WAAE 2BRRH 3RUGA 2NY6B 3MRDA 3WIHH 4XCEA 5CUSH 2FIKA 2DM3A 3O6KH 3BPLC 1BOGB 3QEUA 3QHZL 1AE6L 2WQRA 4JZJA 1J05B 4GRLB 4P5MB 4K23L 4UZGA 3D9AL 3LQZB 1XT5A 4MAYC 1LGVA 3UROR 4QRRD 2EDOA 4L8BA 3S88H 1FJ1B 5CBEA 3BEVA 3I02A 5GGRB 1BIIB 1U6AL 5E6YA 4HUXA 2HT3C 2N7BA 3TPUA 3IDJA 1IILE 4ODVH 2ADFH 2J5LC 2NW2A 2BDNH 2NYYD 4RGNC 4QRUA 1IQWH 4NZTL 4P99A 5K59E 3U7AA 1OGAA 2V2XA 3QQ4A 4KK8C 1JPGA 3VA2C 1OW0C 3J8F7 5IMLA 4NN7C 4HEPG 4M6NH 2R8SL 1EO7A 5BV7C 4HJJH 1FZMB 2BFVH 1W72H 4YDJA 1GAFH 3BPLB 1CGYA 2V9TA 4PRID 5FAAA 4MAYB 3RKDD 3W39A 4CDGC 4ZFOL 4X5XA 3VXSB 3TP4A 4NWTL 4I5BA 4M5YL 3BXNB 4MA8H 5C92A 1UCBH 1RZ8A 5B8CA 4Z0BL 1MPAL 2WLYA 4NQXB 2J5LB 5KVFL 3GHBL 1KULA 1YNLH 4RGNB 5FECB 1ZSDA 2F74B 5EBLB 5JUEL 4K8RC 5JOFB 4NQCA 4U6VH 2HFFA 1B9ZA 4Q7DA 2AJYL 4TNWF 3KPNB 1AXSA 1YEEH 3U9PH 1HWGB 4NN7B 2DIAA 1KT2A 3V4VL 5BV7B 1RK1A 3TN0A 2FX8L 5CBAB 5SWSB 5C2BL 1LE5B 1S7TA 4XC1H 3QO1A 3BRFA 5ECJE 1B88A 1T7XA 1WFTA 1OP3H 5B3JE 1G6RH 3W9EB 1CXIA 2IALB 3GKWH 3L6FA 5CP7B 5I1CH 1TZIA 1AI1H 2PNDA 1UVQB 3VXMB 1P4LA 1E27B 2XKNA 4XVJH 5BXFB 3S97C 3S98A 1J86A 3MV7B 3QDGD 2VITA 5MP6H 1LMKA 2DQDL 3HAEH 4DJMA 2FHBA 1ND0A 1FNGB 1EJOL 2QSTA 1OGTA 5EU4A 4ACPA 1NEZA 3TT3H 4GMSL 4XC3L 3A0OA 2GKIA 3EJJX 1DQLH 3QIUA 3WLBB 1K2DB 25C8H 4KV5E 1KTLB 2EDKA 4LP4A 3VXUA 4C56D 4ZNCD 4E0RB 5ILTL 1OARH 3SKOB 3HG1B 4QHMA 3QFJD 3PXJA 3SKNB 2H32H 3CMOL 4C59B 3BEWA 3RX8A 3OG6B 3KPLB 4PJHF 3AS3A 3Q48A 4JZNA 3T3MF 1A6WL 5L2JA 5IEHB 2F5AL 3G5YA 3VXRE 3H3PH 3NIDE 3UBXB 3F58L 1YQVL 2EH7L 3V7MA 5EA0L 1BP3B 4RX4D 4GBXC 1M7XA 1RUMH 1RK0B 2KQMA 1FFQA 1MELA 1S9WA 3I6LE 5EORL 2JB6B 1WWWX 2XXMB 4XBGA 4UUJA 4MD0B 1X5GA 3MFGB 1NC2B 4N1CA 2G60L 1H3PL 5DVOA 4AL8L 2BNUA 5EC2B 4IRJC 1AQKL 2HYMA 1FLRH 3DX6A 3MACL 1MWAH 2IGFH 1DE4B 1RIHL 4M9PA 1DQJB 5EFIA 2BSED 4LU5H 3QIWD 1A0QH 4J3WA 3QUZB 1CICA 2B0SH 4Y5XA 4AZ8A 4NQUA 5FXCH 1NFDE 4PRNA 2AJ3B 3JWDH 4GBXB 1CD9B 1BVZA 2XICA 1SBBA 3O41B 4PJ9B 5L8LB 1J10A 3SDDA 2JIXA 5E8EA 2AJXH 1L7TH 3QEHA 4Q0XL 5FYLL 3ZTNH 3ZKXB 4HWBH 4PJEE 2AK1L 2BOBB 2EE2A 3O11B 1HKLL 1MQKL 4GMTH 1JF1A 8FABB 3WEXB 2CRYA 1KLUB 3DYMA 2YD5A 3SQOL 1FFOA 5J13B 5CCKH 2P43B 1OAQH 4JRYE 3MROB 2BVTA 3ESVF 1OAKH 2V2TB 4NZUH 2GY5A 3L5IA 3UTQA 3DI3B 3ARGD 3M17A 2VC2H 2CJUH 1CXFA 4H8WL 1BBJA 1XGPA 2AQ2A 3BKCL 3IKCB 2NNAA 1E6JL 4G42A 5HHMD 4YGVB 4ELME 4JPWH 3KS0J 3G6AA 1UXSA 4JFOA 1KJ3H 5GS2D 4MX7B 4O5LH 2YD1A 4UBDC 3D0VB 4MQ7B 4XCCH 2ZUUA 4Q6YA 5TFSL 2NY0B 1Z9MA 2CR6A 5HYQA 3MZTA 4PGCB 3S96A 1MLCA 2IPTL 1GZQA 2K3TA 3PQYD 5HYSB 4YHPB 4GQ9L 3TA3C 5D93C 3MLTA 4X4YB 5DHXB 2P8MB 4D3CL 1G7MA 5A3ID 3ULVF 5M94B 4E41B 3O6LL 5E56A 3GIZH 3REWA 2XZZA 2Z4QB 5IMKB 1NKOA 1JIBA 5I8CA 4QGTA 1AQDB 1EHLH 2DD8H 2Z9TA 1ROWA 3VG0L 4XP6H 3VXTA 2ZOLB 3UTTB 1SJXA 5FUCC 5D7LB 2ZCKL 1IQDA 4M1DH 2YA1A 4LLUB 5IKCA 3D18B 3V5HA 4NGHH 4HUKB 5JXAL 1I3RB 4JZOB 4WFHD 5A43C 3UJJH 2ADIB 4N9GA 1LDSA 1VADB 3STZB 4LGRB 5FIEA 1T20A 1AKJA 1T1XA 5CJBA 4LCWB 5F1NA 5T3XL 4WHDA 4MAUL 2AVGA 5HI3C 3EYSH 1NGQH 3PWLB 2VUOA 3W11C 5F6HJ 4IRJD 3ARZA 3VXNA 3D0LB 4KPHH 5FOBB 2DQHH 3D3VE 4XCNA 5DR5H 1ADQH 1TZHB 3PHQA 4PV8B 4WEBH 4PRPE 4EIGB 3G9AB 2DBLL 1J5OL 4PS4H 2XQYK 1SYVA 2AJUH 2ZPKH 3C2SA 4FP8H 3JTSB 3OF6A 3MFFB 5E24E 3DV6B 1XGUB 1IGMH 2XXCB 3AS2A 3D87B 3OHXA 4GUPB 5KVMC 3O0RL 2C5DC 3QNXB 1TDQA 4NDMA 1R5WB 5HHXL 3TJHC 1AGCA 4TSCL 3VWJC 1KELH 3BKML 5DJXB 1FORH 1KJMA 4JQIH 3B2VH 5KSVB 2RIKA 4V2CB 3B4NA 4AMKL 1D5IH 4MLSA 1X4ZA 1MREH 4K3EH 2QQQA 3L3HA 1TQBC 4RZCB 2ICEB 2QR0B 4IS6A 3K4ZA 5AD0B 1WQVT 1L7IH 3ALPA 2Q1EA 4M9OA 5GGVL 4YGAB 2H26B 5BQ7A 