2E7LC

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
total genus 33
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7lC00
1FH5H 4B41A 2FBJL 1HILB 4JVUA 5F7FA 4L1DA 3S35X 3O0RH 1RIHH 1SYVA 4HS8H 4LOUD 3HPLB 1KG0A 5AD0B 1HXMB 3T2NL 5ISZD 1AJ7H 5L2KD 4JFPB 4QHKJ 4UIKL 2V5YA 3ULVC 4QF1B 1OARL 3BWAB 8FABB 1BGXH 5L2KA 3E6FB 2CKBA 1HNGA 1FORL 5C0BE 4BZ2H 3QHZL 2P8LA 4Z7UF 1A1OA 1MCPL 1FNEB 4JFQB 3OF6A 3SDCA 1KTDB 5I8OH 1EAJA 1KJ2H 4WO4D 1DLFH 4YHPA 1LO3H 3EYFB 3EAKA 4PJFB 2YRZA 1TZHB 4U1NB 2RBLA 1OP5K 3EKCA 4J3UA 1YNLL 2XZQH 3GHEL 3O6FD 5I1JH 4MDJA 3L3DA 4KY1L 4DN4H 2ZJSL 1RJLB 3F58H 1JV5A 1NAMB 4G8EB 5SX4H 1R24B 3PWPD 5FHBL 4M43L 4FZEL 3JV4B 1AY1H 3T04D 1LEGB 1DL7L 3RWEB 2V2XB 1ORQB 3TO4C 1IAIH 1F6AB 2FX7H 3KYMB 5FA4B 1S9WB 4HQQH 3VXRD 2CLVA 4IEFB 5GHWL 1RZ7L 3W2DH 4K23L 2XPGB 4YXLH 2FATH 3EOYG 4U1LA 1BLNA 5IOPA 4EXPX 3SKUD 4PLKD 4F7CA 5F71A 1XFPA 4OCXH 4I1NB 4BQBA 2XG4A 4ZTOL 1XF3B 3H9SA 5EUKA 4YHYC 2C3VA 1G7LB 3O3AB 3KJ6H 1QZ1A 1ZTXL 4M61B 2APFA 2EH7L 3RKDD 5IT2H 2QADC 2PR4L 4Y5VB 3SGJC 4AENA 3T8XA 2AVGA 2ERJB 3HUJF 2NW3B 2EDKA 5IMLB 3QDGB 4PG9B 1HHJA 3O4LD 3P9WB 3FQUB 5KSAC 2VDQH 1QSFE 5C07B 1T4KB 1Y0LA 4WEMB 2AW2A 2C5DC 3VFPB 1MJUH 4DCQA 5B38B 3VXSD 4HFWA 1C12B 4MS8D 4RAUB 4UT9H 5HVWA 4JN1L 5E2VH 1XF2A 1J1OL 5H94B 5EWIH 4M5ZL 1FGVH 5IFJB 5JIPA 1F4YH 3U7YL 3VXTB 3SDAC 4AYFA 3NMEA 2AK4B 3MRCA 2I07B 4DTGH 3R0NA 5D7KD 1Y0LB 1YPZE 4X7TA 4QHUA 4ZYKA 5DXWA 1A2YA 3OAUL 2R1YA 2PCPA 3BEWB 4L3AA 2NY0C 4PJFF 4QRPE 2PO6C 4JHAL 5K9QG 4NZUL 4UT6H 5E5MB 1JV5B 1QVOA 3VRJB 1IC7H 4P4KD 4XPFH 4JZJB 4NQXA 4K55A 1SM3L 3VXUE 4HEPG 3TCXA 5I1GL 5F7UA 2RJMA 3PQYB 5DA4A 4G3YL 3DV6A 4I48A 1OTUD 2UZXB 1T7XA 2XV6B 4JO4L 3QCUL 4JFZH 4P2QD 3S36L 2GJ6E 2R4SH 4U7SA 1V3JA 1H8SA 2B0SH 1B9ZA 1MI5D 5FKAA 4KUZL 4YHOH 3C9NA 4MNQD 5DZNA 4MXVF 2OZ4H 1P7KA 3HMWL 5C8JB 3P4OB 2LAAA 2B8OT 2BJML 3OG4B 4P9HC 1KBGL 1WT5C 5F7DB 1OWRM 3VWJC 4FNLH 3NN8A 4DKEL 3BD5A 1T04A 3MXVL 1K8DA 1SJEB 4XVSL 5GSVA 1XIWB 1Q94A 3I75A 4NQCD 2Q8AL 5JXEA 1U8JB 5EIVA 3NA9L 4PJ7B 4ZUUB 3NH7H 2MSPA 3SCMC 2VSCA 4WVRA 1KLUB 4Y2DC 5HD8D 1MHCB 2CIKB 3HUJB 1A6VH 3ARXA 5L9DL 4PLKC 1R5VA 1EXUA 1PW3A 4OCWH 5E1AA 2DM4A 2BY2A 3MRRA 1C08A 1I1YA 3F8UB 1DVFD 1UQSB 4NQCA 3SE8L 2QADD 1JZ7A 4PJBB 2SEBA 4WFGE 1QSEB 4HAFA 3HC4L 1K4CB 4NJ9H 3B8SA 4FXGB 4Z0XA 1VEOA 35C8H 3HE6B 3QUXC 4RFOH 3CZFB 2DI9A 3SQOH 4JFYB 3O2VH 3TBTB 4JO1L 3R4DA 3P4MB 5L88L 1L9MA 4QNPE 5FOBA 3CSBA 2X89D 1XH3A 3BDYH 3ULUF 4KKAC 3MGOB 3BPOC 1NCWL 4LHUG 1V7NH 1S3KL 3C6LC 5MI0C 4LRIA 5I16A 6FABL 4CAGA 1P7QA 4PJ5A 4JY4B 4GMTL 4DKAA 3L7EA 4M3KB 3WJLA 3KDMA 3FRUB 3W0WB 1AXIB 1QLRB 1IEBA 5DJ6A 2ITDA 4X9FA 3SKMA 4JKPL 3WNMA 5CEYA 4PV8A 4HXAL 1P5UA 1MFAH 5BZWB 4CGTA 5T33L 1M05A 4KTEH 2DLFL 3QO1A 4E41D 4M9OA 3PWNA 5I1KH 3WYRA 1CU4H 5GS1B 1OTSD 1RUKL 1ZHNA 4UOW0 3FRUA 1CLOH 5I30L 1CK0H 3GSNL 4OFIA 1CXKA 3OGCA 4PJ5E 5BZDA 3LEXA 2XPGA 1N3NB 2YWYA 1GHFH 1L7TL 5J13B 3IDXH 4XXDA 4OF7A 2DQTH 1R5IA 1DEEA 3SQBA 2BNQA 5I15L 4GG8B 4QHNA 2HP4A 4C56B 1EVTC 1OW0A 2IWGA 5JHDB 1A7QH 3O81A 3GSQB 3LIZH 4RWYL 3C8KA 1KJMA 2AXGA 3MJ8A 3Q5TA 4OV5B 2VZVA 5FDWB 1C16A 1VPOH 3EGSB 3LKNB 3DRQB 4NQEE 3NIFF 4IBLT 3CK0H 1HSBA 1IFHH 1RI8A 4A6YH 1ZGLA 3EZJB 3RTQC 2C4FT 3QUYB 5CEZL 3EO1A 1KLUA 3WCYA 4G6KH 5A2IH 5C09E 4GRLA 3RBGA 1L0YA 4PR5A 4EIGB 1NLBL 43CAB 2CD0A 4IMLA 4OLUH 2H9GB 1ZHLA 4WFED 4APQD 2IH3B 2IBZX 5GZND 2VIRA 4BQCA 4WI3A 2VLME 3MYZA 1MOEA 1N0XH 3ZDXF 1ZVHA 1J05A 4PRNB 4XTRC 5F8RC 3NGBB 3ROLA 2ZJSH 3F58L 2A73B 4KK8D 4LSSL 1BFTA 1I7UA 4QRUB 3ZKSD 1R3IL 1AY1L 4PUBH 1ND0A 1R5WA 4BSJA 3BIKA 3AM8A 3MUY1 4IMLB 3TO2A 5E6ID 4TUJA 4UNTA 3OMZA 2YXFA 2Y5EA 2EH8L 4URTB 4QXGH 3P0VH 4F15C 1IQWL 3MFFB 4QGYA 3D0LB 3K1DA 5DJ0A 3P40A 4R0LB 2KQMA 4JRXE 2Y9RT 5E5MA 4ZTOH 4L9LB 3H3PL 3VA6A 2X40A 2DBLL 3WHE1 4KKAD 5DS8A 3FFDB 1ZTXH 5GGSB 2DMBA 5L8JB 2ED8A 7FABH 1CD9B 1CFNA 4RNRB 3DX8A 4TNWF 3ME0A 3BHBB 1I8LA 1JF6A 1P9MC 5BMFL 4MJIB 3SDXB 3PV6B 2FB4L 2FIRT 1LHZA 3UYRL 2H32B 1U58A 1I7TA 1BBDH 5GS1A 2YK1L 4ZUVB 3MNVA 4EVNB 4YIQA 5FOJA 2VDPH 4L8BB 3IJYB 4XHJD 5JDJA 3DHJA 4ZOAA 4Y5VC 1CLYL 4GRWH 1E4XL 4JN1H 2W9DH 3PGFL 2CDFB 3NCCB 1F6FB 4CNIA 4HKZB 4PJIE 3VD5A 4N90E 1AR1D 1FV1A 3HA0A 4WUUD 4FA8A 1S8DB 3RPIB 4J3OC 5DD1H 1LO4H 3G9AB 5SWQA 3LPWA 3SGKA 5GIRB 5HYJE 1BFSA 4F80A 4PGEA 4HPOH 5E8DH 5MENA 1O5DT 4GXVH 2EEBA 4F3FB 2WP3T 1T22B 1DUZB 4OFYA 3P73B 1LK3H 4UT6L 4KMTL 3IU3A 1GJIA 3PXJA 4XCNA 3TGXA 5IQ9B 2AJVH 3S3JA 2KDGA 5D7KE 5EU4A 5I1GH 1F5WA 1F3DH 1ZLUH 3INUL 3BKCL 3W0WD 3DARA 4FQIH 4U33A 3C60B 5T3ZE 3QCUH 2VUYA 3LB6C 4IS6B 3S3SA 3L5XL 4GXUN 4HK0B 3T77B 3B9KA 4PJ8B 4JCLA 5SWSA 2X4QB 1UACL 2CSPA 4KUZH 3JWDH 1NMBH 4B7LA 1JZ4A 4Z7UB 2OZ4L 5T3ZH 3UYOD 3UTTB 2FJGB 3HMWH 4N0YH 3IDJB 4U49A 3H7LA 3HE7B 3KNBB 4Q9BA 4F37F 3VXOB 2PKDA 2J5LB 3HI1A 3T4AA 3GFUA 3WS3B 2QR0A 2NY3C 4KRPD 3W5NA 1N64H 1ORQA 4OLYH 4FQPA 2PYEA 3CSGA 4QLRA 1Q0XH 1BECA 5HGBB 3QJHB 3UAJC 5DT1H 2EO1A 4O5LL 4NBXB 1ZLSL 4NP4H 3DXAB 5T1DL 1PDKA 1QBMH 4UV4L 1JPST 1NAMA 3EYQD 2YSSA 