2ICEB

Crig bound to c3c
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
183
structure length
183
Chain Sequence
DEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C3 beta chain
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 183
sequence length 183
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 2iceB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iceB02
4EXPX 3V6OC 3KPPB 1LVEA 1M05A 1WJ3A 5FCUL 2C7UB 2V5TA 4U1NB 3BGMB 4LCYB 1T3FA 3HCVA 2AKRB 2NY3C 1NGYB 4GXVL 1JHTB 1MWAH 4TQEL 5ESQB 1B90A 1XF3A 4ZXBA 3BRDA 4UINL 3O6ML 3E0GA 3KNBB 5L2KA 3VGEA 3KJ4B 5EORH 4KPHH 1DFBL 4QTIH 3S37H 4FMKA 4ZAKD 2NYYC 4O00A 4YHYC 1WGOA 4XWOC 2PUQT 1Y6NR 4PTUA 3RBSA 1VFUA 2YSSA 4RDQF 3LEXB 5SWQB 3FQNA 4TSCH 4DUXA 2HFFA 4J3TA 5KJRH 4YHOL 3BHBB 1NEUA 4ODHH 3OX8A 3IVKA 3K8LA 5GS3A 4R7DB 5D5MF 3MV7D 4XCCL 4HWZB 1NMAH 5IHZB 5BMFL 4U6HA 2PXYA 4K71B 2G60L 3I6LD 4KRMB 2VDOL 1VHPA 1CR9L 3MO1B 4FQ1L 1HHGB 1X5AA 1G7IA 2GHWB 3P9LA 4PR5A 4MVBC 4KMTH 1DDHA 3QDJD 4Y16B 4NO2A 3B6SB 1CD9B 4D3CH 3EAKA 4WHYG 3CH1A 3RX7A 5DC9B 1D6EB 1KCSL 1LNUB 3UTPD 4FQQB 1ZANL 4NCC2 5HJ3A 1D5BB 5JIHA 2W9LA 3MROB 3TN0D 4M7LT 1G7MA 4MB5A 3Q6GL 4HG4K 2NY7L 1LE5A 4HX1A 5C2UB 4LHUD 3FFCE 3IFPA 2Z31A 2ZCHH 1AXSA 1KBGL 5D70L 4OFKA 2ED9A 4JJ5B 3RKDD 1FCGA 2YRZA 3B9KD 1DANU 3ZDXF 1AO7B 5FIEA 2EICA 5CP3H 3DO3A 4UT9H 4F58L 5B39B 5EN2B 3MLUL 2NY5L 2R0KL 3FO1B 4MNQE 3EOAA 5LWYL 2HVJA 1W8OA 4QWWC 1T04B 4P2OD 1S9VB 4PGDB 5JXEC 2Y6SC 1IEBA 3T08A 4G8EA 3L9RA 4MJ6B 1NANH 5C3TA 3GM0A 5FCUH 1LO0L 3SGEI 1KIRB 5FK9B 2Z8SA 2F5AL 2ZG3A 4GXVH 3BIAX 4L1DA 4TQEH 4JRXE 4UINH 1QFOA 3O6MH 4DN4L 4PV8A 4EDXA 5J1AA 4L4TD 1DFBH 5DO2D 3OG4B 4RFEA 3E6FB 2EXYC 2X4OA 4HIHB 1MVFA 4R3SB 4HPOL 5IHUH 4FFYL 1MCFA 5C0DB 3P4LA 3QUXC 4C58B 4XVSH 3BUYA 2NY0C 3CFIC 3O3DA 4TULL 4YHOH 