2E7LC

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
b'EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxic Tcell receptor
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 33
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7lC00
4NZUH 1AR1C 4PRIB 3HB3C 3UJIH 5TQ0L 4XBGB 1OTUD 3L3OB 4QRQB 2OXGA 1MHCB 1OAKL 3NA9L 1V05A 3QRGL 3TZVA 2IBBA 2WWMC 4XCCL 2BNRB 3GSNB 1I3UA 5FUCE 3OG6B 2IBGA 3OKMA 1FZMB 1OM3H 4OZIB 5FA3B 3QUYA 1UJ3A 5BCAA 4WFHE 2BRRH 3QR2A 4LARL 4HKZB 4Z8FH 4GW5B 4DOHB 4MS8C 2IFFL 1REIA 3FT2A 4WW2C 2P8LB 3QHTC 1JNLL 3LPWA 3OAUL 3CUPA 5HHME 4JO4H 3ARFB 4JG1L 4X9GA 1AHWC 3DPBA 2BC4B 5GGRY 5DJZA 3EFFB 4WWID 4V1DB 4OCWL 3WJJC 1O0VA 4M5YL 2BSRA 4WWKD 4M1DH 4RDQF 1FVEB 3IAGC 3OXRB 3VFWB 3QFJE 5C9JB 4N8VA 1K2DA 3RDTD 3NCJH 4OAWA 4P2OB 3SOBH 1W72L 4E42B 5EU7C 3VXUA 5L2JA 2A9NH 2CR6A 4NO2B 4HWEH 4JO3L 1GVIA 1WJ3A 1UT9A 4ZUVA 1T22A 1TDQA 5DEGA 5AAWA 3MBED 1DQJB 1F3DJ 2QADC 5I2IA 2XZZA 5E9DA 1WCQA 1Z3GH 2XZAH 2YWYA 3RBGA 4JM2F 4Y8DC 3WUWB 2AEPH 4DGIH 1QBMH 2IF7A 1A02N 4JJ5B 5I1EL 1XIWD 3HE7B 2IJ0C 4UDUA 2LV4A 5JIKA 4JY5H 1KT2B 1PY9A 5EN2B 5FUZL 3AGVA 3F7VA 4JKLA 3DVIA 4U33A 2VDLH 3RWGB 3MLVL 2AJUH 2JCCB 1MFCH 2WIMA 3JWDC 2GJ6E 5TF1H 5JO5A 1LDPH 1FNLA 4PLNC 1MCQA 4LSTL 2LTQC 2ZG2A 3ULVD 2QSTA 1S7XB 3ULUH 2G5BB 2GJZA 1KBGL 4PJEB 4CL7A 1J8HB 2ATPB 5B22A 1RULL 2DQUH 1NPUA 4HIJA 1YEEH 1DL7L 3LKOA 3P4NB 3WIFB 3Q2CA 2H3NB 2ZUQB 4LPXA 3DMMB 1BVZA 1KB5A 3BKML 3NCYP 1B0GB 5IB1B 1J0KA 2ARJA 4QKXB 1E4WL 4LK4A 3MMEB 1ZV5A 3VI3E 2IAMC 3KPLB 4L8BA 1MHPL 3FQTA 4BFEA 3AS1A 3UPRB 2ICWJ 1HI6A 4GAYA 4UT6H 4DCQA 1YA5A 1R24B 3QUKB 3FOMA 2E6JA 2CUMA 3G6JE 2NX5D 3RVUC 3SGDH 5EZOH 3V6FB 1Y18A 4GMTH 3HN3A 3Q3GB 4O4YH 3U46A 5FYLH 1BOGB 1P7HL 5FO9B 4KKLC 2V7NB 1UCBL 4WO4D 3F6LA 1MCJA 1FL5A 5C07D 5DRXB 1FPTH 1R5IB 4O9HH 5HBBA 2VSCA 1A4JA 1BQSA 5SWZD 5KSUA 4MCYA 4FXGA 2BSED 2FJFB 1OY3B 2DQHH 2X42A 2Z8WC 2R0KL 3O11A 1MQ8A 4J4PA 3ULUF 4K3DL 1DSFL 2WINB 3AROA 3ZHDA 4JFEA 3QDGA 2CK0L 3IJHA 4PJ5A 1ONQA 1ZHLA 4U6YB 5DT1H 3SKJH 3TJHD 4UUJB 3IFOA 3DIFB 4AMKH 1AH1A 1OWWA 4JFYA 1OARL 3T0AA 5E2WL 1RHHB 1V7MH 2X1PA 3O0RL 3BP5B 2H32A 3EYQD 3MROA 2IQAA 5JIPA 1AHWA 1JUFA 5GRJH 5B39A 2BFVH 5J11C 4XH2A 4GQPH 1YJDL 3PIQB 1MCCA 3CU7A 4XNYL 1AXTH 3MA7B 1KEML 3TVMD 3KLSA 3RBSA 5KW9H 1WZLA 3MLRH 5IBLD 4MD0A 4NBZB 3QDJB 3S3JA 4M93C 1K6QH 3ARGB 3OKNB 5LCVH 2DQDH 4ZUTB 3C5ZB 3JZ7A 5D96C 3PGDA 1OSPH 2X7LB 4Q9RH 1P4IH 3BDXA 4LCUB 5E03A 1CGYA 1R0AL 1VPOH 1A6ZB 4QRPD 2FIRT 1X5IA 1JHLL 3BJLA 4JFXA 3RWJB 43C9A 4FN0A 3BD5A 1IE5A 3OKDB 5DWUH 3VWKD 2NY3C 2BNQD 3O8XB 1CFBA 5CZVL 1S5HB 1BM3L 2ED7A 1RZIA 4XP6H 2F8OA 2KPNA 4JFEE 1I4FB 5MENE 3IFPA 1KPVA 4PJ5E 3P4LA 1DBML 4MJIA 4LCIH 1RI8A 1K5NB 5EBLB 5DK3A 3MJ8A 4PBVC 5CEZH 5F3HB 1DQDL 1YMHB 5T5FL 1MLBB 1U91B 4BZYA 3P73B 1YMME 1RIHH 4YPGB 5GGVL 3BD3A 2FECI 1CBVH 4WCYH 4U1SB 2PW2A 2W0KA 4HWUA 3I6LD 3SQOH 3HAEB 1TPXB 2FHCA 4RFOH 2IAMA 3RHWF 1K4DA 1J1XL 3DURB 5HJ3A 5ID0A 5MEPA 3BDYH 1KJ3H 4P3WA 5HY9A 3MO1A 4PR5A 1SEQL 4JDTH 3GSRA 1JPGA 1G7LA 2J2ZA 1HH6B 4Q9QL 1HXMA 3P77A 1I3RA 4BJLA 5K9OA 4EQ2A 1CXIA 3TBYB 3L5IA 1TJHL 5LWYL 1QD0A 3QIWC 5JDJA 2WLZA 5D7LA 2N1KA 2PETA 4YWGL 3CFCL 2ZJSH 1DVFC 3R06B 2XI9A 3FRPA 1QSFB 1G6RH 4K3EL 2H45A 3I75A 4QGTA 1JYXA 1AY1L 4PJGB 3LPFA 2YD3A 4MQSB 1CI5A 3D48R 1INQA 5EBWA 4QHNB 4MJIE 2FYYB 6FABH 5KS9B 2VR5A 3FB6B 4OZGF 5MEOA 4PJHA 3BRGC 3ALWA 3BE1H 5DVNA 3QISA 3IKCB 4MJ4A 4EJ1C 2OJZH 1BPVA 3OHXB 2CO6B 1N26A 3OF6D 1Q9WB 5ACZB 4JQIL 5EBGA 2GFBB 3EYOA 3IU3B 1UB5B 4GSDL 4YC2B 4BZ1H 2ITDB 2MJWA 3MRDB 4MB5A 4FQXB 4MX7B 3PGFL 1YNTB 4TSAH 4YPJA 4X99B 3RDTB 1ZAGA 5HI5C 4NQSA 1KJ2A 3EOBA 4U1IA 2Z8SA 1IKFH 2VUOA 3BZ4B 4D9RE 3NAAL 4JRXD 4Z7WA 4PJBE 1JF1A 3GJEA 2AK1L 4JHWH 1NUDA 1J0IA 4JZOB 1XGPA 4OUUB 5J56B 1HWGB 3KPPB 2NZIA 2PW1B 1BAFH 2MCPL 1J87A 4Y2DB 4LSPL 1I8KB 1JZ6A 1S7UA 4EDWH 3MODL 3D3VA 5D7LE 5JOEA 4BYHA 4R2GB 1UVQA 3S9DB 5F8RC 4ZUSA 3X17A 4QO1A 5FGCE 4ELMB 4FTVA 1P4BL 5E2UH 1A7NL 3R8BB 4P2QD 4XI5C 1GGCH 3LS5H 1BIHA 2G2RA 2BJMH 1AO7A 3LKRB 4HUWB 3MRFB 3CDYA 1PG7L 4NN5C 3A67L 4YXKH 3UJJL 3WO4C 4PRPE 4PJHE 1NCTA 4X98B 4LFHD 5E8PA 1GZPB 4JM2B 1X5KA 1B6UA 1MWAH 4MQ7B 3BGMA 4NJAL 1JWSA 4YEEA 3SY0A 4XGZA 3A6CH 2IGFL 4ONHA 1Y6KR 5C2BH 4U6HA 4XWGL 1J9CT 5B39G 1DE4B 1JRHL 3CVHB 2R0WH 3MA9H 5H35A 4LBEA 1Z0MA 2BVQA 3V6OE 1XF3A 2EIDA 4RMTA 1F00I 1RZ8A 4RISH 4IRJC 1SY6A 1A21A 1L0QA 4ODTH 3LRSB 4U3XA 5TE6L 2NX5B 4IDJH 4L3ED 3S7GA 2DMBA 4O02L 3O2VL 2Q8BH 1U8MA 1YNLL 3V6BR 4HPOL 4TOYL 3IFNH 2IPKA 3VXRD 2UZIH 5FIEA 3BRDA 2KDGA 1C5CL 2RIKA 3IXAB 1CDIA 1FV1A 4LSDA 3WL9A 2E6PA 2QQQA 5SWZB 5I1HL 3QIWA 5I17B 1ED3A 5HPMB 2IPTL 2DM4A 3EHBD 3U7WH 4XPBH 1G7HB 2V5RA 3CDCA 1K4CA 1NFIA 2FL5A 1YN7B 3O6MH 5CFHA 2H8PB 3Q5YA 4IMKA 3WLBB 4XBPB 1IBGL 4MDIA 4MSWA 4F15C 4M7ZC 5BV7H 1UZ6E 3I02B 1XGUA 4A6YH 1NBVH 4UILL 1M6OB 3H7BB 3PV7A 1RJLB 4Z95H 3SDDD 1JE6A 3D2UB 2JIXB 3D18B 3UTOA 4R0LC 3FO9A 1E6JL 1U36A 1HCVA 1OWRM 2FR4A 2F53D 1ZLWK 3F5WB 2Z31A 3O41A 1SBSH 1CFNA 5B38B 3S37H 3HE6A 1N0XH 5DI8B 4TSCH 