4HEPA

Complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
162
structure length
162
Chain Sequence
ASIKKVYRGMKNGAETINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Viral infection modulation and neutralization by camelid nanobodies
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
molecule keywords BPP
total genus 27
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hepA02
3HG0A 2X53A 3EJCA 3U6XA 4IOSA 2WZPA 2BSEA 3DA0A 2F0CA 4HEPA 3D8MA 1ZRUA 2BSDA 4HEMA
chains in the Genus database with same CATH superfamily
5FO9A 1UOKA 4F27A 3OLDA 5K9JL 1GTFA 1ACYL 1HHGA 4FFYA 1KXQA 1MFBL 2ZWKA 2MNUA 2NSXA 5L9DH 4IOSA 1PIFA 3KXFB 4XI5D 5C0RL 5IMOB 2E56A 2EILB 4NQCA 4U2YA 3ZE1F 4AIZB 4TNVK 4JFWA 4IGBB 4G80B 3TZVD 3B2VH 4HULB 2EDBA 1JK8B 5PAZA 1JTOA 4Z7QF 1BV8A 1WZMA 2AFNA 1YEEH 4EVNA 3MLYH 4N8CL 3U25A 3ASNB 4YX2H 4UNVA 3HZKA 2AV1A 3QS2A 1N5YH 4TTDC 4G71B 1U3HC 1SN5A 4L8SC 4XODA 4JFZL 4HC1L 4K7PL 2B2XL 3ARWA 1ID5I 3P4OA 3SCMD 3T3MB 3WJLA 2VDLH 4GS7B 1IAOB 1Q9OA 2BRRL 4N2BA 1CD8A 5B1BB 3SPGA 3EW3B 3T1FB 5J1TC 2W9LA 4KK5C 3EBAA 2GTWB 2B1AH 1KCSL 2FUQA 3IDIA 3HG5A 2WQUA 4Q4EA 4APXB 3WUZA 3ETBF 3D4GA 1ZKAA 2QHRL 4JDZB 2R1XB 4FLQA 3IXTB 1GY1A 3CDZB 2ZSWB 3UZQA 1UH3A 3SO5A 5C9JA 1P4IH 3CFIC 4RVBA 4HLZH 1P5UC 2FTAA 3QIUA 2NXYC 1PYWB 1KN4H 3QRLA 5FM8A 3DGGA 5TF1H 3W5NA 4DCQB 1B2YA 4CSSA 5T1KA 1T89A 5B1KA 2BSSB 2CKNA 2WB1A 5LBSA 5E1IA 2IVFC 3MRDA 4WHYH 5GGRY 3NIDE 3WENA 4U3CA 4RAUA 4XWGH 1CLVA 3EJSA 3SJVA 4DW2H 3TA3A 1Z3RA 4WFGE 1OAYL 3GMMB 3KDPB 4MJ6A 2CRMA 3OTTA 3U7YH 1OTUC 3IJEA 4KTEH 4GRWF 5ALBH 1A6VL 2A74B 2OCCB 3RTQA 4E9SA 1F4XL 1ZOXA 4I0PC 3O9WB 2CRYA 5HGGS 4DTGH 3E1ZA 3CN4A 4GFTB 5AWNH 3MR9A 2YXWA 4HT1L 5IUSA 1ASPA 2I5YL 4L5FH 3MV9E 1R24B 2BSRB 5IW1B 4NN7B 4OAWA 2ZOOA 1LEKA 2ZUYA 1VACB 2N59A 3LXUX 4YHIB 2ZX7A 2F19L 3LNDA 5J3HC 3DPBB 1CJYA 1CURA 3O3EA 3GSVB 1MI5D 4MYPA 1XGQB 1JN6B 4WWNA 4JFOB 4LCYA 4OIAA 2J6WA 2NXZD 1WITA 3JZYA 5C0IB 4L4TE 3OMZA 1KXVA 3P4NB 3DX6B 2J55A 4MD4B 2Q6WB 3MGOB 2AEPH 5K1JA 4KKLC 4IHBA 1N8ZA 5CLXA 4ZZFA 1GC1C 5E1HB 2YN5A 3CZNA 2CDFA 4HUVB 3MLZL 2D0FA 1IQDA 3DROA 1HZLA 4OVUA 1OSZB 3EFFB 2Z8VC 2VWEE 4KMTL 4XBEL 1G94A 5FAAA 4GQ9L 4S2SB 2A6JB 4PWJA 4ZUWA 4QRUA 5EORH 4WW2C 1UEYA 1X4XA 4DK5A 5FUZH 5M94B 2VAAB 3U83A 3Q43A 1WAAA 1IBZA 3PWPB 4OCWL 1CBJA 5DVLA 2VISA 1Y18A 4NM8H 4XTRC 2MOQA 1S7TA 2FNWA 4OZFB 4X42A 4XOBA 1FORH 4V1DB 3TESA 5T1JA 2WTRB 4H8QA 5T1LD 1AS6A 4Y4KB 1ECZA 5CP7A 1Z9NA 3K5SA 4TVPE 3W0WE 1HJCA 1AI1H 1N7MH 2YD9A 1CIDA 1C1EL 1B2WL 5LCVH 4I3SH 2OV0A 2Z9TA 5HY9B 4R4BA 3DSFH 3FO9B 3ES6A 4MTMA 4WTXA 4ILDA 1R3IH 3ZE1E 2VZTA 1H8OA 1E5CA 2ITCB 4PJ8B 4KTYA 5ILTL 1A5FH 1HTYA 1KTLA 1RJZB 2FB4L 3ABZA 3KXFE 1AP2B 3OWRA 3DGGB 4PD4K 2BHUA 4JG0H 4IDLA 3WJMA 2F54D 4PJHE 1RUAH 3DHMA 1KPUA 4CGUB 4TVSa 1FBIH 3ZVVA 2CRIA 2PLTA 2XV2A 4MXVF 2RTTA 3ZK0A 3LEXA 3I9AA 5JPNA 1ED3B 3VXUE 1E9QA 3GQFA 3PDOA 2BP3A 4QXGL 1A6AB 2NUTA 5J9PA 3FF7A 2C9AA 4M8QB 1QNZL 1MHCA 3T6WA 1CCZA 1P7QB 4J3TA 5BMFH 4OTXH 5KVGL 1MNNA 2HLFD 4MB4A 1JHTA 4PG2A 4JNXA 2VM4A 5DLLA 2BM3A 4EZLA 1IO4C 2MPVA 4EUPH 3WHXA 3T4YA 4NAQA 2Q86A 1HESA 5D1QE 2AS5M 1KWKA 1AY1L 3MLSH 3SQBB 3A47A 2YD1A 4L8BB 4LSPL 5D7JA 2C3GA 3OKLB 1F13A 5K9OB 2ITCA 4PJ8A 1BG1A 3BUDA 1GKOA 3GHEH 2A9NH 3HNTL 4N85A 1NL0L 2HA1A 4OR1A 3NFSL 4ORZC 4P23A 4WO4B 4QGTA 1QO3B 1XEUA 4U0RB 3RWCA 1AGCB 1BJ1J 2ZQKA 5HD8D 3L5XL 3NJHA 4N0RA 5GZND 4KBPA 5EO0A 1TFHA 3IDUA 3UAJC 4PJ7B 3N41B 3C60A 5I5RA 1A6WH 2IFGA 4HX1B 2Q7YB 2R1WA 2BOCB 1ZT4A 2IXQA 1AZRA 2Q10A 2PO6A 1TJXA 3W0WA 3LNIA 4FFTA 1E4HA 1BBJB 3UZEA 1KLUA 4TVPH 5I1DA 1NCGA 4F15B 2G9KA 1D3CA 2YARA 2XI9A 3JSSA 2BVEA 2BW4A 3O6FC 5T1MB 3VXQA 2G3NA 1ONQA 4RSVA 1SOKA 5CEZH 5ADOL 4LOUD 5DEFA 3WY1A 5HTSA 4FXGC 2WXIA 1E2VA 1IQDB 1FFNA 4LLAA 4JQIH 2O61A 2JKXA 4PG9A 4R4FL 2YXVA 3FTZA 3HE7A 4QTIH 4BA0A 3IGUA 3IJSB 2D03L 2C5DC 3NIFE 1GS6X 1S7XB 1Z9LA 2BPBA 5IR1A 3L16A 4IJ3C 2OK0H 1OIOA 1AIZA 1FQ9C 4G72B 2KZ1B 4IBVA 1XGQA 2XFGB 2VDKL 1J0KA 1A1OA 4LOEA 3DX3A 3ZHKA 4P3CH 1O6SB 2BSEA 5GGVY 4MJ2A 3TBYA 3T4AB 1MQKL 4TPRL 3E6HB 4ZNEA 2XN9D 1NFDF 1AD9B 4ZXBC 2OXHA 2GJRA 4PG9B 1QTPA 4PJEA 4ADGA 4PJBF 3V0GA 2ZG2A 2QPFA 3X1FA 2E86A 2N1KA 1P5UB 2ZSVB 3D2UD 3SDAB 2G9HA 2DBLH 4R7DB 5GQBA 3ZY7A 3KVQA 4CU8A 4CVXB 1E6JH 3X13A 3HUJE 1BFVH 3UL4A 2EO7A 4V1DE 4J7RA 2XNAA 3ZKMC 2R29A 4MDIA 3ARSA 4J2XA 1DFBL 1TCRB 1EJFA 2OP4L 3WFBL 1OF0A 1WAEA 3NAAH 5AWNL 3W0WB 1RZQA 4GG6A 4X6BB 2ZCZA 1MJ7H 5DTFA 1A8ZA 3VXUA 3CFJB 2BNRB 1FP5A 3KGTA 5GRZA 1N26A 2F19H 3OD3A 4PJ7E 2BS8A 5I30L 3V5DA 4BZ1A 1KN2H 4CA4A 1XGRB 2Y7SA 4KVCH 4P2CG 1XGTB 1JGIA 5H4YA 2ODHA 1NFIA 4IOFC 3ZO0A 2BZ7A 1GGUA 3CN0A 4IBWA 4K7FB 1QO3A 4K94C 1WWBX 4P4KC 4DO6A 1ZV2A 1EEYB 3KPRA 5TGBA 3LQMA 1WHOA 2DLEA 4KK8C 2X4NA 1AO7A 4N8VA 4IU3A 4X9BA 4MA7L 2ZKHL 3QR0A 4FYRA 3LVTA 3LRHA 4BH8B 3ZKND 5C97A 4M6OH 4RMVA 4HYTB 4CU6A 2YSSA 3PAVA 4MZIA 1F6AA 4F8QA 3C60C 4PJXE 3S3SA 5E8PA 1GIGH 2WNKA 3K2IA 1H3UA 3O6KL 1A6AA 2NUTB 3WS6A 5J9PB 2XQBL 3QJZA 4M1CD 5FO8A 4O02L 4KX7A 4Y1AD 5IVNA 3BHBB 1T20B 2XV3A 4LSTH 4TN9A 1NAMA 