4HEPA

Complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
162
structure length
162
Chain Sequence
ASIKKVYRGMKNGAETINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BPP
publication title Viral infection modulation and neutralization by camelid nanobodies
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
total genus 27
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hepA02
3D8MA 2X53A 3DA0A 4HEMA 3HG0A 2WZPA 4IOSA 3EJCA 2BSEA 3U6XA 1ZRUA 2F0CA 2BSDA 4HEPA
chains in the Genus database with same CATH superfamily
2H8PB 1CDUA 2WUCL 1NGXA 4ONGL 2ESVE 4NUQA 1HSBB 2VR3A 1HCFX 4H7VA 4Z3FA 3GINA 1X4XA 4MXQD 4RNRA 1TJHH 1ZCRA 2DKSA 3BVVA 3UEZA 2N1KA 5GGQL 3MV7D 1M9WA 4YUEH 5ADPL 3KPOB 4M8QA 3VXPA 1SOXA 2FHCA 3D4CA 2ZUSA 2BP5M 4XXDA 3SE9L 1DBKH 3ZHDA 1WA0X 4N90E 1GSMA 1YMMD 2BVEA 3DOHA 4JX0A 3T2PA 3SDDA 2GTQA 2AABL 2W92A 1BQSA 2BSEA 4PLNC 2KZWA 5IOKA 1B0RB 2WVUA 5LJYH 1I9EA 1L0YA 4RMTA 2GC4C 2MPAL 5F44A 4NRZA 4GIPD 3IF1B 5K1VA 3L4XA 4FF9A 4QRTA 1GA2A 3BH9B 3S3BB 4L8SC 4XO8A 2O5ZH 4PJ9B 3ZT7A 4WW2B 3D6GA 4GKZA 2BOLA 3A6CH 1NLDL 3V79C 2HWZL 3ARED 5D55A 1I7UB 4K73A 4K3EL 4PMEA 2X2JA 3T3MF 3VXNB 3I02A 2P1YA 4GFTB 3TBYA 5HYSB 4LL9A 5DEFB 1IGCL 1IGFH 1E4WL 4JQIL 1R5IA 1RZJL 3D7PA 3ZVVA 1INEL 5TF0A 3V6ZB 5F7WC 4HUUA 5GZOD 4JKWA 4MNGA 4I87A 4D9RE 3II1A 5KVDL 4QHKJ 1I8LC 1NM9A 2P5WB 3CH1B 1NJ9B 2XN9B 3K74B 3D69A 3V5DA 1VERA 3HR5B 3MJWA 2X89D 5EU7E 2HTLC 2GK0B 3GMQA 4WV1B 4YAQB 1BMGA 2RGSA 3EO9L 4OZHE 4UOJA 4ZOBA 1HEZB 3FQXB 4YMPA 1DBBH 2BPBA 2LABA 2NYZA 3GKZA 4WNQA 5D7JB 3FBQA 1NH6A 1BJ8A 4P46D 2Y6SD 5BV7B 1Y6KR 4ZW7A 4PW9A 2BINA 4KKPA 5HDBB 3BO8B 4BQ6A 1QFUL 5F97E 5F9WB 4LESA 1WBZA 4ZXBB 5CJQH 5A2JH 4HWBL 5HVGB 2FL5B 3CSFA 1K8DB 4KVCH 2P52A 1KGXA 4OJDH 4PJIE 1P84K 1BZEA 4QOKB 2FX8H 4XP1L 2VTFA 2WB7A 1IT9L 1BYOA 1JGDA 2PCXA 3D30A 4WJKB 5CJOL 1EZSA 4PJHE 4Q52A 4X7TA 4MAUL 1MHCB 3VWJC 3QFJA 3T2NL 1ZSDA 4K8RL 1ZWIA 4ZX4A 4HUXB 4LHUG 2VR5A 4U1JA 2J1XA 2VLRB 2GCYB 4IRJB 1L9MA 3KDMA 4PREB 1YEIH 3D3VA 4XXCC 3R4RA 3SBQA 2YGQA 1L7IL 2WHVA 4PWKA 1JXFA 1TJXA 1S7UB 3IKKA 3RU8H 3SSGA 4F37K 5GS0H 4JKNA 1NCCH 2VDNB 1IQDA 3H2PA 5E8EA 1BZ7B 1HH6B 4LSPL 2P47B 4WKXA 1WA2X 2GBTA 3MLWL 3JWDL 3FOLA 2Y22A 3C8DA 4L1LA 4AGMA 3LN9A 4JPSA 2WVVB 5KSBB 5GS1A 3IE4A 3AITA 2PKDA 1CDJA 1B0IA 1FHNA 4W9IC 5E94A 4Q6KA 4AUJA 3QAZC 2HLFD 4FL4B 1G1OA 4IEFA 2YJQA 4KJWD 2Y2TA 2ZKHL 3KXFD 3TBSA 3JYCA 5CJBA 3RGVA 4D9RD 2R0KL 1N64H 2UY7B 2XC8A 3WSQH 3VXUB 1TKWB 2JKJA 3FO2B 3L95A 3QBTB 4PV1C 3H55A 4HPOH 1A3RH 4GAYB 1X6LA 3DK2A 4XMKH 4E41B 3LZQA 5CD5C 2E6QA 5IK3A 1Z5HA 2X88A 1D6EA 3CFDB 5CINL 5ESQB 4HT1L 3FFCB 1V3LA 4ZT1A 1FYTA 5JMRA 2NW2A 3GGWB 4UM9A 4HFUH 1NC2B 4WO4D 2WIMA 5IJKA 2PF6A 4OZGA 3K6IA 4DZ8B 3U2IA 5IREA 2UWEA 1IM9B 3O3DB 2LQRA 4AUYA 4OQTA 5C0DB 1X7QB 1K4DA 3CPUA 3ARBB 3GXTA 3O9WC 4NQXA 4U31A 5CP3H 3EXLA 2W91A 2IAMB 3SE3A 3PWJA 4XT1C 3OAYK 4XB7A 3SYOA 1OZUA 4IGBA 3BXNB 2JKLA 3REWA 5T1KB 4DOHE 1MCOL 1GGIL 2P45B 2Z0BA 4WHCA 4Y5YC 2ZG1A 3T71A 4IRSB 3ZO9A 3S8WA 4R4BB 2ZKXA 3MOAL 3KZ8A 3W11C 1HNYA 3VFNB 1RZ8A 1YPZB 3F58L 5I1KL 4A37A 4UMGA 4KROD 1WZMA 1NZRA 4X4ZA 4LVEA 2DMGA 1D7CA 3FB8A 1I7TB 5D8JL 3UC0L 1UJ3C 2Y0SA 1V8HA 3BZFB 2G3ZA 5INDB 1I8MA 4LKCA 4X6BA 1W0VA 1N5YL 3Q8CA 5HI5C 2DWXA 3BI9X 4ZTOL 1E7VA 2FX7H 2J8OA 3IFPB 5IR1B 1YN6B 4XN9A 4KZEL 2Z31B 2OTWA 1A6AB 1XH3A 2PTUA 5FYJL 5D9SB 1ERNA 4X99A 4EUPA 4HWZB 2ZWZA 1OCWL 5C0AA 2CJSA 5HJ3A 3REVB 3SE6A 3RE0A 3G5YA 1BFVL 3OXSB 1SDDB 3HG5A 2YLHA 3DGCR 3I74A 1VFMA 4GKNA 3IT8D 5F1OB 3MV9B 2Q8BL 2G9HA 1BPLB 3GFUA 4FHKA 4PWGA 3IAQA 4AI7A 3GS0A 2NR6C 3LKOB 4CVZA 2ZWLT 3KE0A 5GPRA 5BS0A 3IKCA 5JW4M 3EBGA 2JJTC 3D9AH 1AZUA 4MKTA 4ZD3L 1TQBC 3GXFA 4L2LA 4EBQH 4PJXA 3RBGA 4HK0A 4C56D 1TO4A 4Y4HB 4U1HA 1IMHC 3ZRCC 3CDYA 4M7ZC 4BFIA 5FR3A 5DD1H 3GSRA 1H8OA 4YHLH 5DRXB 4A7QA 5FM5O 3JV6A 4L48A 4WWNA 1CFTB 5JIHA 1FZKB 1HKLH 3NIDF 2XN9E 4RMWA 3Q5TA 2CIIB 1YDPA 2HT4D 3QZPA 1QO3B 3DYPA 2XZAH 3SJVE 4L5FH 2Q2EB 2Z4QA 3FCTA 2OSYA 3IDJA 4YDVB 4DEUA 1E4KC 5KJ4A 2EYSA 4LAQL 3OJMB 5ERWB 3MRBB 3RY6A 4TL5A 5IQ7L 2OCFD 3QXTA 2PW2A 4WNSA 3HCVB 5HDBE 4KKCD 1TXKA 2Q0ZX 4LLWB 1MFEL 3T09A 4OLXL 2JQZA 1NMAL 3IDMA 1NUFA 3L1EA 2VDQL 4IW4C 2KDGA 3IEAA 1DEEA 3BH4A 4JZJB 3QHFH 4QRAA 4QOKE 5HVWA 1TZOA 3ALPA 3WIFA 3RVUC 2ZPKH 3P02A 2WGXA 1JZFA 4LEOB 4UYQA 1IBDA 2J2ZB 1BG9A 2CCLA 5DD0H 3F7KA 1BBDL 2BNUA 3D48R 1OE1A 3JTBA 1XGUA 5E9DD 5GGUB 2DI7A 5L8KB 1RK1A 1IB5A 3SGDH 2QELA 2P26A 4OBRA 2VLRE 2BRRH 2FBOJ 5FYLE 2E47A 4G3YH 1HQRB 4UANA 4OQTL 3PWNB 5K59E 4FC3E 2QADB 3TCTA 4PEEA 1N0XH 1EGJL 4XP6L 1AHWB 5LBVA 5FGRA 1CCZA 1EQWA 1G0XA 4JJ5B 5DZNA 5GRVK 1RLWA 4KPHH 3P77B 5F88A 3BE1H 4JO1L 3J8F7 3W0WB 5I18H 4Y2LA 1U36A 1ZIBA 2DIAA 2JF1A 5BZXA 3ALWA 3UYPA 2CO6A 2W9DH 4A1RA 5KSBE 5IB5A 3A21A 2VW6A 4W6WB 2CUIA 3C6SA 2BWQA 2XYCA 4YDIL 5IIEB 5KTEH 2R0ZH 3QXUA 4TQHA 3LPWA 2A9AA 2H0JA 4ALAL 2I25N 3AVEA 3N1GC 1XGYL 4F37F 2FHFA 3VGHA 4LL4A 2ZF9A 4J8RA 1HU8A 2P5WD 3ULUF 1NC4A 1R34A 2XN9D 4ZQTA 5AW1B 5C0RH 3VXUE 4LOFA 3PUUA 1TJGH 4J4PC 4MJIB 5JLZB 4HJ0C 4NQEA 2A5UA 