4PJ7E 1FVDA 2FNBA 3BEWA 3D87B 3RIFF 4L8CA 4KTDL 3BQUA 4NZUL 1U0QA 3TVMB 3UJIL 4S0SD 5H94A 1OAUH 4M6NH 4X5XB 4NQVB 3M8OH 4L3AA 2YD8A 3VFNA 5IEKA 4U1MB 5D1QB 3SGJC 3RNKB 4H1LA 3TPUA 3ZKSD 3L3HA 1CVRA 4P9HH 4Z7UF 5FYJU 1EIBA 1A2YA 2MNUA 5IVNA 2R2BA 5FYKD 5CJBA 5E8NA 1NDGB 4X8JB 1R5WA 3V9FA 1OM3L 4OZ4A 9CGTA 1EUUA 1HILB 5IFJB 5HHOB 1JK8A 1QRKA 1T1WA 4Z8FL 4MWFB 1Y0LA 2PCPA 5AWNH 3C5JB 3CDFA 4L3CB 2C7UB 3HZYB 5C92A 3GFUA 2F5AH 4JO4L 5D9SA 3C09C 4IDLA 1IM3A 3AMLA 2P7TB 4GKZA 3ZT5A 5JHDE 4PLJC 3N9GH 4G42B 1QBLH 1T1YB 1TIUA 1U3JA 3L7FA 3VE0A 4HH8A 4JVPA 1U92A 1NGZA 2HFEB 4M1DL 3KPSE 5T1LD 1DZBA 4YHPA 5CIPH 2XNAB 1JZ7A 2JJSC 3TWCH 2NY4C 1GJIA 1RUPH 2G75B 3NCJL 4XHJD 1ZLVH 3SOBL 25C8H 3RX8A 1UG9A 3NCEB 4CDGC 1FYTB 1G7MA 3W81A 4YK4B 4BH7A 1IC1A 2A9NL 4GOSA 4S1SH 1W0WA 4S11A 5D7IA 3VXSB 4M1CC 4HWEL 2VITB 3MYJA 1G7QB 4R4BB 5T1MA 4N8CH 1F02I 1PYWB 1LEIA 2IG2H 2KKQA 4DZBB 1Z3GL 1KCVH 2XZAL 2EDEA 5K93A 1CYGA 2AEPL 5CBAB 4DGIL 4IRJA 3GB7B 3MCG1 3ARUA 3CZFB 1QBML 3FQWA 4HSQA 4PFEA 1CFSB 2EIZB 3LY6A 4NQED 3RI5F 4D94A 4R26H 5HGAB 4FFZH 2AJ3B 5F1NB 2BY0A 2D03L 3IDXH 4JY5L 3MRRA 1FHGA 4KDTC 3X3GH 2IWGA 4LCWB 2Y5TB 2VDLL 4TULH 2AJUL 3ILPA 1MFCL 2YXFA 1E4XI 4HS6B 5HHVH 5TF1L 4HS3B 1LDPL 3LH2H 3ARVA 2OL3B 5JA9A 3MRCB 3MRBB 3ULUL 1N59A 2VLJA 4TVPE 3TA3C 3LSOB 4KUCF 1S7SA 4ODVH 4Y4KD 1W72A 3D85A 2X05A 4LSSH 4M00A 1YEEL 4X6CA 1EZVY 2DIJA 1FRGL 2PR4H 3HCVB 4RCAA 3N1PC 5CGYD 2GK2A 2P8PB 1BX2B 1DBJH 1EMTL 4WTWA 3MRKB 3IDGA 1Q0YH 5EU5B 3PL6D 5IHZA 4GRLC 4K55A 4R0LA 2GT9B 5K9QG 4D8PB 4NRZB 3EOAB 3CU1A 1ZT7A 4UT6L 4UQ2B 5T3XH 2VDKL 3UYPA 3MJ7B 1C16B 3DX8A 4H5SA 5L2KD 1S7WA 5D7IE 3PDOB 3GMNA 3GIVA 1WAAA 5EZOL 4KJQD 1U8KB 4GMTL 3HI6H 3Q6FA 3BT2H 2NXYC 5FYLL 5DMYA 4JRXB 2C4XA 1CFQA 1UADC 4AH2A 1S3KH 1U8HA 1KGCE 4CU7A 4PPTA 2YXMA 2X4QA 3SGJA 2GIYA 4NBYB 1RJZA 1G1CA 5DJDA 5FB8B 5EPMA 2DQHL 4N0FA 2HTKC 4U1GB 4MJ5A 4FZ8H 3N0PB 4H0HB 1PZ5A 3P3YA 4U1JB 1BZ9B 1U2CA 4UB0H 1SHMA 4GW4A 3SKJL 1SJVA 4AMKL 3REVB 1A1OA 5GISH 1VFAB 5HYFA 4Z76B 4P2QB 3HG1D 3IETA 3C6LA 2J12B 3NCMA 3JVGA 4LLVA 3D69A 5GRJL 1T83C 1JHKH 5CS7A 1KTLA 2BFVL 5EU4B 4EI6A 4W81A 1I8MA 3P9WB 3SO3C 4RQQB 2XTJD 2P44B 2EO1A 2OL3L 2AP2A 1CG9B 2WWKT 1AXTL 4CU6A 3RVXC 1TNMA 2Y7QB 1CICC 4EI5B 2JJSA 4HIHB 2A6DB 3C6SB 3O9WC 3QEQA 3VDCA 3MPCA 1WCBA 2OI9B 3DVGB 3MLRL 2HN7A 1U95B 5CZXD 4NO3A 5ESVB 3L3KB 1L4IA 1XGRB 4PV9A 5INCA 5HYQB 3K7UA 5IGXH 1WAAE 1K6QL 5T5NF 5C0BE 5LCVL 1T7ZA 5GS1C 2D7QA 4KU1A 3UBXA 1ZHKA 4PRIE 5CD5C 3QNYB 1TFHA 4K7FA 1OSPL 4Q6YA 4Q9RL 1P4IL 3LQZB 2VR9A 1VPOL 2J8OA 1H0DB 4QXTA 4IS6B 4JKMA 3IJYB 4OB5H 4L9DA 4Y19D 2XA3A 3NFPA 1D5XA 4KDTA 5DWUL 1YEHL 4ERSH 4EUPH 1C1EH 5I1DB 1KIRB 3MSPA 4E41D 4OZIE 3RZCC 4XP6L 1KG0B 2BMKB 1FLTX 1D6EA 2EYRB 1HXYB 1F45A 2B4CC 2YPKA 4LCIL 5ICZA 2Q87A 5BRZA 4XPHH 4KY1H 3VI4E 2W9EH 2ZKHH 4PTUB 4I2XA 5EBMA 5CEZL 1AC6A 5JNYB 1EXUA 2VMFA 5I0DA 3VCLA 1J11A 2NY1C 3FOLB 4X9IA 3U0PB 4V1DE 1RIHL 5DJ2A 1B0GA 3QEUB 3ZE0E 1CBVL 1BF2A 2A0LD 2NCMA 2F53B 3SQOL 3I85A 4R7DA 3SDXF 5DURD 4RFOL 2H26A 5DJYB 1X5JA 2VE6A 2AEQH 2RJMA 5EWIL 5L6YH 3BDYL 1KJ3L 5GXBB 3BW9A 4XZUA 2CDFA 3S8WA 4JDTL 5ALBH 1NAMH 1JZ4A 3BPNB 4JY6B 4KUZH 4OM0H 5K9QI 5IQ7H 4WW1B 2ZUYA 1LO0L 3Q3GA 5JUEH 3LRHA 1A6TA 4KI5E 4MA8H 3VJ6B 3RWHA 3MNWA 1EFXA 1T4KA 4OLEA 3G08B 5IM7B 1MNUH 4S1DC 2ZJSL 4PJXA 3IVKA 4NUJA 1G6RL 1XEDA 3H3KA 3BEVB 3MRGA 4MQXD 5DEZA 1LEKA 1D9KD 2X4NA 4G43A 4I77H 2JCCE 3S4SA 3KPNB 4D2NA 4G5ZH 2WINA 1XGYH 4G7YH 4GG6F 5DMKB 2BSSB 2NNAB 1OHQA 3PV6A 1QEWA 4ODSH 6FABL 4MNGA 4R96A 2HKFH 3QI9D 4P23D 2W0FB 3ZZ1A 3BE1L 2W1NA 5K59E 1JGLH 2H9GB 2EECA 1OW0C 4NKDB 5IFAL 2J8UB 1ACZA 2Q20A 2OJZL 2EZ0C 2PYFB 5JPNB 1T83A 4Y5YC 1T0PB 4OLVH 1TZGH 4OBSA 1T66C 4TYUA 4BZ1L 2FIKA 4LIQH 1U8PB 4TSAL 3U9UA 3WLWD 2WM0A 2DJSA 4QHUB 1CICA 4MXVF 3U82B 2P5ED 3O9WA 3BKJH 3OXSB 4TQEL 3QUMH 2AQ2A 5IKCB 1N0LA 5JQ6L 3MC0A 5GSVB 5IMLA 2BOBA 3FFCA 4JHWL 1F8TH 1NFDF 1OT2A 2AV7B 1BAFL 4F7CA 3IXTA 2O61B 3EJZC 4NQEB 5ALCH 5F6HJ 3EJYC 4ODWA 4EDWL 1TQCC 5E70A 1N7MH 2YA2A 4MDJB 1P6AB 1XF4A 3RHWK 1A6ZA 4Q6IB 3BFOA 3MNZA 4S2SB 3QO1B 4BFIA 2YUZA 4PG9A 4P46A 1MCEA 2P4AB 3TBWA 5DHVA 1KPRA 2F15A 4ZUUA 5E2UL 4AT6A 2PYEA 1CLCA 3MOBH 3O3AB 4X83A 4RIRA 1GGCL 3ARPA 3LS5L 3QXAA 2A2QT 1PKQB 3L3IA 4MQTB 5INDB 4P57A 1OP9A 4MNGE 2NXZB 1WFNA 5DHYB 5FHBH 4YXKL 4Y4KB 5C0GA 4XVJH 3GM0A 4L4TA 4P99A 2ED8A 1BJ1H 3SCMC 2JELH 1YEKH 4OIAA 1EAJA 1MWAL 2VERN 1ZEAH 2OLDA 4J8RB 4YX2L 4NFCA 4MAYC 5HYJA 3A6CL 4GT7A 4JN1H 5C2BL 1QHOA 1IGCH 2H41A 1ZT1B 4PJAF 2E7BA 4Z0BH 2R0WL 3MA9L 3RY6C 1FNGB 4KKNA 3DV4A 5EIIA 2Q7YA 1D5IH 4POUB 4LPWA 4O5LH 4RISL 1QZ1A 3Q5OA 1FNEB 2GCYA 4X5WB 1C12B 5KSBB 3P4MB 4LLYB 4MD4B 4ODTL 4YAQA 3VH8A 4KK9D 5L2KB 3RWFA 4GS7B 4IDJL 3EGSB 4FMKA 4J3WA 3K4DA 5JW5A 3FFCE 3K2MC 2BVPB 2D4FA 2Q8BL 5C0ND 1EERB 2R23B 3J7HA 5BMFH 3C8KA 3QDJE 3IFNL 4KRPC 1WK0A 5J3HC 3ULVH 4LVEA 1H3UA 3H9SD 4FP8H 2BY1A 3FAWA 1CDYA 3UBXG 4Z7NE 4ZYKB 2P42B 4Y16B 2W92A 2Q3AA 3ZDXF 3RQ3A 4XPGH 1BD2D 3U7WL 1OGAD 4XVUD 2J6EH 2X89D 1L6XA 2Q6WA 3O6ML 3H9YA 3PDDA 