5DK0B 2WINA 4KJPC 3U0PA 5C1MB 3QEUB 4U0RC 2DRUA 4OCRL 5IMOB 5HGBA 3OKNA 5ANMB 2CMRL 3Q5YA 2M8XA 3ME0A 4POUB 4L8BB 4WHCA 3KHQA 5GGTL 3MR9B 3BEVB 4HUXB 3GNML 2D31B 1MCIA 4UBDD 3IDJB 3MRPB 4X7SL 5IFHH 3QHFH 5EOQH 3P0VL 1OM3H 4IOIB 4YFLI 1L0QA 4QRUB 4PJ7E 5DZLA 4R90H 1OGAB 1HCVA 1TQBB 1A7PH 4ZMAT 2OL3A 3U6RA 5LGHH 3TO4A 5HTSA 5BO1L 1NBVL 3T4YA 5C70A 3SE3C 1IJ9A 3TA3D 3KPPA 5C0FA 4J3OC 5E5RB 3MQIA 5F7KC 2CK2A 4LHUD 4Q2ZA 1UA6L 5IW3A 1QBAA 2H32B 3BKJL 3BZFA 2DF3A 1A6PA 1X5IA 3JBG7 3QHZH 1AE6H 5DXWA 3U7YL 4K23H 3D9AH 4IEFB 4YE4L 1KCLA 1KN4L 1ZWIB 3QXUA 1VDGA 5F88A 5B8CB 4G8GD 2XQYG 4X5LA 5F71A 3AS0A 4LHJB 1U6AH 3IDXL 4OFPA 1V3JA 4JFED 43CAB 3QWQB 1TVBA 2Z31D 4EUPG 3QDJE 5C08A 3FQUB 3MRRA 2IBZX 3RL1B 1VHPA 4NZTH 4DAGL 4ZSOA 3OKLA 5DTFA 1RK1B 2WBWB 2A77L 3MODL 4HJGA 3GSOB 5I15L 4HAFA 4NOFA 2R8SH 1S7TB 4P9HC 1WAAF 2DDQL 3KPOB 4JE4B 5TE6L 2ESVA 5J57B 3PIQB 2O5ZL 4GW5B 3MXVL 4UINL 1TZIB 3O4LA 3BO8B 4U1JB 3MRLA 1GGUA 4U6TA 1P4LB 1URLA 1OAZL 2A74A 2D7MA 4NWTH 3T0EA 4M5YH 4IIQA 4Z0BH 1MPAH 5KVFH 2BHZA 2E27L 4J1UA 3TZVB 1B4JL 5JUEH 5LCVL 5EU4B 4LSDA 2K1MA 2AJYH 2BJML 3O45B 2PYEA 5F3HB 5K59F 3QIUB 2FBJL 5DHVB 3V4VH 3BP4A 5C07A 5HHQA 4LSTL 3FO0L 1OD9A 2FX8H 4WWKA 5C2BH 2X9WA 4HWUA 4NRYA 2WMPA 3ZTJG 4WO4A 1A6TA 1MHEA 3VWJD 1KPVA 1C7TA 5DJ0A 5DQ9A 2DICA 4PJFB 1IFHH 3O9WD 3UYOD 4JCMA 1WAAA 1ES0A 4K7PY 2VO5A 4JFFB 4F7PA 2B1HL 1M05A 2CUIA 5F9DC 1CE1L 4GG6B 3MRKA 2DQDH 3RPIA 5BJTA 3JXAA 2R2BA 4KJPD 1EJOH 1A1MB 3VI3E 4JO3L 2FL5A 5K9OA 4O2FB 1BZ7A 2BNUB 4GMSH 4LHQB 4XC3H 2HAZA 5C0EA 5F1IB 2DLFL 1CDYA 4NN5C 4ZO8A 1A6AB 2X1WL 5E4IA 5ESAA 3ARWA 4Z6AT 4X83A 4PIRF 5CP3H 3RGVA 4BFIA 4NQED 4WUUD 4TN9A 5I1GL 4NQVA 1KPRA 4G6FD 5ICXA 5ILTH 1CFTA 5TQ0L 5EDXA 3H9HA 4JJHA 1I8KA 1QOKA 3EHBD 4WI5A 1YEJL 3CMOH 5B3JF 2X1PA 4KJWC 1MFNA 1A6WH 4PRNB 2YA0A 4JQVC 4XP9H 3F58H 2JJTC 1YQVH 1MUJB 5EA0H 1HE7A 3SDDB 5I1KL 4PJHB 4X6CE 2AK4A 1DVFA 4P3WA 3VRLE 5EORH 3IDMA 2Y6SC 1XH3B 1NCWL 4P3DA 2UZYB 1S7WA 5DRZA 3VWKC 1XGTA 2G60H 1H3PH 4AL8H 1N0LA 1DN0A 1AJ7L 4KV5F 1AQKH 1F4AA 1A64A 3MACH 3K8LA 1RZKL 4S1SL 3B9DA 1JPTL 4OD3L 3S3PA 4KKCD 4PJ5D 1QA9A 1RIHH 3SJVE 2Z92B 3BIKA 4A6YA 1QFWL 3T0DA 2JJVA 3LY6A 3WL9A 1BX2A 4EUPA 1A1NA 3NIDF 1IEHA 3JWOC 1JNNL 1E4KC 2EZ0D 5EO1A 1RY7B 3VFSA 1PVHA 5IQ9A 1A02N 3DBXB 5K33A 4YNYB 1AIFB 2VDRL 4Q0XH 5FYLH 4DEPB 4O2EB 4KVNL 1CFQA 1U9KA 3P40A 1HKLH 1MQKH 2YEZB 4MJ5A 3SY0A 1NGZB 4M7ZC 4OZHA 4ZOAA 4LBEB 3QUMA 3SQOH 5D1XD 1INQA 2C3WA 5D1QA 2KPNA 3BSZL 4UU9A 3MLTB 5DJYA 1OWRM 5ID1B 2P46B 4GFTB 4H8WH 1SBSL 1NCNA 3BKCH 3IS1X 3O8XC 1E6JH 1NFDF 2DLIA 3REWB 4HKXA 4LNVA 5EZJB 3PP3K 3FFDA 3MNZB 3FCTB 5AYUL 3F65A 3QH3A 4MJIE 4NSKA 2BVPA 3QXDA 1FYHB 3DXAE 3VXTB 3MOQA 5DUPL 3DV4A 3VXRA 2FEEL 4PJEF 3ZSTA 4P57B 5C09E 5TFSH 4G9FE 4RAUA 3V5HB 4EOWL 5GRVL 2IPTH 3G6JE 4PLKD 5JDJA 2DQCL 4RNRA 3E8UL 4MJ4A 4GQ9H 1T20B 1AKJB 3QWRD 1T1XB 5F7NC 2YPLE 2XA3A 2P5ED 3KYMA 2C26A 3O8XB 5C9JA 4D3CH 4RMRA 1Q0YL 2BNRD 4WI6A 3V0WL 2F53D 3BHBA 3OJ2C 3O6LH 3MJ7A 4ELMF 3MUJA 4XI5C 5ALBL 4O58L 4FHBD 1J8HE 4V1DD 3VXNB 4OKVA 2PW1B 4PYGA 4FQHB 2VAAB 5F7MC 5FGBC 2XG4A 3OR6B 3VH8B 3L3IB 2ARJA 1NFDA 3VG0H 3VRJA 2NY4B 3IVKB 2CXGA 4R96A 5E5UB 2ZCKH 5BW7C 4O9HH 5EIQA 1V05A 3DNKA 1V8HA 2HH0L 4QNPE 3OB8A 3I6KA 1V5JA 5JXAH 1VFBA 4J4PC 4QOKE 5IEKB 1RQ5A 3KYNB 3LVEA 1Q9LA 3CMGA 5CSZA 4X8JA 4U1MA 1CFNB 4OF6A 4HUWB 1AGCB 5J89A 3QNZB 1A9BB 3BYYA 1KJMB 3DTXA 2Y6SD 5T3XH 4MAUH 4JRYA 4L8CA 3E2HC 1X5YA 3VWKD 1WTLA 1J0ZA 3JTTA 1YPZA 1DBMH 2H45A 3SN6N 2DI8A 2P1YA 2EE6A 1U91B 4I9WE 1KGCE 3DO7A 2OSLA 3QO0A 3O3BA 