4HEPA

Complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
162
structure length
162
Chain Sequence
ASIKKVYRGMKNGAETINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords BPP
publication title Viral infection modulation and neutralization by camelid nanobodies
pubmed doi rcsb
source organism Lactococcus phage tp901-1
total genus 27
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hepA02
3DA0A 2F0CA 4HEPA 3HG0A 2WZPA 3D8MA 2X53A 3U6XA 2BSEA 2BSDA 4HEMA 4IOSA 3EJCA 1ZRUA
chains in the Genus database with same CATH superfamily
1FZJB 2Z1PA 5FO9B 4U1MA 1AGFB 2MPAL 4K3DH 3TBVB 1C7SA 2DKSA 3BHBB 5PCYA 3W5MA 2A4CA 4HEPG 3T3MB 4V1DE 4JHBA 3O2DA 1SQMA 2IDQA 2W9EH 3H85A 1RP9A 2IOOA 2FUQA 4FDWA 3SZKC 4OCWH 2JSFA 4KBPA 2CQVA 3N41F 3K6IA 4MNGE 4MSWA 1A7NL 2AEPL 2ATPA 3ZR6A 1LK2B 4E9SA 1J10A 5E1IA 1F3DH 2MWCA 3DUUA 4XMLL 4OU3A 2BOCB 3DGCR 2FE0A 2CGRL 5D7JB 1AZUA 3IETA 2ZXBA 4XE5B 5LWYH 4ODHH 2ZKHL 4QHLB 3NIGE 5FX3A 2YD3A 1KG0A 4HJJH 3HMXH 1U36A 2Z93A 4BFBD 4N9GB 1OF2A 4M7KH 1UM4L 1HSBA 2X2HA 4XCCL 4U6TA 3AXLB 1RV6X 4Z95L 5TFSL 5LN4A 1G7PB 2VUYA 4BINA 1C7TA 4QXUL 1NEUA 5JTWA 2W0FA 4PLJC 2H26B 3R0NA 5DWUH 3DYMA 4AM0B 2X2UA 5DZVA 3V5KB 1ZLWH 3ZTNL 1IKOP 1XEDA 3HJ0A 3K8LA 3LAFA 2NPLX 4GKSB 4GUCA 3OD3A 4AENB 4L9LB 5KSBE 3LNIA 4NM4L 2EEFA 4NN7C 1ZPLA 2MCPH 1ZLSH 4EI5B 5EUOB 3AS2A 3L81A 1NMCB 2X09A 3CAFA 3OHMB 4K3DL 3BESR 4BWWA 1I1YA 2OM5A 3N0PB 4XGZB 3ARWA 5FYKE 1S7UA 3OPZH 3GSQA 1B0RA 4JJ5B 2XQYG 5F6IB 2W9EL 2NOYA 3ESUF 4XPAH 2BXYA 4OCWL 5TE7H 5EEVA 4JCMA 2R1YB 1JPGB 4LEXH 2Q9OA 3CPLB 3B2VH 1OCRB 3X2QB 3INOA 3C5ZC 3IDJA 4MA3B 4J3TA 3TEZA 5J13C 5F71A 5C08E 1FNEA 1K2DA 2MHAA 1T7VA 5JIMA 1S7TB 4F57L 5SWSA 3IFOB 4GY4A 4MJ6A 2YAOA 5AWNL 4OZ4A 4LOUD 1U8NB 5I5MA 3NRQA 2F8OA 5ICZA 4AVIA 1R3LB 3FUHA 4JKPH 3GTTA 5DDHA 5FK9A 4F2MA 5LWYL 4HJJL 2C9PA 3FUNA 3HMXL 5FW6A 1NTDA 4IDJH 1LXMA 2IPKB 2A74B 4M7KL 4EJ1C 4Z0BL 5JPMB 4ZS6D 4G8AC 2MRYA 3QPQC 5IB1A 3DHPA 2MCG1 3KYNA 4C59B 1IQDA 1XGTB 3HZVA 4AG4H 3DBXA 5EEXA 3D50A 3DVNB 1MVFA 3B9EA 5DWUL 1N67A 3CSBA 1Y6KR 2J72A 4QWWD 4TUUA 5CWSB 4ZUVB 3UBXB 4NKOA 3MRPB 1KIPB 2WQRA 2VYRE 4Z7VE 5F7HA 2PLTA 5F9JB 4H44C 3QYNA 2C9SA 2H32H 1OAZH 1ZLSL 2MCPL 5JHDB 4B5EA 2FEJA 4NT6A 1TZAA 1AQ8A 4M00A 3MO1B 4HUMB 4MD4A 3CVIH 3QARA 1AO7E 5EU6B 3OPZL 5IK3B 3PQYA 3SO3B 5M7QA 4MBOA 3BT2L 4XPAL 2YEVB 5TE7L 1COBA 1OP9A 3A24A 3B2VL 2DMKA 3ILQD 5FUZL 5BCAA 3ZKMC 3JQOB 1FYTB 4MCYB 1JD9A 2Z6FA 4IMKC 4OZIB 3BWUC 3S4SB 4QXVA 3LN4B 1U3HB 2CO7B 5C3LD 1IM9B 4PJAA 4ETQB 2F0CA 2FK9A 3KVQA 2J56A 2JELH 3MBXH 4MA1B 4CJ1A 4KVNH 4JKPL 2G0KA 2CK2A 1ZJBA 4ANXA 4LL1A 2DRUA 4JFQA 4ZMZA 1AKJA 1E9PB 1NMAH 4TYUA 4R97C 3KLHD 3LB6C 5KG9A 1CXLA 5IVXB 2Y2TA 3TIDB 3ARBA 4AG4L 4TL4A 4LGRB 5IG7B 1TQBC 3NIDE 1GGUA 4OZGB 4NZTH 1WD8A 3QISA 5D1QC 1KGYE 3ZYZA 4H26A 4P46D 4BZ2A 1FFOB 3VXUD 3FPXA 3Q1EA 3CDZB 1JI1A 2GT9B 3OF6A 5KVGH 1JFQL 2VSDA 1C5BH 1YDPB 3MZGB 2BY1A 4HLEA 1T7XA 4K5PA 2TSBA 1QBLH 3QNZB 5I5IA 4G7QB 5E6UB 3OKOB 2F15A 5IVZA 4FNPA 5CF3A 1S78D 2MTPA 5ICUA 1L4IA 3HE7C 3V10A 5C1MB 2R29H 3CVIL 1JD7A 1FBIH 1GRWA 3VXRE 4DVBB 1F1GA 5BOZG 2WVVB 3D4ZA 4BSVA 2AJZA 1RUKH 1NCCH 5D1QE 3QIBA 2D31A 3ZR5A 3WNKA 2A83A 2NSQA 2ZUQB 2CR6A 4XVUC 3OJDA 4OJDH 4Y88A 5IQNA 5TK2A 2P5EB 4PS7A 1VESA 2AAAA 2WV3A 3FU8A 1LEIA 1I7ZB 3MRHB 4J3XA 5IJVA 4M03A 4S11A 1QSVA 4U2ZA 5E6IC 5H37A 2X7LB 4EVNB 1TZIB 2JELL 3MBXL 1L0QA 2IADA 1YMMD 4KVNL 1MFBH 1BF2A 3NBNA 5AB0A 4AQZA 1X5YA 3V6ZB 4EI6A 4HULB 4ZMYA 2NTFA 2ZOTA 1UWXK 1NMAL 2N01B 2NR6D 4PJDB 4QUOA 1JGIA 2F08A 2OYMA 4LARH 4Y4FD 2F7QA 1J86A 4JG9A 3JYBA 2VDLH 1RK1A 3O6KH 1GS6X 2MJWA 3GM0A 4FXTA 3LQMA 1CG9B 3V6FB 4P5TD 4NZTL 1FZOA 2JCCB 5KBLA 1T6WA 1D5RA 1JNHB 5E6YA 1HEZB 4HEME 1S7WB 1OGAA 5MERA 3ESNA 1JF1A 2O26U 5GIRB 2Q0ZX 5KVGL 3DSNB 2XPYA 1YPZA 3IRZA 4Y1AD 3BIBX 3EYQC 1JIBA 4W93A 4PGCB 1QBLL 2FBOJ 4HV8B 1L3WA 4Y4KB 2XWJB 3T65A 3UTTD 3L9RB 4N8CH 3SYPA 1L5GA 1JWMA 3B2UC 5EEYA 4AUJA 4FGMA 5CU9A 1BD2B 2R29L 4HBCH 1S6NA 2F74A 1FBIL 4HUVB 2OK0H 3L4WA 4PFEA 3Q0HA 1RUKL 1NCCL 5D6CA 4QRTA 1G7IA 1YQVH 3M46A 5GRVL 4CVXA 2XG4B 2A9BA 1SN2A 3UTSA 1NUNB 4EIZC 2JWYA 1NFAA 2KQMA 3FPYA 4KK6C 1QLFB 2OMVA 3BKCH 4X5LA 5AALA 1R47A 2IFGA 1MXGA 3IU3B 3RP1A 4ZS7H 3AQDA 4BDVB 4XN4A 6TAAA 3ASWA 5CJ8A 1MFBL 3ULSB 2VUOA 4QMEA 1XGPA 1HKLH 3G5XA 4LESA 4GG6A 3AAZB 1KBWA 2WSKA 4LARL 4ZDHA 3EH5B 2VDLL 4NQSA 4ZW3A 3O6KL 4GXUM 3N1QC 3WHE1 1NAMA 1OXYA 2EXTA 4GINA 3WENA 4YIQA 3ZOAA 4J8QA 3K74B 5ECJE 4J3OG 1N0XH 3MRFB 1M9WA 4ORGB 5I66B 4RNRB 2LAGB 3S3SA 4YHZH 1G6RA 3WMSA 2IAMB 1J8KA 4PJ9D 3GSNA 4WZ9A 3AG3B 2OYPA 1AVAA 2NUTB 4ELKB 5DUBB 4HBCL 4IGBD 2F61A 2OK0L 5DEFA 1R24A 5CFHA 2ATKB 2VQTA 1RUQH 3CSYA 4WW2A 1CT8A 2NDFA 1YQVL 3U7AA 1NPJA 4BBWA 5F9OH 2PUQT 2WQWA 3MROB 5TGBB 5IR1A 1MW2A 4RFNB 3I2CH 3BKJH 3JWNC 3RIAF 4ZS7L 1XF5A 3WLBB 3WLWC 4NNXB 2XVKA 2GCYB 5D7JC 1FVEA 3LXCA 3L7FB 3WMQA 4TNVK 2NY5H 4EZKA 5D5MB 4PRHA 3EADA 4X6BA 3E9TA 4NFBA 2GJ6B 1LNUA 3VRJB 1HKLL 1YVLA 1Q0YH 3QEHA 3MRGB 3CFNA 4KRNA 4K07A 2XTSA 5JR1H 1F97A 1O6TA 5HDOA 4PBXA 4MZ3A 1KGUA 2DWEB 