3CX2A 2WBJC 3M1BB 1EJ6A 1RIUH 2PYEE 5IB2B 3OV6A 5DO2D 4JDZA 3FB7A 5BV7L 4KJPD 2XWJB 4LLQA 5GGSB 4DVBA 3TF7C 1X5ZA 4LPVA 1I7TA 2M26A 4QHKI 4OFDA 1ZGLP 4X6DA 3EBAA 4F57H 4UIMA 4XMKH 4Z95L 3QAZC 2YK1H 1HKLH 1CIUA 4L4TE 1DVFD 4QRSA 3V7AE 5TDNA 3BKCH 1OW0A 4BZ2L 4YBQC 5CGMA 5KSVB 1UZ8B 2I9LB 4IOFD 3ARDD 1SBSL 5D2NA 5HYJE 2D0GA 4Y5YA 2XTJB 3AB0B 5FGBC 4E0RA 5EO9A 3RTQD 3RL2A 3C5SA 3FZUC 5E56A 2Y5EA 2DWDB 1DCLA 2HVKA 3BVNA 5DRZA 3ULUC 5HVHC 1OAUL 3FQXB 3M8OL 5F8QC 5AG8A 4P9HL 1ND0B 4IMLA 1D7FA 2XWTA 3G9VA 2NY2C 3MRLA 4M7LH 3P9MA 3GSVB 1S7QB 3UMTA 3N1GC 3MRMB 4UT7H 2PXYB 4ZPTB 1MUJB 1E0OB 2UUDH 1U8NA 4QGYA 4Y5XC 4B50A 5AWNL 2BNUB 1J8KA 3VFSA 5D7KD 4Y19B 4JFQB 4LGPB 5BJTA 3DX7A 5IG7A 4WNQB 3PG2A 4RMSA 2F5AL 1DDHB 1C5BH 1QSFE 3L5XH 4PJGE 3N9GL 3LCYA 1A7RH 5DQ9A 3S35H 3I6GB 3WJLA 3S4SG 1UM5H 5C0RH 4EDXB 3S36H 1NL0L 1BVKA 1IILE 2ZSWA 5KS9E 4U7MA 4YDVA 3TWCL 4IRSB 3CFJA 1HSAA 1AGDB 5LBSH 25C8L 5D2NE 4CW1B 5C3LD 4XI5D 4MAYA 2LU3A 4S1SL 4MGXA 1OTSD 2ZG1A 5DRWB 1HDMA 4L8DA 3BZFA 3RY6A 4N8CL 1XF1A 3FTGA 5IIEB 2A1WH 2IG2L 5EZIH 4ONGH 1HQ4A 1KCVL 4UDTB 4Y4FB 4G9FD 5F1SA 4EXKA 5HYIA 4PLOB 2X9WA 3T3PF 1LMKA 4GBXD 4NT6A 1T7WA 2AJZA 2XY2A 1FN4B 4R26L 1IGYA 1P7QA 1D5BB 4DJMA 2VZ3A 4PGJA 3IDXL 1IFHH 3X3GL 3MXWH 2X4PA 3ZKQD 4TULL 3RGVD 1P4LB 5EU6B 5HHVL 5DMGC 3LH2L 3E3QE 2VABA 3RIFK 2PO6C 4LAJH 1TZIB 1PEZA 1F4XH 1TMCB 2V5MA 1EFQA 2OTUA 4OGYH 2GTZA 4TUOA 5C09D 4ODVL 1D9KB 3CFKA 1LE9B 4LSSL 1B2WH 3QXVA 5FO8A 4AM0B 4ZNEA 3UBXI 1OOAA 2PR4L 3DGGB 5BZDB 5DS8A 3EO9H 1A7QH 4NWUL 3Q1SH 4L4VA 2VUYA 4P23B 3WN5C 1Q0YL 2L7UA 4P48A 3N1FC 4LASL 4P4KA 2W65A 3BP7B 1IC5L 3LS4H 3O4OC 2E7MA 4PG2C 4K3JH 1SEBA 1T1ZB 3WEXB 4RRPA 3S5LB 1U93A 4QRTB 4TUJB 2YR3A 1J05A 5L8KB 2Q3ZA 5F6IC 1ZA3B 4WJ5B 4AEEA 1NGWA 4TNVF 5FGBA 4AYFA 1FVCB 4EUPB 5I18H 4BFGA 2ADFH 3FCTA 4O51B 1MCPH 4CVUA 1MH5A 3W39A 3UXFA 3R8QA 5I66B 3BT2L 1F5WA 1XCTA 2PNDA 4L8SC 3FB8A 3KYKL 4P3DB 4PJ8D 4DN3H 1VHPA 4F7TA 1S3KL 4GG6B 3D39A 1HE7A 4HWZA 5KZCB 1HH9A 1LDSA 1BECA 5C0DB 1KCUH 2R1WA 5CCKH 4IHOA 3MUZ1 5FYKU 1EVUA 4BA8A 2CIIA 4G6MH 3L7EA 3VGAB 4JREB 5JR1H 4OFYD 4BELD 1AD0B 3NIGF 4PJCF 5HHNA 5IFJA 4UB0L 4Y5XA 2OTWB 2AJYH 2RQ8A 2VLKD 1RQ5A 2VL5A 4HHAA 2VWEC 3C60D 5DHXB 5ICYA 5GISL 3U0WH 4I5BA 4XCYA 4JPVH 3RI5K 4QNPE 4DW2H 3UTPD 3MXVH 3NFNB 4RMQA 2CRIA 1JNNL 4JRYB 5ISZA 4U7SA 1S9XA 5E8DH 1N2RA 1VGKB 4MD5B 2UZYB 5IR1B 2Y9RT 5J7CC 1LQSR 1YPZF 3T0EA 3EYFA 1KJMA 1CVSC 3LB6C 1KTDA 1VEMA 4CNIB 2Y6SC 1XZ0A 1MJUH 1U8LA 5TE4H 2VISB 3NGBB 4PLJD 1WC7B 5E5RB 1DLFH 1RUQH 1LILA 1XAUA 4PRHB 3HS0A 5IGXL 3HRZA 4H26A 4HIEB 1TZHA 1MJ7H 4ZXBD 4NKMA 2VRAA 3B9KC 4U6TA 4N0CC 3FHQA 3DTXA 5D1ZC 3SDCB 5T3ZH 4NQCA 4C83A 1Z2KA 3D39E 5C0FB 1B0RB 2YPLB 2HJFA 4JFOB 3UTSD 4OB5L 3GMOB 2IQ9H 3CSPA 3HUJF 3H9SB 4ERSL 2O93L 4LPTA 2G9HB 4HV8A 1C1EL 5KAQG 4RGNB 4OTXH 2EH8H 3SE8H 4ZTPH 5HHOE 1EAPB 1BD2B 5F7YC 3MV8A 4P5TB 3TCLA 1ES0A 2PO6A 2W0PA 2XQYG 3U83A 3VFMB 1DEEA 1ZHBB 1WBYA 3B43A 3HPJB 3QUMB 4XPHL 1S9YA 4KY1L 1S8DA 3OJMB 2ZKHL 1I7RA 4RDQG 4HAFA 2W91A 3FB5A 5GRWA 5JOFB 3M17A 1AD9B 3ET9F 4OM1H 1BX2A 1ETZA 3WN5A 4O2EB 1AGEB 1Q9OA 3FT4A 4G8GD 1QSED 2DI9A 4NKQB 4ZPVA 5FYLE 5A3IC 3T0EE 1RD6A 3T65A 4PG2A 4U1KA 3SEPA 4X8XA 1SMOA 3GSUA 4QRRA 4OT1H 2IADB 1U3YA 1X5GA 2AEQL 4RBPH 5L6YL 3PDGA 3QIBD 2EXWC 3HMWH 3V5DB 1FYTE 3RTQB 4Z77B 1QRNA 3NPSB 4CVZA 5BOZG 1ZSDA 1UKQA 1NAML 1ZA6A 1ZVSB 3VXSE 2XACC 3L9RA 4KUZL 3GJFB 1KIQB 1ZKAA 5MERA 2DB8A 5IQ7L 3VMOA 1LGVA 5JUEL 2P8MB 3MV9B 4P5MA 5GJTH 1JYWA 2D4DA 1JZ2A 4MA8L 5D7SH 4GRWH 4NQCE 2R2CA 3VXPB 3ZLQC 4KAQH 3RUGF 1AKJA 1YY9D 2IH1A 3SE4A 1MNUL 5FK9A 3FO2A 2R0ZH 4N1HB 4WHTB 1IL1A 4GO6B 4OLWH 3KS0H 2J3SA 1OQXA 2GSIA 4OZGA 3WS3B 1OGTB 5I1AB 1S7TA 2XN9A 4DEPB 4LCWE 1QLEL 4I77L 4JLRA 2GK0A 4X6FB 2X4SA 3G5ZB 4G5ZL 1XGYL 1TVDA 4G7YL 3MV8E 3V4PH 3Q48A 4ODSL 5KVGH 2HKFL 1MPAH 5KVDH 2YEZB 4LQFH 3DWTA 1JGLL 1HZHH 3ARBC 5SX4I 4JFDD 4JPIB 1J5OH 1YC7A 2E8YA 3L3DB 4NKOB 4AL8H 1VACB 2C1OA 2EYSA 3TFKC 3V0WH 1UCTA 1SBBA 2CKNA 4OLVL 3MRNA 5I16A 5FO7B 1TZGL 2H6PB 3BIKA 3FONB 3SKMB 3UTQB 4G8IA 4L5FH 1OCWH 3MCKA 1FAIH 3W0WB 4I18C 1D5MA 3IGAA 1FFNB 3RRQA 3BZEA 3EO1A 2YMXL 3VWJB 3RL1A 1T1XA 4KJYB 1B88A 2EICA 4RRPG 3QUML 4ZFFA 1VADB 4LVOB 4LGRB 1MFBL 1QRNE 5C2UB 2C26A 1G6RA 2HFFA 3PWPA 1F8TL 5E7FA 3PGCB 5IESL 4QYOA 1QUNA 2VDOH 3EIFA 3E1F1 4K94C 2NMSA 5CP3H 4IIQA 4GRWF 5GGRA 3H8NA 3MV01 3TN0B 4PGDB 3WE6B 2HTLD 5ALCL 4PV8A 4NN6C 5H2BA 1HYSD 2I07A 3HZMB 3AM8A 2YA0A 1N7ML 3O3EA 3MREB 2NR6C 4AENB 1ZWIB 5CEZE 3RGVB 4OZGE 5ESQA 3IJYA 4DUVA 1R3HB 2E9IA 3MOBL 1QPXA 5D5MB 5DJ0A 2ZUXA 4LMQI 3NBNA 5E6ID 3BPOC 4Z0XB 4TVSa 3ZE2F 3L95B 5ANMB 1RAMA 2AVGA 3JV6B 5FHBL 4A2MA 1CZ8H 5GSRA 2JELL 3F7YA 1ZEAL 5JNYA 5L8JB 4JN1L 3U48A 3S36X 1PQZA 4EN3B 1IGCL 4Z0BL 5EO1B 2X9XA 3UTTA 2VQ1B 1EO5A 2APBA 4ODUA 5B8CB 1R3JA 4WFHD 1T21A 3X12B 4LVNB 1D5IL 2F74B 2JB5H 4O5LL 3BP6B 1JFQH 4QOKB 5EOTB 3DLQR 1H3XA 3AU1A 5HHMD 4XNQA 2UVFA 1A7PL 4NGHH 3THML 1A1MA 3PWPE 5BMFL 5SWQA 1U41A 3ARED 4M8VA 3V0VB 4P2CG 4HT1H 4PJ8B 4R3SB 4GMSL 4FP8L 2DQGL 