2E7LC

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
total genus 33
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7lC00
3IS0X 4F33B 2MNUA 4M3KB 4G7YL 5JZ7C 3EDDA 4LLMA 4PJCA 5DTFB 1LEGB 4MXWH 5EBLB 3QA3B 4JM2F 2XFXB 4KJYB 3UZVB 2X70B 3TCLB 2CDGB 1EJOH 3L3OB 3GSUB 3QP3A 1CXIA 2PYFB 2IPUK 4Z18A 1H0DB 3GSRB 4PYHA 4MA1C 1CT8A 4K7PX 5FYKE 4KVCL 1GSMA 2N1KA 1PEWA 5E8EA 3U1SH 1YNKH 4HT1L 1EH9A 3L7FB 5CUSL 3V0VA 3LQAC 2WINA 3EFDH 1S7SB 2MSPA 5TE7H 1MFEH 1P4IH 1NMCB 3L6FA 1ZKAA 3FB6B 3MRJA 4N1HB 4N0UB 5F9DC 5DRWA 3MRHA 3JTSB 3DVFA 2BXYA 5INDB 3IDIA 4NO0A 3MLVL 4LPCA 4JY6B 3DBXA 1WZKA 3T1FA 5AYUL 1IEAB 4YDVB 1I75A 4NM4L 5C0IA 4XMKH 4C83B 3BO8B 1YJDL 1AXTL 4QRSA 1SJVA 1UA6L 3MMEB 3KYOA 1JNJA 4L8CA 3D5OF 5DJ8A 2P47B 4FQJH 4WW2F 1JBJA 1WCBB 3QI9B 1EEYB 4HWZA 3WE6A 3WXWL 2D0GA 4HG4J 5CJBA 8FABB 1CD1B 4Z7WA 4HUXB 4DKFH 4G6JH 2W60A 3HB3C 3J7HA 5JPNB 4KHXH 4RBPH 5F7EH 3G04B 4K3GA 3U0PB 4PRIA 3WIFB 5FFLA 1M4KA 1DEEB 3OZ9L 4P4RB 1F4YH 1HYSD 5JQ6H 1KXQE 4G9FD 4XCNB 2QQKL 4QRRD 3ZZ1A 1YA5A 5A2LH 3TZVB 3QDGD 3VW3H 4M1GL 1ZANH 4O2EA 3IDNB 2APWA 3SCMD 2NXYB 4F15C 2WANA 1J1PL 1HXYB 1G7IB 5E6IC 3H3PH 5C0GB 4ZXBC 4XVSH 2IMMA 5KS9F 1JV5A 3AU1B 4MZ3A 3SQBA 3V9FA 1IAKA 2VSDA 1T20B 3U7AA 3B9DA 4HC1L 2YBRB 3CFEB 4HUUB 3K8MA 1WEJH 1DBAH 4AENA 4RISH 1YJDC 5FCUH 4M62H 3RWJA 3QFDA 1T66D 1LNUA 3IRPX 3ELAT 1XF3A 2H2PD 1AHWB 2FO4A 1SJEA 4E41D 3D25B 4BFBD 3MROA 1WWAX 4NQTA 2ADFL 1XIWC 1PG7H 3GMPA 2DAVA 1MCLA 1EHAA 1CBVH 1EZVX 3UYOD 1WZLA 4N8CH 3CU7A 3E6FA 3D18A 5J89A 1FV1A 3P9WB 2EDNA 1DL7H 4PJAF 2QKIA 3S36X 1NAKH 4EDXB 2EDWA 4XCCH 2IH1B 1FP5A 1NAMB 5D7KD 5J8OA 2L7UA 2NX5E 3E3QE 3MRNB 5JDJA 1CICB 2FEEI 4KUZL 1ZWIA 2X4SA 1CDCA 4JZNA 4HS3B 5ETUA 4TUJA 3MRIB 1GGCH 1EHNA 4O02H 1QKZL 1U92A 2ARJA 2GITA 3ILPA 3RVVD 1DQQB 1KYOJ 1RAMA 5HHNA 3NA9L 1JPST 4KWUA 5LJYH 4IDJH 4LGSB 4DN4L 5IMMA 4JFFB 4KQ4L 3HRZB 2IAMC 4QGTA 2B0SL 3VFRA 2O5ZL 4M43L 4YEEA 2V5SA 4NGHH 1NCCL 3KJ4B 5I8KL 3EBAA 4G6KL 4Z76B 5IHUH 1FVCB 4KK8C 4U1KA 3MXWH 5K9QG 1OPGH 2WW8A 1A0QH 1F5WA 3DROB 1EGJA 5BMFH 5IBLD 3ESUF 2QSCH 3KPOB 3VFVA 1CIDA 1CGSL 3GMOA 1ZSDA 1E0OB 1EIBA 3IAGC 4J3XA 3O4LB 1CFVL 1F02I 1QQDA 2OCFD 4QHUA 5DJCA 2AV1B 3V6OE 2VLRD 5E9DB 5BZWB 2YD6A 5B38A 2BVPA 3UTSA 3IDYB 5ITFB 1A5FL 1MIMH 4PB9H 4GXUM 3ORJA 1LE9A 5IV2A 2PW1A 3QG7L 3LRSB 3IDXL 1S7VA 3NZHH 3H9SA 2VKXA 5C0GA 1T22A 1MVUA 5IQ9A 3L9RA 5M95B 1PGRB 4JDZA 4F3FB 3TO4B 3MRFB 4PBXA 4UV4L 4X6CF 5C08A 2PO6D 2VDLL 3FQUA 4I3RH 4Z0BL 2X9YA 4MNQD 5I74B 3B9EA 3V4VH 1FVDB 5DJZA 3RWJB 3U4BH 1QVOA 4LCIL 4PJDE 1SQ2N 3GB7B 1FO0A 4GKNB 3JSSA 4RMSA 2G2RA 2W9EH 1DTUA 4JFHD 2LAGB 4CDHA 3I3EA 2JTDA 5D1XD 3BZFB 4PLOB 1LMKA 2XPGA 5KVEH 1IM9B 2A6DA 3VMPA 4J6RH 1A6PA 4N0YH 1F6AA 3DHJA 2DB8A 2X4RB 1KB5A 4ZFOA 3TIEA 4O5LH 5IW1B 5JXED 4NWUL 1NCUA 2FB4L 3I2CH 5FM5M 2BOCA 4ZS7H 5DD3H 1BX2A 4KJWC 2EDDA 2OTUB 2YEZB 2ORBL 3SDYH 5C9JA 1FDLL 2CJUL 3F7RA 3VGFA 2F54A 4G8GA 1FG9C 4QTIL 1DDHA 4DQOH 5B3JE 1FC2D 3STBA 5MI0C 1A22B 1B9ZA 1VFOA 2VDML 1BQLH 4EVNB 5T1DL 3OHXA 4XNXL 1ND0B 3HNTH 4NCC2 2APBA 2HRPL 4YFLF 3FRUB 4HK0B 3OKLB 3QHZL 4LCCB 5CP7A 1AR2A 5I1LB 5IHUL 1G7LB 3CDYA 4YXLL 5DLMH 4Z7WB 5GIRB 2M26A 3QDJA 4LFHG 4YXHH 1RFDH 1VGEL 1EO7A 2V5MA 2Q86B 1NFIA 4Q0XL 2H2SD 3UZQA 1NLBL 4UQ3B 4H1LG 3EHBD 4LAQH 1A7QL 1I9RH 1JL8A 5HGBB 3V4PL 43C9B 4R4BA 5C09B 4X6DF 5I1EL 1MQKH 3D3VA 2ZP0T 3HS0B 3QXAB 1HH6B 2OP4H 4JRYB 4BH7B 3GM8A 1SM3L 3P4NB 3QEHB 5GISH 2NLJB 5F70A 5SWZD 5EH1A 2R29L 2I07A 1Q9OB 3OBAA 4L3CB 1MJ7L 2YRLA 3WHXA 4PJ5A 1CS6A 4U1LB 3GRWL 4PUBH 4AH2A 4BA8A 3JWDC 5JXAL 3IETA 3M1BB 1G0XA 4R0LB 4AENB 2WUBL 3ARGD 5D1QA 1FG2A 3MA7A 4JM4H 5IB4A 1G9NC 3KLHD 3MRHB 4NUGH 4RGOH 2AI0L 3KPLB 4J1UA 4KDVA 4B0MM 1G7HA 1CXFA 2J7LA 1IAIH 1SEBA 3QIWD 2A83B 4Y4HC 5ESQB 3RL1A 1DUYA 4Y5XC 3VGAC 2A6JB 3MLWH 2EDTA 2FX9H 1DLFL 4JPWL 3ULSB 3V5KB 1HN1A 2AJUL 1G7MB 1U8OA 5DJ6B 3CZFB 3MLUH 3WEXA 1RI8A 2HLAB 1EUUA 5D1XA 1CU4H 5I66B 5B39G 4OFYA 2XWJB 4FMFA 4Q6IC 1CD1A 3FJTA 1BVLA 1U93A 2NY7H 4KFZC 4OLYL 1MCSA 2OL3L 4FFYL 4RCAA 1VEPA 4WI3A 1MELA 2CRYA 1JZ6A 3HFMH 4OFIA 1UWEH 4ZPTB 1G6RL 1NGQH 1NMAL 5T1DH 3VE0B 4OCXL 3ALXA 5CKAA 5LQBH 4JO3H 12E8L 4HIIB 5C0BA 3MBXL 4KAQL 2FNBA 4AQOA 4LK4A 5SV4A 1A7PL 4D8PA 3QJFB 5ERWA 3PQYD 1OT1A 4O51A 5IM7B 4L8SB 4UIMA 5T5FH 3FB7B 2AJSL 3GI9H 1HCVA 3RWFA 1LEIB 5DUMH 4F58H 3S4SA 4YDKL 1OAUH 2AKRB 4OCMC 3TEUA 2PW2B 3MGTA 3NPSC 1ORSB 3O0RL 1T7WA 2VUYA 4J12A 4HJJH 5ACMA 1BOGB 1FL6B 1U3HC 5JMOC 4DW2H 1UT9A 4RAVB 4ODUB 5DC0A 2V2WA 4GRMB 2X1WL 5FOJA 3F58L 2J1KA 1H3PL 3QEGH 1JYNA 1BD2B 4CN6A 5KS9E 3CFKA 2IQAB 1I9JH 1MJJA 2J5LC 4LFHD 2B8OT 1XCQA 2GJZB 5GQBA 1AGCA 3QR2A 4JRYD 3TT3L 1YUHA 4YXHL 4ONFL 1A14H 1OSZB 1QBML 2O93L 3PHQB 3VWJA 1JMXA 3O8XD 5M7QA 3MUZ1 2X4UB 3V6BR 2NLJA 4PTUA 2F53D 4KTEL 2FIKA 1FNHA 1GC1C 1RMFL 2AJYL 5DS8A 1I9IL 2C1PA 4WW2B 4YBLC 3NTCH 1F90H 3BI9X 4R90L 4RMRA 2BXZA 3B3IB 2I60H 3MRLB 1JGUL 5D2LB 4R2GD 2VZSA 1B3JA 4NBXB 3TO2B 4L4TB 3B5TA 2FWOB 4X6CB 2Y36L 2DQIH 5GRWA 3HNSH 3IU4L 5BS0E 3BN9C 3P77A 