5DJDB 4Q9CA 3L3IB 2BSRB 1R24A 4PGZA 5GGRY 3SGKA 1D5IL 3N9GL 4Y4FC 1T80A 2I07A 3MV9B 4XCCH 5BMFH 1H3PL 4ZPVB 2LABA 1D9KD 3WDIA 3LZFL 5AG8A 3DYPA 5J06A 2G60H 5F89B 3VCLB 1R0AL 1VACA 2VDOH 3CPLA 1CR9H 4FQ1H 5C08A 3HI5H 4GG6A 3QFDA 3V5DB 4HMDA 3G5XB 1QLFA 4XB7A 4ETQB 1U3HC 1DVFD 2AJUL 3QIWB 1GH7A 3KPSE 1KCSH 1JGUL 1ZANH 2RFXB 3UEZA 4S1DC 1BLNB 1HCVA 1HEZA 3DI3B 5H35B 5L0QC 4MQXD 4P2QE 4KKLD 4YDKL 2Q6WA 1JN6B 1YYML 2BHZA 2VL5B 3Q6GH 5ISZD 1MHEB 3F7VB 4N0UB 4PJEF 5BRZA 2J8OA 2CRYA 3OGOE 5DHVB 4APQB 1KBGH 5D70H 4OLYL 1EBAA 4EIGB 1OSZB 1CFSB 3HRPA 4O2CB 4P5KA 3TCXA 4NN5B 1BD2E 5IIEA 3W5MA 3TA3A 1FZMB 4IRJB 4QRRE 5EU6B 5D6DC 3OAUL 4P2OA 5E95B 4U1KA 4EI5D 4HAGA 4F58H 2X70A 3PGFH 5D1XC 2VC2L 2R0KH 2B39A 3MLUH 1QO3A 1OLLA 1NFIB 2I9LB 5LWYH 2R2HB 4QYOB 1KJMB 3H0TA 3TVMC 4Z7VF 4NWUL 3PWJB 32C2A 5DGRA 4XPBL 1XCTB 4PJXE 1LO0H 2OI9B 3VRIA 3OTTA 5I1JL 5L7XL 5C2BL 3WIHA 3ALPA 3GSQA 3GMMA 4DN4H 4NDMA 4Z9KB 5GS0H 4YDJA 1K85A 5B3NA 2YUWA 4Y1AD 3KLDA 2G9HB 3PWPA 4DKFL 4X8JB 1OTSC 2AJ3B 4OM1L 4QRUB 4WHTB 4UZGA 3P4NA 3HI1B 4HPOH 1TFHA 3NPSB 1UJ3A 3PQYE 4FFYH 4LQFL 1JFQL 3VFOA 1QNZL 3NCMA 1ZGLM 4NKDA 4P5MB 5IVXE 3NIGE 4AM0A 1YDPB 3GMNB 4NM8L 1U8IB 2VITB 5IB3A 1CGUA 1D5IH 5FV1L 3D2UA 3N9GH 5DFVD 4LCWD 2ENYA 4W70A 4QXUL 4GAGH 1JPGA 1H3PH 1J10A 3NABL 4LLMB 5JOFB 2JF1A 3G9VA 4IHOA 4K55A 3LZFH 1WIPA 3ULVL 3BEVA 1Y18A 5T1MA 3K8MA 3WFEL 2IALB 1A6TA 3TBSB 4XNYL 2FBJL 1U91B 3MUGB 2CKBL 1U3JA 5GHWL 2AJUH 5E2TL 4G42A 1NGQL 4G8FB 1IKNC 3TIDB 4C59B 1JGUH 4RA3A 3S4SA 5K93A 2P7TB 4R2GD 3AMKA 2FO4B 5H94B 5KSVA 4QF1A 4YDKH 2VIRB 4JM2C 2QADD 3WUWB 1DE4B 3HMWH 3BW9A 4TNWK 2A77L 5E6IB 2NTSP 4JCMA 4OLYH 1UB5A 4DWHA 2LVEA 4Z7UA 1N2RA 2PW1B 2VLRE 3LCYA 1QQDB 3OAUH 5CWSA 3QI9C 4BELD 4ELMF 2P24A 3T65B 2VC2H 4LLYA 2FEEI 3EOBA 5LXGH 4UTBL 5DMIL 2R0LL 3ULVE 