2E7LC

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
total genus 33
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7lC00
4ENED 4ZDHB 2ZUVA 4Y19E 5BZWA 4K7PL 2XPGB 1G6RL 3D0VA 4P3CL 2VDOH 3TNMB 4KGLA 5C07E 4FQ1H 4IMLB 2YWZA 3F5WA 1OW0A 3FN9A 3PP4L 3SGKC 4E41B 1I8MB 1YNKH 4NWTH 5JUEL 2AK1H 2IPUK 1NCDL 4URTB 1CFVL 5C0BD 4EXKA 2G2RB 5BXFB 2I9TA 2I26N 2CXGA 1LEKA 3DMMD 4QEGA 3L5WB 3NA9H 4KRPD 4S2SB 3WHE0 3X3GH 5BW7A 5HSFA 5C09B 1CICB 2IC2A 1M6OA 1G6RA 4PRBA 1DLFL 1LP9F 3O3EB 5DQJB 1BJMA 4JQIH 1NMBL 1RD6A 2YUXA 2XQBH 4M48L 4MQXC 3PDOB 5KSBF 1JZ8A 3MJ6A 4XP9H 4P5TB 5LCVL 4Z8FL 3VXSB 5B21A 1I1AC 5F71A 2GIYA 1SEBA 2FX8L 2B1HL 2VKXA 4GKSA 1P4BH 2DQHL 2GUOB 4M6NL 4ONFH 1OCWL 2HJKB 4X98A 4LCWB 2AK4B 4EI6A 1IZKA 4LARL 4YXKH 2JF1A 5JMOC 1MWAB 4WW2C 3MLSH 2OMNA 2D03L 3I6GA 4R0LA 2DQEL 1FYTA 1N64L 4I3RL 4XWGL 3V52L 3RZCD 3BQUA 4WV1B 4MAUH 4PJ8C 2RFXA 3W0WE 5F3BA 2X44D 3PWPD 1XGTB 3GIVB 3ARBB 3QIBC 2VZTA 4KRPB 4PR5B 1E4KA 5IBUG 1JYNA 3MRCB 3O3AA 1VFBB 1IBGH 3W11C 5D2LA 1R0AL 4CNIB 4L4VD 1ZLVH 3BO8A 1WWCA 2CMRH 4UILH 3WHXA 4GBXC 2BC4B 5FCUH 4KJPD 5E5UB 1U3YA 3I50L 1KJVA 4UQ3B 5C70A 1TQCC 2BX5A 5DWUL 3MUY1 2LU4A 4UV4H 2E9BA 5DJ8B 3SKUD 4ODVL 1FDLL 4LAQH 5C1MB 1JP5A 3QXTA 4O9HL 2H1PL 1QLRA 3HMWL 1L7TH 3VH8A 2VXTL 1QSEA 5E2WH 4OCYL 5IFHH 4CN4A 2AV7A 3C9NA 4LASH 4QXGH 3SE9H 4M62L 4U3CA 3RY5A 3N1PC 3MYZA 1TZHB 5KG9A 4HIEA 3NTCL 3RIAK 3J7HA 3GO1H 1ZOXA 3VFRA 4LCYB 1OF2B 35C8L 2B39A 1DP0A 4M1GL 3MXWH 4J6RL 5HBBA 5H37G 1EEQA 2HFGH 3VE0B 5L2KA 2WLZA 1KG0B 4HG4K 5IFJA 5C0GB 3LEYL 2NNAB 5E9DD 2GHWB 5CINH 3OSKA 4RAUA 5D9SB 4GRWE 1FFNB 4PRIB 2P42B 1L4IA 2I5YH 5DDHA 1MUJB 4G6JL 4WDIA 5FCUL 2DJ4A 1FVDA 4XP4L 2QR0B 1NGWB 2B7DT 3ECBA 3QG6B 3OKOA 4PJEF 1EH9A 4P5KA 3PL6B 4IOFD 4R9HA 4NJ9H 3CFJB 3GI8L 2FGZA 5TJWK 4KDTC 3DV6B 5F96L 1PLGH 1UT9A 4PRAA 5F7DB 4KH2A 2VDQH 1AGEA 1AKJB 3OXRB 1Y0LB 2ED8A 2NY4D 3STZB 3UPRB 2W0PA 1F4XH 1IKFL 5MEND 3V4VL 1FPTH 1J5OL 5JHDD 1U8OB 5FOBB 4X99A 4GBXA 2AQ2A 4JHZA 1BZ7B 3IDYC 4YHYC 3NGBC 2YEZB 1CGYA 2ILLA 5IVZA 1JN6A 3VXNA 5AZEH 5L8LB 2N7AA 3TESA 2B2XH 5C0JB 5F1KC 3RL2A 1RHHA 4H1LB 3U9PL 5DMJB 1ACYL 2JB6A 1UZ8A 2CPCA 3P9WB 4WFGE 4LP4A 3DRTB 1HQRB 2QADC 4IS6B 3K8LA 1MRFL 1JHTA 3HN3A 3BEWA 1UM5H 2KPNA 2ZJSH 1NDGA 1G6RB 2XN9E 3NACH 3GDBA 2IH3B 1PX3A 2YXFA 4S0TD 3X3GL 1OTUD 4EBQH 1DCLA 1NBVH 2N4IA 3P0VL 2ICWB 4M4RA 1D6VH 2ADIA 4P4KD 3P9MA 4Q6YA 5JR1L 1G7MA 4BKLA 3FQUB 2RCSH 4LPYA 1YNKL 5C0CE 2WBJD 4YH6A 2F58H 3I6LE 4NKDA 4EEEA 1S78D 1G6RH 2APFA 2XN9D 3HRPA 3QCUH 3MRPB 2MQ3A 3OHXB 5BZWB 4P46A 2R9HD 4CVXA 4X98B 1YECL 3FO9A 3VI3E 2CLRA 2LAGB 1MCDA 1VADA 4RAHA 5ESQA 3B9DA 3ZO0A 4N9GB 2OL3B 3GMNA 5C0CD 3CVHA 5C6TH 2XA3A 3IS0X 1VGEL 4Z5RA 2VR4A 3B3IA 4N0CC 4R7DB 5KVMC 4XP9L 5BRZB 3P0YH 2P5ED 2J8UE 5H8DA 4M48H 2ESVE 1L0XA 5DQJA 3ZKND 4C58B 1X4XA 3GMRA 3KLSA 1I8MA 4MAYC 1R3JA 4I0PC 3CH1A 4PRPE 4GUPB 2EXWC 4HLZH 5IG7B 1CLZL 4I3SL 2IPUG 3AM8A 3EYFA 3DSNA 4UU9B 4ZXBC 2Y25A 3JBG7 1GL4B 1C08A 1YMHB 1Y6NR 5EOQH 3RI5F 4QTIL 1TDQA 3KYMB 3R1GL 3SJVE 3GMNB 3BPCB 1BOGA 2EKJA 5K93A 5ESQB 4HIHA 4P4KB 2GAZA 1A9BB 3AY4C 5DFVD 2R4RH 4CMMA 3ARVA 2UUDK 1X5AA 3VFUA 2YD9A 2P5WA 4AMKH 1F6LL 3WJLC 3CSYB 1QA9A 1AE6H 4ZO7A 5HDBE 5EZLA 4MAUL 4JDVA 4N68A 4RQQB 3O41A 1T04A 3VXTA 4QXTA 3WFCH 1BOGB 3ARXA 3IFLH 4EQ3A 5I1EH 4KK6D 3P11L 1KJ2A 1NCAL 3R4DA 2EEBA 1HKLL 2G75B 2VDRH 3I9GH 2O5ZL 1IQWH 1UCTA 5E8NB 3KYNB 4IRSC 4MX7A 2A83B 4LLVB 1UKSA 2DI7A 4RMUA 1MCPH 3QFJA 1LO2L 5BQ7A 4WO4C 3DV4B 1IM3B 3QDGE 1L9NA 2Y6SC 3EOBB 4WFED 5GISH 4ZMAT 5JQ6H 2J6EL 1N26A 1D9KB 4JFPA 2XNAB 2VLJE 1QYGL 1EEUA 3WCYA 3E8UL 1REIA 4P5TD 3AS3A 4PJDA 3CVHB 3F62A 2V7HA 1ZTXH 5FUOL 3DX9A 2JTDA 1WJ3A 4QHNB 5IKCA 1EEYB 5TGBA 3DV6A 2P8MA 2BNRB 2QQLH 4FQJH 2QQKL 2VDPL 4MD0A 3UZEA 4KROB 4OD3L 3P4NB 5D7SL 4KHXL 1BPVA 4U1IA 2IFGA 4YEEA 5F7EL 3OKKB 1JPGA 1PYWA 4IDJH 5CSGA 3NBNA 4LHUG 1PY9A 5FF6A 3L5XH 4C83A 3DX7A 1ETZB 4UB0L 4MXQC 4YE4H 1WIOA 1PEZA 1JGUL 4KHTH 4ELMA 4I8DA 5K9JH 3S96A 1DQML 2OTWA 5CEYB 1IL1B 4Y5YA 3MBEA 1J8HA 2VLRD 5HYSG 5I30H 4NM4L 1U8NA 2ZOLA 4TUKL 2FBJL 1W72L 4U6VH 1QBBA 3HG1A 4RWYH 4Y4KB 2IAMA 2Q76B 4PB0H 2BFVH 5GS2H 1OGTA 3F7VB 4BFIA 1FYTE 1JIBA 4K9EC 4BQ6A 1DN2A 5I8CA 3DVNA 4JZNB 3UO1H 3TO4D 3VD7A 2VZ1A 5C08B 4E0RA 2VWEC 3D85A 1MCPL 3OKLB 2XA8H 1JK8B 4UINH 1CL7I 5E2UH 5CUSH 2C3GA 4HKBB 4HPYL 3H9SB 5I1GL 1V3KA 3GRWL 5ESVA 4FQIL 4MA7H 2H6PA 4RFOH 4XC1L 1ZT1B 3CZFA 4NFBA 4PP2B 3CNKA 2YRPA 1OTTD 3SJVD 1NBYB 2FECI 2PNDA 1KJVB 1B0GB 4UQ3A 3S3SA 4K8RH 3NAAH 1OB1B 4JB9H 1ZLSH 4ONHA 4PGJA 3INUH 1OAUL 4MJ6B 2AP2A 5ITFB 1Q9OA 4D0CB 1I8IA 1HINL 1I1CA 3CXHJ 3PQYD 1JV5A 4ZTPL 5JORA 3OKMA 3VWJC 2P7TB 4FQLH 4WHYH 1AI1L 2X4SA 5DFTA 5MEPB 3V9FA 3WFHA 2NY2C 3UTTA 2AXGA 2P44B 4NBXB 4L8BB 1A6AA 1I3UA 3QB7C 4CMHB 3L3OB 1A47A 3HNTL 2Z31D 3EJYD 1JV5B 1MI5B 3T8XB 1HYRC 5FFLA 1J0HA 1ZEAL 5KZCB 1JHKL 4N0FA 1QFWL 2XWJB 3W82A 3KHQA 3U6RA 3HE7B 1L7IH 1NCUA 3SPVB 2UWEE 5F7YC 3FB8B 5GIRB 4Z7UB 5F7FA 4ZFOL 4PJXB 3FHQA 5DSCA 3KPPB 2CUHA 3MRGA 4Z7QE 4LU5L 