3SJVB 4AEFA 4JZJB 5AEAA 1M7XA 3PV6B 4U3CA 5SWZE 5IB4B 4OUOA 4F7MA 1I9IH 3RBSA 1UZ6F 3KPLA 5IMLA 1I7UA 1BF8A 1G7HB 1MHEB 5IBUG 5IIEB 4Z7NE 2HFEA 2VKWA 4POZC 1KFAH 4JKPH 1WBYB 1XGUB 1K4CA 1QTYT 4OLUL 2KUTA 4RNRB 5E9DD 5BRZB 1N5YL 2QTEA 4R8WL 5GS1B 2QSTA 4FFWD 3CZFA 4P23D 3BKML 2SEBA 2BOCB 5D1XB 5HDQL 4PRID 3C8DA 3WCYA 6FABH 1KCRH 1RK0B 2YEZA 5C0AD 2Z92A 1X5AA 5BJTA 2GUOA 3FQNB 3RDTB 3MYZA 4KRPC 4WV1B 2AJVH 5D2LF 3IYLW 3BGMB 5JHLL 3BT2H 2VR4A 2F15A 4EQ3A 5FM5O 4QNPE 2D31A 5AZ2H 3EYSL 5DDHA 5CEYA 2BK8A 3CFIC 5F9OL 1MFCH 2EC9T 3MLSL 4ZAKC 1OW0A 1BPVA 5LXGL 3SGEI 3ARFA 5CZVL 1Q38A 4XP9L 2NCMA 3HC3H 2P5EE 1JGEB 4XP1H 5JXAH 1A6AB 3QIUB 1F11A 1J0YA 3H9SB 1UZ8B 3BEWA 4ZTPH 3PWPA 4WIQA 5IROC 3P0VL 2BVTA 5AZEH 3TO4A 5TPWH 4M5ZL 3RRQA 4H8WH 2VR5A 4HJ0C 2YUVA 1PZ5A 1AR1D 2VLRB 2VQTA 2ZOKB 3QCTH 2VDNL 1LK3L 2XQBH 2K1MA 3FQUB 5ALBL 5MENA 4I3SH 4RZCA 1A6WH 3WUZA 2BP3A 5FHAL 4XPFL 3GKWL 3OKMB 4X80L 1Q1JL 3FCTB 3K3QA 3S98A 1OD7A 5CGMA 1CI5A 4NJ9H 4X4XA 3KVQA 5F6HI 4BZ2H 1AQDA 4LHUA 5CIPA 1B4JL 1IM9A 2A6DB 4Q2ZB 3UYRL 1E27A 1U2HA 2CK2A 1I3UA 4LSSL 1A7NH 1VFBB 1PFCA 2VWEE 1MJ8H 1AXSB 2BDNH 4MAYB 1P6FA 5DO2D 5HPOA 4JFFD 3QDMD 5FO7A 1K8IB 4E41B 5JW4M 4R6UA 2DMCA 1NCWL 1J1XL 4K94C 5JA9A 5ESQA 1BX2B 4KK9D 4JG0H 2V2XB 4KKCC 3Q6GL 1MFBL 3BDBA 5EORH 5SWSA 3DTXA 3IS1X 5IHLB 1XF5A 4Y4FA 4GRLA 5TPWL 4OKVB 2VAJA 3DURA 3NABL 1MRCL 4YHKL 4YR6A 2R1YA 4B7LA 5EBWB 4MB3A 3T0WA 1FCGA 4UT7H 4MWFA 4P3DA 3FT2B 3QUZC 4J4PA 5IP4A 5IJKC 1MCNA 3ARBB 2OS7A 2XKNB 5IB5B 2HFGH 1PLGL 1VDGA 2J88L 1QPPA 1QLRB 3C9NA 4JHWH 4LCWE 4XRCB 2R56L 4RIRB 4OAWB 1JF1A 1U8LB 4KRNA 3DX9A 5JW3L 5ID1B 3JV0A 3VXTB 4R4BB 1RVFL 4JCLA 1FFPA 5C09A 4XNQB 2DJUA 4P23B 3VI4F 3DXAE 3SGDI 2JCCE 1NUNB 4MMXC 1BBDL 1J0HA 3MRKA 3W81A 4K23L 1G7JA 4KKLD 4NRYB 5SX5K 3H9SD 3VXUE 1A64A 3UTQB 1G9EA 4J4PC 3EW3B 1JWMB 1NUGA 3P40A 4FXGA 3L3HB 1RUQL 2EIDA 1P4IL 1WVZA 4HBQA 1K4DA 1X4ZA 3C6LD 4XPFH 4GXUN 3TIDB 2OXHA 3ARGA 2ENYA 2ZUWA 4YDJB 3CK0L 2RQ8A 3CGTA 2OR7A 4JFXA 4X99A 4UT6L 3UC0L 4PGBA 5ALBH 1DBMH 2I27N 3WNNA 5A3ID 1PKOA 3R8QA 4MMZC 1RJLB 1PKQE 1T1ZA 1WIUA 4MHHI 4IJ3C 1TZGH 5JW4Q 4XVTL 4U2YA 43CAA 3IVKA 1A6AA 2E3VA 2R0LL 4KGJA 2Q7NA 2C7UB 4U33A 4HGWB 5IR1A 5D1ZB 2W0FA 3QUYD 2CUHA 4LBEA 1MLBB 1EAPB 2FGZA 2GY7B 3S36H 1EFXD 1BEYL 3UP1A 2XT1B 3HC3L 3BFOA 1BGXL 2VZOA 4R90H 4RA0C 3IT8D 3TZVD 2YWZA 4EDWL 2V9QA 3RX8A 4PJCE 2VDRL 5IBTH 3T3MF 4UTAH 2BFVH 1AY1H 4LASH 4POUB 1LGVA 5HYEA 3MJ6A 4Y5VC 4H5SB 4LMQE 2EICA 4W68A 4XCEA 5I15H 1M6OB 1R5VB 2HKHH 5JA8B 3QFJD 1T83A 4FZEH 1LP9A 1L9NA 4ZPVA 3FB6A 1A4JB 3WNLA 4CMHC 1CIUA 1UXWA 3HZMB 5IGXL 4AIZA 3PF2A 4G80A 2X7LB 3WFHB 4UTAL 1QSFD 2IAMB 1T03L 2X05A 1I1YA 2EEBA 1CE1L 4IIQA 2R56H 4IOFD 5C0CE 3C60B 4BQBA 1ZHBA 4J23A 5GSRB 1X7QA 4RNRA 4X9HA 4YDKH 4OKDA 5HYFA 5F7YC 4YGVB 4JO2L 3AGVA 2F19L 3PP3K 5IEKA 3QNZB 1BJMA 2OJEA 4AL8L 4P3DB 3T0EE 3MCG1 1JGVH 1QRNE 5DT1H 5DUPL 3ZDYF 1QFWI 2LU3A 1WQVT 2HT4C 1OY3B 4E5XB 3I6GB 5FB8B 5GGQH 4NT6A 5F9AC 2VIRA 4APQB 4EUPG 1BD2D 3BD3A 4YE4H 9CGTA 4QTHA 4PGDA 4OUUB 4QRTB 3LS5H 4JREC 3ARFD 3O9WC 1FLRL 3HFML 2EDHA 5E1AA 2GK2A 1NCBL 1NANI 3QHFH 5DA4A 5MENE 2UUDH 4OF6A 5DJ2A 2ICEA 2CXKA 5KSBE 2JIXB 1RZ8B 3S97C 3QIUA 2M2DA 4HIHA 4MA1B 1J8HD 4NRZA 2Z0BA 5EZIH 1JYVA 2WWKO 4AEHH 5DJDA 4D0BB 3QPQC 2VOTA 2CDGA 4X5XB 4LSPH 2J8UE 1J1PH 2R1WB 1JHLL 1LQSR 2FWOA 3NCCB 2IC2A 2ZZUT 3A67H 3CX5K 4OTXL 3T77A 5F6IC 5I1KH 4Z95L 3ROLB 3PABA 4BSWB 4D9LL 5KSVB 4KROD 2PYED 4HUNB 4WW1B 4JFDA 3OKKA 1C08A 4ZSOB 4YUEL 4AY0A 2NW3B 1RU9H 4PJEF 4LKXB 4X4XB 4KDTA 2QADC 4ZFOL 4OM0L 5CEXA 4XPTH 3QIBD 3U7YL 4P4KC 1LDSA 15C8H 1CFTB 1NBQA 1K4CB 2XV6B 3MLTB 2PYEB 2VL4A 5INDA 1MFBH 3QI9C 4MNQE 5KAQG 4L9LA 1F3JB 2ADFH 1PKQA 5IW6B 2RGSA 4B7IA 1GHFL 4MD4A 5EA0H 2J6EH 4DOHB 5HGAA 1HYSC 3MMEA 2E9IA 3MV9A 4BFIB 1GPOL 5E2TH 1PQZA 4HWBH 4WI8A 5ESAB 4LSPL 4LNVA 3MRNA 2BCKA 4WWKD 3TJHC 2OSLB 1YEKH 2CO7B 3UTSD 3EOBB 1BQUA 4NJ9L 3MRBA 1V3JA 4L8DB 4WTZA 5MI0B 4XVSL 3PDOA 5TE7L 4XPBL 1LP9F 3LVEA 1DN0A 3G6AA 3KJ6H 1ACYL 3U0PA 4MA8H 3TP4A 1K8DB 4J4PD 1GPOH 5E2TL 3C2AL 5C07A 5J9PA 3W0WA 5EO0B 3PWPE 4E0RA 2IMNA 2W65B 3ULVD 4HUVB 1IARB 4JANA 2BNRB 4PYGA 2DS4A 5CSBA 4P49A 2EDEA 1FNLA 2IH3A 4KQ3H 5C2BH 5LKNA 4G8FB 1JK8B 3RPIB 1F4YL 2MWCA 2FD6H 2VERN 4OLVL 4OCRH 5IOPA 5GZNC 1DBBL 2FBJL 3QNYA 3VXNB 2DLIA 4OT1H 4J3VA 4OV5A 2BNQB 2F74A 1DP0A 5LXGH 5D7IA 2F9BT 1DL7L 3KPQA 4Z7WE 3MUGA 2MHAB 2AQ1A 4L29B 2DQJL 1AHWC 3LKNB 3MUHL 4YBQD 5JOEA 4OUUA 4FQIL 4MXQD 3GBNL 2R29H 3C87A 5T3ZH 1MCOL 4GKSB 2ZNWA 3W5NA 3I85A 4XCYA 4E42A 1YPZF 1I4FA 1HIMH 3D0VB 4LQFL 4QXTA 3VXOA 1CGUA 4D2NA 3RPKA 5HY9A 1EXUB 3O11A 3HLAA 4XZUA 2NPLX 4XMKL 2AEPL 4NKDA 2JB6B 3HI1A 3L9RB 4JGUA 5I18H 1W0VA 3QUMA 4KTDL 2BVOA 3MRFA 5E00A 1T5XA 2E9JA 4K8RD 4JFPA 2VE6A 4YAQA 3JZ7A 1YN6A 35C8L 3O0RH 4PJFA 5C07E 4F7TA 4LU5H 1RJZB 3MV8B 4Y4KB 1D3CA 5FKPB 5HDBE 1CLOL 3O4LD 1QBBA 3ZHLA 2VLLB 5HI3C 4WJ5B 2IANA 3FB8A 2ZUYA 1KC5H 1N8ZB 3ULUF 3H3BC 2G2RB 5F1KC 1K6QH 2HMID 5L2KB 5C6TL 2CKBL 5EOCJ 1D5MA 4NWTH 1X9QA 4JG1H 