3L3DB 1E5CA 3MRLA 1EAJA 1QTSA 3PWLA 2UZIH 5CCHE 1WAAF 4AEHL 1AS6A 4PGDA 2OMUA 5KYUA 3JWNE 5CAYB 1N0XL 3ULUC 2DQEH 3R19A 4NBXB 4RX4D 4ANVA 4Q4EA 1BEYH 1OAJA 4YHZL 2WP3O 1ZGLB 3S5LG 3W39B 3QT2A 4XPGH 1IFRA 3E38A 2RB8A 3UC0H 4HDIA 1A5FL 3O2DH 4EI5C 4ZUTB 1R1CA 3BVDB 3PNRB 1G9NL 1R17A 1AGEA 1H15A 4OFKA 2HJLA 1TYRA 2XVLA 4H8WH 5F7YC 5CJBA 3VYPA 4FNLH 3T8VA 1H6EA 3CLWA 2CLVA 4KFZC 5I1GH 5CD3B 1RK0B 3MRQA 3ULUE 4H4NA 2QQKH 2NQDA 2IBGA 2CUHA 4F7MA 4Z77A 2WTOA 5F9OL 3WUWB 3LPGA 3CC5B 4ODBD 3JV0A 1AZRA 3NEEA 4DNLA 3RWHB 2LAAA 1B90A 1NOFA 1PEWA 5FLUA 3HZMB 1UCBH 2QELA 3BKJL 4JFEB 5EUOE 4I5BB 1KN4H 3DRTB 1BAWA 1YNTF 2JLLA 4ZJ9A 1V7NH 2NY5L 2XWZA 3T2NH 1R5WB 1P5UC 5IUCA 5IMMB 4GSUA 3QUMA 1Q0YL 2F8IA 3F01A 4PQXA 5DC4B 4AK2A 5FV2A 3UZQA 4WWNA 2A74C 1Q38A 3L3GA 4ZFQA 3OKEA 5JR1L 5JPMC 2Q5BA 4LIQH 3VGBA 3BRDA 1PTZA 3ZT7A 5LDUA 2HVKA 2UZIL 3UYOD 1RJLA 1IBBA 3FCSA 4OGAD 1UM6H 2HKAA 5AAPA 2BNRD 4FXGA 3RFZA 1BZOA 4PLOB 3U30B 2DQEL 4FG0A 1PZDA 3Q43A 3SY0A 1BEYL 5SX5K 2V7NA 5EU4A 3RZWA 3ZDYB 4XPGL 3US0A 5LHDA 5JDSA 3UC0L 1BM7A 3O2DL 3WXVH 1IGJA 1CUOA 1WFJA 2JVUA 3V5DA 3P11H 1DEDA 3IFPB 3GYRA 3C6EA 2XY2A 2FWLB 4O2CA 2AQRA 4H8WL 1UURA 1YN6B 1V54B 5AB9A 1XXFC 5I1GL 1HE7A 2G75B 2J44A 3V4VA 2PP7A 2QQKL 4JRXD 4N2IA 1ZHNB 3KM1A 4PTUA 3KD4A 3SDAA 3VFPA 4ILDA 2VLJA 3CFUA 1RIUH 2VR6A 2ZG3A 3T6ZA 4Y9GA 1U3HC 3LKPA 5SWQB 1KZQA 3P3SA 1KN4L 1QPPA 1N2RA 4L4TB 3APNA 4ADIA 1ODAA 5EU6E 2L3BA 3O4LD 1V7NL 3T2NL 2QDWA 2J88L 4C57C 1FAIH 3MPCA 2A6JA 4PJIB 3D4GA 2FDBP 1Q1JL 1DANT 1NC4B 3KLLA 1H3XA 1S7SA 3TASA 3QFDA 3MXWH 4HUCA 5IJCC 4FL4B 1E4KA 1FYTE 3D33A 4HKZA 3NIFF 4LIQL 3JTTA 4QRPA 1TPXB 4OZIE 1A2YB 1U9KA 4LHUB 4LF3B 1UM6L 1A65A 4JN2A 2DWSA 3AUVA 4AJYV 3EFOB 3TBTA 3NJGA 4ZI8A 1PX8A 1WBXA 2LFEA 3VH8B 1KCWA 1AHWB 4N90D 4ZQKB 3LIZA 2ZAHA 3MFGB 4HJTA 5EZJB 4OFQA 1JZ5A 3ZRCC 5LVEA 3LEXA 2WD0A 4L37A 3GSRB 1E5ZA 4U6YB 2WWMC 5EBWA 1M71A 3WXVL 1O7SA 3G6JF 3DMMB 3VU2A 2YRBA 3MODH 4CADB 3VXUB 2IH9A 2ADIA 4QIRA 5IVXE 5D6DC 3TURA 3ZPDA 3CQQA 4OZGE 3B6SA 3MOBH 3W9EB 4Z0XA 1HI6B 1PBYA 2RD0A 3DYPA 4YDJB 2AJVH 4LCVA 4C56B 4LKCB 3NEOA 2W65B 3FN0H 1KY6A 2PYFB 2ITCB 2WM0A 3RE0A 1SYVB 3BEWA 4XXWA 4V2CB 2J8UF 3II2A 2Q20A 2Y3AA 4UUJA 5D8JH 4YXHL 2K8QA 1U3YA 3D25B 4ERSH 4BHUI 3GXTA 1L9QA 1KB5A 1V7MH 1OY3B 1FAIL 3LQAH 5GGQL 1EO5A 1NGPH 1WGVA 5C07A 1E30A 3BZFA 3FO0H 5BQDA 1C8QA 1O5DT 2G3MA 3MXWL 4BZ2H 2QPSA 3V0HA 1OAYL 2HPTA 3SKMB 3LXUX 4MMYB 4HAFA 1XEUA 5KBPA 1KGIA 1A3QA 3L5WB 4R7VA 4X50A 4G9FA 5ERWA 3B1UA 1DUYB 1JPFB 2EAEA 2C7UA 4FXKC 5L88H 1X5IA 2BVPB 2DJMA 4J3WA 2GAZA 3GTVA 2VR5A 4R4FL 3AQZA 3D07A 4JM4H 2FJGB 3KPNB 4PJDE 1W91A 4P5TB 1ML0A 1X5MA 4ODWB 3MODL 3L5JA 4IMLB 1IGFL 4JX0A 1JZ2A 1XGUB 3W82A 4GKZB 3ENEA 3N1GC 4G6MH 3QUYD 1F3DJ 2JCCE 3MOBL 3MGOA 5IEKA 1A4JA 4QYOA 5F3FA 3UTTB 4AMXA 2AJVL 1OOWA 2X6BA 4UIMB 2H8PA 3FCGA 4QJ5B 5HYSG 3POCA 5H37H 2A7BA 3VFNA 3FN0L 3WIFA 1S9WB 5JLZB 4ONHB 5DVLA 4FYQA 5I17B 3NA9H 4YHNA 4MJHA 1KJ2A 2XYCA 4E5XA 5I6MA 5D8JL 2BW4A 4AQ8C 2Y9RT 1BD2E 1V55B 2KDYA 4UQ3A 3BH9A 4ERSL 4JM2B 3RY6C 1V7ML 4WTXA 3LQAL 1NGPL 1CFMA 1P69B 3IS0X 4FHBD 2X0UA 4X6CF 4FQIH 4DGYH 3HJEA 3EYOA 2P24A 4QXTB 4G8FA 3FO0L 4I18A 4AZ8B 1KPUB 2ZD0A 3FB6B 1ORQA 4BZ2L 1EJ8A 1IVTA 3PL6A 2R9HC 4RWYH 5DT1H 5IEHA 1CDIA 3FSVA 3EO1A 3QCUH 3MJ8A 1ZSDA 3J07A 5F9AC 2G0LA 1PG7W 5L88L 1AZZC 3FL7A 3S8WA 1GYWA 4OTXH 4Z8FH 1ZHLA 2WKOF 2OSLB 4DPAX 1EHAA 2BC4B 4JM4L 3VI3F 3GIVB 3PP3H 3LPOA 1K5NA 3RVUC 1XXDC 2ADGB 5E08H 3WIAA 2DH2A 2VDRB 1MY5A 1LM8V 3J7HA 2JQAA 5GGRA 5AB1A 2RA1A 5I30L 1XF2A 4HIHB 1TSRA 1M1SA 4G6ML 5EZLA 5EBMB 1UD2A 2XWXA 4NM8H 5F88B 2WJ5A 3O3EA 2MQCA 4KROB 2G5BA 3H2WA 4OUOA 4M5ZH 3UTZA 2VQ1A 4W70A 1PLBA 4C4KO 4Z78B 1IGYB 2VDKB 4HCIA 5D1XA 2N7AA 3UTPE 4RFNC 5EEUA 1T1YB 1UWYA 3NA9L 3SO5A 3VTTA 1BWWA 1NUFA 3IRPX 4M48L 3PE9A 4I2XB 4JDEB 2OTUA 1KNOB 5IQ7H 1G6VK 3SE8H 1JGDA 3LD8B 1NAMH 4FQIL 1INEH 4DGYL 4GI8A 4WI3A 4PJXA 2D3NA 1XR8B 2VLME 2I69A 2Y5TB 3G08B 4GBXA 3AACA 3BSHA 4JKKA 3ALPA 2EUZA 4RWYL 5FM5M 5DT1L 2R23A 3OV6A 2NCEA 2YGOA 5FOBB 3ARGD 1G6RH 3QCUL 3SCMD 4FYSA 3QRGH 4YGVB 4OJYA 4MDIA 5KVEE 3NZ8A 4M7ZB 3GSNH 4PW9A 4LB8A 1XO8A 4P4KD 1D7FA 4HP5A 4OTXL 3SJVB 3ZXAC 4Z8FL 5D5ME 1QR1A 4UDTA 4YWGH 1HZLA 2GJ6E 3F85A 3NSCA 4RGOH 3KBFA 1U6AH 2ITFA 3RUGF 4DGIH 5E08L 4Z1PA 4G43B 3HG1A 5DA4A 2NX5D 5IWLC 43C9A 2HJKA 2PETA 3AY2A 4J2QA 2YD0A 4QLRA 4NM8L 3W0WA 2DV6A 4Y5YA 1VKXA 2KUTA 4FLRA 4M5ZL 2EE9A 4DEUA 4RMRA 4X99A 4AYGA 4JN1H 2WLLB 3PHAA 1A6UL 2HFEA 4NHCH 3S98A 3WEXB 4EN3B 3QJOA 3WHXB 3NACL 3APFA 4XXDB 3RDTA 1EXGA 2PN5A 4CN6A 1LO5B 2Y36H 2R1WA 2FSEA 3WO4B 3SE8L 5IBLD 4F3FB 4XOCA 1NAML 4AUYA 3WE6B 4X2UA 1INEL 4YXLH 4WJ5B 1A02N 4DP8X 4S1SH 3T6VA 1NFKA 3O0LA 5HDBF 4FMKA 1TEFA 2FT6A 4ELMF 3QG7L 2BFVH 1YJDH 4LOUC 2YBGA 4AIZB 4HUXB 5EPMA 1WV7T 5C2UB 1OAXH 1X5KA 3KH4A 3RAJH 4YLBA 3W81A 3QRGL 4EKXA 3BFQG 1LO0H 3B9KA 3CZKA 1PQZB 3U30C 4LP5A 3GSNL 3MV01 4MX7A 4ZS6C 1CXHA 4F33A 5JORA 4AQ1B 4YWGL 4L9DA 4O00A 4HS8H 4RGOL 1WS7A 1ULVA 2VITB 4N2NA 3VWKD 4F8LA 4DGIL 4AH2A 3UIZA 3QQ3A 2PWGA 1THAA 1ZLUK 4B95C 4LSVH 