5HJ3A 1NC4A 4U4BA 5DA0B 2X7LA 4LLWB 1MWAH 1UB5B 2YD2A 2X41A 4IM8A 4S10A 4NO5B 4GLRH 4HCRH 2X4RA 4Y16A 5J8OA 4GG6A 2GQHA 5GGTA 1SEBA 3WFZA 3CVHB 3TA3D 3UJIH 3O41A 4Q6IB 5F9DC 2NY1B 4NWTH 1G6VK 5FGSA 4C83A 3DRTB 2VE6A 1EVUA 2XNAA 1NCTA 5DJXA 2VO5A 1LP9E 1C12A 2IPKB 1WZ1L 4Y88A 4R7NB 1GAFH 4QRRD 5D1XB 5IEHB 1VFAA 3WEXB 1U6AH 3CH1B 5I75C 1RMFL 2G2RB 3SE3A 5F7DA 3MV8A 4FQCL 5D7IA 3D25B 4TYUA 4POZC 2AV1A 1NCUA 5DI8B 5I6XC 3OKMB 2MFNA 4X5WA 4WFEE 5LKNA 2DWEB 5ACLA 1P6FA 1J11A 5AUMB 3CVHL 5D1ZD 4DEPB 1PX4A 1JZ8A 3RY6A 1Q9OB 3BZ4A 1GGUA 5DJAB 3VFPA 1T2QH 1AR1C 4MMZC 1RZJL 3MRJB 5D93C 2HH0L 4JPWH 1DBKL 3T0XA 3VRJA 3STLB 1NDMA 5F88A 4QTHA 3D39E 2L4OA 2QSVA 1FYTE 1BQHB 1BIHA 1J18A 5EU7C 4D0BA 2VLLA 3KPRE 5J89A 3R06B 3UCRA 2QEJA 1N7ML 1CLOL 3Q5OA 4YIQB 4ZOCA 1CK0L 2C3VB 2DIAA 4L3EE 2VABA 2YN3A 2BOBB 4F8QA 5I76B 2IAMA 1ZA6A 2FR4B 3RA7H 3D39A 1IAOA 4M93C 2A6JA 5KVEH 1B0GA 3ZDYE 2D7NA 5E2WH 3S8WA 3MLYL 4OZHE 1BREA 1OLLA 3WE6B 4LF3A 4XVTH 3RZCB 4KZEH 3O4LB 1IM3A 1TXKA 1OAQL 4NYLB 3WHXA 1I8IA 3MNWB 4FQQA 1IT9L 3IKCB 2V5MA 4N9GA 3F7VB 1R3KA 5FB8A 5E8NB 2ORBH 3K2MC 2K7QA 4OFKA 3RDTB 2E3VA 3PXHA 1KG0B 4BZ1H 3O9WD 2BSTA 4OJFH 1Q9WA 2R56L 3G08B 1QHOA 2X4OB 3MQIA 3DV6B 4GW1B 5DC4B 4JFYA 1R3IH 2NCMA 1GPOH 1D5XB 4G42A 3MV7B 3LD8C 4KWUA 1WWBX 3VXMA 2VLMD 3S88L 2ENSA 4DZ8B 2R2BA 3RWJA 4Y4FA 1LILA 5C0IA 4QXGL 1GGCL 3MRNA 2G5BA 2WMPA 3IDGA 2DQIH 4UDTB 3HR5B 3EOAA 1U92A 4M6OH 1IEAB 1CT8A 1G6RA 2GSGA 3ZKXC 2DQDH 5E94A 4POZD 4G9DA 4XNMA 1JPTH 3H0TB 4XCEB 2NY5C 1OAYH 2WWKO 3RNKA 1I1AB 5LGJB 1KF9B 2V7HA 4PP1D 1CD1B 5SX4I 3SBWC 5HGHB 3FQWB 1DBAH 4JO2H 3PWLB 3RHWK 5SWSB 3VD7A 2VAAB 3LKQA 1P4LA 3ILQC 4QY8A 3UO1H 3KPOA 4EDWH 1FH5L 2NY5H 5I1EH 3WUWA 1CBVH 1ZT1A 4OT1L 3BDBA 5JW4N 4OZ4A 5HI3C 4IDJH 1BBDL 4PJGF 4CW1B 1P1ZA 3PABA 1KIQA 2FO4A 2FX9H 4P3WA 3ARBC 2OBGA 1RIUL 3BGFB 1S9XA 1E4XH 3PGFH 2W9DL 2P49B 4I18B 3TM6A 1RURL 4ODUB 1WAAF 3K4DA 1IM3B 4NHCL 3EJZC 4RGNC 2OI9B 4EKXA 2ADIA 3MACL 3ESUF 2VMFA 3SO3C 5BW7A 4Y5XA 4Z7WA 1WFNA 5ID1A 4FQXD 3TT1L 3KG5A 1NBYB 4JLRB 4PRIA 3RWHA 4XMLL 3V0AC 4HMEA 2BHYA 1OT1A 1JWMB 1IGFH 2E9IA 4I18A 1OTTC 1LK3L 1VGKB 1XCTB 5J6GA 4X5LA 3OSKA 3QQ4B 3Q2CA 1CICC 5ICZB 3TJEH 1I9JL 1CL7I 2HLAA 1CXLA 1MHEA 1T1YA 2JJSA 2RCSL 3T2QA 5D6CB 2NY0B 3L5XH 1CXHA 1RJLA 4GRLC 3AC0A 3PP3H 5H94A 5BZWA 1IAIL 3FAWA 4X0KB 2FX7L 1CI5A 4DZ8A 4PJ5D 1UACH 4QRUA 2EDFA 4CVXA 1VESA 4S1DC 1G0XA 2ICWJ 3SGDH 1SJEA 3WS6A 1F13A 3ROOA 4RDQF 1WBXB 1F2XK 2XN9D 1NFIB 4ZSOB 4F15B 1XGPB 3LKRA 3RHWF 1VGEH 5HHXL 1AH1A 2IC2A 4M5YL 1V05A 2CGRL 2VN4A 1U8KA 4OM0H 3FT3B 1UCBH 2R23B 1Y18A 2Y72A 4JZOA 2QQKH 4RFEA 1NGQL 1U92B 4OZIF 4GKOA 4ONFH 4HWBH 5IG7B 1J8HE 1H5BC 4HBQA 4UV4H 4NN7C 4OCYH 4G9FA 1UKTA 3EDEA 1YNKL 2ZZUT 4WI6A 1JIBA 4OKVB 1BJ8A 4LSUL 5CJXA 5T3XE 1MSPA 1NCBH 1PFCA 1KJ2A 1DEDA 2Y25A 4K3HA 4L8CA 5MEQA 3ZO0A 3UJIL 1M1SA 1U3HD 4NPYA 3LKQB 2ED7A 2VAAA 2GJ6A 5JXAH 1LNUA 2HKHH 4KUCF 2Y4SA 1C5DA 2H2PC 2K1MA 3BIBX 2CO7B 4NN7B 2EDTA 4PYHA 1OCWL 5I8KH 4PP1C 3IJSA 2H9GA 1BOGB 5DUPL 3QXWA 25C8L 1D5BB 4M5ZH 5HYSG 1J0YA 1AHWA 3V5KB 3FZUC 1KJ3L 3WN5C 1GAFL 1A5FH 2DBJA 2PETA 1FPTL 5F7KC 3AXLB 5C0JA 1BD2B 4OLXL 1MF2H 1UA6L 2DQFA 3GSXB 5HI4C 5I75B 3S7GA 4H1LH 4PBVC 1A7OH 1IL1B 4WI4A 5B39G 5B22A 5K59F 5BRZE 2X2YA 4R4FL 3H3BC 1PYWA 3NCYP 4A2MA 1JPSH 3BZFB 4WUUB 2ARJQ 5ICYB 1D3CA 2F54E 3U9UA 5DURD 4OSUL 1MI5A 4D8PA 2LABA 1F2QA 1HH6B 1CYGA 1MCBA 2MPAL 3ZE0E 4XWOD 3BSZH 4NCDA 1YC8A 1RZJH 4JFQA 2VH5L 2DI7A 3WDJA 3W5MA 2VLKE 5GGTL 2AEPL 4X6CE 3T8XB 3U2SB 4Y0GA 4YE4H 5EOTB 5MEOB 2QKIB 3CGTA 4PJCB 4P23C 1ED3B 1YN7A 1KPUA 5DHVB 3TYGH 2ADGA 2ESVA 1XCQA 5ID0A 2BJMH 4NFBA 1OSPH 2B4CL 4PJHA 1BQUA 4DCQB 5CKAA 5J1TC 5EU4B 4HC1H 5GGQH 1VEPA 1S78D 1IAKA 1HH9A 3D85A 1MREH 3FB6A 1FZJA 1BIIA 2E27H 3EYOA 3QQ3A 1B90A 1DUZA 1RUPL 5IUSA 2HFEA 4JY4A 2IAMD 4MXQC 1A14H 2F8OA 4WUUE 1JGUL 3OKLA 3U7AA 3P30L 2XY2A 1BF8A 2DKMA 3OX8B 2PXYC 4MJ5B 3MREB 1ZEAL 3EOBB 1VA9A 2VLRD 4OCWL 5HYIA 3DBXA 3W81A 3HE6C 1CD1A 1SQ2N 4PJ8D 1XF3A 3QUXA 4WTXA 5C0RL 5KS9B 1DFBH 1OAQH 3QFJD 5FYKH 5B3JF 2C1PA 1BZ9B 1UZ6F 3S4SA 3OKEA 4YHIA 4LLDA 2Y7QB 3QXAB 5C0EA 5FYLL 3HC4H 1AGCB 3QDME 4P46B 4NO3A 4NQCB 1WC7B 3SQOL 3O2VL 5C0JB 2Q6WB 5KVDL 3MLSH 4NRYB 3OJDA 5HDOA 3THML 5D2LE 1SYSA 1CLCA 3HFMH 3K8MA 1QFUL 2R56H 5HGDB 2UYLB 3VFSA 4H20H 4O2EA 1QA9A 3BDYL 1LEIB 2IQAB 4JHWH 4NWUL 5DK0B 3V0WL 4LPTA 4R8WL 1GPOL 5C0FB 4QHKI 4LIQE 5I73C 5GGSY 5GGSA 1EV2E 4PRHB 4KRLB 2QQLH 1EEQA 4U31A 4GMTH 2IADB 1DUYA 1UG9A 3MA7B 4PLNC 4Z77B 1B4RA 1GGCH 1FL3B 2DQIL 3W9DB 4M6OL 4JKPH 5IWLA 1OLZA 4WFFE 1TJIL 5HGGS 2XN9B 5KSBA 3QDJA 4NPYB 4ZSOE 3EHBD 3VH8A 1F8TH 1OOAA 5MEPA 1MCCA 4PRBB 4LNVA 4Y16D 1M7IA 3IDJA 1CU4L 4YDLB 3FO0L 1AQKL 5I17B 1AFVH 1R3KB 4YUEL 3SGEI 2XA8L 4ETQB 4M6ML 1CBVL 4R96B 2VAJA 2XYCA 1KIRA 5DQ9A 1CXIA 1JUFA 3SGDI 3G04A 4R0LC 2ICES 5HYSA 4XT1C 4NQSA 5CJBA 4DAGL 2VABB 3NFNA 4DGVH 3ARGB 3LIZL 4FXLA 4F57H 5LXGH 1RHHB 5LCVL 1BIIB 1TIUA 5BVJA 5IG7A 5F6IC 3RFZC 4I9WE 5K9JH 2YMXH 1A9BB 3MRDA 3TIDB 4FP8H 2E7HA 4G6KL 