1EO8L 5DQDH 2FD6L 4M03A 4GAGH 1FL5B 3MBEA 4AIZB 4OI8A 1D6EA 4ZQKA 2A0LD 3BD4A 2V7NB 1J86A 3ISWA 4IIQB 3X3FL 4K8RH 2CMRH 1MCPL 5HYJD 5EU6E 5GGVY 3B6SA 3MO1B 5DJXA 3HR5B 3L3HA 3S9DB 3FB5A 3VWJD 4EVNA 1A6ZB 1NPUA 1HHKB 1TTGA 4PY7B 4PGCB 1S7XA 4HK0A 5DYOB 2BJML 3CAFA 3FFCE 4C4KT 4K2UL 5CP7B 3VH8B 3I6LE 1JWUA 3N85H 3VFGL 3QO0B 3QQ9C 2DL9A 1YMHA 4JKLA 4Z7UF 2VIRB 3JTTA 2D4FA 4HZLA 4IMKA 1MH5A 4GAFB 3MV8E 2R4RL 4GG6E 2JELL 2VC2H 1TJIH 2D03H 5D7LB 5DJCB 2AI0H 5JW3H 3GHEH 2GW5A 4P48A 2I9TB 1DQLL 1TVHB 2CLVB 3FO9A 3RP1A 3GEWB 5IFAH 4JM2A 4WUKL 2GTZA 2GHWB 5I0DA 4ZFGL 5I17B 1N0XH 4M4RA 3WN5A 4GMTH 3G5YB 5DMIH 1A47A 2AAVA 5HHVH 4X6BA 1TJHH 3LH2H 4JR9H 1DLHA 1MJ7H 2EYSB 4BFEA 2DF3A 3H0TB 4M6OH 4FQXC 3TN0C 4DUXA 4OCXH 4GRLD 5F7HA 2WBJB 4OZIB 5DK3A 2D7TL 1SHMA 3DOSA 1IC5H 3FN9A 3PABB 4BSWA 4B41A 2AABL 1A4JA 1H15A 4LGPB 4R7NB 3SKNA 2C9AA 3FT3B 3OKKB 3KWWA 2X1QA 1TFHA 4QHNB 3N1QC 4LLUA 4FQLH 4I2XA 1SYVB 4BK5A 2Y25A 2Y06H 3BZFA 3S37L 2BMKA 4JM2D 4RFEA 3SDXB 3VXQA 5DI8B 4XX1E 4KJQD 3OKYA 5B38G 3VGDA 5DLML 5LVEA 3BH9B 2FX9L 3VD5A 2E5EA 1X3DA 4KRPB 4YGVA 2AXHA 4LSRH 4F57H 4BSVA 5I1IH 2R2HA 2JB5H 5CMAA 5AG9A 4IRJA 3HAEH 1BIHA 2IADA 1HHHB 3RIAK 2HT4D 4HPOH 3D2UB 1ZA6B 2F54B 5MEND 5F21B 3SQOL 4PJ9B 1QG3A 1CLYL 4DVBB 1FORH 4G6AD 3U4EA 5D4QA 3UPRA 2DTMH 2VYRE 1BHGA 4TSBL 4MJ5B 4FQHA 3CH1A 1GOGA 1CLCA 1BFVH 4GAYA 1JZ7A 5I1LA 1TCRA 5CGTA 5M94B 4HW6A 1MHHA 1EUTA 5KJRH 2ICEB 2QHLA 4ZNCD 3P4LA 4LCCC 4N8CL 1O0VA 1OTUC 4AQ1B 2VRAA 3PJSB 1EMTH 2V5YA 4JGJA 4HQQL 2DBLH 4IOIB 2VR9A 5GHWH 3S88H 1Z5LA 4RDQF 1D5XA 4X5XA 2DJSA 1Z9LA 3SCMB 2ZJSH 4ZNEE 2R9HC 5I8EA 2W9LA 2AK4D 5EZIL 4M62L 3M8OL 1T7VA 2E9WA 3ETBF 2O26U 4GSDL 2NY2D 1RZKH 2OQJB 1U58B 3L95A 4R2GC 4Y4KD 3KYKH 1U91A 2ICWB 3VH8A 1ZAGA 2P8PA 1JPSH 2W9DH 2YKLH 3ILQD 1A7OH 3VDCA 2DM2A 2KBGA 3K8LA 3U7WL 5JO5B 3JTTB 1D6VH 3KAAA 2YPLE 4YPGB 1P69B 3MXVH 2LAAA 5DXWA 5DJ0B 2ZSVB 1RSFA 5BXFA 1IC4L 3QI9D 3U1SL 2MKWA 1I8MB 1YEJL 4WHTA 2HN7B 5FA3A 3WFDL 4GLRI 3I2CL 5DMKB 2ZCHH 5I19H 3CSBA 4M6NH 4NQDD 4XVTH 1MSPA 3CH8A 3VXRA 4HLZH 3KLHC 2XWTA 2EYSA 3TBYB 1MI5B 1WZ1L 1NGZB 4JFPB 4KTEH 4YAQB 3QG6B 3VFNA 1E4XH 2B2XL 4P2RA 2BNQD 2HG5B 5F9JA 4MLSA 3HUJF 1OQXA 3OXRB 1A2YA 4OGXL 4Y4KA 3O3DA 3BZEB 1D5BB 3PGCB 4Q9QL 3PHSA 4HS6A 3DX8A 2FX8L 5AZ2L 4F7MB 1NBZB 3U4BL 4IDJL 2OZ4L 3V0VB 4J3OC 5EOTB 5ENWB 2EXWD 3PGFH 4FMKA 4WI7A 5IIEA 4FQQB 1HYRC 2EIEA 1AD0B 3IRZA 3G6JE 5KANG 4N0UA 3V0WL 2IH3B 3ZLQC 1FNSH 1QA9B 4YFEA 5FYJD 5IVOA 5GS1A 4CUCA 2DQCL 3S88L 2SEBB 3BIKB 1KLUA 4GBXD 4MQXD 3TPUA 2WP3T 1T7YA 3LKRB 5E2UL 32C2B 4X9IA 4HJJL 5BJTB 1KSRA 3GI8L 2CKBB 5D8JL 4QHKI 5LCVH 4PJ9A 2MHAA 1AJ7H 3WXVL 4D3CH 3KYOB 4NO5A 1DQDH 1KJ2H 3FB5B 3U4EB 1N59A 3WFCH 2RAMA 4OLXH 4PJDB 5KZCD 3IFNH 4HWZB 2IBBA 5EWIH 5DVNA 4XAKE 3EOAA 2Y7QA 2P5WD 3V5DA 3IDUA 1CN4A 1NGQL 1NMAH 4JFDD 1EJOL 4WUUB 4OCRL 4FTVE 4Q6YA 2F5AL 3T3ME 1IL1B 3QCVH 2DICA 4LLMB 4PJCB 2FR4A 1UZ8A 1GAFH 8CGTA 2V2TB 4W6WB 3PE9A 4N1CA 1XGYL 5JHDB 4RFOL 1OAKL 3HHRB 3MNWB 1JZ5A 5E00B 2XXMB 2LVCA 2D7MA 2ZOKA 1MHCB 3BE1L 4X0KA 1YEKL 3NA9H 4D0DA 3H7BB 1IGTB 1HXMB 1Y18B 4PRAB 1ODAA 3WN5B 1SY6A 3INUH 4L9DA 4TULH 3RZWA 4M5YH 1H3GA 4Y1AA 3LQAH 2IANB 4ODTH 4UOW1 1IAKB 4TVPE 3WLWC 4KZDH 1UADC 5D2LA 3EO9H 4IHOA 3V6ZB 4JPIB 4Y19E 1UEYA 5FECA 3F58H 3MREB 1S5IH 1E27B 1JIBA 1TPXC 5ABDE 5CD5D 4OJFH 1NFDE 5SV3A 4XNYL 4NUJB 1D7FA 5TFSH 3JV4A 4LSVL 5EBMA 1KXTB 1Q0XH 2P7TB 3GDBA 3T1FB 1TITA 3RVTC 1JPFB 4JFFE 4NCDA 5MERB 2J6EA 5K9QI 4NQUA 1YMMB 2YD2A 2APTA 2ATKA 1IGML 1MFCL 3MO1A 5DJXB 4NYLA 3E6FB 5E2UH 2E27L 4LPUA 3RWCA 2HJKB 4JZOB 2ZG2A 4LPVA 1DBKL 5J3HD 3BZ4B 1OAYH 5AG8A 1FNAA 1EPFA 3NH7L 2VAAB 3BWUC 5HD8C 2W60B 4KHTL 4DZBB 2CIKB 1A6UL 1MPAH 5SWZA 4TVPL 3MR9B 4NO3B 3SDCD 3RZCD 3QDMA 1PX3A 2YA0A 1TZIA 4RISL 3WIFA 4U1IA 2KL6A 4ELME 3T3PF 3OB0K 5EZJA 5CHNB 4O58L 4PD4K 1XEDA 1N5AA 1T7ZA 2APXA 2C3GA 3S34H 3FFDB 5H94A 4H0IA 1SBSH 4Z7NF 4MJIA 1OP5H 3BQUC 4Y2DA 3NCMA 3LKRA 1UWGH 3X3GL 4I4WB 3BXNB 1NBYA 2F58L 4XMLL 2XFXA 5EU4A 3LS5L 4P2OD 4PJAA 5C0AA 4GW5B 4JKMA 3VFUB 4OCSH 2ZKHL 3LN5B 1SVCP 3L7EA 4NWUH 2ESVB 3VG0H 5I76B 1KCSH 1KGCD 5T1MB 4EI5A 3HNSL 3IU4H 1NC2D 2Q3ZA 5IWLA 4LIQE 3UTTA 3QO1A 2H26B 3ARQA 1NMBH 2QQNL 4HXAL 3WFBL 5J6HB 3UC0H 5LCVL 2D4DA 4ZAKA 4MAYC 4ZFFA 1BVKB 3RI5F 1R24B 1U8HA 3Q2CA 1KV3A 3ULUD 5F9OH 4PRPB 4FP8L 5IHZA 4U6YA 3V79C 2FJFA 3TC9A 3PIQA 2DOCA 1PSKH 4LHJB 3FAXA 1CXEA 5GRYA 2V2TA 2JELH 3TH3T 1RZJL 1YMME 1A3QA 1AXTH 5JOFB 1G9MH 2DQEH 5I71B 4QXWA 1JTPA 3CFJB 1OGAD 3BKYH 3LPWA 4WVRA 3RBGA 3W9DA 5KSAB 3LV3B 3T04D 5C0IB 5C0DA 3MA9L 1M7IA 1J7VR 4JFEA 1HIML 3A6OA 5E08L 4HIJA 4H5SA 1JHKH 4Q58C 3DRTA 5HHMB 3NIGE 3HE6D 3ZT5A 4ELMF 2VDRH 3AUVA 4L3EA 5IVXB 2ZUTA 1C8PA 5FGRA 5CUSH 3OJVC 3QNXA 1IILE 3NFSH 3F5WA 4Q6IB 1IAOB 2VLJA 2OR9H 3HNTL 3GB7A 5J11B 3JV4B 4U0RB 4P59L 5FYLD 1EX0A 4OF3A 2Y72A 3VJ6A 5TDPB 5T3ZD 3OJMB 1JPFA 2CLRA 5SX5H 1K5NA 1ZMYA 1CFNB 5D2NE 2Y36H 2OK0H 1VCAA 4KVNH 5I75B 1RZIA 5CEZH 5C86A 4WFHD 1J18A 3RGVB 5JUEH 2P5EA 2DRUA 5D7JA 4HKJB 1GL4B 