3RWHB 5B8CC 2BVQA 3C2SA 3TH3T 1YDPA 2BK8A 2FR4A 3IFPA 4Z7OF 3VFSA 4ZUWB 1XF4A 2Q7NA 3WMSA 4X6CA 3PV6A 3CFEA 3SE3C 1WBXB 4LIQH 2IG2H 3VW3L 1DUZB 3TBYA 3OWEA 2Z35A 2C1PA 4OFYA 4S1SL 4NJAL 1P7QD 3HHRB 5IHUL 1UM5L 3DARA 3QNXA 1A6WL 5E08L 2PKDA 1GGIH 1T1ZA 4ZSOE 4L8DB 5E4EC 4J1UB 3QEQE 1CLOL 2XXMB 3P77B 5DUPL 4P3DA 4Y7MA 4EN3B 4UOJA 3U0WL 1Q94A 3IFLL 4HJJH 3MJ8A 1SJXA 3WO4C 3WBDA 4TNVF 1LP9A 5F1NA 2BVTA 4PB9H 3LQMA 2P8MB 4KZDL 3T3ME 1X5JA 5J06A 1X5KA 1B4RA 1ZWIA 1YEJH 5IMLB 2RIKA 4GG8B 5HHMD 4D0DA 3LN5B 3C5JB 3BP7A 1IC4H 5EC1B 3LN9A 2L7JA 3V0WL 5IHZB 4ODSH 3JSSA 4QRUA 5EBWA 1I4FB 4POUB 1EGJL 1NANI 1JNNL 3SQOL 5D5MF 5EU5B 1F13A 5J6HB 1YY8A 1ZSDB 4KGJA 4P49A 1MRDH 4X9GA 4GMTH 2AEQH 4U7SA 4JPVL 3SDCD 1EO8H 3MRQB 3NACL 1BEYH 1WFOA 4Y5XC 2OCFD 1LD9A 3QXWA 3FT4B 1AHWC 1ZS8A 1U92A 4WUUD 3C5JA 2EYRB 4HFWB 4QXTB 1NAKL 4PJBB 5TQ2H 2R29L 4PJHA 3OX8A 4P59L 3QUXB 1HHGB 2VXSH 4KKCC 1LO0L 4H88L 1MFBL 2DTMH 5D93B 5I8KL 1KT2A 4QRTA 1K2DA 4N5UA 4PJ9D 2ZWLT 5HYSA 3U4AA 4HK0A 3TCLB 2BVYA 2AK4E 4K23H 4OZGF 4YZFE 1JZ4A 3STBA 3DTXA 5FF6B 2XOTA 3F7QA 1BD2A 3NCCB 2BSRA 4KI5C 4KVCL 4GT7A 4WI8A 5KZCD 3EYFB 5LG1A 4LHQB 4JVWA 4U1IB 5JDSB 4BUHA 2F5AL 4KTDH 5MI0C 3C5ZC 5DJ2A 5EOTB 2RGSA 3BSZL 4C57C 3DX6B 2MHAB 3FN0L 4I4WA 1CK0H 1HQRA 3BD4A 4UBDC 2A73B 1MFCH 2ICCA 4H1LA 3JTTA 4S10A 5SWZD 3D3VD 4XCYA 3TLRA 2V5RA 4RFEB 5LQBL 5DK2B 4CRPA 4JREB 4YHPA 3SCMB 5CMAB 2KZWA 2SEBB 5EUKA 3WFDH 2WBWB 4HWEL 3VDBA 1NC2B 1NCWL 2FRGP 3GM8A 1QQDA 2AEQL 1EX0A 4YHZH 5D8JH 6FABL 4JPWL 4HUWB 2JK5B 4NZRH 3RY4A 1T80A 4LPVA 3KPNB 5HHNA 1UJTA 1NJ9B 3TV3L 2HLFD 4W68A 4F80A 2I60L 4ZFFB 1ZV5A 1T1WA 4U1LB 3QNZB 4UAOB 3QUZD 2D7MA 3ULVF 1C16B 4G9FB 1QACA 3ZYZA 3ZTJH 1D5IH 3GB7B 4XP5L 3BZFA 1QR4A 5FYLL 1EVTC 4JM2A 1VESA 5HVGB 2ERJC 4KQ4H 2JB6B 4KY1L 4M43H 5MENE 3OKYA 1WBZB 2W0LA 4CU8A 4Z0XA 1UGNA 3M1BA 4FABH 4WDIB 3SDAD 1FBIL 2PO6B 1F4YL 4YFDB 3V5HA 4HZAA 2FBOJ 2J2ZA 2IJ0C 4J23A 1DQQB 1I8IB 5JOFA 4L3ED 2VR5A 5E6IA 5HHVL 3OB0K 1Q72H 4TVSa 3NCJH 3X11B 1P7QB 3QO1A 1Z3GL 1FL5A 2GJ6A 2IQ9L 2FX9H 5HGGS 3IDIB 5E8OB 4KRPC 4G7YH 4G5ZL 1I85A 4FQ2H 3NN8B 1U58A 2CRIA 2HT4D 5A2KH 5DR5L 4JY6B 2WINA 1N7MH 2QQQA 1IAKB 2VZVA 2VITA 4LOUD 4NN6C 3KYAA 5EZJA 1TQCB 1WCBA 2DQHH 1T6VN 4UUJA 3TVMD 1AO7B 5JO5B 4GQPH 5DUBA 1HI6A 5K9OB 4B53A 3LVEA 5JIHA 1OP9A 5DUPH 1KCKA 3FB6B 5DRNA 2H3NA 1OSZB 3L3IA 1N6VA 3TN0B 5DURB 4BM7A 4OZIE 1MLBA 4K7PY 5D1ZC 1BQLL 3JV5A 3NH7H 4WI2A 4RMSA 4UTAL 2EEAA 2P48B 2ZP0T 4YDLC 5E03A 3S98A 5IFAH 4Y1AA 3AB0C 3IU4L 1AXIB 4O2FA 35C8H 4WTZA 5DMIH 4S1SH 1RIVH 3N1FC 3SDCB 3EOTH 4AT6A 2DBLL 2NZ9C 5C0CA 5DHVB 3SDAC 3VGFA 1KNOB 1S7QB 3SKOB 5F7MC 5KS9F 2BDNL 5FO7A 2EDHA 1IAIM 3G6DH 1NGYA 2FJHB 2JJWA 5I16B 4Y88A 2O61B 2HFEA 5C71A 4O9HH 3K7UA 1BD2E 4RGNB 5I1HH 3RY6C 2Y5TA 3GHBH 5JQHC 3GK8H 3TYFB 3G08B 3MRBB 4OGZA 1IFHL 4TSCH 1KEML 1XR8B 3H9YA 4MA1B 1G9ML 4YFEA 5JHLL 5HHOA 4CN1A 1S5HB 3RVTC 3TM6A 1BHGA 4JFPB 4EN3C 5KVDL 4P9MH 4NM8L 1XF2B 5DJ0A 1XH3A 2A0LC 2X4NB 2XA8L 5EU4A 1TJHH 3D48R 1EHXA 4U1NA 2E6JA 3QFJB 3UO1L 1M6OB 4PJGE 4O2EA 4PR5A 3DVNB 4JZNA 3UTSB 3NPSC 4HWZA 2BSTB 2RAMA 1HZHH 4UDTA 2WZPD 2VABA 4NQEB 4EVNA 1UZ6F 1BZ9B 5JO5A 1R6VA 3PABA 4Y0GA 4PGDB 3WLWD 4MNGA 5T3ZH 4S11A 1RZJH 5FB8B 3T04D 1FNHA 4JPIA 4MXVE 3NABH 1EEZB 5FA4A 2V5SA 2YPKB 4NRXA 1KCVH 4GKNA 4KZDH 1V7NL 2DBJA 1Q9LA 5E00B 1B0GA 2EC9T 3U83A 4LSVL 1ZLUH 5B22A 5GS2D 3QH3B 3QUMH 5T1MA 1OL0A 1KB9K 4ZTOL 2HT2D 5D7LA 3WFEL 3CVIH 1K6QL 5A2JH 3VFVB 3D39A 4WW2B 5HPMA 1IJ9A 2JIXA 2A2QT 3KXFA 4NO0B 5T1KB 1IM9D 2DN7A 3NPZB 3FB7A 1NMBH 2DDQL 1QFOA 1WBYA 1NGXA 4PRBB 3HMXL 3SJVB 2R15A 2ZUSA 1C5DA 3RAJL 2LQRA 2FDBP 4JN2B 2YUWA 5EOCH 4XGZA 3DYOA 5F6IC 4YDIL 1ADQA 2NY1C 4KJWD 1I8LA 4XAKD 1HNFA 1RZ8B 2W59A 4HS8H 4DGYH 4L3EE 3VFNA 1S9WA 3V6OE 5B39A 4FTVD 5MEOB 1MCNA 3TBTB 4JM4L 1MIML 4KPHH 1FORH 1P2CA 3BYTA 2DTML 4QF1A 1MFNA 4NC0B 4TUOB 5MI0B 2RR3A 1TTFA 5J12C 5CEXA 5E2TL 3FTGA 1MCQA 4M6ML 4JO1H 2Z92B 4NO2A 4PG9A 4IBLT 4RDQG 5E7BA 3EAKA 2DYPA 4R90H 3C6LB 4QYOA 5FK9A 5CEXB 5KTEL 1I3RA 2B20A 3L1OL 4U6XB 4NNYA 4K7FB 1G7LB 3T2NL 1TTGA 2Z4QB 1N59B 4LLDB 1KCVL 4MS8C 4AENA 5IBLC 2A9NH 3O2DA 3R8QA 5JOPE 5LAXB 4KK8D 1NJ9A 2EDJA 2Q86B 3EUUA 2BOCA 5LVEA 5E8PA 2FWOB 1FFQA 2LVCA 3MBEC 1U8JA 4LSPH 4I3SH 4QCIB 4HAGA 1FZKB 5L9DL 3QIWB 3DUSB 2BNRD 1T4KA 5AUMB 2YA1A 3O2VL 4NIKB 5T3ZE 5KAQG 3FQTB 5I1HL 3AREB 2ZUQB 4KVNH 2FX7H 3JV4B 4KDVA 4U1GC 4MSWA 1RHFA 2R1YB 4YHNB 1F6AA 4OCXL 4M1DH 3P4MB 3MJ9H 3C09B 4AENB 2BP3A 3V5DA 2LU3A 3SKMB 1Q0XH 4MD5A 3MFFB 5I18H 2UY7A 1TZIB 3OAZH 3FFCD 3MOBH 1KIRA 4G6AD 3C5ZD 4LEOA 4NQVB 4X0KB 3IVKB 1IAOB 2DQDL 4XVTH 4UTAH 2ZUWA 3JWDH 2HKFL 3Q6FB 3QUXC 3CUPB 4K3EH 3M8OH 2YD7A 1FFPB 5T3XE 1MUJA 2YA2A 1BQHB 3VI4F 1YEEL 4DGIL 4IHOA 4FXLA 5F97E 4EBQL 4PJ9C 4YK4B 4F7MB 2FBJH 1TTUA 5GGTA 4LHJB 5CILH 5GRYA 3MPCA 1F4AA 3T0ED 1JHTB 4HXAL 4B5EA 1CDGA 5C0AA 3EGSB 5KSAD 4G7VL 4L8SA 5DEFB 2GKIA 1SM3H 5KSAC 5CLWA 4HWZB 3SE8L 3DUUA 3GSWA 2P24A 1HE7A 2W9DH 1WITA 2KDGA 1I7UB 4XI5D 3HZYA 4XMPH 3IDGB 1NH6A 2OJEB 1B6DA 