5C86A 4E41E 5DS8A 2ZWNA 3V52H 4AT6A 1YZZA 4TNWF 3SO5A 4G9DB 2B14A 4ZAKD 1CS6A 4G8FA 5DGQA 4FA6A 5DSCB 2VDMB 1U58A 1W0YT 1CLYH 3L4WA 3Q9PA 5I1LA 1I7RB 1R0AL 1UADC 3CBKB 5IHZB 3MTXA 3FUIA 4YXHH 5HSFA 3RUGF 3IRPX 2MOVA 3AB0B 1XCTA 2NDFA 3BYTA 4EI0A 3M17B 4LRIC 3L9RB 3PL6A 4P23C 2J1KA 3RNQB 3N9GH 4ODXA 5HHVH 5E7BA 1L6XA 2QEJA 3WEXB 4D3CL 1H8LA 5F9JA 1A7PL 3EAKA 3BUTA 4FRWA 4GRWF 1S7RA 3GNMH 5JPNB 1TZAA 3SPVA 1BECA 5E2VH 2ZUUA 2E74C 4IRJD 2JKRM 3RA7H 2X4NB 4TTDC 1YPZE 2E3VA 3WFZA 3AS2A 4J8QA 4M5YL 3ABGA 3CTTA 1BD2D 4KDTA 5ILTH 4NSKB 5FLUA 3WL9A 1BREA 5DT1L 1GR7A 3PCYA 1F6LL 1KCRH 2E76C 2DBLH 4Y9EA 5I66A 1CURA 3C75A 2AEPL 2JELL 4FA8A 3VWKC 3EZJB 4P5KA 3AS3A 4HUWB 5L6YH 3FRUB 5HGDA 2K8MA 3TEXA 4L1DA 1EDQA 1YEHH 3KGSA 5DGRA 3T6ZA 2DLTA 4ODSH 5DLMH 1RHHB 1RZGA 3L7EA 2CLZA 4XN2A 2RQ8A 3IU4L 5IW1B 4PJHA 3V0AC 5E6ZA 1AQKL 32C2B 3MBEB 1NEZB 3MV9E 1JZ6A 1TEYA 4I48A 5M7QA 2AEIT 4OAWB 4XNMA 5TDNB 2W9LA 2EIZA 2P3YA 4E41D 4JFZH 4MJ5A 3FPXA 3FTVA 5IBUG 2F5BH 3FFCD 1J0HA 1HL5A 4LMQE 2QFRA 4U6XA 5F0LB 1NEUA 1S78C 4H4NA 3OPZH 5EO0B 1K5WA 1O75A 3T08A 1KC5H 1IM9D 3B9VA 4JFPA 4LEEA 4ONGH 5HGBB 3ZQXA 5IB1B 1XBDA 4YFEA 1AP2B 3ARBD 1IKNA 1T89A 1OSPL 2QLVB 3QWNA 1CYWA 4AQ8A 3NJFA 4K3JL 3UP6A 3OLEA 5PAZA 3QJXA 5DVLA 4Z76A 4OFQA 2YD1A 4G8GB 2WCGA 1A7RH 3L3JB 3D4GA 5ETUB 3IK2A 1RULL 4QRSA 4I2XB 4X5WB 5SWQA 4R83A 1PEWA 3FT4B 4MA7L 5H35A 1P5VA 1BJ1J 4WLCA 4G1EB 3K71A 3KNBB 1MIMH 3WJMA 5AW4B 1XCQA 1EAOA 4PY8J 4OD2A 4DK3A 1M2VB 5J6HB 1F4XL 1H6FA 3EYOB 1P4BH 2IOOA 5C0NC 1DUZA 3AUWB 2ZUTA 4Q9RL 1I3GH 2EICA 2FJFA 1T2JA 4R0LB 2AZAA 5T1MB 4KKAC 2YA2A 1MW1A 2HWZH 5TPWL 3UL4A 2EXTA 2Z31D 1WZAA 3UXFA 1XBRA 2AP2A 3HG3A 2GT9B 1MAKA 2B1AL 3L16A 4ODVL 4JKPL 1XZ0B 3CFJB 5DMIL 4JKKA 3RVVD 2J44A 4AW7A 1IGCH 4JQIH 4A67A 1JF1A 1RZJH 3BKYH 5IG7B 3HN5A 1J1XH 1WV7T 2DJSA 4KVPA 4NQDA 1FSKC 1CL7H 2ZAIA 4Z77B 1JVLA 2M1KA 2WQXA 1V3JA 3W0WE 4KQ4H 2XJKA 3MN8A 4WFED 1XMEB 2B5IC 1I1AA 3L1OH 3U6XS 3ETBJ 5L2JB 1EUTA 2HG5A 2QDWA 4HS3B 8PAZA 4XWOC 5KW9L 3AZUA 5AYTA 2IANA 3FFOA 1QFWH 1EHAA 3KYNB 4AL8L 1EFXB 4GRMB 1MFNA 4QLRA 1XSKA 1MH5A 1BF8A 1U4EA 3BZEA 4PJBF 1DFXA 1ROWA 3H6AA 3N1QC 4HWBH 43CAB 2R2EA 5TFSL 3OHXC 3OB8A 1LO2L 1MFAL 1XWVA 1ZMYA 5DQJB 5ESAA 1VACA 4MKMA 5DC9B 4MJIE 3FO0H 1GS8A 1IT9H 5CJOH 5F6IC 3S3SA 3VM5A 1YMHA 1VIWA 3PGDB 5I6LA 1RJLA 1OGSA 4J1UA 1TFPA 3PUCA 1JI2A 2WTRA 4ONFL 3TLRA 4MMZC 1YAZA 4UAHA 1EPFA 1JV2A 3L9YA 1UHVA 3ZSTA 1QVOB 4F7KA 5GS1C 3FHAA 3NJMA 2E5EA 3F84A 3EJCA 1IBFA 3MRRB 5CXPA 3VXQB 2GSGA 3NCXA 3KBPA 3ARXA 3AADB 4KFZC 1L7IH 2UY6B 3BX7C 4GINA 5IB4A 1KF9B 1X5FA 4GMSL 1XR8B 1YC7A 4ZJ9A 1NBVL 4I77H 1OF0A 4XMTA 3HKZA 4LSPH 4N8VB 1SJXA 3HNVH 3MLWH 4BRJA 2A6KB 3L9BA 3QXWA 3Q0HA 1FRGH 5EULV 3Q8EA 4UU9A 1UOWA 4X8JA 1ZLVH 3V95A 4DUWA 2WD0A 2ZSVA 3LRKA 1XGRB 1GJIA 1SJHA 3WKQA 1EHXA 5I1GL 4X9FA 4NXKA 2XVLA 2ZKHH 2AV1B 4RAVA 1LXMA 4XMPL 5IJKC 4HH8A 3LNGA 2JIXB 2PO6B 2EDJA 2AFNA 3H85A 3MO1A 4LF3B 1N6UA 2N3JA 4U2ZA 2UX6A 3V4VB 3ZE0B 1QHOA 1MJ8L 5I1IL 4HT1H 3L5XL 2BY3A 2EUXA 2ZE0A 4URKA 4IGBC 4MD0A 4OTXL 4RBPK 1VGEH 3PYCA 5MP6L 3LZRA 1X5AA 4WFGE 5KSAB 4M7JL 3GK8H 2BNQA 1FNGB 1Z5YD 5ACMA 3FL7A 4F7CA 1TSRA 5I0YA 2FDBP 1EDYA 1T1WA 1KY6A 4OGAC 1RCYA 4OZFA 4CN1A 3VMNA 4RGNB 2D3JA 2KZBA 2QQKL 3LS4L 4LSVH 3TCLA 1BEXA 4CMHC 4XP5H 2JI1A 5I16A 4KK6D 4ALAC 1FFRA 4AZUA 2F7RA 4B9YA 3GMPB 2FEDC 4U7MA 3ZE1F 1MCOH 1UD4A 2OMTA 1B6UA 1GGIH 1TTBA 1LO3H 4MRCA 4PJ7A 2BZ7A 3IFOB 3ZIMA 2MHAB 3WKML 4Z6AT 2G4EA 3MOAH 4F1ZA 5FOBB 3RPIA 3U6RA 3EFFA 1DUYA 3FCSB 3G6JF 2P48B 3GI8H 3UGXA 3IVKB 3T0EA 2J25A 5IESL 4NO5B 5SWSA 2YQBA 4PRDA 1MY7A 5D8JH 3US1A 4X98A 1LK2B 3SGDI 4ELMA 1SBSH 2AQ3A 3KPSB 1PGRB 1DQTA 5FA3A 4HPYH 3QIWD 3SKNB 1KBPA 1VFUA 4YDZA 4G8GE 5KVGH 4KZEH 4EI5B 5D7KD 1CJYA 1MUJA 1XR9B 2EUWA 1DLHB 1OCWH 4I2XE 3R0NA 4JDEB 4WNJA 5K9OB 1NLBL 2VZOA 3C2AH 4PPTA 5AEAA 2Y7QA 3DO7B 3GKWH 3NTCL 1BFVH 1QFWM 1TZIA 5H37A 4LU5L 1C5CH 4M00A 4ZDHA 3K4ZA 4WGWB 2Q8BH 1TMQA 1QWHA 3E2HB 3E80A 3FF7A 3IMSA 4WK2B 4Z7QF 3LKPB 3GO1L 4TSBL 2XICA 3FUNA 1ZGLP 5T1DH 2L7UA 2WO2B 1T0MA 3ASNB 5C0FA 4YZFF 4C4UA 4Z7WF 5IB2B 1WLHA 2VC2L 4G5ZL 2BMKA 5BUAA 3VTTA 5EPMA 1ZK9A 1FL5B 3BSZH 3C5JA 4UQDA 3UTSA 1OSZB 4F7PA 5CM1A 1A6VL 2N01B 4OM1H 1SDYA 5IHBA 3VFMB 3RY6C 3MJGX 5FB8A 1OK0A 3BFWA 3MBED 3QJHB 1S7TA 4K71B 5JIIA 4AYBA 1QLRB 3MODL 4EDWL 5I19H 5KYUB 1NMCC 4QRQB 4ENZA 5J89A 4CVXB 4MASA 1PD1A 2CO2A 2DD8L 1NFDB 3ZZ1A 2H32A 4N1HB 4YSPA 3DX6B 2ZCKL 4LAQH 4I18A 2IDTA 1S5HB 3KEHA 3ECQA 4JFEA 1OM9A 1NDGB 3MLSL 4NZTH 1FO0A 4NWUL 1RIVL 5K5YA 2VRAA 1GW6A 1BQHA 2VN3A 1G7HA 1JXJA 2AAVA 15C8H 3WUWA 1AYRA 3QDGA 2VDQH 5D2NB 1N10A 4BZ1H 5E7FA 3W39A 1BZ9B 3JUZA 3FB5A 4JNXA 4AJ0A 4Y1SA 4PR5B 1NFIA 1QAWA 3HG4A 1QR1B 3H7BB 5H94A 3HS0B 3O6ML 3T1FB 2EKSA 1MW2A 3B9KD 4CN4A 2SEBB 2ICWB 3MA7B 1DYZA 3SQBA 4CU7A 1MCWM 4OVUA 4KMTH 1J11A 3Q05A 4HF5H 1CFMA 2F7OA 3L13A 4W6YB 3SDAB 2OL3A 4AZ8A 4F33A 2V5SA 1FGVL 4FQQB 4GKSB 4WWID 1B3IA 3CHPA 5L2KD 1G0YR 4FMVA 1M7UA 3VXSA 3U2SB 1I1YA 1R3IL 1W0WB 1XB3A 4XP6H 4JDZB 5JOFB 4GSUA 1ODAA 3EOTH 3WJJA 4E5XA 2YC1B 