2Z4QA 1R3JB 1NCAL 3ARDB 4U0QB 3REWB 4LSRL 4F57L 2EDRA 5I1IL 1G7PA 3VG9B 1MQ8A 5D1QC 4PG2A 1JJUA 2X1XR 5IUSA 5KAQF 3PWNA 3W9EB 1NCCH 4NT6B 5DFVD 2X4QB 5GS3A 1JVKA 1A9BA 5L2JA 4IJ3B 1ADQA 3ME0A 2XYCA 4QCIA 4ESKA 2VXSL 1QQDB 4X6CE 5EZJB 5EUOA 2A6KB 5GZOC 3T0EB 2NNAA 3I9GH 4BUGA 4DCQA 4KHTH 1GGBL 5C71A 3OAYH 3EOAB 1MAJA 3DMMD 2R4SL 1FFNA 5EUKB 2HTKD 2MKLC 1GXEA 3P9MB 1AGFB 1IKFL 4RFNC 2NY1B 4UQ3A 1NC2B 3LOWA 1S7VB 1FPTH 1S9VA 3N50A 1WIOA 2XWTB 2ZUQC 5I1GH 4OM1L 3HS0A 3KPPB 4ZAKD 1F2XK 3DX7A 4JM4L 5FDWA 4HWEH 2QR0B 5C0CD 1XCTB 1X6LA 1INDL 1SYSB 4M00A 5HGHB 4PLKC 3T4YA 3V8OA 1KN4L 5J1AB 3ULUC 4LLDA 3EYOA 5JDSA 1C08B 1NLDH 4PJ5B 4HMDA 3RNQB 1QBLH 1I8LC 5DHVB 3TVMB 1HHGB 1MIEL 4MD0B 2A9ML 3Q48A 5GGVH 3TZVC 1KB9K 1J05B 4LOUC 1VFUA 2RHEA 2XZQL 2QSCL 2ZWLT 2YRPA 5I1KL 3THML 4S1SH 3A6CL 4JFQA 4XC3L 4KI5F 2VXUH 3MGOA 3RHWK 4P2QD 1IGIH 1RIVH 4LSSH 4ZFOB 1MAKA 5FV1L 5IQ7L 1FSKB 2UV3A 1OAXH 3NACL 2EC8A 5I1EH 3UTOA 3OKDB 5E5MB 1I7TA 4AG4L 4HFUL 1C5BH 5EO9B 4NN5B 2H45A 1WBXA 2EEAA 5IMOB 4M8VA 1KJ3H 3HRZA 3JV6A 1T1XB 1XFPA 1FYTA 1AGEB 2VDPL 4Q97A 1IFHH 2KH2B 1G7MA 4JPKH 3FRPA 2OSLA 1T80A 4I77L 3A6BL 3MYJB 5I73B 2BRRL 1U2CA 2R9HD 5GSVA 5C6PB 1A1NA 2VLKE 3D9AL 4E5XA 5KVGL 5ICYA 4S2SA 1QBLL 2Q86A 3GMOB 3O41A 2IPKA 5TDPA 1CD0A 5CEZD 5HI5D 4QOKA 1I1AA 5HGBA 4MD5A 4N90D 1HEZB 4ISVA 5E0QA 3OZ9H 1T21A 1WJ3A 4YDIH 3WO4C 5KVFH 5B38B 2NY3D 4PJAE 1S7RB 4WI6A 4DKDC 3C5ZC 3E1F1 4U1GC 4U3XA 1RZ8A 4JE4B 4F9LA 1MHCA 4IEFB 3DXAB 4QT5A 1BVZA 3I50H 4XVJL 2J12B 3LZFH 2PUQT 1T22B 3KPSB 3UTSE 5H37G 1RZJC 1MFDL 3HMXL 5IT2L 5FK9A 3OR7A 1K2DB 5D72L 2I9LA 1JPGB 2CUIA 5CSGA 4X98B 1NC4D 2AV7B 5EN2B 4DGVL 3SY0B 3QEQD 5KTEL 3RFZC 3H9ZA 3R06A 5FHBH 4WU7A 1RURL 5HYQA 4NHCH 4JY5L 5D5MF 3TN0B 4RWYH 1QVOB 2W0KA 4Z7OF 5TE6L 3LEXB 3GO1H 1TJGL 4DUVA 1MCPH 4JFOA 1JHTB 3LQZA 3DSNA 5H37H 4WNQA 5EIVA 1YN7B 2E7LA 4YDIL 4OD1H 1W0VB 4HFWB 1OSZA 4QXUH 2X5PA 3BYYA 3ZE2E 4X6DE 1KPRA 5GGSA 4PRHE 2YSSA 2ATPA 4MQSB 3W9DB 1IC4H 3BPCA 1I7RB 2COQA 1HNGA 5EUOE 3T3PE 2A6IA 3S8WA 4DGYL 1LE5A 1KJVB 2BRRH 3HMWH 3LAFA 1URLA 3SGDH 4QGYA 1W2KT 4L3EB 5HSFA 4QXUL 2BVUA 3OG4B 2FJGB 1BZ9B 5D1QD 2ADGB 1LHZA 1UYWL 1TQBB 25C8H 1ZEAL 1ZXQA 3QUZB 2H1PH 4YLQT 5IFHH 2Z31D 3M8OH 4YGAB 3QQNA 3QDGA 1JNNL 3E2HB 1A4KB 4ETQB 3HE6C 3OKDA 3STLB 4O58H 4WHYG 5E6ID 3GKZA 3OKNB 1GH7A 2FHFA 4MYWB 5HHXL 1B2WL 2DD8H 1NBVH 5E2WH 4QRSB 1T2JA 4GW5A 3BRFA 3V6FA 3LZFL 3LN5A 3MZGB 4X8JA 1WCBA 3QI9A 5D7LE 1UZ6E 5MEOA 1CD9B 1KGCE 4H1LH 4DTGH 1G6VK 3ULUH 2BNQA 3VWKB 4G9FE 1CL7I 2XACC 3DXAD 4ZFFB 4NZJA 2EE9A 1E4KA 1E4XL 2B2XH 4QXGL 2D31B 1TQCB 1QRKA 5JLZA 4YIQB 1X5FA 1JN6B 2NY3B 3C09B 1C5CH 3WFEL 3ZDZF 3PIQB 3B5GA 5ISZA 5CEYB 1KIUA 1N6VA 3U9PL 2R0ZL 5E8NA 3QWRD 4M61B 4OCSL 2Y6SC 4I13B 3RUGA 3DSFL 1AGFA 3P9MA 3P9LA 5T3XE 5BMFL 2VLKD 1E6JL 5I17A 1A7PH 4FS0A 1MEXL 2E7HA 2YN5A 1EJ6A 5C0DB 3BPOB 4N5EC 4NC1C 5JTWA 3MXVL 1FH5L 1FZKA 1ES0A 1JV5B 4HWBA 4R9HA 1DLHB 4J3WA 4OLYH 5E9DE 2JF1A 1RK1B 3CSPA 3QDGE 1T20A 2K9UA 3MUJA 3DRTB 3PDGA 4RDQG 3TM6A 4PJFB 4PV8B 5GGTH 1XH3A 5IVXA 4CU8A 3LKPA 4RZCB 1KPVA 4OI7A 3C8KB 1LO3L 1IAOA 4FFZH 2HT3C 2VLJB 1S7UB 1U42A 3G6DH 1AO7E 3Q3GA 1NDGA 3H7LA 1LO5A 1WWWX 2FRGP 3VJ6B 4JCMA 1WBZA 4NHUB 3RZCC 2QQLL 4M8QB 3CDGA 5D6CB 4DGIH 1OAQH 2C4FT 1KENH 4KVNL 4YHLL 1FL5A 1I3VA 5CLWA 4L4VD 1EMTL 2MCPH 4IOSD 5DT1L 5DUPH 3FO2B 1E6OL 3LIZH 5IK3B 2HMIC 4UILH 1Q94A 1W0YT 2F8VA 5T3XH 3U46B 3SGJC 3P11H 3R1GL 4C83A 4U6VH 2OR9L 3RUGE 3FQNA 5J0BA 4GFTB 3BGAA 1WWBX 4MA3B 4J6RL 2R0KL 3TT1H 1U8IB 3QDME 2EDQA 3WNKA 4QCIB 1HQRA 4PUBL 1LDPH 4HMEA 1C1EL 2R1YB 3LMJL 4NQXB 3TLRA 3PL6C 4I0PA 4QO1A 1L9MA 1EEYA 2ZNXA 3SDAD 5C0FB 1A7RL 5EFIA 8FABA 4LCYB 2YHGA 4ZUVB 2R69L 2XRAH 2XZAL 3QUYA 3T0EA 2J4WH 2Q76B 3EOTH 3X17A 1ZHNA 1B0GB 4NOFA 3SPVA 3QUKA 4LCWD 1BQSA 1CXLA 1MCCA 3WL9A 1BD2A 3VFPA 1ZHLA 1MI5E 5FCUL 5I0ZA 1LILA 1MJ8L 5LGHH 3PL6D 2MCG1 5EBLA 2GJ6E 1KBGH 1W72H 5I9QB 1HKLL 4OIIL 2A38A 1JNNH 4Z7QE 4EUPH 4EUPA 4XP4L 1OP3H 2CXGA 5HHQA 3TVMC 4QWWC 4JEGB 4LLYA 4WW2A 3GSXA 5F88B 3L5XL 4Y5XA 3VD4A 3GJEB 1F4XL 1RUPL 2HVJB 2EXYD 1K3ZA 3ZDXE 2BZDA 4YHOH 2D2OA 1OP9A 4A6YB 3P73B 4C56D 3VFMA 4MS8D 5IJVA 2ZPKL 4R7DB 1B0RB 5C8JA 5DC9B 1Q0YH 2O5ZH 4BK4A 5GS0L 5AYQA 1FVEA 4NQED 1FO0L 3RIFK 1Q9KB 1FZKB 3RI5K 4ZXBD 2DYPD 1MI5A 4TNVF 2JJSC 5DUBB 1HE7A 1TZHA 2GFBA 2FDBP 5JHLH 3RWHA 5FO8A 2WIMA 4DKEH 1RZFL 3DI2B 3P2TA 5D7IF 2Y9RT 2GSIA 4FNLH 2DQEL 1FVDA 5E2VH 3RDTA 4HS6B 1IBGL 2H8PA 4HKZA 4MNHA 1C16B 4P4KD 3C2SA 2FX8H 4XRCA 1MF2L 1A7RH 1RZ7H 1MWAB 4YHIA 4LEOA 3HZKB 1R5VA 3FOMA 5CZXD 3S5LB 1DQJB 5CJOL 4PJ9C 3BP6B 4W70A 5D6CA 4EOWL 2C3WA 3BGFC 4OQTL 4G42A 3HUJE 2CGRH 3QUZA 1S7RA 4CADB 3QULB 4IRZL 1GOFA 2B5IB 1WTLA 5ITBL 4WCYL 2FBJH 4UQ2A 2IAMA 5DD6B 5IB3B 1KIRA 1EK3A 3B5HA 1KLUB 4W6YB 3MJ7B 3JWNC 4NRYA 5C09E 1G9NL 4TQEH 3SDXE 3TF7C 3WFDH 3GMNA 5GRJH 1X7QB 4JKWA 1KIQA 1DDHB 2ESVD 3MZTA 3BWAA 1IKNA 1N59B 1XGPA 3DV4A 5A1AA 3QNZA 4ZODA 1SBSL 1FVCA 1VA9A 3PHOB 4ODTL 3ZKMD 1T66C 3UBXI 4TPRH 2BOBA 1R5WB 1RPQA 4UINL 4XT1C 2WAHA 