3EO0A 3JWOC 4U1MB 1C16B 1Q1JH 1NLBH 4H8WL 2IAMC 1JMZA 2FBOJ 3C87A 4LASL 4OLUL 3N1GC 1HHKB 4PJEA 1M7DA 1YYML 4PPTA 2NNAB 2VXQL 1G7IB 4P59H 1PG7W 2JB5H 3C2AL 1K6QL 2HT2D 3MRRB 1IQDB 3VFTB 4HIHB 1ACYH 2ZCLH 3SDYL 4PUBL 5GS2D 3KXFD 2AGJL 5DD5H 3T4YA 4R2GC 4WWKA 2CQVA 1KV3A 5HVHB 3P0VL 2FO1A 3AS1A 1O7VA 4PJXA 3JBG7 3VGAC 5SWQB 1P53A 2ICCA 1NBZB 1IILE 4UV7H 3VDCA 3UBXI 3WNLA 4ZMAT 2DBLH 4HIIB 1P9MA 2EKSB 3BP5A 3SKNA 4RRPG 2ZOKB 4P3DA 3S96B 5E9DE 3C09C 3EUUA 4ONFL 4HWBL 1MFBL 4NQED 5DQJB 4G9DB 2O26U 4X6DE 4Q6IC 5DS8B 5J12C 4ODWA 1U93A 2FB4H 2VKWA 4ELME 1I1AA 1F90L 2VXUL 2WW8A 4ZD3H 3BD3A 5DJCA 3EHBC 5E00A 3VWKB 1S5IH 4U6TA 3D48R 5CINL 3WNOA 4N1CA 2N4IA 4GAJL 1FLTX 1GVIA 3ZLQC 4UDTA 3I84A 2DICA 1EEZB 3I85A 4P2RE 5LAXB 5HHMB 1DN0A 5D1ZC 2DJUA 3KXFB 3MUHL 5JOFA 1OB1A 3DROB 3QEQD 3RZCC 3OPZH 1A5FL 1IGYA 3FFCE 1B0WA 4MQXD 3V4PL 1LO4L 2NY2C 4NC0B 4OLXH 1S7TA 1MF2L 2XY1A 4TRPL 1QKZH 3FT2B 3T1FA 5B3JE 5C6PB 2R23A 5DFWH 5C0CE 3SCMA 1LDSA 2ICEA 1G7MB 1TFHA 1BZ9A 3P0YL 4HUVB 5E08H 3HZKA 2D7TL 3VXMB 3BJ91 4HJ0C 2C3GA 4PJFA 1X4ZA 3INUH 2GJJA 2VH5H 3C6LD 5FHAL 1J8KA 4RSVA 4YGVB 1HI6B 1IGJB 2EZ0C 3DURA 2ATPA 3K8KA 5DD6B 2XQBH 3X11B 1YPZF 2A6JB 4HG4K 5KSAB 2YBRB 2FHCA 4TVPD 2VDOL 5IK3B 5I76A 4MDIA 4DJMA 4QO1A 4YHLL 1SBSL 4H1LB 5I73B 2DL2A 5KAQF 5F96L 3T2OA 3KPSA 5GGQL 4HUUB 5A3IC 4JDVA 4QOKD 3HE7C 5D6CA 1MCDA 4RMWA 1EAPA 5AZEL 1Z5LA 4JM2A 1BGXL 3O11B 4Z7VE 4LDEB 1P2CB 5BRZA 3WJLC 1NANH 2Z91A 1I7TB 3RVXD 4O5LH 1UYWL 2FO4B 1K4CA 2BVQB 1MCPH 3DJ9A 1NGYA 2YBRA 1S7UB 1WV7T 2EYTB 1R3JA 5B8CA 3QIUC 3VFUB 4P2RD 3V4VH 5C0CD 4GAGL 5D1QB 4OCNC 1E6JL 1MEXL 3PL6D 3AU1B 3VXPA 5HYJD 2K9UA 4X8JA 4C57C 4MX7B 1U8IB 1A6WH 3ULSB 4MAYB 2Z8VC 4HBCH 1RD6A 3K8LA 1FYTA 2XWJB 1KCLA 3IGAB 2NZIA 1QSVA 3MMEA 2FH6A 1KPVB 3T3ME 3BFOA 3O6FB 2X42A 5EZOH 4HJGA 1C1EL 3G5ZA 1OW0C 3GMQA 3GMMB 1QFUH 4ZUWB 5GJTH 5GHWH 1RZ7H 2H2SD 1X5IA 2X89A 2DLHA 3KPSD 4R8WH 3V7AE 2OQJB 3TV3L 2D0GA 2FSEA 4OCXL 1GCFA 4H5SB 4WFHE 3MLUL 5DF0A 4DFIA 5FGRA 1YA5A 1HHKA 2ZCKL 4LEOB 3DV4A 3MZTA 2PN5A 3H7BA 3NZHL 3KR3H 1I3RB 5KAQG 1VACA 2HH0H 1TJIH 1MFDH 2AEQH 3F7VA 5IVXE 4MSWB 1RZ8A 2X05A 1FFRA 2EDJA 4YK4C 4PV9A 4YBQC 4ZFFB 4L9DA 2P24B 4MWFB 4ZFZA 4LCCA 4DUWA 4P5TB 4AMKL 5JZ7D 4HCRA 4W81A 2G75B 3SCMD 3DROA 1RSFA 2Q3AA 1JGLH 5DJZB 4KDWA 4A6YB 1WK0A 1XF5A 4G42B 4UT9L 3ORJA 5EZJB 3OKNB 4G8IA 1ZT7A 3C6SB 4LSVL 3RA7L 4YDVB 1RUAH 3HE6D 1NBZA 4MNQB 3QNZA 4OUOA 3N0PB 4EI6B 5DK0A 3U7YH 1ZA6B 3VGHA 2JCCB 1KJVA 1U8JA 4C59B 3W39B 2R15A 4OCSH 2OTWB 3B8YA 4HS3A 2F74A 3QQ4A 2BZDA 1A2YB 2P5EE 1XF1A 3RIAF 3UC0L 5B3NA 5F44A 4BSWA 32C2B 4DQOH 1MI5E 3ARBB 2GT9B 2Z8WC 3U9PL 3VFOA 1Q1JL 1FN4A 3STZA 1ZGLP 1CDUA 4CVUA 5AAMA 4OZGA 1Q9LB 3O4LA 5C0ND 4J3TA 1KLGA 1X5ZA 4MJ5A 1PD6A 4P59L 3F12A 1CFBA 4YDJB 3V52H 1GH7A 4D0CA 1IM9A 3S36H 3MBEA 1EHLH 1K6QH 3UZQA 2B0SL 5CGYC 3IXTA 1BQLL 2FH8A 3HLAA 3M17A 2DL9A 1CGYA 4J6RH 4Y4HC 5CHNA 5HY9A 3H9SD 4NC1E 3V5HA 2YRPA 2VOTA 1ZOXA 3O11A 1SVZA 1D9KD 3RBSA 3QSKB 1IC4H 5C6TH 4LLMA 2R0KL 1JYNA 3PF2A 2BX5A 3MLWL 3W0WA 1MI5B 3MXVH 5FO8B 1N0LA 3M1BB 5IVXF 5FDYA 3UPAA 2F54B 1B88A 1B6UA 4X98B 3MC0A 3IFPA 3LB6D 3L9RB 3QDGD 4HMDA 5SWZB 3PJSB 2V5RA 3ZYIA 3BZEB 5D96B 3OJVC 3ALWA 3T65B 2C7UA 1JPTL 2H2PD 3QUZC 1FIGL 4XVUC 2LU4A 4XPTH 1A6VL 2GI7A 3CUPB 5D7SH 3MXWL 5L9DH 5HTSA 2XOTA 4KRMB 2EE6A 2CDFA 1NGWB 4UOW1 5FA3B 3MZGB 2FLBT 4M8VA 4OCRL 1DE4B 4KK9C 2CLZA 4M7LL 3EYOB 5F8QC 6CGTA 5KSBB 1E4XI 4TTDC 2NY4C 4P5TA 4XCYB 4JM4L 2V17H 4NJ9L 3S6CA 35C8L 4NSKA 3N50A 1S5IL 1DQLL 3N1QC 3U1SL 5C0AA 1ZMYA 2VISB 5IM7B 4RCAA 3WO4C 4YDVA 4DKDC 1TTGA 4G6JH 2CK2A 2D31A 1UM4L 5DD0H 1F3JB 4EI5D 4QRTA 1OQOA 1QBBA 3DXAD 3VGAB 1S7QA 2LU7A 4TRPH 1QD0A 1WAAE 4XMLH 3PWPA 1HDMB 3KHOA 4CMHC 1CE6A 5DFTA 4OGAC 5F9JB 3VD4A 5JQ6H 1M4KA 3ILPA 3VD3A 3ZHLA 1G6RH 3ULUL 4NT6A 5CHNB 5HY9B 4OKDA 1TDQA 4PIRF 2WBJA 2NTFA 3KPPA 4L4TA 2ADGB 1MHHA 2Q86A 4HZLA 5FHAH 5C0FA 2NW2B 5I2IA 3UPCA 1NLDH 5L2KB 4PRNA 3OF6D 3SDCD 4QKXB 4OBRA 2W0LA 4HIHA 1F45A 3LDBB 5EU6D 4PGDA 1L7TH 4YFLF 1QR1B 3RPIA 4YHLH 4Q0XL 3V7AG 2HFEB 5I15H 2A6DA 3L3KA 1WIOA 3ARDB 2CGRH 3V5DB 1FJ1B 4N0UB 1KT2A 4LL9A 3FQTA 4XBPA 2VLRB 5AZEH 1NGQH 1VPOL 5FOBB 3J7HA 3TN0C 4JANA 4OAWB 3H9HB 3LKNA 5F1IB 5IB5A 4A6YL 2EIDA 4W4OC 1R3HA 4ZS6C 3BN3B 1NCBL 2OM5A 5HHPB 3WFHB 3ARZA 3BHBA 1RHFA 4GBXD 3WUZA 2HKHL 4OF0A 3FB8A 2ZOKA 3QUZD 2R2EA 5GGVH 4NFDA 4YDLC 1FLRH 1QSEE 1YNTB 1Z0MA 2X4PB 1EHXA 4F7CB 4LSSH 1OD7A 3QI9B 3MGAA 4K9EH 1CG9B 5EZOL 4ZOEA 1OAKL 1FPTH 2WV3A 3WFDH 4H1LA 2AV7B 2F8XC 5I1AB 4HJ0D 3DHMA 5D1QD 1WVZA 3MOBH 1Q94B 2BVOB 4ODWB 4EN3B 4NRXB 2E6JA 4JFDD 3QHFH 4Y4HB 2W0FB 4ZAKD 1B4JL 4M1CC 3H3PH 3MLUH 4D0DB 2MPAH 4JDZB 1PVHA 4LFHD 1IGYB 5EU6E 3TBWA 4JO3L 3ZYOA 3RP1A 4BFEA 5ICYA 3ELAT 4NDMB 3RIFF 1EXUB 1SEQL 5F7MC 5GGTH 3GZKA 4WW2A 1MFDL 2OTPA 3A6CH 5DGQA 1HQRB 4GG6B 5JORB 5D2NE 4OLZH 1I7ZA 4J1UA 3GMRB 4PRDA 2ICEB 4NOFA 5C0AB 4NC2B 1A6PA 1AKJD 1SYSB 3I50L 4AMKH 1P4IH 4YX2H 4P4KC 1JGLL 3SKJH 1URLA 1MREL 2PCPB 2HFGH 3NFNB 1VKXB 4APQB 4FXKB 3ZTJG 