4H1LH 4AEHL 1UJ3A 3PGCA 4WI4A 4ELMA 4F8TA 2VKWA 2WINB 5GRVK 1J18A 3WO3B 1LK3L 2EDTA 4KHXL 2DBLH 1J5OH 4KTEL 5E7FA 4MNGB 3WLWC 3UAJC 3RY6C 4OGYL 3AVEA 3O0RH 1I3UA 2E9WA 1TETL 5DS8A 1YJDC 2AJZA 5HHXH 1Q9OA 3E2HB 4XAKE 1KEML 4CNIB 4N0CC 4TSCH 4Y1AD 5EIIB 3WSQL 3BKMH 2YWZA 2J12B 1WC7A 2COQA 2OL3B 2DQGL 3UTZB 4AMKH 3BRGC 4P2QB 3T4YB 1ACYL 3KPPB 5HPMB 5C0FB 2APWA 2XN9D 2NTFB 1D3CA 1U8IA 1WFOA 4P3CL 4JFHD 4PREB 4Q2ZB 4QWWD 5F70A 1B0RA 3M1BA 4NN6B 4FTVE 4OCRH 1KB5B 2CMRH 2DN7A 3CZFA 5FO9A 5GGTH 1YNKL 5F88B 2BVQB 5CEXA 1QSVA 4YHNA 2ZCHL 1GHFL 3BI9X 3GNMH 4JFPB 4N1EA 4X7SH 2GTZB 3E6FB 1OF2B 3P0VH 4U7SA 1U8JB 2QADB 1R5IA 4QHUA 3IFOA 3OKLB 4LIQE 2D7NA 1KNOB 2FNBA 4M1CC 5FEBA 1NQBA 1N5AA 1WIOA 3KPSE 5BO1H 4KVCL 1FNSL 1NBVH 2J8UA 2BSSA 2E7LC 3K74B 4Y2DA 4MNQD 2ESVB 3MC0A 4U1KA 5I8EA 4WRLA 3VFVA 3BDXA 2VOTA 3BKJH 5IFAL 4U7MA 3PL6D 5ACLA 1YA5A 4NT6B 3MRLB 1PGRB 4JRXA 3U7YH 2X4SB 4YE4H 2A74B 1BD2B 1KN4H 2D7PA 4PRPA 1RURL 1JN6B 3MRMA 1HDMA 3IDXH 4JREC 3QPXL 1FDLL 2Y06H 4Y4KC 4PJ7F 1S7XA 1ZHBB 1BWWA 2A83B 4DAGH 3ARFA 1G7JB 1I1YA 1U2HA 1P1ZB 3GSXB 2NQCA 2P5WD 4RMQA 4J4PD 2A77H 3MODH 1F13A 1JWUA 4WWKB 5I15H 4BZ2L 4WO4B 2DDQH 4EVNA 4OIAA 3OKKA 1MHEB 5TE6H 3ULUE 4YDIL 5DQ9B 3HR5A 3O2WL 4ZS6C 1BZ9B 3PWUB 3OGCA 5I1DA 4OZFA 5EO9A 2O5ZH 4HZAA 4UINH 1Q9KA 4UV7L 4H8WC 3P4NA 4R4FL 3ZHDA 4O2CA 4JREB 2OMNA 3ARBC 5ADOL 3GEWB 2PETA 1XGYL 3C60D 4Y4KB 5L8KB 2E27H 1AP2A 2R2BB 1B4JH 4DFIA 5E9DA 3CX2A 5LCVH 4I8DA 2BJMH 4ZPTA 4BH8B 2M26A 4JDTL 4U1HA 3WLWD 4R7DA 1PD6A 1MHPL 5BMFL 2FBJH 2RR3A 1LO5A 1Y6MR 3ARQA 5FV1L 1A7BA 1KCKA 3RGVB 3FO0H 4PJBB 3BD3A 4GOSA 4NQVB 1KPRB 4PJ7A 1CFTB 5IW6B 4Y16A 5CILH 1SJEB 3Q6FA 3IAPA 4N0CD 3CXDL 3H2WA 3QUXA 3IJSA 3SGJA 1JV5B 1F3RB 3G5VA 1VENA 4PD4K 2AQ3A 4KH2A 2EO1A 5DD6B 3ARBB 1R5VA 4LLVA 5KSAC 2B1HH 4MDIB 1Y6KR 2WV3A 1S9XA 3KJ4C 1DVFB 4LVEA 1IGJB 1CE1H 2X70B 2OTWB 5EU7E 4XZUA 3S37X 5FUOL 5IB2B 1S7WB 1XFPA 4RGMC 4TUOB 1ZHLB 1GYAA 4JO3H 4OGAD 2X05A 1DN0B 2NR6C 1TCRA 3QXWA 2DLFH 2E3VA 2GQHA 3VXOA 3RWGA 1QA9B 4NYLB 1QO3A 4NKOB 1DQML 5I1GH 2JTDA 5EZIL 5TQ0H 4RMSA 1FH5L 1ZTXL 2E6PA 1BX2B 3KPMA 1YEJH 4L5FL 4EUPB 1UXWA 1JF6A 2H3NA 3LKSA 1I3GL 3MOAL 4M1CD 4ZTOL 4LDOB 2R2EB 5KSAB 2A6DA 2DM2A 5F96L 3S9DB 5F1OB 1AC6A 1WVZA 3KJ4B 3VFSB 4TTDD 4FA8A 5J56B 2HMIC 5IQ9B 5CGYC 5I1KH 5T1LD 2R15A 5C0CE 3QDMD 4RGMB 1BM3L 5KANG 5L7XL 4WFGD 2V5SA 1QFPA 1CFQB 2BSRA 2BK8A 3C6LA 1NCWH 3VI3F 2EYTA 5CWSB 4B0MM 3QUMB 1UJTA 4QT5B 4RFNC 5D5ME 1AJ7H 3TNMB 2B4CC 5LGJA 1R3IL 3CLEL 5GS1C 1HQ4B 1Z5LA 1RZKH 4S1SH 1JPTH 4OD3H 5CEZE 3WN5A 1EHXA 2E8YA 3SPVA 3TVMD 1X5FA 3QCUL 4XBPB 1JZ6A 4N8PA 1QFWH 3BOVA 5FYJE 3FMGL 2GK0A 3NIGE 5FYLD 1FLTX 4LP5A 3LDBC 4Q58C 4YJZL 4CJ1A 1JNNH 2Q76A 5IESL 4NSKB 2BVPB 4KUCD 1JWSA 5J1SC 4LAQL 3VXRB 4X6CF 2X4TA 2EEDA 3VRLF 2VDRH 1FNEA 4DKEL 2VABA 2VDML 4KVNH 1ZLUK 1F6LL 1QSFD 4HWZA 1G7QB 4RFNB 2FEEI 4D9RE 3HE7C 4CVZA 5GS1B 5JLZA 1DP0A 5J6GA 3MYJA 3DMMC 3BSZH 3S4SG 3JSSA 4D94A 2BXYA 1QNZL 5T1KD 3BHBB 1SBSH 3QG6B 1NDMB 1KJVB 1G7LB 5HGGS 1JVKA 3CFJB 3BW9B 5FK9A 4HX1A 2IJ0C 4JEGB 5AYUH 1FG9C 4LVOC 1NAML 3QEQD 2R0ZL 2ARJB 1NFDB 5I1LA 1WK0A 5DUPH 4R96B 4F33B 4NC1E 4NQDE 1A14L 1GOGA 3I6KB 4YHYC 5ID0B 4AQOA 1VFBB 1T04A 1S7SB 4EOWH 3DMMB 2ERJC 4PJEB 1Q9LB 2V5YA 3HPJB 4NNYB 5KS9A 1VERA 2DQCH 3E8UH 1M7DB 3LRGA 3W5MA 3DTXB 5BOZG 4L8CB 2GJ6E 4PJCE 1Q0YH 3V0WH 2O93L 1IZKA 5ALBH 2UVEA 4O58H 3SJVA 4XPHL 5BCAA 3OKEA 1JPFA 3TC9A 5I1HH 3O3BB 3DIFA 1YMME 3IXAA 4JDZB 1UJ3B 4ELMB 1H9VA 3PNWA 2ADJA 3RPKA 1K6QL 1MCNA 4YHYB 2H2PD 3I75A 4FG6C 1MHCB 1Z6JT 1VCAA 5C2UB 5T3XD 