3NVQA 1ZLSH 2AS5M 1PZUB 1JN6A 4KTDH 3GMRB 4Y16D 3S37H 1A9EA 43C9A 5FAAA 1C5BL 5CP3A 3U30B 1G84A 1MLBA 4NM8H 5E99L 4UTBH 3O6ML 4M1DL 1T04B 4DEPC 4WI9A 5C0NC 3U83A 4OLWL 4WHTB 3GIZL 1H3VA 1JF5A 4PS4L 2R8SL 1NCNA 5DMKA 1UH2A 1MPAL 1SBBA 2WM0A 5FYJE 1C7TA 3CXHJ 4FQ1H 4M7JL 3SKJL 4R4FH 2NY4C 1P4BL 1IEBB 3EIFA 3RVUD 1ES0B 2YPKA 3HRPA 3EYUH 4N0RA 1XMWA 4PJBE 1DE4A 3QB7C 3QG6A 4JPIA 4OF0A 3VFNB 1MCJA 4OBRA 4NO2A 1TTUA 2VLJE 3M1BA 1ZWIB 1A2YB 2WUBH 2WIIA 3OR6A 3FT2A 3FQXB 1UWXH 3PGCA 5DJZB 3NABH 1INDH 5D6DA 4M48H 3SO5A 4U1NB 3BHBA 4FQ1L 4M7JH 3ARXA 4G80B 3KPTA 4YHLH 5EBMB 3DETC 4M1CD 3QDGB 4GKNA 4PJHF 4RIRA 5T33L 5ANMA 1I1YB 1ZTXH 3EYUL 1Q0XL 5HHNB 3Q5YA 3O2VL 4KMLB 3CUPB 1MJUH 3C60A 1CDJA 3F8UB 2H3NA 2APVA 1KB5H 3S3SA 5GSRA 3VG9C 4L4VB 2NY0D 3VXSA 3WDHA 2ADIA 5D9SB 1ZLUH 3VFRB 3VXRD 3PGFL 5D2NB 5B8CC 4OZFB 1TMCB 3OKEB 1ZS8A 1DSFL 4MAUH 2P42B 1TIUA 4MDIB 4PJDF 4HDIA 2NR6C 1LEKB 5HHOB 1CK0L 2FATL 3IU3A 5FF6B 3O6LL 1RJYA 3L3IB 4APQA 4YJZL 3D0LA 3RVVC 1IAIM 1EEZB 4YHIB 5GRVK 4MDJB 4DK3A 5FGCB 1J12A 1H3UA 4NQCD 2EE2A 2AJZB 3TYGH 2AV1A 2OI9B 4HLZG 4HSQA 1G7LA 1I8LA 2P5WA 4TNWF 3H9HB 3IGAB 2XOTA 4Z7UB 5EU6D 3VXUB 1DZBA 3W11D 2XG5A 2A9MH 4GW4B 43CAB 3IVKB 3U9UA 1NCTA 5JIKA 1JYXA 2A2QT 2NYYC 4TRPH 4KK8D 2HJLB 4BZYA 1JGUH 1AKJD 1QNZH 4AEIH 4JDZB 1V7NL 4F3FA 2XKSA 3EHBC 5JIPA 3O4OB 5MP6L 4Z77B 1A1MB 5F6HJ 5GRVL 1U8QB 3RKDD 4PJIB 4KI1A 1CVRA 2VH5H 3WXVH 5GPRA 3KR3L 2VN7A 5EIIA 2VXTL 3EGSB 4XNMB 5E7FA 1FZMA 2H26A 2GTWA 1TJGH 4GBXB 4IBLT 5F7DA 4PJ7E 1ED3B 4KU1A 3FHAA 3V4UH 4MGXA 4NPYA 4LNRB 2F53E 1EAJA 1Q72H 5CP3H 1N4XL 2R1XB 4KGLA 1F6AB 1FO0H 2HKHL 4X6DB 2X4TA 3KLDA 2HYMA 4GQ9H 3TIEB 2CR6A 3HI6H 3CCHA 4OGXH 1F4WL 2HTLC 5DK0B 3RJQB 5A43C 4JDVA 3UTZB 2BFVL 2X4OB 1YYML 1AE6L 4PRBA 4ZDHA 4GW1B 2IGFL 1M7IB 4JFEB 4N0FA 1U95A 3QG7H 3RVXC 4U6VL 4F37K 1KOAA 1Z3GL 1EZVY 5KS9A 1FZOB 1QO3A 4GAGL 3TO2A 4EXKA 3OHXB 3KGRA 2R2BB 4F7TB 1T83C 4EBQH 3VXMB 4QF1B 4L5FL 1F4XH 5FKPA 1N64H 1P4LA 3VCLA 2VAAA 2Q76A 3KJ4C 1DUZB 1DBML 2F8XC 1VACB 4YHOL 2LTQC 3QCUH 2APFA 2HVKA 1P2CA 3CVHA 1Z3GH 4LEOB 2EYRB 3BKCH 4WCYH 4Y5YA 4TUKL 5DSCB 2BY0A 4I77H 2GSGB 2VLRE 3QFJB 4NZDA 4PP2A 5CWSB 4D0CA 3F6IA 5FYLL 4IMLA 2B4CH 3AXLA 3KJ6L 4NGHL 1YEGH 1MCFA 3GO1L 3MBEB 4ALAL 4BZ1H 5DD0H 3B9KD 4RAUB 3KYKL 5D2NA 4QHMB 1RZKL 2V7NA 1KN2H 4WFHE 1H9VA 5FHBL 2Z4QB 2RCSL 1HILB 3QZWB 3DNKA 5MHSE 1ZS8B 4FFVC 2F53A 2YKLL 4PGEB 1RK0A 4PBWD 4KI5E 1CE6B 5D71H 1ZLWK 2IG2L 1RULH 1GZPB 4WV1A 3PWNB 3HUJA 2IFFL 3B6SB 2AK4B 2YD1A 4POYA 5GGUA 3VFUA 5HHPB 2ITDB 1FCCA 4P9HL 1WV7T 4XC3H 5FUZL 4Z78B 3R0MA 2XTJC 2RB8A 4OZHA 1IAIL 1OCWL 4EI5D 3I6LD 3PHOA 1VERA 3VWJC 3NCJH 3QO0A 1WAAA 5HHVL 1FFNB 1BZ7B 5HYIA 3RIFF 2EE3A 2UWEB 4JY4A 3WNMA 1JGEA 3RVTD 1TENA 2VZ1A 1LEGA 2XTJD 2WSKA 4RX4A 4XWOC 1CF8L 5FYLE 4RA3A 2P44B 3LRHA 2ZCKL 4G7VL 2BVOB 3KHQA 4LVNC 5EO1A 5F7KC 5CEZE 3L3OA 3FO9B 3QXDB 2VE6B 4AK1A 2GFBB 2X4UA 4M9OA 1BFTA 4D9LH 5C08D 4LVHC 5KOVC 5MENB 4K7PL 1OGTB 3D2UD 4GRWB 3T4YB 5JXEC 3MXWL 2FJHA 4OCLC 1NBVL 2YS4A 1MHPL 1C7SA 5H8DA 3CMOL 1VESA 1XT5A 1HZHH 2EH7L 4LQ1A 3BGFB 4KZEH 4L4TA 1QOKA 1ZT4A 1DQJA 4Y19A 4TSCL 3SJVA 4ZPTA 2VN4A 5GRUH 3OR6B 5D2LE 3QIUC 3L6FB 4HAGA 5F9WB 4JJ5A 3OL2A 3WIIH 3MRDB 3FT3A 1MLCB 2VB5A 4JVPA 3RGVC 1I1FB 1IGIL 1D6EB 5ESVB 5IM7A 1K85A 3VXPB 4K7PY 4K8RC 3HMWL 3FB7A 1KCVH 4S1SL 3FL7A 1MHEA 5EO0A 4M6OL 2V2XA 4LIQL 4JANB 4CW1B 4Z6AT 5C92A 3S4SB 4JO4L 1L6ZA 3T0ED 1C5CL 2ERJC 3BRGC 1N26A 2Q8AH 5K93A 3WJJA 3QDJE 3WS3B 4GXVL 4OCYL 5T1KD 3MRGB 3RX7A 2A9NH 5ISZE 1BD2E 3DARA 3TFKC 5JZ7D 4RAVA 3TVMD 4MAYD 3KPQB 1RU9L 1FE8H 4P4KB 2G9HB 4CU7A 3BD5A 1KULA 5GJSH 3T0DA 4RMTA 3MV9E 5HVWA 3ARDD 2XZCH 1EBPA 4N0CC 2V9RA 4HLJA 3JUZA 2GSGA 1MVFA 3LKOB 4DTGL 5F1NA 1ERNA 5ECJE 1J1XH 2ZUQB 5EUKA 2FYYB 5FKAA 3IDNA 3TWCL 1GYAA 3D0VA 4X7TB 2FIKB 4NQEB 2ZOLA 3V4UL 3X12A 4FZEL 1ONQA 2AXGA 5HY9B 5DS8B 1N5YH 4NN6B 4LOUD 4CVXA 1DBAL 3V7AG 2ICCA 3G08A 4P3CL 5T1KA 4ALAH 4BZ1L 3HUJB 4XPGL 3LQMA 3BUYB 5KVDL 3CMGA 2CMRL 5IVNA 4X8XA 3U36A 4LLWB 4XNUH 3MOAL 3MV7A 1J9CT 2Z8RA 1KB9J 1FNEB 4I0CC 3QRFM 1IVLA 2ICWA 3V6OC 4KV5E 4K7FA 4OD3L 3L5WB 3G5XA 1S5HA 3UPCA 1BEYH 1QP1A 5BZDB 4YNYA 3C5SA 3P4OB 1HQ4A 1LO4H 4L8SC 2OTWA 4NZTL 4OB5H 4LHUG 4N8VB 5KSUB 2HWZL 2C7UA 5IR1B 3VGGA 4NPYB 1ZGLM 2VLMD 5D2NC 1OTTC 3GSNL 1U8JB 2Z35B 2PO6A 2VQ1B 1NL0L 4X5WB 4MNGB 4N0YL 2G60H 3SN6N 1FL3A 1IFHL 2YSSB 4W4OC 4R97B 1J0IA 4O9HL 4U1MA 3PL6B 4ACPA 3WIHH 1IGCL 1U95B 2KQMA 4BYHA 4YK4C 1GGIH 3I3DA 4ZUWA 1XZ0B 1WFOA 5DEGB 3DV6A 3GJFB 2J2ZA 1QR1B 4XHJD 5BV7B 2EDOA 2DKMA 1MRFH 1I8IA 3K4AA 2C1OA 4HS8H 3GRWA 5IT2H 1NJ9B 1SY6L 2V7HA 3VFTA 4CN4A 4NQVB 4YFLI 3IGAA 1L7IH 1WIPA 2UZXB 4MLIA 2VZTA 1AGDA 4G9DB 1FRGL 3QUXA 3MFFB 5CSZA 1JF1B 4JQIH 1KEML 5EOTA 1P7QA 4Y5YB 2QHRL 3U6RA 2P8MA 5T33H 4L3AA 3KNBA 4L4TD 4PJCF 5FYKL 1KELL 4HAFA 2A1WL 2OMBA 5GZOD 4HXBL 3KPRD 1KTDB 2P8LB 5D7SH 2QQNH 4PJIA 2C4XA 2BY1A 1G9MC 1VPOL 1YPZE 2F53B 3LKQB 4YUEH 5F7WC 5K59E 4UOJA 1MCBA 4OD2B 2EDKA 3I6GA 5F7DB 4ELMB 3ARPA 3PWVA 1I1RA 1Z9SA 