2XFXB 2CK0L 2E47A 5JXED 2W38A 4YSOA 5C0GB 4WEEA 1JNLL 1MLCB 4G8GA 3NIDF 3M7OA 3H53A 1MSPA 5L4IA 4DGVL 2X89D 1UWFA 5CMAA 3TONA 1OB1B 4ZMXA 2PPAA 3CIAA 1FL5A 2GBTA 1FL6B 1GH7A 3KWVA 4QRQB 1OSPL 3BDBA 1T0PB 2X2YA 2WVVB 4JO1L 5BRZE 3MLTB 2IV9A 3GIVB 4IS6A 3U36B 3PAUA 3WKYA 1CICC 4PV1C 1HEJC 1BQHG 1FFQA 2ZOKA 1CXEA 1RZJH 1T7ZA 3TF7C 2R0KH 3SDCD 1W6WA 3GSUA 1JK9B 3QT2A 4K55A 4BE6A 4KKRA 1MCEA 2X70B 3BZ5A 4YBQD 1R3JB 2WW8A 3FTGB 4RQQA 2C1PA 1GMEA 5DUPH 1I1AA 5AVTB 5FK9A 3RZCA 4JDTL 2VCOA 3GBMH 4HIHA 2EZ0D 3D51A 3UO8B 2FQDA 4Z7VA 2K3HA 1EIBA 1TR7A 1XH2A 1TZIB 4P0DA 2EE9A 3IDMA 2OW6A 4LCWA 4XHJC 1ZA6A 4ZAKD 4N87A 3ZMNA 1PZSA 3WFDH 3IB4A 4YGVB 3L3IB 1W0VA 1M1SA 4OCRL 4EPSA 2X1QA 2OR9L 3Q3GB 3MJ7A 1NCCH 4N2HA 3QIUD 5DZNA 4RGNC 3HS8A 4JRFA 4ABVA 3MLSL 4NSKA 5EEXA 1IGJA 1U6AH 3HRZC 3F5WB 5IBTH 2Z1KA 4CJ1A 2P8LB 2B0SH 3B7UX 3I9IA 3QZPA 4AGPA 1VZGA 2OMVA 1PKQE 3VNZA 2H2PD 1XIWD 3DX6A 4PRHE 5KVDL 4HXAL 3H56A 4Q6KA 5CZVL 4XN7A 1KBVA 3CU7A 2G2RA 4JFEE 4NKDA 4KK6D 4BSWB 1G7PA 3CH1A 4KKPA 1EZVX 4KRPD 5KUMA 5I73B 5JQIB 5FA3A 1YYMH 3QARA 2G5BB 4S1QH 1FG2A 1S8DA 4OM1H 3WYRA 2QZQA 4Z78A 1JAEA 3AY4C 2CQVA 4AXWA 2C9QA 5IW1A 4Z7VF 4HFWA 4KQ3H 1KTBA 1V3MA 3SE8L 1LO4L 4P2AA 1HOCB 5C3TA 5E2WL 3WLWC 2B1HH 4OLYL 1MEXH 2EADA 3T6VA 1PNDA 1BEYL 3CPLB 1B9KA 4H20L 3QCVH 3VU1A 1OM3H 4FAAB 5DD1L 1CF8H 1Q90A 4AQ1B 4LKCB 3LEVH 2FWSA 1X4YA 4H1LA 1AQMA 4ESKA 1JPTL 1T22B 5GSRB 5CKAA 5DJ0B 2A6DA 4KFMA 1M1XA 4GW5B 1A7OL 1H0DA 3SKNA 4AENA 1CLCA 1SF3A 2X4PA 1JF1B 3QJXA 3VFVA 4F92B 2A77H 1PYWA 1PJ9A 3QIUB 5E6IB 4D9LH 4OZGE 3CFCL 4OGXH 4M8UA 5ICXB 3WFCL 3D33A 3HZVA 1B0RA 1ZHNB 3N1MC 1TO5A 2B77A 2HT4C 2VXQA 1KIQB 3QUKB 4KUZH 3MRBA 4OCYL 5I18L 3CXDL 5E0QA 3B3BA 5IVZA 3GSOB 1BD2B 5LKNA 5DZLA 5EU5A 1OPGH 2GI7A 3PYCA 4UTBA 4OQTH 4JE0A 2HT4D 4RGOL 3VWJC 4LHUG 3NQKA 4Q2ZA 5HYSB 4O2CA 2H45A 2XBTA 4FQJH 5BOPA 3PWVB 3DURA 3BZ4B 2V8LA 4QNPE 3NOIA 3B56A 4NRYB 1T3FA 3W2DL 3BO8B 1ESOA 4U1SA 5T5FA 1EDQA 2A7BA 2CBOA 3MLUH 3A6BH 3G6JE 4Y9FA 2ID5A 3FHEA 4HSCX 1OTSD 2K7PA 3APCA 5HI3C 5HDQH 5JIIA 3PWJB 4FNPA 3CHSA 4X5XA 4I85A 1N12A 5B39A 4TMPA 3K6NA 3LV3A 2NNAB 3IETB 5DO2C 3AQYA 5JW5B 1OL0A 3NCFB 3VE0A 3KYMA 1KYAA 2CZNA 1UM4H 4ZXBD 1IBHA 4BQ9A 3P73B 1Q1JH 3BQUB 5DJZA 4PJGE 1W0WB 2ZYSA 2DTML 1P0SE 3R1GL 2DQEL 5C8JA 3LN4A 3FULA 4RWYH 2F0CA 1IGIL 4A66A 3Q8CA 3T04D 3UDWC 4MNGA 2X9YA 1T6WA 4R97C 1U2HA 4IMLB 2CJUH 3AGWA 1XXDC 4MDJA 5D7HA 3RGBA 1GGTA 4NRXB 2AEQH 3G5VA 5I6XB 3MHZA 3S98A 3NIGE 1X9LA 1G7JB 3WO3B 2QQNL 2P24A 2Z0BA 3BD3A 3DRTB 4WI7A 4XBMA 4PJDB 2WN2A 2AJYL 2HG5A 3H8NA 4UV4H 3ZDZB 5GS1C 2I24N 2XCMC 2C7FA 3MROB 1DO6A 2KI6A 3AREC 4HGKC 1G7LB 3FQTA 4G9DA 4OZGA 5D1QB 2UXVA 3LD8B 4H5SA 1UD4A 3KYOA 4DN4H 3TCTA 3NCCB 2WQRA 4JZNA 1TNMA 4BBWA 2QT6A 3SKNB 3EOYG 3PGFL 4ZSOB 2G3MA 3ARRA 5IOPB 1MAKA 4U05A 2DLTA 2DQGL 3K74B 3O3BB 5KSBA 4LBEA 2VLKB 1U42A 2BDNH 3QPXL 2IH8A 2AK1L 2GUOA 3BCDA 3EJTA 2QADB 3OZ9H 4X6CF 5C7ZA 4V11A 1CR9L 1S7VB 4YSUA 4WAFA 4AG4L 5F3HA 4FG0A 2YD0A 4ANKA 2UY6B 4UT9A 5F88A 5HD8C 4XZUA 2UWEE 4NNPH 1ZVNA 2WZ6A 4WNQB 2GVYA 3CFDB 2PW2A 2K45A 1EGJL 1PZDA 4JDEA 4H2AA 4KHTL 4A2LA 4XVUD 4P2QB 4ADIA 2TSBA 2XTSA 3TO4A 3TPUA 3Q9QA 4ZTOH 3LOWA 4HZ1A 4FJZA 4N2GA 3MRJB 3EJYD 3TBSB 4DQOL 3EKCA 4GSUA 3AB0C 2PYFB 5IVXE 3B9KC 1Q9WB 1UENA 4HFUH 4OT1L 3GZKA 1CLYL 5AW5B 3QYNA 2KH2B 1ASOA 1KB3A 2YGPA 4C4KO 2CA4A 4BXVA 3JTTA 2GIYA 4Q9BA 3KYOB 5C0NC 4W9JC 5JHLL 3RE0A 2OW7A 4U1NB 1DQJB 4DGYH 3E8VA 3W57A 5BNXD 4W9CC 1IGJB 1QBLL 1V7MH 3LX9A 3EDEA 3V0JA 4K3EH 3MLVH 3IGLA 2D7TL 3K3QA 1DUZB 1FCGA 1CE6A 1W80A 2MTAA 4AGQA 2YLHA 4H4NA 1OGAD 2NYYC 3L3IA 3U1QA 2X1WL 4H0GA 1YEHL 1SY6L 3B3IB 4OD1L 2JIXB 3WMQA 1KJ2B 4CW1A 1BXXA 3HG1A 4LSSH 3QH3A 3HRZB 4JAMB 3TT1H 5BQ7A 3IKKA 4MNGB 4BQ6A 2A9ML 1DL7H 4K3JH 4XNDA 1ZLDA 2XN0A 5LXGH 3MLWL 2Z92A 4PP1D 5KSAA 1OCCB 1R3JA 4RQQB 5F1SA 3VRLF 4BZ1L 1DBJH 2BS71 1VPOL 1MJUL 2NUPA 3PGCA 2FX8L 3GSQA 3PQYA 4ODSL 4PLJC 1D9KD 2DQHL 2NRDA 3BWZA 3MROA 4KVNL 4RGND 5EU6D 3SBRA 4Z7WE 4TNEA 2PTTA 2XXMB 1NLBL 4EXKA 2DD8H 4Q0XH 1RPKA 1A21A 5J6SA 4Y9GA 2EYSB 5D7LA 3S35L 4LARH 4RETB 5EC2A 1SVCP 4G6FB 2HLFC 2YPVH 4X5WA 1KB5H 1QNIA 1X5KA 4NPYA 1S7RA 3RRQA 5J6GA 3KZ8A 3BEWA 4OF8A 2OXGA 2JNZA 4YL9A 2V2TB 3DPDA 1H5BB 4N2OA 4ZFOA 4AEIL 3QUMH 5TDPA 5C0FB 1X5HA 3DURB 4KGLA 5C0FA 4YDZA 2GY5A 2G4GA 4YVUA 2HXAA 2NY0B 2QTEA 1QKZL 1FF5A 2R39A 4L1LA 3V0HA 5CGYD 5I6KA 3RKPA 4X5XB 3WE1A 1CS6A 1R5IB 2Z7UA 2B39A 4C54A 1YEFL 4XMKH 1RUQL 2MOVA 4OM0L 4DHLA 1BPVA 4CVZA 3N42F 4HEPA 3G9VA 1W72H 2V9TA 5T3XH 1OHZA 5ICYA 3QS3A 2SODB 2CGRH 2DICA 3X3FH 5KG9B 2AJ3B 3N40P 4KI5C 4GAGH 1FC1A 4ODVL 4BHUA 1J8HA 2VMDA 3GSNL 4XX1E 4ZW7A 2ROYA 2AQ1A 1H0DB 4AENB 5JW4Q 5FXCH 3RBSA 4IRJD 2JKNA 5TQ0L 1Y6KR 4FJYA 2KPNA 1QFPA 1YPZA 5HHOE 3T0ED 2QBWA 1MPAL 3HAEB 4JM2D 4OF6A 3MZTA 3Q2LA 3UG4A 5LNDA 1KIQA 3FT2A 1TITA 2HRHA 2DB8A 4HH9A 1DE4B 1FV1A 1GRWA 4MAZA 4RX4D 3RWEB 4D7PA 3HZVB 4UT6H 1DVZA 1HHKA 2B4CH 2X89A 4P9MH 1A65A 3LZRA 3V5DB 4ZFZA 3P02A 4WUUB 4HK0A 4NQTA 5ICXA 3ZE0B 2BNRA 2HFEA 4QTHA 4WW1A 4OF0A 3IDJA 1DEEB 1N5AB 2KHAA 