3G6JF 2VZOA 4WV1A 1R24A 1FC2D 2NX5E 3L3DB 5CGYD 1PAMA 1K5NA 3GSNA 2X6MA 5D2NC 2AJZB 3J7HA 3W0WE 4K7FB 4S11A 1WC7B 1CIUA 2HLFC 4LSUL 3PDGA 2X4RA 3MV9D 4D0CA 3X12A 3FT2B 1KEGL 2X9YA 4K2UL 5H94B 2Z8WC 4R7NA 4NQTA 2YPVL 1MAKA 4G6AC 3PWPB 5LQBH 4N0RA 2A73B 4AEHH 1U8IB 1F3JA 5DMGC 1JPSL 2GITB 1CDGA 1B0RB 1NBZA 3DX9B 4Y2OA 1LK3H 1O5DT 4KHXH 4NO0D 1ZLVH 3S8WA 1JGDA 2LTQC 4KTEH 1JWMA 1JZ5A 4QRSA 2P44B 4ONHA 4QNPF 5EBGA 4MJIA 1VFMA 5IM7A 2G9HB 4OGYH 5CEXB 3RX5A 5D2NB 1ZA3A 3F7RA 1A4JB 4PJAE 2OZ4A 1TETH 4G9FA 3L7FB 5C0BD 1IVLA 2WBJC 3QWOA 1KEMH 3G6JA 3WSQH 2AABH 4K9EL 1RHFA 3K2UL 3ARUA 1U8LB 3LB6C 1ZS8A 2BC4A 2DQGH 3HE7D 3RVTD 4YR6A 4ZQKA 3WHXA 2XNAB 1DCLA 4LMQI 1ACYH 1TVHA 2DI9A 1DN2A 4WNQB 3S4SA 3WNKA 4P3CH 3PHSA 1J8HA 2YOCA 3SGKC 4FMKA 3D3VB 3ARDD 4KKBC 1J1OL 2YXMA 3T2PA 4EN3C 5GHWL 3UTSD 1N4XL 4PRPB 1YNKH 1IM3A 4XGZA 4POZD 3IF1B 4I4WA 3FAXA 5DRWA 2YSSA 1GHFH 2ZCHH 2WBJB 1U41A 3DURB 1LQSR 2LQRA 7CGTA 4QOKA 2DYPB 5JHDA 3HZYB 1LO2L 3F7PC 3GMMB 5GRWA 4GS7C 2IMNA 1WV7T 4CU6A 3GMNA 2H2SC 4W6XB 1A1OA 2FH6A 4KVCH 1QZ1A 5DZNA 4ZOCA 3CX5K 5HY9A 1T66C 4AIOA 4G43B 4EVNB 4X6DE 2ED8A 4KQ4L 1CD1A 1TMCB 3MCLL 4OLEA 4HKBB 1RZKC 5TDPA 5EO9B 2AXGA 5IJKC 3KXFE 3VFUB 4B7IA 4EN3B 5IFAH 1Q9KB 3CU1A 4WI8A 5E95B 1XF2A 3EUUA 3MBEA 3P4NB 3S36X 1CE6B 4O2CB 3KPRB 4MCYB 4LEOA 3RWCB 5MEPA 1X44A 3QJHB 3FQXA 4G7VL 5F8RC 5HHOE 1JF5A 1MFAL 3CDYA 1BMGA 1QSZA 5J3HC 4GS7B 2EDYA 1FDLH 3QPXH 2VXSL 3PHOA 4FQIL 3V6BR 2FECL 4ZPTB 2DQTL 1JHLL 3QEGL 4Z7OE 5HGDA 3DYPA 1R3LA 4BK4A 2C7UA 5EOTA 4R97B 1CVRA 4PJ7B 3MV8A 3ARED 1SVCP 1FN4B 4QRPD 1KB9J 2EDJA 1JE6A 4BZ2H 4L4TE 5D96C 4ZUUA 3O6ML 3Q6FB 3B9AA 1T7WA 1KN2L 1NGXA 4YDIH 2DLGA 3QUXB 1MJ8L 2VXTH 1LHZA 1XF5B 3O2WH 5A2IH 3GUTB 4K7PX 5EU6E 3WIIH 3IRZA 2HN7A 3NN8B 1CTNA 4UV7H 4G6AD 4LLVB 3QI9A 2EKSB 2DKUA 4MZ2A 1FP5A 1ZANL 4G6JL 4R4FH 4UAOC 2VE6A 3PDOB 1SM3L 5ADOH 1U95B 2EECA 4FTVA 2ZNWA 1XGYH 4CVXA 1OQXA 3HC0A 5HHVL 1J0HA 2RQ8A 1HH9A 4JDTH 3D1MC 5BMFH 1MHPH 3VGBA 1S8DA 4LKXA 5D96B 3QDJB 4OZGB 5CMAA 4GJTB 4F37K 1SMAA 4I3RL 1G0XA 3ULUF 5FM8A 2PYFA 4ZUVB 3KPMB 4KKNA 3T2QA 3ZDXE 1UXWB 1TVDA 3LKSB 3KPSA 2H3NB 4BH7B 2HT2D 2EC8A 3ES6B 2D0GA 3LB6D 4UI2A 3R4DA 3V7AE 4HS8L 2RHEA 4QEGA 2J1KA 2BOCB 5BZWB 5IGXL 4Y5YA 4G80A 1BJ8A 1WWCA 5FUOH 3CD4A 4S0TD 1MCHA 4NKDA 5IV2B 2HRPL 3WUWA 2X41A 5ICYA 4QTHB 4KC3B 3O3EA 4X7TA 5LGJB 4HJ0C 2H41A 2IPUK 1NC4D 1Z5LB 5ISZD 1ZGLP 4N5EC 3WN5B 2E9JA 2IADB 5CJ5A 2ZUYA 1DQMH 5E8OA 3SPVB 2ZUXA 3BN9D 5EZIH 1JUFA 5C0AA 1FH5H 1ZTXH 1BLNB 5DEGA 4L5FH 1T1WB 4S1DD 4LKCB 1I3GH 1H8SA 3MOAH 4ZTOH 4MVBD 1D9KD 2FHCA 5F96H 3HZMA 2Q76B 4PJXB 4HIXL 5EZLA 1OB1B 2VQUA 4HHAA 1UM4L 1AO7E 2X4TB 4JHWL 1FV1B 4DZBB 1NLBL 5D6DC 3KLHC 1BM3H 1ZVHA 4HIIB 1I7UA 2MKLC 5L7XH 5BVJA 1BEYH 1HNFA 1S7UB 5FO7A 5CGMA 2HP4A 4ZUSA 2Y36L 1D6EA 4CVZB 4PLOB 5JLZB 5JR1L 2OR9H 5J6GB 3HCVA 2GJJA 1IC1A 4LRIC 4YLQT 1R3IH 3CLEH 3BPNC 4NUJB 3B9KD 3EO1A 3PGDA 5IG7A 4M6AA 5GQBA 4W6YB 3QCUH 4Y4FC 4P2RD 1XGQA 4BFBD 3FMGH 2J2ZA 2A6KA 1ZE3C 5I19L 5MEND 3RZWA 3QULB 3QR2A 4KRLB 3DSNA 4XHJC 3SDXE 1WT5A 2ATPA 5CIPH 3GGWB 1VFAA 4I0PD 2OTUA 5FKAB 3KYOA 4LAQH 4EI6A 3H9YA 3TIDA 1OAXL 4DKEH 1FIEA 4JHBA 2VDMH 4DZ8A 2YMXL 2J8OA 1S9VA 3Q5OA 2AXJA 4X6CB 5IVZA 2ADGB 3BPNB 2PN5A 5D5MF 4CDHA 5JPNB 3IFNL 4HT1L 1XF4A 1WSST 2XFXB 4Y4FB 1Q9WA 1QNZH 4LCWD 2NXZC 1KBGL 5KW9L 1IRAY 5E00B 1BFOA 3CPLA 2IPUG 4I48B 5ERWA 4W4OA 3NIGF 4J23A 3MRBA 3SJVB 1IGTB 5LBSL 4F9PC 5FKPB 1YN7A 3DIFB 4QHNB 3IXAB 5E2TL 2JB5L 1NAMH 3L3GA 5E03A 3GMLA 2R0ZH 3V8OA 1T80A 1LDPL 3P77A 4X7EC 4BQBA 4JFXA 3GMPA 3DYOA 