1GC1L 1ZWIB 4LSVH 4X80H 4YJZL 3WDHA 5LJYH 3O11A 5IROA 1PZ5B 2A74A 4PLKD 5EU5A 3O6KH 4K3HA 5HI3D 3UAJC 1EEZA 5C8JA 4BQBA 2QQLL 5HGBA 2D9CA 3PV7A 4NUJB 3QT2A 3VDAA 4Q0XH 1C5BH 1AR2A 4ALAH 2HLAA 2E8YA 2OYPA 4FFWD 4KROD 2NPLX 4F7EB 3FT2B 5DJAA 1RFDL 4Y4KD 1M05B 1A6VL 3VRIB 4PJAB 1OM3L 4LOUC 3LH2L 3NH7L 4FOMA 4U1NB 3UP1A 4PGEB 3EIFA 2XWBB 3MRIA 1SJEB 4PD4J 5IEKA 3RWGB 5C6WH 4KRMB 5D96C 3PJSA 4X8XA 4NO3B 5CGMA 1M71B 1UACH 5F7KC 5KSVB 1EAPB 1OGAD 1X4ZA 1S9VA 1WZMA 4UUJB 5EU3B 4J3SA 3MRBA 2FGWH 4PLOB 5TE4L 2ZCLH 3TBVA 3IGAB 5F9WB 1HKFA 4WWID 4H0HB 4AMKL 2R0KL 2OZ4A 4JCLA 4AIXA 2P5EE 4I0PD 1P6FA 4Q2ZA 2V2WB 4CDGC 1OD9A 1ADQH 1KNOA 1K3ZA 1S7QA 1XGPA 3SKOA 4C55A 1E6OH 2EIZB 2ID5A 1HYSC 3QIUC 3DHMA 3IETA 1CGVA 4X5XA 3MRKA 4U1JB 4M6OL 3MJ7A 1UH2A 3KWWA 1KXTB 4OGYH 4XB7A 5CHNB 3GBMH 5A16B 1QLRB 1VACB 4P2RA 3S34L 1WZ1H 3UJIH 3RRQA 3V5HB 5BS0E 5HPOA 2X6MA 1NAML 4L5FL 2F19H 3V0VA 2E5EA 2MTPA 2YOCA 5GGVY 4RGNC 1ZHKA 2VQ1A 4ZO8A 1YEIL 1A21A 4FZEL 4O51A 5TFSH 5HHOE 1HN1A 1OAQL 2JELL 1A7QH 2FO1A 4IIQB 1CXFA 3Q5YA 2NXYC 4E9LA 1IT9H 4DKEH 4F7CB 4PJAA 3IJYB 1Q9OB 4LPXA 3RP1A 2FX7L 3RDTD 4O00A 3NZHH 3KDMA 3VG9C 4X7FC 4KKBD 1B9ZA 5AYUL 5F1OB 1QBLH 1EERB 4PLJD 1BZQK 4PJEA 4AZ8A 5MEPA 2CKNA 4XCNA 5KG9B 5C2UB 1U8MB 2GY5A 1F3JA 2XY1A 1O7SA 4JM2B 4XVUD 2YD8A 1F6AB 5LWYH 5GGQH 2XRAL 1LEGB 1UVQB 4N8VG 4NZTL 1K8DB 4BZ2H 3GI9H 1HYSD 4RMWA 4MD5B 4NP4L 1OCWH 4KK8C 5IV2B 1QRNE 5T1LD 4Z76B 4M1CC 3IF1A 4X9BA 3GMMA 2ZSVB 1RZKH 5EC2B 4MHHG 3IDJA 4MB4A 3K80A 4IMKC 3LQAH 3DIFB 1NCAH 5F8QC 5D70L 3L5IA 5C0AE 4S1QL 4K2UL 4OGXL 3QUZC 2E7LC 5I8CB 4MA1C 4TULL 2Q87A 2Z8RA 1RUQL 1CDUA 3GJFK 3NZHL 3MTRA 1LEKB 1CFVH 2HJFA 4BJLA 1BLNB 2X1OA 1DSFH 3NCYS 5FGRA 3ALPA 4AM0A 2Z8WC 3VRLF 5EO0B 3WJJA 1AGBA 3TPUB 1YEIH 1KEGL 5DRXB 2HA1A 4LSTL 3WFBH 2BOBB 4R97B 5JW4N 3ARBD 5IUSA 3EO0B 2Y5EA 2HTKD 3ZMRA 4GRWF 3MRHA 4PGZA 4YHNA 3WIHH 1I9RL 4YR6B 2WIIA 3KNBB 2XKUA 3DXAB 4WUUA 5ACZA 4OAWB 5EFIB 4U1GB 1YMHA 5TPWH 3S7GA 1J0JA 43C9A 4FRWA 5DJDB 3CFCL 3T0BA 1INQB 3O2DL 3SKNA 3GFUA 4X6FB 3MBXL 4G8FB 5J1AB 3VW3H 4OZIF 4HXBL 4D8PA 3B9KC 1WTLA 3VFOB 5TF0A 2NY7H 3FN0H 1YMMD 3QQNA 4KUZH 1NFDB 3DRQB 3QBTB 4EJ1C 2HVJA 3QQ9D 5L6YH 1IC5L 3EFFB 4L4VB 4PREA 4FNLH 3SDYL 1CGXA 2VAAB 4Z5RB 5C08E 4Y19A 5TE4H 3DURA 3GSXB 2NLJA 4NN7C 1S7VA 5A40E 1XIWD 3PIQA 4MX7B 4OCWH 5TDOB 3U0TA 1XGQB 5F6IB 5I75C 1YYMH 4P5MA 2R2BB 4DVBB 1JUFA 2GK2A 1JRHI 1EXUA 4H26A 1EFXB 2XV6B 4JKKA 2DD8L 4YHKH 1KPRB 5EPMA 3MJ8B 1RJCA 4OB5L 4AYFA 4PRPD 1OM3H 5DWUH 5CBEA 4R4NC 3NIFE 5BCAA 3Q1SL 1ZGLM 3FFCA 2W60A 3QDGD 4WFEE 5DVMA 5H94B 5CJXA 3TYGH 4PJCE 2B4CH 3DJ9A 1NUGA 3PABB 1MQKH 1GOGA 2AKRB 5DRZA 4YC2B 1OAUH 2EYTB 4M8VA 2IAND 4QGTA 5D1XC 2Q6WA 3TO2A 4RGNE 2ZZUT 3G5YB 2R1XA 2DICA 4K71B 3BN9D 5GGRY 3WDIA 5C0JA 3BP6A 1CICD 1FLTX 1AGCB 1ZHBA 4TTGA 1JVKA 3UTTD 2QSTA 5IF0A 4Y4FB 2ESVA 5IT2H 3I6KB 1CLYL 4UT9L 3S5LG 3U4BL 2EO1A 4FQIH 3CSGA 3CPLB 1JTOA 4RDQF 3D39B 3ZKNC 1IGIH 1H3PH 1MVFA 2GSGA 5MENB 1P7KA 2FR4B 2EE2A 1GAFL 3ZDZE 4PLNC 3MCG1 4U3XA 1RSFA 1PEWA 4LSSL 4OKVB 3CXDH 1EO5A 5HTSA 3CFEB 5DHVA 1NBQA 2MWCA 3GJFH 3VRJB 4JY4B 4WI6A 4WW1B 1FCGA 2WBJA 1C5CH 2O61A 4DGVL 2Q8AH 5AWNH 3CFJA 3O3BA 1A14H 4XMKH 4WUKL 4L4JA 1FZMA 5IQ7H 1BECA 5EU3A 2I07A 5J7CC 4KXZH 3QXAA 4S1DC 3ARGC 3ZTNH 2F74B 1NLDH 3E3QE 5TQ0L 4KTDL 1T20A 4JE4B 1A7PH 3V0VB 4Y4KC 3SGEH 4J1UA 5DRWA 2JJTA 3PG2A 1KGCE 1UWXH 1JPFB 3QJFB 5DJCB 3RZWA 5IR1A 1TZGL 1MWAH 3WFEH 3GUTA 3BEWB 2P7TA 1QBAA 1XGYH 4DKAA 5GZND 3PQYE 1TETH 4JG0L 5BZDA 1EO7A 3NOIA 2WBJB 1L7TL 5JIKA 2C1PB 4DZ8A 4KKLC 5CJ5A 3MRKB 1MFBH 5C3TA 1U8OA 5FOBA 4Z7NE 4PJ9B 1G9NL 4LSRL 1X6LA 4DW2H 3BJLA 5A2IH 5KANI 3I75B 5LXGL 1UENA 5ENWB 3EW3B 4QHLA 2JCCB 1RZJC 3DPBA 4XVSL 4OF0A 3KHOA 2L7UA 4LGSB 4GAGL 3MLTB 5CGYC 1JGEA 1ODAA 1TJGL 1MPAL 3QG6A 5IB3B 2Y9RT 3DXAE 3GSNL 4NQSA 4GMTL 4PJCF 3GSQA 1H3GA 2F8VA 2K1MA 4BSJA 4KTEL 1AQKL 3SPVA 3I2CH 1OAZL 3C60A 5FUCC 2ZNWA 5K59E 1JK8A 4P9HC 4NHCL 5DJ6B 1DBAL 2E6PA 3V0WH 3N0PB 4WJ5A 1KBGH 5JOFB 1AIFA 1HKLH 4LPWA 3CFBA 5GISL 5ID0B 1T2JA 1WC7A 15C8H 5DHYB 2FH6A 4MJ6A 5ITFA 1XT5A 3ARWA 1SQ2N 4GRLC 3P73A 3E6HA 1LO2H 1AJ7H 5IHBA 4XPHH 4LCWD 1U3HC 1BQHG 3BAEL 4GXUN 1AO7A 1RK1B 3L5XL 1DBJH 3QDMA 5L0QB 2WUBH 4MJ5A 1MJ7L 2UY6A 3GSQB 1KFAH 2ZG3A 5T33H 1AP2B 1NEZB 4JKMA 2AGJL 3BDYL 3FQRA 1IKNC 3KPSE 4TPRL 3FZUC 1U8KB 2WV3A 4GFTB 1FG2B 1MVUA 4G7VH 4G8GD 1KYOJ 1MY5A 4HFUH 4NC1E 1U58B 3RWEA 4QHUB 3FB5A 2GTWB 2PCPB 4PRID 1A7RL 4OD2A 1NFDF 3VMNA 5HHOD 3MOAL 3K4ZA 3WNNA 5I8OH 3MCKA 2A77H 3QO0B 3MBXH 4LMQI 5FYJH 1P1ZB 3MLUL 4GQ9H 1BD2D 1NLBH 5E6IB 5GRZA 1UXSA 1NCBH 1TLKA 3PDOA 2GFBA 3VD4A 4MWFB 4U6VL 4X4ME 4GRWB 5HGDA 2IGFL 1QLFB 1GAFH 1E4KC 2A83A 5KSVA 4XPBL 2BOCB 3N1QC 2H2PC 4N0YL 4JFXA 2DQGL 4JG1H 3BIBX 4Z77A 5IT2L 4X4YB 4AG4L 4RRPA 4EIZC 1IGTA 1SJHA 4O5LH 3ZDYF 4QRPA 4G6AC 1OAXH 2OI9B 1HIMH 5IKCB 2VXVH 4UNTA 3CFKA 1N5AB 1I8KB 2HFTA 1N2RB 1XGUA 4F2MA 4WI3A 2JB5H 4LMQE 3BKYH 5CJQH 1S7SA 3QEQB 2XNAA 3AREC 4GW1B 3O4OC 4HBCL 1MAKA 4I9WD 1XGQA 3OAUL 5CJBA 4P4KA 