1JF1A 3FK3A 1MRCH 3R4RA 1OT1A 3KE0A 3UC0L 1QLFB 4PRDB 5C6TH 1UUNA 4H1LB 4MZRA 2D9QB 4J6RL 1XF4A 4GRWE 1DBKH 1HSBB 3WEXB 3PP3H 5JPNC 2XTJD 1XV8A 3F2LA 3Q8EA 1MAML 2R4SL 1L9NA 2ARWA 1QTYT 2XJLA 4F91B 5D6CB 2X4RA 3NP4A 2Y07L 4M9PA 2AERT 4AXWB 1SXAA 1JRHL 2CCVA 1WF5A 1DLFH 2IC2A 3ARDD 3PHQA 4JGJA 2J6EL 5DO2D 5AUMB 4FQCH 1MCCA 4H88H 2BP8A 1RAMA 5DMKA 1ITCA 2VUKA 3A6CL 4WY7L 3RP1A 3I2CH 4N0YL 5IOPA 2IMMA 3K7UA 2BP5M 4NP9A 4PJXB 3QUXC 4HLEA 5IR1B 4NKDB 3WIIL 1A6WL 4NZRH 4XN4A 1QOKA 5K93A 3V0VA 2IAMC 2O72A 5IEKB 4WFGD 3VFRA 1K5WA 4ZX5A 2FEEL 1E8XA 2JV6A 3ME0B 5HJBA 1C7TA 3VUAA 2DL2A 3BRGC 1DLHB 2V3FA 4MMXA 3ZOAA 3I74A 1OHQA 1KCKA 1CU4L 4WU5A 5D1XE 3B7RL 2BH0A 2ZOKB 2HCZX 4JFEB 1MCIA 2Z8RA 1YY8A 4U49A 4PJDA 1O5PA 1TF4A 4TNFA 3MLTA 1JGEB 4K2UL 5C0RH 3FRPG 4JZOA 4XP4H 5ABDE 2ZXQA 2Z31B 1IC7L 4HHWA 3OMNB 2AITA 1OANA 2XYCA 5DS8A 4APQA 2ED6A 1G87A 3GS4A 4XMLH 4OLWH 4PM1A 3OAUH 1VF5C 1J87A 5C8JB 5DZVA 2F8XC 4GXUN 4PLNC 4TNWK 1PQZA 1JI1A 1FYTA 2VUOA 2GK2A 1BYOA 1TVBB 3VE0B 5I8EA 2W92A 5FO8B 1AR1C 3S88H 4ZT1A 5D71H 4LE8A 4UT6A 4TOYH 1JZ2A 4PGJA 1AS8A 1VCBC 2BVYA 3B9KB 4B50A 2FL5B 2Z8SA 3QJUB 4X4MA 2KPWA 3QR2A 1K3IA 2GBAA 2O6FA 1H6TA 4EIUA 1QSFB 2FO4B 5DT1L 3D07A 1QSEB 2Z4QA 3BKYL 3P11L 1FHNA 1FO0H 4H0IA 2ZONA 4UTBL 1P7HL 4FMKA 2F9BT 4NNXB 1XB6A 3V8CA 1A4BA 1NAMB 1MIML 2I32A 3AUVA 1D9KC 1TQWA 1JPGA 1ZIBA 1ZVYA 2W59A 5B21A 1NA8A 3CFEA 5BW7A 5ES4B 5TF1L 3THMH 1R3HA 2FDBP 1UZ8A 4BYHA 4FXGB 1PSKH 2JH2A 1PD6A 1J9RA 1F3JA 4WO0A 5LXGL 2E9BA 3CMOL 1DSFL 3W11C 1GC1L 1RK7A 2PCYA 3ZSSA 1H3XA 5CWSA 5C9KA 1EERB 3L4YA 1IFRA 1MCWW 1UGNA 5EMYA 3HR5B 4PY8I 2SEBB 4B7IA 3IGAB 3CFJA 3AROA 2CKBA 4A2FA 1ETZA 1YNKH 2M8XA 3IMTA 1PY9A 4P2QD 3ALXA 3UBHA 2BS9A 3ARTA 1MIEL 4JRYA 2IDQA 3W39A 1FNGB 2CD0A 4LARL 4PBWD 3LS4L 3GXFA 5DJ0A 4MDIB 5IFHH 2LOEA 4RIRA 5DRNB 3UEQA 3RJOA 2CCLA 1I7TA 5E6ZA 3SKUD 4YQXL 1MZYA 3MA7B 5ID0B 3CFMA 3L5WA 2G0KA 3GFUA 3MXVL 3QXDA 4XO9A 5DD0L 5LGYA 5K1NA 5DJ6B 4NYLB 3KMDA 1MCDA 3KM2A 4LLYB 2X1XR 1UXMA 1XMEB 2HT2C 3ZW3A 1I9JH 3DBXA 3OX8B 1O6SA 2NPLX 3BP7B 1KLGA 3N43B 4QXTA 1JZ5A 3HTLX 2AJVL 3NA9L 4GG8A 4M7LL 2B9AA 2OJEB 2AEIT 1YEFH 3HR6A 4PRBA 4YHOL 3E7JA 2EC8A 4N9OB 3STZA 3GXMA 4DZ8B 4JFDD 2DMBA 3PRZA 4ELMF 4Q4IA 3GRWA 2A6JA 1I9IL 4LB8A 2G2RB 3F7RA 1OP9A 4AQ8C 2I5YH 2QSTA 1G6RB 4IBLT 3HEIB 3UIZA 5ITFB 1DJIA 3VFNB 3VXOB 4F2EA 1FH5L 1SDYA 1B0WA 4G8IA 4G6JL 1AZVA 2X2HA 3LKQB 4BJLA 1I4FA 4BRVA 4X5PA 4OZIE 4LEOA 2L8AA 3DUUA 1YEJL 1VESA 3HMWH 2HJKB 1PG7L 2ZYHA 4WKXA 2BFVH 2HH0L 4M3HA 4E9WA 3HG0A 2MIZA 5DCCA 3B8SA 1EJ6A 2AP2A 2NR6A 1MUJA 2G5UA 4DZ8A 3A23A 3NJIA 1JPST 1Q94A 4OZHE 1L9RA 2OMBA 1YCSA 2DQIL 1THAA 4WFFD 2PO6B 3FMGL 5CSZA 3MJ8B 4MDRA 4OY9A 5DUPL 3EG9A 4DEUA 1RK0B 2ENJA 2WTOA 4I2XA 5GHWH 2VABB 2F6AA 3QWQB 5JW4M 2WXHA 2J72A 3P77A 4M8RA 4HA1A 5AOKA 4F7TB 3DYOA 3OJDA 3QEQB 2FAUA 4ZUUB 4JDVA 4BFNA 3DX7B 2ZOUA 1WFIA 1JJUA 4B60A 4UT9H 3CXFA 3RWCB 1M57B 5A3ID 3DRQB 4HJTA 2WN3A 1KLUB 5GJTH 1QFWM 2WO3B 4NC2B 4NQCD 3C08L 3LHAA 3OKLA 3X2QB 5K9OA 1GVIA 3K8KA 3FQXB 5BW7C 2B0SL 4QOKB 4AQAB 1QNZH 4I77L 1E67A 3VQ2C 3LJ3A 4AT6B 4DGUA 1Q8MA 1MHEA 1G4RA 3D30A 4GAJH 4L1SA 3B2DC 4XB3A 3PL6C 4K94H 5D7LE 1VFAB 4XGZA 5GPRA 4PJAA 1JHLH 1HWHB 3GI8H 5F7WC 3U4BL 3BW9A 5KJ7E 2ZSWA 4DPRA 2VMEA 2KERA 3TJEL 1XSOA 2B16A 2EDWA 2IH1A 5KBKA 4PJFF 2A9CA 2VDNH 3QUYA 4XNMA 4A7GF 5KSUB 1CICB 2VZVA 4RGMC 2AANA 2WWKO 4ONFH 3OZKA 3TN0C 2AHIA 1N6VA 1E3FA 4J3OD 3P3RA 4HV8B 3P3YA 3QRBA 4PWEA 4NHUA 1IIKA 2WXQA 2W9DL 1E3XA 4NUJA 5JHAA 3VVVA 2VB5A 2OR8A 1S9XA 2JCCA 2PCXA 1NPJA 4FABH 1AZBA 3UPAA 4BK5C 4R83A 2N56A 3E3QC 4PPTA 3VD3A 5I28A 1BQKA 4FXLA 4X7CC 3DA0A 1DANT 2JELH 4WFHE 4ZG1A 1BMZA 1E5AA 2P5WD 4NC0B 3O8XD 4FULA 3FO9A 3D3VE 3ETTA 3NSYA 1AYOA 5HHXL 2NY5H 1S5IH 5GS0C 1QACA 4D9LL 4O58H 1S9YB 3CHQA 1D6VL 2E7LC 4DP4X 5CJXC 5DUBA 1DANU 1DQDH 3PWUA 4Y19D 1HHGB 3F12A 1UA7A 1ADWA 3VM7A 4PJ8D 3WJMB 1U3HD 1CFNB 1P4BH 2B5IC 2QGDA 3BSZA 3OXRA 5IROA 1EVUA 4ZK8A 3T0VA 4OGQC 3ML8A 4RMSA 2CO6B 1MF2H 2VO8A 3CE1A 4LPUA 1E27A 3NCXA 2Z8WC 2W0LA 4JPVL 3I6GB 3ILPA 3VSUA 4F7KA 3MRFB 4DGIH 1NCDL 5D7JD 4YSSA 3AADB 3QEQA 5I82A 3W56A 4ZAKB 1BVKB 2Z3FA 5AOZA 3RAJH 3BP6B 5IP4A 1AD0A 4AGNA 1KF9B 4TPRH 4GO9A 1PD0A 2F8OA 3MOBL 4P2YA 4JG5A 1CFBA 2FR4A 1DVQA 4I4WA 3M07A 2Y5TB 1UM4L 4M43L 2DBLL 5L2KD 4KZCA 1BZ9B 1PTZA 5IKCB 5DJ8B 4KK9D 2VL4A 2BP8B 2W60A 2WMPA 4UANA 2HFGL 3DO4A 3K6SB 5DVPA 1LEKB 1NCWL 1XL4A 2HVBA 3IRPX 3MRLA 4WWPA 4L29A 3MRQB 5IY5B 1TQBC 3MJ6A 4HIIB 2GEQA 4TUKL 3TWYA 4D94A 2CSPA 3QI9C 4FG2A 1XAKA 3TF4A 4XPGL 3PL6D 4N6QA 4PCYA 3VFGL 4FYQA 2NZIA 1DR9A 1IL1B 1JZEA 3PV6A 5H2BB 3TEXA 1SQMA 5I1IL 3WNIA 1K5NA 1AHKA 2GFBB 2OMZA 4XCFH 5DJ2B 1RJYB 4R3SB 1MQKH 3DI3B 3KPLB 5FOBB 1I9EA 1D7DA 2MH4A 4L4VD 4ZMQA 2NY6D 2PPEA 3DYMA 4MA8L 5L4JA 1DQVA 4G6MH 4B6ZA 4LLDB 1SF5A 3QEGH 1DEEA 2XBZA 4PP1C 1JNNH 3ZDXB 5EEUA 1UD6A 1R24A 1IZJA 1DTUA 4Z7OE 3DJRA 3S96B 5ESAB 1C5DB 4Z9KB 2VR6A 3UZQB 4HWBL 1OPOA 4Q6IB 1SFDA 4J2QA 4PLKD 4BQBA 2YXMA 1DE4A 1SOQA 1IJ9A 1UADC 4NJ9L 3GB7B 3R0MA 4Y4FA 3KWUA 4ZMNA 2X4UB 4M8VA 3RJDA 