4HC1L 3MLPA 3I75B 3HC3L 1A14H 1JHKL 4YC2C 5AG8A 5ELIA 5C0CA 1QPPA 1R24B 1T0MA 2I60L 3GSNB 3IJYA 2NXZB 3KGRA 2DJSA 3HB3D 2PTTB 3RZCD 1JPST 3C6SA 4PRHE 5BOPA 4P5TA 2JF1A 5CEYA 1S9YA 5D5MA 2WUCL 1XGRB 4R7NB 3AUVA 3MRFB 4TSAL 2W59A 1RSFA 2R1YA 4HGWB 3DROB 1I9RL 1W0VA 4XPHH 4HJ0D 5AAWA 3CZJA 4X4ME 5DYOA 4N5ED 3RVXC 2W0FB 1F3JB 4M93B 3QXAB 4F37F 1NBZB 1BJ1H 2VXQL 5CGTA 1KIPA 3UYPA 3S34L 4Y88A 1U8HB 1K6QH 4YC2B 4FXGA 3MRHA 3IJHA 1JWMB 4QRSB 3FFCD 4ONHB 1J7VR 5JW5B 1WUNT 4MJIB 5IM7B 3DXAB 5E5MA 4D8PA 4F9LA 1ZA3B 2CKBL 3K1DA 5C09B 3VGAC 4H25A 3FHAA 4LASL 5I8OL 2EDQA 2VH5L 3G6JB 1RJLA 4S0SD 2W65A 5E8DL 5IW1B 4PJCF 4LSUH 1WGOA 1KEGH 2D9CA 4YFEA 2P8PB 2VISA 4F7TA 4K2UH 4YR6B 2YPLB 4HH9A 4BZYA 2Y7QA 2YPVH 2BVEA 5C6WH 4P46C 4WGWB 1J0IA 1MHHA 3QSKB 3S4SB 3MLSL 3H9SE 1JPSH 1SJHB 4UDTA 2UY6A 1SEQL 1H15A 4HGKC 5E0QA 1UB6A 5EWIL 5HYJA 4ODWA 2X5PA 4NNPL 4PD4J 1P9MC 1RZGB 4WUKL 4XHJD 3TNNA 1IM3B 1X5AA 4Z95L 3C5ZA 5DRWB 4BKLA 2YSSB 5GISL 1JYXA 3C8DA 5ETUA 4NQDA 2O61B 1I1FB 4TVPE 4NQCD 4U0QB 5D7KE 1IL1A 1KCUL 3FJTA 3EDDA 3BZEA 4APQA 2Y5EA 4K9EH 1G7IA 4IOFD 3K2UH 4H26B 3T1WA 4P46B 3UPAA 1A4KA 3TN0D 3GHEL 5INCA 2YRLA 3LMJL 5JO5B 1A1OB 3QISA 3K46A 5HY9B 1IMHC 2GAZB 3K80A 1NDGB 1C16A 5FA3B 4X9IA 1F4HA 3VFNA 5SWZD 43C9A 5TDPB 2AXGB 4EDWL 2HWZL 3BIBX 3RHWK 1J1OH 4UOW0 1YMMA 1WFNA 4LEOB 5GHWH 4JLRA 3FQXB 1N4XH 4P23C 4D0DB 4L8SC 4L3ED 1QRNE 4PJAF 4UTBL 2EE3A 1UEYA 1G7HA 4HK3N 2V5TA 3PHOB 3LKPA 2VZUA 1DANU 2NX5A 3NCJL 5HGDB 1LO2H 3VCLA 3WDIA 3MGTA 5FOJA 2FWOB 4X7DC 5EULV 4XTRD 3W0WA 3VXUD 3V5DB 2X4PA 4YXLL 1UG9A 4BUHA 5IOPB 3IAGC 1NGXB 4KQ4H 2L7JA 4QRRE 4JFZL 3MCLH 3KDMB 4X4XA 3VMNA 2QQLL 4N0YH 3ZE0E 4LCUB 4P23B 4L8SB 1HNGA 3H0TB 3QI9B 4C4KT 1MIEL 4UB0L 1A6ZA 4R3SA 3RVXD 5FFLA 2IG2L 4G7VH 4FTVB 3MLUL 5JIIA 3X13B 4KI5D 4KAQL 1MFAH 2F54B 2ITDB 2VXSH 4FQIH 1JHLH 3GSWB 3QEGH 4P2YA 4PJAA 2YD4A 3MJ8A 1S8DB 4Z76A 1MQ8A 4YDKL 3U36A 4X6FA 5DJZA 3IAQA 4PRIE 1X7QB 4JFDA 4X6DF 1CICD 3O6MH 2QHLA 1CS6A 3V7AG 4HS3A 3VFWA 3KPSB 1KN2H 3W2DL 1WWBX 4WU7A 1MJ8H 4PGJA 3H7LA 2HJKB 4JM2C 5F72S 3QQ9C 1LEIA 4HLJA 4A6YH 1WF5A 5CIPB 1ZANH 4G6JH 4JVWA 3ULUC 1I8LA 2JIXD 3DJ9A 4YAQA 1SM3H 1U58A 4Y5YB 5JW4M 4G80B 5L6YL 4U3HA 1Z9OA 4NP4L 3D25A 5DRXA 1C12A 5DUBB 4NKDB 4KK5D 2NLJB 4Z7OF 5ICYB 5HHVH 1JFQL 1QLRA 3WIFB 4G6KL 1IAKA 1T21A 3ISWA 2VDPL 2IAND 2Q3ZA 1Y6NR 5D7JA 5SX5K 2KH2B 3P9WB 3LPGA 2NY2C 1VEOA 4I3RH 2GSGB 1N2RB 5EOCL 3REVA 4JM2B 3QQ3B 3QDGE 1JL8A 5C71A 1HHHB 3ZSSA 1KIRA 3F5WA 3HZMB 1JCKA 2LU3A 3P3YA 5CKGA 4AY0A 2IPKB 4HS8H 3IDNA 4XPTL 3KXFA 3P0YL 5K93A 5IGXH 4OF7A 2HFTA 1RUQL 3LKRA 5BVJB 1AGBB 4U7KA 3CFEA 3QZWG 4C56E 2PF6A 2BZDA 1D6EB 1NJ9A 2HRPH 1UWEL 1T83C 3TO4C 4CADB 3HCVB 3QFJE 3F6LA 1MI5A 1A2YB 2GTWA 3EO1B 4LLMB 4MZ3A 1B90A 4YFDB 3VGEA 1LD9A 3ZDXF 3CFBA 5GSVB 3WFCL 4HLZH 5HHPB 3DUSB 1R3HB 5AAMA 3T8XA 4TQEL 1VFOA 2ATPB 4OZ4B 1MCQA 1E0OB 4L4TA 2WSKA 4L8DA 3OJVC 5HDQL 4HIXH 3UJIH 2F8VA 5H37H 1TENA 1QLFA 1UM4H 2WIIA 4JHWH 1NLBH 1L6XA 2NY7L 1QFOA 5ESVB 3B83A 4NNXB 5DMYA 2EDXA 5IVZB 3T0VA 1RUPL 2Y36H 2QKIA 2C4FU 4UQ3A 3RHWF 5JR1H 1YUHB 4MMZC 3OMZA 4R0LC 2EXYD 4GSDL 4RGNE 5K9KA 2J3SA 3STBA 5T3ZE 3CPLB 1DLHA 1FZJB 3Q1SL 3QFDA 3MRBB 5I19H 4G7YL 4LSQL 5SWSE 3PV7A 5TF1L 2OLDA 2C3GA 2WW8A 4RAVB 2EIEA 3TEUA 4DUWA 1QPXA 4AEIL 3QPQD 5L8JB 3P77B 2XKUA 1F8TL 2MKWA 4XXCC 1DQDL 1P7QA 1RJYB 1OAXH 1X3DA 2VDQL 3FQWA 1LEGB 1R3KA 1MVUB 2EEAA 3G08A 1CVSC 4PB9L 4QF1B 2X4NA 2YMXH 4OKDA 2DQJL 3VGHA 5GSRA 1FVCA 3MV7E 4EZMA 3I6GA 3IJYB 5E2JA 2EIBA 1DSFL 3IFNH 4L29A 4HT1H 4MHHG 3KLDA 1I1AA 2ZG2A 5ENWA 