5HJBA 1Q90A 4MAYB 3P0VH 1AG0A 4G80A 4ZSOA 3LTVA 5CCGE 2R39A 4JO1H 4Z7AA 1KTLB 1DQIA 2GVYA 1V05A 4WTQA 1A6TA 3CXHJ 5LUMA 4KRPC 4GSQA 4OIIL 1FAKT 3G5VA 5C0EB 1FA4A 2JKSA 3CHXA 3GB7A 2CKBA 2DYPA 2BHYA 5B3JE 2WMPB 1HHGB 1S2EA 3GJEA 4R7LA 1PD6A 3I6LE 5KVEH 5IMMB 4OFPA 4ALAH 2E7DA 1WFUA 3TIDB 1U8MA 1ITCA 1XV8A 2WC7A 4UIMB 2APXA 3NYKA 1YSOA 4I0PD 2PYEB 4FZ8L 1MQKH 3QEQE 3L3GA 4IJTA 2OBGA 2WZ6A 3SDYL 3POCA 4X7EC 1HC1A 3BH8A 3SE4A 1X7SA 1HESA 3DHMA 3OR6B 4HKXB 4HH9A 4HV8B 3PL6C 3K2UL 1T3FB 2VXSL 3NZUA 3FUFA 1EFXD 2FJGA 3NPZB 4X6CB 2W88A 4AQAB 1RZIB 1IM3A 3WTTA 3DX7A 1FE8H 4OI9A 4BA8A 4Z7NF 2EDNA 2EAEA 3TZVB 1R0AH 2Y9RT 4E0RA 4FFWC 4GOSA 3RZCB 1JD7A 1WTLA 4XPAL 3NIGF 4JG0H 5DHMC 2XXFA 4HDIA 2VXTL 4LO9A 1W15A 4RGNE 1HHIA 4AL8C 2XZQL 1JWMB 1YNLL 4WKZB 2AXJA 3IJ7A 4HU8A 3HOGA 2X28A 4HETA 3PG2A 7FABH 4KDTC 1VESA 2DMCA 3VI4F 4D3CH 3V7AG 1A7PH 3KWWA 1PYWB 1YEDA 3NABH 3NIFE 4Y7OC 5JIDA 2BRQA 5DJ8B 5A2KH 1MCHA 3NJXA 3HTLX 5GS2H 5ITBL 5DUBA 3C5ZC 3V5KA 2BDNH 4L3EB 4QYAA 1FCCA 1SLVA 3MQIA 3QCVH 4M5YH 5CIPB 1HI6B 3V6OE 3U0PA 1ZAGA 5LNDA 3DX0A 3A4EA 2YN5A 5CZVH 3NCFB 2D4FA 5HDOA 4DGYL 2HJLA 4X8CA 3VRIA 4BXVA 2B2XL 5I74B 2F18A 3BAJA 2ICEA 3KPSE 4LRNL 1U8CB 2AEPH 4ZOCA 2BP8B 3QJFA 4R2GC 1ZLSH 4Y2DA 1JPGB 2XRAH 2OR9L 1D5MB 1UM5L 1CL7I 1U42A 1I4FB 3LZFL 1FNEB 1P6FA 3CFIC 5FK9B 1E3XA 3EYVB 1F1DA 4NKOB 4B27A 2HJKB 4Y9CA 2ZXGA 1MRCH 5EO1A 2XV0A 4M4RA 3E3QC 1AQKH 1ZS8A 1ULVA 2JIXD 2PO6D 3L81A 2IBZX 3UBGA 1S8DA 1ORQA 1QFWI 1OLZA 3RAJL 4JREC 5BQ7A 4AIEA 2FT7A 2WBWB 4ZFZB 3FRPA 2V7NA 4P5TA 3P69A 5EUKA 4G7VL 4RMSA 2WW8A 4QHLA 5CKAA 2O5XL 1T89C 2D2CC 1Q72H 1CF8L 2IVFC 4L4TB 5EEWA 4GH7B 4XVSL 3QWOA 4H1LB 4HIEB 1DEDA 2VABB 3F7LA 3QPXH 2QZQA 3LRSA 2OL3L 4HUCA 1ORSA 4KTDL 5KSAD 3SDXA 6PAZA 4H13C 3WEMA 3HS8A 3NK4A 4X5XA 3VMPA 4NDMB 1XCWA 1GGCL 1Q1PA 1F86A 4EDXB 3NFPB 3BKML 1JGUL 3VB8A 4ZNEE 2AW2A 4ISVA 3U2JA 4RGND 1WD9A 2OJ1A 3PABA 4XPHL 4WGVB 4LSSH 4E36A 1DVYA 5I8EA 2WM0A 4Y16C 3SD2A 3VGBA 4I5BA 3HAEH 3HW7A 1B9ZA 1AKJB 4K3JH 3MRKB 3GBML 2CRMA 4XTRC 1IQWH 1NA8A 4HLZH 2QVFB 3P3RA 4NPYA 4PV8A 5JIKA 1NFDE 2KZ1B 3ZBMA 4BSVA 1BWMA 2V8LA 4RZCB 2DWEB 3BD3A 5AB0A 3PWPB 4G82A 4J6RH 1J9QA 3WN5B 3LD8C 5JPMB 1OCOB 5IKCB 1BWWA 2HZHA 4Q9CA 4JK0D 2QQLL 3HR6A 1MFVA 3QQ9D 1T7ZA 4Q9RH 5D2NE 3KPSD 1A9EB 4MMYB 5IMOB 2EDTA 2X4QA 5D93B 2ZOOA 5DFAA 1OGAD 3WFCL 5I1JH 5FV2A 1CXEA 5TPWH 4G8AC 3OLGA 1KIPB 4EI5D 4MSWB 1JZ4A 5DS1A 1E8XA 2Q7YA 5JW5A 2XG4A 4AJWA 4AGQA 4IJ3C 1I1AC 4F2MA 4CL7A 1UGKA 2AK1L 1KXVC 4LHJB 2VDLB 4YXKH 3HFML 1TYRA 1ZT1A 4MGXA 1H9DA 3CBJB 2F15A 1JZHA 2I85A 2UZYA 5AW7B 4TQ8A 2DWDB 4HJGB 4L9DA 4K94L 2NQ3A 2VZ1A 1YECH 3RNKB 1IO4C 3F05A 4H8HA 5F89A 5CCKL 1QQDA 4K5LA 1WAPA 1ZLEA 1DBML 1F13A 5IHWA 4XNQA 5A16B 1UZ8B 3DSNA 1U3HA 3GXPA 2BOCB 2X0UA 1MHHA 4UTAA 5EU6B 4Q6IA 4TUOA 5EZJA 5AYQA 4AL8H 1IKOP 4AGLA 4W9CC 2H0FA 4MQ7B 4N26A 5I17A 3MGTB 3ULVL 1SNRA 4EDXA 1JFHA 3L6FA 1RMFH 4NQCB 3VD2A 2R9HC 3OQ3B 5D4JA 4AOFA 5GSRB 3RVXD 2O93L 5TFSH 3NJKA 2O61B 2PYEE 1AD0A 3OWEA 5FIEA 1JYNA 1ETB1 4KH9A 1RSFA 4U6TA 1XXFC 2NSQA 2X70B 4KQ0A 4QYOB 1KYOJ 2H6PB 5DO8A 3RVWD 4HGMA 7PCYA 4FFTA 2PCFB 4ETYA 2Y5TA 1MCQA 1KTRL 3O3EB 3TIEB 3MFGB 2GFBA 5F3FA 4LEXH 4ONFH 1LO4H 1XSOA 3WNMA 3A5VA 4ZFGH 4X6CE 2VM3A 4U7SA 4F1SA 2DMKA 4MQXC 4WI2A 1IGMH 4JR9H 3ZKND 1ET7A 4QRPB 1OAYL 2AEQL 3GSVA 1PTZA 4P4RB 2Q3AA 4TPRH 1L3NA 4UQ3A 5F6HJ 5BVJA 1YJDC 1H6EA 3QQ3A 4LKXA 4YE0A 4ANUA 1NBVH 1QR4A 2XIIA 3UBXB 2BIQA 3T2LA 3U4KA 5KSUA 1I9JL 3ARWA 4LL1A 1BYPA 3FU6A 3PGCA 3PREA 5FUOL 3ZIYA 3CLEH 1UUSA 5CZKA 3S35L 1C5BL 4M29A 3TN0A 3NBNA 1FCGA 2QPFA 4JLRA 1ZSHA 4XP9L 2RQEA 1OAJA 3PE9A 1D7FA 5C7ZA 3GSWA 5T8IA 3SDAD 4K5NA 4R9HA 5DRZB 2YD2A 4Z7VA 4OD1L 4FXKB 4L3EE 3QUXA 4LSUH 3UBFA 3OLDA 4L4JA 3C60B 2XCMC 2AQNA 3F85A 3FTSA 4X4YA 2X4TA 1JCKA 3UMNA 3S5ZA 3KAAA 3QI9A 2NCEA 4MAYD 4B95C 3MRJA 4OLZL 2GBAA 5HYJB 1ET5A 1QPKA 3BJ91 3F62A 4QJ5B 5B21A 1XGQA 5I1IH 4QTHA 1MHEB 4JB9L 4FQ1L 4CW1B 2IADB 3L5XH 1CXKA 4LNRA 4WW1A 4MLSA 3OMIB 2C1PB 2A7BA 4M7LH 4WRLA 3PIQA 4N5EC 4OTXH 4GW1A 3CN4A 1ND0A 1YA5A 1NUNB 1GZQB 3WAJA 3O8XB 1U93A 3L4VA 4NNXB 3RWFB 1ZLVK 1CYGA 3DV4B 4AX3A 5J12C 3OKMB 4QGTA 2WANA 4BQBA 2YZ1A 4IMKA 3MV8B 1M53A 5JTWA 5IGXL 2M26A 2QQKH 2AJ3A 2WQWA 4FMFA 1AC6A 5E4AA 1K3IA 5LXVA 4NN6C 4EUPG 1O7DE 1JV5B 3OKEA 3T0EC 2AITA 1X5JA 1OM3L 1F6AA 5AL0A 3CUPB 4Z0XA 4IOSA 1A47A 5CN3A 4AENA 4L4TE 2YOCA 1J9TA 4K2UL 1RXLA 4KX8A 3X12B 3HE6D 4UQBA 1I8KB 3TZVD 3LS5L 3ZE2F 2BHFA 3GZQA 3RZCD 3T3MB 1LEGA 2JMRA 4XAWL 3QEUA 4UIKH 1JZ8A 1KEGH 1UGNA 2YSTA 3S5LB 1PCXA 4GUPA 2IH8A 3HFFA 1IKFH 4UNUA 5I6NA 4ZPTB 2WLLA 3S96A 3MJ6A 4ODUA 1KBWA 2NTFA 2YGVA 5C9JB 4GXVL 3BZDA 3S5YA 3SKMB 4BKTC 4N0FB 4TVPL 2BIMA 1XQ4A 1AFVL 4GXUN 5FHAL 5ICYB 1JI1A 5LXGL 1LLAA 1CFNA 3ATBA 3EFOB 5D1ZA 2AQTA 2B0SL 4HSCX 4JY5L 4JRWA 4NQQA 3UPRA 1UWXH 2XVKA 3PWPE 2XN0A 3V9FA 3DRTB 4PLKC 3V5HB 1BV8A 2EXYC 3NTCH 4ZO6A 3VI3E 1MEXL 1AANA 5BO1L 3SCMA 2CBPA 3U0TB 3BEWB 1XTLA 3SKJL 2FCBA 1O6SB 3P4MB 2HXAA 5FFLA 4JZOA 1BMZA 3GSXA 3ESVF 5KYXB 1NWOA 1RZ7H 5TE4L 4FQJL 4X2UA 1R5VA 4YBQC 