1YY8B 4ALAL 3QFJD 5IROC 3QSKB 4XPFH 2CLZA 1HHJA 3ZKMC 2J6EL 4LF3B 1TNNA 1MWAA 2R2HA 2GJJA 5EZJA 2OSLB 1LNUB 5JOPE 1RIUL 1ZXQA 4LSVH 4B5EA 3EYVB 3KPOB 1T04B 1XR9B 4PRBB 3QO0B 1MHHA 1N64H 3GSQB 1N8ZB 2KL6A 2EKSA 4OCSH 4HMEA 4F57L 1MRDH 3C60B 4XMKL 1WWWX 4Y4HB 1DUYA 1XH3A 1HKLL 4PTTA 4NJ9H 3CXHJ 3X11B 3WFDL 1NGPH 1Z0NA 3ARBA 2CK2A 3GRWH 4RX4D 4MNQB 2D0HA 2ESVB 4NPYB 5F88B 4JG0L 5HGHA 5C8JB 3L5WA 3HLAB 1NANI 2GJ6D 3WFCH 3QJFA 1TTGA 4Z7UA 2APVA 3UTTE 3QUYD 1HEZB 4I18A 2HH0H 1OTTC 2QQLH 4BSWB 5KG9B 4ZAKC 4F33A 1OP3H 2V9TA 3N1MC 2VZ1A 3DSNA 4G6FB 3K0WA 5CBEB 3TPKA 2XPGB 5DUMH 2Z4QB 4P2OC 3PHOB 1QQDA 1IMHC 4LHUB 4ZXBB 1INEL 4M7LL 4PJDF 5ADOH 3TO4D 4UT7L 5J12C 1IAKA 1X5LA 2ZUTA 4A6YA 2OK0H 3T0BA 1NLBL 2AK4B 2WANA 2APFA 3QDAA 2CMRH 4GAJL 3VFPB 4GUPB 3UTSB 1G9MC 1UFUA 1U3HD 3MGTB 4HDIB 2C3VB 3KXFA 4HIIB 2Y36H 2VDPH 1CD1A 4LLDA 3HE7C 2X70A 3SDYH 2VLLA 5EIQA 1C5BL 4KKCD 5DEFA 3L5XL 3LN4A 2JJTA 1A7RL 2AKRB 4PD4K 1QFWH 4C56B 1JMZA 3W2DH 1CDJA 4BQBA 1RUAL 5C0RL 5D2LF 4M7JH 4NQDA 3TYGH 4QLRA 4NYLB 1AXIB 3DRQA 4PP2A 1NJ9A 4HGKC 3OJDB 1MFNA 3O6LH 2BY2A 5LBSL 1YZZA 4ISVA 4XTRC 4WUUA 3QQ3B 1KEGL 2VTFA 5IOPB 5LJYH 4LLUA 3B83A 1E4XH 1G7PA 3OKEA 2RR3A 4Z7UE 3DMMC 2XKNA 2QHLA 1IGFH 4OV5A 3EDFA 3O6FB 2C3HA 1WTLA 2MQ3A 1FNGA 5EZIL 4ONGL 4MNHB 1JF5A 5JW4N 2XFXA 5AD0A 4P5KA 4F7EA 3SCMD 5A2KH 8FABA 4KK6D 3ROOA 5DGQA 2HVJA 3R0NA 4TPRH 1MCBA 4UNUA 3SGDI 1IFHL 1QLRA 5I30H 3MXWL 3HHRB 4Z7VA 3OQ3B 2Z93B 3T4YB 5GS0C 4OKVB 4NO0A 5F7DB 4DAGH 2HT2C 4D3CH 4LPUA 1PFCA 2O5ZH 3V8OA 3O6KH 4X4XB 1XGQA 3QJHA 3WKNA 1I9IL 2ZNXA 1I8LC 5CIPA 5FCUH 1F4XL 3CXHK 5IROA 1IGJA 4OGYL 2BDNH 4BSJA 2N7AA 4JFZH 1S7VA 4UOW1 4WW2F 1J0HA 1B2WL 3UPCA 3I2CH 5IB5A 1FO0B 3AVEA 4C59B 3P4OA 1U8OA 3F58L 1PGRB 1MCOH 3WXVH 3EO9L 1A7QL 5AZ2H 1N5YH 3Q1SL 1NC4B 1PKQE 4XC1H 4I3RH 2NW2B 1IEHA 1JNHB 4K3JL 4AK1A 3FQNA 2EDJA 5IUSA 5DZOA 5GZND 2ERJC 5IB4A 4WUUE 2I26N 3CFDB 4FQHB 2OM5A 2CRMA 4ENED 5EUKA 2B5IC 4JFFA 3G5VA 3CXDH 3L3GB 2YZ8A 2ADFL 3PWJB 4XCNA 4JFED 1MCPL 5DFWH 4K7PY 2DF3A 5DJXB 5MEND 4PJ5D 4ZAKA 2DWDA 3VFRA 5D1XD 4U6XA 4FQ1H 3MLSH 4LEXH 3WIHA 4YGVB 3DVNB 1A6AA 2X4RB 4D0DB 1EEYA 5CCKL 3IRPX 2AV1B 4NCC2 4JPKH 4G6ML 4JFPA 1YMMD 5E00A 4FFVD 2HT4C 3QUXC 4DTGH 1JN6A 5JR1L 3BPCA 1M7IB 3NCFB 5IQ9B 2PXYA 1BFVH 1FAKT 3ARGC 2IANB 4Y5VB 5IW6A 2Q7NA 4CN4A 4KQ4H 3UAJD 2AJYL 1A4KA 3VGEA 3VXNA 5ACMA 3VFUA 4Z7OF 3HI1A 3B9EA 4CMHC 5E8EB 3U0WL 2HMID 1OPGH 2MFNA 4HXAH 1ZMYA 2EXYC 4KZEH 2X4UA 2WW8A 2B8OT 1QP1A 5AEAA 3WNLA 4Q74A 4JPVL 3NZ8B 2R1XA 4DW2L 1F11A 1OAYH 4QWWD 3MXVL 2HYMA 3R0MA 1BEYH 4QCIB 2UUDK 1VERA 5E8DL 4ZTOH 5F1OB 3TIEA 4UAOB 4ZFZA 1QG3A 4N8PA 5JPMA 3WSQH 5BXFB 1CT8A 1A3LH 12E8H 1BZ7B 4GRWB 3ROLA 4IOIB 2NY0D 4POZD 4XWOD 5IF0A 4PGCB 3O4LA 4IRSA 2Z8RA 3QPXH 3UEZA 5I73B 1BLNB 5HI4D 3QDMA 1RUQL 1LO5B 2PF6A 3U4EA 1KJ2H 2ADGA 1AI1H 35C8H 1MJ7L 3W11C 4MJID 1DBAH 3OKKA 4ZQKA 5C0CA 1QFUH 4WV1B 3X13B 1SJHB 3QXDB 1I1FB 2XYCA 5T3ZL 5IEHA 1T7VA 4Z78B 1NMAH 3DUSB 5K9KB 3TESA 3HC4H 1KSRA 2GSGB 5CWSA 3QUZA 2W9DH 1F58L 2CKBB 5E4IA 2R8SH 2FECL 2X6MA 4TNVK 4OTXL 1M7XA 2EH8L 2QJDA 3NCYS 1U8QA 2R1YB 2FWOA 2YD6A 3SE8L 3EYSH 4N5EC 4R4FH 4ZTPL 1OTUC 2OZ4H 4D9LH 4GKSA 4R7NB 5JLZB 3B2VH 4D9RD 1CTNA 4PJ9B 2VXQH 4BK5A 4P2RA 3SDXA 4X4MA 4YR6A 3QHZH 2D7MA 1LWRA 2LU7A 4NWTL 3GMLA 1VESA 1KN2H 4I0PA 4OM1L 5B3JF 2UYLA 4Y1AA 1DQQA 3TZVB 2GY5A 4JZJA 2IPUK 5D7LD 1RK0A 1P7KA 4OT1L 5DQJA 3S5LA 4QF1A 4JCLA 4XC3H 3OKMB 1WZMA 3SKOA 5ERWA 3QUYB 1UJ3B 5E08H 2EDBA 4KVCH 3REWA 4WWKC 4PJIA 2B2XH 1DQLL 3FT2B 4NCDA 2R9HD 1RJYA 4YC2C 3FN3A 3CUPB 1GGIH 4PRPD 1CDBA 3RDTC 5D7SL 4WDIA 5DJZB 4KAQL 1KV3A 1OAZH 3VGFA 3IJSA 1A47A 2BSRB 1YYLH 2CDGA 4JY4A 5F9AC 3QUXA 3MBEC 3TH4T 4N8VB 5EU6E 1K2DB 3QIUD 4OAWB 3V4PL 1Z6JT 2VN7A 3K74B 1Q72H 2NY6D 3VXUB 5L2JB 5KVGL 1XIWC 1MPAL 5KVDL 4LQFL 5FA4A 3U30C 1HZHL 4ZUVB 1T22B 5DEGB 1J5OL 5I2IB 4AL8L 5E9DB 2BXYA 2NLJB 5L88H 3V0WL 1NAMA 4WI6A 1YN6A 2ADIB 1ORQA 5CUSH 2NY7H 4J12A 5FM4A 4L5FL 3ULVC 1OCWL 4JRYA 4Y1AE 1FAIL 3BN9D 4WI9A 1J1PH 1NFDA 4UDUB 3EOTL 5EC1A 4XXCC 1UM6H 1A7OH 1SMAA 2FBJH 3F7VB 3KYNA 2YD4A 4APQD 5HDQH 1FDLH 4ETQA 4YDLB 1TQBB 1B0WA 3KJ4C 4H25A 3WBDA 5JO5B 4ZUWA 1BREA 4AEHL 5KSAD 2GJZB 4Q97A 2YN3A 4FQQA 4FQLL 2DM3A 1SVZA 2FH6A 2ZWLT 1PVHA 1MCIA 4HIJB 3LKOB 3RVVD 4U2ZA 4C57C 4GG6E 1KB5B 1IM9A 2X40A 2YPLA 3VW3H 2ARJB 1ADQH 4J1UA 1PSKL 4MA1B 5HGDA 4KTEL 4HMCA 3K8LA 1GC1C 4L8BB 1NBYA 1B4JH 3FQTB 1C8PA 3B9KD 3F7QA 1HI6B 4GAYB 4DCQB 3BP4A 4WO4C 4JO2H 1SJXA 4IJ3C 4PJAA 3E6FA 3FOMB 5EUOA 4M03A 3ZDZF 4OD3H 3VFMA 4OZFH 1P6FA 3QQ9D 2AGJH 4H8WC 5BVJA 3MV7D 3WUWG 1CZ8L 1J1OH 4JGUA 3RGHA 2FJHA 1Y18B 3U46B 3TEUA 4LLMA 4MXVE 3MRHA 4N9OB 2LABA 1IQDA 1FL5B 4JRYE 3IDNA 2M8XA 2V17L 3TJHC 5KVEH 3TH3T 1A4JB 5KSUB 4MCYB 2JB5L 4FXGB 2O5XH 3G6AA 4OF0A 1JFQL 4K7PH 2YD1A 1FFOA 5GGUA 1B6DA 2ADJA 3O11B 3EYQC 3IFLH 3B2UC 4DGVH 4NQUA 4NGHL 4KMLB 4PBWD 5CD3A 5JHDD 2W07A 4JFEB 3QDGB 3JV5A 3IJHB 1WWAX 1RUKH 1ONQB 1ZHLB 3DRTA 4PJ5B 4PRHE 1FSKC 4WWKA 1VFUA 3IFOB 5I19H 1NAKH 4HT1L 3TBTA 5A3ID 3IAQA 1FIGH 