4Z7UE 1G7PB 3CDFA 4YDJA 3ARZA 4K94L 3HUJE 1N8ZB 3ARDB 1SY6H 2HYMA 5C0BE 4N5EC 2VLKA 2GJJA 2D7PA 3IDNB 1KELH 4N8VA 3D18B 3G6DL 3SDDD 2VDRL 3I9GL 1KJ2B 3DX6A 3WE6B 3B9KD 1YNLH 4IRJA 4F9LA 4HPYH 3GK8L 1MCCA 1IGCL 5I8EA 4YBLC 4TVPD 3D5OF 1BAFL 2VL5B 5IB2B 1S7SB 3QEQA 3HPLB 3QI9B 4KPHL 4L3EA 2NXZD 5L8KB 5JHDA 2YBRA 3IU3B 3SOBH 5E5MA 1A2YA 4LCWE 1MFEH 1T04B 4WHDA 2AJUH 1YPZB 4HKXB 3D0VB 3ILPA 5MERA 4LEXL 2LU7A 5DI8A 3UPCA 1JUFB 2AJSH 5ALCH 1K4CA 3S35L 4M5YL 3TBTA 2EDFA 3QUXA 3VGDA 1T1ZB 4RWYL 1H5BA 1NLDL 3RIAF 1KN4H 1QSFD 3OF6D 2DQDH 3QEHB 1T6WA 2DQCH 1BGXL 1RZ8A 5BOZG 4ZFGH 4MNHA 5A43C 1I7RA 5I6XC 1LQSR 3VG0H 3EYUH 2CDGB 2NY0D 4UTBL 1Z2KA 3TFKC 1MRCL 4HUUA 4D0BB 2Z8VC 1ES0B 2ED7A 3UBXG 2VH5H 1ND0B 3NIDF 4JDZB 4OUUB 3EZJB 1RJZA 5FYKH 1A02N 4IOSD 3MMEB 1KACB 4NQCA 3H7BA 3ULVL 4Z9KB 1IQDA 1KIQA 2CLZB 4JO2H 3U7WL 4OD3H 5D7SH 2VTFA 5FV2A 3VFVA 4QY8A 4F58L 5EBWB 3QIUA 4M00A 2A6DB 3MGTB 1DANU 2GT9A 4F7PB 2GI7A 2F5BH 4U1MA 3H0TA 4Y16A 4DUVA 4PJHE 4IRJD 3TEUA 1DR9A 4HLZG 1QYGH 3QJHB 2OTUB 4GAJH 3RKDD 2FZ3A 3OQ3B 1U8KA 2VZSA 3B43A 4RSVA 4L3CA 3QXDA 1PSKL 3KPPA 4XHJD 3OR6B 1JZ7A 5DURD 1TJHL 3OKNB 3DGCR 1PSKH 3HTLX 1YPZF 5TH2A 4I18C 3RL2B 1ZLWK 3HE7A 1V7MH 4QTHB 4X4MA 4Y5VC 1MY7A 2IH3A 4JY5H 3RL1A 3WFCL 5K9KA 3CK0H 1J7VR 3AMKA 2XG5A 4KI5F 5CD5D 2YWYA 2WK2A 3K8MA 3N85L 5E2UL 1JWUA 1FNFA 3THMH 5L8JB 4DN4H 4Y5VA 4PBVC 3O6FB 5GGSA 3VXRE 5I1LB 3O6KL 3KPQA 2C1OB 1MFDL 1Y0LA 5LBSH 4TQEH 4U1HA 4W81A 4L1DA 4QXGL 1YEGL 1RJYA 4WO4D 4JQXA 3O45A 1RUPH 4Y8DC 2CIIA 3IKKA 5ID1B 2VLKD 4NNXA 1B0RA 3F6LA 1SM3L 4WEUD 3RWHA 3O45B 2F54B 4OFKA 3MGOA 3BGAA 1V3MA 2P24B 1FL5B 3QFJD 5C0DB 5GPRA 2X7LA 4JO3L 4P23B 1T03L 1CDJA 5HHME 1NL0H 2R4SH 1BBDL 1F58L 2WWKT 1CZ8H 5BV7B 2E7LA 1YEEH 2B5IB 5L88H 1F3DJ 2OP4H 2VDLL 5FA3B 1WWAX 4YO0B 1U8IB 1PKQB 2X70A 3H9SE 3LMJH 5J57B 3PP4H 1UJ3B 2HFGL 3G6JE 5M95B 1QHOA 1JF1B 1KJ2L 3GSRB 2EH7H 4MA3B 3THML 2BNUB 1XZ0B 3PWPA 4NQDD 1FZOB 4NQEE 4LCUB 4HIEB 3VXUB 2CDFA 1KTDB 4NQSB 4K9EH 4PRNA 4LU5H 3IXAB 4ODBD 4R4ND 3HI6L 5TE6L 3UTOA 3RGVB 3RGVC 2MPAH 3ABZA 4RFNC 3DX8B 4OFDA 2QLVB 5DZOA 2DM3A 4LCWA 3U7YL 5F3BB 1MOEA 5SWSA 2Y36H 4HF5L 1KXQE 2VLLA 3MUGA 1MLCA 3I6GB 4NKMA 3MROB 3MREB 5JNYB 3OAUH 4NUJA 5E8DH 1NBZB 1U3HB 4L4VE 4NZTH 1F6FB 2DM2A 3DSFL 1DBAH 2AXJA 4JZJC 3U46B 3P40A 4F33B 5DZNA 3WHXB 2FO4A 1L0QA 2WM0A 4ODTH 4WU7B 3PHQA 2R23A 1T4KB 5AUMA 1EV2E 5D6DC 3QQ9C 4ZNCD 1S7UB 3TVMB 5KVEL 5KVFH 1J86A 4A2MA 1ND0A 4RFEA 3EO9L 1FPTL 5CSBA 2EYTA 4L8SB 1KIQB 4BSWB 2AK1L 4XVSH 5TE7H 3BH8A 3UTPE 4HIJB 1TVHB 1CT8A 4NKQB 1A5FH 3RVWC 1B0WA 3L3DA 3GIZL 4EI5B 4DVRL 4RIRB 2A38A 3DX7B 4D3CH 4J4PA 2CRZA 2FIKB 1T66C 4KRLB 1A6WH 1VPOL 5ABDE 1A2YB 2I07B 1MSPA 1A7QL 3CDCA 5EPMB 1E4XL 4APQD 2CIKA 1URLA 3WFDL 3P4NA 2FX8H 5LQBH 1IARB 3WJLA 1NLBL 2YA0A 4KUCD 5C0RL 3MRRB 5C0IA 3U0TB 1NMCC 2DM7A 2PW2B 1NFIB 3MLYH 1CK0L 3S35X 3I6LD 3LKSB 1BJ8A 5JW4R 3MRLA 1YECH 5MEQB 5DK2A 5D93C 1ZHLB 2IADB 4ORGA 1N5YL 4PRDA 1TNNA 3FO2A 2XKSA 1YQ2A 3NTCH 4PUBL 4DAGL 3KYOA 3I3DA 3KYKH 1QD0A 1RIHH 5GRVL 2BERA 2Z93B 2EDQA 3V6ZB 4JO4H 4XWOC 4EDXA 4P4RB 5L2JA 2Z91A 3B4NA 4HUUB 2DQIL 5JMRA 2CDGA 1I1AB 1LVEA 1OTUC 1M7DB 4NO5B 4YDKH 4R2GB 2VE6A 1FDLH 1NGQL 4JRYB 4LAQL 2ZSWB 3QEHA 3TCLA 1ACYH 4PRHB 3C09C 5B38G 1UA6H 3RWFB 1A6VH 5IMMA 1QA9B 1ORQB 1S7WA 3ES6B 3RJQB 4XVUC 4ZS6D 3WUWA 1YJDC 2PO6C 2AJSL 5ALCL 3ET9F 3S35H 4NC1C 5I66A 1I3GL 2WLYA 1T0NB 4XP5H 2O5YH 2K7PA 3C6SA 2ZSWA 1ZLUK 3UTPD 3K0WA 4GBXD 2AERT 2EIDA 3C8KA 3DRTA 5AAWA 3D39E 4X5WA 4XPAL 3Q1SH 4H20H 3V7AG 3QULB 1IQWL 1A1OA 2GY7B 4BK5A 3CDGB 3ARGA 4HUVB 3ZYOA 3CH8A 5D72H 1IGYB 2IEPA 2WMPA 4TUJB 4HCRL 2R8SH 3SE8H 4ZQKB 5H2BB 2YK1H 6FABH 2ENYA 3RZCB 2XZQH 2NCMA 1C1EH 2MQCA 1FIGL 2X09A 4OZHA 25C8L 3GZKA 3NFPA 5EB9A 1N5YH 5DJZB 1NCTA 3X12B 1NEZG 1GC1H 3LSOB 1CGWA 5IVZB 5T5NG 5C3LD 4PJBE 3VXUD 5F7DA 1MIEL 1CD1B 2XTLA 1GCFA 2Q3ZA 2F53A 4ESKA 3SKNB 3RWEB 5C2BH 1MREH 1IM9B 3MUZ1 4HH8A 1J0KA 3QIBD 1CWVA 5FUZL 5IB1B 4OQTA 5L6YL 3VWJA 3UTSE 4XB8A 3RAJH 3DXAA 1MFAL 4LHUA 4J3XA 3RNKA 1A4JA 4NM4H 4M9OA 3UDWC 3VXUE 4WHYG 1E4XI 4U33A 5T1MB 3VD3A 3QRGL 4IDLA 1P5VA 2QKIA 1GIGL 4XNUH 4O2FB 4PBWD 6CGTA 3U79A 3O9WA 1JFQH 5DXWA 1U8QB 4K23L 1WFNA 4M5ZH 4PRHD 4NSKA 4PJHB 4WY7L 3UJTH 2H3NB 4XAKE 3Q48A 2PUQT 1DUZA 3MGAA 3C60B 2ZCLL 2QHLA 1T21A 4U1SA 3G6AB 3GIZH 3PHOA 4MVBC 4PPTA 2FL5A 4PS4L 1FVEB 4YAQB 1EHLH 3VFSB 2NW3A 2YZ8A 4ZFOB 3UTQB 5EZIL 2XKNB 2FX9L 4DZBA 4KJPC 2NX5A 1DQDL 4U1KA 5IWLC 3MV8B 4GO6B 4JFFB 1GOHA 4PTTB 4Q58C 1CU4H 3OGCA 5C6PB 3VXMB 3G6JB 1JNHB 1VFAA 5EC1A 1LDSA 3BP7B 1JF6A 1JTPA 1RU9H 1Z5LA 4OZIA 3ZL4L 3TYGL 1ZTXL 4LBEA 4JFEB 3HE6A 1Q9LB 2X4PA 3DX8A 5M7QA 3HFML 4AG4H 3DBXB 2BVPB 1HOCA 4RA3A 3R0MA 4L9DA 2XIDA 4NQTA 4WFFE 4XTRD 4GRMB 4UIKL 3GJEB 3TBSA 4U4BA 2VLRB 4W4OA 1H5BC 1RZIB 3BH9B 1IEBB 3FQWB 1RZGB 1FVCA 4IJ3C 3CGTA 3QUKA 3LS4H 5BO1H 1U8IA 2X70B 1K8IB 4ZSOB 1JNLL 1KG0A 4PGBA 5DLMH 4F7TA 2BXYA 1SJVA 4QRPE 8FABB 1MHCB 4JPKL 3R1GH 5ADPH 5EIQA 4DAGH 4YDIH 5GZNC 4JFEA 5DMIL 4NZUH 3T0AA 3QWOA 4Z7WA 