3C6SB 5IP4A 5IF0A 2GCYA 3NTCL 1KBGH 5KW9H 4HK3J 5D5MB 3NBNA 4U2ZA 4YPJA 1BFVL 2OZ4L 2PW2A 1RZJL 4YBHA 4G8EA 1C08A 3V9FA 1T1ZA 4MSWA 5LBSH 3SDXF 4YHZL 1NGPL 3DSFL 1XEDA 4ODSL 5DWUL 2EDRA 1F45A 4RFOL 5E2TH 2JB5H 2NY2D 2L7UA 3CX5J 3FOLA 1WBZB 1MCSA 1LDPH 3PQYE 2JCCA 4FXGB 3NA9L 1UT9A 4LNRA 4HC1H 4AM0B 3A6CL 3L5XL 3HC3H 1JHKH 5E5MB 4N0FA 3EFDH 1FHGA 4TOYL 4F7CB 1DQTA 1VKXA 2E8ZA 3AM8A 3HI1A 2EXWD 2I60H 4K3DL 3FO1A 4L9LA 3KVQA 3GSVA 1RJLB 3H9ZA 3MA7A 3VI4E 2CUHA 2W65B 3EJZC 2CH8A 4FQXC 4C83B 4P4KC 2WUCH 4F7TB 1T22A 3TO4D 4TSAH 2GK2A 4KGLA 1OL0A 3RWDB 1BWMA 4RQQB 5C3LD 2VSCA 1MAJA 1UWXH 3CVHB 2RJMA 4N68A 1MY5A 2VXQH 5KVEL 5EG6C 3RIFF 3S34H 3SDXA 1KJ2B 1S5HA 3OPZL 1EHAA 2J6EA 3DVNA 3DRQB 5E6ZA 4ZUWA 4AEEA 1T89A 1HKFA 3VRIA 4IOSD 2EDWA 4AIZA 5H8DA 5I73C 2CKBH 4KKAC 1GH7A 4YHML 4PBVC 1YYML 2AV1A 4NQDB 3BAEL 3M07A 4ONGL 1IL1B 4LASH 5I8OH 4FQXB 4OM0L 4P4KB 2VH5H 2C1PB 3BZEB 5C08D 1C5BL 3WJJA 5E8DH 5BS0B 3B3IA 1YEHL 3GBNL 4JJ5B 3CFKA 1CIDA 4NWUL 3PJSB 1I7TA 1AY1L 1QR4A 3TESA 4XH2A 1CGTA 2XWTB 4CU7A 2Q8BL 2GJ6B 2DQUL 4PJCB 4XMLL 3MLSH 43C9B 4LGSB 4OZIE 3LV3A 1SEQH 5F7DA 3O4LD 1YMMB 3AY4C 1S7RB 2DKSA 5EWIH 2ICWB 2LE9A 2NTSP 4NNPH 5I73B 4WUKH 3T09A 3T0ED 3SDCA 4Z95H 3P9MA 4U3XA 5GISH 4XVUC 4OZFH 1T2JA 4HKJA 4ZUTB 4X6BA 3IETB 4DUXA 1KCUH 2PXYC 1C5DA 1U2CA 2NX5B 1OOAA 1NBQA 2PYED 1NFIB 3MGTB 4XX1E 4OAWA 5C07D 1XAUA 1OTSC 3LMJH 4PRHA 3FQTA 4WWKD 5EU3A 1JZ7A 5IHUL 2VIRB 5JXEC 2ICWJ 1B6DA 3B5HA 1CD0A 1S7VA 4Y8AA 3EYQD 3S7GA 4X4XB 4EDWH 2HWZH 4X4MA 3WS3A 5JZ7D 5IQ7L 3RL2A 1A6ZB 4NJAL 4WTXA 1BVLA 3T04D 3D85A 4L3CA 2BERA 2V7HA 3LD8C 4UTBH 3UTTE 3HNVL 1IKNC 1N7ML 4ZS7L 1IEBA 5C0DA 3W9DB 4DGYL 4ETYA 5SX4I 1ZGLB 2VLLA 4IMKA 5LG1A 3NCJH 3MJ8B 3EAKA 4HPYL 4LEXL 3GI8L 12E8H 3U36B 2DWEA 2EDDA 1V7NL 3MZGB 4YXLH 3K3QA 2G75A 1HSAA 2FO4B 4WU7B 4JFZH 1F4XL 2X4QA 2Z91A 4G8GE 3ETBF 2QQLH 5GGRY 1CGVA 5H2BB 4AQ1B 4E42A 2H8PB 4QXUL 1U3HA 1JGEB 1T0NA 3G9VA 3UPRA 4JFEE 3QA3B 1MIEH 4UB0H 4I18C 4KK9D 5FUCE 1QFUL 2CR3A 4NQSB 1U58B 3FKUS 2AK4D 2IG2H 3MRNB 1BVKA 3MLUH 1BF2A 3RX7A 5I6XB 4E5XB 4KAQH 1T5WB 4H20L 4UNUA 3AU1A 3HS0B 3BD5A 3O6FC 3HPLA 3U4EA 4IJ3B 1IAKB 3OJMB 3SGEI 3GJFK 2HG5A 3V4UL 5FYJU 3P30L 4YDKH 2Y23A 4MD4A 1IM9B 2VYRE 3C08L 2EYRA 2IAMC 4FXKA 5B22A 3W2DH 4HDIA 4B5EA 4YBQD 1KIRB 1UQSA 3BPOC 3FB7B 3ZE0F 4I18B 4JO4L 4Y19D 4X6DB 2Q7YA 4X98A 1IGCL 2AEQL 2WLZA 1RUKL 2R0KL 3OZ9L 2R23A 4F57L 1NEUA 4QCIA 1K8DB 1T5XA 4IMLA 3LKRB 3O6FB 5L6YH 2DKMA 4ZAKA 4NP4H 3U2SA 5HHOB 3VJ6B 3CSYA 1U8KA 1QRNA 1UB5A 1JFQH 1T1YB 1WIPA 4G6KH 2VDPH 3MRQB 3OAYH 1TPXC 5D1QD 3QB7C 5EU5A 2VL5A 4XVUD 4Z77A 4ODXA 1CYGA 2IAMB 3BWUC 1PZ5B 1UEMA 4NRXA 3RY5A 4PLJC 2PXYD 3BPOB 5EUKB 5EOCH 3CDGA 4PB0L 3QHTC 4JPIB 1FC1A 2VWEC 2DIBA 3CSPA 4AG4L 4XP5L 4G5ZL 3DRTB 2MHAB 4Q6IA 4XPTH 5EU6B 7FABL 2WIIB 4TTGA 5A2LH 3NZ8A 3P0YH 1IKFL 5JQHC 3HE6C 4R8WL 1RUQH 4Z7VE 2Z0BA 3UC0L 3QUYC 4GKZA 4NQEE 4WUUE 2JK5A 1TPXB 3FQRA 5F9WC 5GS0C 5DJ2A 5F9JB 5D9SA 1UWEH 3I6LD 3EYVA 4HBQA 3Q3GA 3MUY1 5K9KB 1HN1A 2GHWB 2V17L 5KG9B 1P84K 4X6EB 1NCDL 2YKLL 3V6OE 3ARSA 5D7SL 1FGVL 5B38G 4JQXA 3WFCH 4PRIA 5MEOA 1RZ7L 3GFUA 4U05A 3ZDZE 1CGWA 1VEMA 3OR7A 5HPOA 4JFYB 4KJYA 5HDQH 3ROOA 2NY5C 5DD5L 3HE6B 4LSVL 1U3ZA 2XY1A 3QUYB 1I7RB 5KANI 2NY7H 3V4PL 5F9WB 5LAXA 4PRAA 3FQWB 1CQYA 4FABL 2X4NB 1PSKL 4PJ5E 4WDIB 3SDAC 1RUPH 1FVCB 1FBIL 3BVNB 4BK5A 2UUDH 1CL7I 4YWGL 1RV6X 5ENWB 4GSDH 3O3AA 5FCSH 1U8NB 1EFXA 4IRSA 5IF0B 3TBTB 1RHHA 5FM5M 4JRYD 2PW2B 1A3QA 1HYSC 4G8EB 1WITA 3Q1SH 1C08B 1EJ6A 4G7YH 4U6YA 4LSQH 4EI5C 5L2KA 1HSBB 5TF1H 3K7UA 2YRPA 