2EKJA 1KIQA 4JFYB 3KPSD 2G60L 1K9TA 1EDQA 3BN3B 3TJEH 1JZ3A 3TVMC 2H32B 5HDBF 3MROB 2IQAB 1AHWB 1JUFB 4RBPK 5J13C 4RFEA 5B39B 4XPFL 1FNAA 2Z31D 5AZEH 3SGEH 2YPLE 4J3UA 3TT1H 1CL7I 2EDFA 4NDMA 4XH2B 4I3GA 2Q86A 3HE6D 4CUCA 3MLTA 1KNOA 4S0TD 1WTGT 2VLME 1F90H 1KULA 3QEHA 3MBEA 3AAZA 4QEGA 5HTSA 4CN6A 1NBZA 1FZOA 3BQUD 1N64L 4RGNE 5C3TA 3T09A 4HH9A 1ZVYA 4YHZH 3VXMA 1OB1A 4PJAE 4MD0B 1I1AA 4JGJA 1XIWA 2M2DA 2YZ1A 4NJ9L 1SJEA 5EFIA 1P2CA 1NGPL 5CLTA 4LU5H 4OZHF 1Q38A 4ODXA 3GRWL 3VWKC 4G9DA 2QR0A 5F9OH 3CLEH 1KXTB 3CC5A 3PGDB 4NP4H 1UJTA 4FZEH 2HAZA 4GAGH 1DLHA 2BCKA 2HH0L 2QQLL 3H3BC 2R56H 3W0WA 5BW7A 4JFXB 3ILQD 43C9B 2YD5A 3QQ4A 2QHRH 4XXCA 4TVPD 1I8IA 1DR9A 5E4EC 2UY7A 5DUML 1KB9J 3ZDXE 1J0JA 4WFGE 5E8OA 1RZIB 5HD8D 1WBXA 4M8QA 3UC0H 3VG9C 4YK4C 3IFPB 1KPVB 5FM5O 4MJIB 3MQIA 1J0YA 4YEFA 4JVUA 5ADOL 1FL6A 2F9BT 5H37G 3MJ8B 2GI7A 3V5HA 3MV9E 3OZ9H 1DBKH 2CMRL 3W5MA 2AEIT 3TM6A 4HXBH 2VZSA 3B3IA 5DJAA 3RIAF 1TENA 2Y36L 2VDPL 2EDNA 4QHMA 3SDYL 1MY7A 4DWHA 2PW2B 5DK2A 2IAMB 4FQJH 5F9JA 1K4DB 5DSCA 3EZ8A 5HJ3B 5ITFA 3WFHA 4AZ8A 5ID0B 5MEPB 4PB9H 3VXME 3FJTA 4WO4A 3VD4A 5IK3A 4M7JL 5HY9B 5CMAA 4ODHH 3MO1B 4PR5B 4ZODA 5C07A 1CLZH 1S9VA 2LVEA 3TYGL 2G5RA 2NR6D 1KGCD 3GSRB 1JPGB 1G7LB 5KN5A 3G04A 4NHUA 1NCBH 4U7KA 1HXMB 3P77B 3FMGH 1I3RB 1JHTA 4PRNA 5K9OB 3UZVB 3RX7A 5TDOA 4WUKH 3L1OH 3IDMA 5I74C 3F7RA 3N1QC 1BMGA 4F7MA 3Q6GH 1E4XL 5EA0H 3MUJA 5KVFH 3AMKA 1IGFL 3HKFA 5D7LB 3W0WE 1TETH 5IMKA 4JVWA 1G0YR 4QOKA 1LK3H 3I75B 4MXWH 4XX1G 5FDWB 3D85D 2CGRL 4YHMH 5JMRA 4TPRL 1YDPA 1INQB 2EH7H 5EBWB 1FC2D 4WFFE 5I30L 5CAYB 3CFEA 5MEOB 4N1CA 1G7IB 4D3CL 2O5ZL 3ZSSA 4N90E 2P1YA 1G1YA 4OGXH 3O6KL 4YXLH 5FCUL 3MUGA 3EZJB 3OKYA 4NRYA 1LO3H 3JTTA 1KFAH 3QCTH 2BVTA 1VFOA 3EYOB 2BDNL 2EEAA 4JFZL 3I2CL 3IYLW 2HJKA 2Z92A 5C0BD 5D5ME 4NZRH 4NQSB 2FX9H 1KJ2B 1MCOL 3A6BL 2ATKA 3EOBB 4U1IB 5AZ2L 5F7LB 3WXVL 1N5YL 1Z5LA 4I9WE 5E7BA 4PRID 4XC1L 1T5XA 4G6AD 4HQQH 4I3RL 5ANME 4Z7WB 3DSFH 1K3ZA 1HHGA 1JF1B 4AQ1B 3GJEB 4HK0A 4QRPA 4P4RA 1ZOXA 1XGPB 4NM8H 4M93B 1IAOA 2A73A 1KB9K 3VWKA 2DJ4A 5EG6C 2BNQA 3T3PE 5C0IA 3QCUH 1RZJC 5D96B 2K7PA 4N0YH 3CXDL 1S7UB 3IDIA 5HYSA 3D3VB 1T89C 1YEGH 2VXVH 4O00A 1WT5C 4TTDD 1UVQB 1XF5A 3CFIC 5IVXF 1X4YA 3WHE1 4ZUSB 1J12A 4FQ1L 3MLSL 5DJ6A 4LEXL 4Z7QF 4KRNA 4FTVB 2ZOLA 4PJCA 4QOKE 2NY3B 4FOMA 5EDXA 4F3FA 3C6LD 2G2RB 3ARFD 5CEXA 2GQHA 4ZFOL 1AO7B 4KQ3L 1YEJL 4JPKL 1S7RA 2E5EA 4F9PC 2A6IA 2DLEA 4V1DD 3TT3H 3BKYH 4OV6F 5CILH 4CMMA 2R0LH 3OPZH 5E8PB 1BFVL 4LPCA 2FRGP 1IGML 1OP3K 4KQ4L 3BGMB 3RFZC 1BFOA 1JWSB 3SY0B 4XGZB 4ONHB 5CJ5A 4U6HB 1NCCL 5CGTA 5H35B 1OPGL 1YPZA 4LBEB 4YHYC 2BVQB 3I3DA 4KZEL 1A8JH 1XF3B 3AXLA 1M1SA 1RZ8B 1YEDA 2RCSH 5F93C 4W4OC 3SDAA 4Q58C 1PY4A 5AYUL 1BEYL 4KROD 4C56A 4ZTOL 3HZKA 3UP1A 2CSPA 2A38A 4HFWA 4I4WA 4KI5D 2DLIA 2HLAA 1A3LL 12E8L 3E2HB 3IDYB 2X09A 1U8MB 4PLKD 2HLFD 1WEJH 4WEBH 2IPKB 3QPXL 4ZNCD 1H5BC 4MNQE 2ESVE 1E28A 7CGTA 4AQOA 3G5YA 3JXAA 1FV1B 3WL9B 3RPIA 2VXUH 3QIWB 1JBJA 1ED3B 4NC1E 1KJ2L 1HINH 3O3BA 4JN2A 35C8L 3HUJA 3PWUA 4GXUN 3SDDC 3H9ZA 1K4CB 4DKFH 1NFIB 1DBAL 2BX5A 2FL5B 1QFUL 1DN2A 1LO2H 4DQOH 3NIGE 4PJCE 2A6JA 4MDIB 4MSWB 1P84K 1NMAL 3DOSA 4MJ6A 1VFBA 2MSPA 1XGUB 3HC4L 2BP3A 3V2AR 4YHOH 3WO3B 2W9DL 3GMMA 3DMMD 2FGZA 4B7LA 2JJUA 1FFRA 4PJXF 2R8SL 3VFTA 3UZEA 1AGCA 3FO9B 3WV0A 1NUGA 1RZ7H 3EYSL 1Z9OA 1TVBA 4R4FL 4RAHA 2FR4B 4HX1A 4D9LL 2Z31B 2CUIA 2AK4E 4RGMC 3O41B 1CFNB 1T80A 3B2VL 1WISA 3HE6B 4XNXL 1FVDB 2VXQL 1YPZE 2DAVA 3BEWB 4L8CB 4K9EC 5C1MB 3BQUB 1T03H 4XP4H 1NLDH 2AXHA 2HT2D 2MTPA 4OD1H 1KN2L 5HHQA 5H94B 5J4MA 3F12A 2VZVA 1FNFA 2VKXA 3B8SA 4XNMA 4C56E 3OSKA 5IEKB 1WF5A 5EORH 4H1LB 1EH9A 3TPUB 3L3HB 3B5HA 1A2YB 3ES6A 4OJFH 4XCEA 5F3BB 2R2BB 5E8NB 2DKSA 2AS5M 4XC3L 1R5WB 5C08A 4OZ4B 1QSZA 2PKDA 2OMBA 1JK8B 4ZS7H 5E08L 3BMWA 3RUGA 1T1WB 3VA6A 1Y0LB 2PCPB 4KVCL 1KLFA 2B2XL 4X9FA 3HUJE 2X4OA 1WT5A 2WIIA 5JXEC 5J06A 1GGIL 4UMGA 5D9SB 5D7JA 1R6VA 4XHJC 4HK3N 1IM3B 2H1PH 4GKZB 1WFTA 4XRCA 4YHNA 3RZWA 3L7FB 2FHFA 4LEOA 1MJJA 1OAZL 3VE0B 1ROWA 4N1EA 3GBLA 1DQMH 1YYLL 1U92B 4OF5A 1NGZB 4UNTA 4NN5B 4YHPB 3WO4B 3ECBA 1FNHA 1QLFA 3R1GH 3RAJH 1HSBA 1LEGA 1G7MB 4RAVA 1Q72L 1B9ZA 3BH8A 4L3EA 1W0WB 3D0LA 5D7IB 2YUXA 3MYJB 5T1MB 3IAPA 2EDTA 2HT4D 3FFCD 2B20A 4Q6IC 1LEIB 3VXRA 4YO0A 5L88L 2WK2A 3QDJD 4K71B 1PLGH 2HJLA 3F8UB 4IRJB 5CUSL 4LNRA 2NY7L 3FQWB 1FCGA 4RGOH 3C5ZD 1J1PL 4NZDA 3CVIH 1UWEH 4U3CA 5T3ZE 4LSRH 1UM6L 1A7OL 4GAFB 3BSZH 4QXUH 1FDLL 1NDMA 4Y4KC 5HDQL 4UBDD 5C08E 3ILPB 4XVSL 5AUMA 4P46D 1H5BA 1WV7T 2CLRA 4MAUH 3BUYA 2F8VA 3ZE1E 3QCVH 5CGYC 2PYED 4R8WH 1L9NA 3O8XD 4X7CC 1N59B 2GUOA 2VLJB 2XT1B 1QO3A 3KPTA 3SDDA 5DD0H 2E7LC 2CDEA 1S7SB 1W72B 3D85B 3K4ZA 4L4TD 2AABH 1VGEH 4X6CB 5EU3A 4F15B 1HNFA 3OB0H 4M7ZB 1SM3L 1QR1A 2IPUG 4PY7A 1LO4H 1MCKA 3IDGB 2RB8A 5HYJD 4GS7C 3HZVA 3VW3L 1ADQL 1V3JA 5IHZB 3PWVA 4WY7H 4KJQC 4OIBA 4CADA 1IC4H 3IS0X 4ESKA 1MCNA 4HJJH 4R0LB 1B4JL 1Q94A 1ZT7B 2IANE 3MLXH 4BM7A 4QRUA 2IEPA 1L6ZA 3OKOA 1QVOA 4OD3L 3DX8B 4H5SB 1S7WB 2AGJL 