1JGDB 2A74B 1WK0A 3MACL 1UXSB 2GJ6D 4WHDA 3Q1SL 4YIQA 4OZHB 3AM8C 3UXFA 1JRHH 3OAUH 4AEHL 4PJGB 4PJIE 3LEXA 3RUGB 4UT9H 4YDLB 4YH6A 1N7ML 5J1SC 5E1HB 4JFOB 3JBG7 4M3JA 2VABB 5DK0A 5IFJA 3UYRH 3ALPA 4HF5L 5TQ0H 3T2OA 2X4OA 5D1ZA 1J87A 3SKMA 5E8DH 4D0BA 3KLAB 3PG2A 4X7FC 5JHDA 3SBWC 1QKZH 4NKIH 1RV6X 5C08B 3QEGL 1H3PH 2ATPB 1QFWH 1S9YB 4MJ6B 4PTTA 1HHHA 1AO7B 4DW2L 2OX5A 2KZWA 2E27H 1ZA6A 4GLRH 4QY8A 2XKNA 5DMYA 4Z7WF 2WBWB 3DLQR 4XWGL 1QLRA 4AL8H 3UO1H 1PLGH 4XCEB 5CGYC 2YD4A 4ORGA 3DX9B 2F19H 4HWEL 4WEUD 3J8F7 1AD0A 1G6RB 3H2WA 2A9NL 4FHBD 4GMSL 3RUGF 3QISA 3HZVA 3QEUA 3TFKD 1VFAA 1DQQA 2WK2A 1TQBC 5JW4R 1JCKA 1S5IL 3PJSA 1N0LA 5F97E 1MF2H 2QQLH 4JQIL 1WT5C 4IOIA 3WD5L 1I85A 4YBHA 1FNSL 2NYYD 2CKBA 3HAEG 5F3BA 2Z31B 1G1CA 3NGBC 4OZGA 4X8JB 3O6KH 1QR1A 2DBJA 1LO2L 2EO1A 2QBWA 3MTRA 4LARL 4YBQC 5C3LD 5L2KE 4PJEE 3AFLA 3QIWB 4LCCA 5IKCB 5GIRA 2Y7QB 2DDQL 5IBUB 4ONHA 2L0DA 5HVFB 5CKGA 5AD0A 4JY4B 2FSEA 1EFQA 1OAXL 3WSQH 2A73A 4EDWH 1GZQA 4JKKA 5D7IE 3U6RB 5FYKU 3QCVL 3DO3A 2DMKA 4XP5L 1UM4H 2NXZD 4MJ4A 3CSYA 3BPOC 3FQRB 3RL2B 2XKUA 5DRNA 5IB1A 3G6JB 2Q87A 2NY1C 1P9MA 2H6PB 4NFCA 4NNXA 1BP3B 3AAZA 2N4IA 4K94L 5D6DC 4XP5H 1YDPB 1P5VA 4MVBD 3FN3A 3C5ZD 4BH8B 3L5JA 1UXSA 3IXTB 3PWJB 4ZOCA 4MX7B 3IKCA 2NX5B 5JW4N 4EN3B 1ZLVK 5JW5B 2BSTB 4LRIC 5ACZA 4F9LC 3BISA 1QSED 4QRPE 3VFMB 4Z0BH 3DUUA 4YHYC 2VDLH 1BLNA 1JHKL 3NBNA 4P46A 4PY8I 1D9KD 4QXTB 3RA7L 3NN8A 4PRHB 4X7DC 2KKQA 1FFOA 4Y2DD 3STZB 4XZUB 3TNMB 5C07D 2ERJB 3SKMB 2IPTL 3GSVB 2H2PC 1A7QH 5DYOA 1A1OB 5DURD 2BSRB 2OBGA 4JRXA 3UEZA 3NOIA 4PREA 3ZE0E 5GS0H 1JNHA 1R3HA 4TOYH 4CRPA 1LDPL 4MJ6A 4PTTB 2D7QA 3ZTJG 1WFNA 2YPLB 2AQ2A 4K94H 2H8PB 4NNYA 4WJ5A 2I25N 3BKCL 5HXMA 1JE6A 4AMKH 5T3XL 1S9WB 4ODSL 4DGYH 4LF3A 3GK8L 5KVFL 3UJJH 4NRXA 3FOMB 1T4KA 1DBJH 2C1OB 1KLGA 3IKKA 2AJSH 1PBYA 5DQJA 2CJUH 2LVEA 3L3GB 3VFTB 3AB0C 4OB5L 1GIGL 3HE7D 1ZHNB 4FZ8H 2IALA 3M17B 3SO3B 4CADA 1F13A 3HZVB 5ILTH 4F7CB 2I60L 3MRQB 2C26A 2BNUA 3CK0H 4LVOB 4LKCB 5HPMB 4X7TA 2G5BB 1U8PB 4MNQB 1U3JA 2CLRB 3MJ7A 5ILTL 4I4WA 3KNBB 4UNVA 4MNGE 1JFQL 1P84J 3D3VE 1IT9H 4PJAB 1KIQB 5B39B 3U48A 4GBXC 4MQXC 3HI6L 3LN4B 3TPKA 5T1MA 3QWRA 3MV7B 1R3JA 3ARDA 3CFDB 3K7UA 3QIWA 1BOGA 1FL6A 1RHFA 2CK0H 2GCYB 4PJ9D 3V4VL 5D5ME 4ZSOE 3TWCH 3NH7H 2XWBB 2XRAL 2OL3B 3LEYL 1MH5B 4XP6H 1RZKC 4XXDA 1HSBB 2FJFB 3MJ9A 1A9EB 2YRZA 5F6IB 2A6KA 4WGWB 2EDYA 3VA2C 4KY1H 2VDKH 1LD9B 1O7VA 1AGCB 3CVIH 5GGVL 2XIDA 4PJGA 4G8IB 3PHQA 5J13B 3WNPA 4P2OC 4FP8H 4H0HB 1FL3B 1I4FB 4JM2B 4PB9L 2VABA 4NQEE 2IBZX 4W4NA 3VXOB 3SDXF 4HXBH 1EVTC 4PRNB 4U1MB 3HLAB 4M7ZB 1OB1A 3HI1B 1YMMA 1SEQL 2X70A 3TCLA 2HAZA 2X89D 3B3IA 1OQOA 3KPPA 1PQZB 1TZHB 3RY5A 3GSUA 2CLZA 1FYHB 3C60C 2QR0A 3O3AA 3WEXB 5K9JL 3P77B 4XNYH 4KZDL 1L0QA 2UUDK 5CBAB 1ITBB 5HGGS 4HUWA 1H15B 1J88A 1AC0A 4IS6B 4Z0XA 3PDOB 3BHBB 4JB9H 1EO5A 3TVMA 3QDMB 3HMXA 5FYJU 4WV1C 2C4FU 3MFFA 4P5MA 1X5GA 1B4JH 3I9GL 3S5LA 4I9WD 2BMKB 4RFEB 3ULVC 3QXUA 3RY6A 4APQC 3EO1B 1GGIL 1UH4A 4NC0B 4P5KA 3RVWD 2B1AL 4CMMB 3QULA 3JTSA 5IESH 4UOW0 2E8YA 3QH3A 3QJFA 3V52L 4JHAL 3RWDB 5D7JB 4TNWK 3HTLX 1KTDA 4JY6A 5AWNH 1NKRA 3GMMB 3QHFL 5DMGC 4NIKB 5EOQH 4OFVA 1NCAH 5B4MC 1KCUH 4G6AC 1IC7L 2F74B 3T65B 1FN4B 3ILQC 2EKSA 4OD2A 1EA9C 4YE4L 1OAYL 2QQKH 1CFBA 4O2FA 3BGMA 3PWVB 3HR5A 1OL0A 5DJ8B 4P57B 4XAKD 5F7NC 3CXDL 4XVUC 1I1CA 3DMMB 1KJ2L 1S7XB 3WFCL 5FYJH 1W0WB 1KLGB 4G3YH 5DA0B 5DQJB 4KTYA 1T1YA 2B7DT 2JJUA 1D5IH 2A1WH 2HH0L 4UDUB 4HK3N 4DN3L 2LE9A 3V7AE 1JI2A 4PJHB 1NDMB 5A16A 4S1DC 3IFPA 4F33A 5MHSD 3PWLB 4PRPA 1AJ7L 4XP9H 1OTUD 1WGOA 1II4E 3RVWC 4DAGH 1EXUA 3O11B 1IKNC 1RUAH 4ZFZB 4U6XA 3MLXL 4KJYA 5TDNA 3QUMB 4C55A 5B39A 3F7VB 4IDLA 1AGBB 4P0DA 1T5XB 4MCYB 5A2IH 1B4RA 3UBXA 3SKOA 4HULB 4ZUTA 1KTLA 3BZDA 2X41A 4ZOBA 2C1PB 1SY6H 2GTWB 3LHPH 3V95A 1X5JA 4K71B 4HC1H 4NNPL 2OL3A 4TYUA 2WINB 4R8WH 2VXTH 1PSKL 5BRZD 3EZJB 3MLRH 1S7SA 1BBJA 4IRSB 3SE9H 1VKXA 1LD9A 1INQA 1ZLUK 3MRJB 3UMTA 2FLBT 3MRCB 4MA7L 4N9OB 4TSBH 3RWEB 4I1NB 3P0YH 4WTXA 5I1AA 3VMOA 1FORL 4NWTL 2ORBH 2FGWH 3RTQC 5KN5B 1MUJB 2VDOL 2XN9A 1HOCB 4DWHA 3HG1E 3OKOB 3KYNA 3QIWC 3OF6A 4MXWL 2XA8H 4LP5A 5GGSB 1TTFA 3O3AB 4NSKB 1R5IA 2CKNA 3FTGA 3D69B 3MNVB 4JFYB 3BZEA 4OQTH 1UM6L 5CBAA 1U3ZA 2HLFD 3VFWB 4WFFD 3NFPA 5B8CB 3VI3F 1CDIA 3TT3H 3WYRA 3JWOC 5HYSB 3ZHKA 2DKUA 3O8XB 4CNIA 1T4KB 1MWAH 1FZJB 2W9DL 1CD8A 4EEEA 4M4PA 4Q74A 3QJHA 3BVNB 2K3TA 3A6CH 5LGKA 2FIRT 4QHMA 3MRRA 3PUCA 1KJ2A 3VRIA 4BELD 7FABL 3WJLA 3QZWA 1VADA 4PGEA 1AFVH 2VL5A 4H20H 3CPLA 5C0RH 4JQXC 1YY9D 4KK6C 5D1ZC 2G75B 5DMIL 1D5XB 1VFMA 1YQ2A 1QHPA 4FXGB 3V6FB 4PJXA 4KK5C 4P2CG 1SMOA 3OR7B 1UKQA 3LN4A 3O2WL 4ZFGH 1E6OH 3LIZL 4YZFE 4JFDE 5E95B 4Z76A 3DMMA 4MQTB 3L95B 3VH8G 1CFSA 1XGQA 4W81A 3R06B 1PVHA 1T1YB 2CIIB 4PGBB 4L1DA 1GC1L 3L3DB 3F65A 2XY1A 5ACZB 4KK6D 3S37X 2MMXA 1BZ7A 3CU1A 3HI5H 5JO5A 1NAML 3D1MC 3AY4A 3T4AB 4Y5VB 3SDCB 4P46B 2FO4B 1IL1A 5DGRA 5JLZB 2DJ4A 4FA8A 5DRZA 1SM3H 2FR4B 4LNRA 3T0BA 4HPOL 5IROA 4FFYH 1UG9A 1TNMA 5H35A 3MNWA 3VD9A 