5KZCB 2AVGA 3O9WC 4NWUH 5J89A 3E2HC 1FVCA 1KIQB 3OV6A 3O6LL 4XPBH 3RU8L 4Y4HB 1FNEB 4PJ8C 4QXTA 1G7QB 5DA0B 4X6BA 4K94C 5F9OL 5I1JH 5L7XH 5C2BH 1FNGA 4X6CE 3O2VL 3MGTA 4IRSD 5GS2H 3LH2L 3HZKA 1MFBL 4HD9A 3CUPB 2ZUUA 4U1HA 3O3BB 4DK3A 3DHMA 4BSVA 4PRDB 5DC4B 4ZQKB 3D9AL 1KOAA 4DKFH 5ETUA 4LAQH 5MEQB 4NFCA 1AHWA 3ILQC 1XGUB 3K7UA 3VFSA 1EMTL 3W81A 3STLB 1TTFA 5C0EA 1JFQH 1QNZH 3P0VL 2EYSA 5F1OB 2R39A 3KXFA 3MRIB 4PYGA 3PV7A 4CADA 1NUFA 2ZKHL 1AP2B 3MV11 2AEIT 2R1XB 1DQQA 4QXUH 4PRNA 4KQ3L 1JPST 1WTLA 2X4QB 2GFBA 5DA4A 2HJFB 5FO7A 3ARDA 1WZKA 4Z7NF 1MRCH 3ULVH 2FJGA 3WFEH 1F42A 4L3AA 2VXVL 4X7SL 2EIDA 4XNYH 2FBJH 1V5JA 3RVTD 4DKAA 2JK5B 2WBJD 2CKBH 4Y8AA 5GHWH 5E2TH 2CDEB 4WVRA 3VFTA 2IAMC 2ID5A 3D3VD 1MREH 2KKQA 2X40A 3WE6B 1M7IA 5I8EA 1K2DB 3V5KA 3FAXA 3S36L 3MFGB 4NNPL 4YDLC 4NN6C 3FFCD 2KUTA 1H5BA 4Y4KD 2DDQL 1YMHA 4JQXA 4XI5D 4KK9D 1BEYL 2DLGA 5E7BA 2AJVH 1E4KA 1YC8A 3LKRB 4RGNB 1CD8A 4IIQC 1T83C 2F53E 3CXHJ 4FQLL 1NUGA 3EZJB 1PJ9A 2FEDD 2K3TA 4GBXD 4MNQD 1MCWW 4ZS6C 2Q8AL 3F7PC 4I18C 4UTBH 3TZVD 5DMIH 3MRMB 5BW7C 2HTLC 5GGTL 3G6JB 3G6DL 1S78C 4DJMA 3JV4B 3FTGA 3N1MC 2XG4A 3O6LH 3RU8H 1NL0L 4PY8J 2XV6B 5CJXC 3FQUA 4UAOC 3S4SG 3SO3B 1Z9MA 3O3EA 3KDMB 5F9OH 3JTTA 2O93L 3O2VH 4JRXD 3RHWK 5BV7B 1ADQA 3NCCB 3QUKB 4J8RB 2ESVB 4OGZA 2B7DT 4R97B 3SDAD 1I85A 3BZ4A 5JORA 4W81A 1RMFL 5MP6L 4V1DB 3QXAA 1ZT4B 4DEPB 2VZSA 4WTXA 4Y5XB 4R96B 1QPPA 1BWWA 3I3DA 4PJFB 2J8UB 5ID1B 3TESA 3P0VH 4X6EA 3H3PH 3OAYH 1Q94A 1ZK9A 5F6IC 2ZKHH 3ZKMD 2V2XB 3BFOA 1KG0A 3TBVB 4MJ2A 3EOTL 3E8UL 1Q1JL 3AS0A 3T0EA 1M05B 5I9QB 3OXSA 5DLML 3EUUA 4Y2OA 1T3FB 3HCVB 2EIZA 3D85A 1B2WL 4ZXBB 2FO1A 4NKQB 2VXVH 1YY9C 3TNNA 4HLZH 5L2KB 2O26U 4PP2A 3HZMA 4HUXA 3U7AA 3KPSD 2DS4A 4KJPD 2OM5A 4PTUB 4P2QD 2YSSB 3NGBC 3S36H 3FQNB 4NNPH 1OTTC 2HFFB 2DDQH 1E28A 