4WFFD 4PGDB 4PJCF 2ATPB 1CFQB 3HN3A 3CX2A 4YHKH 4R7DB 1A1OB 1DQDH 1EA9C 1YMMA 3O3DB 3C08L 2W91A 1QFWM 1UKSA 5KG9A 2OQJA 5DD1L 3MLRH 1FVEA 4FHBD 1V7ML 2J6EA 4Z78B 1U8QA 4N5EC 1KFAL 3VW3L 3U0TA 2HMID 4GG6E 2BK8A 1JGVL 4B5EA 3V6OA 1BHGA 2WUBH 4OFPA 3U9PH 1WBYA 2EIEA 3FTGA 3RX8A 4KMTH 5ESVB 5FYLH 2E9WA 3F62A 2YWZA 1MFCL 2AJVL 4Y4FB 5C0IB 5F1SA 4HWEH 3R06A 2A77H 3DLQR 4S1RH 5ICXB 4RAVB 1MJ7H 1MCFA 1T7VA 4PREB 4UDUA 4LVEA 1MCWW 2E6PA 3CMOL 3D39B 1QSFB 1XGUA 2P43B 3I9GL 1KPUB 4J6RL 5D7IE 4E41B 5C6WH 4BSVB 1ES0B 3X12B 3VXSE 5CLWA 5DMYA 3BQUA 3ZKMD 2XWJA 1CQYA 1QRNA 1PKQB 3O3BB 4I4WB 4KK5C 1CICD 1ITBB 1FL5B 2CRZA 2VXSL 2VZOA 3BMVA 4O9HL 1H15B 1N5YH 4XNUH 5CZVH 3RGHA 2WANA 3DX9B 1RZFL 5GGUB 2R4RH 2X5PA 3MCG1 4P9HL 3NACL 4YFEA 3P3YA 3LPGA 1GIGL 4NP4L 2B2XL 5T1DH 4JJ5A 4RGMB 4KDTA 3FQXA 2BNUB 1FIGH 5D7SL 3D3VD 2MCPH 1GYAA 1N26A 3FO0H 2N7AA 5LAXA 5CGMA 1I9RH 3GO1L 4YUEH 4ALAL 3KAAA 2V9QA 4GAYB 5T3XH 2NZ9D 1KEMH 5JHDD 4NWTL 5T1KA 3RDTA 2AJUL 2ID5A 1CGWA 1IRAY 2BP3A 1CT8B 1D5MA 4XVJH 2HRPH 2CUHA 2NX5D 2VC2L 3MA9L 3QR2A 4DAGH 5J11C 3L5JA 3SN6N 1WZ1H 3B83A 3JV0A 1FP5A 5E9DD 2HLFC 3GKZA 1R5WB 5LCVH 1Z6JT 4LPUA 3U1SH 3GMNB 4C54A 1EPFA 3GSNB 3HNSH 1N6QL 1U8QB 4LLDB 4UTAL 1MCRA 2YUVA 1WIUA 3VRLE 4QY8B 3FT2A 3GGWA 3JV6B 3SKNB 5TGBA 4LSQH 5AYUH 5TJWK 5L2KE 4K71C 1CDCA 2PUQT 1BQHG 3ZE1E 1G0YR 1CN4A 4LASH 2I60L 4NZDA 4Z7QE 1JTPA 5E9DA 2WNGA 1TZHA 4TPRL 5E94B 1Q9OA 1UVQB 3EO0B 4Z7WF 3KYOB 2VTFA 3GSNA 1QEWB 3O4OC 4JPWL 3QDJB 1DBKH 4OIIH 4QHMB 4L4TE 1CGTA 3PG2A 3GMMA 4XHJC 5HHNB 4YHNB 3ULUH 4WW2C 2O5ZH 3OAZH 4K7PX 1R3LB 4K8RD 1NSNH 1P7KB 3JV4A 4XP6L 4LCYB 1KTDA 1KJMB 3MJ8B 2AQ2A 1D5IL 2AGJH 3DRQA 1JK8A 5L8KB 1N7MH 1D6VH 1JMXA 3G08A 5H37H 3KPNA 3NPSB 3VXQB 2CMRL 5IVZB 2AK4A 1BWMA 4MD0B 2FR4A 5DUBB 3OJDB 5I71B 4JQXA 5ECJE 4RFNC 3T0EB 3AU1A 2J12B 4FRWA 3VXPB 4U6YB 1KLFA 3FRPG 3IDYB 3QUMH 4HIXL 2X4TA 4MQXC 3R8QA 5CEZE 4P4KB 3LEVL 4MWFA 3ZKMC 1OPGH 5CSGA 4G6AD 2RGSA 1MFBH 1CXFA 1BM3H 3DUHA 4CU6A 4NHUA 4P3DB 2BC4B 2RB8A 5JW4Q 4F3FA 1JCKA 3UJTL 1KJVB 4LPWA 5DLMH 3IXAA 4KPHH 2DJSA 4QRRB 2DQFB 4ZD3L 5ILTH 1DBML 4WNQA 1A8JH 3TO4A 4JEGB 4QOKE 3BIAX 3L6FB 1Y18B 4RAUA 5CP7B 2ATKA 4KUCD 2IGFH 5IK3A 4LVNB 4U1HA 4K3EL 1LP9A 2ZP0T 4OZGB 3WNPA 5I66B 1XGPA 4OJFL 2VDML 3W11D 4EN3C 4K9EL 4EOWH 4GW4A 2HVKA 2D0HA 2NZ9C 2WBWB 2ZUUA 3V4PH 4MVBC 3IXAB 1FIEA 3D39D 1S9XB 3MFGB 4M1DL 2O61A 3RWFA 3D2UD 3HC0A 1GZPB 2B39A 2IJ0C 1Z3GH 4P2OC 2VSDA 2UWEE 3M45A 4F8TA 3VFNA 1FJ1A 2YRLA 4N0UA 2COQA 1UZ8A 4JRXB 2HLFD 3MR9B 1JNHB 1YEFL 5HXMA 2YC1A 1I3RA 4PRAB 1RHHA 3KVQA 3QHFL 4GQ9H 4TNVF 2D7TH 5I1CL 3LS4H 4LCWB 3TA3C 4ORGA 2JIXD 2VLKB 5CJQL 3LV3A 5BOZG 2HJLA 4JO3H 4FTVE 4MA3B 5A1AA 1DBAL 4JO2L 4G8IB 5K93A 5E1AB 1DSFH 2Z35B 5J1AB 2XQBL 3H9SB 5EUKB 5JIHA 5IJKC 1INDH 2R1WB 2ZCHL 3OAZK 4AL8L 2MHAA 5I1EL 4LIQL 4OLWL 2EE9A 4RISL 3IAQA 4H25A 1MHHB 4HZLB 2DM7A 2VDOH 2APXA 5CIPB 5F9JA 3I50H 2VDNH 4JZJC 1SBSH 4Z6AT 1AD0B 1S7XB 3ZE2E 5JQHC 4XNYL 5IBLC 4KQ3L 4NT6B 2X4NB 5DJXB 1U8MB 3MRHA 3SKJL 2FX9L 5DTFA 1UZ6E 4MNQE 3RNQA 3TA3B 2QR0B 3PWPB 1X5AA 3QUZB 2X70B 2R0ZH 4HKJA 2GTZB 2GEEA 3L95A 4NQDE 3C5ZA 4IOFD 4BQ6A 1UYWH 5GRXG 4NM8L 1LEKA 4G80B 4IRSA 4JR9L 4X99B 4NHCH 2NPLX 4GBXC 1Q72L 3FT3A 3S4SG 1T0MA 3FO2B 3IDNB 1LO0H 2P5EA 4F9PC 2WWMD 3MTRA 2WZPD 2N7BA 1UB6A 1AXSB 3E8UL 4NSKB 4H1LG 2EEAA 4FQXB 1A6WL 4LBEA 4HUVA 3QFJE 5T1KB 1G6RB 1KCUL 4G6AC 1OSZB 3GSUB 4GMSH 1AGEB 4NQDA 4O02H 1I9JH 4LLUB 4P3CH 3BEWA 5FM4A 5IMMA 2PF6A 5J57B 3DUSA 1NJ9B 2QSQA 3VRLF 4PBWD 3SEPA 5F7YC 3PHSA 3LSOB 4JHBA 2V2WB 4I0PB 1WZLA 3OHXA 3NBNA 1CG9A 1BP3B 1CQKA 1H3UA 2OTUB 3TV3H 3GK8H 1U0QA 1HZHL 4LCWA 3TP4A 1W0WA 5AAWA 3SE4A 3RUGF 1GC1L 3VRIB 3X13B 1UCBL 3KR3L 3B9DA 1BVKB 3K1KC 4M7ZC 5EZLB 1RZFH 4PJDA 2R4RL 3OKDB 1QFHA 2AEQL 3TO4B 1BJ1H 2AERT 3OG6B 5D7JA 3V5DA 3QI9A 1XT5A 4OCYL 3PV6A 4R97C 3CFCH 4JAMA 2HT4C 5C08D 1EBAA 3AS0A 1ODAA 4LSUH 2C3WA 4NQDD 3BPLB 5I66A 4CMMB 4BA8A 4GKSB 3O9WC 2ZUWA 2R39A 4HHAA 1I9RL 1A6ZA 3HLAB 3GO1H 5MEOA 3FO1B 2A2QT 1ZWIB 1BQSA 4TSCH 5GRUL 1FZJB 4JY5H 1G9EA 2ZUSA 5T3XL 3L6FA 1OCWH 5CJOL 1XIWD 2DKUA 2UWEA 2PXYB 1HXYA 4XVJL 4JPKH 25C8H 3MRFB 2DQEL 4ZFGH 1KJ3H 3VXME 1K85A 4YR6A 4KJWC 3BKYL 3FN0H 3IRZA 1U42A 4GKNB 1WFTA 2WIIB 2X70A 5FO9A 3WIHH 3HNSL 5KSVB 1QRNB 5C0CB 1UA6H 2X4RB 4OCSL 5I1IL 2NY3B 4LPXA 4JGUA 1A7OL 2W0PA 4GG6F 1MCOH 1CGXA 2I5YH 4DVBB 2OL3B 3D1MC 1LVEA 3TBSB 4X7SL 3PQYD 5BS0E 1FNFA 4RWHA 1JPSL 4ZUSB 2OR7A 5SX5H 5CBEB 4JQIL 4OSUH 3U9UB 2I60H 5DHVH 5C3LD 4D9RE 1WZKA 2W65A 5H2BA 4F58L 5A16A 2P8PB 4HWNA 2Z31B 3DUSB 4FXKA 2KL6A 5D7LE 3TPKA 2YD7A 4E0RA 1S7XA 2NXZB 4PJEF 1LE9B 3V8OA 3S3PA 5K9OB 4KK5D 5I8EA 4BH7B 5T1LA 3TYGL 3L3JA 4HDIA 4LGPB 2EXWD 4Y19D 5IR1A 1OSPL 2VNCA 1G9ML 2R0KH 5HHOB 2NY6D 3WS3A 4QXWA 1V8HA 1JYXA 4D0DA 4RGNE 1EDQA 1JRHL 4LFHG 3DTXA 2LU3A 1ZHBB 3TCLB 3LQAL 2CDEA 2ED9A 4PRHA 5DJ8A 1BPVA 4WU7B 1JGUH 4Z8FL 1MRFL 4R90H 3HCVB 3QUML 4HIXH 1JFQH 5HSFA 4MD5A 5SWZA 3MXWH 1FSKC 1XR8B 3O6KH 4OLVL 1OPGL 5TH2B 2BRQA 1PJ9A 4P2CG 1KN4L 4I3SH 2DJ4A 