4BSWA 2YZ1A 4AEIH 3RNKB 4J2XA 2YD7A 4PJFE 3WJLC 5DRNA 1F8TH 3HNTL 1V7ML 1DQDH 1W72L 2HTLC 5IBTL 3SDAB 2VDQH 5FV2A 3EJYD 2IEPA 1CL7H 1REIA 5MI0C 5E70A 4KK6C 4OCNC 1AO7B 4PB9H 2DQJH 3NCEB 2PTUA 1VKXB 1DL7L 1BOGA 4GG6E 3HI1B 1J05A 4K94C 4P5MA 1DSFH 3LQZA 3NH7L 5E1HB 4Q9RL 4XWGL 4C56A 3GSVB 3MA7B 2KZWA 1FJ1A 1Z0NA 3P9LA 5GGRA 3NTCH 4MXQD 5IROA 4EI5B 4JPVL 3QZWB 1BFVH 2OZ4H 1RZJH 2MCPH 5ESQB 4YHZH 5EUOE 3UPCA 1NGPH 5FB8A 3DSFH 5C0GB 4ODSH 3DVFA 4ZODA 5DWUH 1QSED 2K9UA 4NHUA 2ZSWA 4RFOH 3CC5B 5GZNC 2VDOL 3BGMA 5IK3B 3SDXB 3BPCA 5MI0B 3U46B 2ZP0T 3NA9H 1HCFX 3A6CH 1HQRB 3L5XH 4U1IB 3TT1L 2D4DA 2VLKB 2DMKA 5DEFB 3TBVB 2GT9A 1JP5A 2HT4C 2P5EE 3WXVL 2APTA 4TOYH 4MAYA 2YD6A 4AIZB 2BNRE 1GL4B 4HFUL 2CQVA 1LWRA 4LCCC 4HG4K 4XVJL 3SGDH 4K3DH 4G3YL 3VXSA 4M4RA 4V1DE 4W81A 2Q87A 4B7LA 3C9NA 4ONOA 1FAIL 4J3TA 3B3IB 4NQXA 5FECA 1L6ZA 2F74A 5EBLA 3HMWL 5JOFA 5AZEL 4XH2B 1BQLL 4M7JL 1OW0A 3KPNA 4Y2DD 1DBAL 3EKCA 5E8PB 3RTQC 1MRFL 4A2LA 3TBSB 5KVEH 5SWSA 1LE5A 5E94B 1OARL 3VU2A 1NANH 4OLYL 2APVA 4JRXD 1BIHA 3OPZH 3PXHA 1BQSA 5IVNA 3JV6B 3Q6GL 3W9EA 4LCCB 3P9MB 3LN5B 4QHKI 1G1CA 5HYSG 4YHMH 3JWNC 4XX1G 4P2OC 1YYMH 3BAEH 3VXMA 3KLAA 2NY1B 1E27A 3VI4F 1AGEB 4ONGH 1D5MB 5BXFA 4OM0H 1EO5A 3NFNB 1C5BH 3MV7A 1CDBA 3V0VB 3ARFD 5IVOA 1YEHH 3GBNH 4OAWB 4CW1B 4NWUH 2YWYA 1FNGA 4KRPC 3RTQB 1AY1H 4PRHB 4XNXL 4NHCL 4LCYB 5EU3B 4WIQA 2I9LB 2Q8BH 2DQUH 1OP3K 3WLBA 4XMLH 1FZKB 4E0RA 3IYLW 3OV6A 3SKOA 3NAAL 3HG1A 1CDUA 2ZUWA 2X42A 3OB0H 3SKNA 1KSRA 5TH2A 3BGFC 2X4OB 3LKNB 3CJJA 2VDKL 4P2OB 4Y1AE 4XNZC 5IEHA 2JJSC 2MTPA 3UBXA 2G5RA 5C8JA 1PW3A 2EICA 3B2UD 5C0DB 5E9DD 3IKKA 4LHUG 1HWHB 1G9ML 3QBTB 1YEDA 1EEQA 1O0VA 1RK0A 4KRPB 1ZA6B 3BX7C 4ODTL 4KK6D 2JB6A 4GMTL 4MQXD 4JFHE 1ED3B 5CJOL 2UY7A 4Y16D 5IHUH 2G75B 1JNLL 1N64H 5HI4C 4LDLB 5I16A 4OZIF 1DE4A 1B0GB 2VC2L 1JTTA 3BGFB 1QHOA 3H9SB 4HPOL 3UPRB 5IQ7H 1JMXA 1EERB 3GRWL 5I2IB 4KZDL 3UXFA 4NJAH 1BVKB 2AJ3A 4GBXA 4S2SB 3HNVH 2Y4SA 1N7MH 4ZS7H 5J7CC 1EA9C 2P4AB 5EB9A 1PG7L 1JZ2A 1GGTA 4DGYH 4OM1L 3VGFA 1AR1C 1BBDL 4MNQE 1QG3A 4HPYH 2BOBA 1XR9A 4LEXH 5F1KC 3GI8H 8FABA 4D9QD 4IRJA 4MD4B 4ODHL 1NCTA 1V7NH 1RJZB 2I24N 2XTJC 2KUTA 3EOTL 1A7QL 1P7KB 2EYRB 1QQDB 3MROA 4FXKB 2V7NA 2V2TA 3IRPX 5KVGH 5CZXD 4HDIB 2EDEA 1F4XH 1I3VA 4PP2B 4X98B 2Q7YB 4QXUH 1IARB 3C09B 3NACH 1ONQA 3TH4T 3IKCA 4NO3B 5I17B 1QFUH 1II4E 1JGLL 5GJTL 1T5XB 2Y07L 4TSBL 3SCMC 2E9BA 4MNGE 1WICA 3C6LD 5DHYB 4ZAKB 4MX7A 3RRQA 4H20H 2XZCL 1U8KB 1QRNB 3B8SA 3HAEG 2AV7B 4DOHE 4MQ7A 2NYYC 4JKWA 3V4UH 4Z77B 4PGCA 4ODXB 3P30H 5DURB 4NRXB 4N0UE 5HYSA 4OI8A 5HVWA 3C08H 1IC5L 4JKPL 3GK8L 1WWAX 4P2QE 4X4YA 2P8MA 1DZBA 4JO4H 3RA7L 3DETC 1G7PB 4Z9KB 1IGCH 2AEQH 4QRRB 1RUKH 2R0KH 1K3ZA 3OZ9H 4F57H 3NZ8B 4BFEA 1ITBB 2Z4QA 3N1QC 4WEMB 1ADQL 5MERB 3CXHK 4GG8A 4OF5A 2ZOLA 3WIHA 3UTTA 2DJ4A 5D7LA 4M8VA 3RNQB 1IGML 3V8CA 4FOMA 4GW1A 3RVUC 1I3RA 3TA3A 2ZUSA 4QXWA 1VADA 2IC2A 4WGVB 1H5BC 4OLXH 4PB0H 4PRIB 2ORBL 2OP4L 3ARTA 2B2XL 3L95B 1U36A 4AG4H 2OXHA 4QGYA 1KPUB 3JUZA 5KZCD 4YZFE 4XP5H 2Y1VA 4G5ZH 3PGFL 5I75C 3WO4C 2XG5A 3PWLA 3UZQA 7FABH 3D0LA 1IKFH 5FOBA 1B3JA 1QEWA 3U83A 4R8WH 4JFEA 3UC0H 1B0WA 4PV8A 3BP7B 3C8HA 4JVUA 4Q74A 5A16B 2MFNA 1QVOB 3D39D 4YHIA 3L1OL 2RAMA 3JTSA 3MFFA 3VXQB 1MCDA 3DV6A 1RZIB 2DIJA 1XGUA 4PGDB 3IFPB 2V17H 4Z7QE 1RIVL 2O5YL 4RA3A 1NCDH 2YKLH 2AP2A 3UMTA 5D7SH 4FXLA 1FGVH 1G84A 4OFYD 5FO8B 3QNXA 4P0DA 3I50H 2VXUL 4OCYL 4H0HB 1QTYT 2IH1B 5ALCL 2ATKB 3GJEA 3FN3A 2LAAA 4GKNA 3NABL 3V6ZA 3QDME 1RZ7H 5DJXA 3FB5B 3MMEA 3WO4B 1UWGL 4WFGE 4NKMB 1A7PL 2CLRB 