5EO1B 2AEQL 4G8IA 3NCEB 2NY6B 3KG5A 2P48B 5IV2B 4XX1G 2PYEE 1WISA 5DMJB 2N7BA 5LAXB 2FJHB 2D0FA 3M07A 1UCBL 2A6IB 1OB1B 1WTGT 4NNYB 4S0TD 5E8OB 2HLFC 1FZOA 5CJ8A 5FA4A 4YPJA 4OKVA 3U0WL 3X3FH 1Q9LB 1GGUA 4YR6B 4KH2A 5FECB 3PNWA 5IB2B 3E6HA 1VEOA 3EJJX 4TUJB 4JVUA 1MHPH 1PW3A 4Y5YC 2ADGA 4GT7A 4ZPVB 4LVOC 3F62A 2E6JA 1VGKA 4NKMA 3M17A 2IALB 3DX8B 1UXWB 3HZMA 1S7UA 1X5IA 4CVWA 4QYOB 4YXKH 5BV7C 1NDGB 1NAMH 3C8HA 3VXPA 4KKAD 1F58L 1DBJL 5J12B 4OCWH 1ZLWH 5D96B 3QAZC 1NQBA 3C08L 4ZNEA 3QDAA 4PP2B 5CWSA 5TE4L 4LGRB 3AXLB 5CJQH 1IQDB 4U1HB 1YYMH 1KB5B 3WS6A 1UM5L 4Y16A 5EBGA 3CDFA 3DWTA 5I8CB 4YXKL 5JHDD 3DVIA 5FUZH 4OZFH 2H41A 4APQD 4FTVB 3WFZA 2JKXA 1GZPA 4GG6A 4G8GB 4ZUUA 1ZV5A 1S9XA 5BVPL 2YMXL 4MCZB 3H8NA 3NAAH 1S3KH 4WUUD 1K4DB 3CFEA 4NM8L 4M5YL 4FQXD 4X98A 5E8DL 1FAIH 5DMGD 4QHUB 2PTVA 5ISZB 2ED9A 5E9DA 3QDJB 2MFNA 4K8RL 5DO2C 5BXFB 1MI5D 4LAQL 4NCC1 3OGCB 2O61B 4AM0A 2H1PL 5IFHL 2V6HA 1I7ZA 2DQJH 4NQDB 2FEEL 3G5ZB 2NY2C 1KJMA 3CPLB 3OAUL 4YXLH 1CQKA 1YN7A 3D87B 1CZ8L 1F3DH 1I1AC 4H8WC 5DK2A 5GRXG 1A21A 5I30L 1QFOA 3DYMA 4UIKL 2ZCHL 1T1WA 1BZQK 5I19L 3GSWB 5ALCH 4XWOD 3MV9D 5CAYB 4LCUB 5KG9A 3EDFA 4V1DE 1KUMA 1JZ3A 5F7EL 3ULVL 1IM3B 4MA7H 3SDCA 1AKJB 3FO1A 2PN5A 1X5ZA 2NZ9D 4YZFF 4URTB 5D7JC 1FJ1B 3GHEL 3MSPA 4GRWE 1IM9D 5GGSY 4JN2B 1RZ7L 3O6FD 5DC4B 4Z7VB 1ZA3B 1MAML 1KEMH 4IMKC 1FBIH 5DZLA 5I1HL 3OJDA 1I3GL 1DSFH 4BQ8A 5ID0B 4K3DL 4CDGC 1R0AL 3MODL 2JCCF 1JZ8A 3MJ8A 1IQWL 4B5EA 4IRJD 1A7BA 1BBDH 3LV3A 5DRXA 2VITB 1L0YA 3I02A 3TA3B 5DVKA 5T3ZL 4Z5RB 1L0XA 3VFOA 4BFGA 1U3HD 3NA4A 5DUBA 3KYNB 1N6QH 4A6YL 4PD4J 1MAMH 2E7BA 3IDMB 3E6HB 3MNVA 3WIHL 4U1KB 5BQ7A 3F12A 1NJ9A 2V7HB 1NMCC 4YQXH 3IFLL 3VFWA 4KKAC 3F5WB 4Q6IA 3TBVA 4NP4L 2DI7A 4U4BA 4MNHB 4G9DA 1ZSDB 3ALWA 3MLZH 2DQHL 4LDOB 1JWSA 1KCSL 2AEWA 5JIHA 1OD9A 3CNKA 5MEPB 4G42B 2XTLA 3VGEA 2FGWL 1OARH 2DIJA 1CFVH 4MCYA 2IWGA 3AMKA 3BAEH 4HKJA 2D7PA 5BO1L 1KJ2B 3SE3A 1KIRB 1F90L 1KYOK 4GOSA 3REWA 3X12B 4HV8A 3V2AR 5HHQB 3TJEL 3QIBA 3WSQL 1T5WB 4CVXB 5T3ZE 5EOQL 1QR4A 1CK0H 2FATH 1RUQH 3GMNB 3AY4C 1QLEL 2G75A 4EN3C 4WEBL 3H3KA 2IEPA 1JGDA 4AH2B 2M8XA 2Z93B 4PP1D 2X09A 3FN0L 2ARJQ 3ZTNL 1F45A 5CINL 3OB0H 4JGMA 3M45A 1YY9C 4RAHA 3VXME 5B22A 1QYGH 1RQ5A 5IMKA 5J6HA 4NUJA 4I0PD 3IXAA 4O02L 4XMPL 3NAAL 2YMXH 2F5BL 4TTGA 3T4AA 1H3XA 1I85C 1PAMA 1TVDA 4HWBL 3FFCD 5IFJB 2IQAA 2V17H 5E03A 2F54D 4J2XA 3W2DH 2VDNH 3WKMH 1FVEB 1XCQB 4PG9A 4K55A 2AJ3B 1MUJA 1KN4H 4QWWD 1YUHB 5L7XH 3OKOA 1KACB 4MZ2A 4NYLB 3DIFA 3O45A 1M7DA 5KW9H 2HJKA 1QZ1A 5F89A 3BZ4A 4HH9B 4XCCL 1CT8B 3O8XC 1FPTL 4LLVB 3UX9B 3NFPB 5B8CA 3EYOB 3RAJL 2DTML 1NAKL 4YHZL 4K07A 4NZUL 4LHQB 5HYSA 3FB8B 4PLJC 1TZIB 3SO3C 3L7FA 1SVZA 1ETZA 3HZKA 3VI3E 1F8TL 5B21A 4HKBA 1QFWL 2PO6C 1YEIH 4LIQH 4R4ND 4R4FL 3UTTD 4HX1A 4JZJA 1YEFH 3GZKA 2BDNL 3K2UH 1M05B 5L9DL 4HPYL 4UQ2B 2X10A 4L8SA 4JDTH 5HYJB 1P7QD 4HUKB 4TN9A 4ZO6A 5D71L 2HTLD 2YD9A 3D85B 1UJ3C 1TLKA 3T2QA 3V4PH 5GGRA 3ZTNH 3FZUC 2P5EB 1WEJL 4RGMB 3NACH 1JTTA 1L4IA 5DEFA 2B4CC 3KXFE 1NFDB 3BAEL 1S7QA 3MQIA 2DQTL 3L1OH 4ODUA 3TJEH 1E4WH 2QJDA 4R3SB 3TO4C 4ELMA 4PV9A 1JGVL 1AIFA 1U8HB 2EC9U 3BIAX 4PRIB 4HG4K 4N5ED 2EO9A 3BN9D 2CDFA 4U6YB 1MJJB 1FSKC 1CVSC 4GJTB 5I74C 2OZ4A 4XCNA 4QRRB 5EU5A 3BX7C 1KCLA 3TBSB 4M7ZC 2P46B 2YA2A 4GKSA 4JJHA 3VWJB 2PF6A 3MLZL 2RIKA 4YC2B 2GTZB 1KEGH 5JHDE 1SEBB 1NANH 1PJ9A 3ARVA 1D6VL 4YDLC 3TNNA 3OAZK 3QA3A 1U3YA 2NTFA 1K9TA 4X4MA 4FXKA 5E94A 1HH9B 2PKDA 3WXWH 3MRLA 1IKFH 3GSQB 3L3KB 4WWKC 3TJHD 4X6CA 1X44A 4ZTOH 1H0DA 3GSRA 4DGVH 3QQ4B 1MRFL 2Y4SA 2DQUL 2YUZA 2OZ4H 4I3RL 1C5DA 1NUDA 4RRPA 2X4PA 3PQYE 4KI5C 1XF4A 3OAYK 1FFQA 3HE7B 2A77L 4Z7VF 3KXFB 5C08E 4DAGL 3EYVA 1JUFB 2D9QB 1E4JA 1WBYA 1NGXB 5GS2H 2AJ3A 5TE4H 4JN1L 1IZKA 5J11C 1T6VN 3QT2A 5ACLA 1M7DB 1RY7B 4OCWL 2WUCH 3QUML 4ODVH 3Q5OA 5F89B 3HC4H 5FOBB 1EO8H 1FDLH 3NCYS 2VITA 4LSQH 5KSBA 5DD3L 3BO8A 3WIHA 2DWEA 3ZTJH 4Y4HA 2JJSA 1S9XB 3V6OA 3X11A 1LE5B 2AKRA 1J5OH 5ADOL 3DHMA 5GS2D 4HKBB 1KG0B 1OAZH 3DYOA 4L3EE 3V8CA 4XMLH 2FJGA 1AI1L 4AEEA 1QFHA 5BQ7B 2HT3D 3S34L 4F80A 1IGFL 1SJHB 3KDMA 4OGYL 3HC0A 4ZS6D 1VACA 2P24B 4F7CA 1QSEB 5BVJA 1ZT7A 2HVKB 1QRNA 2BNUB 4OFPA 1A4KA 4RGND 4ETQA 4EN3D 1RURH 5I16A 2DQGH 2A73B 3GJFK 1U8PA 1DFBH 4P9HC 3ZSSA 1I1AB 3OKNA 4ONGL 3HCVB 3I6KA 4D0CB 5MEPA 5FHAH 4NJAL 2BC4B 2Z8VC 1RUKH 2AABH 1DLFH 2R69H 2XNAA 2XZAH 4JLRB 4XBEL 5F1IA 1UJTA 3QIBB 3B9KC 3KR3H 2H2SC 5KG9B 4NN6C 4Y7MA 3ZDXF 1NLDL 3VFVB 4AYFA 5HHPA 1X4YA 3BESR 2ZUXA 2HRLA 1BGXH 5CIPB 3SY0A 3RWGA 2ARWA 5C1MB 5I8OL 1YEHL 5DFVC 5JPMB 3MLPA 2BVPB 3UTSB 3SKNB 3MV7E 3EYFB 1RJLA 4UILL 5L7XL 2EE6A 1LE9B 3CCHB 2OYPA 5FA3B 3F7PC 1DN2A 3D25A 4WNQB 4XPHL 2NTSP 3T08A 3CUPA 3STZA 1QLFB 3SDDC 3TNMA 1J10A 1U6AL 4PLNC 3U0WH 1Z0MA 1KXVC 2YWYA 3QRGH 3VFOB 1RUKL 3VXSB 2JIXD 4FQCL 2XXCB 1QO3B 2YPVH 3O6LH 4BSVB 3G6DL 3IDGA 4PV8A 3HAEB 4OZFA 4KQ4H 3BKJH 4HIEB 2BX5A 4IOFC 3BPCB 4C58B 1P4LB 3VCLB 4OLUH 3C09C 3AB0B 4HF5H 5TQ0L 4LPXA 5DEZA 1YEEH 2IH1A 1KJVA 4WFGD 4YK4B 3ARZA 3QRGL 