1NA8A 1P4LB 4QWWC 4P05A 3LRSB 2BJMH 5L2KA 2CKBA 1FNAA 1M2VB 2DH3A 2AF2A 5ICXA 1BOYA 2ZT9C 1KPRB 4DZ8A 4QHKJ 4XNAA 3U9WA 5ACZB 3S8FB 1U93A 4U1KA 3IDYB 3ZL1A 3K5RA 1NCBL 4RWHA 2MNJB 5TDOA 3KDPB 4BQ8A 3LKOB 3KPTA 2AGJH 2HTLD 2ZXDA 3ZDYE 4JN1L 3IS1X 4GW1B 4HEPA 2DLIA 4IHOB 4Z3JA 4AX3A 3ATEA 4GKNA 2G3XA 4TXVB 1S9XB 1O7VA 3QUMH 3UBXG 4U1SB 2FATH 1M7IA 4M1CD 3VA6A 1PLAA 1CE6A 2Y36L 3QHFH 4JRXB 2RACA 3N41B 3ILQC 3KPSA 5LJYH 5A16A 2L7QA 4FKKA 2AERT 5TF0A 1VENA 4S1SL 4PGZA 4X5WA 1ZRUA 5JA9A 4HZLA 4FL4C 4NRXB 2BFVL 1YJDL 3P69A 2IBZY 4NKDB 1TPXC 3RB5A 5G4NA 5IIEB 1OAXL 3ZHLA 2HLAA 3RAJL 5AVWB 2FO4A 2WPGA 1G1OA 1VA9A 4J23A 4YBHA 3L9EA 2YC1A 3QS3A 3CV5A 1FG2A 5KSVB 3QEQD 4MJIA 3KLHC 4OF3A 5DF0A 4KDTA 1J8RA 5HJ3A 3S4SG 2XLLA 4WHYG 1UVQB 1CLYL 4HJSA 4HS8L 4Y19A 3VNZA 4PJIE 2NW3A 1TVBB 5HVGB 3S36X 3F7YB 2FT8A 4P46C 1MQ8A 1QWHA 1U42A 1XBRA 3V4VH 2BJML 4OQTA 3W1ZA 2C1OA 4U1NB 2E4FA 3QWOB 3IVKB 3K1DA 1YLBB 5LGJA 3LKRB 4YSCA 4JFPA 3HE6D 3KE0A 1VSCA 1NINA 4Q58C 3ZVVA 2AAVA 1S78C 5E9DD 3ZE0E 1MWAB 2KPNA 2AGJL 2UYLA 3D52A 2GITA 1J9TA 3EGXB 3QQ4A 3WN5B 4EBQL 4BKSC 2XQYA 2ZYIA 2CZNA 4KRPD 3QUML 2J1YA 2OMZB 3VXUE 3UBFA 2NY3B 3QHFL 1JN6A 3VXOB 3OMZA 2AEIT 1BJ1H 4LLDA 4U6XB 1A1OB 4BA8A 3MLYH 4WHDA 3KM2A 5DMIL 1MCOH 2X10A 3SE3C 5F3BB 4LHJB 3S96B 5IROD 3G5VA 4C56E 5IF0B 4K5MA 3LIZH 1CD8A 1A4BA 1A9BB 1PZ5A 3SDDD 5D7IF 4GAJH 2BVOB 4WLCA 1BIIB 3WJLC 2NTSP 4NUQA 4WNSA 5ES4B 2Q87A 3UYPA 2PF6A 1N5AB 2NR6C 5DJ0A 5KS9E 2FIKA 2X6VA 2WCPA 4Y4FC 1M3JA 3TL5A 3BVXA 4M5TA 3HKFA 2VN7A 2O30A 5L4IA 3QDJD 4P5TC 4Z7WE 5DJDA 3UGEA 2PYEA 3BD4A 3PWNB 4ZFOB 4OCRH 2IQ9H 1EJFA 3V4VL 3WKYA 3X1FA 1IL1B 2WAHA 4KVPA 5BQ7B 4P2RB 5ADPH 1AZVA 2FLBT 4IJTA 1AAJA 4R7NB 4WO0A 5HYJA 1AQDA 4HAGA 4U6VH 5KSAA 1RURH 1PMYA 4OFYD 1ZDSA 2HRLA 2YUXA 5IHWA 3FO9A 1TQSA 5DO8A 1KB5H 4PW4A 2A99A 2E27H 5H2BA 4ZD3H 1UEMA 1LE5B 3C8KB 3NABH 3HZ3A 4M7LH 5F7WC 3C09B 3POHA 3MUZ1 4JM2C 3ZDXF 1SVZA 3T8MA 5DRWA 2DQ6A 3MLYL 1PCSA 1MCOL 3EGSB 4QRUB 3GMOB 1YYMH 3UTTE 3GFUA 1JE6A 4J2XA 1THCA 2X0VA 2FUTA 4X9GA 2YAMA 2R2HB 1NFDF 3LIZL 3QQ9D 1SDDA 3MRDB 4GAJL 1X9LA 3II1A 1DQQA 5DS8A 2AMUA 4XO9A 2ZX7A 1I4FB 4M9PA 2GIXA 5J3HD 4WEUD 3RIKA 2FT7A 4N22A 2CHNA 4PP2A 3EOBA 3OMAB 5F6HJ 4UF7C 1SLUA 3VSTA 3QG6A 2JKTM 3L1FA 4L3CA 4NSKB 5B4MD 1ZHKB 1O6SB 2GSIB 1WP6A 2J12B 3FO1A 4OCRL 2IQ9L 3BEVB 2GIMA 3HCVB 4U1JA 1ZLWK 4JFDB 1WTGT 5ADPL 3DV6B 4NCDA 3MRRB 1ZE3H 4J3SA 2AS5M 4Y89A 3O6FA 3FSAA 3G5WA 3AG2B 3WYRA 4B6ZA 3EJJX 3LKSA 4PJ9C 1WCBB 1KJ2H 2ICWA 2IOIA 4DKAA 1T0MA 2ZNWA 3AZUA 2E6QA 1NLDL 4OIAA 3HR5B 1RSYA 4IGBC 1KB5L 5F89B 5FM4A 1U8QA 4B3VA 1H6TA 4LPUA 3TF7C 4ZD3L 3UO8B 1R3HB 1E3FA 2CM6A 2CHXA 2B1AH 5E94B 1A6AB 4CGTA 4NB7A 4LSDA 1G7HA 2VMCA 5DTFB 5DD6B 3LD8C 5GJTH 1SLXA 5H35B 5AEAA 4BYHA 1WICA 5ITFA 3O2WH 1YYML 3U6RA 4XRCB 2V8MA 5K1JA 3CFEB 1HQ4B 4JM0A 5JW5B 1VACA 3M1OA 4F7TB 4NO5A 5GGSA 2KL6A 1LD9A 4QOKA 3VGDA 4MNHA 4L23A 4WGKA 3MLTB 3X1NA 3Q48A 4IBZA 5BJTA 2GQHA 5D9SB 1P4UA 5I8OL 3FTGA 1YN7A 4A6YA 1AHMA 3EJZD 5G5DA 5IB2A 4ODTH 5ALCH 1DL7H 3HFML 1F86A 5F7FA 2VDPB 3BPLB 3ARGB 5CCGE 2WVUA 3SCMB 5I0DA 4H0GA 2H1LM 1ECYA 1P1ZA 3KPRD 4P4KB 4HKXA 1P2CA 2VZTA 2A2QT 3D9AH 2B1HH 5KSUB 1UZ8B 1FFQA 2EDJA 2FZ3A 4GRMB 1QZNA 1NC2A 5D7KD 2P7TA 1KJ2L 2BSCA 3PPSA 4I48B 3E9UA 1Q0EA 1SXBA 1RUMH 2B20A 2NX5B 3KWVA 4LLYA 3C12A 3HC4H 4BK8A 1P9MC 4EN3C 1TTAA 1L9TA 1WHOA 3HS0A 2HG0A 3IYLW 4N1EA 1T89A 3SZ6A 3ZZ1A 3CFKB 1OOAA 1HKFA 1I7RA 2B1AL 3WO4C 2ICEB 3B5HA 5KZCD 1D5ZB 5GJTL 1KB9J 5JPNC 1O0VA 2JKLA 3D2TA 3EDDA 4JANA 5CO1A 3O2WL 3HNSH 4CN4A 4QO1A 2HUHA 2Y4SA 3L3IB 3B3IB 4P5KB 4Y2OB 2DBLL 5JXAH 3DHUA 3U46B 2YFOA 1UT2A 3I9AA 3QXAA 1WAPA 4PJHA 4A2FA 4YR6B 4E41D 4AYID 1MCRA 3MREB 4XVTH 4F2FA 1I1CA 2HT2D 2WP3T 4PY7A 2VM4A 3MJ9L 2P4AB 3BVNB 1OP4A 5BW7C 3DRQA 2WK2A 4DUXA 2IALB 1UJTA 2F68X 4ODTL 5ALCL 1DL7L 3RGHA 1BVKA 4AQ1C 1MNNA 2WMPB 1R3JA 4OGAC 5EF0A 1NOAA 3EW3B 3NT0A 2DQCH 2NLJA 4LOVA 2LLGA 4OD3H 2RTTA 3CZSA 3ESPA 2XRAH 4Z7NF 4ZXBA 1OTSD 5L9DH 5I1AA 3D9AL 1JWUB 2B1HL 2HT4D 4AEIH 3X14B 1VLXA 4RA0C 5D1ZA 1A4AA 1DVYA 1NCWH 1O6VA 3IDYC 1ACXA 1KV3A 1CLZH 3OX8A 4KKLC 4KKRA 2VZVA 4M6NH 4ENZA 4Z3GA 1JUFA 3K6SA 1YC7A 4G8EB 1KACB 4WI5A 5I6XC 1RUML 1D5MB 3HC4L 2VXSH 1PPIA 3V0JA 1FVCB 1D9KA 1DO6A 1EXHA 4ZUUB 5F96H 4X4XA 3I6GA 2WQAA 4JQVC 1CPUA 5GRVK 3RKDD 2D0FA 4U2YA 3G04A 1UXSA 5FKPA 4V1DA 5GS1A 4UT6A 3D0VB 1FFNB 5GZOD 4GAYA 2JV6A 3RNQB 1U8LB 3GUTB 5JXAL 1J5IA 1HHJB 3BGFB 1PIGA 1RHHB 1AGCB 1CL7I 1DJGA 2PTUA 4MNGA 2R2EB 1KTDB 2FJUB 5M95B 1X5LA 4ES9A 5EUKA 4TQ8A 5AOJA 1S5IL 5AW6B 4XVTL 2V5RA 4G1MA 2K1MA 1S7RA 3G5ZB 3UX9B 4GQZA 4JRXE 2HJFA 4OM0H 4KKAD 5ISZD 4LSSH 3SYQA 2VR7A 2CKBH 1SN0A 1FFRA 3CX2A 2DQCL 1SM3L 1D5BB 4KPHH 3GJEB 4QAWA 3AY4C 1U4FA 1J1PL 3KYMA 2XA3A 1JMZA 3KW8A 2I9TB 2XRAL 4U31A 1TTGA 3IDNB 3QEQB 5L9DL 3BVUA 4EDXB 3S5LA 1NGWB 3V9CA 3ZHFA 1JDCA 5D7LD 4AEIL 2GBUA 3ES6A 3LZLA 2GUOA 4ZMWA 1NCWL 4FYTA 4S1QL 4M6NL 4ADJA 1CLZL 2ZKXA 4M7JH 1AI1H 4A2MA 3GHEH 4LHUG 3SKUD 2DQDH 3VH8G 1MJJA 5E5MB 2EC9U 4P2QD 5F96L 1MRCH 3FXIC 2AK4D 3B7RL 4FNUA 2ZOKB 5AVVB 