1WLHA 3QCVL 4PJ8C 1E4XI 2XTJD 5DD5H 3QDGB 3GSQB 4LSVH 4RZCA 2ICEA 2QR0A 3O2DA 1L0XA 5AD0A 4Z7VF 3V4PH 5BZDB 1E4JA 3N0PB 2H26A 3LQAL 5DK0A 5HVGB 4FABH 3U1SL 1PSKH 5CAYB 2RBLA 1FBIH 5EO0B 1CFSA 2ITCB 1G6RA 4YWGH 5IMOA 3N9GL 2FD6L 5ANMA 2P8LB 2W0PA 4C56B 2DL2A 5FYLE 3MR9A 1BJMA 3HRPA 3P9LB 3SCMD 3QFJB 2ZUQC 5I1AA 3U4BL 2D31A 2KDGA 4WHTB 3VWJA 4OSUL 3QIWC 3MRPA 3M8OL 2XI9A 4NFCA 4IOIA 2WANA 4PJBE 3HAEA 3ZDZF 5FB8B 4NHUB 2ZSWB 1JNHB 3BGMB 3HMXA 4Z7UE 3BPCB 3HNTH 1V7MH 4TUJA 3BT2L 5IBTH 5IIEB 3LPWA 1KXVC 2GT9B 2UZXB 3DETD 4MA7L 2H32A 1K4DB 1P6AB 5I1EL 1DL7H 1X6LA 1R6VA 5F3BB 4G9FD 4M6ML 1I9JL 3NH7H 4Q9RH 4XWGH 4WUUA 4PGEA 1ZWIA 3C9NB 3QIWB 1VFUA 3ARGC 2HJFA 4JPVH 3QEQE 3WBDA 4O51B 3DUUA 43CAA 4KFZC 5TGBB 3FQUA 4YDLC 3RL1A 4LSSL 4DN4H 1FE8L 5A2JH 3RVUD 3SE3A 3A6BL 4HIHB 2NW3A 4MYWB 4PJFF 1J8HD 3GSOA 5DSCA 2VDOH 2QHRL 3GZKA 3GJFB 4FN0A 2EE9A 3KPOA 3CAFA 3EOAB 5B38B 2ILLA 3LN4A 4HZLB 4GLRI 3PIQA 3TT1H 1NCUA 3I85A 4Y89A 1IFHL 2X4UA 1R3JB 3QDAA 2X7LA 3WXVH 4GG6F 4GW5A 3CK0H 1OT2A 5KTEL 4HW6A 2Z35B 3BO8A 4HFUH 4U1JA 3KLAB 4Z7WE 3MX0A 4G3YH 1W0WB 3ARGB 3PWJA 4M43L 4KROD 4GRWH 4QOKD 2BRQA 1OLLA 1GRWA 4I0CC 5JHDD 3SE4C 3RFZC 1FAIH 3QYCA 2I9TA 1CGXA 1OAUL 3TZVA 4YDLB 5A3IC 2VLME 3LHPH 1XCTA 3HMWH 5TDNB 4HWBA 4UDUB 5AZEH 5DMKB 5EUOF 4NO5B 5AUMA 1BQLH 2GY7B 5TDOB 5IWLC 2MOVA 3O45A 4M7JH 5F3HA 1IT9L 1MCOL 1DBAH 1MRFH 5E6IC 5DHVA 1MCCA 5T3XE 4GLRH 3C5JA 4OLYH 5K9QI 2XRAL 3MBED 4Y4HC 5TH2B 4H5SB 4PJFA 3PQYB 3Q6GH 1UKTA 4WJ5B 5IUSA 4PJ8D 3BN3B 2ZSVA 4PBXA 4XP9L 4ODBD 5C8JB 2A9ML 2P42B 3IDGB 4JFFA 1VA9A 1YEDB 1NUDA 3ZLQC 4BELD 4GG6A 1HHIB 1CFVL 2R1WB 3P73A 4OJFL 3VG9C 2B7DT 2GSIB 4WHYH 1A1MA 3RI5K 4XNXH 1F02I 3MV8D 4NHCH 4O2FA 4B41A 1ZVYA 2AAVA 4I77L 3G5ZA 5F1IA 1A6AA 3P4MB 5I16B 3S35X 3MRIA 3GSUB 3VH8G 4NFBA 3CGTA 5EUOA 5CD3B 2E6QA 5LGKA 1MF2L 3NAAH 1RU9L 1A9EB 2C3VB 32C2B 4HULB 3FT3B 2VDKH 3C2AL 4XVSL 5EBMB 3OKOB 3FQNB 4MWFB 1MUJA 5INDB 5E4EC 5MEQB 1G9MH 4PJHA 3WD5L 3VG9B 2BNRA 4ODTH 1XR9B 1EFQA 3T2OA 1FYTD 1XH3A 4PTTB 4IRJB 4V1DA 4PY8J 3LRHA 5CJOH 4RA0C 5JPMB 1P84J 3UDWC 1JNLH 2V7NB 4CJ0A 5E8NA 2Z92A 5DFVD 2VKXA 4R4ND 2WNGA 4HPOH 1ONQB 3GRWH 2FJHA 4JQVA 4KZDH 2JJTA 4OZIB 1KYOJ 5E4EB 3T3PE 5GGUB 3LKQB 3DECA 1PG7H 4JN2B 3DBXA 4P5KB 4OM1H 4YNYA 2QSVA 1AIFA 1NMCC 1HOCA 1HINL 1BBDH 3QIBC 3VWKA 4O2EA 2R0LL 5IJVB 3WMSA 1OD7A 2YEZA 1AC0A 1NGZA 4NOBA 4ODHH 4LBEA 2Q86A 3EOTH 5FUZL 5C0AD 1A7QH 1DUZB 4CBPA 4Y7MA 5AEAA 2MQ0A 1XIWC 5KSUB 3EGSB 3PWPE 5ID1A 1LEKB 4Z5RB 5CS7A 1E4KA 5EZJA 3CH1A 2Q3AA 1JGLH 5E6ID 1WTGT 5GJTH 2C9AA 3MNZA 1FNHA 1J0JA 2Y07H 3FCTA 4TSBH 1JGVL 5HDLA 1NMCB 3RVVC 2XZCH 4Y1AA 4GG8B 4NKIH 3MGAA 5D2NE 1Q1JL 2MSPA 2Z31C 4Y4HD 2EC9T 4P57A 4O9HL 1S78D 2CLZB 4R4BA 5DO2D 2ZWLT 3RWIA 4GW1B 2CDGB 1NAKL 3TA3B 1M71A 3FRUA 3I3BA 5D93B 1UACL 1QACA 3IDIB 4LHUB 1IC5H 4JKPH 3GK8H 3O8XA 1F90L 3QRGL 3RA7H 3ILQD 1N26A 2WK2A 1DBML 4ZXBC 3FHQA 5IR1A 4G8GB 5TE4L 2PO6C 2PW1A 4FQHA 1QEWB 2VAAA 4JFEB 4QYOA 4ZPVB 1PX4A 1ZEAL 3L7EA 3OR6A 1W72B 2Z31B 4LPYA 3VH8A 3L3IA 2B1AL 2D2OA 1J9CT 2N7AA 1J87A 3IVKA 4YHIB 1LP9E 4PR5B 2N56A 1DJSA 2ZOKA 4HG4J 3U0TB 1OAYL 5IEKA 5J4MA 3KYNA 4MNQA 3CUPB 4M8QB 2XY2A 1CFNA 5M7QA 1IE5A 4HUWA 5EN2B 3GJEB 4ERSL 1W8OA 4GKNB 2OP4H 2ORBH 3BKYL 3V6ZB 1UCTA 1PBYA 3QNZA 1A9BA 2B2XH 3MMEB 3O9WC 4WW2C 1H3XA 2M2DA 5I74C 3RI5F 3PGFH 1L9NA 5JORB 5FGBA 1CWVA 4HF5H 1U91A 3CCHB 2G2RA 4QXTB 5ISZE 1UGNA 1GSMA 4R26L 4RFEA 4MD5A 5D70L 1WISA 3KPRE 3BWAA 5BW7A 5C0CD 5E2WL 5LXGL 1KLGB 1CFSB 1G6RB 3ARVA 4MNGA 4YDVB 4J4PA 1CDIA 3L1OH 4M3JA 1CU4L 1FO0L 2W38A 2QJDA