1ZS8A 1A7PL 4IJ3B 1DFBL 1G9NH 4D9RD 5JIIA 4OCRH 3HMXH 1HSAA 4S1QL 3O4LE 3L3HB 4WWID 5DLML 1T22A 3LQMA 4H25B 4GRLD 4QHUB 4ZYKB 3BW9B 2Y7QA 3QXAA 3KYKL 2BVYA 5ILTL 1DBMH 3CAFA 4XP9H 1FO0A 3RU8L 2F54D 4YPGA 2HT4D 3TT3L 3QWOA 4FFWC 2D4FA 2R8SH 1C5BH 2DIBA 5BXFB 1DVFB 4JN2B 5KVDH 1ZLWK 4ZUVA 2N56A 5CZXD 5BV7B 4J3XA 2YA2A 4KXZI 2VDMH 2EKJA 4WWKB 3VFSB 3KJ4B 4Z18A 4JM2C 3MV8E 3FQXB 1JWSB 4X6DF 1F4HA 3ZE1F 1JHLH 2WIIA 5AUMA 1JHTA 2VRAA 1QR4A 3LKPB 2XZCH 3QWRD 2PW1B 4EQ2A 5BVJB 5B8CC 3BUYB 5FKPB 3L7FA 5J6HB 4L8BA 5AWNL 2D4DA 2X4TB 1I8LC 2VDLL 5IW6A 2N1KA 5CEXA 1A3RH 1L0QA 3O8XA 2F8VA 5DHYB 3QDGE 4XCNB 4AENB 1T1XB 1ZWIA 1F8TL 4L4VA 5EUOE 1GSMA 1HDMA 1W72A 2R0LH 4U3HA 4DKFL 5C8JA 1AGDB 2GJ6D 3HRPA 4QCIA 5JOPD 4U6HA 3N85H 4I3GA 1DSFL 1HQ4A 3RWGB 4KJQD 2VLRE 4L5FH 3KYNA 5D8JH 2ZCHH 2HT3C 4AL8H 5L0QC 3U82B 1U3ZA 1CIDA 1UWEL 4RISH 4O2CB 3FMGL 3SO3B 3OR7A 3HNVL 1J87A 2VDNL 4PJ7A 1AGCA 3G5VA 3T2NH 4N0CC 5SV4A 2DQJL 2XN9E 5GISL 4I18C 4DGVL 3P2TA 1QBLH 1MCLA 1OARH 1XR9B 4X4YB 2R0ZL 1FFOA 4I3RL 3BGFC 1E4KA 4NUGL 5DWUL 3L3KB 2BY1A 4FABH 1FORH 5KJRL 4Z78A 1EZVX 4NM8H 5K9JL 4EEEA 3CFBA 2EYRB 3VG0L 2AK4D 1F3JA 4MJID 1UKQA 4TVPH 1LO0L 4P99A 2FYYB 4OZHF 1SEBB 3CFEB 4YHZL 1AP2A 1X5KA 4OD2B 3BRFA 3O2DA 2VLKA 3SKOA 2Y6SD 5FFLA 3E8UH 5A16B 3T65A 2JB5L 5GS1C 1EEZA 4OZFH 2J8UF 4YHPB 2MCG1 2XTJC 3W82A 1H3VA 2PW2A 5BW7C 1MELA 4Z7VF 5D4QA 5A2JH 4ZOBA 5FGBC 4FZEH 5ETUA 4I77L 1OAKH 3WFDL 1XZ0A 1YEHH 4LPVA 1IKNA 2PW1A 3DX6A 3FFCA 2DF3A 4NKQB 3QCVL 2FEDD 4TUOB 4JE4B 2WQRA 1CICA 1GOGA 4WEUD 1EX0A 4F9LC 2ZNXA 5IM7A 2A38A 4KMLB 1U3YA 4EN3A 5MP6L 3WHXB 2JE8A 3SJVD 3CDYA 2MKWA 5IT2L 2Q1EA 3WE6A 4MA7L 1GGTA 1VDGA 1MCKA 4KI5D 3QUXB 4W6YB 3RL1B 5T5FL 4Y5YA 3BT2H 4RQQA 3HE7D 1RK0A 3FHAA 4P4KA 3IAPA 4JFFD 2RAMA 1ZHKA 4U6HB 2Z0BA 5F88B 3GB7A 4P48A 3FQRB 3AUVA 5F1IA 1ORSA 4YDKH 5FM8A 1P4BH 2BOBA 5C07D 5CJOH 4GAJH 1VB9A 2YC1B 5BXFA 3DGGA 1J1OH 3G9VA 3PDOA 5ADPL 1ZHBA 3TCLA 4XH2B 1UH4A 1BWWA 5B38A 1BVLA 2F5AL 5HGAB 1HYSC 3OPZL 3C08H 4KRNA 1PQZA 4DK3A 2QQQA 5F3BB 3MLRL 2A1WL 4KK9D 1EAPB 4JPVL 4AEEA 4TTDD 3DI2B 4G80A 4IRSB 3VW3H 1QPXA 3IYLW 4M7LT 3U4BL 5HBBA 1JGVH 3B6SB 3BD4A 4ENED 1KXQE 5IB4A 4M03A 1KGCE 3P0YH 5E08L 4CVZB 2NLJA 4PV8B 3VGGA 3ISWA 1EO7A 3O8XC 3TJHC 3CJJA 3SDDC 2APVA 1WWCA 4OZFA 2X4SB 4YPGB 2HG5A 5FAAA 2X09A 2R4SL 3NCEB 2O5XL 3FQWA 4CVXB 5JIKA 3LS5H 1WEJL 2G75A 2JCCE 2YOCA 4RMQA 5I6XB 3GMNA 2QHRH 1OTTD 4X4MA 4Q9CA 1U8LB 5E24E 3QULA 4OGAD 1WCBA 1G9MH 2P7TA 3L3IA 4LEOA 3BP7A 3OKOA 2ZOLB 3QRGL 4ZO6A 2YA0A 5D1XC 1IGCL 4M7JL 3OKKA 3EGSA 1KPRA 2VXTH 4P4RA 3ZT5A 3KJ4C 2OSLB 5IF0B 4Z8FH 3G5YA 3GDBA 1X9QA 4XI5D 5DRXA 2R1WA 3KPMA 1JFQL 3X14A 4EQ3A 4C56E 4XNQA 4XC3H 4X7TB 3QXUA 1ZLVK 1JF1A 1EFXD 4RMSA 2UYLA 1A7PH 4BUHA 4JAMB 3GEWB 3NOIA 1G9NL 4I13B 3LH2L 1G7QB 5DK2A 4P23B 2YPLB 1CL7H 3BP4A 3IS1X 3EOAB 4MAYA 4PJBF 3KLDA 3TO2B 2H6PB 2VC2H 4N68A 1PQZB 1PBYA 5D7JD 5ALCH 4PB0H 3VRIA 5ICZA 4X4XA 4JO1H 2R8SL 4NUJB 1C5BL 1NFIA 4EDXB 2PXYA 3FQNB 4P5MA 5TDOB 1NGWA 3I6GB 3TVMC 3CCHB 5GJTL 4PTTB 3ZE2F 2X6MA 4PLJD 4P2OB 3EDKA 3QNXA 1DP0A 2C7UB 2V5SA 3GJFK 3LOWA 3NZ8B 4KZDH 4KROB 4LCWD 5DEZA 4ZS7L 1EEUA 3O6FC 6FABH 2XZCL 3D0VA 4IRJC 4HUUA 3TN0A 3NTCH 4ORGB 3S5LB 5AWNH 1RK0B 2NNAA 4P46C 3NZHH 5SWZD 3QUYA 1Z5LB 3FQNA 4HGMA 5TDOA 2ZG3A 1KB5A 1A3RL 3GI9L 4QXTA 2A6DB 3FJTA 4HXAH 2DIJA 4GFTB 1CF8H 1T03L 3JXAA 4EVNA 2HTLD 5DJ6B 1NSNL 4XP6H 2WP3O 4YQXH 1MIMH 2VB5A 3W0WE 2WBJD 1JP5A 1I9IL 2OTUA 5JW4R 4YFLI 4Z95H 3N85L 4YHNA 3VMPA 4D94A 4ZTPH 2ZG2A 4JJ5B 4XWOC 1I85C 3HMXA 5CWSB 3VXTA 1UWEH 2DM3A 1MWAB 3WNKA 3MV9B 2D31B 2UV3A 3DSFH 4HFUL 2AXFA 2BY3A 4LSVH 4HLJA 4PJDB 1OAUL 2GY7B 3VH8B 5IVZA 2DQJH 5DJDA 5ISZE 5ELIA 1U8OB 4YAQA 1FCCA 4BSVA 5KOMC 4NUGH 5JMOC 5DWUH 4OM1L 1T5XB 1S7QB 2BNRD 3GGWB 5GGVY 5C09A 3T1FB 4PJBE 5IV2B 4LCUB 3ILPB 5SWSE 5D1XA 5IEHA 3WLBB 2BNRA 1B6DA 5ANMB 3PGCB 43C9A 2ICWI 4R96A 3T08A 4YHZH 3ARED 1BF2A 1T89C 3B9KD 5DGRA 5A43C 3V52L 2IFGA 3BPLC 4XCFL 3OKMA 1SVCP 5FCUH 4K3EH 4L8CB 4MAYC 2FNBA 1JRHI 2GJ6B 1MPAL 2DLIA 1HEZA 1CE1L 4JGMA 1MIEL 4EOWL 4ZFFA 1XIWA 3I75B 3MRGA 5LBSH 5JOPE 2CXGA 1N59B 1IC4L 1GGYA 4GRMB 3JWNC 3QCVH 1MFEH 4K3JL 2X1QA 3OXRB 5EO9A 4MLIA 1QLFA 1YEFH 2VUOA 5L6YH 5I1LA 3NIGF 3ARDC 4Y8DC 4HLZG 5EZLA 5I1CH 4PRPB 3WJJC 4E0RB 2Z93A 1I4FA 4Q97A 4PGEB 5CJQH 5MP6H 3PQYA 4XPTL 3PWVB 1RJYA 3VXUB 4QT5B 4WI5A 1TNNA 7FABL 5IJVB 5C2UB 1RFDL 2FX8L 2M26A 4P46A 1BZ7A 5CWSA 5IW6B 4YDIH 2A83A 5IBUG 1FN4B 4P5MB 1UADC 3UYRH 1VADA 4LHUA 4X7EC 3WEXA 4M7LH 1FRGL 3DIFA 1RZIA 3G6JB 4LLAA 1FYTB 4UZGA 1HN1A 5TFSL 4LCIL 4L4VB 1MRDH 3NFSL 2HWZH 2VDPL 5F72S 2VITA 1GOHA 4YDJA 5F89A 1JPFA 1TZGL 4NN5B 1NANI 3A0OA 5ADPH 3MOAH 4GT7A 1BX2A 5IGXL 1T2XA 4WJ5B 3QWOB 3KPNB 2EYTA 3CSYB 4KTDL 4NIKB 4JPVH 1F4XH 4PP2B 5GRYA 3UROR 4H88L 4PFEA 5E6IA 5FYKE 4YH6A 3AAZB 3U4BH 4KRPC 2LVEA 5EBMB 4LGRB 3O2DL 4HIEA 1T89A 3ULVL 2KPNA 1N4XH 1TQCB 5BQ7A 4L3EA 4BQ8A 3O45B 4HGKC 3DX8B 3UBXA 5HPOA 1BD2D 1FHGA 4MDJB 2O5XH 3PL6C 3IDIB 3LS5L 1QO3B 1YY9C 1NMBL 1T66C 3BISA 