2AXJA 3OX8B 2DQHH 3IVKB 4YEFA 2PR4L 1BEYH 2WIIA 2B4CH 3PHOA 2VXQL 2W65B 4XNUL 4QRRD 4FQLH 4KQ4L 1MF2L 2L7UA 3CDYA 3L95B 2PXYB 5TF1L 1HYRC 3MBED 2Q8AH 1WZMA 1DQJA 1G7IB 3P9LB 4PR5B 3C6LA 3UBXA 3H42L 4I5BA 1DDHB 5GGTH 5ACZA 2ADJA 2EKJA 4NO2B 1T2QL 2X89D 1P7QA 3CH1B 5FB8A 1NL0H 1GGBH 5GZOD 1WAAF 2J2ZA 1KULA 3RZCD 1BGXL 1G7MB 3MUJA 2XWTA 4HX1B 1LE5B 3PWVB 4HDIA 3ULUF 3QDGB 2Z31B 3OAYK 1AXSB 5MP6H 4PJHB 3PQYD 1IZKA 1RHFA 5INDA 1TCMA 1FV1B 1NDMA 3QJFA 5EC1A 3WDHA 4KAQL 3ZE2F 3SKJL 4AJ0A 2CSPA 3EYOA 2AXFA 2BVTA 2X42A 3DUUA 3EOAB 2WUCL 4LSUL 2HVJB 2ATPA 4JLRA 4LARH 4X8XA 3CD4A 3EOTH 1NMCC 3E8UH 3PJSA 1Q1JH 1IEBB 4G8EB 4FQCL 3L9RB 3MUY1 3HR5A 3ARWA 4M3KB 3AM8C 1NKOA 2NY2C 1XGTA 5I8OL 3LB6D 3V8OA 4OQTA 3AB0B 3UJIL 3HPJA 1B2WH 1UCTA 4NQCA 4PJIA 5DD1L 5F7YC 3QCVL 3DXAA 4PV8B 4X0KA 4EDXB 5J1AB 1J8HD 3G9AB 2DYPA 3VD3A 1MH5A 4RFEB 4CJ1A 1HHKA 3VXSE 2DQGL 4CAGA 4I77L 4CDGC 3SJVE 2IQAA 4JO2L 4G8GA 1BD2A 1S8DA 2BRRL 3BUYB 4Z7OE 1OVZA 3O3DB 4HEME 5D93C 2Z93B 1R24B 2ILLA 4LGSB 3P30L 4YWGL 1CL7I 1VERA 4H20H 2BXZA 4WI4A 3WL9A 2PR4H 4J3XA 3MRFA 2I07B 2VXQH 2V9QA 4XNUH 2HT2C 4KQ4H 3BZFA 1I3GL 1VACB 3CPLB 2YRLA 5C08B 2ICWA 3ULVD 3MV9D 1MFNA 1O7VA 1RJLB 3H42H 3QFDB 5A2LH 1IM3A 1T2QH 3ZKQD 2DF3A 3QCUL 2HH0L 4Z76B 5KAQF 1WBZA 4QT5A 1H15A 2X05A 5B21A 1BVZA 4WW2A 3T2OA 3DETD 4I2XE 1BGXH 4QCIA 3DVFA 3BN3B 3PQYA 2Q6WB 4JE4B 4N1CA 3L5IA 5BRZB 2XTJE 3BYTA 4ODSL 1KTDA 4BSJA 1QSFE 1I9RL 3RFZC 2VAJA 4N1HB 1S3KL 3C6SA 5IIEB 5IQ9A 3HS0A 3TA3B 5I0ZA 1OM3L 5DMJB 4U1KB 5EOQL 4DVRL 4KAQH 3SKJH 2X70B 4LK4A 2APVA 1QO3B 3LDBB 2WUCH 4LSUH 5LKNA 1LQSR 3H0TB 3UBXG 3BESR 3QEGL 32C2B 4FQCH 3VWKC 3VFUA 3CK0L 3VRIB 4K8RC 3UJIH 2GCYA 3GSQB 3GMMB 3UO1H 5HI5C 5DD1H 2VQTA 3QCVH 4NDMB 4Z6AT 1A4JA 5HHQA 4YDJB 2F8XC 4NNXA 2VL4A 3VFWA 1Z9OA 4OZGA 1IL1A 3PWPB 3MV8A 