3T0WA 4UINH 3AY4C 3GMNB 1UC6A 1J1OL 3GIVB 4KXZI 2EO9A 2VZOA 2JLLA 4EQ3A 1E4KC 1ZHNA 2DKMA 5E99H 3Q6FB 4QT5A 5FKPA 3VXRE 1CCZA 3F6IA 1JF6A 3LKNA 1CFQB 4N5ED 4AH2B 5CP3A 1U8HB 1KOAA 5KVEL 2X4QB 3HNVH 43CAA 5GQBA 3ULSA 5SV4A 1RJZB 1MIMH 5DJDB 2O5XL 3VFOA 4GKNA 4K7PL 5EPMB 3J8F7 4GRWE 2YHGA 4N0FB 1LVEA 4MJ5B 1BZQK 3IFLL 4DGVL 1CDCA 1CLYH 4ELKA 1QSFD 1PZ5B 2W9LA 3P0YH 5IHBA 1JGEA 4GW4B 1RUKL 4KK5D 5DJ8A 1PDKA 2XTJC 2XIDA 3AB0C 5I19L 1NAKL 5T1LA 4I13B 4H0IA 1FIGL 5LGHH 1A1OB 2VXTH 5KAQF 3TJEL 4DK3A 1KN4H 1CGUA 3P30H 3C6LB 3IETB 2X5PA 3C09B 3QBTB 1X9QA 4LLVB 1B3JA 3D69B 5CZXC 1AC0A 1KTLB 4HKJA 5AZEL 5EOCH 4M7KH 3TT1L 4R6UA 4EI6B 1I8MB 4F8QA 2A9MH 5TH2A 1NANH 1A3RH 1F90L 2JE8A 4QTIH 3VGBA 4CJ0A 4U1LA 3KLHD 5BVPH 2NY4B 1IEBA 5KJRL 4FQXD 3QEQB 3TP4A 4YHZL 1WCBB 1V5JA 4V2BA 3SE9H 3U4BH 5J1AA 3KWWA 2HN7B 2C3WA 4NO3B 1BFSA 2HT3D 4PV9B 5INCB 1EA9C 2DM7A 3DI2B 1D6VH 1WBZA 4LU5L 1UH3A 5F9OL 3CLEL 5TJWK 1ZHKB 4X7SH 3UBXB 4KROB 3RX5A 5ILTH 2NLJA 1EK3A 4P9MH 1JI2A 4K7FB 5IMMA 4NP4L 4QHKJ 2ADIA 3I9GH 2D2OA 3NH7H 4QXTB 4Y2DD 5HGBA 3L3JA 2R56L 2H2SD 4X6BA 4HZLA 4EZMA 2HRPH 4PJDA 4LOUD 2QHRL 3NFPB 1D5XB 4R2GD 1QKZH 1IQWH 4WTZA 2XQBH 5IWLC 3VD9A 1GAFH 1TLKA 2IMNA 1UA6H 2C1PA 2HKHH 3KHQA 2Y23A 3UC0L 1G9EA 1J10A 1D6EB 2FEEL 5DVOA 1OAXH 3PL6A 2YPKB 2VXSH 2OR8A 1K8IA 5ICZB 3TC9A 2A0LC 5BRZB 3L6FA 2E7LA 3W82A 2EDWA 3B9AA 4I2XB 5EBMB 4P59H 1NGXA 3OZ9L 1DBKL 3ZT7A 1Q8MA 4LFHG 1EXUB 3MBXH 1BQHA 5KBNC 2NY5H 1OP5H 5D2LA 4OCRH 3VCLB 4JM2D 4OFKA 3ZO0A 5DJ2B 2DLTA 3GRWA 5FOJA 4NNPH 1JJUA 3G6DH 2W60A 3ZTNH 1V8HA 3MLYH 4R7DB 2XXMB 2AXFA 4FQJL 2H26B 4D0CA 2VE6B 1MJ8L 1MFDH 3KPRA 3ELAT 5C0AA 3BW9B 5DMJB 4ODHL 4XZUB 2CDFB 1CLZL 3VXUE 5JXAH 3AY4A 1NCBL 5F7KC 3FMGL 4DUXA 4B41A 4LP5A 4MQXC 1EEZA 3QWRD 5BQ7A 3Q0HA 1E4KA 5E9DE 1D9KC 2NXYB 3L1OL 5EH1A 5C6WH 1A6TB 4R4ND 1NMCB 1FLRH 3Q6GL 5EA0L 4PGEA 5KVFL 4GXVH 3RWHB 3MNWB 1EFXB 2PN5A 1T4KB 3QI9C 4P23C 1TETL 4PJXB 4UU9A 4Z6AT 3IVKB 2XTLA 4NUJB 1LK3L 3MRGB 1LEKB 3BWUC 3HG1A 4M43H 4PGBA 2X4NB 4G43B 4YHML 3S4SB 2Y4SA 4KKAC 3NOIA 2EH7L 3D0VA 4KHXH 3CX5J 3PV6B 1QEWB 4MNGB 4R96B 3ALXA 3B8YA 1F6FB 4WW2A 1IVLA 3CDGA 3WLWC 2VH5H 5F1IA 3D2UD 4FMFA 4OGXL 5CSZA 1DUZA 2AXJA 2JIXD 3HC0A 3B2UD 5ACLA 1LO3L 5D2LE 1KFAL 3F7PC 3QCTL 1M7DA 3WJJA 3SO3B 2FIKB 2CXGA 1MF2H 1H8NA 3U9UB 2VSDA 3C9NA 4NZRL 1CICB 2FX9L 4FXKA 5TPWH 3O9WB 3KPRE 5C0AE 5I6XC 4HQQL 3EYUH 1KUMA 2EEDA 2APTA 3DSFL 2Y07H 5IMLB 2JJVA 2BOBB 3FFCB 3D39D 5TGBA 4NM8L 5D1QD 3K3QA 1YECH 3GGWA 3QHFH 4F7CB 3IXTB 3QCUL 3RIAK 5IW1A 3DETD 5ECJE 5FF6A 4WRLA 2WWKO 4N0YL 1CWVA 4E41A 4ODWB 3KPMA 2NZ9D 1RFDH 1YEGL 1A6VH 5HHOD 2VXVL 4M5ZL 1XF4B 3MNZB 4OUOA 4BFIB 4PG9B 4P46B 3TBWB 5DHVB 1KPRB 4Z18A 4ZUUB 1MRCH 3STZA 1JCKA 3KLDA 4AT6B 2PYEB 5IWLA 4JQVC 4RIRB 1BQUA 3T0VA 3QXAB 5DTFA 3L3IB 4P57B 4FFWD 3QDGE 5C0GB 2K9UA 3BKYL 5CILL 3QPQD 3D5OF 4X4ZA 2R0LL 3OPZL 1DN0A 4L4TB 4F7PA 4AJ0A 3MV11 5FYLD 3A0OA 3IF1A 4NSKA 5CJOH 3SHSA 3P11H 4KK9C 5HYJB 3KLAA 1JPSH 3SGKC 4LKXA 4BUGA 5I71C 1NKRA 3WFEL 2NY1B 4AY0A 1AQDA 1FYTD 2YC1A 5HI3D 2WSKA 5C0NC 3DV4B 4JB9H 4L9LC 5EIIB 2Q7YB 3NN8A 2EIEA 3VXSD 1SYSA 1NMBH 1F4YH 2RCSL 3ZT6A 2GCYB 1MCLA 4YHIA 4YAQB 3VH8B 3RWFB 1GZQA 2ID5A 5EU7E 4KRLB 4NQCD 5SV3A 5JW5B 6CGTA 4XVUC 3C8KB 1WEJL 4WEBL 4WHCA 1INDH 4YE4H 4ZFOA 3MLPA 5DO2C 3CX5K 4LCWD 4KJPC 2YN5A 2GITA 3U1SL 1QBBA 2DTML 3OJVC 1HINL 1XGTA 3MV8D 5LQBH 5ITBH 3QI9A 3U0TA 3V95A 4DKFL 3NPZB 3CCHA 1R3IH 5T1DH 2Q6WB 1LO2L 4DQOL 4IOFC 4XAKE 3ARDC 4JDZB 3FB7B 2A74A 1MCRA 3MRIA 4LLQB 4WTZG 5FDWA 4DVBB 5AAMA 1I7TB 4X6DB 4Z7OE 4YHOL 3RTQC 3OR6B 1CR9H 4UIMB 3NPSC 1I7ZA 2DMCA 4FFYH 3LKQA 4YDJA 3T1WA 4QRSB 5TDNB 1G7IA 5DA0B 1RZ7L 3MJ6A 2P5EA 2P49B 5D2NB 2YOCA 1RZGA 4Y5YB 4EVNA 5F72S 4YJZL 1AGFA 1BQHG 1KCSH 4E0RB 5L0QB 3PWLA 4F80A 5F9WB 5EO9B 2QTEA 3RL2B 5DUPH 5C7XH 1QRND 4OFPA 1VA9A 4RNRA 4HUUA 5D6CA 3C5SB 1T03L 4XP4L 1NLDL 2HVKB 3EDKA 3BVNB 5DRZB 2A6KA 4DEPC 1KCKA 2B4CL 5E2JA 1NFKA 2HG5A 3T1FA 1ZK9A 4IMLB 4N0UA 1FG2A 2XWTB 3LIZH 3QA3A 4OJFL 3MRLB 3P9MB 4LDOB 4KKBD 5GGTH 2VQUA 5CEZD 2QSCH 1JYNA 3PABA 3VD3A 1R3LA 4ZS7L 2FSEA 1U8NB 2AQ1A 4M4RA 3VFSB 5IB3A 1LP9A 3PXJA 3VD5A 3VXOA 2VL4A 5BJTB 3DX7B 5IG7B 2V2XA 4NRXA 2OZ4A 2H1PL 3MLWH 1MCHA 4UQ3A 4JQVA 5DQ9B 1A7BA 1QYGH 3DX9A 3F62A 3MGAA 1UYWL 3AS2A 1OTSC 1DQML 1EGJH 2WQ8A 3DO7A 1L0XA 1BVKB 4JDVB 4R97B 1Q9LB 2XV6B 2IC2A 2ZSWB 1DQTA 3MZGB 4Z5RA 4YDVB 1MFEH 3R1GL 3MACH 1N3NA 3CFJB 3RAJL 1HSAB 4IBLT 4Q7DA 4GBXC 5B3JE 3KPQA 1HYRC 3QXUA 3SJVA 3WNPA 4MAYB 3VXTA 4EI5D 5FM8A 1F97A 4BKLA 1UENA 4FQCH 5FXCH 1HDMB 4L8DB 1FL3A 4U1HB 2VIRA 3BZFB 5FHAH 3FTGB 3DUUA 2B0SH 4L9LA 3RGVC 1HQ4B 1JVKA 3X14A 4PYGA 5DD6A 3ZMRA 3DHJA 1MRFH 3QG7H 4IOSD 4RGOL 1JV5A 2UV3A 4NT6B 2AJZB 4TVPH 1LD9A 4HS8H 1IGYB 1P7QB 5T1KA 3MGOA 5J9PA 4Z7WE 2FX7H 1ZGLA 3CVIL 1OGAA 1UWEL 1Z9MA 1YUHA 2GEEA 4LSRL 5HGGS 1NGQH 3BSZL 3BUTA 4QXUL 2X4PB 3PJSA 2GAZA 4YDIH 5DUBA 4KRPB 3OGCA 1PD6A 3GKWH 3HA0A 2VB5A 4LLAA 1CGTA 4MAUL 4QXGH 1DJSA 3QCVL 5JOPD 4G7VH 2VABB 4R8WL 5CZKA 3UPAA 3D3VE 2OTUB 2GTZB 5DD0L 