4N90E 4I3RH 1H0DA 3DJRA 1ZA6B 4LBAA 3Q8FA 2W95A 1UKSA 3HN3A 4NPJA 4TV3A 1I75A 4P3DB 1KWKA 4KRPB 1UWEH 1AG6A 1T5XB 1YUHB 3B2DC 3TCXA 4N8VB 5CUSH 3CH1A 5AENA 5KBKA 3KAAA 1K85A 1RZFH 1YNTB 1AACA 4WNQB 3X11B 1P53A 3L4UA 4DN3H 3LX9A 4DIXA 5TTRA 1REIA 4NQVB 1ND0B 1PZ2A 4HIEB 4AITA 4YSQA 1NM4A 1E27A 1ETA1 1M05A 1SBBA 1UA7A 1MG2C 1ZKAA 4H0LC 4LSSL 3AG1B 2CKBL 4OQTH 3BWZA 1G7QB 2IGLA 3SDDB 5DLML 4NERA 3ZDWA 3K2UH 3ETBF 4KPHL 3OLDA 3OG4B 1UG9A 3C5ZA 4K94H 1P6WA 3C6SB 2F1AA 1F90L 2XOTA 4A39A 4XVJL 4ZUWA 4LZKA 5BVPH 3P3UA 2DM2A 4ZODA 4B41A 3TV8A 4PV8B 4X4YB 2H0EA 4HXBH 1YYCA 2OCCB 1MLBB 4L1TA 4M7JL 4ZSOA 1A1NB 1AI1L 3GHEL 6PAZA 3S37H 2VABB 4C4BA 1NDMA 5K33A 4AXWA 4Z7VA 5JQIB 2DQDL 4HHGA 5ENWB 1ZT1A 1ERNA 2BWIA 2X9XA 4LSUH 1MI5B 2B3IA 3U0WH 1MRCL 1QHQA 2J20A 2V17H 3QUYC 1DVZA 1VFOA 3ETSA 5T3XL 1LEKB 1LJMA 4PCKA 4DUVA 1CFTA 1DDHA 2XWTA 4AOFA 2QQNH 4XNQB 3C09C 1AO7A 4N2OA 4I3RL 3CLFH 5T1DH 4P2RE 4FQ2H 4HA1A 1AQMA 2Y23A 3UPRB 1NFIB 2TSAA 1KFGA 2XFXB 1CFNA 2VRQA 1UWEL 3AS3A 4P04A 3EG9B 1HH6A 4ADGA 4X4ZA 4YXKH 1RLBA 5CUSL 5C0FA 3IGLA 3GF8A 3PUUA 1KXVC 1RZFL 1X6LA 2A73B 5FFGA 5DZPA 3GB7B 4DN3L 3UJTH 1T0OA 4BCXA 1N59B 1BX2A 2X4SA 3RU8H 3VFWB 1OWWA 2XY1A 1SUHA 4IEFB 3CMGA 1DQKA 1KXTB 1G7JA 1YZZA 4LLAA 4LLMA 3T0EA 3HLAB 3UP1A 3FT9A 1C12A 1MRFH 3MA7A 2I24N 4OQTL 5DJYB 2UZPA 3NIFB 5SWSD 3U48A 2W0LA 5GSVB 3RI5F 2D7NA 4YS4A 2LVCA 3K2UL 4XN2A 1WC7B 2N56A 3UJIH 4RMWA 2E6JA 3GSOA 4K94L 4R7DB 2VL4A 5FKAB 1Q9OA 4OLZH 2E9JA 3OR7A 5BVPL 2WO3B 1F5WA 5DJCB 5A6MA 4MS8D 2CHZA 4HXBL 5LXGH 1U8IB 2FEDD 2OMWA 2BSSA 3PHQB 5INDA 1DUZA 3KLAA 3G6JB 3TBSB 4MBRA 1B0GB 1KGCD 4LBEA 4LSUL 4NKIH 1T22B 3U0WL 5AB2A 1ZA3B 2V17L 5HGDA 5FDYA 1FH2A 1XVSA 3P77A 3QGVA 2WKLA 5EF1A 1ZGLM 2QQNL 1E9QB 3KPMB 3GDBA 5T1DL 3CLFL 1TTCA 4JFDE 4FQHA 1S9KC 2Q6WA 4FQ2L 4PYHA 4FLQA 2K9UA 4M8RA 5A2AA 5EULV 1IRAY 3RVWD 2MKLC 3MRMA 4POYA 1L6PA 3ARVA 5GS0H 3VG9C 5HP5A 4AMWA 3PQYD 1ID5I 1T2XA 3NZSA 4YXKL 1QWNA 4Z5RB 5GSRA 4YEFA 5IB4B 5EC2A 3UJTL 4XX1G 4L3EA 2W38A 4N2HA 4XZUA 5DJAA 4G42B 3RWJA 3MGTA 4B9ZA 3B9VA 5F7BA 1MRFL 4H8PA 1B88A 4HFWB 4IBYA 3WNPA 4OBRA 3ARGC 3SCMC 4PM1A 3UJIL 2PP9A 2PPFA 4I13B 1NCGA 4JJOA 2XETA 2H1PH 1S7QA 4OLZL 4P4KC 3TH2T 2EO1A 2VXTH 3BDXA 3MJ7B 1TQVA 5DYOB 3VYNA 3VXTA 3NFPA 1AKJD 3T1FB 1U30A 2WC7A 3CFCH 1NBYA 4C4KT 5D96C 5LXGL 3HMWH 2IWGA 3PV6A 3DJTA 3DPBB 3ARBD 4RETB 1AANA 3B7SA 1FLRH 3D34A 3QEGL 4NKIL 3VM7A 3JWOC 1EDHA 2ZSVA 4WIQA 3CN3A 3OF6D 4G83A 5IY5B 4IOFD 4DGWC 1GGBH 4FZ8H 2ICEC 4TLSA 5HYSA 5IMOB 1YEGH 3PAUA 4NDMA 1KTKE 2ZG1A 3MUGA 3ZKQD 4FOMA 4IRZA 3LHPH 2Q7AA 1SXCA 2KZKA 4PJGF 1UT9A 4PRIA 2VDLB 5GS0L 4DK3A 2V3EA 2C3XA 1OGPA 4LNRA 1ZSHA 2NX5E 1AMXA 1EZSA 4P9MH 5C0EB 2KZ1B 3BP7B 4A6YH 5KVDH 2XC8A 3QIBD 5EORL 4I1PA 3FTXA 3D3VB 1DSFL 4OLEA 4X6CB 1JGVH 4I85A 3MRCA 4QXWA 4ANKA 5T1JA 1T1WA 4EDWH 3Q5OA 5HHVH 5TDPB 1Y18A 1G94A 4N85A 5DJXA 5D72L 1DQLL 1WA1X 4YJZL 1KB9K 3PHOA 5FECA 4WU5A 5AW0B 5K39B 4OV6F 4NLHA 2OYLA 4P4RB 5DEGA 4A7GF 2H1PL 5TQ2H 2X4QB 5DHYA 3FO2A 1WWWX 2X4RA 1JTOA 4X5PA 2EDKA 4MJJA 4MA8H 3N1FC 3CFCL 4FQQA 3QJVB 3VWKC 1PDKA 3VI3B 3X13B 3ZGIA 2EIBA 2QT6A 2ZOWA 2FL5B 4YFEA 4MHHG 4MLIA 1BJ1J 5JQHC 4FQLH 1RIHH 3TFKD 2HN7B 2OP4H 1FLRL 4DP4X 4KDVA 1HAUA 1KYOJ 3C5JA 5D4JA 4W9DC 1YO4A 3KJ4B 1OGAD 5I24A 4J8RA 1B4JH 2I9LA 3IT8D 1GGBL 4FZ8L 1UXWA 1YEGL 3C5SA 1U95B 3M88A 3VFUA 2UZXB 2HTLC 4B9KC 1CGTA 3A0OA 4FG6D 2LVEA 3ZHKA 3CE1A 3ULVH 3D85A 3FFCA 5EH1A 1BG9A 3BGFC 3DUSA 4KO5A 3KWWB 4P9ML 4M1CC 4N2KA 2X05A 2DMBA 5KVDL 2VDQH 2YRZA 2AXWA 3QIWA 1KJ3H 4YSRA 1FZJA 5FO9A 2G9KA 1AGFA 4DFIA 1E0OB 4H0IA 1CF8H 2ZYRA 3TBVA 3UTSD 1JGVL 3BHBA 4AVKA 3I3BA 1CFBA 4J3OH 3FOMB 4EDWL 4YLCA 5HHVL 1BQHB 4HUKB 4EE2A 1QFWM 1M1XB 2KYIA 1GOHA 3KGRA 3H1ZA 4LCUB 4Z3TA 4OZFG 4S1RH 1IAKA 2R0LH 1RZKL 3U36A 4JW3A 2I85A 4K7PH 4AYMC 3I6LD 4WEBH 3FMGL 1YCSA 3O6ML 4MA8L 4A7SA 4YL4A 1OAUH 2MH4A 2VMJA 1M6OA 3RUGB 3U0TB 1FZMA 2EEDA 4FQLL 2OP4L 2DDQH 1OLZA 4FHKA 4HKJB 1V05A 2OMBA 3CFDA 5CP7B 1BMZA 5I8CA 5EDXA 2HFGH 4HCRL 4UT6H 5E1HB 1Q9WB 1QI4A 5D7LB 1WAAE 5CNHA 1B4JL 3HE6C 1OPGH 2YWZA 3AXLA 1Z9SA 2L7UA 3MLSH 3QEQE 4NEHB 1HFUA 3GS4A 4BEIA 1HHIB 4AM0A 3UZEA 1MFAL 3RGVB 3ULVL 4UOQA 4P2QB 1PVHA 1SLVA 4KRPC 2AK4B 4UQ2B 3IDGB 4BFNA 3PDOB 1KEGL 4GKSA 2NZIA 3GPSA 4L9LA 1WWBX 2W07B 2X89A 3VDBA 1MCEA 1KJ3L 5E4OA 4XNMB 4BHUA 3SOBH 1U3NA 3CGTA 5EN3A 5EUOA 2VIRB 3O81A 2X28A 1CF8L 3BAWA 2QGDA 4JZJA 5L4JA 2YLKA 4KOCA 4KUCF 2P5WA 4XGZA 5IROC 3VQ2C 4JJ5A 5HDBB 2DI9A 4ELMB 4YHML 2NYYD 3SDDC 1I82A 1JPGA 1IZJA 3K2MC 4S1RL 2R0LL 4K7PL 2J4WH 5CGYD 1BQKA 1MNUH 3NCCB 4O9HH 4PRHD 1KTJA 1S7TA 4JVPA 2YSSB 2H45A 1OAUL 3HC0B 4YO0B 4XR8C 3PP3K 4KQ0A 2BX5A 1U8NA 1NCAH 5ALBH 1E50A 5GISH 3HI5H 2DDQL 2BH0A 5F8QC 4TRPL 3FS9A 5FYKH 1TCMA 2HFGL 4L5FH 1KG0B 1F4WL 4UT6L 1NJ9A 2CUMA 5HGBA 3VMNA 4BZYA 2Z93B 4PVLA 1OPGL 1MFUA 5ID1B 2CPCA 1QSZA 3S5ZA 3RY4A 3WFCH 2ZE0A 3MLSL 1A14H 2C9VA 5CEYA 2COVD 3TU6A 1EAOA 3U83A 3CZNA 4QHMB 2V33A 2W0FB 1GJWA 5J7CC 3DX0A 2CXKA 4ZUVA 3TFBA 3UBXA 3BAXA 3RWIB 1PZBA 5FM8A 1IFGA 4XBEH 3P0YH 3VGEA 4NC1C 5F9JA 