2OMNA 2R1YB 5JNYB 1MFBH 4MJ4A 2BSCA 4N90D 5J4MA 1JV2B 2ED9A 3VGGA 4K9EH 3TWCL 5GRYA 1PZBA 4L3FA 3M88A 3O4OC 4QXWA 1CO1A 2CBMA 2DWXA 4UBDD 2P46B 4GKSA 4NLHA 2LU4A 3AAZB 4HU2A 2ZCHH 4R97B 1F11A 2WM0A 1U3NA 6CGTA 3ZXAC 1EMTL 1KGJA 4ZPVB 3MYJA 5C7XH 1DUYA 1HEZA 3E6FA 2Y72A 1QR1B 2DI7A 2ADJA 3GGWA 1JNLH 3H9HA 5D96B 1THCA 1U33A 2GG1A 1ZJBA 3VFMB 2H41A 4PSRA 4NO0A 1U8NB 4BUQA 4TV3A 4YK4B 3KPPA 1Q9OB 5C0AD 4ADJA 4FZEH 3QEHA 4G9FE 3P4OB 5K9JH 1CMOA 1JPFB 3WNNA 4FQPA 4K3EL 4P5TB 3MRHA 3RPKA 2B15A 1F11B 1G7MB 1SVBA 3UTTD 5GGUB 5GZOA 4GKSB 1WZKA 1S7RB 1E4JA 1DZBA 4K8RC 4O02H 4OFDA 4U6TA 3ULUH 3CK0L 3PQYD 2F53A 3KPOB 5HHNA 4TNWF 2J57A 4YE4H 1RZGB 2XN9B 3KPSE 2CWRA 3P9MA 5CP3A 2GC4C 3KVDD 4NZ8A 3X11A 5DK3A 5F3FA 1J5IA 2HWZL 4A6YA 3QHTC 4ODSH 1SUHA 4CSTA 4ZNEE 3WFHA 3TJEH 3MTRA 3NSDA 2MRYA 4KTEL 3SEPA 2P3YA 2YPLD 3ZQXA 2Z92B 4QD2E 4PY8J 5BVPH 4HUWA 1EZSA 3B37A 3WIFB 5IWLC 3MV8E 1QI3A 2ALAA 2DD8L 2ZX8A 2Y9RT 2N7BA 3VXNB 3OAWA 4WFED 4WDIB 3V5HB 4ONFL 1I31A 3MXWL 4YZFF 1HWGB 3VXSB 5EF2A 4N2FA 5HYJD 4J12A 1CLZH 1E6OH 1TQVA 1KJ2A 1KB5L 5FYLD 1RZJL 5FCUH 3PREA 1PZ5A 4I48A 2MJWA 3T6QC 1NGQL 3HC3L 2Y7LA 1P84J 3V6ZB 1KC5L 1IC4H 3WY3A 1OWWA 4JRWA 1RZFH 3PFUA 5GISH 3E1F1 4L4TB 4GMSH 2FHFA 3TZVA 2WCPA 5A2KH 5CEXA 2HT2D 2WXKA 4K8RL 4L4VE 5IMMB 4XPHL 4LLVB 4KKCC 4U1NA 3MX0B 1KDIA 3VTAA 2VO5A 1PCSA 2RR3A 2QV2A 4N2NA 4KX9A 3G6DL 3OLEA 3LKOB 5E2WH 5B3SB 3QG7H 4AVIA 5I71B 1CF8L 3LIZA 4PJ5A 2VLME 3U30C 4W4NA 3WJJC 1UXSB 4D9QD 4QHUA 2H2SD 4EQ2A 1QUPA 4QXTB 2BOBB 3ZDYE 5CCKH 1USZA 2YEVB 4AYGA 1I8LC 3A21A 2HVKA 3DI2B 1DVFC 1ZHBA 4P5KA 5CBAB 3KPQA 4ZAKA 2A73B 1MF2L 3S36X 5AKRA 3VXUD 4IW4C 1GGCL 2IANE 1E4WH 1WFUA 5TE7H 5DJCA 3I6GA 1BF8A 2O1AA 1HH9A 5IVXB 4URKA 4RAUB 3SJVB 5B38A 1HYRC 5HGBB 5SWSE 4G8GE 3TV3H 2BSSA 4L3ED 4X9HA 3FB8B 5F3BA 1K6QL 3QNYA 4OBSA 3NCWA 4TRPL 2VXUL 4RH4A 5KW9H 4GPVA 2IWFA 2HVJB 1OM3L 2JWYA 3BYTA 1OAXL 1AO7D 4DP9X 1NC4A 3M6DA 4LSUL 4FKHA 3ASWA 3LEVL 4KKBC 5G5DA 4NI3A 1G6VK 4UV7H 4APXA 4XCCL 2R23B 2FJGA 5DVOA 3TCLA 3PNWB 3UTTE 3ESOA 2XJKA 3HAEA 1I7UA 1AR1D 1MCPL 2F54B 2P8MB 3NN8B 4K9JA 4FX5A 1ULVA 1TQBB 1RU9L 2ZIDA 4U6VL 2XX0A 2YUWA 3VCLB 3QFDA 1KXTB 2PXYB 5LNEA 1J05A 2JCCB 1BD2D 4P8QA 3EJRA 4L4VB 2J3SA 4QAMB 1T0NA 2ZWNA 3HBPA 2NDGA 1QHOA 3NSJA 4MJID 1P6FA 4NHUB 2OTWB 4HIEB 1X7QA 4LDEB 2E3VA 4GINA 4FQQB 3G5WA 1IGIH 4LHUB 2LLGA 2V6HA 3BAYA 1D6EA 3QEGL 6FABL 4MCYB 4QWWD 2OA9A 3BVNB 3MO1A 2Y7QA 5C0BE 1EXHA 5D1ZA 3LYRA 3WTWA 1AZCA 1DVYA 5I0ZA 4QRSA 4IHOA 4ELKB 4I5BA 3BXNA 4NKMB 4XNQB 4MLIA 5IGXH 5D2NE 2A83B 3LH2H 3BPLB 5F89B 3EDKA 3BH9A 4GP4B 4MSWB 2DQTL 1YQVH 1YEKH 3KH3A 3IAGC 3S7GA 3WEMA 2VDRH 5BV7H 4A7SA 3ZT7A 5EC2B 4GKNA 5JQ6H 4PSPA 1RFDL 2OL3B 2IG2H 3FT4A 1OTUD 2MCG1 3RUGE 1U0QA 5KYNA 1JRHI 1IC1A 3O0RL 4PJCB 1E6JL 1TZAA 5F71A 1BQLL 5CCHE 1CDJA 2DV6A 3HC4H 3CN3A 3KPSD 4N1EA 3WEAA 2FATH 3GRWL 4CC4C 4OUUB 5TQ2L 2ESVE 4KRLB 3SPJA 1BQUA 3L7EA 1BJMA 1FYTD 2FT6A 1BSIA 3ZPDA 1OARL 1HHHB 4JPQA 3CVDA 1MWAA 3RB7A 3MFGB 2APVA 2NCEA 3UBXB 3JV6A 3MV8D 4FP8H 3MUZ1 4FF9A 5D93C 3BMVA 3O3DA 4MS8D 5FYKU 5DMKB 2NY3D 3C2SA 3BSZL 3CHPA 1FDLL 2DM3A 4PJIE 2WLJA 5K9QI 4BA8A 3GM8A 1BZ7A 2FQFA 2EC9T 3KPMB 1N0XL 3QORD 5ANME 1CFSA 1DQQB 12E8H 3L9YA 3DX0A 2FBRA 4XMTA 4M1CC 3IPFA 3BIBX 2UZXB 2DKSA 4WFHD 1WTGT 2XOTA 3Q8AA 1WAPA 3RIAF 2CM5A 3CIQA 5CJOH 2VQTA 3JTSA 1JTTA 3HE7D 5EIIA 2CCWA 3C6LD 2CGZA 1G7PB 4GRWB 2DLFH 1AXSB 1UH2A 2E76C 2AZUA 2C9UA 4HH8A 3TBWA 4UB0L 2X38A 2GTZB 1OAZH 5C0AE 2H3NB 3MU3A 4NQDA 2RH0A 3HE6A 4AQOA 4OJFH 1R3LB 2J8UA 4KKAD 5B1JA 2PW1B 3UTSE 3A4EA 2WO4A 4NQXB 2FJHA 3T2OA 4DUXA 3DVNA 3HC3H 1E5BA 1I7TB 3SYPA 1PLBA 3N44F 4LBEB 3W3BA 1UWYA 2GQHA 5FWRA 3BE1L 5M95B 3LPWA 5JHLH 3MLRH 3SDCA 4HZLA 3ROLB 4XN2A 2YD8A 4HS8H 2C9PA 4U6YA 2MKWA 3GI9H 1B4JL 4DGWC 3N9GH 5SWSD 2YPVL 5KG9A 4IMKA 4PGEB 3NA9H 3AM8A 4JY6A 2EDXA 2VC2L 1S5HB 1V8HA 4N24A 3RGVA 3U1SH 3RIFK 5MENA 1BZDA 3U46B 4CU7A 4G8FA 5TE6L 1P7BA 5CZKA 1QASA 1ZLWK 3R8QA 4K3DL 3TFKD 3C2AL 4GLRI 1UG9A 3O2DH 3S48A 2CBTA 1ZCRA 3X1BA 5AD0A 3HFFA 3U82B 4BZ1H 2GJZB 4N0CD 3GJFA 5EUOB 3X14A 1WBYB 3PXLA 1F6FB 1FL3B 2JB5H 1KN2L 1DBMH 1SHWA 2UX6A 4KVCL 3KYNB 3I02B 2NY6C 3P2BA 4FI7A 3G08A 3LAFA 1NLBH 1GA2A 1HXMB 3HZMA 1AOZA 2AK4A 3GSXA 5DUML 1NCJA 4HWUA 4JZJA 3HB3C 1T20A 2HFFA 5KVFE 3FONA 4KXCA 4YDKH 2P42B 4ZFQA 5INDA 4D2NA 5I6XC 2KLTA 1BVNP 4Z76B 1A7NH 3KGSA 3CD4A 2DM4A 1Q38A 3N6YA 3BAWA 3S9DB 4LHUA 3L9BA 1V10A 1T1ZA 2AXGA 5FGBA 2X6MA 3ARGB 1RUKH 1SBSL 4HCRL 5HGDB 4D8PA 3FW6A 4HVBA 4U1SB 3FQRB 5IMLA 1UOWA 2BSDA 5EEVA 5GJSH 5I9QB 5E1AB 3DMMA 4TF4A 1SDDB 2QQQA 5HI5C 2H0PA 1QRNB 3T2NL 1HIML 4EKJA 3HNVH 1HI6A 3KH4A 2AMUA 2WXNA 4Y7MA 3FO1B 5KVEH 2BVQA 3MV9D 3VTTA 3EHBC 3RG1C 4E2OA 3DXAE 1Q9KA 4KX8A 4Z7QB 1NFIB 1XGYH 2N0KA 1BOGB 5HVHC 3U46A 5EU4B 1LDSA 3D09A 4LLQA 3K5RA 2BNQB 2N7AA 2YA1A 4QY8B 1SOXA 2WBXA 4J3SA 2XWCA 4PBVC 4NM8L 3Q2VA 5FC9A 1DN0B 1MFNA 4IRSC 1JPEA 4IOFD 1HK6A 1KGYE 3V0VB 1RKRA 1DQIA 3JTTB 2QQLH 3GBLA 3ULVC 4KI5F 2EDFA 5JIPA 4TKWA 3D39E 1EA9C 5F9OL 2COQA 5EBWA 1EWHA 1T66D 2YPVA 4QRTB 2XN9E 3GRGA 