1MCSA 3RWDB 5DVNA 3MLVL 4N0YL 2MJWA 3GK8L 4OI8A 3DYMA 4PRPA 3BQUC 3T3PF 2HTKC 3HZKB 4XHQA 3RUGB 4WI7A 3TBSA 3MV9D 3SDCB 3H7BB 3NCFB 1KENL 4NRXA 3MRPB 3QA3B 1D5MB 4IOIA 1GL4B 3MPCA 4X5XB 4CJ0A 3FRPA 3MA7A 4YZFE 4ZODA 4RDQG 3IGAA 4QEGA 1OP5H 2BRRH 3TPUB 1MWAL 3ZKQD 1MCWM 4JFDB 4JGJA 3DMMD 4PJFE 2CR6A 4XX1G 1L0XA 1NCDH 2VERN 3GMQB 5M94B 5D9SB 4Y4KB 4CNIB 1Q9WB 5GRUH 3ULVF 4OZFB 1FQ9C 4HUNB 4N0RA 4AIXA 5C0BB 2DYPB 5TQ0L 4Q7DA 4GKSA 4MNGE 3O3EB 5HHOA 3LQZB 5JPNB 5HI4D 2C4FU 5I8CB 4NM4H 4LNRA 5FUCC 4P2RA 4QF1A 2FJHB 5BJTA 2WSKA 1G7PB 4NQVA 5HDBE 3MBED 2KUTA 4PP2A 3TO4D 3ARFB 1HOCB 3CLFL 1UXSB 1EIBA 2PTTA 3ULUD 3AAZA 2NYYD 3T4YB 3ARWA 2O93L 4UT7L 3SDDD 2HJKA 5GSRA 3GMPB 3QDMB 2OS7A 1U8IA 3JUZA 4XNZC 1HKLL 5JMRA 4JQIH 1B4JH 1WUNT 3PV7A 4EN3D 1LMKA 3B4NA 3DNKA 4YWGL 1T2QL 1V3KA 4HIJA 4TVPE 1UENA 1C7SA 4H0GA 1T1YB 5CP3A 4MD0A 1DLHB 1TCRB 3RGVD 5E6IC 3A6CL 1CGVA 2CKBB 5F1KC 5MENB 3LN5B 5F7LB 1T03H 4N0CD 4M62L 4YQXL 3U4AA 4GAYA 3X13A 4JRYE 5HHMD 3F7PC 4U1MA 2M8XA 2YPLD 1VERA 2DS4A 4MHHI 4OTXH 3K2UL 4WTWA 1XGUB 3QUMA 4XBEL 4RQQB 2IEPA 4ZFOB 5DJ2B 3GNMH 1G7IA 4LVHB 4ZUTA 4F7TB 3UDWA 4PJIA 4Q74A 4AM0B 5DMGD 1A7NL 3LAFA 4YHKL 3GI8L 4XPAL 3EO9L 1DQDL 4FQLH 3U30B 1MRFH 4OD2A 4R90L 1I4FB 3QNXB 1CCZA 2CIIA 4MJ6B 5JXED 1FL5A 2UUDH 3VXMD 4KH2A 3RX5A 3WIHA 3G6AA 2J8UB 2XTJD 1QYGH 5IHBA 1JI1A 2J88H 4X6CB 2LAGB 4I3SL 2AV1B 4S0SD 1AHWB 2VR4A 1TJGL 1CXEA 1LDPH 3AXLA 2GTWB 2VL4A 1G7MA 4M3JA 1S9YA 1UWGH 1IT9H 4WDIB 3QIBD 4HWEL 3RVTC 1KXTB 5D9SA 4PLJC 2CIIB 2G60H 5F1NB 1KSRA 3C6LA 4IRJA 3TNMA 3FN3A 4FN0A 2YR3A 3CXHJ 3CMOH 2H3NB 3O41B 4JY6B 3IFLL 3N9GH 1NBVH 4J23A 4G6MH 5GSRB 3VGBA 3VXQA 2P42B 4GRWF 1FYTD 5I9QC 1WSST 3CUPA 4RZCA 3QP3A 4LKXA 3TWCL 3L5WA 3QJHA 1HOCA 1LE9A 3N1MC 2WUCH 2D9QB 5E00B 5J9PA 4K3JH 3D3VE 1OGTB 3HG1B 2DD8H 4NQEB 5JW5B 5GSVB 2YUWA 4XNUL 2Y07L 1TCMA 3TF7C 1KULA 4QHMA 2ZPKL 2H3NA 5F93C 4X8JB 1GIGH 3MRHB 2B2XH 3MCLH 3KXFA 4JRXD 5JOFB 4YK4B 4AQOA 4Y19A 3GIZH 5JW4M 4WI9A 2OL3A 5DMIL 1F4WL 1J8HB 4GS7C 4ZXBB 1MY5A 1RFDH 2FX8H 4WENB 2Y36H 4OZFG 4QRSA 4EDWL 1NC2D 3C8DA 1I1AD 3FMGH 1T6WA 3U4EA 2I26N 1UXSA 1FRGH 3U30C 3KPSB 5EIQA 4QTHB 2H8PA 3MA9H 4LRNL 5DQJA 3RZCA 2IH1B 1BOYA 1KCRL 4LNRB 2FSEB 3MBXH 1TZGH 1HSAB 2XT1B 1N6QH 2VLLB 5HYQA 4PJ5B 4HLZH 4JVPA 3DVNA 1F58H 4ZAKC 4Z7NE 2GSIB 2FEDC 1LE5B 3OQ3B 1JZ3A 4U2YA 5DD6A 3BZ4B 4ZUWA 4S1DD 2WLZA 5HVFB 4MLSA 3VG0H 4U6XA 2CKBH 4P5KA 1F4XL 5K9KA 1NEUA 1YJDC 2BC4A 1YPZA 4IHOA 4PGBB 1E6OH 1FVDA 4EDXA 4NUJA 1ZHKB 1RUMH 5TE4H 4K7PY 4CL7A 2R2CA 5DJZA 1TTUA 4KQ4H 1L9NA 3ARDA 5EBLA 2O5ZL 3CZFA 1JWMA 5BO1H 1G7JB 4XNZB 5D5MA 4BELD 4LSPL 3FKUS 3QQNA 1VADB 4I77H 5HGHA 2E9JA 4WCYL 1LEGA 2EEDA 2PW2B 1PG7H 2G2RA 4RGNB 1TJHL 3QIBC 3QDJD 5J9PB 5E99L 1XH3B 2OK0H 4WO4A 2APBA 1X7QA 5EOQH 3MLVH 1U8PA 5ITFB 4UNUA 2DDQH 1T0MB 3HUJE 2BSTB 3GMOB 1JI2A 5KOVC 2VLJE 4M5YH 2OSLA 2CXKA 3FZUD 1X6LA 4CU8A 1JGDA 1NFKA 4YJZL 1I7RB 2HA1A 4NQEA 1AXSA 3GJEB 1N59A 2QQKL 3MV7A 1KENH 5LVEA 3LEVH 4J8RA 4RBPK 1QFPA 1ZXQA 3V6OE 4FFZH 4WFHD 1HEZB 4LARH 3QI9C 4BFGA 4CDGC 2NXYD 3S98A 5CIPA 5FO9B 4X80L 4KPHL 3VH8G 5T1MA 4NRYA 4YDKL 3V6BR 1P4BL 2AKRB 3DV4B 2IGFL 1QEWA 2NR6D 3SPVB 43C9B 1I8KA 3HRZB 5C9JA 2R2HB 3REVA 1I3UA 4L8DA 4QCIB 4QYOB 4MZ2A 4D3CH 5I74C 5HGDA 3EIFA 3WIIH 4PJAA 3IDGB 2F5BH 4ISVB 4QHLA 1HWHB 3MV11 3TBYA 2BNRB 5ANMA 3WUWG 5IFAH 1OGAA 4JFOB 5E03A 2NX5E 2DWDB 3PL6B 4JDTL 3RWFB 1Z3GL 1A64A 4UT7H 3MRMA 1QTYT 4FFWD 3HRZA 1J0KA 3D69A 1E28A 3PQYE 5BS0D 1QPPA 3MV9E 1H3PL 2HAZA 5FGCE 3BSZL 3CPLA 3L1OL 1L7IH 4KFZC 4HK0A 2AEPH 3TFKC 1EEYB 4RMRA 3VXUD 3HZVB 2EDRA 5CUSH 2HTKD 4KAQH 4NQUA 1WEJH 1S9WA 5IQ9A 1XF4A 4NNYB 5EO9B 4LIQH 1A0QL 4OLWH 4Y5XC 1ZGLM 3LN4B 3GRWA 3GIVA 5IW3A 3P4LA 3CCHA 3DVGB 1NFDF 1K4DA 2B4CH 5C0BD 4HC1L 3K2UH 2VZSA 3MJGX 4G43A 3QRGH 1XCQB 3MYJB 1PY4A 1YUHA 5ID0B 2OI9C 1RUPH 1TPXC 3HZVA 4N0FB 3BZEA 2DLGA 3ARFC 5E8OB 5IHZB 4LLVA 4KKLC 2YPLE 4WUKL 4XAKE 3P30H 5C7XL 1CDHA 3GSVB 4HS6B 1CIUA 3HS0B 3JWOH 4ZQKB 5CCKH 2EDEA 2JJSC 4YHML 4ZPTA 1M7XA 4JREC 3FO2A 3IDNA 3FQUA 4RBPH 4EJ1C 3ZYJA 1QYGL 1RZIB 1U95A 3GSWA 5BV7H 1QSFA 5D7JB 4BK4A 5HI5C 3KPMB 1TJGH 1UH3A 1ZLUK 4J12A 5HJ3B 4J3WA 1KTLA 3CFKA 1LD9B 1NGXB 4UU9A 4GUPB 2H32A 5LQBL 1T20A 3MRGB 3MBEC 3N1PC 1KCUH 4NKIL 2RR3A 2E6QA 2XNAB 1JNJA 1ADQH 4GMSL 1J0JA 3KLAB 2H2SC 1E0OB 1SMOA 4NQDB 5ALCL 4PB0L 2NXZD 2JJUA 3U2SA 5IVXA 2BMKB 4PJGE 3THMH 5FK9B 2A74B 5E2UH 3PWUA 1HH6A 3E3QE 2CIKA 4JHWL 3WBDA 3QEQE 5DI8A 2J4WH 5ALBL 5GRJH 1PEWA 3S96A 1T5WB 2DN7A 1YEDA 3HG1E 3FTGB 4LCUA 1QO3A 2ZOLA 2Z8RA 3QFJA 1N8ZA 3NTCL 4OD3H 3QUXD 1GC1H 1F42A 1UJTA 3KYOA 2OJZH 1N5AA 2Y07H 4R4NC 1MCHA 3IU3B 4KKCD 5JORA 5DVLA 4N5UA 4HPYL 3VWKC 3L3IB 3MCLL 3TH4T 5M95B 2H41A 3UTOA 1MIML 4H0HB 1SJXA 3V9FA 5DMIH 4F37K 3P4OA 3U48A 1U3HA 5IMKA 5D2LF 4AIOA 4ZTPL 1HILA 2FWOA 4JY5L 3FHQA 1X7QB 3MOQA 1Z0NA 3PWJA 5CD3B 2E7BA 1J12A 3TZVD 3HB3C 1R5IB 1AIFA 1BBJB 4ELKA 4KI5C 2YD1A 5LXGL 3DGCR 2C26A 5KSUB 3MBXL 3WIHL 2VWEE 3NABH 4MGXA 4RFEB 5IHUL 2OZ4A 1E4KC 4I0PD 4M93B 4K3GA 1OTSC 