1BJMA 1W16A 3V0GA 3S35X 2C9SA 3L5JA 2VC2H 2DOCA 4G5ZH 4H8PA 5E2WL 1NOFA 1Q0YH 2OMVA 3HN3A 3MJ7A 3LNFA 4KAQL 3RTQB 4YIQB 5F9OH 4AEIH 4Z18A 2X38A 1A6VH 3LNDA 1A65A 1KJ2H 3L3KB 5C2UB 4OJEH 2EIDA 4BXSV 1E30A 4JPKH 4LCIL 1X7TA 4WU7B 4Y2NA 2QR0A 3MODH 5I0VA 1QTSA 4EDWH 3L08A 1E5ZA 1JK9A 3VH8A 4FQ2L 5DR5L 2NW3A 4XAKE 4IIQA 2XNAA 1DSYA 1AO7A 2Z93A 2PCPB 3RWIA 3CXDL 1P69B 4DQAA 2ZJSH 4N6RB 1CDHA 2ZCKH 2FYYA 4R97C 2KS0A 5MI0B 4F8OA 4FCHA 5EU6E 5JHDA 1VENA 5EFIA 1YJDH 5AVQB 2NZ1A 3BSGA 3H42H 3OJ2C 3Q3GA 4O2FA 5AOIA 2ZAHA 4NQVB 5DA4A 2VN5A 3DTUB 4NWUH 3NJGA 2WVSA 3D06A 3JV4B 4NQCE 1LO0L 4HIIB 5DHVA 2H1PL 4HMCA 4GO6B 4KNTA 1OPGH 3LYRA 4TOYH 3W9DA 5DFVD 5GJTL 2XZCH 1KJVA 4DHLA 3ZHFA 2BWIA 1CG9B 1C7SA 2IALB 1O7SA 2OA9A 4TLKA 4G59C 2HFGL 1HILA 3ZW3A 1CGSL 1F3DH 1QUNA 3OJDA 4F58H 1JYXA 5D4HA 2VE6A 5JDJA 1VPOL 5C6WH 3MACL 2K45A 3X17A 2AXFA 2PR4H 2ZCLH 2HAZA 3L3HA 3PWPD 1TU2A 3TTYA 2ZUVA 4N0CD 3MLTB 2YS4A 3FSZA 4X6EB 3HC3L 1DBAH 4MMXB 3IXAB 2AKRB 1FGVH 3CZGA 2WLMA 3BUYA 4OZFH 5JZ7D 5DI8B 8FABB 5I1DA 5JHLL 3ATEA 5DDHB 4QRPE 4WI8A 3WG7B 1WIUA 2H3KA 5TGBB 4PTUA 3GS4A 1OP3H 2Q86B 2HMIC 2PWFA 1LQBC 3VD7A 3SDCB 2OTUB 3H0TB 3OMNB 4P07A 4FQHA 3B5HA 2VITA 4HZAA 2Y07H 3BZ4A 3SE4C 1TTUA 3L3OA 3DX8A 4NGHH 2DV6A 3X1BA 4DVBA 5BJTA 1V7NL 4I9WD 3ILEA 1GGUA 1QBLL 3B2XA 4X5PA 1XEDA 3L4UA 4R96B 2C9PA 2Z1PA 4QXVA 4W9LC 3X3GH 4ICWA 3FUKA 5T3ZE 4FZ8H 4Y5XA 3QH3A 3U79A 3ZSSA 4Q74A 4PWJA 5HYJE 5I0XA 3NA9L 1PCSA 3LQAL 2WZPD 3K6SA 1F2XK 4N2BA 4F27A 3P0YH 1IGJA 4M48H 5A40E 2R1YB 3G5WA 1B6DA 3K2UH 4OUOA 5ANMB 4DKFL 2VXSH 3UAJD 5D7HA 4XOBA 3SPCA 3T6WA 5K9JL 4PIRF 2ZSWB 4ZMZA 1K72A 4HFWA 4QHUA 3ZZSA 4XC3L 4GG6A 5E9AA 1LD9A 5I5IA 3LRHA 3TOPA 3VFPA 1Y0LB 1E9QB 4XPAH 3VO0A 1K4CA 4B5EA 3MV8E 1NAKH 3QISA 4N2DA 4UTBA 5I2IA 2PP8A 1MIEL 3D39B 2XZQH 2L7EA 1AZRA 1U92B 3FMGL 4NPJA 2X2IA 3ULVC 4HIPA 1PZAA 1ZVHA 2XA8H 3BPOC 3PDOA 4G7RB 1WHPA 2H26B 5EORL 3X1EA 3DSFL 2XXGA 4FHJA 2ICEC 2F58L 1ZA6A 3MXVL 5EIIG 4DF9A 5DJCA 4G7YL 1DO5A 2HTKC 5ITBH 3B56A 3ZTJH 3B2MA 3L2MA 3QNXB 3JTTB 1QATA 4M93B 3SGEH 4DAGL 4QRPD 3T3ME 1DLFL 1A6WL 4MDJB 1MCFA 2WNKA 5F96H 1T1XA 3VX0A 3ULSB 2B2XH 2CRZA 3DMMA 4Z23A 3FU8A 3V9CA 2FTAA 2NY6C 5IUSA 1FZMA 2OW7A 2GUOA 1JUFA 3OKNA 2F1EA 2H32H 2R2BA 1KCKA 4YGVB 1KTJA 2OR9H 3NIDB 4GFXA 1UM5H 4P5TC 1Q94B 4G6ML 4PJ6A 2F08A 2OI9C 3LZFH 1XIWA 1S6NA 2B20A 1FO0H 5IFJA 3QIUC 3K72A 2Y7OA 3FT3A 1OAZL 5DFWH 2WN2A 5HD8C 5FV1L 3M1BB 3C60D 4QI3A 1UWEL 4FHBD 3FCBA 5T3ZD 2GEEA 5D96B 4HX1A 3DBSA 3HE7B 5HYJD 2Q20A 3H4HA 5LGHL 1KULA 5ESVB 5IW6A 2WVTA 4XR8C 5EU5B 4XBMA 4CAGA 1I8IB 1JWSB 3NFNB 5ALCL 2OYLA 3FT1A 1YUHB 2O5XH 4XMLL 4FMKA 4HEPG 1YY8B 1CF8H 2Z7ZA 3NZHL 4HKJB 4OZ4A 5LAPA 5IEKB 1XF4A 4PWEA 3WIAA 2AI0L 2WXIA 4LBEB 2OL3H 1QA9B 2YA1A 1ICTA 3A6BH 4KJQD 4N2GA 4BDVB 4I4WB 5DC0A 2W80C 2G30A 4QRRD 2NNCA 2NXZC 1JGUH 3MV8D 4XH2B 2OQJA 4FTVE 5C0BB 1COBA 2DQHL 4MB5A 2OSWA 2RALA 4YPGB 4R7DB 4O51A 5DMGC 3KGRA 3FQRA 1HYRC 1OXYA 3GBMH 1P7QA 1J8KA 2PWEA 1FVCB 4O2EA 5CP7B 3D87B 4AYFB 2K3HA 4UNIA 2CKBH 1J1PH 1T7YA 4ZUVA 2FK9A 4UNTA 3MRCB 3IDIA 4TULL 2P24A 4GMTH 1C12B 5FC9A 5KSVA 3GBEA 3MLYL 4HGWB 2CGRL 6TAAA 4Z3EA 4IKNA 2QQLH 4PRHA 3F6JA 4AGOA 1WHOA 3FUDA 5JW4R 3VDBA 1R3LB 4RFOL 1A1OB 2OSXA 1G7IB 4QNPF 1KGUA 1HCYA 4JHAL 1YMMA 1TT6A 3CK0H 1JDDA 4P04A 1AVAA 5I30H 2WIIA 3PWVA 1F0LA 1C1EH 2DIJA 1AQDA 2B39A 2R2HA 2W8CA 2VJ8A 2A73B 2YEZA 3WEOA 2Q76B 2TRYA 3G08A 3KLSA 3OMAB 4NJAH 4CC4A 3L7FA 2EYTA 3C12A 4MD4A 4YX2L 2MJWA 3II2A 1QLEH 2UXFA 2ARJA 3FT0A 4KUZL 3Q5YA 1O0VA 1T4KB 5I9QC 3HFMH 2X87A 1BM7A 4UTBL 1A4CA 2GTZB 1FZOB 3UDWA 4PG9B 4Q6IC 1DVSA 4HSAC 1AXSB 4V33A 5F7UA 3LB6D 1EAJA 2AEWA 1KTKE 2BERA 5DEGA 3TONA 1J8HA 2D9QB 4WSJA 3TEUA 4DVRH 4XPTH 3BAEL 5CCKH 1E8YA 5EBMB 3RUGB 1MJJA 2VWEC 2C1OA 1XF2A 3JTSB 3QO1A 3DK0A 4XBGB 1E9OB 4R4NC 1QABA 4YWGH 4EO5A 1LP9A 2RD0A 4WAFA 3S88L 2GI0A 5DJAB 1EBAA 5GZOA 1BVZA 3I3BA 1TQVA 2P80D 4OKVA 3D05A 3ULVH 1WAAA 3GDCA 2X89A 3E9TA 1KIQB 4GIAA 4GRWB 2AQSA 1TJIL 3VNYA 1O6VA 4NT6B 2EXWC 1BMWA 5TTRA 4MCYA 5J5EA 2F8XC 2XG5A 4EZKA 4AWJC 5FHBL 3HRZB 1LM8V 2B08A 3BN3B 5HVHB 4DGWC 4B96A 3RFZB 1QLFA 4IHOB 2WSDA 3C9NA 3VI3A 3O3BB 5DUJA 4JGUA 4UCFA 1OKEA 3EJYC 5ANME 1TZGL 5AZEL 2LU4A 4B9CA 2KLTA 4OZGF 4TTDD 2ZNWA 3TN0C 1J8SA 1DCLA 3B6SA 3EJSA 2UWEF 3TH4T 3DUHA 1MRFL 1OCRB 3UJJL 4Z3IA 1OAYH 2AEQH 4GRLB 2DQUL 4H26B 4L8DB 5CILH 1R6VA 4M6NL 3KLKA 3D39E 3QG6A 1PS3A 4DZBA 1JZDC 2J4WL 4PRIE 3LH8A 5FUOH 5JW4Q 3QI9C 1LE9A 1FH5L 1JHKL 1HXMB 3TNNA 3GBDA 4GAFB 2IPUK 4LCCA 4JZNB 4F7EA 4OZFG 1WT5A 2CKNA 4X8GA 1HHJA 1CICB 2DRUA 3O2WL 3IJSB 1V5JA 4HS8L 5AOKA 4MZ3A 2X6VA 2HRPL 3N50A 4ETQA 3JVFC 2P42B 3FFDA 1IC5L 1FV1A 5ES4B 2E9WA 3LKRA 3OG4B 4U1LA 1AGCA 4OLZH 3BFOA 1NCBL 2I9LB 4KK9C 2HFFB 2F0CA 4HCRA 4IMKC 5BZDA 2WXGA 3ZMNA 2F74A 2G5RA 3QUKB 2B59B 1NGPL 5D7LA 5C0JB 1FL6B 1R3JA 2ARWA 4F9LA 4WF7A 3C6LB 3WTSA 3KXFA 2APWA 3NIDE 5J3HD 3BKJL 4WZ9A 2AC0A 1DE4A 2MKWA 2KZKA 1QNZL 3KLLA 1PW3A 2Y1YA 3MRPB 1PLBA 1F56A 1I31A 3GM0A 2VMCA 4NIYE 4Q9QL 5T3XL 1TYEB 2WINB 3D08A 3L4ZA 4H8UA 4EKXA 4LASL 1OE2A 