4OJEH 5JHDA 3AM8C 1ZK5A 3L48A 2P43B 4X9IA 1EHLH 4KZDH 3BH8A 1EIBA 4GW4A 4FABH 1ZV9A 4TKWA 4GG8B 1PKOA 4PGBB 2E0PA 4XTRD 3QQ9C 1B0RB 4E9RA 4OCMC 4B7IA 2BY2A 1TUPA 2WXRA 1V3MA 3NK3A 1TU2A 3EOTH 1TETL 2X3BA 5I1EH 5FCUH 2J4WL 5J3HC 3I02A 1H6UA 1IKFH 1PCXA 1MNUL 4MCYA 4QTFA 5DXWA 3IDJB 4OZIA 4NC1E 5KJRL 1XF4B 3BUTA 3P02A 3S4SA 2MHAB 1K2DB 3LN4A 2CO7A 5SWSB 4ETQA 3QRFM 5INCA 5B4MC 4MJ6B 1NCAL 4OZ4B 2X1OA 5ALBL 4BCYA 3WJMB 2C7FA 3HI5L 1C1EH 5ICZB 2VR4A 2QGBA 2F7IA 1FHGA 1M57B 5FK9B 4F2MB 1QI5A 3QR0A 3NIFE 3K7UA 1MZYA 4L5FL 2C4FU 1E9PA 3B34A 4NWUH 1SMAA 4UOJA 3BAEH 4YSAA 1KGWA 5IVXA 2WIMA 1BAFH 2C26A 3TIDA 5C71A 1A14L 3HZVB 5B3SB 2X41A 4ZW6A 3DBXB 3K72B 5GGSY 5IHHA 3FCTA 1NWOA 1FFOA 1XMWA 4K73A 4KTDL 2GT9A 2O6FA 1YDPA 4NUJA 1L9MA 1U58B 3HS8A 4H5SB 3G6JE 3LPPA 4XBEL 3P0YL 5LGHL 1IKNA 1MUJB 2WKGA 1U21A 5HYEA 1OV8A 5H8DA 1EHLL 4WCYH 4KZDL 2EXYD 2XN1A 1B6UA 1F56A 3CMOH 5C9KA 4G1EB 4D94A 4FABL 3ZLQC 4QRQA 3SDAD 1CGVA 2GPZA 2Y7MA 3JUZA 1SOSA 4FRWA 1QSEB 2ARWA 2VLJD 3PQYB 4CC1A 3OLIA 4PHZA 5IQOA 2Z7ZA 1JZ6A 4CC0A 1PYWB 3EOTL 3LZFH 4HJGB 5D7IB 5EO9A 4H2CA 5I1EL 2P5EA 5CLZA 1TTFA 5FCUL 4L2LA 4EOWL 1IKFL 3L1OH 1BVOA 5I23A 3JZ7A 1I7ZA 2ZX5A 1BIHA 1F58H 3MRHA 2X9ZA 1TQTA 3GBEA 4EVNA 2X7LA 1SXAA 1TZIA 1VZIA 4QRPD 1GJIA 5EF3A 4UQIM 1C1EL 4WTZG 4PVMA 3CK0H 3VVWA 2H1XA 3QJFB 4PJDA 3P3RA 1I8KA 2QTVA 4JFQB 2J1KA 4NWUL 2O6PA 3CQPA 5AAMA 3BAEL 5HDLA 2FBRA 1CDCA 1BAFL 4ZO7A 3SPVB 4KJYA 1KYFA 5FCSH 1VPOH 5G55A 3V6FA 2AQSA 1U3ZA 5DQDL 4UAOB 1JNHA 2VZSA 5GIRA 5C0IB 3MV8B 3DSNA 3NJFA 5J56B 1WT5C 3WFHA 1NBVL 2VERN 3TYGH 3LS5L 3QFJB 4PGCA 4X6DF 4Y4KA 2XWJA 3L9RA 2H6UA 4HSQA 3ZDXB 4LPCA 4W81A 4WCYL 1G87A 1JHTB 2D0GA 3CMOL 4K8RH 3CBKB 5IVZB 2W88A 4GMSH 4XMPH 2WBKA 2CDGB 4LRNL 5D7KE 3SDXA 1LE9B 5E5LA 4FFWD 4FNQA 2WBXA 4FJYA 1NFDB 3ILEA 4GKLA 3SGEI 2AJZB 4ZTPH 4BSVB 1J0YA 3L3OA 2XG4A 3QIBB 1PLGH 2V9TA 3LZFL 3UTOA 2HT2C 3Q6FA 3MFFB 5EC1A 3L1OL 3NJIA 3G6DH 3REVA 5JHBA 5C07D 1QLFA 1MCDA 1F58L 3D3VE 2D3VA 3L3JA 5IJVB 2C34A 4X6CE 2OR9H 3ULSA 1FNLA 2IADB 3ZKXB 3CK0L 2CLZA 1OTSC 4G9FD 4IBQA 4M8VA 2DJUA 2HT4C 5E2VH 5B1JC 4IRZH 2EIJB 3OVUB 4WKZB 1M56B 1VPOL 1PW3A 4TNGA 4Y5XB 1KIQA 3BVTA 1UUSA 3MMEB 4ABVA 4MS6A 1XCXA 4B5ZA 1FZOB 2CHWA 3MRFA 5F7DB 3P9MB 2ZG2A 5I66A 2Z64C 1OGAB 1MCWM 2AI0H 3LYRA 3EJCA 1XAKA 4PEEA 1WBYB 3TYGL 4PR5B 1BPVA 1J05B 1CXKA 4HOMA 1YPZB 3RKDC 2IAMA 2GTQA 1HX0A 1KYOK 1L5GB 4K8RL 5GZOC 3BUDA 2YQBA 2NUTA 4ELKA 4GMSL 4PY8J 5DUBA 4XMPL 5IMLB 1G0YR 1EJOH 2ATKA 2F74B 4OGYL 4PSPA 2YPVA 3ASNB 3OMIB 4ZTPL 1JZJA 5E0FA 5D6CB 4QRTB 4OGXH 1G7IB 1G9NC 1PLGL 1XR9A 2DS4A 3EH4B 4CVXB 4V11A 3MROA 2XWDA 2GHZA 3UTSB 3S35H 5TGBA 1OK0A 3G6DL 5C97A 1EVUA 2V7HB 3SDYH 4KKAC 3KVPA 2V37A 4MB3A 5A2BA 2OMVB 1H5BB 3SOTA 3WLBA 3B7TA 4NNXA 2WXQA 2OR9L 4PN6A 2JFCA 4NYLB 4C55A 3CFQA 3K1KC 5FM5O 1U8HB 3PL6D 5I26A 4DGVL 4MD0B 4QD2E 2GJ6A 1XGPB 3MRGA 4NQCB 1B2WL 5L4MA 2XKUA 2CR3A 1U8JB 3DJZA 3LN9A 4YSDA 1UB6A 4ZDHB 2NY5C 2DWEA 3GBNH 2W92A 4AYFB 3WEOA 2DY2A 4G6JH 3RI5K 3IPBA 2CM5A 3MN8A 4HX1A 5CN2A 4J3OF 4N2LA 5HJDA 3FW6A 3R18A 4NI6A 3ZE1F 3O41B 2AI0L 2C1PB 4MCNA 3PWUA 2K3HA 1ZGLA 5DFTA 4Q9QH 3W39A 4N0CD 4LLVB 3N55A 3RL1A 2P52A 5F1IB 4ZUTA 1IE4A 5D7LE 5FWQA 2EDWA 3FTYA 4XHJD 4LLUB 3GSNB 4ORZC 2XV6B 3ZU8A 1SJXA 5IWLA 1EJOL 1X9UA 2DI8A 4OCSH 4NZJA 2YMTA 5D1XD 5E1AB 1A0QL 5DFWH 5T8IA 3RWDA 3QXVA 2A1WH 1R24B 4PTTA 1RQ5A 5DEFB 5GS2H 2J43A 2QSQA 4HWBA 3WKNA 5CD3A 1RK0A 1O75A 4OGXL 3LZPA 4P2QE 4Q9RL 2BOLA 1ZEAH 3E7JA 2AK4E 1JFHA 3S35L 4H8WC 2WYTA 3RWHA 1GYVA 5K9JH 2KQNA 3HZMA 3H3PL 2N7BA 1LO4H 4JFEA 4X5RA 1MCLA 4NRZA 3DRTA 4HH8A 3T2PA 3WL9B 1URZA 4GBXD 5EG6C 2I25N 2QV2A 1R5WA 1FVEB 4E9YA 5HDBE 5IMMA 1UD6A 2FYYB 2IPTH 5HI3D 3NZUA 4Z7NB 4JVWA 4AV4A 1HK6A 4WDIA 4FQPA 3QEHB 4P57B 3H7BB 3TA3B 5CMAB 3NDZE 4L2YA 2DYSB 3GBNL 3IJHB 4G6JL 4JO1H 3MRLB 4TULH 3PWLB 1ET7A 1SRDA 1TMCB 3K8KA 4YQXH 4KXBA 3T3PF 4OJAA 4WI8A 4Z76B 1U8KA 3MOAL 3UFIA 4Q9QL 4ZFFB 4MAYB 2H9GA 4Q6YA 2OJZL 2HH0H 3HRZB 3W0WD 4IU2B 4E42B 2X9WA 1CFVH 2AJUH 3IFPA 2L7JA 4XNUH 5CS7A 4OCSL 1H15B 2ICWJ 2HJLB 1HXKA 2A1WL 1J8HB 1OT1A 1ZGLP 2G75A 2CLVB 3RDTD 4HW6A 2IH1A 4WY7L 3MRQB 4K3HA 3OQRA 1Z0MA 4F7MB 4G59C 1FI8C 4BE6A 3A5VA 5CM1A 5K9JL 2EXSA 3F04A 1H9VA 4JO3H 1LQBC 1LO4L 1BVNT 1ZXKA 3B1TA 3KPQB 5SWQA 1RZGA 1PEZA 1D5XA 2JK5B 2JI3A 2QZ5A 4L4TA 1LK3H 1JPSH 3AWEA 3APDA 1ID2A 2EADA 4Y2DA 1FL5A 1E3ZA 1I9RH 2C3WA 2KT6A 3R06B 5F2FA 2IGTA 4UB0H 2GYSA 1Q94B 4D2NA 2IPTL 3IE9A 4HD9A 1H3TA 5GRYA 4DN4H 1NC4A 3QUMB 2W60B 3B9KD 5HSFA 2MEJB 1SEQL 2WLYA 4L05A 3UZQB 1ZK9A 1ASOA 4MS8C 3VFVA 1F4XH 2C3HA 2FEDC 1A2YA 2DLEA 4YFDB 3SPJA 4LHUA 5AZ2H 4JO1L 4DTGL 2AJXL 4TULL 2HVKB 3NA4A 1ITBB 3EFOA 4JHZA 2DMHA 3APMA 4KFMA 5D2NA 5SWSE 3VH8A 1AHWA 1H8SA 4ZQKA 3B83A 4YQXL 1ORSB 1WDAA 4FXGB 3RFZB 4DHLA 4XT1C 5ADOH 5L2KD 2YD6A 5IB5A 4P3CH 3SY0B 3GSRA 4F2ME 5EU4B 4U6YA 2HH0L 5JDSB 1CFVL 3DMMA 2UUDH 4JJHA 1BQLH 4XNUL 5ESAB 2QEJA 3V5DB 3RVWC 1KIUB 1DR9A 2QHLA 3KWXA 2BIMA 4KUCD 4O2CB 4ZNEE 3VW3H 4HSAC 1NZRA 2QDVA 4OI9A 1HI6A 3GK8H 4W6WB 1KGCE 4K71B 4WHYH 1I9JH 4C56A 