4TUOB 5B8CC 1DVFA 3CFKB 4LVNC 2VYRE 2AABL 4MA3A 1C5DA 4FTVE 4C4KT 5FO8B 2Q76A 2CXKA 3WDJA 3ARDA 5IV2A 1KIUA 2Q1EA 5DS8B 1W0YT 5GIRA 3V7MA 4K94H 3GHBH 4L4VB 4OLYL 1YEFH 1AO7E 5F89A 4P4KB 1F3DH 4PREA 5CJQH 2W65B 4WY7L 1HCFX 2QBWA 4KFZC 3HR5A 3QAZB 1AJ7L 4FHBD 3RVWD 1IC4L 1SEBB 3SBWC 4HJJL 1U93B 4NM4L 1J05B 3MLXL 4PJ8C 2BVEA 2OXHA 1I3GH 1H8SA 3SJVE 1MOEA 1NGWB 3AUVA 2A83A 1AIFA 4EIZC 3FCTB 1MH5B 1RK1A 4HJGA 3W39B 1XCTB 5CP7A 2JB6A 2GTWA 3OAZH 3FB8B 4JHZA 4I3SH 3PHQA 4LAQH 5HVHB 4F7TB 3OKLA 5KTEH 3D39B 4HWZB 1HH9B 3HNVL 3RKPA 4LRIC 2R1WB 1MIML 3O45A 4IHOB 3C60C 2NY2B 2CIIB 3L7EB 4Y4HC 4GW1A 3NMEA 5F3BA 1CL7H 4YLQT 1CLYL 3P0YL 2D7NA 5HHNB 1ADQA 3T3MF 4OCNC 1UXSA 1EHNA 4Y5XB 2BRRL 1KYOJ 2R69H 4JM4H 4JQXC 4RA0C 5E5MA 3V79C 4HWBH 2VL5B 4HHAB 5LGHL 2VXTL 5ICYB 5DFVD 3LV3A 5EO0A 2D7TH 4FS0A 4I5BB 5HHXH 3P30L 4XCYB 2AW2A 4ZSOA 4OZFA 4RMRA 1PW3A 5JDSA 4YHLH 4HKXA 5EOCL 5ISZB 1S9XB 1N2RB 1AXSA 3S96A 1A3RL 4LSTH 3T0EB 4QTIL 3EYFB 4OZHA 4ZXBC 1KJMB 1FBIH 5F7HA 5F71A 5JXED 1ERNA 1F3JA 1KTDB 4HGWA 5E2TH 4G9FA 3FAXA 1XZ0B 3LN5A 2ZCHH 1U8LB 4GBXA 4F9LC 2MPAH 4KK8D 4YZFF 3T8XA 1D6VL 3HS0B 3GSNH 3HRZB 4H26B 1U9KA 3LDBC 1TZHB 3BWAA 1KJVA 4OKDA 2V2TA 4NKMB 5A16A 1QFWI 5ILTL 3FQUA 3DTXB 4P9ML 5C6TH 5MEQA 3S34H 2DQCH 1HKFA 4PJFA 1MY5A 3P0GB 2VLRA 4NQCB 5TDPA 4C83B 3I9GL 4HZAA 3NH7L 2BK8A 3BJ91 3O2WH 4RWYH 3U7YH 2HJFB 2J4WH 4OQTA 3GK8H 2F8XC 2HRPL 1GPOH 3WYRA 2KH2B 1HIMH 5BZWA 1ZLSH 3H0TA 5C09A 3LD8C 4X7DC 1QKZL 1IQWL 3I84A 2XQBL 2FB4H 5EOCJ 1TTFA 4HV8B 3UYRH 1GAFL 5K9JH 5HDBE 3O3DB 1UA6L 2HKHL 2W59A 3JWOH 1O7VA 3MV8B 3TCLB 1ES0B 2PO6B 3RKDD 1DEEB 3WIHH 5L9DH 1WBYB 4Y88A 2VXSL 3GUTA 4U1NB 2LQRA 1S9YB 4ZOBA 1S8DB 4Z7VF 1I7RB 2NXZD 4P59L 4K3HA 4KGJA 1TITA 3VRJA 2DQUL 2Y1VA 3FB5B 3QIBC 2DQJH 2NY5L 4HAGA 3M17B 4CVWA 4KGLA 4K3GA 4WUUD 4NNPL 4WTXA 5J6GA 1ETZB 3WN5B 3G6DL 5HHPA 1Q9OB 3FT4B 4ZPVB 3ZTNL 4ZG1A 3MLYL 2DI7A 3T65B 4U1KB 3GSUB 1X5XA 3W5NA 4QRRB 2R15A 1G9MH 2PTVA 3GM8A 2OP4H 4G9FE 4RMUA 1MFDL 4ONOA 4WFEE 1OARH 5F6IB 1YY9C 1QRNB 3TNNA 4CVZB 5JXAL 3OB0K 1ZSDB 1ZA6B 1M71A 4ZFGH 4X4YA 1QPPA 3BYYA 3L9RB 4JANA 4LKCA 5DF0A 5MERB 1LE5A 4OFYA 2XQYK 5JIHA 4HC1H 4O4YL 4KUCD 1CXKA 4P5MB 5JW4Q 1KYOK 2VN4A 1FLRL 2VLRE 4GXVL 4KPHH 3D1MC 3DYMA 1NGYA 1AKJB 4LVHB 2IH1B 1FPTL 5FK9B 3FO2B 4KZDH 4O9HL 4Y16D 1IL1B 2VLKA 3G5XA 3OB8A 2GSIB 4OZGB 1S7TB 5C0EA 2XN9B 2MHAA 2FD6H 4ETYA 4M43L 2KBGA 3E6HA 4JLRB 2GK0B 2X4SB 5MI0C 1ZLUH 1N4XH 5DD5H 2DI8A 3ZKNC 4KHXL 5IT2H 3HTLX 1MLCA 5DT1L 2GY7B 2VLJE 4JQXA 1CD8A 2FATH 2VH5L 5I76A 2AI0H 5I8CA 1IARB 3VFVA 1V7ML 2C1OB 2EYSB 4NO5A 4X6CE 5I16B 3MRNB 5GS0H 1XCQA 3BIKB 4G8IB 4KI5F 2YBRA 4ACPA 3MCKB 5I1LA 1BM3H 1D5MB 3IGAB 1LHZA 1MF2L 4IM8A 3BZEB 3EO1B 5HDLA 3RL1B 1T1XB 1R3KA 4MLSA 5TPWL 2HTLC 1HYSC 5KW9L 1FFPA 4ZFFB 3EYUL 5FYJH 4LGSB 1T0MA 2Y07L 4F9LA 1G6RB 1DQDH 2HFFB 3PWPB 5T5FH 2EDQA 4QYOB 3FN9A 1HOCA 2WV3A 3HPLA 5IVXA 1YECL 3L5HA 1HN1A 4IIQB 3BZDA 2DQDL 3PUCA 2F54A 3QHFL 5GGRB 4PY8I 1WICA 1X3DA 5E6IC 4PJEF 3D9AH 32C2A 4PV8B 5H2BB 2PXYD 2DRUA 1EHLH 2RHEA 3CSYA 2I07B 5IBTH 5ETUA 1A6VL 3O3EB 3ESUF 2E9WA 1HHIA 2JJWA 4UAOC 1V7NH 5ESQB 4Y0GA 2HFTA 3LKSA 5GS2H 1MAKA 4PRAA 1S9WA 5DJ0B 4X7FC 3MR9A 5JHLH 4TN9A 5FUCC 1IT9H 5FOBB 2W38A 4TSBH 5H37H 3HNTH 3U36A 3FQRA 2BOCA 2BHUA 1GXEA 1IEAA 4O2CA 4G8GA 4OLXH 1QSEA 3OJ2C 3LQAC 3GSWA 5GSRB 3TA3A 3KG5A 5CJOL 3CMGA 3P11L 3F7YB 2J7LA 1NCWH 3QIBA 4IRSD 1JPSL 4LHQB 3V0AC 3S88H 1PQZB 1VB9A 4OZFG 3V5KA 2IH3A 4I1NB 4CJ1A 1EEQA 3UTTB 1E4JA 4ODUB 1G6VK 1R3JB 3MRQA 4NN7C 1T21B 2XICA 4K07A 4WCYL 3AREC 5B4MD 4HF5H 4HBCH 4POYA 1NMBL 4GRLA 1N6VA 4F2MA 2PUQT 3AU1B 4XPTH 1OF2A 3QEQE 3VDBA 4XNQB 3L5JA 4Y4FD 1Q9KA 1A1MB 2VDRH 1OP5K 1W8OA 5SWQB 1NEZA 1RU9H 1N5AA 1UH2A 4MCZA 4PJ9C 4Z7QE 3RNQA 1INDL 1U58A 4YE4L 2F54E 3QUZD 4KMTH 4KJWD 3ARZA 2CQVA 2XY1A 5E94A 5EU6D 1R5VA 2CLZB 5LQBL 2YRLA 1HHJB 1NEUA 1OVZA 1TJIH 1R3IL 1DFBH 1MWAB 3CIQA 2R2HB 5T1DL 4PJIF 1CDGA 3VRIA 4OF8A 5EZJB 4HUXA 3GSOA 3H2WA 4JFDA 3K81A 2AK1H 1KPUA 1MHHB 1EVTC 2ILLA 4MMXC 4F58H 2EKSB 3GNMH 3RWCA 8CGTA 3QUYC 3JTSA 1DUYB 1XH3B 3IT8D 3HAEH 4FFYL 4PGZA 4Y1AD 4Z9KB 5A43C 4PTTB 3H6JA 5I1KH 5BRZE 3ARBB 3ARWA 2CO7B 4I2XE 5I9QC 5HGHB 3T2NH 4KKAD 3L5WB 1KCSL 4NC0B 5CJ8A 3QJFB 4Z7UB 5C7XL 5DUPL 3OX8A 4I18B 1LK2A 5IMOA 3BXNA 3TO4C 1KLGA 4F33B 1SQ2N 2ITCA 2LU4A 2UWEA 3HNSH 3A67H 4YIQA 1UH4A 1IKFL 1C7SA 2XKUA 4M7LT 1PZUB 1U3HC 1QQDB 2Z8VC 3LIZL 5CLWA 5KZCD 3T77A 1Q1JH 2E7HA 5GGTL 1H15A 2QSCL 5BV7B 4KKCC 2JK5A 4JAMB 1IAKB 1RZFH 5GS1A 4A6YB 4X0KA 5E6IA 4NN6B 5DFTA 1ZTXH 1XMWA 2IALA 1F2XK 3CFBA 3KXFB 1CD1B 4LLDB 4PJXE 5TE6H 3KAAA 5SX5H 2X70B 2VLLB 4XXDA 4JFDE 5DEFB 4O02H 3LKPA 3MLWL 3O2VH 3LN4B 3QNXA 2QKIA 2KQNA 1WWCA 1QYGL 3JSSA 4TOYH 3BPOB 4AEIH 5CHNA 2BJML 1N6UA 1EGJL 2ZP0T 3RZCA 1A1NA 4NQDB 4HLZG 4EIGB 4MYWB 4JRYD 2VQTA 3MFFA 3DRQB 1CD0A 1NJ9B 4PP2B 2RAMA 1MFEL 3MACL 1T2QH 1RUMH 4LDLB 1CE6A 4FG6D 4ISVB 4KK6C 4WUUB 3W9EA 3QYCA 1HQRA 4XBEH 1IGIH 2AAVA 4LLUB 4FQCL 1HHHB 5M95B 1G7PB 2BHZA 3OKEB 1EBAA 1GHFH 4EBQH 2XKNB 4OV5B 2NTSP 