3QULB 3A6BH 1VCAA 2EDYA 2IQAA 5DDHB 1KT2B 2P47B 1TQBC 2E5EA 4FP8L 4NKDB 5TDPA 4GRWB 4NO2B 3QQ9D 4O58H 4YBHA 2CKBL 3QNYB 5HHQA 3ARVA 4H8WH 4Q58C 2BVTA 5HHPA 3E3QC 3QHTC 4LU5H 2V9TA 4LDLB 2BY0A 1ZKAA 1NCAL 1CDGA 2VXQH 5CP7A 1AC6A 3T0WA 4XCFH 4P5TC 3C2AH 3SGJA 5KSBF 3S37H 5FCUL 4JQXC 5A2LH 1E4JA 1FFNA 3U6RA 2PTTB 4KQ4L 1XEDA 4PY7A 2J2ZA 1IGML 4L8SA 4NO0B 5HDLA 4Z76A 3SDYH 1M7IB 1FNAA 5LBSL 2R0WL 2YPLA 2UZYB 3GIVB 2I9LA 1CE6B 5DD5L 2EXYC 2XQYG 3Q0HA 5E99H 2AJSL 3TZVB 4MXWH 1RZGA 1RZJC 5LGHH 4J4PA 4MNGB 2R2EB 5GZNC 1S7UA 1H3TA 1A21A 2CRMA 3C5SA 4NZRL 5L6YL 3G04B 2FECI 4HX1A 4UV7L 5GGRA 2PNDA 5L8LB 1KYOJ 3QUMB 5K59E 4OI7A 2VE6B 4EUPA 3B2UD 2A0LD 1KOAA 1QLFB 3QDJE 3BGMB 3QO0B 2X1PA 1RVFH 5HI3D 5AYQA 4JFDE 3QXVA 2NMSA 2VZ1A 4OZIB 3BGAA 4S2SA 3UTPD 4DUVA 3RJDA 1A9BA 2CJUL 3MRDB 1UB6B 4LLYA 2CLVB 5B4MD 5IB3B 2CR3A 4LARL 1S7WA 4IIQA 3M8OL 1A6UH 1G9NC 1J8HA 3H2WA 4ZXBA 3QYCA 2DMCA 2FEEI 2XN9A 2VXUH 4LKCA 3RJQB 5TFSH 4LCIH 4S0TD 4XP9L 1U91B 3RU8H 1KPVA 5CINH 3TT3H 3JUYA 4G8GD 4LHQB 2EDXA 4J7RA 3QDMA 4MCZA 3D2UB 3IU4L 4I0KA 2A9NH 1CD8A 5F1NA 4Z9KB 1KCVH 3IRPX 1DVFC 1T0PB 2F5BL 4K7FB 1XGTB 4NNPL 1FFOB 3TZVC 3ZDZF 3BXNB 3RL2B 2C1OA 2EC8A 1QKZL 3EDDA 3OXRA 5IBLD 5MEPB 2Z35A 5J1AA 3GSWB 4OGXL 1I1FB 1NGYB 1OAZH 1RZ8B 4J8RB 1JZ5A 4LLMB 1QVOB 1EK3A 3O8XB 3OGOE 3WFCL 1BVLB 5HGAA 4ELMA 3EJYD 1NBYA 3EOTL 1ETZA 4OFVA 2R0LL 4DKFH 2C3HA 3U36A 2WWMC 4CMMA 2W9LA 1D9KB 3L3GA 3QG6A 5GS3A 3GB7B 2B1HL 3JTTA 5CIPH 5FCSH 3KS0H 5JHLL 2BFVH 1EERB 3MNWA 1IGJA 3DURB 4KJYA 3T0ED 2I9LB 1BVZA 4OUUA 4LVHC 4PJ9D 5DC0A 1MNUH 3S35L 2WLYA 3IJHA 4I3RH 4XPGL 1WBXA 5ABDE 1AGBB 5C08B 1S7RA 1AI1H 3BP6B 5EO1A 4ESKA 4AJ0A 4WJ5A 5IFJA 5FYLE 4CDHA 1M7DB 2IALB 3GUTB 3IF1B 5IKCA 3B9VA 5IJKA 4WWKD 4JFEB 2R9HD 3IDUA 4YHMH 5DRWB 2IQ9L 3QNYA 3V4VL 3O9WB 4JFED 4GAGH 3MLTB 1YEIL 1CDJA 3V6FA 2AJXH 4NZJA 5F6HI 3U46A 2Z93B 3VFUA 4U0QB 3G6JE 1UM5L 2SEBB 4K2UL 4HBCL 4GBXA 1KIUA 5FF6A 4ZUUA 1NQBA 4PG2C 5IF0A 4Z0XB 2NW3A 3B5GA 5MEQB 1BBJA 1FCGA 5IW1B 2IF7A 4F9PA 4K7FA 4LMQI 1C1EH 4D9QE 4PJBA 1X5HA 3P4NA 1YEHL 5JLZA 1AE6H 3GSXA 3HI5L 3CLFH 4P5KB 5E2UL 2Z4QA 1YEEL 4PRPE 2NTFB 2OLDA 4FMFA 2J4WL 3V5KA 5GRJL 2APTA 4ERSL 1HKLH 2EC9T 4YFDB 4XC1H 3OKKB 1Y6KR 3RVUD 2V5TA 4C55A 1WWWX 3BPNB 4YWGH 2DQHH 4ISVA 1S5HB 2P8PA 4KJPD 5EBLB 1I1FA 4MQSB 1N2RA 3VCLA 2F53D 3BE1L 1KJ2B 1YC7A 2ADJB 3ZDYF 5F3HB 2DLTA 4XCYA 1EO8H 2MQ0A 1YMMD 5T5FH 5F9OL 1CZ8H 3WXWL 1HKFA 4G9FB 3T0BA 2XZAL 3L3JB 5ISZB 3RQ3A 5FYJL 3VFGH 4WW1A 5C0NC 2Y5TA 5FUOL 5JA9A 3WDHA 5H35B 3LPFA 5FYKD 4JREB 3FCTA 4GJTB 2BMKA 1A7NH 3DO7B 2A74A 1QUNA 1IVLA 4PJAE 4C56A 4QXUL 3EO9H 1TPXB 5BS0B 5GZOD 3DXAA 3Q5YA 1HH9B 3D85B 1QFWL 3OXSB 4IMKA 5FECB 4X98A 1R3HB 4XXCA 2HVJB 5IP4A 2L7UA 3I3DA 2J88L 1DQMH 1NDMB 3BUYA 4PJDE 2HJFB 3UC0H 1LDPL 3KS0J 4M4RA 4I9WD 5T3ZD 3BP4B 3EYUL 2D7PA 4DQOL 1WFOA 3KWWB 3OJMB 1H9VA 3MREA 1K3ZA 3LN9A 4LU5L 4NJAL 2IANE 2X4PA 4N9GB 4O00A 4HIJB 3RZCD 2HT3D 7CGTA 4D9LL 4U1HB 3RKDC 1YUHB 2OYPA 3QISA 1NGZA 4N0FA 2AQ1A 1BQLH 3N9GL 1NBVL 2JLLA 1ZK9A 3EJJX 4NHUB 2AJ3B 5B21A 3HKFA 2R0WH 2ESVB 1WZMA 4J3VA 3QT2A 5C6TL 4R3SB 5CEYB 2VN7A 1KNOA 3BN9C 4Y2DB 3S5LA 3LN5A 5BV7C 3BVNA 4U6XB 2DD8L 5C08E 2HKFL 1KCKA 3BIKB 1BVKA 1WQVT 1OP3K 3P9MA 4NZRH 5CD5C 1ZVYA 4M7JH 3F7RA 2ZPKH 3A67H 4XWGL 4OB5H 2Y6SC 4Z7NF 3D85D 5JPMA 3GIZL 4Z77A 4ZFOA 2QHLA 3Q1SH 5L7XH 1F4WH 2GK0B 3LEYH 1F02I 4U3XA 3EFFB 4M00A 4IJ3C 4OCLC 3CU7A 4P2YA 3SKOB 1LP9F 1AGEA 4PJ8C 3IDMA 1G84A 1IL1A 5DHVA 3IB4A 3IFOA 3LH2H 4G8GA 5I18L 3QDHA 3D0LA 1G7HB 1EJOL 4CUCA 4I5BA 5C0AD 5ISZA 3G6AB 3ARRA 5E2TL 1DLHA 1TCRA 1R24A 2V17L 3AMKA 4FTVA 5JDSA 4G9FD 4R7DA 1Z9LA 2VIRB 4NO3B 4PG2A 2CLZB 2W59A 3EFFA 1F58L 1BZQK 3WD5H 2C3XA 1A7BA 4LF3B 2CH8A 3B9KC 5E8PA 2VZUA 3CFBB 3G6DL 2V7HB 3H9SE 3GBLA 1UM4H 4Y89A 3CXHK 3UBXB 2WQ8A 3RGVB 3V7MA 3PWUB 3E6HB 1ZHNB 1PX3A 2X4NA 3GSQA 4PJ9B 2DQUL 4NKOA 5L0QB 1E6OL 3WFEL 5AZ2H 3SOBL 4PBXA 4KU1A 1ZAGA 3GI9H 3OB8A 3QEGL 4RMVA 1JHKH 1X5GA 1XCTA 5DO2D 4V2CB 2LE9A 5J6GB 5JQ6L 4H26A 3RWCB 1TQCC 1CF8L 4OQTA 3MMEB 4XMPH 2QLVB 4NKMB 3EOTH 4WHYH 1FL6A 1VFOA 5BO1L 2FD6H 2W60B 2YKLH 1J7VR 4PRDB 3VFNB 3LMJL 1U2HA 1I3VA 2NXYC 2X1WL 4KI1A 2UWEB 4Y16C 1IMHC 2YD3A 3OAYH 5H37G 3HR6A 4WO4C 5DVOA 5IMOA 4MHHG 3ARFD 2VL5B 1ZV5A 4PTUB 1D5ZB 2JJTC 5F6HJ 4KKLD 4XPHH 2BNUA 4OZIE 1JWUA 4QTIL 4C4KO 4PRIE 5DQDH 2YEZA 3MV01 2DDQL 4OD1L 2K3TA 5HHQB 4L5FL 4Q0XH 2Z92B 1GGIL 5GS0H 3DX9A 1Z9OA 1U41A 4Z7WE 1P7QD 5E8OA 5HI5D 5DC9B 1PAMA 1MNUL 3S35H 5JNYB 3BVNB 1WC7A 3WMSA 4V1DB 1VGKA 1M71B 2Q3ZA 5EBMA 1JF5A 1I1RA 5JPNA 5JZ7C 2XIDA 3PIQA 1U8HB 3PHQA 4R4BA 2A83B 3CIQA 3RWDA 3TJHD 3KPOB 5T5NG 2QL1A 2H1PH 2IQ9H 4O2CA 5GXBB 3D0VB 5MHSD 5IJVA 3F65A 1LE5A 3TZVA 2FHBA 3X3FL 4MCYB 4ETQA 3M17B 4PD4J 1UM5H 4QOKB 3BRGC 2XICA 4F9LA 3MSPA 5HHOD 4K2UH 4Q2ZB 2P44B 3IJSB 3CNKA 4ONHA 4WI2A 5C07A 1K9TA 3HPJB 4D3CL 4X4ME 3VG9B 2WBJB 1AHWC 1QQDA 3RUGA 1AKJB 3DTXB 2QSCH 4FQXA 4LBEB 4IRSC 4QYOA 2PYFA 5IFAL 1F3RB 2PTVA 3W39A 1T3FB 4S1SH 2Q8BL 3NN8B 4R2GD 3NCJH 4U1SB 1MFEL 