4YOKA 5J1AB 4XPGL 1OTSD 2W81C 3V8OA 2YN3A 2ITCB 4KKBD 4FFYA 2BC4B 4Q14A 5I6OA 3KBHE 3KLAA 3H9SD 1ZTXL 3ZL2A 5TQ0L 3ZGIA 3VSTA 1CTMA 1OM3H 4N4YB 4ZO9A 4BV1A 1EANA 1BFOB 3O4LB 1E6OH 1KOAA 5JORB 3HZ3A 3LKQB 2JLPA 2EDRA 4K2UH 1IEBA 5H37G 3E7JA 2WNGA 3WXWL 4PJ8C 4PJXF 5EEYA 1F4HA 5BUGA 4POYA 1MPAH 3RB7A 3T3PF 1JZ3A 3S4SA 3HN8A 5EU4B 2E9JA 4XAWH 4K3GA 2OSLB 3ES6B 5C0ND 1UD6A 1SEQH 4NXSA 5C0BE 3D39D 4FQXB 4WWKB 1RU9H 2J8UA 4N9OB 1ZV5A 2FB4L 1N0LA 4JO4L 4MCZA 4R6UA 2IDFA 3E6HB 4CADA 2EDXA 3IJHB 5K39B 5HYIA 5FF6A 1AH1A 3HHSA 4GXVH 4OCMC 1G7JB 3NCBB 4TVPH 1E90A 5LAXB 5FHAH 4KHTL 1M05B 3V4PA 1HT6A 4QWWC 3MZTA 4YHKL 4JY5H 4UTAH 3WY2A 3K0YA 4K5OA 4H44C 4HYTB 1JGVL 4KK8D 2WQ8A 5K69A 2JB5L 3BN9C 5EZOL 5E08L 3MCYA 4UDTA 4G72B 5DQ9A 3F12B 2DEWX 4OLYL 1FDLL 4NO2B 4X9HA 3I9AA 1RPKA 1MEXH 1MREH 1A4JB 2NY4D 1A7OL 3BKCH 3LEYL 4ZK8A 1R75A 5JIMA 2NY5C 5E0QA 3BDYH 3AM8A 4U6YA 4KJYB 4MX7B 5TE4H 1ANUA 4LHUB 1ZHBA 4APQC 3UTTD 4BFFA 3GIVA 3FTWA 4X83A 3ULUE 3AC0A 3TO4B 2QZ5A 4BCZA 3IGAB 3DO3A 3WTVA 1A1MA 3WNPA 4IIQC 1VGKA 3MJ8B 4PTTB 1IGTA 3FO1A 4KAQH 1GRWA 5DC4B 3WUWG 1WZ1L 1ZGLA 3P30L 4WTWA 4PRAB 4U1IB 1NQBA 5IROD 4U3SA 2YPVH 2RACA 1Z9SA 3OR7B 3KYOB 3K91A 1QKZL 3HE7D 2AJZA 2DLFL 2R15A 3H3BC 3L2LA 3QR1A 1PSKL 1UZ6F 4YSRA 5DR5H 3B1UA 5DZPA 2VSKB 3ARDD 2BP0A 4UINH 1NOAA 2EJ1A 2VH5L 1RJYA 4RFEA 4UM8A 3RUGE 5F7LB 3WKPA 4C56A 4H20H 4A04A 5CZXD 4JFHE 4GQPH 2MMXA 1X5LA 3BPLC 4ATTA 3IDGA 5DQDL 1D9KA 4RIRA 3UCQA 1DDHA 4HLJA 4YO0A 3RWGB 5I73C 3KWVA 3QUZC 4ES8A 1MCDA 4DQOH 3MU3A 4BINA 1Q4NX 43C9B 4OI8A 2C9VA 5C0BD 3R7RA 4AK1A 1LO0H 2JJUA 2OYMA 4GRWE 4PHXA 3NQIA 4LSDA 3WKNA 4HCRL 3ILPB 2F54B 1P2CA 2HPTA 2KQMA 4ZYKA 2BOBA 3BIKA 1CFQB 4JAMA 3SGEI 1B9KA 1QBBA 2NY1C 3SY0A 2QBWA 2HFGH 2XY1A 1CGSH 4RSYA 3ISYA 3R4DA 1S7XB 1VPOH 3J27A 3MACH 2HH0L 3MRLA 1JXKA 3I3DA 1X4ZA 2K8QA 4PFEA 3HC3H 4A2DA 3EF4A 3BDBA 4FNSA 4HZLB 1OGPA 3IDYC 3ZLQC 4U49A 4H2AA 2K6WA 4O4YH 3DXAD 5CEYA 4UBDC 5IB3A 1XFPA 3G9AB 4WHDA 1R4XA 1DQDH 5DRNA 3F64A 2C3GA 2JE8A 1DVFA 4Y4KD 1H0DB 5C3TA 4YHPA 3M7OA 3HJ0A 4Y5XC 5E9DA 3WNJA 3DROA 3ULUD 3QA3A 3EYQC 4NQUA 1RZKL 3MZGB 4FTVA 1MFCL 3FN3A 3KDPB 4S1DC 2HG0A 1E3ZA 1NDTA 4JY4B 4ZS6C 3AG3B 4F2EA 5A2CA 1ZDSA 5EF3A 1NANH 5F1IB 3SBRA 5AYUH 3OWRA 1GGTA 3ABKB 5C0IB 4RFNB 4H25B 1AE6H 3ZE1B 3EKCA 3QORD 3AY4A 2DJ4A 3VXMB 4TRPH 5AVTB 5AD0B 1AHKA 5J9PA 4P2OA 3SZ6A 1OT2A 1A0QH 3QCUL 4U0RC 3QJTB 1I7UA 4JN1H 3CSYA 3TV3L 4XI5C 2C7UB 3UAEA 3QUYC 2G9KA 1L4IA 2V6HA 3G6JB 1CDIA 2FEDD 1PAZA 3C08H 2IV9A 2IV8A 3EOBB 1BVKB 3S34L 3V4PL 4ONHA 3MUGB 3PWLB 3VMOA 4ORGB 3QSKB 4RGOL 4FNTA 2IWFA 4DKFH 4S1RL 2YD7A 1N18A 3NDYE 2L7QA 3GMMA 3OX8A 1F4YH 5CGYD 2P5WA 4TNEA 5DVMA 4BGDA 3GRGA 3QQNA 4QCIB 4Y1AB 1NCAH 1B4JL 2FATL 2QVIA 2XBDA 4O02L 4PJHF 2GK0A 2ICWJ 4FFZL 2ZOLA 1HXYB 2XQBH 4EIUA 3DTXB 2V9UA 2GJPA 4XBPA 1K6QL 4MJJA 1MIEH 4BEIA 4PRBA 3IM1A 5CEZD 3ARFB 3FMGH 3QXDA 3LKSB 4ZAKA 1ML0A 4LLQB 1KMGA 1WBYA 2G75A 4Y5VA 3O4LE 5EORH 3DMMC 5J11B 2VMJA 5DJYB 5F1KC 4BRVA 1SUJA 2F58H 4MD5A 4Z7QB 3MXVH 5CAYB 4G7YH 3ROLA 3IDNA 2FL5A 2HVKB 3OV6A 4KI5C 4AIXA 5DJ2B 4Z7WB 3FRPG 1JNNL 4DAGH 1N12A 3K2IA 2UZPA 2PUQT 1UWGH 1A6WH 1XIWC 3BD5A 3O6FA 5BQDA 3RGBA 4QXUL 2R0WL 2FZ3B 3D2UD 1TNMA 5F9AC 1FPTL 1OTTD 2H41A 1MCBA 4FULA 3JV5A 3NEEA 4HUXA 4C4KT 1BOYA 3QUMA 5LWYH 4YHYB 4XMZA 4IRJA 4FYQA 1GIGL 2ZCHL 4TQEL 2NNRA 1CQYA 2E56A 3CC5B 5LDUA 2MQCA 3B34A 3BAXA 5EDSA 3SGKC 3TJHC 1QSVA 1JHTA 3NSCA 1BD2A 1CICD 1MCEA 3SOBH 4UILH 1P7HL 1OAZH 4QMEA 1MFDL 3DOIA 5DHVH 1QSFB 2V9RA 3FT2B 3LAFA 1SF3A 1W91A 3L3DB 1RLBA 1DQJB 1MCIA 5DURB 4LARL 4U1MA 4HWEL 2IPKB 4M4PA 4PJBE 4H88L 1OW0C 3L1FA 4ZRGA 2MOQA 2Q8AL 3C6LD 1HVXA 1D5ZA 2AI0H 2FR4A 1JGEA 4NZRH 1XF5B 3V0FA 2UY7A 1A7NL 5FUZL 3U9UB 1MXGA 1Q0EA 1PZCA 4C83A 2VR8A 2AJYL 2DQEH 4FKKA 2YD5A 1F58L 1MI5B 3APFA 3QNZA 1NBYB 1SEBA 4JO3H 4MXQC 2VR9A 1WJ3A 5ESQA 3U9PL 1U8NB 4M02A 2FX9L 5DEJA 2B1HL 2QVTA 1SRDA 1MCSA 1RUKL 2RR3A 4G6AD 3HC0A 2VZVA 4W6XB 2X4UB 1NBZB 1CT8B 3CGTA 3QFDA 2Q6WA 3NCWA 3QG7L 2V2WA 4OGZA 2V9QA 1USZA 5KBLA 1U2CA 3B4NA 4KZDL 1T2XA 4PCKA 3C09B 4AYEC 3CMGA 1ZV2A 3EH2A 1XB6A 2GY7B 3MLYH 2CGRH 3MNVB 4CC4C 4DKDC 3FU7A 4FZEH 4NO0A 3UTZB 1PKQE 3X2QB 3LN4B 3VXTA 4I3SL 4LSRL 4RFOH 5FO7A 3PAZA 2AK4B 2Y2YA 4WWKD 3WO4C 3Q1EA 1TNNA 3RJQB 4JHAH 3BFQG 5GGVH 3TP4A 3I75A 4P5MB 4Y9BA 2Y5QA 4RISL 2F54E 5JQHC 3LEVL 3AREC 3QC6X 1FL3B 1YYLL 2ITDB 2XXCB 1PEZA 4WIQA 1G9NC 4QF1A 4A7GA 1JWUB 2D7MA 4YX2H 1QX1A 2EDWA 2LLNA 4WEBL 5HYQB 2A83A 2VISA 2P8PA 5BO0D 4PGEB 3BP6B 4PGDA 1L3WA 5I76A 4LDLB 1HE7A 3AQYA 4GS7C 4MLIA 1TFHA 4XO9A 4UTBH 1OVZA 1JGIA 1KN4H 2CUMA 3FDWA 5GZOC 4YFDB 4Q4IA 4OLVL 4X6FA 2NNAB 5AKSA 1XF3A 4Z7NB 2LFEA 4G42A 4ZOAA 1WE5A 1Y6MR 2QHRL 3EYFB 3HI6L 3O3AA 3H2WA 3JWOL 2JI2A 3N1FC 2ZUYA 3X1GA 4PBXA 1XMWA 4FQLL 2VR4A 2LT9A 3TO4D 3DVNA 2VN4A 4MRBA 4O2CA 4V1DB 5LLIC 1CLVA 3B8SA 3T6XA 4P46C 2Y6SC 1HH9B 3OF6A 4NCC2 2FYVA 1OTUC 1BLIA 2D7PA 3GXUB 3HG0A 3KYKH 4JMNA 4RCAA 1KZYA 3VI4B 1O6TA 3ZE1E 2VXVL 3VXME 3BHBB 1CO1A 3AACA 1OSYA 4WWPA 3BPCB 2NLJA 3MROB 5C0CA 1ZA3A 3CFUA 1U8IA 2ILLA 