1BIIA 1X5XA 5DMIH 5LAXB 3UJIH 3NJKA 5IQLA 3ZUNC 5D1XA 2R0KL 5CJBA 3MRNA 2HFTA 3NGBB 5AL0A 2X4QA 4B97A 1GZQA 1TZ8A 1XIWB 2G9HB 4K23H 3VVWA 2A6KB 5FO7A 1WEJL 1ZAGA 1F4HA 2FJFA 1E5ZA 2BHYA 2YHGA 2NR6D 4P5KB 4J6IA 3QQDB 3LKSB 4LF3A 1MZZA 1ZANL 5CN2A 3TBYB 3QA3B 1J0ZA 1HSBA 1RUAL 3WEXA 4JPIA 5D1QC 2Y23A 1EHLH 1RMFL 3P2DA 2Q8BH 1BEYH 5FA3B 3S4SG 1BQLH 4KU1A 2F7RA 3NSCA 1NCIA 3QFGA 5FCSH 3OHXB 1KEMH 3V0WH 3UTSB 4HJ1A 1DVFA 1IIIA 5EPMA 4GYBA 5TQ2H 2PXYD 4IRSB 3TVMD 4WW1B 2EQDA 3N5AA 1FH2A 4OZGB 3RBGA 1HE8A 4XVSL 2X10A 4FXTA 1YUHB 2F7OA 2NQCA 4G42A 3GMRB 1QRNE 2HJFB 3PHOB 4U3SA 1QUNA 1YNLL 1A7QH 5ADPL 1NEUA 1WWAX 5F7NC 4N6RB 2VRKA 3UAEA 3IDMB 4LCWB 1PX4A 3FQ2A 4QYOA 1UACH 4FLOA 5EBLB 3D34A 3HMXA 5IROC 5JIKA 1MLBA 1R19A 3RZWA 5E8DH 3FJTA 4P5MA 4OLZH 1QRNA 3IAQA 1ZRUA 2F08A 3BH9B 5H37H 3OR7B 1VZHA 2LT9A 5I23A 1UKQA 2R59A 3F83A 4XNQA 3VG0H 1TKWA 4YUEL 4WGVB 1OV8A 1IC5H 4MCZB 2BSTA 2P5EE 2D8KA 3QG6B 4JGNA 1MFVA 3CZFA 3BWAA 2ZXDA 1KJVB 5D6DC 3UP6A 3U7AA 1X7TA 1JUFA 1MIMH 1BFSA 4YGAB 3OF6A 5JHDA 2YGNA 4OJCA 3FT4B 4CAGA 4Y1AB 2WQSA 3V10A 5KYUB 4A7GA 2YA0A 2UZIL 3BLBA 2F1EA 3O2DA 4WI0A 5I1JH 3FSWA 4P48A 4IRZL 2J2ZB 4KKLD 3HS0A 2AAVA 3PP4L 2W88A 5JXAL 5HYFA 2FH6A 3TEWA 1DSFH 3BT2H 3I02A 3T0XA 3MODL 1KXTA 2PXYA 3AU1B 3SDXE 1SXNA 2FWLB 2WXMA 3D8MA 5DJDA 4CMHC 4P46A 5CIPH 1WIPA 2VXSL 4FERA 3UZVA 2KT6A 3GXPA 1RULL 1OTTD 5L88H 5HYEA 3L4WA 2FEDC 2D4FA 1FI8C 3RDJA 4YEFA 4X0KA 1EGJH 3WNKA 4S0SD 5KYXB 2CJUL 5L2JB 3D25A 1DJZA 1BBDL 2JFCA 4GKLA 1ET7A 2E59A 4YHML 1NBVL 2NQDA 4JM2A 1BFOA 3ARDB 4OW6A 3RGVB 3ZIMA 1XTMA 2KMWA 3TCXA 3WLWD 1KTCA 4MNQB 3E0GA 3PS6A 4NJ9H 3U4EA 1UD5A 1J18A 3I3DA 4JPWH 3ROOA 4AUUA 5AZ2L 2X6UA 2WXPA 1CDYA 1SLVA 2MFNA 5E23A 5HI4D 1DJWA 3ROLA 4LZKA 4PY7B 1G1YA 3GLZA 4QEGA 1JZGA 2WKGA 2VJ0A 2WLYA 2JIXA 2Y1VA 3IMSA 4S1DC 2ZUVA 3IDNA 4K7FA 2ZP0T 4PVLA 2X4OA 4YPJA 3FSZA 1NMBH 5C08D 5ACZB 1J12A 4AYID 5T3XD 1DUZA 4EN3D 1XGRA 3C6SB 4TNGA 1K4DA 4EAEA 1OF2B 2GC7C 3JWOL 3LIZH 3HZYB 3MOAH 4QJ3B 5DFVC 4NRZB 2MPAL 1RHFA 2B59B 4JJ5A 5A2CA 1ZY9A 3QJOA 1Y18B 5AOIA 2I26N 4F3FB 5GGQH 1S9VB 3N1QC 1MJUH 1DQKA 5IFAH 2YEZA 1HE7A 2ZNWA 4R3SA 3BEVA 3FSAA 4CC0A 3FCGA 3VGHA 4E9RA 4NFBA 1CYWA 5TPWL 2WVTA 4ZTOL 3CN2A 4Y2DC 1E3ZA 5KOMC 3FB7B 3ARGC 2X40A 1FFTB 1P5UA 1FZJB 4QRPD 5E2VH 4XZUB 4QHKI 5F7FA 3ZE0F 4PJEB 3ULUF 1T04B 1X4ZA 1PZUB 5I0DA 2K4WA 1N0LA 1LP9B 2FRGP 1SBBA 5C0EA 3QEUB 3EOAB 3CAFA 5B8CC 4G59C 3GXDA 1AJ7H 5DR5H 1LK3H 1NCHA 1QKZH 2W1NA 3HRPA 4MHHG 1XH3B 5DZAA 4U31A 2OYPA 2QKIC 5E4AA 5E7FA 1HQ4A 2J5WA 3MLXH 5J1SC 2YUZA 4L18A 2CLVA 3QIBC 3BUIA 4UAHA 2X70A 4LVNB 4M56A 4WTQA 1QPPA 3FU8A 3MR9B 4F33A 5C6WH 2OMWB 4NBZB 3QIWB 1RIVH 2JXMA 1G9ML 2DMGA 4Y4HA 3MRFA 1DBJL 4HFUL 4LNRA 1CLYH 2ZKWA 3EDFA 5I6MA 1A8JH 3KLSA 1L7IL 4ZD3L 1IC4L 2LVEA 1IARB 3TO2B 3Q6GH 1G7JA 2NNCA 4HW6A 4DETA 3FFCB 1GR7A 3GUTB 3FSVA 1SNRA 2L7UA 3SCMA 2GAZA 4G5AA 3BSGA 5G4OA 3GKWL 2YZ1A 4PFEA 7CGTA 5EU6B 5E6YA 1SM3H 3PWNB 4L1TA 1NZRA 4A7VA 4KNSA 4Z7AA 2JVUA 3G04A 3EXLA 5GS0L 1I9RL 1LK2B 1WBZB 2E7BA 5ACLA 4AEIH 2WZPD 1VB9A 2L3BA 5DUBB 3NJNA 3P73A 2UY7B 3QO1A 3EYUL 5J13B 3P9MB 3K2UL 1KEML 3V6OE 3LV3B 3FB5B 4AVKA 4AUJA 5E2TL 5FA4A 1UM6L 3RNKA 2AK4E 2CGYA 3IDXL 3UC0H 3ZYZA 5LN8A 3MRIA 4XAKE 4D0DA 3NA4A 4NGHL 4ODXA 4LL9A 1QG3A 4M02A 4HWNA 1NC2A 2FWOB 4UOZA 4MNHB 4U3HA 1BF2A 1WFOA 2VDQL 3UX9B 5KYYA 5C0DB 3CZKA 2PTVA 3CXHK 4YHYC 3GK8L 3DWTA 3CBRA 3WAJA 1TJIH 3L5IA 4HJEA 2XVGA 1R34A 4RISH 4LCCB 4OLUL 2WWOA 4H0LC 3ZKMD 3JYBA 3ZRSA 3RUGA 5EU5B 5MEQA 3MV7E 1A6ZB 3S5ZA 3LDBB 4X99A 1V7NH 3I3EA 5FYLH 1NFDA 4U33A 1EGJA 5TQ0H 5E9DE 4P04A 4I3GA 1N64H 4R9HA 4OF5A 4M03A 1DUYB 1MG3C 1ML0A 3E6FB 1B3JA 4X7FC 3APDA 4YDNA 1H8LA 3P4LA 1NCBH 4PCTA 5DK0A 4AYDC 1NTDA 2DJMA 3WIHA 5FIEA 4ZMVA 5EEWA 3AJ7A 2YLKA 3OMIB 2HKHH 2Q3ZA 5ENWB 2BVPB 2FSEA 3LRLA 4BSVA 1RJYA 4H20H 4RFEA 5HGBA 5I76B 5AVSB 4OM0H 4F7MA 1N9PA 1BVNT 1D9KB 3GHBH 4U6VH 4X7TB 1U3HB 3L3GA 4LNRB 3L3OB 4U1KB 3QIWA 5A43C 5LWYH 1DBAL 2A73A 1NGPH 2VABA 3KHQA 3P30H 3SGKC 2OXHB 3U48A 4X6FB 5JIMA 3GO1L 1NCWH 4WEBL 1VLXA 1QFWH 3EG9B 2RALA 3KL0A 4HCRA 4P06A 1JZ3A 1TVDA 1FLRL 1KENH 4HXBH 4RMUA 3S36H 2IGTA 1EJOH 1O7DE 1RH8A 3BAEL 4JFFA 4HISA 1XH3A 1B6DA 6FABH 4P23D 1NDGA 1ZV9A 4I89A 4YFEA 1JNHA 4HJ0D 1DN2A 1OZTG 3SKJL 3T2PA 1QPKA 1IAIM 4WK0B 1BYNA 1UVQB 2BK8A 1BPLB 4G1EB 4X8JB 4CDHA 2FR4B 3OAYH 2E75C 4Z7NE 2JB6A 2JTYA 3O45B 5AZ2H 4RGOH 5EEZA 2VQ1B 4G6ML 3H85A 3UAJD 3MRLB 5BV7L 1HWWA 5FM5M 1S7SB 2JCWA 3OXSB 3IFPB 1J8KA 2EYRB 4M9OA 5FYJL 2OI9C 3U7WH 1TZIA 2FGWH 4JG9A 4XNXL 1KGCE 1MAMH 2E27L 2R4SH 2ZG3A 2XICA 4OJYA 5J6HB 4OFVA 4UDTA 5DC9B 3R0NA 1G7HB 5C0CD 1MW1A 5DMYA 5I74C 3D0LA 1KDJA 1OVZA 2NT1A 2O30A 3OG6B 4C59B 3VDAA 1QRND 5I16A 2DQEH 3RIKA 1M7DB 1U95B 1OQOA 4MJ6B 3ZZLA 3V0FA 4JN2A 2HTKD 4NOBA 1VGEH 2BNRE 4MA3B 5I5IA 2ED8A 3IDNB 4Y9BA 2F53B 3B8YA 3MBEC 4M00A 4BELD 4P23C 2VLLA 3LS4H 5D9SB 5CMAB 1ROWA 1IVTA 4CN1A 3MUJA 5IHWA 3VI4E 3JVFC 1JWUB 1MFDH 4HIXL 5DK0B 3S3JA 4URTB 2IBZX 1KCRH 2R69H 1G7MA 2QELA 4HG4K 4MA1B 2W80C 4MNQA 3WHXB 3LHPL 5DHYA 4MAYC 3L5HA 