5DJAB 3SGDH 4AH2B 3FT3A 3QUZA 4XWOD 5A2FA 5LKNA 1GGBL 1A14L 3G08A 1OSPL 1PX4A 3VXME 2O5YL 5SWZB 1QSEB 3ZYJA 4QTIH 4HLJA 1ITBB 4EDWH 1JL8A 4L8SC 4UQ2A 5J6GA 3MLWL 3A6OA 1F8TH 5DVNA 5E4IA 4XNMA 2GTZA 4YAQA 4XX1E 1B2WL 1MEXH 4X6DB 4JY4A 1QOKA 1LHZA 3BESR 2HN7A 4MQTB 5DJXA 4EI5C 4YHPB 1MCHA 3G9VA 3RHWK 3TJHD 2G60H 5CP3H 4WWKA 4WFGD 4IRSB 4XCYB 5GS1B 4Z7WB 3DI2B 4HGKC 3ARSA 2GSGB 5IK3A 4DVRH 5MENA 1IQDB 3U6RB 5IROC 1FV1B 5ICYB 4NRYA 1RZJL 1FZMB 4OZHE 1A1OB 3I85A 4JDZA 5E99H 3ZHLA 1FNAA 4PJDE 2NXYB 5EIVA 1ES0A 2VDKL 2VRAA 3RWIB 1KCRH 2VIRA 3AC0A 4G42B 4PUBH 4NN5C 1DBMH 3OF6A 5FM5M 4X9HA 3IDMA 1N4XH 1KTLA 1UM6L 1A64A 2X4QA 3KPRD 2HT3D 1WCQA 5E6IC 4F15C 1YUHA 4G43B 4P3WA 1UWEH 4LGRB 1HCFX 1X3DA 3CK0L 2R29H 4LSPL 3D25B 3SE4C 5EBMA 2W0FB 5FHBH 1INEL 1F4HA 1H3XA 4I77L 4KJQC 4KTEH 2A74B 4NPYA 5CS7A 3DHJA 3TA3B 4XCEA 4YHLL 2AABH 4NOBA 4NWUL 2W9EL 1MPAH 4OFVA 5ACMA 1FAIH 2CK2A 2G5RA 3QUYD 1FAKT 2MCPH 4LLQA 1T2XA 1TNMA 5KOVC 2R69H 4P5TC 3PL6D 4HQQL 1KIPA 1N0XL 4ODUA 2Q6WB 2WSKA 5D71L 4OF8A 5I73C 3TJHC 2R8SL 2E27L 1S7XA 1C12A 4FQXC 3ARGB 5IEHA 1DQQA 5C08A 4CVZB 1A6PA 3ULSB 1B90A 2P45B 3JWDC 4XT1C 1INQA 1NUFA 1KN2H 3E6FA 4ODUB 2FEDC 4L4TE 3MV11 1Z9SA 3UBXI 3RVUD 4D94A 3D3VB 4IMKA 3RWDB 4OTXH 3W9DA 4FQCH 4HJGA 3T0EE 3TH2T 3KNBA 3MX0A 1U3HD 3RKDC 2BJML 2PTVA 2DJSA 1C5CL 1PLGL 1JHLL 5E94A 3O8XA 4G9FA 3HAEB 4JVPA 3DI3B 12E8H 2Q3AA 1XGRA 5EN2A 4JFDB 1QLEH 3A67L 1S7VB 3SKMA 3CXDL 4NKDB 3G5VA 3BPCA 1CDCA 4ZD3L 2EYSB 3VWKA 1Q94B 2W07A 4HXAH 5ITBH 4OZ4B 1XFPA 4OZGE 3MLRL 2COQA 1FYTD 2J3SA 4P5MB 3AGVA 5EN2B 1A5FL 3L95B 5E1HB 3VXMD 1QSZA 1KLGA 3PWUB 1CXLA 3H7LA 1CD1A 3QIWA 2XZAH 1QNZL 4HFWA 2AI0H 2J1KA 2R0KH 3RIFF 3QO0A 3W2DH 5SV4A 4K71C 4NKIL 4LCCA 4DQOH 1BVLB 4GW5A 1A6ZA 1YMME 2NY1D 4KJWC 1HQ4A 5ILTL 3OJVC 2X4TB 4XNYH 2UVEA 3ZHDA 3GBLA 1NUDA 4U3HA 1A1MA 1C12B 4XNZB 4APQB 3UTZA 2DLEA 2EDWA 2QTEA 1YY8B 5I75B 1KULA 3IFOA 5ESAA 4L9LC 1QFWH 1CBVH 3TN0C 1T1YA 5JDJA 2VLJA 3D69A 4FFYH 1YYLL 1E4JA 3CX2A 4QWWD 4JRWA 5D7KD 1J8KA 2HTLC 4UV4L 3NPSB 1TJIL 1XIWA 4RCAA 3Q5TA 3O3DA 4R6UA 2GJZB 4QOKB 5FYLE 1K8DA 5FV1L 1W0WA 1ZVSB 2EDDA 4R4BB 5FM8A 4Z77B 4UILL 3MV8D 4RGOH 4JFYA 2KUTA 2F8XC 1FH5L 5ACLA 4KC3B 3KPSD 2XZZA 4RX4A 4C56D 3R06A 1RZIA 1BFOA 5HYIA 4MA3A 5ERWB 5HYJB 2VABB 1MNUL 4NQEA 4UDTB 1QLFA 3S37L 3L3GB 2N56A 3GJEA 1UG9A 2QQNL 3MUHL 4EDXB 3V6FA 2A9MH 4IIQA 1K5NA 5FA3A 3C60D 4HWEH 1W0VB 3G5XA 4LVEA 2AAVA 4TSBL 5EZOL 4G80A 1A6UH 3JUZA 2AQ1A 1PQZB 2JCCF 3T0EC 3T0EB 2D3VA 4OKDA 3AUVA 5EG6C 1EDQA 3MV7A 4QLRA 4P2QB 1MCFA 5SWSE 1AGEB 5D7LB 5FEBA 2GJ6D 1WZ1L 1D3CA 5I9QC 4UT7H 3MRLB 2AV7B 1AD0A 2Y4SA 5EO1B 1Z9LA 4L29A 3U2SA 2I24N 5GGTH 1P4IL 2JIXB 1EK3A 1A4KB 1EFQA 2YPKA 2NY0C 1MFCL 3H9ZA 3QEGL 4QHLB 3PQYB 1FFRA 4G3YH 5JPNA 3LEYH 3TBVB 5CEZH 4OF6A 3STLA 2F5BL 5HHMB 1DVFA 4HZLA 3ROLB 2XI9A 4QRRD 5GGSB 2D4DA 1IAIH 5EU6A 5FDWB 4YPGB 1FFNA 4PJXE 4PRIA 3E3QC 4FG6D 3VCLA 5DTFB 2M2DA 4YHOL 1NC4D 3S88L 2JCCE 5DLML 4JFOA 4KQ3H 1I7ZA 4CNIA 1CT8B 4NOFA 4NCDA 2PYEA 1O5DT 3IAPA 3PNWA 5DJ6A 2CUMA 2R2CA 2ZUYA 1ORSA 1Q72L 4JEGB 1YY9C 4XH2A 4HWBH 2R0ZH 3HMXA 1S7RB 2DQFA 4IRSA 3QDMD 5ICZA 1WWBX 5KJRH 4L5FH 3UTTB 3H42L 2HMIC 2VLRA 3MBED 1N6UA 4Q2ZB 4WWKD 4XX1G 4MZ3A 5D6CB 1D5ZA 3WN5B 4AIZB 5J3HD 2C4FU 1CVRA 1X7QB 4PJBF 3VJ6B 4HS6B 2V7HB 4TQEL 3REVA 4XVJH 2EICA 1HCVA 4B50A 4ONOA 1QSFA 4UT6H 3ULUD 3WN5A 1RURH 5DEFA 5AEAA 4ISVB 4L3AA 5J56B 5FO7B 2Y07H 3D9AH 3UAJD 1JPTL 5ADPL 3GJFB 4WGVB 4JKPL 4JY5L 5E9DA 1UCBH 3B5GA 3WHE1 2EZ0C 1PJ9A 4FMFA 5K9OA 1MHPL 3EYSL 3MV9D 4L8BA 4XAWL 4YXLH 4FFYL 3JZ7A 5DD3H 1HEZA 4DKEL 2MCPL 4YHIB 2ZCKL 3G6JF 3HR5A 4HDIA 5F7HA 5ANME 4OGYL 2ITCB 2NZ9D 3VCLB 1KIRB 4NQVA 3WUWB 5LGHH 2JJTC 1OLZA 2AJUL 5EOQL 2F19L 3UMTA 3HE6B 3HE6C 1RIVL 4G8EA 4R96B 1IZJA 3GSXA 4DFIA 1X44A 3ZKMC 1A3RH 3RPIB 5GS0H 4U05A 1EZVX 3P4MA 5ESAB 3BGMB 4RZCA 4PTTA 3JV6A 1PY4A 2GK0B 2IPTH 2Q8AL 5DO2C 3WXVH 1F2QA 3MFFA 3K1KC 5DD6B 3CMOH 4RA0C 1BFVL 1HILA 1VGEH 2HWZL 2ERJB 1B4JL 4J2XA 2NY6B 5EH1A 4S2SA 1RUMH 1CE6A 4X7EC 4AJ0A 3VGHA 4L4VA 4PREB 1JPSL 1AGDB 4OM0L 4NCC2 3DETD 3QO1B 2VLMD 1FFPA 1CVSC 3R06B 3VU2A 2EH8L 2HT4C 3GSNA 3LKNB 4ZD3H 3ISWA 4YR6A 1RAMA 1V8HA 3C5SA 4KI5E 5CP7B 5HDLA 1ZT7A 4GXVL 4Q9QL 5DJDA 3SKJL 5AG8A 3HCVB 5IESH 3T0WA 1SYVB 4GRWH 1E27A 3S5LA 1INDH 4POYA 3UJJH 3GIVA 1BP3B 2MSPA 4ZUTB 5FXCH 3Q6FA 4I1NB 2X5PA 5FK9B 1QR1A 2P5EB 3PE9A 5I2IA 1BIHA 4MYWB 4XNXL 3ARRA 3O6LH 1QRND 3MC0A 3ZE2E 3TJEH 1XGRB 4QRTB 5FO9A 1F4WL 4QRPB 3LZFL 4PS4H 5F89A 3KPOA 2VSDA 5CP7A 3UYOD 4O02L 4JO1L 4BSWA 5C0AD 5KS9E 4P23C 5SV3A 2EYRA 1DE4B 4ONGH 5DK0B 3RVXD 2J7LA 5ISZA 4NQCE 2BXZA 5F1IB 4Z78B 1M7DA 2ADJA 3CLFL 2VXQL 4LNVA 1E28A 2GQHA 5KVGH 1DE4A 2AW2A 2BDNH 4EUPG 3OZ9H 4Z0BH 4OZGA 5IB5B 2MHAA 4W70A 3WLBA 4XRCA 3NZ8A 3AFLA 3HC0B 5BQ7B 4HV8A 1ZLWH 3L95A 1WAAE 3VA2C 2X41A 2H8PA 4D0BA 1A8JH 3SE4A 4N0CD 3MROA 4POZC 3K2UL 2Q86A 4I0CC 2OR8A 4XCFH 5E08H 1I8KA 1N5AA 2X1PA 2OMBA 4MNHB 5F3HB 3KPOB 3KR3L 5I1AB 2Z4QA 5HY9B 4PFEA 4K94C 1YMMA 4TNVK 2VDKH 1J1XL 4ZYKA 