1MDTA 1DJXA 3JQOB 3G6JE 3QUML 3QDMB 4N0UA 1A3LL 2OULB 2YD4A 2EVFA 2N1TE 3SE8L 2ZUQC 3JWNE 2OZ4A 1UH3A 3GHEL 1SOKA 4P4KD 1LL1A 4QXTB 1CPUA 3ESUF 5C07A 4IOIB 5EZLA 1TZGH 4YSDA 4KY1H 4P2QB 4YBLC 2P46B 2IEPA 2E4FA 4PU2A 4Y1AE 3PP3K 1MRFH 1TVDA 1WT5C 5LNGA 4GP4B 2ZYSA 3SKOA 4NCC1 1Z3GL 5IBUB 2F54D 2R29A 4F80A 1UXSB 3LKNA 1G5AA 3MRBA 1MCPH 2VLKD 3BISA 1HSAA 3QAQA 1P4LB 1ITBB 1ILUA 4KNQA 3CZFA 2R0LH 4L0ZA 1TUPA 2BNRD 2JKXA 1JHKH 3APNA 3HI1A 5F9DC 1LE5B 3IMWA 3K4DA 3MBWB 2CAKA 3F01A 2VLJB 4PJ7F 5BCAA 3X14A 4Z7QE 3MDJA 5DD3H 4GI8A 1DZ0A 3O4OC 2HLFC 4HS8H 3MOBH 2XETA 3PV7A 4F9LC 2OFQA 3O6KL 4KJWC 2HRPH 2LAAA 3A3YB 4YZFE 4Z7WE 5IOPA 4LPUA 5E8NA 1A25A 3V4UL 5EEVA 4UQCA 1VKXA 1IC5H 3CU1A 5C08A 1D5BA 2GAZA 1RURL 4ELMF 1PZDA 3ZTCC 3AWFA 4LLVA 5DK0B 2EYRB 3TASA 4N2MA 1SZNA 3BMVA 1S7VA 1CD1A 1J0IA 1SYVA 4GUQA 1NGPH 1E28B 2Y2WA 3IN0A 2IBZY 3GLZA 3MA9H 1UATA 2KMWA 4RLDA 1TEGA 3ZT6A 4WO4C 2QMKA 3P11H 5MEPB 2FGZA 4L2YA 4FABL 2CLRB 1B4RA 2IQAA 3VXMD 4NP9A 2OX5A 1RP8A 4G9FE 3WLBB 1AD9B 1QSFE 1ZANH 3O2DA 1L9RA 2F2HA 1E4XL 2WSKA 1A4KB 4XPGH 4WU5B 4BFEA 1NDMA 1X5MA 3C5SA 3TBTA 3CVDA 1HX0A 3L2NA 5IHHA 1ZTXH 1NGZA 5TQ0H 1LO5A 2BIOA 1OGTB 4WHYH 3GC3A 1BOGB 4YDJB 5I1CH 1EEQA 5D5MA 2WLJA 4Q8BA 4V2CB 5SV4A 2EEDA 5FYKL 3L5WB 3BPNC 4NUGL 4WUUD 3VE0B 3THML 4A2MA 4JFYA 1VLXA 4KKRA 3QIBD 3EYSL 2H1LM 1IU1A 4N2OA 3ABZA 1LMIA 5GZND 1JN6B 3DIFB 1QRNA 4KROC 5EHFA 5KUMA 3WFHA 1F45A 2N7AA 1MI5E 1TVHB 1G9NH 3QFGA 5JOPE 2XWBA 3EH3B 3MRHA 2FB4H 3SKUD 2XWZA 4DP4X 5C1MB 1ZHKA 5DJZB 5DSCA 4YZWA 5AZ2H 4TXVB 5K9QG 1S9WB 1ZIAA 4TLSA 1RUAL 4NHCH 4KHTH 5IJBC 3GXDA 4DP7X 1C8PA 1I7RA 4YHKH 5H2BA 5LKNA 2XWTB 2G3XA 1J87A 5KVFH 1B0GA 3AAZB 4KRMB 4Z3JA 2Z8VC 3X11B 4BUHA 3VH8G 3P4OB 4ZFFB 4QY8A 3ARGB 1E5UI 3FB7B 4ENED 2JJVA 3LEYH 1KENL 3WU1A 4S2SB 1NANI 3QIWA 2ROYA 1W72A 1NPJA 5HHOB 5GIRA 4QHMA 1FC2D 2WB1A 4KI1A 3ILQD 4ACPA 1E42A 1ZY9A 2XBTA 1KPVA 5JPNA 4U1KA 2OZ4L 4LP8A 5FDWB 2OJZL 3RY4A 4PB0L 4Q4EA 4LZKA 5BPPA 5M95B 4NNYA 5E1AB 5C92A 4G7QB 3FN0H 2BIHA 1WWBX 3CJJA 2X4OB 5EBWB 4W1TA 1CVRA 4DTGH 5D1ZI 1F11B 2DL9A 4DP8X 3PP4H 2X05A 1RKRA 3BW9B 5DJXB 1DSFH 3WV0A 5I6PA 1EJFA 1I85C 1QKZH 3K2MC 3LHPH 4ZUSA 1FLRL 2FH8A 2VERA 3HBGA 2VW7A 4Z7NE 3GWJA 1H5BA 5IVNA 1KIRA 2HT4C 1TENA 5IVZB 4EOWL 5CLYA 5AOLA 2VH5H 3EO1A 3NIGE 3IXTA 1WCBA 3VCLB 1RHHA 2WJ7A 3MBXL 4S10A 4V1DE 1J10A 3FT9A 1C7TA 4XN8A 5DQDH 5IW1A 5KAQF 3MBEA 2FLBT 3BP5B 2NT0A 4KKCC 2OLDA 2O30A 3VI4E 1MI5D 1HINH 4JM4L 3WELA 5JOPD 4NKMB 3VXRB 5K9QI 3O9WB 2P8MB 3IRCA 1G7PB 1A9BB 1N67A 1Q9OB 3MXWH 4A66A 2FJUB 4G11A 2HLAA 4OB5H 3FF8A 4IYKA 3HMWL 4C54A 3QDME 2C4XA 2GK2A 5ITFB 4JFDB 4ZS7L 4PY8I 5TDOB 1MVYA 2WOBA 3EJRA 3U4BH 4DO5A 2RB8A 3UABA 4UAOB 1DQQB 2NMSA 1GJWA 4I3RL 4M1DL 1EEYB 4P2QE 3C8KB 4PJBA 1L5GB 3O2DL 1CZ8L 4NRYA 1E40A 2AK4D 1YVLA 2JJWA 4ADIA 4JCMA 4EIBA 5FGSA 1WFTA 1RK0B 4X4XB 4FFYH 3EBAA 4OF5A 3VFVB 2QSVA 1UJ3B 2Z34A 4WW2C 3B9KA 4QTIL 4NO3B 5HY9A 5JUEH 2OMYB 4PLOB 5CHNB 4B9GA 1A14L 2VAAA 4WJ5B 3B2VL 3FONA 1EHLH 1CE1H 4OFYD 3W2DL 1IFHL 3VG9C 5L2KA 2Z0UA 5KJ7E 2VLJE 1G0DA 3Q13A 3FPYA 4I3GA 1KLUA 3K6NA 2AQ2A 4JCWA 3AS1A 1WF5A 3D18A 3SQOH 3FYEB 4G6KL 3PXHA 3GJFA 4KUCD 1JPTL 3ULVF 5EOCJ 2RMNA 3STZB 3TV3H 2I69A 1JP5A 1U8HB 1HQ4A 4MNQE 2CDFA 3ZE2B 4FFVD 4N2FA 4E9XA 3SPHA 3WNNA 3TJEL 4HEME 1LEIA 2VN6A 4WI5A 4RGOH 1FFNA 3BP4A 5CD3A 4ZAKC 2ADYA 2ATKA 4H8QA 1BF5A 4TS6A 2R1XB 5BV7C 2OZNA 3ARRA 4EZLA 4I0PA 3KPQB 1FNSL 1Q9WA 4E68A 4X7FC 1B4JH 2FATH 4NLAA 4Z77A 4X4KA 3UYOD 1I1CA 1VADB 4LSQH 4AQEB 3MJ9A 3EGSA 3HLAB 1W72L 1K6QH 2X4SA 4N8CL 1T83C 3BGMA 5D7SL 2F53A 3QDMD 5CJ8A 2BP3A 2CZNA 1J05B 1D3CA 1SFDA 1UC6A 4LQ1A 3E6FA 5IJVA 4ANKA 1SUHA 4XXWA 4MDIB 1VFAA 1BQLL 3SDXF 4P2QD 3V0DA 1OF2A 5TH2B 4ADGA 2D31B 4IRJC 3PHQB 4OKDA 3MHZA 5D6CB 3LZLA 1JNNH 4N9GB 3F04A 3NCJL 3B1TA 1BZDA 4QXUH 1OEZW 2VB5A 5GISL 4NQSA 1FPTH 1UWYA 3QDAA 1V54B 2IPTL 5LHDA 2IH9A 4PMFA 2YARA 2I7SA 2EO1A 2PPCA 4D9QE 4DKEH 5JDSB 1LDPH 4NHUB 3PV6A 4KX9A 5C8JA 1GIGH 2ZCHH 4B0MM 3MRNB 5JW3L 2HRHA 4X0KB 3KGTA 1Q0XH 4YDKL 1JK8A 1WC7A 4JFFB 2FJSA 2DLEA 2EIBA 2UY6A 4L18A 4IBTA 5IMKA 1HDMB 4PJAA 2F8OA 2XHNA 2FJHB 1XR8A 4L5FE 4XNZB 1IL1B 1O9ZA 5D1QD 5HPOA 3ZQ9A 4N6QA 3RL2B 3MUY1 2WYHA 3QP3A 3RIKA 4C4KO 2GUYA 4XRCB 5HHOE 1I82A 3MV11 5MENB 3TBWB 1PQZB 4LARH 3RWDA 5A6IA 3MNMA 3VXOB 4OSUL 1QSEB 2LAGB 3TA3B 2HN7B 3H7LA 3CLFL 3QULA 4RETB 4MNHA 1KB3A 3CFQA 5IF0B 1U8JB 2ADFL 3CZLA 3D25B 2NY2B 2PN5A 1Y18A 4ODTL 1A7NH 1VB9A 2YPLB 2DTSA 4GBXA 3CFCL 3RB5A 4PP2B 4B9JA 1S9KC 4RDBA 2AJYH 3FTYA 2HA1A 3WENA 2NY0D 1PZSA 3ARBC 4GSRA 2D4DA 4NKDA 4XC1L 3PJSA 2VXUL 4JRXA 4WHYG 3SY6A 3U9PH 4LCWB 5I1EL 1XGPA 4DP6X 5I6KA 2J43A 2W07B 3T65B 3WFDH 2P4AB 2CO4A 2PXYB 2V8MA 1AOZA 3A67H 2WBJB 2CA4A 3QG7H 5AVUB 3T77A 5ICZB 1F42A 2Y7LA 1MVUA 1VFBB 2ENQA 3N44F 3VJ6A 4NS0A 5L4IA 2O5YL 1Y1DA 2LU5A 5L7XL 4TUJA 5E5UB 2PPDA 3DI2B 3GMPA 4DKTA 3CZNA 5HXMA 3VXRE 3WOVA 4YHMH 2YIHA 2X6AA 5E6RB 2WAHA 5HGHA 4OV5B 2G2PA 1P1VA 3KPTA 1KY7A 4M5SA 3U0WL 1YYLH 4JFDE 2Z31C 1SJVA 3LQMA 1QEWB 3I6KA 4MJ6B 3PWUB 3RIAK 4N2HA 3QR0A 4XNUH 