3MOBL 3AVEA 5E7BA 4M7KL 3K80A 3CC5A 3U83A 3ULUE 3FAXA 3T0EE 4L4TB 1JNNL 3O2WH 4E5XA 3RL2A 1D7FA 5DJAA 1YY9D 1H3PH 1FG9C 3FQRA 1IKNC 4NCC1 2DQHL 5DRXB 5DUML 5BJTB 4Y4HD 5F1OB 1HWGB 3IKKA 4K3DH 5TF0A 1WGOA 2Z8SA 2UWEF 4RGMC 3O3EA 2W65B 5H2BB 4OLZL 3WIFA 1JK8B 1INQB 5ACZB 3CC5B 3WXWH 1JWUB 3X3GL 4YDIL 1W8NA 1KB5H 2PO6D 1QLEH 1NL0H 5F3BA 3L3HA 3WLWC 4HH9B 1HQRA 2B4CC 4KGLA 1RZKH 1P4IL 4L3ED 5HGBA 3UTQB 3CDCA 2HWZL 4PGJA 4XB7A 5DEGB 1P69B 4N8VG 2HFGL 1UCTA 4U6YA 4C83B 2DTMH 5JLZB 1DR9A 1WTLA 3P77B 2LVCA 4L4VD 3MLPA 1FO0H 1CGSH 3MOAL 1U91A 1FDLL 4WGVB 1GGBL 3EYVA 5C7XH 5CCKL 3C6LB 2PO6A 4F7MA 2NXYB 1V7MH 3T77A 1KFAH 1MAJA 5BV7L 4JFXB 2X4UA 4DGIH 2HTLC 3ARQA 4ZPTB 4XNXL 5DFVD 3SKMB 2WUBL 3EYUH 4FOMA 5LQBH 3O9WA 1QFOA 5ERWA 1AXTH 3O2DH 4KJYB 4NKIH 2MWCA 5IHLB 5GRVK 3T4AB 2A77L 3FB7A 4FTVD 5E6ZA 1T21A 4D9LH 4W4OA 5FV1L 2B5IC 4YNYA 5EORH 1CFSB 4UBDC 4Y4KD 3VWJA 3VXSB 3AGVA 2MQCA 1ETZB 2W9EL 4MYWB 3LN4A 3AB0C 3QJFB 4KJPC 5DJ2A 1NCCL 4ZAKA 2JK5B 4F33B 3TIEA 1AR2A 2FL5A 1DQTA 4KI5E 3PHQB 4Z0BH 3I3EA 1TVHB 3MRIB 2ZUVA 3MGTA 1R3JB 5E95B 2C1PB 4HMCA 5HYJA 1DTUA 2OJZL 3BQUB 5EBGA 1XGQA 2GFBA 4TNVK 2E8ZA 3FB5B 4P9HH 3NACH 3VWJB 4O51B 4XWGH 1C08B 1HIMH 4E41E 4HG4J 4UQ3B 1XGYL 3MNZB 1BLNB 1UVQA 3JTTB 3CH8A 4ZPVB 1LWRA 2MCPL 4L4VE 5EUOA 3HI6H 4POUB 3BP6A 5EO1B 5I2IB 1NCDL 4MCZB 2DMKA 2J8OA 4KK6C 1M05B 3D25A 1IZKA 4XXCC 3ZTNL 5F7NC 3O3DA 5E2JA 4DZBB 4Z7OF 1P84J 1FNHA 1KEML 2J7LA 3LKSA 3L5IA 4LCYA 1U3HB 3FFCB 3UXFA 1NGZB 2DB8A 4FQ1H 5JOEA 1NKOA 3PNWA 4NCC2 5IBUB 1RIVH 4NM4L 5MI0B 1QBAA 1A3LL 3KLSA 4K8RC 2PO6B 1MHPH 5DJDB 4P2RB 5J0BA 3MODL 1E27A 5I16B 4P2QE 2PYED 4UTAH 3GKWL 2DWEA 2FLRT 4I2XA 5C71A 4MD4A 5KW9L 3RVTD 1G7LA 3O3AA 5C0AE 1IGIH 2NX5B 5AYUL 3UZVB 1U3JA 5EBWA 5C09D 3G6DH 2QQNL 3C8KB 4GW5B 3CFEA 4WW2B 5IB3A 1PGRB 1I85A 3B2UC 1DN2A 5ANME 3OXSA 1S7SB 3DPBA 2I27N 5IW1A 4I0CC 3OWEA 2V2XA 4XPBL 5E1HB 3SOBH 3S37L 5EU7E 4LKCB 5JW3H 4G7VH 1DZBA 1JHKL 3VDBA 4OIIL 2NTSP 3DO7A 1NDGB 3QH3B 5HYEA 4ODSL 4HT1L 3HPJA 4G8EA 4M62H 1OGAE 3O6FA 2AJYL 1IGMH 1QRNE 5EULV 2MHAB 2G5BB 2ZSWB 4HWBA 1U8LA 3ARTA 1U8OA 1FFPB 2GUOA 4FQHB 5D2NB 1D5IH 1T83C 1FVCA 3VJ6A 5D72H 3MGTB 3QUYC 4OTXL 3AREC 3I6KA 1D6VL 2JKXA 3ROOB 3S36X 3DWTA 4XVUD 3IF1A 5IKCB 4QTIH 3ZMRA 2IG2H 4P4RB 1BFVL 2HT2C 2X9YA 2ADJA 2VYRE 3GI8H 4XPAH 2IMNA 1G7JA 4HUXB 2VLJB 1TVDA 3CZJA 4K8RL 5FO8A 1YEKL 4PJEE 3UPRA 3FT4B 4LPCA 3HNTH 4PR5B 1CFTB 1NKRA 5J3HD 2ZUYA 2EO9A 3PHOA 2J8UA 4LQFH 1BM3L 2AXJA 1Q9KB 1J10A 1A6UL 2IANA 1MLBA 3M8OH 3UJTH 3U4EB 2H1PL 1Q38A 3BDXA 2AJ3A 5C2BL 5TQ2L 3MRBA 5GRVL 1Y6MR 2FJFB 4P9MH 3NFPA 4GKZB 3SDAD 5IBTH 4RGOL 4ZUSA 1OGAD 1HHHA 1MCEA 5D96C 4EBQH 4HK3N 3MROA 4D0CB 3WFBH 3UTSB 2F58L 2FGWL 3ZL4H 4X6EA 4PTTA 3PGDA 1ORSB 2A9NL 3BEVB 3ZDXE 3LSOA 4JLRA 3CSPA 4DUXA 2XFXB 4JPIA 4KGJA 4G6ML 2ZWLT 2GFBB 3VA2C 1YY8B 3QUZA 3QPXL 5J56B 5DVMA 3AY4A 2ENYA 1UFUA 3TWCH 2MOVA 4KHXL 4OV6F 3BPOB 2FIKB 3NCJL 3SDAA 2WUCL 5DD3L 4PJAF 3U0WL 1CD0A 4OGXH 2UZIL 3ZE0F 2O61B 3MROB 3Q3GA 4GQ9L 1EFXB 3R8BB 1ITCA 1OY3B 1ZT7B 4QRPD 3LS4L 3WKMH 2DRUA 3ARPA 3PABB 1A6ZB 2F53A 4Y5YC 3QG7L 4JKWA 5DUMH 3GRWH 1MQKH 2XTJB 2GUOB 5D2NA 4U1KB 1VEMA 5EC2A 1DN0B 2IFFL 2JB6B 2G9HA 3C60C 4AEIH 3KHQA 3MV7D 4YGVA 5C9JB 2YHGA 2E7LC 4HV8A 4Y4KA 3VWJD 3U0PB 2B1HH 1DBJH 3OB0H 4NKOB 1I8MB 3X3GH 4DGYH 4XCCH 5JHLH 4MZ3A 4QRRA 5CP3H 1B2WH 4KDVA 3ET9F 5EZIH 3TBYB 4AH2B 2NY7L 1FVCB 3B9KB 2HVJA 4XNYH 1X3DA 3IDMB 4KQ3H 1X6NA 4LRNH 4WU7A 3SCMB 3BH8A 1VFAB 4IRJB 3FQTB 4XBPB 3TNMB 1K8DB 4MS8C 1P84K 1NFDA 4QRTB 4LK4A 4M6NH 3SO5A 1FO0L 1AI1L 1QRKA 3D3VB 1I1YB 2BVEA 3KLAA 4JR9H 5BZDB 1Q72H 3QIBB 3NCBB 3VGDA 3TPUA 3PGCA 4DN3L 4ZPVA 1FBIH 5FK9A 3G5XB 1ADQA 4OGZA 1MFNA 4MB4A 4WEBH 3CFJA 4JFEA 4DGIL 5A3ID 4EI5A 3LHPH 4R9HA 4PJHE 3VWKA 4JG0L 3H3KA 5CZKA 4U05A 5FDWA 5IFHL 3CU1A 2EDDA 3QDMD 1LO5B 1RUML 1C7TA 5TE4L 3PJSA 4ODTL 3RVXC 5IQ7L 1DANU 3D5OF 4KKNA 1BQHA 1J1XH 4O02L 4OQTL 5H8DA 4P3CL 4OLEA 1XF4B 4NNYA 3RVWD 2PTUA 3QQ9C 4I8DA 4UUJB 3DOSA 4Q9RH 4WCYH 4V1DA 3DMMC 1AE6L 2WM0A 1IAMA 5DMGC 1J8HD 4ZXBD 3DBXB 4M1CD 2QKIA 1QA9B 5KTEL 2OK0L 1YEEH 1I3GL 4LCWE 5B8CB 4OZGE 2J8UE 3UTZA 5EOQL 4HXBL 4CN4A 1M6OB 1FE8L 2J6EL 3E2HC 3F7YA 3RY5A 1AGDA 1EUTA 3GMPA 5KVGL 1YY8A 4FG6D 3MCKA 3E2HB 4PJCE 5HDQH 3WO3B 1B0GB 5SWZE 5DMKB 5DTFB 3RX7A 3CMGA 3FB6B 4OFYD 3ULVD 4KROD 3RZWA 2VLRA 3QEUB 1F97A 1QACA 4OFDA 4FFZL 4JFXA 4J4PD 2I24N 3L3OA 4U1JB 4Y8AA 1YQ2A 5F9OH 5K33A 3VFVA 2GITA 2P5EB 2XWBB 1BEYL 1MUJB 4X80H 3BPCA 1JZ2A 5HPMB 4JRYB 2P5WA 2ZSVA 4L3CA 4BJLA 3MRLA 1K5NB 1EEYA 2EYSA 3OB0K 3H42H 2EYRA 2A0LC 3ZTNH 2NY1D 3TNNA 2H26A 1JN6B 3N1FC 1RJZA 4R26L 4U6VL 4XP1H 3S5LG 5TE7H 3HAEB 3C6SA 3RGVC 4RA0C 1K4DB 4JPKL 2J8HA 2EIZB 3HC3H 4WHTA 3EDFA 3HC0B 1A3LH 4YHYB 3BH8B 3WIIL 1QFWH 5ENWA 3BKYH 3FN0L 4Q6YA 4D9QD 3TIEB 1YYLH 4APQA 5ESQB 5BRZD 2JCCA 4ODXB 1A4JA 5I1IH 2R2BB 3LKOA 5KW9H 4JDTH 4YEFA 1MCOL 2I5YL 3ARGA 4PV9B 3PWVA 5CD5D 2GSGB 1J9CT 1JUFB 4NJAH 3DVIA 1DQQA 3D69B 1PEZA 2FEEL 4WNQB 2VL5A 2PYEE 4PTUA 3WLBA 2NQCA 3L1OH 1L7IL