3NYKA 4X9BA 3V4VB 1WLHA 1L9SA 2QGCA 1I8MB 1BBDL 4NCC2 5IESH 4PTUB 4XWOD 4F8QA 3KPSD 2ITCA 4OAWB 1KTLB 1FO0B 5T3XD 5FGBA 3SDAB 4JO3L 3MA9H 3VFPB 4F20A 5HYFA 4FFYH 4KJPD 1DJXA 3RX9A 2D4FA 3U7WH 5IOKA 4FEMA 1ZOXA 2WNGA 3WXWH 4I4WA 4UB0L 4RFOH 1QSEE 2Z0BA 3PQYE 4HS3B 4DN4L 4W1TA 2EVJA 5D7IE 3WIHA 1S7SB 5AG8A 4LSPL 4MJID 1GR7A 4N2GA 1IC0A 5LLIC 1F4XL 2A9MH 5EU3B 3LQAC 3SKMA 2B2XH 3JTTB 5TD4A 4Y19D 3ARBC 3L5WA 1OCWL 4JN2B 4ZAKA 4KK9D 4NXSA 5DEJA 3WN6A 2OSWA 1DUYA 1JPFA 2NR6A 3M7FB 1IEAA 2RGSA 4ZMPA 5ADOL 2BVPA 4P3CL 4IOFC 3I3EA 3ROLA 2FJGA 4L37B 4D9RD 1TT6A 4W9KC 5C8JB 4P5TA 5TQ0H 2R27A 4U3SB 2FCBA 3I6KA 4IMLA 4KXDA 2IPUK 3FYIB 4GKZA 2FQEA 1N64L 3TEUA 4DVRH 4WUKH 1A8JH 4D0CB 3N6YA 5HJGA 2CRIA 4Z0XB 1R19A 2YD4A 3LHAA 3QIBC 4PYGA 1I9JL 5JIIA 3ATDA 4UIMA 1OTTD 5AUMA 1KIRB 5IESL 2CBTA 2CUIA 3QFJE 5FO7B 1RSFA 5DUMH 1S9WA 2NY6D 5IJDC 4FA7B 3MA9L 2AXFA 3ZDXE 1XHHA 1KYUA 2APFA 4JQXC 2IEPA 4YLQT 5C6TH 3U7WL 3VNYA 4JM2A 5CJQH 3WXWL 3R4RA 2GW5A 1FJ1B 4G3YH 3ZKXC 3O3BB 1NFDE 3SPIA 1XCWA 1F1AA 3ECBA 1AJ7H 4GO8A 4QXTA 1KPUA 3CQFA 3VMPA 4KY1H 4A63A 1M53A 1S3RA 3AT0A 2A9ML 1EK3A 2DEWX 3L95A 4Y5XC 4GXFA 1UFUA 3TFKC 5CLTA 3DARA 2PYED 1ZHBB 3JTBA 4I9WD 2WYHA 4G9FB 1YEFH 3NG5A 3BZ5A 3RNKA 1ONQB 5HYJD 2GAZB 2BC4A 3GIVA 5I1CL 5KSAD 2XTLA 5TQ0L 2ADGA 2VL5B 1UD8A 4ZMAT 1TQCC 2Y25A 3CHQA 4FG6C 3WE1A 4OFVA 3BE1H 2XJKA 2XYBA 3RLSA 4DVRL 5EBMA 4WUKL 3OGCA 2Q86A 2VT0A 3ZIMA 4TLKA 1IGTB 2XX0A 3MGOB 5IEKB 4QYOB 2FQDA 2XFGB 1OGAE 5J9PA 4JZNA 4Z78A 3QC5X 1IGYA 1YPZE 4UNVA 5DUML 3P4NB 3WIFB 3WFEH 5F0LB 4YHPA 1IAOA 1P0SE 3D2UA 4PJ8B 1BDYA 5K1NA 1ZMYA 4IK7A 3X1GA 4I2XA 5DSCA 5C6TL 4YHNB 1KJ2B 1KNOA 4OD1H 5CJQL 5D4QA 1VGKA 1PL3A 4G3YL 3M1BB 3MNZA 1BZ9A 1LWRA 5I1HL 3KMDA 4A38A 4ELDA 2EKSA 1AJ7L 3BPCA 1NCOA 5GS0D 2AANA 3EFDH 4KY1L 1XR8A 1EMTH 4N20A 3G08A 3NSYA 2WO4A 4M3JA 3UTSE 1ORQB 2XQYK 1WBZA 2FGZA 2ZYSA 4GT0A 1XTMA 1KSRA 5FOBA 3TYFB 2UX6A 2N59A 3D4CA 1JPTH 1QSFD 3EO1B 4MLSA 3MJ8B 4N2CA 1D7BA 4EIBA 1YEFL 3SJVA 2FX9H 3CHSA 4QLWA 2ZCHH 4M1DH 1U2HA 2CALA 1YEIH 2AKRA 3ZSSA 5L2JA 1ZHLB 3O6FD 4YBLC 1MCKA 3U25A 4PRPA 3VD1A 3DECA 4JE0A 4G43A 2YPVH 4XPBH 2W59A 5CJOL 3BE1L 4AKPA 3BRFA 2PMZA 4PWKA 3VFGH 1XF2B 4PJGB 2AV1A 4NO2A 2X6CA 2YGNA 3K6FA 4JDZA 2FO1A 4TNWF 5F7LB 3O3EB 2OSYA 2R0ZH 2VQ1B 3CG8A 4IOIB 2WLLA 2Y1YA 3WFEL 3WEXA 4EN3A 5D1XB 4BH7B 1ROWA 1TJMA 3OB0H 4F58H 3OKDB 4XXDA 2ZQKA 1QFWI 2XTJB 2NYYC 2B39A 2ZAGA 4OD1L 1JVOA 1HILB 1QATA 2HKFH 4QOKD 2IXQA 2O5YL 4F3FA 1OW0A 5C3IA 5CGYC 3RWCA 1SXNA 3WE6A 1JGDB 4WJ5A 3R8BB 5I2IA 4NQUA 1T20A 3EFDL 5HY9B 1EMTL 2P49B 4EXKA 1KDJA 2F7RA 2HA1A 1DQJB 4JHVA 4HUXA 1BXXA 1HJCA 5EN2A 1JPTL 3L3KB 2K45A 4YL9A 1CK0H 4KKBD 3RWEB 5I6KA 4JFUA 3D0AA 4MDIB 5HJBA 3BYTA 4CBZA 3GO1H 1YJDC 2FX9L 3NZ8B 4JDVB 4WSJA 2ZCHL 4M1DL 4S1DD 5FDWB 1OGTA 2YRLA 5CR1A 1GYAA 1YEIL 3HEIB 1OB0A 2VITA 4UDTB 2FJHA 1UQSB 1XF1A 4XMUA 3CVHB 1DLFH 1NC2D 2YPVL 4XPBL 3OAZH 4HWBH 1A47A 3RL2B 5JA8B 4HPOL 3LRGA 3B7YA 3UEQA 3LRSA 4GQPH 4JB9L 4ACTA 3VFGL 3ESVF 4XAKD 43C9B 4JUSA 3ISYA 1JXJA 1T6BX 2HMID 1KCKA 2VW7A 3NFSH 4E9LA 1VKXB 2CO3A 2R0ZL 3LKOA 1T2QH 1MF2H 2OXHA 4GW1A 1UENA 2KZBA 5GRZA 2RAMA 2HFEB 5SX4H 3WS3A 1S9XA 1VEOA 2CXGA 4XTRC 4KI5F 4U1SA 2F58H 4OZFA 2I5YH 5KANG 5ECGA 3TC9A 5F1NB 3UADA 3B2XA 2HKFL 3B4NA 2R7EB 3A67H 3VYOA 2EEXA 4ZG1A 1A66A 1YA5A 3ULVD 1OARL 5I74B 3ECUA 3NH7H 3D7PA 4NRXA 4ZTEA 3CXHJ 3HG5A 2J8OA 5LAPA 2B08A 4IIQB 1EFXA 2EJ1A 1L7IL 1CK0L 1GYUA 2CDEA 3NUKA 4L1SA 4J3OD 3N06B 3IDXH 3RFZC 4FXGC 5KSVA 3B9KB 1XCTA 3GO1L 4A2LA 5EOCH 3U9UB 4ZXBD 3CN0A 2QLYA 1UVQA 4MX7B 4F33B 5D1ZD 4ANWA 4O02A 3I75B 1FCCA 1DLFL 5A7EA 5L6YH 3NJJA 1DN0A 4AH2B 2ODIA 3AY4A 2DKMA 3T0WA 4BSJA 5EBLB 4R83A 2P48B 4U1NA 1FL6B 1PZ3A 1BEXA 3QWOA 4LCCA 3IVKA 5L2KB 4YZFF 2CKBB 3UIYA 2AITA 4AJWA 3LKRA 3DIDA 3GRBA 3NFSL 4U1KB 1V3JA 2EXYC 1MF2L 4XMXA 3OKMA 4V1DD 2P5PA 3EGXA 5E4AA 1JRHI 3WN5A 5C0GA 3SDAC 3ZTJG 2AEWA 2JQMA 4RZCB 4GIPD 4GKNB 1JGUH 1M7IB 1CE6B 3A67L 3MAWA 4KK8D 2DF3A 4WKXA 5F3BA 3KPSB 4NXKA 4O51A 2A9NH 2BZCA 3BWAB 4A1RA 3NH7L 4X5WB 5EFIB 4W4NA 5IF0A 1SN5A 4F9PA 4OT1H 3IGKA 3KL0A 1A9BA 3QBTB 4LRIA 2BVOA 4KKZA 1BIIA 2V5SA 1L6ZA 2X38A 4HH9B 3IDXL 3PPEA 4HYTB 3VD5A 1ZLEA 2WCGA 4KOBA 5EOCL 3WY3A 1FG2B 2VWEC 2ARJA 3TBCA 5F7UA 5HJ3B 3BKMH 3JV6B 2ZTBA 3GIZH 5L6YL 3PWNA 4ZFOA 4ZK8A 5MEQB 4X7SH 3IGUA 1UD3A 4XNZC 3P73B 1IL1A 1EEQA 5BQ7A 4P2RA 1FIGH 4M6MH 4WW1B 4JFXB 3NP4A 2C1OB 3IK2A 5G4MA 2WIIB 4PJ7F 3REWA 4FJ6A 2DL9A 4UT9L 5B3NA 3QCVL 5E0QA 5DZOA 2VWEE 3Q05A 4JZOB 1AIFA 2UYLB 4FFWC 2GITB 2BP3A 4PB0H 3QQ4B 3UG4A 5J4MA 4QDGA 2ZPKL 3VMOA 1OCCB 3BX7C 4XXWC 2JJUA 1LE5A 1RUPL 1QBBA 1ZIAA 3MV7A 4FQJH 4AIXA 3WIHH 2HPOA 2BCMA 3STZB 2JMRA 4YGAB 3UPCA 3IM1A 4I0CC 3GMOA 5AKTA 2A9NL 1UASA 3G7TA 3WU1A 3BLBA 1OHQA 2R2HA 5LQBH 2V4LA 1T83A 2ENJA 2WAQA 4OT1L 2Q3ZA 2CJSA 1WF5A 1PZ5B 2WQUA 5JDJA 1I4FA 2Z92B 4ECNA 3GXMA 1OHZA 4RDBA 4Q8BA 3DETD 4GS7B 1T6VN 4BZ1A 4Z6AT 5DJ0B 2I7SA 2FIKB 4LU5L 4OJFH 4FFTA 1JZ3A 4G72B 1ZHKA 1O6SA 3P4OB 3BKML 2GSIA 4FERA 5ESQA 2R1XB 3GIZL 5DMJB 5C07E 1EO7A 2YARA 3BEVA 5DJDB 