3IJYA 1QLRB 3KD4A 4LSVH 1OT2A 4PGDA 4AIOA 5I1AA 4LOVA 1GPOH 1TT6A 4AW4A 2QZ5A 5GRVL 5KYXA 3BUTA 4LESA 3UMTA 1L9OA 2DL9A 5KSUA 4QT5A 3EYQD 2CXKA 3LEXB 3D39B 5JPNB 4OLWL 4FQ2L 4UQDA 3TH4T 4YE4L 4MS8C 5ACMA 5C7XL 1A1MA 2XV6B 2Z0UA 3LH8A 3DVGA 4PJAB 1RIVL 3AW5A 3GLEA 4MD0A 1UXWA 1G9MH 3QNZB 4RZCB 4KRNA 3OL2A 3KPNB 2QGEA 4G6JH 5DS2A 3OSVA 4N8VB 3LQAL 4UCFA 4Y4KC 2EDDA 5AW4B 3V5KA 1U3ZA 4R5VA 2AXJA 5D9SA 3ARUA 2O6DA 2HJLA 3QFJA 4LSRH 1G6RH 1TEYA 4X4KA 4R96B 3LZLA 4P99A 1H3GA 3FUMA 4HS8L 4GAYB 4W9KC 2H6UA 3LKNA 1PKOA 5J0BA 2CHXA 2IOOA 5IMOA 1NAML 1EHKB 3TNNA 4MCZA 3L48A 2XXFA 4LEXH 3FU7B 5JHBA 2YEQA 2MQ3A 3DVIA 1H6FA 3FCSA 1GCFA 3EIFA 2B4CC 2BC4A 4DGYL 5FYKL 1E40A 3TA3D 3MKKA 1AS7A 3RWFA 3GEFA 1IAII 3FN3A 3L2NA 3OKNA 1Z5YD 2OMZB 2ZUQB 5DJ2A 4AQZA 1GC1H 2H9GB 4LAQH 2J8HA 5LBSH 1BAFH 2ZXBA 3I9PA 3MRKA 3WNOA 1DBML 8PAZA 1HS6A 3KBHE 3V2AR 1WGVA 1A2YB 3RVUD 2VDQH 5T8IA 3F64A 1I82A 1MRFL 2VERN 3MQIA 2BP0A 3RDTD 4IOIB 2GPZA 4G8GD 4BE5A 5MI0B 2V7NB 5E5MA 1KSRA 2XKUA 1XD1A 2LU3A 5IEKA 1IVLA 1MI5A 1YMMA 4BRJA 4GEIA 5KS9A 4EDXB 2ICES 4NHCH 4EKXA 2I9LA 2IBGA 4LCYB 2WWMC 2X42A 1EANA 2YD7A 3US1A 3OHMB 3K6IA 2ICWB 1JYWA 4JPIB 4I0CC 5D8JL 5AW8B 2IEPA 1GGIH 5DEGB 3KL5A 1WZ1H 4UAOC 3NZ8A 3TC9A 3WIAA 1GXEA 3TV3L 4FC3E 1LO3L 3I75A 2YRLA 3HG1D 3QZWB 1YJDC 4YDJA 1RP8A 1NDMA 3FTSA 4JFDA 3CVIH 3TO4D 2AJVH 2HKHL 1PMYA 3FDWA 3STLB 4UQ2B 2QTVA 5KVEL 3ZSTA 1K8IB 15C8H 3KYKL 3UYPA 3RU8L 1XF4B 4XC3H 3SGDI 5I19L 1OTTC 3X12B 4XTRD 1E27B 4DVRL 2DIBA 1OAUL 1RD6A 5GSVB 3LRSA 4JRYD 2YBRB 1SRDA 1RV6X 3QBTB 1J1PL 4ZX6A 4HCGA 3T3PF 2G60H 4CADB 3AS0A 2CNZA 2AJSL 1S46A 1Z0NA 3FRUB 2H26A 4WUKL 4ZW6A 3ZR5A 3O3AA 4G83A 3GLDA 2SEBA 1JYVA 1TTUA 1KB5A 1XR9A 5EZJA 4W9DC 4PRIA 3HFML 4TTGA 4NWTH 2A2QT 3T09A 4QRRE 5HI5D 2OMYB 3WY2A 5GIRB 2DZEA 4GAYA 4W6YB 5MEQB 4TRPH 1J0HA 3RWGA 4PWFA 3UABA 3ZZQA 1WS7A 3SDXA 3W39B 4NQED 1NCOA 1EZLA 1V05A 1B3IA 5CLYA 5E08H 2PF6A 4JRXE 3B83A 2DIJA 3RWIA 5KYYB 1ZGLA 1P4UA 1SUJA 1GYVA 4F2FA 4R7NA 5I1GL 2ZE0A 3BLPX 4N28A 5CS7A 5D72H 3RL1B 2R83A 5CGBA 3C5XA 1Q0YH 1X9RA 3RIAK 2AV1B 1BVLA 2GITB 4YO0A 2UZYA 1INEL 3TIDA 4ZYKA 3OV6A 4XPBH 5IB3B 1RU9H 3ULUD 3K0YA 3K72A 3PDOB 4ZFFA 2JK5B 2XQYK 4H25B 2XN1A 3ZL4H 3QNXB 2GCYA 3CWGA 3PABA 1X6NA 5EOCL 5K59E 3WN5B 3CZLA 3VXRD 1LK2A 1HL8A 1E8ZA 3F7VB 1OGTB 4ZTEA 2F5AL 2HFGH 1HCYA 2X9ZA 3B2PA 5CJQH 1KZQA 5FO9B 4YNYA 2GIXA 4NT6B 3HJEA 1AP2A 1KCVL 2A9AA 2RQEA 2EVIA 4OLVH 3GRWH 2JLLA 4JFED 5DYOA 2C8NA 2EUVA 1JP5A 4AIEA 1DQLL 2FL5A 2WXOA 2FBJH 5DRWB 1OARH 1VIWA 3VFOB 3SKOA 2VM3A 4K07A 4RDBA 3LZNA 1FO0A 4W9GC 3LQZA 2X12A 3CHOA 4XP5H 1U9KA 2CMRH 4K73A 4Y4HB 3CFKB 3P9LA 4G7YL 5JQHC 4WKZB 3VH8B 5DFVD 5JW3L 1MCKA 3VFUB 1TKWB 2OMWA 5AL8A 1NCDH 1F90L 4IM8A 5E8OB 5CSZB 3L3DB 4MJJA 5BQ7B 3OKOB 4HDIA 2LU5A 1ZIAA 4ZW5A 3JZ7A 2VDKB 3PNRB 4ODWA 5MP6H 4M93B 1A64A 4MWFB 1MXGA 1OGSA 4LLWB 4JANB 5CR1A 1IKOP 1HHJB 5JPMB 1OWRM 1KT2A 4DEWA 5D70L 2EXTA 2ADFH 4IRZH 3IN2A 2R29L 1AFVH 4MYWB 2FJHB 4U6HB 4FTVE 3O8XC 2X2JA 3C6LC 3MODH 3QZBA 1D5ZA 2XC8A 2PP7A 3I3BA 1JWSA 2X4RB 4KH9A 1RXLA 2CBQA 1ILUA 2VQ1A 2DBJA 3ARFD 1YEIL 2Q6WA 4ZX3A 3HHSA 1OD7A 1P1VA 2WXLA 2KKQA 3G6JB 4QHPA 2JB6B 5ITFA 3EOTL 3UO1H 1AXSA 4ZMTA 3BKCL 3SDDA 4K71B 1RLBA 1SMAA 3M1CA 1F1GA 1MVUA 4W9HC 1FSKC 3VFGH 4MQTB 2K9FB 3EYQC 2B14A 1NDGB 4KXAA 3WY4A 2YD4A 1JVKA 4UYPA 3BUQA 3O3EB 1JXGA 1K8DA 1QBMH 5DDHB 3SB3A 1S9VA 1C12A 1TQTA 5D5ME 1AC6A 3QUXB 5BO1H 3OAZK 3QC5X 1JPSL 4MFHA 5C92A 1KIPA 3VD2A 1UZGA 2H3XC 4H13C 4LLYA 4UOJA 3H9SE 5F88B 4PYHA 3U0TB 3IMUA 3IS0X 3TTYA 4HK3J 1FO0L 1OGAB 3BCFA 5C0ND 3TU6A 1FZMA 1G7QA 5T1LA 3QDJD 2N4IA 2VR7A 3GMMA 5D1XB 4EJ1C 4XAWH 3BZEA 5D1ZC 3T65A 1E28A 5GGVL 4KO5A 4AC4A 2CDGB 4OD3H 1XGZA 4X6EB 4B0MM 4KTDH 3K4ZA 1QTSA 1OP5H 1FNGA 3OVUB 4PP2B 5I1HH 1URLA 3CCHB 3RVTD 3S3DB 2CRZA 4P2RA 5AQ0A 4K9EL 3NK4A 4MXQD 4E42A 3HN5A 3GPSA 3AABA 1ETJA 1UEMA 5IIEA 5AAWA 5AW6B 5EBGA 3A4AA 2MHAA 4NHCL 3WGVB 2GK0B 3IKCA 4R4NC 4LCIH 2J25A 4YBLC 1D5IL 4WENB 5BRQA 5E70A 3F58H 2NTFA 5BVPL 4N8PA 1KIRA 4L2YA 4R7XA 3CDFA 1AR2A 1S4IA 1TU2A 1AZUA 1BM7A 2F2HA 3JV4A 4GKNB 5I73C 4JFXA 4GSQA 2AEPL 3OG4B 4NZUH 3WO4C 1XF2A 4HWBH 4BCYA 1KC5H 5GS0D 3X1NA 3HOGA 3RTLA 5L2KE 3VYNA 2H0EA 4KMTH 4XBEH 4OZIA 1ADQA 4N2CA 4I1RA 1NCAL 4DKEL 2XHNA 2VXVL 4GBXA 1PKQB 3EFOB 5DJAB 5F9AC 5IQ7H 3VAEA 3U9UA 4FQ1L 4XO3A 4GRMA 1R5IA 1M71B 4Q6IC 4N86A 4PJ9B 1RURH 1JL8A 1SYSA 4APQC 5D1QD 5I5JA 2VW6A 1DCEA 4PB0L 4PJ9A 4XVJH 1NKRA 4J3WA 4AIZA 5JR1L 2AXWA 2E9IA 3UTZA 1WWCA 3ULUL 1SXBA 3VI4F 1J5CA 1H19A 2OTWA 4HIEA 4QO1B 4FLHA 4NPJA 2QLYA 4RAHA 5KSAD 4J3OC 4PRPA 4HMDA 5TDPB 1T5XA 3UFIA 2Z91B 1H6UA 1N3NB 1ZWIA 4TQIA 4FOMA 1R0AL 4IK7A 4LL4A 2ARJA 4PJXF 1OGPA 4KPHL 3BJ91 3BN3B 1A14H 3B5HA 1IV8A 5HJ3B 3RL2A 4M62L 1M56B 3G5YA 3NN8A 3MRGA 4LQFH 3KW7A 1SBSH 2IQAB 4HCRH 4WV1B 1YLBB 4L37B 5D7LD 5AVZB 2PKDA 3OGCB 3HC0B 1RUMH 2WNWA 3K2KA 2XQYG 1CGSH 25C8L 5I0WA 1I3GH 3VD5A 5JHLA 1WCBA 1YN7B 2HTLC 1F86A 4YBQC 4L48A 2XPYA 4JRYE 1J7VR 4G7RB 2CHNA 35C8H 1YAIA 2H32B 2DQIH 4MCNA 4JPSA 5IB1A 4ZFGL 3BGFB 3U6RA 3EAKA 4PJEF 