5CFAA 5E6UB 4HJJL 4W9JC 4FXGA 1QBMH 5JO5B 1MCWW 5MEQB 4RWYL 5BXFB 2FO8A 3RVVC 3FTGB 1U6AH 2KPNA 5B7FA 2VRQA 3MJ9L 1EZLA 1VZIA 2IXQB 3ARGD 1GYWA 3NJLA 1OGAA 1T04B 4WTZA 3U36B 2VDOL 4AYGA 1KFGA 5EWIH 1U8QB 3ABMB 2B1OA 2A9NL 1YQVL 4LLMA 5BV7H 1XR9A 1DLHA 1M71A 1XL4A 2QHRH 1HFUA 2ADIB 3PAYA 4M6OL 4O9HL 4TSCL 4X9GA 3JWOH 4OCWH 4QT5A 5CBEA 1SVBA 3VWKB 5DZ9A 2B3IA 1H3PH 4G8IB 3V0IA 5BRZB 5GGSA 4ABQA 4OW6A 1JPSL 4BYHA 5E4EB 3SIKA 1BVLB 1TIUA 4JPIA 1NGYA 4Z7VF 3M07A 4FG4A 5DXWA 2OJEA 4M1GL 3IJYB 4Y7MA 5C2BL 5DRWB 5DJ6A 4ABUA 1JBJA 3LKPA 2N0KA 2W65B 2Z35B 4DSYA 1PFOA 3CE1A 1SXAA 1SMOA 1WITA 2VL5A 3TWCL 1NGXB 3QUMH 2RCSL 3ZE2E 1A3LH 1KFAL 4MXVF 4U1GC 5B3NA 4RNRB 2IFFL 3TYFA 5EA0L 3GHEH 4Q9BA 3VFMA 1RZFL 4M8QB 1D5IH 3VXPB 3PJNA 1A5FH 1B4TA 3QJHA 3NZ8A 4XXDB 2OAAA 1QLRA 2D7OA 2R83A 1U41A 4F9PA 4LLUA 3SDDB 1ONQA 3UC2A 1YUKB 1NFAA 1YEFL 1DFBH 1Z3GH 2ZOKA 4RAUB 4NRZB 5ALBL 3SYAA 3GHBH 1J5OH 1BAFL 4ZPVA 4QRTB 4CKVX 2A6IA 4Z78B 4HJIA 4JO5A 3TNMA 5KBKA 5HHQB 4NUMA 3LOWA 3KLHC 1F8TL 3CIAA 3IU3A 1ADQA 4GKZB 1E4JA 2FO4A 3K5SA 5GS3A 1S5IL 3VQLA 1TJMA 2FQFA 4NEHB 3JV0A 5B7EA 2G5UA 3O6KH 4K15A 4A39A 4ZW3A 2W38A 3V4UH 4Z3GA 4RRPA 2G2RA 3UYRL 1XAKA 2CK2A 3TBYB 1J86A 3T9WA 3VQ2C 3T1WA 3RY5A 4U6HA 3CMOL 1KIUA 3UG3A 5IQMA 2ZKMX 3TBCA 1R5IB 1JDAA 3IMUA 3WD5L 4CDGC 4OCSL 4B9IA 1GYCA 4HUUB 3DI3B 4MNGB 3SYQA 3IPEA 4WQOA 3EHBB 3V5DB 3S4SG 5D1XD 1KN2H 3KJ6L 3U2SA 3BMWA 2VRKA 3GMQB 4JFFE 4LLDA 9CGTA 2VM9A 4K55A 4FABH 1JTOA 1BXUA 2YC1A 3Q01A 4WUKH 5E2UH 4MAYA 4BZYA 2NZIA 4WNQB 1TJHL 4QHPA 4ELKA 1HOCA 4N1CA 1F6FB 2DEYX 2JH2A 3OKLB 3QARA 3CSBA 2CDGA 3NUKA 2TRHA 5C0EA 3IBOA 2NNXA 1FSKB 3NRQA 4Q56A 4AC2A 4KK6C 4IKJA 5MENE 1X9UA 1DBKL 1WBZB 2BVYA 1QTYT 2VUOA 3G6DH 5I1AA 2KKQA 4F8TA 1QSEE 3RDTD 1AGDA 2B5IB 1RD6A 4BCYA 4O00A 4K7FA 1K9TA 2BO0A 5FYKH 4NUGH 3THMH 4W4OC 3VD3A 1VEOA 2YPLE 1MCKA 3ZZQA 1JGDB 1NL0H 2HFEA 3WHE1 4X7TB 1U95A 5CLXA 4PRNB 5A1AA 3QFJB 1ZSDB 1ZWIB 1WZKA 2PR9A 3CU7A 2O5ZL 4U1JB 3HPJA 3OR6A 4HKXA 3RYMA 3MYJA 3WEBA 4WI6A 3A6CL 1EMTH 4LCWE 5AL8A 4AQZA 3IJ9A 4OLWH 4OT1H 3GM8A 3LPGA 2JCCA 2X4RA 3VYNA 3HE6A 4A7UA 3QIWC 1JGLH 4GQ9H 5FO2A 3GBNL 5F6IB 3JZ7A 5DYFA 5KVDE 5E8EB 1IQDB 3ZR5A 1CGVA 5JPNC 4Z8FH 3VW3H 4P48A 1J5DA 4L8SA 4YSCA 3FOLB 4KC3B 2CMRH 3CZSA 2ISDA 4HCGA 1JWMA 4RSVA 1IV8A 1AQHA 1MZZA 2ED7A 5GS1B 4GW5A 5I6XB 2N0MA 1UACH 4X5LA 5FO8A 4PBDA 2Z4TA 4W9KC 4OM0H 4IEFB 3TC9A 3ZYZA 1OAQH 4BQ9A 1PYWA 5KYWA 3TBSB 2J6EA 1LWRA 3RGVB 3B3BA 5E5RB 5B1AB 3ZDXF 4A55A 2OZ4H 2XVGA 1DBBL 3IAGC 3L95B 5IP4A 4P3DA 1BLNA 2VJ0A 4F8PA 2VDQB 2QLYA 2FGWL 3P4LA 4NB7A 4LPYA 1VHPA 1I8LA 2FUQA 5IK3B 1D6EB 2V5TA 4RX4D 2APTA 3QWQB 2E6PA 4TNVK 1FYTB 2CU9A 2NW2B 1FJ1A 2D7TL 1W9XA 4UM9B 5M94B 4MVBD 3VTMA 1SM3L 1FN4A 4P05A 3MBEC 2VXQH 2R29H 4GKLA 1NGWA 1PL3A 4JPWH 4OZGB 4RZKA 2FX8L 1D5MA 3FXIC 5GRZA 2UWEB 2X1WL 4HXBH 4X9BA 2EDMA 3V7AE 4JGMA 1QSED 1A4AA 4EOWH 2DS4A 3RIAF 1K4DB 3TA3D 4GB9A 4NQXB 2XQYG 4JO2H 5GQBA 1NBCA 2NY2D 5AFAA 4DCQA 1ZLUH 3AFLA 4HIXH 5BRZE 1G9EA 3ATAA 2WYIA 2BXZA 1DSWA 3REWB 3CXHK 4JM4H 4PRPD 4ZFZA 1OT1A 2ID5A 3EOAA 4FJZA 2HVBA 4FNLH 5GS0L 3P4NA 3VWJA 4LIQL 4A68A 2X53A 1X3DA 3AS0A 5CSBA 1JZJA 1RZ8B 4H1LA 3HMWH 2OR7A 4EZJA 4XMUA 2J8HA 1L6ZA 3P3TA 2PXYD 1GW0A 1F02I 2WBJD 3S8FB 1KWKA 3B9KC 4XXCA 4PVNA 3D52A 3UTQB 1Y1UA 2QQNL 2CHDA 3KPLA 4K3HA 4AXWA 1I8MB 4LKCB 4X6BB 1W0VB 3ENEA 4FG0A 4GG6F 3ERXA 5DYOA 2H1XA 1XH3B 2DQMA 2OTWB 1CZ8H 4X99B 2QGDA 4EUPB 3WSQL 3VNZA 1JPFA 2YMOA 1BM3L 5C0AB 4JRFA 5HJ3B 4E42A 4HPOL 1A3RL 4QTIH 1R3KA 3G5YB 4R0LC 4XMKL 1LEKA 2NXYD 1NOLA 4GQQA 3E1ZA 3B2VH 4JVWA 1JYWA 1IGYA 4GKNB 3VFWA 5KEZA 2G9HB 4HKZA 4HFUL 1IFHH 1CDYA 4JANA 4WI0A 1V7ML 2AV7A 3TT3H 3P1VA 3NSYA 4L1BA 1R24A 1T1YA 4TUUA 4Y19D 3US9A 1FZJA 4CVZB 4W70A 3H2QA 5ISZD 3T0BA 3IKCB 4G6KH 5EOQH 1A9EA 2MQ3A 5TD4A 4GYBA 2WSPA 4K8RD 4PJXB 4I0PC 5BZZA 4HK0B 2VN7A 2D9CA 3U6XA 4XCFH 2Y06L 2WBKA 1NCGA 4U1HB 4BFIB 4OZIA 4WFFE 3T3PB 6CGTA 2O6CA 3JV6B 4Y88A 3IAPA 4MNGE 5DZOA 2IG2H 5HHMB 3OAUL 3VU2A 3WDJA 2Y69B 1PX4A 1YDPB 2J56A 4DFHA 1ED3A 1N6QL 4DP2X 2Z4QB 3C8HA 2MOGA 3CV5A 3GMOA 2ZP0T 3TGXA 3FCTB 4KTEH 3IDJB 5J6GA 3IS0X 2EYSB 4XXWC 2ETWA 5KVGE 2WZPA 3KVPA 5FYJE 3G04A 4ZMNA 1RUQH 1X9QA 4RMQA 2OXGA 2PW2B 4GQRA 4N8CH 5IHUH 5JQ6L 1HZHH 2J6EL 3LN5A 4Y5YA 5D7SH 1UZ8A 4JHUA 4PVMA 4G7SB 2FX7L 3IDMB 5J1SC 4ODWA 4UQEA 4QNPE 2H45A 2X0WA 2JFCA 5LNEA 3ZU8A 1DEEB 4K23H 4XNAA 3BN9D 2OMNA 4JKMA 5F6HI 3WIFB 3S9DB 5E1IA 2YR3A 4LGRB 5MHSE 4NC0B 2EIJB 2Z7UA 5C09D 1RK7A 4LCUA 3SDDD 1J12A 3NCJH 2BSED 3QFJE 1WBXA 2BNUB 3E8UL 1XGUB 4UQAA 1RK1B 1AS7A 5GISH 5CGBA 3B7YA 1MAML 2IPTH 4UOZA 2XXMB 3D3VE 1J18A 4FGMA 5BZWA 4FTDA 3GXMA 5CLZA 4JFXA 4D7PA 3NCYP 3FO9A 1J48A 1MFMA 5F88B 3CDZA 2CGZA 5J06A 3WDIA 7PAZA 3HBQA 3UYPB 2CO6B 4ILDA 4YHLL 3OZ9H 2NR6A 2ENSA 5IB5B 3N5AA 3C6SB 5FEBA 1IC7H 2PO6C 3N40P 1O9VA 2V5RA 1HKLL 1KXQA 3DUUA 4X7DC 4L5FL 3TF4A 4RAHA 4OSUH 1T0NA 2YBRA 3EHBD 1NC4B 3ARYA 4BQ8A 5T1JA 5SX5H 2ADFH 3QQXA 5CO1A 4NQEB 4LCYB 2GBUA 5KSAC 4IDJL 4BH7A 4M3KB 4CDHA 4PYGA 4AT6B 2Z65C 1Z2KA 4XNXH 5I75B 4PJGA 2A6JB 