3D0LB 5CZKA 4P5MB 1M6OA 1U8LA 2F54E 2X4SB 2XPGB 1BZ9A 3QFJA 2XZQH 5HVGB 2E7MA 3VGAB 1D5ZA 2P5WB 1RVFH 1BF2A 1MHHB 4RGOL 1QACA 1D9KC 2X7LA 3WFHA 5C09D 4X83A 5IW1A 1CF8H 2ITCB 3FAWA 4GKOA 4HGMA 3ECBA 4XP1L 3C60D 2OM5A 5C70A 4WU5B 1F4HA 3TPUB 4XAWH 4L3ED 2PNDA 5IJKA 3MLSH 2BY2A 5C0JA 1HHJA 3LSOA 1J11A 1FNGB 4TSAL 4ZD3L 4Z77A 4D3CL 2FEDD 3B2VL 4PJDA 2FH6A 1WFTA 5GRZA 3FRUA 2OQJA 1NH6A 5FUCE 3OPZH 3UTTE 3PWPD 1NFDF 2VWEC 1QFWM 1G1YA 4F8TA 3DROA 3JWDH 4NHCL 5T1LA 3OKMA 5GS0D 2YD3A 3OF6D 3N85L 1P7KA 5FXCH 3RX5A 1JHTA 3V0WH 1SJEB 2NY6C 4HGWA 4FNLL 3CZJA 4YHPA 3IDJB 3S96B 4MJIE 1YEDA 3LRGA 4C4KO 4LSUL 4JLRA 4X6DA 3N1PC 1OF2B 1RZJH 3EUUA 4U7SA 4ZXBA 2Q8BL 4ODXB 1PX4A 4MXVE 4QRQA 5BV7L 5D1ZD 2QSQA 3SE8L 4YHNB 2VDMH 1MIML 5DHYA 4ZMAT 3IJYA 1PG7W 3DTXB 4P9MH 5E8PA 2W0LA 2ZUSA 3BP7A 4JFZH 5HVHC 3UBXG 2HG5A 5F9JB 5EBWA 3O9WB 5JNYB 5B4MD 4MWFB 3X14A 4ENEC 4YX2H 1M71A 2H9GB 4PJEB 3WO4B 5HBBA 2GITB 5D5MA 4U49A 5SWQA 1TXKA 3C5SB 5IJVB 5IG7B 3KXFA 1AE6H 1PYWA 4P9ML 4FG6D 5BOZG 4O2CA 4JVWA 4UDTB 4K9EH 3AS3A 3E8UL 3RWIA 4OBSA 4EI6B 1A6TA 4UB0H 4XP4H 4M7LH 3I75B 2XN9B 5DFWH 3HZYB 4MNGA 1NSNL 1V7ML 1CXHA 1CL7L 5I6XC 2W59A 2JK5B 3B9AA 4NQCA 3BP5B 2ZJSL 3MRKB 3OXSA 4OQTA 1ZHKA 2Z8WC 1R5IB 3FTGB 4HIEA 5DFTA 4WO4B 5FOBA 4NBYB 3ZKMC 4QRRE 2LU7A 2KZ1B 1PKQB 5IW6A 3N9GL 3RA7H 2ZG3A 4AIOA 3G9VA 3SHSA 1IQWH 3ES6B 3JVGA 4CMHB 1EDQA 3I3BA 4NQXA 3TIDA 4LHUD 5HHME 4NC1E 5SX4I 4NUGL 3BP6A 2P5ED 2E6QA 1RD6A 2FZ3A 4EIZC 3BVNA 1BQHA 3SBWA 3HPLB 3ULVH 3CVHL 3VFPB 4G3YL 3IFPB 2WNGA 5KJRL 1OAUL 1P7QB 4P5TA 1CG9B 1VADB 2OR8A 1ZOXA 2EYTA 4M6NL 2BC4A 2EDXA 4I48B 4TUOB 5J1TC 3B43A 4G8FA 3RPIA 2CRIA 2R1WA 3QFJE 1XGPB 3DV4B 2VJXA 2VNCA 1TNNA 1CICD 4JO4H 3U0TA 1O5DT 2WMPA 4H88H 2CIIA 4GG6F 2F5BH 2XY2A 1R5WA 4J3TA 3QXVA 2V2WB 4GRMA 4K7FB 4S11A 5E4EB 4ZAKB 3O6MH 1UB6A 2BRQA 1XGRA 2JE8A 2Y06L 1CU4L 4MB4A 3MGAA 3IETB 3CFKB 3U7WH 1H8NA 2J3SA 4E9LA 1BWWA 3B2UC 4K71C 4BQ6A 4U31A 1VKXB 1JF6A 1YPZB 2J8UF 4NN7C 3ARWA 3MRDA 4PRDA 3BDYH 3TV3H 5H35B 5EA0L 1T04A 1FLRH 4XCYB 1A6UH 4E42B 3FO2A 1CGYA 4FQCH 4TTDD 1PY9A 3CFJA 1B0RA 2BNRE 4PBVC 3BPLC 5KN5A 5ADPL 3ZT7A 4V1DD 4CW1A 1DEDA 1OARL 1HOCA 2ATKB 4M48L 3B4NA 3FKUS 4KXZH 2VMFA 2R0KH 3BN3B 4M6AA 1YN6B 5GJSL 2ICWI 3WBDA 3MC0A 3SKUD 2X40A 3EJZD 1S7WB 4LCYA 4ZUVA 4X9BA 3PV6A 1F2QA 1DR9A 4DKAA 5JQHC 2VLLA 1TJIL 1PG7L 4OGAD 4V2BA 3QPXL 4Z95H 4D9RD 4CNIB 5L2KA 5SWSE 2NW2B 5GISL 2Q1EA 4FOMA 4X4ME 2P8MB 2Y5EA 5I1GL 2NXYD 2HFEB 2EDFA 3MBXH 4KAQH 4OLWH 2P49B 4XVUD 5GZND 1RZIB 3VDAA 1MQKL 3FFDA 3RGVA 2XNAB 1A3LL 5FKAB 1V05A 1CXKA 2XN9D 4IRJC 4WTZG 2OP4L 3MRRB 3GMLA 3QNYB 6FABL 2AXGB 4I2XE 4NRZB 1YQVH 1CDGA 3WDIA 3EZ8A 2Z92B 4OLZL 4Y88A 3P30H 5DJDB 5HHMD 4Y5XB 1AY1L 5CJ5A 3MUGB 5K9KB 5ANME 3BKJL 4WY7H 3SGJA 4UT9L 4PJXB 1HK6A 3C6SB 3L7EB 3SDCC 1A6ZA 4XBPA 2PW2A 3MGTB 3EJZC 3MCLL 1OGAB 3PXHA 3ROLA 5KSVA 3VMNA 2B1HL 3EFFA 3MA7B 2Q6WA 1AI1H 4WW1A 4J3SA 1BQHB 4ERSH 5DR5H 1NEZA 4PJBA 4YNYB 4LKXA 3DO7B 1CGTA 2BVQA 5A2FA 5CILL 5L2KD 4ODVL 4P5TB 1QHOA 2A83A 4Q9BA 3RQ3A 4KK9C 4P59H 1A02N 4LSQL 3MJ9L 4L4VE 2ADJA 1CLOH 2DN7A 1OPGL 3NFSL 3D39E 1EV2E 1U8KA 1KC5L 1F42A 3FRPG 4X4YB 1KELH 3IF1B 2EH8H 2HLAA 3GSNB 3LS4L 3MV8A 4JM2C 5CJOH 4HD9A 3NIDE 1WWCA 3BMVA 1IBGH 1UB6B 3MV9B 2XQYK 4BFIA 1X5LA 1RIHH 4UV7L 2O5XH 1WF5A 3ZKNC 3FOLA 1XR9A 3FO1B 2DLGA 5FV2A 1T0MA 3PP4L 5D96C 1BIIB 3ABZA 4W6XB 3NPSB 2X2YA 1S3KL 1H5BA 4HIIA 2C3VA 5C0BB 2R1XA 1WLHA 1U3HB 3KPNB 3HMXH 2HA1A 4PGZA 2J8UA 3DBXB 3TA3D 1IEHA 4Q0XH 3BH8B 1Y0LA 3U2SB 1E4KC 4FFVD 5MP6H 1LEIA 3MOBH 4HWUA 5JIIA 2C5DC 5AUMB 1Z0NA 4KKNA 1BAFL 2B5IC 1FNGA 1OAZL 4TRPL 2OJZL 2PTTB 4KVCH 1KLFA 4OZ4B 4XGZB 3VFSA 2EIBA 2DLTA 2PXYB 2R0LH 1V7NH 4Y1AD 3O81A 4I18A 3VXMA 3MPCA 3F12B 3UDWC 4HXAH 2V5RA 3WFBH 4U6HA 1G7QB 4ZUUB 2MJWA 4OLVH 1J1OH 1CQYA 4NKOB 4WW2C 4S2SB 4YBLB 1CZ8H 3QXTA 3W2DL 4HIXH 1JZ2A 2FSEB 4MJ2A 4V1DA 5I1DB 4LF3B 3NTCL 1CGSH 3MNZA 2NW2A 5DSCA 1IRAY 1WZMA 3N1MC 4H1LA 3H9HA 1B0WA 2XA3A 3MRQA 1OF2A 3W82A 1NEZG 4ONFH 2ZSWA 1UENA 2QADB 4PTUB 3U9UB 4UUJA 4X6FB 1OSPL 1A8JH 4WWKB 1CG9A 2ICES 3GMLB 4LPYA 5DGQA 5GRUL 3G5ZA 4YHNA 3VDBA 3AAZB 3SDAA 5H2BB 3AM8A 1ZGLA 1OHQA 2WP3O 1JWMA 4EI5C 4JPWH 5GGUB 3CD4A 4P2OA 4X7CC 3EOTL 1JRHL 5ISZD 4Z78A 1KCKA 3U0TB 4UV4H 4YWGL 3ARGB 4Y2DC 1S9YA 3IKCB 1U58A 4X99B 1FQ9C 1JP5A 1IGMH 1IGYB 1M71B 2H9GA 5JW5A 2BSTA 2VDQL 1U9KA 5AZEL 1HWGB 3TN0A 2NY5L 4U1NA 4G8GD 1DBKH 1RZGB 4ELKA 3CDCA 2Y5TB 5INCB 1BLNB 2JJWA 3LQZB 3WFEH 3JWOH 4NZRL 5L8KB 3LKSA 3NN8B 4G6ML 5EZOL 1HSBA 4Q2ZA 1BQHG 1TETL 1JYWA 4LBEB 4EI6A 4WUKH 1A6TB 2XI9A 3GSVA 1YPZA 3VXSE 3BYTA 4JN2A 2Q8AL 5FYKH 4HFWA 4L4JA 5D9SA 4G6FD 5FM4A 4C56E 2R0WH 3WDJA 2MOVA 5LQBL 4P46D 1UB5A 2IADB 1WSST 1I1AD 1NGPL 2FHBA 3VXRB 4OF5A 5ELIA 1NGZA 3EKCA 2CLZB 4U2ZA 3V0AC 3V52H 3UAJD 3IDMA 4GAJL 4MJ5A 4QF1A 2RCSH 1D5BA 5EB9A 3KPRA 3ILPB 1ZEAH 4ONHB 3ARFB 4HEME 1GAFL 1P2CB 3NCFB 3CLEH 3HA0A 2FLRT 3STLA 4MNQA 4RSVA 5ENWA 4RFOH 1LK3H 4B50A 3VXTA 5IMMB 5GJTL 2NY6D 2R2CA 2WBKA 3B9VA 2HFFB 4L8BA 3SCMA 4RAUA 5GGQL