1FZOA 4XMPL 3IGKA 4JLRA 5C08B 4NP4H 2PTUA 3LXCA 4HPOL 2X4PB 4G1MA 4QXUH 3QNYB 3V7AE 5D2LB 5E2TH 4PP2A 4CJ0A 2H8PB 2A6DB 4KNUA 3ABGA 2YKKA 5HDBB 3G5XA 4EI5B 5IJVB 2CDGA 1FRGL 3MNVA 3MRCB 4C4UA 3IXAB 4UT9L 4NNYA 5C0AB 3VFTA 3SE9H 3ALWA 1E9OB 3DHPA 2OX5B 4N9GB 1SMOA 2NSQA 3ARFA 5EZIL 5GJTL 5IQOA 3TEYA 2Q7NA 3DOIA 3EH4B 3KWXA 4WNSA 2UY6A 2QQLL 3DV6A 3BDYH 3W9DA 1UWEH 1MCNA 4HZAA 3T5WA 3MFFB 5CAYB 3TBWB 2R51A 2WAQA 4HETA 1VFUA 4NENA 4X4XB 4X6DF 3S5LA 2G5BA 4PJ5B 1CFTB 2GSGB 4EBQL 2HSIA 3IM1A 1NAKL 3RFZB 2J1ZA 3IJ7A 3MC0A 4CILA 4YR6B 4YHKL 4KO6A 2OMXB 4FFYH 2GI0A 1T03L 4PTTA 2X9WA 4LASH 2ZCKH 5GS1B 1ZANH 4G43B 4OV5B 2NCMA 1AXTH 2DWDA 3L1OL 4LQ1A 1YN7A 1DDHA 2P7TB 3OR6A 1XB3A 5IV2B 4GBXD 3KCWA 5FUOH 3BD5A 3TV8A 4PR5A 1FGNH 5C07D 3E3QE 4FG6C 3ULVL 3KJ4B 3GUFA 1H15B 2CG9X 1X6LA 2G3ZA 3QZNA 5D2LA 1SYVA 3MGTA 4IMLA 4MDJB 4R90L 3KXFD 1BOYA 5LAPA 4AGMA 1A25A 1QLEH 1QYGH 5AG8A 1HL5A 2WIMA 3FO0L 5KN5B 3G5ZB 4O51B 5AVXB 3O8XB 5ESVA 2X2UA 1D6VH 1SDDA 2X87A 1NFKA 3IE9A 5E99L 4PN6A 3ZDYB 2AKRB 2HX7A 3CFKA 3P9LB 1MCWM 3GDCA 4KTGA 1P4LB 1VADB 3F7YA 1LQSR 3CMGA 3HC0A 4M7JL 4DERA 3LQZB 1XCQA 1O6VA 2A6IB 5L2KB 4OCXL 2MOGA 2NZ1A 4X7SL 3C5SA 1CK0L 1ZLWH 2CUMA 4KXBA 4JZJB 3EZJB 1M7IB 1GL4B 1E9PB 3L7FB 3LB6C 3U0PA 1N3NA 2UV3A 2Y36L 3TBVA 1MCLA 1WUZA 3NPZB 4NRYA 1N19A 1V27A 1YY9C 1U4FA 3GTVA 3NYKA 1XCXA 4FE9A 1TEGA 4Q9RH 1KJ2H 2AQNA 2BY0A 2GHWB 2R2EA 2OXGB 3RAJL 1UCTA 4I13B 3VJ6A 2AZAA 4L0ZA 5KYUA 1TSRA 2XTJC 1PZCA 1WD8A 3MOBH 1O9ZA 4I1PA 1SYSB 3CQQA 1I1CA 5EC1B 3SDYH 3FQWA 4ODTH 5FGCB 2NTFB 2HZHA 2IG2L 2XTJE 1TZGL 4WW2F 4X9IA 2GK0A 3IKCB 5DWPA 4FQXA 4IEFA 1XAUA 2HRGA 4AITA 4P46D 2V7HB 4JE4B 1JMZA 3OF6D 4XT1C 1A7PH 2EE2A 1K4CA 2BRRH 2KLSA 1OAKL 3HC4L 3O11B 5BRPA 4ONOA 2VTFA 1GOGA 7TAAA 1L0XA 2PCFB 3SDXB 3QH3B 1OLLA 2XWZA 4ZUVA 5C0JB 3VA6A 3PHAA 3CFQA 4Y19A 3C5ZC 4KKCD 1LEGB 1A7RH 4NQXA 1GZPA 4PJIB 1GYAA 4HKBA 4XPFL 2NY4D 5EZJB 1RUPH 4FXKB 5C3IA 1SEBB 1ILSA 1KELH 1YN6B 4KRPB 2WGXA 3DMMD 3O3AB 3NVQA 2PP8A 1XF5A 4FNTA 1RZKC 2DQUL 1JNNL 4F5CA 1GPOL 2GTZA 2JE8A 4KH2A 2C7UA 3E8UH 2IAMA 4WGWB 4FNLL 5I75C 5ERWB 4EN2A 4WHDA 3FSOA 3CSGA 3EJPA 5GRUH 5JR1H 2DYPD 4P4KD 4XRCB 3WN6A 3PPEA 5KBMA 1E28B 1QZNA 3QZOA 4KXZI 4RWHA 4POZC 4FLRA 1JE6A 5DA4A 3S97C 3D0VA 3K71A 1WS8A 2ADGA 3C2AH 4WFFE 4XB7A 3N0AA 5FFGA 3SPCA 3PDGA 3ZT5A 3NJVA 5AZEH 5EU7C 5LQBH 3QC6X 3QJFB 2QMJA 1LWRA 3VGAB 1A14L 5F3HB 1WPCA 5BO0D 4IKKA 4B41A 1A6UL 3UJTH 3NZ8B 4J27A 3RB5A 1SOSA 3G6AA 3MOQA 3LN5B 2X05A 5DRZA 1LD9A 1NIBA 3IFNL 4U1IA 1JGDA 3FRPA 5DD5H 4EZJA 4Z7NB 1BGXH 2O6PA 3DSFL 3MCLL 3TN0B 3WXVL 2MEJB 5E8OA 2YJQA 1KB9K 1KN4L 1WJ3A 1QATA 3IJHB 4HJ0C 1BVKA 5F7LB 4NZDA 4UZUA 3US0A 3SBWA 3UERA 5IMMA 1HXYB 2D7MA 9PCYA 2WLMA 3ULUC 2W65A 3IDYB 5FUZL 4HUXA 4JCLA 4YPGA 3GMPB 1NSNH 1HIMH 1J1XL 4Q9QH 4DK6A 4JW3A 4OCWH 5F9WC 5A6LA 3MNDA 3VFOA 3L4ZA 3ULVE 1VZIA 3P69A 1OLZA 2CO6A 1X5LA 2EVFA 4Y2OA 3VRJB 3IFOB 1JERA 3IMVA 5E9DD 1L0YA 3VXNA 1HCVA 3FNKA 2Q7YA 1L9TA 2BX5A 2P49B 4HMCA 5J12C 2K7QA 4O02A 5HHOD 3T0EE 3GSUB 2X4TB 3CVBA 3EYVB 5D7IE 1YA5A 3BVNA 4MMYA 2CDEB 1OP5K 2B3IA 5DUMH 4EO5A 5JW5A 2F53E 3SKOB 1WZ1L 3PWJA 4QRQA 4XC1L 4R96A 5JHDE 3SDAD 4ODHH 1M2VA 1F02I 2A9NL 1ICTA 3MMEA 3GSRA 2QGBA 3IVKA 5E5LA 3B5GA 3NRQA 2WTPA 1XR8A 2HP4A 4AKQA 3N43F 4MA1C 3TN0D 3TURA 3P0VH 5CLWA 1FE8H 2PABA 4LP5A 5DD1H 5DZ9A 3T1WA 4MXQC 5CJXA 4KO9A 4Z7NF 2F5BL 3WN5A 5F44A 3H54A 4X6CB 3SQOL 2BLFA 2V2XA 5KZCB 3LEYL 4PJBE 3MV7A 3WTTA 2YD5A 4Q14A 2DYPA 4P4KA 1S7QB 1RLWA 4P5RA 3ZL1A 4YO0B 3GJFK 5CCJA 1ZHNA 1J5DA 4EOWH 3B6SA 5GZOD 3JV5A 4JFPA 4PRIB 4FNQA 4MQXC 3DX9A 5KVDE 4HPHA 2HVJA 4KQ4L 4R7LA 1MHEB 4YDKL 1CDUA 5KSAC 1XF3B 4M48L 5L8LB 4LCUA 3WTYA 4V33A 3TM6A 3MACH 3MV8B 1M6OA 2BERA 3ES6B 4KXZH 5GSVA 4C4BA 1MCFA 4H0HB 1AR1B 3ZQWA 1EXUB 3NZHH 5DQJA 5AKSA 2V0AA 4YXLH 1DSWA 5T5NF 1Y6NR 1ROCA 5F0PB 2J1WA 1JV5A 1XGTA 2PW1A 1EO5A 1NANI 2PR9A 3EO1A 3OJDB 1NCBL 5IHZA 3MPCA 1GJUA 5TFSL 2AGJL 1D5MA 1K6QH 2WTRA 4R84A 5FDWB 3RUGF 4ZQTA 5GRJL 1TTFA 1NDMB 4HFWB 2ZAGA 3QZWA 4YDJB 3TLRA 5F72S 1I7RA 4L3EB 3X1EA 4LLDA 4Y5YA 4I87A 5HHME 2IANA 1V5JA 5B7FA 1TSHA 1YY9D 4YUEH 2GJ6A 2ZF8A 5DDHA 4D3CL 2D0HA 3NJJA 2PWEA 5ADOH 3QP3A 1BW8A 3MNZB 3PPSA 5FYJH 2XIDA 5LLIC 2EZ0C 4M1GL 5DS1A 3N50A 4R7DA 3QUMA 2XSKA 1NBYB 3MZGB 3AMKA 2QDVA 5SWZB 3ZHFA 4A39A 4XOAA 2AEQL 3O45A 3KS0H 4NSKB 1PW3A 1JGVL 4UQIM 4AE1A 1YNTA 3HB3B 3PE9A 3ZYOA 1LVEA 2X1PA 3N42B 1EBPA 1ONQB 3SKJH 2E46A 3KAAA 3QAZB 4JFOA 4F2MA 2QR0B 1M4KA 4OGAD 1QZ1A 5INCA 3UBXA 3FUEA 3DNKA 3ULAB 2WKOA 4J8RB 2WANA 3EH5B 2LVCA 3HNSH 5T1DL 2VSMB 2VR9A 1NUNB 1CG9B 2C3VB 3H1ZA 1TIUA 4W81A 4Y2DD 3WDIA 3HE7B 4JHZA 1WT5C 5HHPA 3IYLW 2H1LM 1X5JA 3QZLA 1RMFH 2FIRT 3CV5A 1FFOA 5B1AB 1CFVL 4P5TC 5K9KA 2DQGH 3J8F7 5BJTB 4MAUH 5J5EA 4RGNE 1DFBH 1CIUA 1XBDA 3MGAA 4L8CA 5E4EB 3RX7A 1W6LA 2DQTH 4P2OD 3L3HA 1CQYA 5E6RB 2K4AA 3WN5C 5EBMA 4RFEB 1FL6A 1KOAA 4PLKC 3UBXG 3VWJA 4MNGE 5LQBL 4JM0A 1GS7A 2G0LA 2WLLB 1E4XL 2KL6A 3MRMA 4HQQL 4O9HL 3VI3F 1KYOK 2DS4A 3IPBA 1V55B 5GGUA 5B7MA 1ETZB 5DJYB 3SDXF 4HK3N 1YEEL 3JWNE 3RVWC 