4FZEL 2XKNA 3NFNA 2W9EL 4OSUL 4NO3A 2DQGH 3P4NB 4I8DA 1UJ3B 4BQBA 3BPNC 4I77H 3Q5OA 2VSCA 4JO2H 3VFOB 5CEYA 2BRRH 2R0ZL 3ARSA 5TE7L 2VLRA 4NKDB 5TGBA 2L7JA 3RUGA 2NW3A 4AM0B 2OCFD 3RGVC 2E9IA 3P30H 4NKIL 5IB3B 4YWGH 3C8KA 3O6KL 2CIIA 4NC0B 4U0RC 3D2UB 1XGPA 2D4DA 2F53D 5IB2A 1JPGB 4KJQD 4W6WB 3Q2CA 4IHOB 2WQRA 1I3GH 4LU5L 2IF7A 4ZAKC 3BEVB 1QPXA 1Y18B 2CD0A 5HI3C 4GKZA 4KRNA 4X6CA 2QQNL 1UB6A 5TE6L 4HQQL 1NBVH 3QCUH 1WWWX 4G42B 3TBYA 3S4SB 5DYOA 2E6PA 4OFPA 5GQBA 4F80A 3HB3D 5KSVB 3D48R 4QF1B 3MODH 3Q5TA 4QHMA 3GJEA 1W0YT 1DEDA 4ODSH 3BW9B 3RL1A 4PRBA 5CIPB 4LVOB 1I9RH 1UB5B 1U9KA 4C57C 4Z7UB 1G0XA 1S3KH 3RVVC 1N2RB 2E7LC 4NQVA 2H2PC 3UROR 4HKJA 1OM3H 2MQ3A 4GKOA 5EOQH 2P24B 4DVRH 5EPMA 4LLYB 3EOBB 5DQJA 1Z6JT 1MRDL 1DQDL 2WANA 4CMHC 3TN0C 3LHPL 3QEGH 2YD2A 4RFOL 5K59E 1D6VL 4HLJA 1FVCB 4ZO9A 1G6RA 1MY7A 1BIHA 4G6JL 4QXTB 3QJHA 3RWIA 3CK0H 5DEFA 4S1RH 2AJXH 1FNGB 2I5YL 3MGTB 5JIKA 3HZKB 3B9KC 2DLTA 2RB8A 4U1HB 4H1LH 4BSVB 4JFYA 2XT1B 1BBJB 4FZEH 4ONFL 5J6HA 5ETUB 4OSUH 2W9EH 1HQ4A 4JVPA 3VFSB 2OLDA 1NBYA 2MQCA 2CK0L 1HDMA 4C4KO 4EDWL 4ODVL 2EYSB 2ICEA 2R0ZH 3KXFB 5TE7H 5DRXA 4CADB 4NKIH 3O6KH 3VXME 4NQEE 1NGWB 1DQQB 1W8NA 4PRNB 2GFBB 3ARBA 4ZO7A 5FO7B 4L9LB 1JMZA 3ARDB 4HW6A 4LU5H 3C09C 4YZFF 4GG8A 1WC7A 1GZPA 2FJGB 4N0CD 1IC5L 4JZJA 4EOWL 3O41A 2HTKD 2FYYA 2QQNH 1X9QA 4HQQH 3VXRD 2C3HA 3TJHD 5CGYD 3WXVL 3VFTB 3N1PC 4Y2DD 5GRXG 5HHMB 3CH8A 4KMLB 1M7IB 5I8EB 5F3BA 3V5KB 2VDML 1AKJA 4Y5YC 3ZDYF 1D9KC 1H5BB 4OFYA 4QTHA 4RAHA 1YMHB 1P4BL 3QUYD 5L8JB 2N1KA 5MHSE 2FLRT 4JFDA 4WIQA 4U3XA 2R4RL 3O8XA 5C07B 2EKSA 3H9ZA 3TF7C 3GJFH 4YUEL 1CDBA 1AGBA 4MD4A 3CSPA 1ONQA 2IBGA 3RGHA 2M26A 1MRDH 5TDNA 3T3PE 1DQDH 1A9EA 3CDGB 3LHPH 4KKLC 1Q9WA 3DVNA 1D6VH 3FTGB 2R9HD 5ANMA 2GY7B 3FQUB 3O3EB 3DARA 5F1SA 3JTTB 5IVOA 3N85L 