1CFTA 5EUOF 5FHAL 2AQ3A 4JHAH 2B0SL 3AREA 2QL1A 4PRHD 5ICXA 2DL2A 1TCRA 2XFXB 4P0DA 4XVTH 3TNMA 4P5KB 3ZKXC 5AD0B 4F7EB 2FO4A 1CQYA 4D9QE 1I1CA 8FABB 3QG7L 1MRFL 3ROOB 2HVJB 2NTFA 4TVPL 1YC8A 3QFJA 4U3HA 4OGAD 4HS8L 2PTUA 3GSXA 3SDCD 2FX7L 3KDMA 5I1IH 1JWMA 1QLRB 3PP3H 1IM9D 1NGQL 4Z7VB 3OAYH 2YPLD 4YDIL 4NO0B 3GKWL 2UZIL 1XR8A 2EDRA 2VLMD 4Y2OA 1T7XA 1MEXH 3STLA 4G7VL 2X1WL 4ORGA 1XGQB 3QJHB 5CIPB 4RGND 1U8JA 1GGUA 1I1YA 1IGJB 4XPBL 1UGNA 4P5TD 4ZOCA 1S7VB 2EE3A 3D6GA 4G6KH 4DFIA 5IFHH 4X9BA 5KANG 5IB5B 5GZNC 2R4SH 4RX4A 3AC0A 3JUYA 4AIZA 2OQJA 4KXZH 3P4OB 1U8OB 2I60H 4K94L 3GHBL 4ENEC 5H8DA 3RWEA 3CVHH 4J4PC 1YEFL 2QSQA 4A6YL 1NBVL 2GJ6A 2DLFH 5CSBA 5CJQL 3OR6A 3TBSA 4L1HA 1IAII 3FQNB 5D1XC 4F8TA 1EPFA 3TBVA 5IB4B 2MMXA 1I3GL 1FH5H 2D31A 1UXWA 2Z35A 3SGEI 5FKAA 2QQKH 5EUKB 3S37L 3QNZA 1N0XL 4JFFB 3UZQA 3G5VB 4TSCL 5ADPH 1GC1H 4WFGD 3VXQA 4XCNB 4FFVC 3DX6A 4CKVX 1F13A 4ZAKB 3TO4A 3VFRB 3TIDA 4U6XB 3ZTJG 4I3SL 4LAQL 5DD3H 4M6NL 5KTEL 4H8WH 1A6AB 3MV9D 4MB3A 3UAJC 1M4KA 2V7HA 4ELMF 1EEYB 1U3HA 2Z91A 7FABH 2VKWA 3ULVF 3U7AA 4JFPB 5E00B 2HMIC 2CR3A 2NY5C 1CGVA 2XOTA 4M9OA 1JN6B 1CL7L 3BPCB 2OJEA 3G6JA 1NEZG 5J12B 3CAFA 1D5ZA 5IW6B 4QWWC 2NW3A 1SVCP 1IGTA 4J3VA 4KV5E 2R69L 1A4KB 4JM4L 3VXNB 3VFUB 4HWBL 3VXMD 3HI1B 3MLZH 1I1AD 2D7TL 5HHXL 2NY0C 2X4UB 4POZC 4XWOC 2P24A 2VAAA 3DUHA 4PB0H 1K3IA 1QSVA 3LEYH 2CPCA 2R1XB 2D03H 1F11B 1Q0XH 3D25A 5HI4C 1QBLL 2FEDD 4YHLL 4HUVA 1HHKA 3BIAX 2FEEI 4L4JA 4X7TA 3TIEB 4U31A 4ZFZB 4X6DE 5JPMB 4JJHA 1AP2A 1CT8B 4JDVA 1D3CA 1Q9LA 4H20H 5GHWH 3ROLB 1FBIL 1BWMA 3JUZA 3WNKA 5IF0B 3W0WD 4Y89A 3O4LB 5E2TL 1RUPL 3SCMA 1QA9A 2ZCHL 3BGFB 1SYVA 3MRPA 3VWJD 2W0LA 5DYOA 3QDMB 3DBXA 2LFGA 1VKXA 3JWNC 2MPAL 4GKOA 1FRGH 3GSNL 3GMQA 1JGDA 3U4EB 4U1HA 2ADGB 4WFFD 1EMTH 3HFMH 1WLHA 3OKKB 4LMQE 4ZQKB 5C0CB 5C6TL 3S34L 2DQCL 1ITCA 1G7JA 4BUHA 4RMVA 3QQNA 5IEHB 4ODBD 4FQ2H 4N90D 3GMRA 4L29A 3TN0D 3O2WL 5DJCA 4QNPF 3U7YL 2J4WL 4RWYL 4LQ1A 1A22B 1TCMA 3GK8L 5EZLA 5TQ2H 5L7XH 4GQ9H 1GPOL 4FFZL 3UDWC 2VDKH 5DD1H 5CWSB 1HIML 1ZLSL 3QUZB 4W68A 4NHCH 4HKBA 5C9KA 2FB4L 3UYRL 5K9JL 2ZSVA 1U8QB 4KTYA 2FWOB 4NQXA 3JWOL 2MCG1 2F58H 4GKSB 3QZWA 4PRDA 2HFGH 3WIHL 5L9DL 4BQ6A 4I9WD 4H0GA 3WHXA 1A9EA 5HVGB 4XNZB 4A2LA 3CD4A 3PP4H 2DQEH 4P2RB 5B3NA 3SDXB 5J8OA 4YR6B 4RSVA 3V8CA 2WBJA 3GMLB 2DQJL 2WUBH 5HDOA 4I0PB 1DBJL 2UYLB 3P9LA 4Y1AB 1KLUA 5TF0A 1DQQB 4BQ9A 2X1QA 2P5WA 4EN3D 2R9HC 4JZJB 5MENA 1RK0B 1P7KB 5KANI 5DQJB 1G9ML 5D1XA 4QF1B 3BPLB 2EYTA 2OP4L 2ERJB 1B4RA 3FKUS 1CS6A 3EO0A 3SKOB 5GPRA 5FFLA 4QOKD 5ERWB 5T3XL 3W9DA 5IVZA 1E27A 3MOQA 4AIOA 2B5IB 5F1KC 3REWB 4ZFGL 4PJIB 1NCUA 5ENWA 1YMMA 1MCFA 1A14H 1RJYB 4HC1L 1UEYA 1OAQH 3HI6L 3V6OC 3LHPH 1WIPA 2RFXA 3CMOH 3QIUC 1EEUA 2OL3H 2C3XA 4KPHL 4WDIB 3H3PH 4G8FA 2NY6C 4KZDL 3BX7C 3IJSB 2CDGB 4JY4B 4ZD3H 3VD7A 5ID1A 3QUXB 2FD6L 3NABH 4HFUH 2X4TA 1KTKE 2CIKA 4FZ8L 1N4XL 5DD5L 3OAZK 5LGKA 3CK0H 4B53A 4OCYH 2V2WA 4P3CH 5IT2L 3BN9C 5FA4B 4CMHB 2FATL 3SKNA 1H3PH 3WXWH 2AI0L 1MI5A 3BIBX 3FFDA 4APQC 4Y4HD 3SQBA 5DK0A 2BSTA 3GDBA 1NAMB 4GG8A 1K8DA 3QG6A 4ZNEE 1YEHH 4QY8A 1JHKL 3K8KA 1YN6B 5GS0L 1ORQB 4MNQD 2ESVD 3QWOA 4MHHG 4L4VE 5KSAC 2P5WE 5LAXA 1NFDB 3NACH 2L0DA 2P45B 5EC1B 3OTTA 3DNKA 3UYOD 3KYNB 2DWEA 4ETQB 3WS6C 1QFHA 4H25B 3MRJA 5A40E 1BQLH 4HUMB 1T3FA 2CLVA 3KYOA 5FYJL 4OD2A 3RVVC 3S3SA 2ZG3A 4G6FD 1WZKA 4ZUWB 5BS0A 3ISWA 3LZFH 4J3TA 5EIVA 1JP5A 5CKGA 4L1DA 4FQQB 1PG7X 4LHUD 1MCDA 1PG7W 4XT1C 3D9AL 5B21A 3ULUE 1EHLL 1FZKA 4NZJA 5IBTL 4BSVA 1IM9B 1ZLVK 4HBQA 4YDKH 2AK4D 5EWIH 3PWNA 3QQ9C 4N8VG 1V7NL 3UDWA 4J1UB 4LHJB 5HGDB 4PJBA 1RZJH 4CGTA 5GGSY 3E2HC 3IDYC 5DRNA 5BOPA 5JHLL 3JV0A 1NBYB 2J5LC 1IT9L 4TSBL 3O3DA 3HNTL 1ORSA 3BP4B 3WMSA 1FORH 4ONFH 3SDAD 3VU2A 1LO0H 4PJAB 3E6FB 4RMWA 5EUOB 2APWA 4IEFB 4C56D 4OLXL 5BVJB 3EAKA 4LCYA 4FABH 1MI5E 4NFDA 4U1NA 4F37F 1FZJA 2VDQH 2FJHB 2W9EL 1JPFA 4LLMB 1X44A 1NCWL 3MRHB 3NCBB 4IMKC 1VCAA 3S88L 3GBNH 4JKKA 5FECA 3GBMH 3DV6A 5F44A 1IQDB 5ISZE 3BRFA 3IDNB 3C2AH 1OL0A 4HF5L 4HBCL 3G6AB 5LGJA 1JIBA 2FZ3A 3O6FD 1FFOB 3EJJX 5GGUB 4PRPA 2ADJB 2DMKA 4XPTL 3HI5H 1OSZA 5IFAH 2VDRL 2QSVA 2XWBA 2Z31C 4M6OH 4UI2A 5ELIA 5BS0E 5CD3B 5ALBL 3DRTB 2AXGA 3HE6C 1RU9L 4WWKB 3OR7A 3U6RB 3TBTB 2WP3T 3E0GA 4OM0L 4E9LA 4KMTL 1BVLA 3SO5A 3PHSA 4KMQA 2EDYA 3BQUC 5SWSA 3V6OA 1JYVA 4L8SA 3QIUA 5E6ZA 4ZO8A 2ENYA 4HLJA 3TYFA 4RFEB 3K1DA 2BZDA 4JE4B 4XAWH 3KJ6H 4TQEH 1TJIL 4NDMB 1DFBL 3NIFF 2Q86B 3MLTB 1KNOB 2BVOA 4WU7A 5JQ6H 4DZ8A 5DLMH 3QEHB 3MBEB 3AAZB 1UEMA 1NBZB 1FCCA 4QTHA 1FZOB 4YNYA 4F58L 4NNXA 4HH9B 4C55A 3GNML 1S9KC 3VXMB 1OB1B 2ZOKA 3ZSTA 1BIIA 3T04D 2R2EA 1I1AB 4E5XA 1RMFH 1XIWB 4J3XA 1CXLA 3QZWG 1NC4D 3ILQC 5I1KL 1SJEB 5EFIB 1P2CB 3U30B 4NOFA 3STBA 4UOJA 2YPVH 4ODXB 4G9DB 2QR0B 4APQA 5T3ZD 4XNUH 3FT3A 4S1QH 3T2NL 5C08D 3CC5B 2VNCA 1HWHB 5HD8C 3ZKND 1ZT4A 1ZLUK 1DLHB 1C08A 1I1RA 4BFBD 3CNKA 5KSAA 2BCKB 5A2FA 3PNWA 4LIQL 3QQ4B 1VFMA 3WDHA 4ZS6D 2X1OA 1I8IB 3HNSL 1IZKA 4QRRE 3WS6A 3KJ4B 3BKJL 4CN1A 3I6KA 1KIPA 5D7JD 5E8OB 4K9EH