2NTFA 3GRWA 5JW4Q 4JFZL 2EDRA 2H45A 4I48B 3L1OH 5HHXL 4NN6B 5DD0H 4ACPA 4S1DD 1MAML 5E0QA 3SQBA 2VDOL 3RBGA 3MV9B 4MB5A 3RDTA 5CZVH 3UTTE 4RAVA 3IU3A 1OP3K 3FOMA 1G9NC 4R7NB 5E00A 1JZ2A 3LPWA 4M61A 1T0PB 2KZ1B 3ARPA 4H20L 5GS0D 4IDJL 1TITA 4LLYA 5GGRA 3QPQC 1BX2A 1QP1A 4TRPH 2VDML 2DQUH 5IB3A 2EIEA 5L9DH 1KB5H 2HLFC 1ZLVK 3EBAA 4PP1D 4MJIB 4G8EB 4GAGH 4R96A 1OTTC 1VADB 3KWWB 4KK5D 3FFDA 5DK3A 3RTQB 1LGVA 4HAFA 5HPMB 4WW2A 3BW9B 5AWNL 5EIIA 3JWOH 2DYPD 3BKJL 3Q2CA 5C0RH 2AVGA 3EOYG 3CVIL 4HIIA 2OXHA 1MHEA 4U1HB 7CGTA 4IJ3B 1Z9MA 4M43L 3REVB 1WSST 3QDMB 1AKJA 4Y16C 4FZ8L 1KCLA 9CGTA 2H2PD 2V9QA 5TDPA 1FORL 3JTSA 4LKCA 4UI2A 3PWNB 5KTEH 5D1QC 3IKCA 1BREA 1KYOK 1F90L 3QWRD 4ZOBA 4K3DH 4M6MH 4BSVB 3E1F1 3ARFC 4RGOL 3GRWH 1DDHB 3T8XA 4JM2C 2VQ1B 4XWGH 3LS5H 5B38A 1AY1H 4LSQH 1PG7X 3QUMA 4XP1H 2CO6B 3S37H 5B38B 43CAB 3LB6C 3TO4A 1F42A 5DVOA 4BSVA 2V2XB 1CU4L 1I7ZB 3VJ6A 3ZHKA 1YEHH 3WNLA 3MRDA 2QSCL 2VITB 1NSNH 1R24A 2JCCA 1B88A 2M26A 3WLWC 5J12B 5DUBB 1NAMB 3NCBB 1NEUA 1YA5A 2HAZA 5DD5L 1J0IA 4NQED 3STZA 3UPRA 3NN8A 4XPFH 1N3NA 3CU7A 2ICEA 4MCZA 2N1KA 5ILTH 1O7VA 4P48A 2Y7QB 5ALBL 4AT6B 2AJVL 5EULV 4O58H 5GRJL 4QHUA 3SDDC 4NT6B 4XPGH 1D5ZB 3X17A 1P7QA 4D9LH 3B83A 3RX7A 2EDNA 2VAJA 2WINB 5GSRA 3ZKMD 4U31A 4KMLB 4MNQD 2NY4B 3ULVD 3QDJD 5HJ3B 3O3EA 2OLDA 1NGZB 3TT3L 5CBAA 5I0DA 1NCDH 4OZFB 1E6OL 3IJHA 4BH8A 4ZNEE 1VENA 1AXTL 5GRUL 3ARBC 5DRNB 3W0WA 4EZMA 3BHBA 1HI6B 1QKZH 5KSUA 3T0EA 3E6HB 3PXHA 4N9OB 3RQ3A 5ISZD 2VXSL 3EDDA 3BEVA 5IQ7L 3BZFB 1P5UA 1Q9WB 5DMKB 1YNTB 1ITCA 4Y19D 1XEDA 3HI1A 2CD0A 1H8NA 1TZIA 1A6AB 5JQ6L 3I3BA 4JJ5A 2BHZA 4LCIH 1ZVYA 1U3ZA 2QKIB 1QBMH 4ERSH 2VO5A 1KUMA 2YN5A 4XCCH 3BQUB 5CD3A 5JPNB 3WDJA 4LLMA 4PJ7B 2IMNA 3LH2H 5IB2A 2J8OA 3CXHK 3PIQB 3TT1L 1YMMB 4IEFB 2XRAH 2ATPB 3A6CL 5JW5A 3LY6A 4P9HH 1CXKA 4FFZL 5F96H 3GKWH 5E8OA 3VXMA 1K3IA 2OBGA 4HUXA 3DX9B 3TH4T 2FJFA 3QHFH 3EFFA 2RQ8A 4JN1H 4N0UE 1HH6A 3WKMH 4X8JB 4H0IA 4JQXC 3TBWA 2NW3B 2JJVA 4X4XB 3ROOB 1A7OL 1CG9A 5F7UA 3QZWB 1CD8A 1ZANL 2W60B 2WWMD 3FQNB 2WAHA 4PJIA 1MHHB 4JFDD 2AXFA 4LLUA 1J05B 1MJJB 3L5HA 3PDDA 2CH8A 5D2NC 2P5WE 3FZUD 1XGTA 4P2CG 5DYOA 3E2HB 1KPRA 2F15A 2XQBL 1N0XH 4C83B 2FHCA 4H1LH 4LHUB 5A1AA 1FAIL 2QSQA 5FYJE 1IL1A 5TDOA 5M94B 3UBXA 1XIWB 3B8YA 4E42A 5C9JA 4ZFFA 4UMGA 3SY0A 1INEH 4HKXA 2H9GB 5ETUA 1P84K 2BJMH 1MFEL 5D2LF 3IFOB 1DLHB 4O4YL 3V4UL 2GT9B 4V1DB 1UWEL 2Z31C 3QUYA 2OQJB 2BRQA 2H26B 2IPKA 1T3FA 3HPJA 5I8KH 2C3VA 3MXWL 2PR4L 3QI9A 1H3TA 2AXFB 4JDTL 2UWEF 1F97A 1P2CB 4DTGH 2NY3B 4FQ2L 1KCRL 4GRLA 3OPZH 3EOBA 4G5ZH 3H7BB 5IOPA 1XAUA 4YGVB 2VISB 3W39A 1LO5A 2GITA 2C3VB 4LVHB 5J9PB 2FWOA 2EC8A 1EJ6A 1AFVH 4FMKA 4XGZB 1LD9B 3HMWH 4NNPH 2FJFB 3EDEA 4ZQKA 5H2BA 2PXYA 2FH8A 3EYUL 1YEHL 2GTWA 2EXYC 3BSZH 3FB7B 4L8CA 4L4TA 1PKQE 4LVOC 3BX7C 1JWMB 5KSBA 1LEGA 4IOIA 5F6HJ 3DNKA 5IVXB 3SCMD 2CMRL 1YEGH 4LFHG 3MRFA 5E1AA 3FTGB 1KTRL 1PW3A 1YEJL 1K4DB 3PGCA 1FL6A 4OFPA 3WXWH 2YBRB 3ZE0F 5F21B 1UB5B 2WBJC 4IRSD 4NRXB 5E2VH 4P2OD 4ELMF 1KB5A 7FABH 1DBKL 4APQC 3IDYB 3NGBB 1T5WB 5DGQA 3QDHA 4S1QH 3QNXB 5CAYB 1NAKH 4Y1AE 2VE6B 3VFMB 1HEZB 3P11H 4J4PC 1NC4A 3MLSL 3D3VA 1YN7B 3JWOL 4N1CA 3AU1B 4O2CB 5HGHA 2ED9A 5D8JL 4PJ5B 3WIHA 3HC3H 4PJFE 2R69L 3S37X 2DQCL 2E6QA 4HF5H 3SGKA 1KB5L 1A9EB 1W8NA 2YR3A 1MJ8H 1U41A 3LN4B 3PV6B 1JNJA 3TA3A 4HKJA 2BCKA 1WZLA 4C56B 3OHXA 3BKJH 4UQ2B 5J6GB 3TBYB 4RZCB 3MRMB 2BVQB 3C87A 2XQYG 3JWDL 4GG6E 2ICEB 2YN3A 4MCZB 5AD0B 3Q3GA 4XXDB 3WIIH 4LSUL 4J6RH 3VI4E 1QO3A 1XF4B 1QBLL 3V4PL 3NIDE 2JKXA 2OR9L 1II4E 3VXOA 4JO2L 3U7WH 1KLUA 3UROR 5IGXH 4X83A 3KGRA 1MLBB 5T5NF 1AHWA 2YD5A 4Y4HB 3WEXA 5GGTL 3QNYA 4LCUA 1VKXB 2Z35B 4AEEA 3VI3F 1TQBC 5HVWA 2D31A 4O2EB 4Y4FD 3UTSD 5DJXB 3LHPL 5BMFH 2HG5A 3GM0A 2BHUA 4HIJA 4WHCA 5HVFB 4XPFL 1PFCA 5C0GA 5BVJB 2R0WL 1D9KD 1NSNL 4NT6A 1U3HA 5CZXC 4F7EA 5DC4B 1DANT 2ADFL 3OXSB 2EE6A 3MRGB 2YRZA 3EYOA 4TYUA 1S5IL 2XY2A 2B0SL 2ZPKL 4XBEL 1L9MA 3FB8A 5GIRA 4XVTL 2XYCA 2F53E 4KKBC 1RPQA 3QXUA 2VQTA 3ARTA 4PJFF 4LQFH 1FH5H 1PZ5A 3Q5OA 4JY6A 1D5MB 2DLFL 3IGAA 5JW3L 4OD1L 3MREA 2DAVA 4U6YB 2VUYA 1HXMA 1Q0YL 3LQAC 5J13C 3VDCA 1JCKA 1WGOA 2OL3L 4JFFA 3L3GA 3MOQA 3C5ZA 4F3FA 4ELME 4PTUB 2CJUH 3GSRA 1PQZA 1RURL 5E6ID 2E3VA 4G9DA 3G5XB 1Q9KA 1W0VA 2FLRT 2XZCH 3MR9B 3V4VH 1I1FA 3ZSSA 3CFDA 4Y2DB 1ULVA 1MWAL 1WISA 2VC2H 3RUGB 4DGIH 1F11A 3NIFF 4IHOB 4JKWA 3NA4A 3FT2A 2AV1B 3IT8D 4P2RE 4NQDB 1EJOL 3MV9E 1R3LA 3SGJA 2J12B 2MCG1 3T0XA 4ENEC 1CTOA 3BUYA 2CDEA 1ZGLA 1QTYT 3QDJE 4U2YA 4WUKH 5EIIB 4TVPL 3DMMA 1FL3A 2PXYD 4FS0A 2IALB 4DUXA 5I1IL 3OL2A 3NAAL 1ZLSL 2AGJH 4UB0H 4CUCA 4L9LB 1AD0B 4WW1A 2BNRA 5JUEH 3IDGA 4E0RB 5C6TL 4BA8A 4QRSB 2WUBL 3LEXB 5ISZE 1T21B 2M8XA 4V2BA 1IE5A 3T4AA 4HKBA 1SEBB 4YDKL 4NHUB 3O4LD 4GSDL 1LO3L 4NBYB 4KK5C 1IAIL 4NZDA 4UV7H 5TGBB 1WUNT 1GOFA 5GS0L 2W91A 4I4WB 4LDOB 4UNUA 3UZQA 4M1CD 1RZKC 5DEZA 5IJVA 1XGYL 1NCBL 1L6ZA 1UKTA 1T3FB 2IPKB 1WK0A 2X40A 1JE6A 2X9WA 3F12A 4FFWC 3L9RA 1EA9C 1MJ8L 4E5XA 1UZ6E 2V17H 2X10A 1HWGB 1IGJB 3MLVH 