2FDBP 5FUCC 5SWSA 1SYSA 1G7LA 1N6QL 3PP4L 5C09E 1NC2A 1TIUA 3QHFH 1HK6A 3BZ4B 1I9EA 4EI5C 3DYMA 4MCZA 3VXSD 5JORB 2KDGA 3MRGA 1I8IA 4KDTA 4ONFH 2PETA 2JJTC 1DBKH 4M8VA 3SJVD 3WNLA 4PPTA 1V3JA 1LILA 2CK0H 2NQCA 4ODVH 4X6DA 4EIZC 3IDXH 4X6EB 1I7ZA 1IJ9A 4MLSA 3GMRA 3VA6A 5DZNA 1JZ3A 1Q94B 1EEZA 4HGKC 1SJEA 3ZKSD 1KCRL 4XBEL 5FGBC 7FABH 5I1CL 1MOEA 3ARGC 5INCA 3T0EB 4NHUA 3FMGH 4O2EB 3OXSB 3VGHA 2OZ4A 4B41A 5C0FA 1XGQA 2EIZB 4WWKD 3D85B 1IC5H 2HMID 4OLVH 3UTSD 2IGFL 3EYUL 4I0PA 4AENA 2COQA 1PZUB 5IR1A 1IE5A 1ZWIA 4PP2B 4HGWA 3HZMB 1JUFA 3REWB 2R23A 3WXVH 5F7EL 4HS6A 5HVHC 2XXCB 4M8QA 4AEIH 5ESVB 2VDMH 3MXVL 4X9IA 1KNOB 3GJFK 5L8KB 2XTJD 1MCEA 1I1CA 4GRWF 1RJCA 4WENB 4PJ7E 2VSDA 4H8WC 5KSBE 2WIIB 3PHOB 3F8UB 2R4RH 1CXFA 1HINL 3PL6D 4YUEH 5DUML 5FYKU 3CFKA 3WJLC 2OK0L 4HLZG 4G7VL 3T1FA 5ESAA 1DQJB 3DMMA 2OMBA 4MS8D 3C6LB 4I5BB 5ACZB 1IBGH 1RJYA 2ADJB 3SGEH 2QADC 5IJKC 3NH7H 5FB8B 3PDDA 5GRVL 4BQ8A 3PV6A 3N85H 3BH8A 4LFHD 5D2NC 1N6QH 3PP4H 2XWTB 3SCMA 4CU7A 5CJ5A 4HDIB 1UM5L 3RP1A 2PTTA 3UYOD 4ENEC 3VFPA 1JK8A 1A7NL 2PW2B 4AYFA 3OF6D 5INDB 4NUJA 4FQHA 1VCAA 1WQVT 1NDMB 1CE1L 3QJFB 5EC1B 1GVIA 3DOSA 2Y25A 3QDGD 5FYJU 3EYOB 2AXFB 3DUUB 1F2QA 4LOUD 3RVXD 2A38A 2EDXA 2ATPB 5MENE 3HUJB 4JLRB 4XBEH 5I1CH 3PJSB 1X5KA 3BAEL 1ZS8A 4JM2F 2WV3A 3HR5B 1K4DA 3L3HA 4FNLL 1XGTB 1MFDL 3CU7A 1J18A 4XGZA 5B38A 2ARJB 3C2AL 3U0TA 3OKEA 4NQCB 2IGFH 4KZDL 3EYUH 4PJIB 3T77A 3MOAH 5JHDE 3DXAB 4X0KB 3CFDA 4MGXA 2DYPB 2ZSWA 1MH5B 1HHKB 1CFBA 1U8LA 1QSFA 2A73A 4G8IA 5F7EH 1MELA 4H0IA 4PB0H 1U6AL 2IQAB 4G8GB 1BD2B 1S8DB 1H8OA 5EIQA 1EAPA 3CC5A 4KKNA 1Z0NA 3HFML 3CZFA 1DANT 4U33A 3WL9B 4N90E 3EO1A 1HNGA 3QNZA 3MRFB 3IF1A 4PB9L 4HWBA 3HNTL 1HINH 3RVTC 2FEEL 1MFAH 2DOCA 3BZFB 2OK0H 4JFEE 1UH4A 2W0FA 4G7VH 4YHZL 2ICWB 5EUOF 2H1PH 4NIKB 3EFDL 