1FYTE 4TNGA 5FYJD 5HHPB 4UOW0 4JS7A 2J5LC 4EXKA 2F8VA 4RGNC 3IFNH 2VXUH 1U58B 4UUJB 2BXYA 4ODBD 3QHFL 1FG2A 2A77H 4OZGE 2E7MA 2LE9A 5I1EH 1SMDA 2ZPKL 1CI3M 1D7BA 2UWEE 1VJSA 4ACTA 3FK3A 2DQJH 1XCTB 5DD0L 1SMAA 5ABAA 1UCBL 3UEQA 4BM7A 1RQ5A 4HLEA 3F7YA 2P5PA 4KV5F 4QRRA 4A2FA 2J6WA 1LP9F 3M86A 4ODXB 5MHSD 4UT7L 1QP1A 2BRRL 4BBWA 4CJ0A 5FKPA 1UURA 2O5YH 3CZEA 4XPBH 3MRIA 1WAAF 3QFJD 4JHBA 5F9JB 1U4FA 1UA6H 1MJUH 3V6OC 1N0XL 1S7RB 2XQYK 1MOEA 4OF6A 1B88A 3QQ9C 4ERSH 1EJ8A 1H15A 3MUJA 2WXFA 4KPHL 4R5TA 4DP5X 3BE1L 4M5TA 1AR1D 2EDOA 3FQUA 2FECI 5KVEE 1K5NA 2XWCA 1M6OA 3FUEA 4BWTA 3D0LA 2W9DL 1I8KA 1G7MA 3WL9B 4EI5C 2Z8RA 2IO5A 5I66B 3BWAA 3NJJA 2R0ZL 3D8MA 25C8H 4RWYH 4JM2B 2JWYA 4P5KB 3MOQA 4KITB 5IM7A 1RERA 3CPLA 4ZMYA 4GT7A 5HGDB 2PLTA 1NIDA 4D2NA 4PYHA 4LP5A 2VDOH 5C0AE 4B41A 1JNHA 3U1SH 3AWGA 3O11A 3E2HC 4FYRA 1RZGB 3L7EB 2PABA 3GTTA 3MCLH 3MNWA 3RGVD 4O9HH 1CN4A 4M6OH 1MG2C 4PJHB 3S2CA 5EIIB 4N3TA 3ABLB 4R2GB 5E9NA 2BVPA 5LCVA 4I48B 4XMVA 5FWRA 2F5AH 5E95B 3TH2T 4XNMB 4GSDH 2EIZB 2FQGA 1JPSH 4MJ5B 2VO8A 2EXSA 1CLYL 3NP3A 3ZHNA 5BS0E 4J4PA 2ZZUT 5EF2A 4YXHL 2CBQA 3FUHA 4U6XB 4UM9D 3U4AA 5DHYA 3ZMEA 2EECA 2Q9OA 3RVXC 2VLLA 3GUTA 4PJXE 2NYYD 1C08A 1KBGL 4F9PC 4HKBA 4JREB 3N9GL 4JFPB 3T3PE 2RCSH 3RVWC 1MNUH 1KFAH 2QDVA 1JVOA 1UXLA 4RVBA 4WTXA 3B43A 1KV7A 5EA0H 5HHME 3GNML 2P80A 1BSIA 5LO7A 1WEJH 4LRIA 3B7TA 2GJ6A 4Z76B 3FOMB 4P23A 2XIBA 2XKUA 2YBGA 3DUSB 4QRSB 4HK3N 3AQXA 5H35B 2KYIA 2H3NA 1P5VB 2PCPA 2Y4SA 4FXLA 5I23A 3K71B 1I3RA 5D2NC 3WJMB 1KCRL 1PMYA 1XCQB 5ALBH 3SEPA 4OD2B 1CLOH 3QZWA 4QUOA 1BZOA 1TQCC 5L6YL 5T5NG 4LMQI 4Z95H 2E46A 1OCCB 2CRIA 1MHPH 4M8UA 1F8TH 1PZ5A 5GJSH 2FJFB 1OP5H 1TETH 1U91A 1A7QH 2H5UA 3Q8FA 3FYIB 4A7TA 4ODSL 3SDAC 5DLML 5E1HB 1XGTA 3LD8B 2WQAA 3BJLA 1CGUA 3PDGA 3ROOA 2CIKA 1AY1L 2VL4A 3CHOA 1LJMA 2J8UF 2J3SA 4GW4A 4MAYC 4KHXL 4JFZL 1OWRM 1JF1B 3ZR6A 3WD5H 2IDUA 3B8YA 4ZMWA 2F5BL 5KZCB 2EZ0D 2CSPA 4X6EA 4NQDB 4R4FL 4MMXA 3SOTA 2AKRA 3AABA 3INOA 2WXPA 4R7NB 3KJ6H 4KQ3H 5ECGA 2X3BA 3L4TA 4GNKB 3MLUL 5L8JB 1XX9C 1UZ6E 1KC5L 3TU6A 1ETZA 4IJ3B 1I1AB 4FKEA 4JFTA 3D85A 1EXHA 2H0EA 4AQ1A 2IANB 4XE0A 3O41A 3AY2A 1WUNT 2WYZA 1G9HA 3VA2C 3UAFA 1YNTA 2A4CA 4YJZL 1SF5A 1MH5B 2XWJA 1MWAA 3BZEB 4CN6A 1XT5A 1JCVA 4JE4B 5GSVA 3WIIH 1A7RL 4F93B 1RZQA 2R2EB 5HHMD 3QDJA 3I9GL 3KEDA 5EUOA 3WTYA 1OOAA 2FNBA 1PZUB 2P7TA 3VDAA 4E2OA 4JEGB 2R59A 1PKOA 2VCOA 5ESAB 1VACB 5HVFB 3WNLA 4NQEE 1LYQA 1MIML 3HE6C 4MS8D 5T5FH 2WLZA 1NCJA 4A2HA 3TZVC 1WRFA 1EHKB 3RGHA 2MFNA 1RJLB 3GSQA 3VFTA 3RZCC 1ES0A 2YRBA 4J1UB 2UZXA 1P4BL 3H9SA 2F61A 2WTRB 3LMJH 3UTPE 2VC2B 1HNGA 1I3GL 3VRJA 2OPCA 3C2SA 1JV2B 3RWEA 1W8OA 4LPXA 1CE6A 2V2TA 5FPIA 2GSGB 3W37A 4MS6A 5TE7H 1UFUA 3D50A 2UYLA 5EG6C 3FQWB 2EIEA 4FNRA 5IB4B 3GBNH 4ZUTA 3J07A 3ML9A 4L37B 4ZO8A 4JRLA 3ARPA 5JXED 3BKYL 1TLKA 3NT0A 4ODHH 4X8JB 5CMAA 1J1XL 4R8WH 1DANT 2ZSVB 2DN7A 1CL7L 1HHHA 1QOKA 1SJHB 3UO8B 1CLZH 2JQMA 5I74C 3DARA 3SJVB 4KQ4L 3L1OL 1IAIM 1CU4L 1FYHB 4RAVB 2CUHA 3K8MA 1BP3B 4PVLA 5DWUH 1UOVA 3DX2A 3KYMA 3MO1B 3QO0A 2KDYA 4QIRA 2D73A 3ZQWA 4J2QA 1XH2A 1QFWL 1OTUD 2FGWH 1KJMA 3OM3B 3WCYA 2ESVD 2XY2A 3WNOA 4KFMA 4LSTL 2D7TH 1P5UA 1AIFA 3IS1X 4O58H 4JL2A 4MD0B 1SM3H 1M3JA 3WLWD 4N2AA 1DTUA 4F3FB 1PJWA 3UTTA 4CJ1A 2A3TA 4N90D 3FO0L 4F7CB 1Z32X 3WY3A 3LRLA 1T1WB 4IRZH 4OZFB 4AGPA 3TBVA 2GSMB 1ADQH 3ASOB 3NK3A 2C8NA 3TCLB 1W8EA 1TLMA 2Y72A 5IROA 4NQED 2WBXA 5I16B 1T21A 3OHXA 4PW4A 3BSZA 2ERJB 3NEOA 3HE7A 3LHAA 5FX3A 1ZVYA 3NFSH 4HXAL 2Y7SA 4PJ7B 1A1NA 4P9MH 2C4FT 3ARDA 3T8VA 1YG9A 4LIQH 3CG8A 3E3QE 4ANWA 3BUPA 4HKJA 4I77L 3RPIB 2XFGB 5DFVC 4KX7A 3HNVL 3CX5J 4NN6B 4MMZA 1XVSA 3T0EB 1HYSD 4XO4A 3S97C 1FNLA 1FRGL 4IU3A 4PRDB 2CJUL 5KBMA 3WJLC 2VDRL 5IQLA 4TNWK 4X98B 1G1YA 1PG7W 2QQNH 2CO1A 3GMRA 4BJLA 2VSMB 4J3VA 3TPUB 1AXTH 3WN5C 4N0CC 5FA3B 2A0LD 1ZLUK 2XDHA 4UYPA 5JZ7C 1CGYA 3EYUH 1MUJB 4YN3A 5CCHE 5JYMA 1BM3H 3MAWA 3OKOA 3QQ4A 5DC2A 1MWAL 4CGTA 4BZ1A 3L4YA 4U6VL 2Y6TE 3I2CH 1NUDA 2Y7QB 3GEWB 1TZIB 1K2DA 4JO8A 4ZDHB 2DTML 2HT3D 2VQ1B 1FBIH 4J3WA 4HHGA 5BOPA 1V7MH 1VGEL 1THCA 2J73A 3BQUD 3CN1A 3SB3A 2XUWA 3DXAA 1G7IA 2XV3A 3GK8L 4JM2D 3N55A 1T0MB 4M56A 2HB0A 2WUBL 5C0FB 4C47A 1A3QA 4NKIH 1T22A 2PWGA 4C58B 3IBEA 2BMKB 4Y4KA 3V0JA 5EPMB 3BLKA 3EUUA 4KKLD 4LSVL 1PU0A 2R69H 1Z5LA 3C5JB 1IC0A 4LXFA 4XP5L 2WWMD 3UTSB 2Y06H 1S7WB 4Z9KB 1M7DA 1T5XA 4F7PB 1OARH 5CGMA 4ESKA 5FB8B 2X10A 4PIBA 3W9EA 4AKOA 2WO3B 3HG1A 1LO3L 1S7TB 3OAUH 4NQDE 2YEVB 3QORA 1OAUL 1KWGA 4ZMQA 7TAAA 1FZOA 3UAJC 2A9MH 1BXXA 1N6QH 4UDUA 3GI8L 1T7XA 2H32B 3TWYA 2UVFA 4I18B 2IANE 3U83A 3UIZA 2JVUA 3GDBA 5EF0A 4AKPA 3NRFA 2VDPL 1LK3H 3KR3H 1SBSL 2X2UA 4JFEB 3JTSA 3DOSB 2J6EH 3OAWA 5JQ6H 1A6ZB 4M62L 1N6VA 4HPYL 3ECUA 1G7HB 5KVGL 3I3EA 2I07B 4M61B 3WUWB 3QDGB 1OK8A 1PDKA 2CALA 1ESOA 3JWNG 3OKDA 3GPSA 5EN2B 2C9AA 3FQNA 3C2AL 5HHXL 1NFIB 2YAPA 4L8BA 2D3NA 5H94B 3GKWL 1UXWA 3VGAC 4NC1E 2EKSB 1U3ZA 4PY7A 4EAEA 1C5CL 3DGGA 3SQBB 3E8UH 3NA4A 5EOTA 3EJQA 1AXIB 2JB6A 3RFZA 5FM5M 1G6RA 2OL3B 3R06A 4TSAH 3O3BA 4AZ8B 4F33B