5CEYA 3MNZB 3WYRA 3V2AR 5KVDH 4I18B 4HH9B 4B7IA 3V5DB 2BSRB 2EXYD 5JA8B 4G6KH 1QSEE 1I9EA 2HJFB 3MJ9L 1KFAL 3AROA 1G9NH 4LSRH 2Y07L 1BQSA 1DBJL 5TE7L 3W11D 2DL9A 4QXWA 3UTZB 5IIEB 3RWJA 3K74B 1R0AH 2P5WB 4UT6L 4JM4H 1IM9A 5T5FH 3BZ4B 4OI8A 1LEIB 3M17B 2E9WA 3C5SB 3QFDB 5GJSL 3T3PF 4HS8L 4FQQB 2EDYA 3O4LE 2NY3D 1DQJA 2DBLH 3MFGB 4NO0D 5T1KD 3HFMH 3MCLH 1Y18B 3KLHD 5C09E 1F00I 5E8PB 5E8NA 1WEJH 2AJXH 3OAYK 1FG9C 2Y72A 4LLQB 3EGSA 3ESVF 4F9LC 1VHPA 2DDQH 4HUVA 1RJZB 4RX4D 4U7KA 5FOJA 5D7IB 2XFXB 4BQ8A 4G8FA 5L7XL 3TWCH 5C0EB 3D0LB 4HPOL 2MMXA 2O5XH 4PYGA 1S7WB 1J0ZA 5T3XD 1LE9A 3JWNC 2R2HA 1SBSL 5JXAL 5EBLA 3H42H 1LE9B 5BVPH 2VDPH 2QQKH 2W65A 3P77A 2ADIB 5JXED 3H9HA 5B3JE 2R2BA 3QHZH 3RDTC 3U30B 4OZFG 4WY7H 3UJTL 4GLRH 3HR5B 1BFVH 2P8PA 3VWKC 5C92A 3EDJA 1BM3H 1FE8L 1KTLB 1BZ9A 3S88H 4LF3B 4OCYH 1A7NH 2BSTA 4FNLL 3SDYH 3ZSTA 1GGCL 2R2EA 4NGHL 2BY2A 4LLUB 4HHAA 2NZIA 5DHVH 1G7HA 2ATKB 1HHJB 4LSUH 3KS0H 5GRJH 5DD6A 5GHWL 4X6CB 5TQ2L 4D8PB 2CK0H 2CLVA 4LGPB 1FNSH 1LEIA 4OFYD 1FGNH 3LQZA 2YSSA 4R4FH 3BD3A 1QEWB 3V8CA 4PLKC 5CGTA 5HI3C 4CGTA 4MA8H 5EFIA 5DQDL 5K59F 4JANB 4LK4A 2AJYL 4D0DB 4HS6A 3QUML 3MUGB 4YDJB 1BEYL 3PWLB 4WFFD 4M7ZC 4M7ZB 2UZIH 1UJ3C 4M7KH 1EAJA 3X3FL 5EBMB 3U1SH 2EC9U 3NABL 1LP9B 1KXVC 3EJYC 3GMQA 1EGJH 5SX4I 1NDGB 3MZTA 1IGTB 1SJHB 1YEKH 1AGBB 4LLMB 4ZPVA 1OLLA 4HT1H 3TN0D 1OGAE 3BKCH 1BLNA 1QVOA 3CSPA 5I1KL 3BE1H 1SMOA 2W38A 3PJSB 1E27B 5DDHB 5GGUA 4YHZL 3DYPA 1MHCA 4JFQA 3L3JB 2QSVA 4CMHC 2D2OA 3IJYA 3TFKD 4GRMA 5JORB 5IFJB 3H9SD 5B39B 5MEOA 1P4BL 2PXYC 1CG9B 1R3IL 2CDFB 5CD5C 4O51B 3U0WH 1G7QB 1OAYH 1QPXA 5HXMA 4PJEE 5C08D 4Z7VB 4WU5A 3WIFB 4LLWB 1NAMH 3O9WD 1P4LB 2Y5TB 2V17L 4PRAB 3SJVA 4M1GH 3RFZC 1H8SA 1QG3A 3GO1L 4QHKI 2XZAL 1LO4L 3BUYB 1TZHA 3C2AH 4YUEL 5LGJB 2EIZA 4MXWL 1U8HB 3K2MC 2D0FA 1OHQA 3CX5K 3VH8B 1O0VA 1NC2D 4LLYB 4YNYB 3O2WH 1G7QA 5KBNC 3EDKA 3IDXH 4JRYD 5E56A 2NNAA 4WHTB 4OLYL 3QFJE 3SE3A 1I8LC 4PJXF 5JZ7C 5TDNB 1FZOA 3C6LC 1VGKB 4YDVA 3TA3C 4A6YB 3UYPA 4CAGA 2IAMC 1RMFH 4K3JL 3HG1B 4MMXC 4CU7A 2CRMA 3WIHL 5CINL 1D5IL 1OSPH 2F54D 2YZ1A 1MI5D 2F54A 4I48A 3WO4B 1C16A 4L3CB 1A4KA 1XCTA 4YNYA 5D7LE 2D4FA 2R39A 4PRHE 1SY6A 2X7LB 4M6OH 3WN5C 1LK2B 3LKQB 3B9KB 4ODSL 3KLAB 4CKVX 5IB4A 1VDGA 4JPKH 1KPUB 1T7ZA 2BNQE 3WIFA 5LBSL 3BOVA 3MLTA 4FQCL 5C07A 2YD6A 4OTXL 4TN9A 1GPOH 4WI5A 2ARJQ 3BW9A 4OZFH 2V7NB 5BZDB 2DLTA 2Q1EA 1DVFD 1SY6L 3CC5B 5DVKA 4HWBA 4P59H 3RL1B 3U7AA 3TO4B 1FZKA 3KPQB 4TSAH 2SEBA 1HH9B 4G6JH 4ZFZA 1J87A 4B41A 4NJ9L 1F02I 4QY8B 5D71H 5F9JB 3WL9A 2MOVA 1JGVL 3IXTB 3U36B 4KJYB 4KY1H 5D7JA 3VFMA 5B4MD 1S9YA 1EHAA 2FNBA 4ERSL 3N9GH 3ARUA 2PYEE 4RMVA 4BZ1H 1LMKA 3ELAT 5KSBE 2Z8SA 2OTUA 4BZ2L 3KPRE 2CKBH 1QO3B 4PLJC 4BK4A 4LASL 5HYJE 3OR6A 3VXTB 4PJ7E 5ECJE 3QCTH 3VFGL 4NKIH 4APQA 4OGAD 3F58L 2MQ0A 2P43B 3IFNL 4O58L 1W2KT 3LD8B 5C0EA 5D5MA 3VXRB 3LKPB 1FCCA 4RGND 1YNLL 1SBSH 5EBLB 4OI7A 4PJCA 1MCWM 3OJMB 3RKPA 1GGUA 2JE8A 2R2HB 2X4RA 2ADGA 3C8DA 5DFWH 3NFPB 2VH5L 4Q74A 3HZMA 4O2CA 3TWCL 3U4EA 1WT5A 4EDWL 1D9KA 1MCEA 2EECA 3MV8E 3QXVA 3MXVH 3JV4A 2G2RA 1QRNA 5C0AB 3ZKXC 1FNSL 3I6KA 4ZO9A 2PETA 1M7IA 1QZ1A 2VDNH 1JF5A 4JQVA 4MCYB 2XICA 3VFOA 2A6KA 4XCFL 3NFSL 4X6FA 1JWSA 5J11B 1M4KA 3U4EB 5J11C 3H9HB 1DQTA 5CEZE 1NCCL 4QXUH 4WTWA 4ZAKA 4GS7C 5H35B 5C0BA 1A7OH 2RB8A 4Z7WE 4OLZL 1EFXA 5DT1H 3U1SL 3MA9H 1MNUH 4GAYB 4X7TB 4R3SB 4EUPA 5I66B 1U95B 1KT2B 5SWSD 1AO7D 4NUGH 5CLTA 3T1FA 3QHFL 4EI5A 5SWQB 3PP3K 4M7JL 3ZE2F 4HJ0C 3O3UN 4X4YA 3D69B 2FIKA 1GHFL 5ANMB 3GBNH 3TT1H 3GSUA 5FDYA 3X3FH 3NFNB 4OSUL 4RIRA 4TVPE 1JWSB 4JJHA 1WWWX 3MLVL 3ZE0E 4PJIB 5C7XL 5DMGD 1VEPA 4WFHE 2VKWA 3X14B 5J6HA 3EKCA 5CMAA 1RFDH 5D1QA 5EUKB 3KPMB 1MCOL 2FEDD 2ADGB 1XGUB 4F2MB 5HHQA 2H26A 2G5BA 1CLZH 5ISZB 1XR8A 3HNVL 1S7UA 3TVMA 4YQXH 3X13A 3GHEH 3DETC 2XT1B 5IM7B 4PBXA 2ARJB 4PY7A 2GFBB 3V6OA 4HEPG 1LK2A 2NY2B 5FKPB 4Y4HC 5D6CA 3FKUS 1S7TA 4NBZB 1UWGH 3OBAA 1ZT4A 3BPLB 5IBTH 1XCTB 3H3KA 1FL3B 3W9EB 1ZHNA 4PP1C 1GVIA 2PW1B 3B9EA 3FT3B 3QUZB 3BT2H 3RNQB 4JQVC 4FQXA 4HUMB 1MCWW 4NQDE 4XPHL 5HYSB 3WXVL 1P53A 3UBXB 1EUUA 5GJTL 3AMLA 8FABA 2PR4H 3MYJB 2NXZC 5TQ0H 5DHYA 3BH8B 4OCLC 3MV7E 1TENA 4JG0H 4KAQH 2GJ6E 3U36A 1J0YA 4HKZB 4OCSH 3N50A 3BH9A 1TZGH 3CLEL 3AB0B 5JPMB 2AV1A 4EIGB 3EFDL 2XTJC 4ODHH 1AGDA 3QDME 5GQBA 4RAUB 5D9SA 4JN2A 1R5WB 4OLXL 5IJVB 4ZTPH 4OUOA 3IJHB 4BH8B 3F7YA 2X4OA 2BVOB 1NGXB 3ILQC 4P46C 3KPRA 3EHBC 3ILQD 3RUGF 5T3ZD 1OF2A 5I19H 4QHMB 2AEPH 1C1EL 1CFQA 5BRZD 2ZSVA 5EC2A 3BWAB 5CKAA 1AD9A 2YK1L 3ARYA 3CCHB 1OP5H 5DMYA 3PDGA 5I15H 1L6XA 4PJXA 4PRIE 3LRHA 4QRSA 1X5ZA 3T2OA 3ZT6A 1AD9B 4Q9BA 2C1OA 1X7QA 1UEMA 3FAWA 4QHMA 3D1MC 2J5LC 1OD7A 1GZPA 2QADD 1UQSA 3ULVC 4YWGL 3O6LL 2XZQL 4HUNB 3QEUA 4N0RA 1JYVA 3QIUD 1MI5A 4FTVE 1ZEAH 1MCRA 2APWA 3MRDB 3BO8B 5CD3B 1AIFB 3PHOB 5IMOB 3QG7L 1ZHKB 5I1LA 4QTHA 4JR9L 1OP3H 3QQ4A 4ODWB 5IMOA 4M6AA 1BBJB 5DFVC 3TZVC 4JHBA 2VOTA 4WHTA 4XNXH 4F37K 5CBAB 4D2NA 3SN6N 5I74B 4UOW0 2H2SC 1TJGH 5EBGA 2Y06L 3UCRA 3MXVL 4A2LA 