4X7SL 2PYEB 3HCVA 2HFFB 3DUHA 1MHCB 4JFDA 4QY8A 4TQPA 2XCMC 1FIGL 3DV6A 4M6ML 4AEFA 2D03L 4HWNA 5KYYA 2G2PA 5CIPA 3VXMB 3FKUS 4TTGA 1W9XA 3ZYOA 1WCBA 3S6CA 4G9FE 4YPJA 4YBQD 1H8NA 1XTLA 5C86A 4CL7A 2EUWA 3PGCB 1C08B 1ZE3C 1Q1PA 3HR5A 4XP9H 3W57A 4UMGA 5F89A 4PB0L 1QW9A 1LWJA 4N8UA 2IIJA 2AQNA 5IQ9A 1UD5A 1GGTA 1R3HA 1EXUA 1BFOB 5H2BB 1T7WA 4FQJL 1N7MH 2D8KA 5E94A 2JI2A 5SV4A 1Y6NR 3VWJB 5DTFA 2CBMA 5DD6A 3EH3B 3L54A 2WZAA 2W91A 2ESVB 4XRCA 4DP0X 4G7RB 1FC2D 5L0QC 1G4MA 1W0VB 1HQ4A 5JW5A 3G9AB 3ET9F 5LQBL 3T04D 2JCWA 4F7TA 5T1MB 4MVBD 2UY6B 3T0ED 3FB8A 1SDDB 3MNVA 3PL6C 4WTZA 1HEJC 3MLTA 5KYXB 1MSPA 5D9SA 2VDRH 3HC2A 1EZLA 1L3NA 3WDIA 4OJFL 3ZZSA 3QG6B 2Z35B 2OULB 4FI8A 2Q10A 3AGWA 1SFDA 4OM1H 1Q72L 3SCMA 1QSFB 1TG8A 3O3AB 3N04A 3N42F 2ROXA 4XN5A 1IAII 4NZFA 3ESOA 5SV3A 1OP5H 2VDKH 4AIEA 1IQWH 3NJLA 4N0CC 4X6DB 3O6FB 3N40F 4O4YL 1HN1A 3FSWA 3LKSB 5KUMA 2A3TA 4I48A 3TBWA 4GP5B 2NX5A 4XP9L 2BNQB 1X4ZA 1S46A 2EE6A 1YHPA 4G9DA 5D1XC 2QFRA 4RBPH 1SHSA 1WIOA 4IKLA 1U8QB 1FL3A 2FNWA 4Y7OC 1FFPB 4DK6A 1N7ML 3CFKA 1D6EB 5SX5H 1DE4B 4FCAA 3EF4A 1D5ZA 2GJZB 1B6DA 1RERA 1XGRA 3FU3A 4KV5E 2YD5A 1EAPA 1SJEB 1MOEA 2WZ5A 3L3IA 3B3IA 4P5KA 4TF4A 4Y2OA 1MW3A 3MOQA 3X1EA 4L3ED 2HWZH 5JXEA 3LNHA 2ZUWA 4GW5B 4GBXC 3CPUA 5FA3B 1OVZA 1NL0H 3WFBH 1VACB 1MCJA 2YOAA 3EF7A 4NO5B 5D1XE 5A40E 1FORH 4K8RD 2IDSA 1CICD 2DQGH 4MNHB 3MREA 4NZDA 2XTJE 1UOKA 4LSQH 4UT7H 2XNAA 5BJTB 2DB8A 3AXIA 1PJ9A 2IALA 3FTGB 1A1MB 3N9GH 3VE0A 2WMPA 2VLKD 2VXQA 2HSIA 3MBWB 4OM1L 5CLWA 4NN6B 2MIZA 5B8CA 3S9DB 2OTPA 1XSJA 3AUWB 3TOPA 1P1ZB 2F8XC 3QDGB 3QXTA 1JWUA 1IQWL 3X14A 5D71H 4GXUN 2DWYA 1UZ6F 2ITDA 1JYVA 4E9VA 2P7TB 4AK1A 5DZ9A 4XNBA 4DAGL 1D5MA 3BW9A 3RFRA 2QSCH 2E4TA 4LP8A 4YC2B 1FVCA 2K3TA 4LLYB 5BZWA 1XH3B 3JTSA 1F3JB 2Y22A 4QEGA 5JQ6L 4PRID 2BZDA 3UAAA 3RDTC 3VD3A 5DRZA 2PCPB 3UMTA 1MCNA 4TTDD 4DCQB 2P8PA 2UWEF 2ZXEB 3B2UD 5I74C 3CZFA 3RNQA 3GUTA 3W0WE 3QDMD 4ESKA 2AJYH 4QO1B 1HHJA 4R0LA 2HWZL 1ZIBA 3H9ZA 2R2EA 4IIQC 1Q90A 1KTDA 2QVMA 1NL0L 3WFBL 1FORL 2DQGL 4IHBA 4PJEA 4LSQL 2YD8A 1UADC 3B9KC 3Q9PA 5CLXA 1TZ8A 4UT7L 1I1FB 1BZ7B 3N9GL 2IF7A 3IDUA 1K9TA 2AJSL 3LPWA 5E4EC 4I77H 4K3GA 4R6UA 2HX8A 1WAAA 4PS4H 4BFFA 2NLJB 4KXZH 1MH5B 4RMTA 2I9TA 3LDBB 2N0MA 3NPSB 4BCZA 3ZE1B 3CXHK 3FTWA 3OKKB 4EDXA 1NGWA 2GSMB 4Q14A 2VJ8A 2EIMB 3D1MC 4IOSA 4JFWA 5I1AB 2QPUA 3AWGA 2L4OA 4UI2A 5ID0A 1GZPB 3L4XA 2JNZA 5D1ZB 2CR0A 3AABA 4OZFH 2AQPA 1FN4B 5EEWA 4UIKH 4YHOH 3QZNA 4KX7A 3D85D 3FFCD 2ZOKA 3STBA 4X4XB 4AKOA 4DZBB 3FQXA 3Q06A 1BWMA 1VFUA 2BY0A 3FRPB 2BHUA 2CMRH 4HJ1A 1TJHH 1ZA6A 5L2KE 5CP3A 1UXSB 1OK8A 1L0PA 2ZX6A 3FC8A 3PWJA 4FHJA 3QIWD 4XWOC 1B4RA 5GS1B 2XHNA 3KW7A 4DO6A 4P3DA 3HZYA 2AJYL 4KJPC 1NUGA 4XO8A 3AB0B 3SD5A 3WHE0 3DDGA 5DHDA 3PRZA 1BA9A 1H8OA 1UTDA 4AYSA 5GHWH 3DWTA 3FQRB 4WNQA 2G3ZA 4R4BB 1BM3L 4NNYB 5EUKB 4A66A 5AVYB 4UOZA 1DBAL 4F80A 4BA0A 3FT2B 2QPEB 4HIEA 5GS2D 5DQJB 3RURA 4BFOA 2HJFB 4U7KA 3E6FB 1UOWA 3OZ9H 3TEXA 4KDTC 1G7QA 3KPSE 3KG5A 3L5HA 2PTVA 3QNYB 5T3XE 4RRPG 4I77L 2HB0A 4PS4L 3T4AB 4ACPA 1KMGA 4KWUA 1UC6A 4KK9C 5GZND 1P6AB 3MRJA 4P2OA 4ATTA 3RIFF 3T3PB 5K1VA 5LGKA 5DHVA 5BZXA 2YS4A 2GK0B 1IMHC 2DLTA 4BV1A 1MLBA 3GMRB 1A1NA 1N26A 2PTTA 4K94C 1ODUA 2VABA 5E51A 3BXNB 4OZHF 5ENWA 3UL4A 2VLRB 1MI5A 1L0YA 2IG2L 4UIKL 5CBAB 1MJJB 4NGHH 4YHOL 1LEKA 4P5MA 1S4IA 1AR1D 3VGFA 4KI5D 4TQIA 4XNQA 1DBBL 2CMRL 2DWDB 4WVRA 1TJHL 1OTTC 3QHZL 3V6OC 2AXHA 2X89D 3AMKA 1H0DB 2IDFA 3UPRA 2KHAA 4HGWB 2NY6C 3ABMB 1Z9NA 1LMKA 4D9RE 2Z0UA 2XFXA 3ALWA 4GEJA 8CGTA 2P5WD 3EG9A 4UU9A 5ABDE 5GHWL 1Z6JT 2FHCA 1UB5B 3GB7A 2G4GA 3NCFB 1WZ1H 1N59A 4QYAA 3MLPA 4O02L 3VFWA 4IEFA 4QHUA 3ORJA 4TL5A 5C0AB 3ZYIA 5G2NA 3PV7A 2LU5A 3V6OE 5CFAA 1TYEB 3S3BB 4IYKA 3IAQA 1HYSD 1NAKH 2QVKA 3C9NB 4RAVA 5HHPB 3EKCA 4D0BB 2DICA 1L9NA 1QO3A 1T7YA 1JYNA 2ZWKA 1SLWA 2NNAA 1T21B 4YSOA 4ZUWB 5B1CA 5CSBA 2BLFA 3ARFB 1VCBC 1K4DA 3M6DA 2AP2A 2Y5EA 1U8IA 1P7HL 1BBJB 1HDMB 4FN0A 1RD6A 3G6JA 3RHWF 4YDLC 4HHWA 4LT7A 3GWJA 4HWUA 1JZDC 4N4YB 2QQQA 4AXWB 5I1IH 1W72A 1T22A 1ZT1B 4NGHL 1ZV5A 4B0MB 4TSBL 5G4OA 2PYEE 1RY7B 3KPMA 3Q6GH 2GTWB 4I9WE 2XWTB 2OQJA 3SYCA 3VXME 5JHDD 1UJ3B 1UXLA 3KL5A 4GSDH 3B8SA 3MUUA 1U8PA 5FA4A 5GXBB 3GBLA 4QGTA 2BWQA 1E90A 2J8UA 3D05A 1CFNB 3QUGA 3WTUA 4L29B 1HH6B 3P40A 5L8LB 4BZ1H 1U92B 2H5UA 4Z5RA 5CCJA 4N5ED 5C0FB 5IB4A 2C9XA 2EDMA 5D93B 1WZ1L 2E46A 3V8OA 1TZHA 4UWQB 3VXPB 5GS0C 3HA0A 1UT1A 4A67A 1AH1A 1BX2B 2XZQH 4ZFOL 3SYOA 3NGBB 3KGTA 2MSPA 4YHIA 4LLMB 4HFWA 4X7DC 1NAKL 5DJ6A 3T0EB 1C12B 4Y8DC 1GMEA 2ESVE 5EOQH 1AC0A 1CBVH 1Z1WA 2P45B 3FULA 5CIPH 3CJJA 4KDWA 2WANA 4YFLI 1QFPA 1T03H 3AGVA 3LTVA 2J2ZB 4DH2A 2O4EA 2E7LA 1ILSA 1O9ZA 2WO2B 5DYOA 2VN5A 2VKWA 1JI2A 1BFTA 4YVUA 1HOCB 25C8H 5DLLA 3O6FC 5JOPD 4ONOA 2OJEA 2A6KA 3DPBA 4L18A 4ONFL 2BSSB 3KPLA 4D9LH 1DUZB 2HAZA 3QQNA 4AE1A 2R0WH 4F15B 5I1IL 2IBZX 2G3NA 4FF9A 5IFAH 1QSFE 2NMSA 2JTYA 5HGDB 5DJ2B 3Q6GL 2VMFA 4GYBA 3K71B 1SPDA 1BFSA 4A55A 5IMOA 3R4DA 4FQHB 3UZVA 2CK0H 2MQ0A 2XIDA 4X6DE 3HNVH 3QW9A 5BRZA 4GSDL 3BJLA 1FHNA 4GH7B 1U8CA 