1WFNA 3FU7A 5I17B 3QDMB 3F7VA 1C8QA 3ZR6A 2CLZB 1T7WA 1AOHA 2RCSH 4NZTH 2FWUA 3EDJA 4LIQE 4JFZH 3TYFA 3LPGA 1HHIA 4MCYA 1CB4A 1QBML 1TTCA 3GD1C 2VXSH 3FTVA 2M1KA 2WKLA 3D3VA 4WJ5A 3TIEA 1P6AB 4U7SA 1GZHA 5CSBA 1I8MA 1HSAA 1NOFA 4RFNB 5DGRA 1G6RL 1ED3A 1IAOA 3HE7C 4NO5B 4NCDA 3HZ3A 3UDWA 3DETC 1QFUL 4X6CE 3FTYA 3X3GH 4ZFOL 1IM3B 1MWAH 4ZTPL 4AV5A 5IHUH 1KPUB 4LCVA 4PJ8C 4FLSA 2EDOA 4BFIB 1RZPA 3VTMA 1BAWA 5BPPA 2ZXAA 4ALAC 3V0EA 4JM2F 1JHTB 1D7BA 4KK9C 1DQTA 2WZPA 4ENEC 3KPRB 4R6UA 2UWEB 1UWGL 1N59A 4WHCA 2YWZA 2R23A 1GGBH 3TCLB 2XX1A 3WKNA 1T5WB 2WD0A 5LGJA 1L9MA 5LG6A 3ZO9A 4G5ZH 3LPFA 3MAWA 4H8VA 5BZWB 2EH8H 3UROR 1NCCL 3DUHA 1UWXH 4K8RD 3PWLA 1S7TB 2QVKA 3NCEB 2ZKYA 4OCLC 5DQDL 2HKFL 4PWGA 4QOKA 4CMMB 3BRFA 3Q5OA 3L13A 5MERB 3LZPA 1UKSA 2BVUA 1T21A 2WZ5A 3QNFA 4S1DD 4UQ3A 4JZOB 2YS4A 1KNOA 4ISVA 2YRBA 3FH7A 3RYMA 1WYJA 3TXAA 5BRZB 1GTNA 2QHRH 3WS3B 3CVCA 3EJCA 4KROB 1UB6B 2CR0A 4FFZH 3ERXA 3IJ9A 3VI3E 3P0VL 1U8HA 2A9BA 2X41A 3QJQB 5CNHA 3IFPA 3N85H 1IAIL 1FFOB 4LPVA 4PJ9D 2Y25A 3P77B 4AMXA 5FPIA 4GT0A 3RWJB 4NKIH 4CN6A 4MMXB 3LS5H 4F2ME 1BP3B 2VSDA 1HJBC 1IGCH 3I75B 3D0LB 5F8RC 3LRMA 4M5ZL 3UG3A 2IQ9H 2D2OA 2BHZA 4XE0A 4XWGL 1YEGL 1RZJC 4OLXH 3MLZH 2WYHA 3P4MB 4RMRA 5E2JA 1UXSA 3V9FA 5AVVB 1DBBH 4IBUA 2OTUB 2C26A 3MREA 4A37A 4LSTL 3LXBA 4QWWC 4KITB 2I9LB 5FR3A 2D0GA 4G6FD 3RDTA 5EORL 2VLKD 4BCZA 1NGWA 2Q7AA 2W0FA 2PWFA 4POZD 3IJSA 3OKKA 3S8WA 1DVUA 1TYEB 1RZIA 3RKDC 4M48H 4Y5XA 4F8NA 4J3XA 4O2FB 3WJLC 3H42H 4FQXC 4LLVA 1A4JA 4L3CB 3DK0A 1NUGA 2YGVA 1G6RA 2APXA 3VXOA 2J73A 3Q1EA 5C6PB 1R3KB 2IADA 2W81C 2WQXA 5DVKA 2WNXA 4XCNA 5TPWH 3ZYIA 1NGZA 3QCTL 1CGSL 25C8H 3GK8H 3FTXA 1I3GL 2NY4C 1NCNA 4F93B 4KUCD 2V2WB 4DJMA 3BZDA 4JQVA 3QDMD 2FQEA 4Y2LA 2IANB 1GMIA 1T89C 1CXFA 3QUZC 2ZCLH 4U3XA 2X4SB 3QDGE 1KPVA 1A5FL 4NRZA 2UVFA 4YEEA 1XGUA 2I60H 5EOCJ 3CG8A 3IXTA 1NOLA 1CGXA 3K8LA 4LRIA 4M5YL 1F4YH 4WU7B 3UJJL 3FT2B 4CDGC 4YSAA 2BZDA 2DWEB 2E6JA 5E2UH 4XMWA 2GTWA 3BOVA 4R26L 5HVHB 2WIIB 2BVPA 2FSEB 4BSVB 5D7KD 3HUJB 5T1KB 3TPKA 5LHDA 1REIA 3PIQA 1I1AC 1KXHA 1U8MB 4IJTA 4IRZA 3FU0A 4ELMA 4LP4A 3ZL4L 3L9RA 3MRHB 1AI1L 1N7ML 4FQCL 5FLVA 1G5AA 4WI3A 2IGLA 3RVUC 3BUYB 2CO4A 3ARFC 4PJDE 3ILQC 3PXHA 3UZEC 2FZ3A 3QDJB 2LW3A 1PY0A 3MCYA 4GLRH 5AW0B 2WXJA 4X8CA 5FA4B 1P7KB 4LSPH 1WDAA 2YPLB 4BGLA 1P7KA 4LASL 2GSMB 1QSFE 1R5WA 1QSVA 2YOAA 1HHIB 2V2XB 4LCCA 4WWOA 2VZ1A 2IH1B 1JPGB 5D93B 3DVFA 1C08B 4HAKA 4PS3A 4OLYH 5JDSB 3BP4B 4YHLL 4ZPVA 1G7IA 2LQRA 3ZTNL 1CFVH 2VSKB 1JXJA 2A4ZA 2OSXA 2OQJB 4HGWB 4N2KA 1J0JA 4TQEH 2FO4A 1YJDH 3K2UH 3QXTA 3D4CA 3MRMB 5EU6E 1A1NA 4H1LH 5JLZB 5IHLB 1M2VB 4F37K 4I18A 4ABQA 4HPYL 4N5EC 5DHVA 2WUCH 2QJDA 4R90H 1H3TA 4ODBD 3SD2A 4ZS6C 5I8EB 1AHWA 1JD7A 1EO8H 4ZMYA 4UOQA 1FPTH 5BJTA 1XL6A 4OGXL 4F5CE 4NO2A 3BKML 4JN1L 3EYVA 5HDRA 4NQEE 5E99H 4X2UA 2JI2A 5EFIB 1KCVH 5CEZL 4V1DA 3CZUB 3U0WH 4YSTA 4JFUA 1T4WA 4AG4H 4LIQH 2EO1A 5JOPD 1KJ3H 4JAMA 1U8IA 2Z31A 1KGIA 2RMNA 1V7NL 1C5CL 2JJUA 1LHZA 1BMGA 5FGBC 1A66A 4OQTA 5LO7A 2GJPA 4NIYE 3TO2A 4KHTH 5GZNC 1K5NB 1T5KA 3BAEH 3CHXA 2G2PA 1YNLH 1F58H 4GRLC 3TBCA 4S2SA 1UKTA 2JJSA 5C0BD 5J3HD 1C5BH 2L0DA 1U4EA 4G8EA 2JXMB 1VHPA 4YDLB 1J1OH 3V0IA 4TUJB 4GUQA 1I4FB 1RIHH 1XXFC 5BO1L 4N25A 5BRZD 3MLUL 5SWZA 3PGDA 4QCIA 4G43A 4PWHA 4BZ2A 5MP6L 2HTLD 3FB7A 2WSKA 2QSCH 3O4LA 4GG6F 3HG3A 3U79A 1IT9L 3V95A 4Z1PA 2PO6D 1ADQH 1I1RA 3WKMH 3ECWA 3GHBL 3QJRB 2O5XL 4LNVA 3OHXA 5CINH 1H3PH 3SDYL 1D5RA 2IH3A 4U1MB 3S5YA 5F1NA 3Q9PA 2ESVA 4Z7OF 4GIPD 4Z23A 4JRXD 5TJWK 3RZCD 1RK1A 2VC2B 1Z0MA 3SGDH 3EO0A 1AQDA 3O0LA 4PGCB 2YQ3A 3SPVB 4ZXBA 3U1PA 1U8KB 1ZE3C 4FQ2H 3MLYL 4N8CH 1W72A 1MIEH 2YPKA 2DDQL 4PJHF 4RNRA 1OP3H 2GJ6D 5DJ6A 1OF2A 3U2IA 3MA7A 3PY9A 2R2CA 5AYUH 3UMNA 2WSDA 2QPUA 2G75B 1UB6A 2BHFA 1UCBL 3L4TA 4FFZL 2BCKA 4NZFA 4KXDA 3AG1B 3HAEG 4IU2A 5G2NA 1RULH 5E4IA 2B7DT 4Z7UE 3A4DA 4IIZA 3GTNA 5AENA 4LSRL 2OSLB 5ENWA 2V9QA 3N1PC 4PY7A 2YMXH 4KROC 4LCUB 2C7UB 4PB9H 2Z34A 5F7EH 1QBLH 2DMHA 4FL4B 5FYKE 4NQEA 4QHLA 4JHVA 4XN8A 3VRIB 1SEBA 3FS9A 2VN5A 4OD2B 1TTBA 2XG4A 3PGFH 4MA7H 4LEXL 3CDZA 1K4DB 3FZUC 1YEDB 4LHQB 4P05A 4XNUH 4LLQB 3UTSD 5F7AA 1K9TA 5F7MC 3E2HB 3C6EA 2UYLA 2KZKA 3O6KH 2XPGA 4MQ7B 4PV8A 4PB0H 4UM8B 3T77A 1LP9E 2VE6B 2WWMD 1OAYH 4P46B 2X28A 3QDME 5LBSL 1BAFL 3KEDA 1NMBL 2F7QA 2UZPA 3BIAX 4MNHA 5E5UB 3EFDL 1A0QH 2ORBL 2V7HA 4U1JA 5DQ9B 4PIRF 5J06A 3OQRA 4OU3A 3BAXA 4P2RD 1MJ8L 2JTDA 1UHVA 4GXFA 4U7MA 3D25B 3ARPA 1JK8A 4XB8A 5E56A 2EIJB 3D4YA 1YMHB 5E1GA 4HOWA 1M05B 3M1BA 1IBBA 2ZICA 3INUH 1I85C 5B4MD 5IFAL 2EXSA 4P3WA 3UEZA 4W9IC 4MMZA 4MMYB 1BMWA 1KPRA 3CLFH 3CX5J 1WBZA 4YIQA 5E00B 2CLZA 4LPWA 1AGFA 1CYGA 1RUML 1QSFD 3B2UC 3MLVL 4ZBJA 1ZGLP 1GGIL 2WVSA 3KYNA 2OMUB 3CLEL 4AT6A 2CHWA 2Z65C 4MKMA 1YEHH 1CT8A 3FQXA 4JY4A 4K5MA 3GMOB 3WEBA 4HEMA 3WHE0 2Q9OA 3JV4B 4Z7UF 1LGVA 1RUQH 3C5ZA 3NQIA 3PJLA 4RMTA 2VLRA 3UOAB 3TTSA 3GWJA 1W72L 2WV3A 1B4LA 3UTPD 4U1GB 5B7EA 3NEEA 1NGYA 5JW4R 1AGDB 5E9DA 1EQWA 2MTPA 2XY2A 3BRDA 4OB5L 2MNJB 2K6WA 4X7EC 4J6RH 4LVNC 4B9KC 3FU9A 2J5LB