2WUCL 3LEVL 5DUMH 3WNMA 3BQUD 4ISVA 1A7BA 2CJUL 2CUIA 1I7TB 5DRWB 4WCYH 5T3XL 4ZXBA 1F2XK 2HKHL 3WEXB 1B4JH 5JOPD 4MAYD 3W5MA 2J8UF 4DWHA 1UA6L 4GG6B 3I75A 1SEQH 3PWPE 1KLUB 1U93B 2DWEB 5JOEA 2M1KA 3T0VA 3UPAA 2K3TA 5D2NA 4HEME 2YPLB 3V4PH 4N0UA 4C56A 2BVOA 1KJMA 5CILL 1MAMH 2APVA 2C26A 3WV0A 3V4UH 2B0SH 5DSCB 43CAA 3OXSA 1DFBH 3VA6A 4GQ9L 5C09A 3SE9L 1P69B 3BP6B 4JFFD 3VXSA 3KYKL 3ZDXF 1D5XA 1VEOA 1J10A 2C3HA 3KPSB 1YN7A 4Z7VF 4GG6F 5C7XH 3BRFA 3BRGC 1Q8MA 2ESVB 3HC4H 5GGUB 1IILE 2UZXB 2R2EB 3VRIA 1M05A 3G5YA 2B2XL 1NMAL 5CCKH 4QRRE 4P57A 3AY4A 5E1AB 4R8WH 4RQQA 3F5WB 4IMLA 4OQ1A 1EXUB 4H26B 1DTUA 4LEOB 2D9QB 1GPOL 2NY6D 3EYQD 4BUGA 4AL8H 3FRPG 2OL3H 3VGGA 3WXWL 3BPOC 2ZPKH 4GAFB 1MF2L 5E8EA 2D7NA 1S8DA 3UXFA 4M8QA 4MAYA 4GKZB 1AGCA 1ZHBB 1MHEB 1N64H 4I3RH 8CGTA 3W5NA 1G0DA 4XPAH 4YBLB 4KZEH 2R1XB 5F7NC 2D03H 4IOIB 3AU1A 1JMXA 3OV6A 1Z3GH 3ZL4H 2R0WH 2H8PB 3CU1A 2EZ0D 1M1SA 5EUOA 2OSLB 4P46D 2X1WL 2VXVL 1FLRL 4HX1B 2A9NL 3NZ8B 2DLIA 1E6JH 3V95A 1G7PA 1K5NB 2FL5B 1QFUL 1P84J 2DM4A 2R0LL 3L7FA 4K8RC 5T1LA 3SO3C 1XF3B 4UIMB 1G9EA 1U91A 3D2UA 3QA3A 3HZMB 4Q6IB 4LF3A 4R7NA 3MO1B 3B6SA 5CSZA 2QADB 2MPAL 1T83A 3FMGH 1D6EA 1RZFH 5GRVK 3JTTB 3E2HC 4OT1H 2V2TA 3ZZ1A 3T3MF 3VFTA 1HHIB 3GNML 1GZQA 3FRUA 5IMKB 3MRRA 5C0IB 1AKJD 1EPFA 3BZ4A 2F5AH 4Y5YB 3GGWB 4F58H 3WIIL 3T2PA 5CBEB 1R3HA 5JLZA 1JTTA 5HY9A 3O6FD 4J3WA 3K4AA 2CRYA 1RY7B 4LNRB 2Z92A 4L3EB 3HPLA 3F12B 3RVXC 4ZUTA 3OKKA 1UH3A 2OR9H 3RWIA 1JWMA 3W9EA 3MRJA 1KC5L 1R3HB 5L2JB 4OFIA 5FKAA 1S7TB 5D2LE 3FQNA 4RBPK 4HGWB 5CZVL 4NQCD 2QHRH 2C3XA 3FO2B 3ZDXE 3WL9B 1OAQH 4LCCB 5DD0L 3SCMA 1KCUL 4BH7B 4MDIA 4M5YH 4RISH 3U9UA 5TPWL 5CKGA 2EIBA 2YPLE 3HLAA 3DROA 2OQJA 3QUYB 4OF3A 5FYLH 4IIQC 1OARL 4X7SH 3KJ6H 4I0PB 4ELKB 3PHQB 3DUSA 3SY0B 5D1XD 1PG7H 1FLRH 4DK6A 3DOSA 4HX1A 4ZODA 1DJSA 3B2VH 4NHUA 1F4XL 3HPJB 1WEJL 3DMMB 1U93A 2D7TL 1ZXQA 4POZD 1DLHA 4YLQT 3LS5L 2AJ3A 1R3KA 3V52H 5IQ9B 1FSKB 5IHLB 3QQ3B 4KVCH 3S4SA 3VXPB 2IANA 4J8RB 5C0FA 4E41D 2E27H 3WS6A 4YEFA 5GJSH 2AQ3A 2GEEA 4OV6F 4FXKA 1MFDH 1V7ML 3LIZH 4X6CE 5JIPA 5IWLA 5FM4A 4TUOA 1KELL 5F44A 1FFOA 1IVLA 4Y2DD 3HI5L 2H1PH 4AM0B 3HZVB 3PGDA 3CFDB 3CFIC 4FZEH 5DQDH 3RTQC 4G6KL 4X7DC 4M03A 1TJIH 3DUHA 3E6FB 2E8ZA 4DOHB 3T3PE 5DGRA 4DFHA 2A6KB 2B1AL 2EDKA 3A6BH 4ZAKC 4X4XA 3ROOA 5HJ3A 4Z7NF 5A16A 4HS3A 4J4PD 1EO8L 4OJFH 1F3DH 3HS0A 4YFLI 4JZJB 1QRNB 4ZUSB 1UFUA 1SVCP 3P4OA 4OCWL 2AI0L 3VG9B 1X5IA 4GAJL 3W0WB 5LWYL 2Y7QA 3LAFA 3LKOB 2I60H 2P46B 2VJXA 4XBGB 3RPIA 1NGZA 1FZJB 4GRLD 4JAMA 4HT1L 4ETQB 4PJ9A 4JG1L 4K7PX 4KROC 1JGEB 3QYCA 4UV7L 2GCYA 3GI8H 2XKNA 5CZKA 5K33A 4UTBH 5KSAA 1P9MA 4JLRB 3CJJA 4MNQE 1YDPB 2R1WB 5HYEA 1ZA3A 1SEQL 5HHPA 3ULUC 1VB9A 3G6AA 4OCNC 2MNUA 4TNWK 4XCNB 1A1NB 5IW6B 3ARDD 1CZ8L 3FQUA 3U48A 4BFBD 3UZVB 1U0QA 1VPOH 3MRIB 4F8QA 4DK3A 2XN9A 3QRFM 1A6TB 1IC7L 3AAZA 4MNGB 4LHUD 4FA8A 3GMPA 1T0MB 3QWQB 5CJOL 4ZO6A 3KPSA 3BE1L 3D3VE 3CVHL 3N1GC 1BAFH 3L5JA 1A6UL 1KEGH 2YPVL 1CD9B 2D7QA 4ZFZB 1JHLH 4Y4HA 1JRHH 3REWB 3CSBA 5LGJA 5MP6L 3B2UC 3HZKA 1HXYA 2EEDA 1G7JA 2PN5A 4PGEA 1ZHNB 2IQ9H 1J12A 5I6XB 3QDJB 4V1DD 2AK4A 1EZVY 4MQ7A 4K8RL 4M9PA 2VNCA 2FYYB 2AJVH 5KOMC 3ARQA 5HI4C 5I74C 4GG6A 1MLCB 1F4YH 4Z7VA 5A3IC 3W0WD 4RFOL 4XC1H 2FYYA 3T4YA 3TO2B 4PJ8A 2FB4L 2BCKB 4NQCB 1OAZH 4I9WE 3FHAA 3MNVB 4XNQA 3C08L 4Y5XA 4R26H 4I0KA 4XVJL 3FFCB 1EAPA 4YC2C 1OW0C 3GSOB 1T89C 3BZDA 4OF5A 2RFXB 1UXWA 4OF7A 3C6LD 4I5BA 5L2KE 2I9TB 1ED3A 3QXAB 2XWBA 1NUNB 3FO1B 3WUZA 3V8OA 4JDVB 2X89D 5H94A 2FZ3B 4NQXA 5FYJD 3PQYA 1HOCB 2CR6A 1K4CB 3B2VL 3MBEB 3O3DB 3RBSA 3TGXA 3MACH 1AXTH 5GRUH 4L29B 4PJIF 4HXBH 4FXKB 3JUYA 1Z6JT 4F7PA 4HULB 5I1AA 3MRFB 2F54E 1UYWL 4PJ5E 1R3KB 3QWRA 3C9NB 5F7EH 3ARED 2VL5A 1U8LA 3D87B 3LV3A 3O6FC 5B39G 5GSVA 3LCYA 1A7PL 2OJEA 1LO5B 2GITB 4IRJC 1FO0L 1IEAB 3ZTNL 3WFBL 4CDHA 3IDIA 1G7IB 5JTWA 3D18A 4R0LC 2C4FT 5FGCB 3RWCA 4TOYH 1GGCH 4YGAB 3D85D 3O6FA 3VH8G 3UYRH 4ZOAA 5HVHB 2PYED 1EBPA 1BM3L 5EDXA 1T5XA 3RVVD 3BDXA 4WV1C 3QPXL 1RUQH 3BZEB 2N7BA 3HKFA 4P2OA 5DF0A 1X6NA 2X4UA 3ULUH 2OK0L 3TIEB 1J8HD 5GJTH 5A2LH 2PO6D 5F9OH 4PV9A 3FL7A 2YD2A 4ELMB 4IOFC 2C4XA 1KGCD 3MV9A 4YX2H 4YE4L 3QQ3A 5LAXA 2NYYC 3S4SB 2O93L 2H9GA 2ZCHL 5ETUB 4XC3L 4Q6IC 2PF6A 4LIQE 4AEHH 3QXDB 3S4SG 2BOBA 1DBKH 3OAYH 4NQUA 4I2XE 5E2VL 3FAXA 5DRXA 1J8HE 4MJ2A 5DD1L 5EWIL 1CS6A 3FO0L 5E94B 3BKMH 1DZBA 1ORQA 1MQKL 4KK9C 2DMKA 1GJIA 3PWLA 1ZAGA 5IJKA 2AJ3B 2E7CA 1JMZA 4AEFA 1UB6B 3EJJX 3EO1B 3L3KB 1RJLA 3EOAA 4EKXA 1U8JB 2ICWI 3DMMC 4QCIA 4HUWA 4TOYL 2JB5L 4P5TA 1ONQB 1OAKL 5F88A 3O8XC 4BQCA 1LK3L 3Q0HA 4K55A 4XRCB 3IF1B 3AS0A 1QQDB 1C5DB 2J6EH 4DCQA 4HGWA 5F7LB 2NQCA 5HD8C 1HILB 4DW2L 5LXGH 3TCXA 4KMQA 5SX5K 3QULA 4X99B 1G7HB 1P1ZA 2ATKA 1IMHC 2NX5E 5C07B 3OG6B 3V5KB 4H1LG 4OCRH 5DK0A 1TETL 4OSUH 1LILA 1FYHB 1I4FA 4RNRB 4BYHA 2W9DL 5DQ9A 4PRPA 2BSSA 3B9KA 5F89B 2DQJL 1EUTA 4KHXH 1CLOH 4U49A 5EO9A 5F6HI 1T1XA 5I1IH 3W81A 2YS4A 1XR9A 1KSRA 3HAEA 3RVWD 3JV6B 2KQNA 3F58H 4J3VA 5F9AC 1TCRB 1IC7H 2BY1A 1WLHA