5AAWC 4K15A 1MCFA 5EOCJ 2OW6A 2Y7NA 3L9BA 1QTPA 2KH2B 2YMOA 3BP7A 4AC2A 4BZ1L 4GRWF 4JL1A 4P06A 3EYFB 2X5PA 2YUWA 3D3VA 3FQTB 3Q8CA 1MN4A 2VDPH 4X6CA 5CSGA 2P5ED 2XZQL 4S0HA 2G2NA 4L3EB 4KNSA 3MGTB 4PSRA 1SOXA 2HKHL 1SVBA 2VSCA 2VMDA 2X3CA 5EOQL 3LKNA 1PG7X 1CBVL 5F9DC 1MCPH 5K39A 1CICB 4NN6C 4P4RA 3BDYH 1T03L 4EZJA 2XPGA 3OAYH 1M42A 1RLWA 3L4ZA 4S1DC 4WUUA 1A25A 3ESMA 1OE2A 25C8L 3VXTB 4UQDA 5ETUA 3NFPB 2VLKB 4E0RA 1RZKC 3JWOH 3R0MA 3VI3A 3X13A 3GMNB 4G6KH 4G5AA 2UUDK 2FL5A 2K70A 4F8NA 2HCZX 2JB5L 4XP4H 4D9LL 2HN7A 1JAEA 4ZX3A 2LU3A 4YC2C 2R0WL 3LN5B 3DI3B 2CGYA 2EO7A 3H0TB 5C6PB 1HQRB 3CN1A 2TRYA 3FB7B 2ZSVB 2CSPA 3BIAX 2HMIC 1Q9LB 1T89C 2WHVA 4PBWD 1USZA 3QDGE 4Y4KD 2ZOUA 4XMWA 2CK0L 4O2EB 5HYSB 4N9OB 4Z7UF 3TF4A 3HNVL 4NDMB 4D8PB 3WKMH 2YK1H 4KKPA 3C6LD 3V9FA 3QWQB 1JP5A 4PRIB 4APXB 1A9VA 5JIDA 3UTQB 4AQAB 4DT2A 3EBIA 3DO7A 3HG3A 4XAKE 1PX4A 3ULVC 3L2NA 5GZOA 5C6WH 2VDPL 2CD0A 2VXQH 4P5RA 3A6BH 2C9RA 3QDMB 3V9EA 3FOMA 2W80C 1JBJA 1HYRC 3UABA 1U0QA 3HI1B 3MRCB 3WY1A 5ANMB 1T1WB 4NCC1 1FZKB 3QR2A 4X8CA 2WXLA 4LCUA 3SD2A 1Y18B 2B16A 4RRPM 5J12B 2CO6A 2TRHA 4HK0A 1MCPL 3UAJA 3WV0A 1P84J 3PHOB 4J3OC 3LDBC 5IW3A 4AGOA 4ZXBC 1JTTA 3FO2B 4OJCA 4PJHE 4WRLA 4IW4C 4XHQA 3TWYA 3ULVE 1DVFA 4X9YA 5D1ZC 5AOZA 3FTSA 4FQQB 4G6KL 4FFZA 3RUGA 4RISH 1PDKB 4J7RA 2RQEA 1PLCA 4IKJA 3HFFA 4HKJA 1R6VA 1DSWA 1K3ZA 1DJZA 3C5JB 4OFPA 3FUJA 4XOEA 1M7XA 4DP9X 4KHXL 3QJTB 7CGTA 3CTTA 4X5XA 4XCCH 3LH8A 3V0IA 1E4XH 1J18A 2IAMD 3ZE1E 3VD7A 2F54A 3NK4A 4NQEA 5GS1C 3CZLA 2YJLA 4QXUH 3RGVA 3WKML 2YK1L 2VZ3A 5F0PB 4F8OA 3AB0C 2AK4A 1CFSB 2IBBA 3IDGA 3PDOA 4PLKD 1XB8A 4UQ2A 2ZUVA 3FFCB 1MZZA 3BSGA 2YD7A 5GGVH 2W07A 4AZUA 4KK8C 1NANH 1WA0X 4ABWA 4NM4H 3N2JA 3GBMH 2VIRA 4BRJA 4A2HA 2VLMD 2VXQL 2E9IA 4UNIA 5LAXB 3A6BL 1QBMH 4H13C 4D0DA 1JS4A 1MJUH 3VGHA 3U2IA 3SE6A 1EO8L 2Z3FA 4ELMA 4ICXA 3U1SH 3HG0A 3G6AA 4LQFL 2ZWNA 3JVFC 5CGMA 3T4AC 3MBEA 2YUVA 1IAKB 3U36B 5JHAA 2O61B 2PCFB 2GJ6D 1ZVYA 1UATA 2YSSA 1UOLA 2O5ZH 3MLUH 3MRNA 3HC0A 4YO0A 4F57H 3FUDA 4YSUA 4CVWA 3D09A 7TAAA 5AWNH 4RISL 1JJUA 1M6OB 4JO2H 1DHKA 4NP4H 3MDJA 1FZMB 2VN6A 1BSIA 4JO5A 5CP3H 4QHKI 1UYWL 4IS6B 3CFDB 5EIIB 1GAFH 4K4KA 5I8CB 3HPJB 2LHAA 4P2YA 4I3SH 3VFRA 1F02I 1JZ4A 2YAPA 3H6JA 5ID1A 1ZLVH 4Z0BH 5B3JF 2QHRH 1E4XL 4F5CE 1I8LA 1NMBH 4KMQA 1Z9SB 3M1CA 3FYEB 3I9PA 3V0GA 4LVOB 4QHMA 3DC0A 4W9HC 1TLMA 1ZD6A 4RGND 3SQOH 2R4RH 5K9OA 3RWIA 5CBEA 3ECQA 1I53A 1M4KA 1AR1B 2WXKA 5GGVL 3BYYA 3MSPA 1EH9A 4ABQA 3BFOA 1X9RA 2VQUA 2IWEA 1CTNA 2HT3D 3GBML 8PAZA 1RL1A 3B5TA 4QJ3B 2HG5B 1QBML 3D5OF 1IC1A 4GG8A 1MJUL 1S9VB 2OKMA 4JZJB 4PGBA 5F7NC 2P5WB 3QZMA 1FGVH 2NQCA 1A7PH 4L5FE 3BT2H 4JFED 5DHVH 2XBDA 3U1SL 5KTEH 4OD2B 3TLRA 2F5BH 2XVGA 1G0XA 4URTB 5KN5A 5FUZH 2BIHA 1FC1A 4MB1A 3TTYA 1XF4A 3DETC 1FNGA 3MLUL 2ICES 1DBJH 2O5ZL 1OQXA 4MWFA 3ARFC 4YDKH 5C0BB 3MJGX 4GUOA 1KC5H 3W11C 3CZEA 4ONGH 4MJ5A 4BKTC 5C0AE 2E56A 4QCIB 3WJMA 3DGDA 3LZOA 1L0XA 3D30A 4JO2L 4NP4L 4OGQC 3VB9A 2D2CC 1NUDA 4XVSH 3WMPA 2NRDA 3PGFH 5C0ND 4JY6A 1LL1A 2BCKB 2QSVA 1GAFL 2XU9A 5HGBB 3HLKA 4I3SL 1NJ9B 3LXBA 5C70A 4F8PA 2YXWA 2QHRL 4X4KA 3LH2H 1NMBL 4YBQC 5GJSL 5J1AA 4ZNEA 4HZ1A 1QD0A 4QRBA 3K72A 5CEYB 3OB0K 1JMXA 1A6PA 3SQOL 2R4RL 5FPIA 2ADJB 4QJ4B 4X8JB 1U58A 4RAHA 4ZSOE 4H5SA 4XCEB 1PU0A 3P2BA 1W0WB 1JFQH 2WUCL 1MUJA 3QO0B 5C9JB 3Q2CA 4XOBA 2BRQA 3BCDA 5D93C 2CU9A 5BOPA 1MHHB 2JKXA 4G1EA 4HWZA 4W9CC 1UOVA 3BH8B 3BP6B 4PCYA 4LEBA 4GW4B 4K3JH 1XB3A 3NGBC 4ZMVA 1FGVL 1QSEA 1OCOB 1A7PL 4MVBC 3T0EC 2MTAA 3S34H 3O9WA 4Q56A 35C8L 5KTEL 2F5BL 4GXVH 1G5AA 1PYWA 4HJGA 1CXIA 4L4TD 5D7IA 1WFIA 1TU2B 5E8PB 2XSKA 4BFIB 4JFTA 1BOGA 4Y2DD 5I71B 1TYJA 2DEXX 2FQGA 3I02B 4TVSa 2A77H 1DBJL 5J11B 1NC4D 3GKZA 1XX9C 2VXUH 4JEGB 4YDKL 2AQTA 3UMNA 1KC5L 1QASA 1W72H 2GEEA 4ONGL 3TCLA 5INCB 3OPUA 3OAZK 4LHUD 4Q52A 4W4OA 5FGSA 3UDWA 3M17B 4OIFA 4UYQA 4OF5A 1CJYA 4XVSL 2BY3A 3T0EE 4F15C 3PGFL 3QJFA 4EN2A 2HUEA 2FR4A 4YX2H 4MRCA 3F6LA 4XP6H 3CLEH 2LW3A 3SKJH 3SPVA 3LH2L 2DYPB 3DROA 1OE1A 4CA4A 4R96A 4N1CA 2EDTA 4LQ1A 4QRSA 5GGTA 2Q3AA 1HCYA 2RIKA 2YLHA 3DMMD 3ETTA 3FCTB 2WQVA 3MV8A 5C0IA 3C60A 5JIHA 2YGQA 1YQ2A 3QFJA 4NUJB 2XUWA 4TNFA 3QE5A 1Z3RA 2FD6H 1BXVA 5BUGA 2BNUB 1JHTA 4L1LA 3ARZA 2YXFA 4C56D 4MNQB 2P8MA 2CDGA 1LE9A 4ETYA 2DOCA 3BISA 1ZCRA 4K3JL 3L8QA 4RLDA 4QRQB 5KW9H 4CDHA 2VRAA 1NFDA 3PNWB 4PJFF 1HINH 3S34L 3RTQB 5LBSA 4GXVL 4K8RC 4RGMB 1CICC 2BS9A 3NCYP 1LGVA 5A43C 3MFFA 3Q3GA 5EO9B 1EEYB 5F6HI 3WY4A 3PABA 2A77L 2VUKA 2VM3A 2VXUL 3EYSL 1EVTC 4JQXA 3RRQA 3QJQB 3U1PA 1W72L 3VCLA 1DSYA 1Z5LB 4N6QA 1H3PL 3JWDH 4L3EE 5D7EA 2EVFA 4L0YA 1X7QA 4ZW5A 4DUWA 4HK3J 2KLSA 4ZAKD 4GFXA 5HHQB 4YX2L 4XP6L 3CLEL 3FHAA 1I8KB 1HIMH 3SKJL 3HN5A 4WKZA 2FJFB 1QLRA 4Y16B 5IHUH 5C0CA 4Y5XA 3MMEA 2EH7L 4KJYB 2EYTB 1N6VA 1VFBB 4LL4A 2C5DC 4HETA 3GMLB 2VLKE 5F7DA 2ITEA 4DP7X 3P9MA 2VE6B 4BFEA 4L4VB 1PY0A 2AVFA 1JXKA 1RJZA 1WBYA 2A9CA 2SEBB 4IK6A 1J05A 1K6QH 4PR5A 3FFOA 3R7QA 4DPCX 3WFHB 3AU1A 1SHXA 3GKWH 3O45B 2JJSA 4TTDC 2FD6L 4HOWA 4Q6IA 4N0UB 3C8DA 3TJHD 5IMLA 3V7MA