5FYLL 4XVJL 1IM3B 4NT6A 3AS1A 2E8ZA 5I73B 1OW0A 2DQFB 1WBZB 4FXGA 1H15B 2WK2A 4WW2B 4XI5C 3H3BC 1U2CA 5DK3A 1L9MA 4Y89A 3RL2B 2A6JA 3RY6A 1JZ2A 4QXWA 1UM5H 4LSQL 2W0LA 1LEGA 4GBXC 2DTML 3DUSA 1A7NH 5GRYA 2BOBA 4F33A 4PJ5A 4JO3L 3TZVC 3QXTA 5IQ9B 1CFNA 3HS0B 4R4ND 1PX3A 2FCBA 1OGAD 2DM3A 4G43A 5IROC 1GYAA 1YN6A 4AK1A 4W6YB 3VXMD 3QH3A 4J3VA 5AAWA 3LKSA 3Q6FA 2YA0A 2NLJA 1H0DB 3IJSA 3VRLE 3K2UL 2FLBT 4ZPTB 3BAEH 3WV0A 2YWZA 5FYLE 4FNLH 3W0WE 1MFDH 3ARFD 4ONOA 3C2AH 5I1LA 1QVOA 1TCRA 2GCYB 1FZOA 2PTVA 3JZ7A 1OAZL 5HYFA 1A4JB 5HHQB 3VGGA 3VH8A 1T21A 4NNXB 3VFWB 4YHIA 2Y5TA 4OZGB 1IL1B 3MV8B 2EDDA 3E3QE 1DSFL 3NFNB 1QSED 4I0CC 4NO3B 3IXAB 3ZKMC 3NN8A 2NY5C 3VXUA 1U6AH 1A7QL 4MJIA 2E27L 3MXWL 5CEYB 5I8KL 4Q6IC 2VLRB 1R3KA 4BFGA 5TGBB 3HFMH 3RUGB 3LRSA 2CIIB 3LMJL 5MHSD 1QD0A 4XBPA 3IAGC 4PB9H 3W82A 3MJGX 2P5ED 2VABA 3HNTH 5DHYB 5IB2B 2HLAA 4XXDA 1FLRL 4Q0XL 3GMPA 1IQWL 2APBA 3LKPB 4PIRF 5DRNB 4YHZH 2Y07L 1ACZA 4AMKL 4GKZB 4KJPC 3MA7A 2EDLA 4X6CB 2YHGA 3EFDH 1IGFL 1U41A 5D2LF 5FYLH 3LN5A 3PGDA 7CGTA 2VKXA 2EXWC 3V52L 5JZ7C 3TBYB 5EIIA 5GRWA 5DYOB 4QRSA 2C1PA 4HPYL 5C09D 2NXYB 1R3IL 5HDQL 3SHSA 3H9HA 2GTWA 2VDQH 4IDJL 4QHMB 3GJEB 1AQKH 3SY0A 3U0WL 4LSQH 4URTB 4PRBB 4GUPA 1INQB 2DTMH 3MBEC 1XF2A 3MRBA 4NZTL 2W92A 4C55A 4UBDD 4KTEL 5F44A 3VXMA 4JO3H 1MFEH 4NQEA 4NQVB 4WO4B 1FPTL 4HKJB 4EQ2A 2GAZA 3V79C 1CXLA 3VI4E 4K71C 5EPMB 5DD3L 3PIQA 5DQJB 4LPVA 3U6RA 1UXSB 3AROA 4MWFB 3RZCC 4Z8FL 2BMKA 3MBXL 3UTQA 4Y16C 4LFHG 3K2UH 3RJQB 3ZKXB 1G6RB 3NCYP 3QJHB 3H9SE 3RWIB 1WUNT 4FXKA 5DEFB 4ZNEE 3UYPA 1HXMB 3JVGC 4NCC1 1LWRA 1OAZH 1I1AD 1VGEL 5I66A 2EDEA 3ZE1E 3GNML 3S8WA 6FABL 4NZRL 1DSFH 5J6HB 4WWID 1HQ4B 4GRLD 1X5XA 1NBYB 4L3EE 3SDCA 1HDMB 2DQTL 3L5XL 1A7QH 3K8KA 1ZLWK 3MXWH 4OLWL 5I8KH 2ICEB 1CDIA 1XIWA 5DRXB 1Z5LB 2RGSA 4GLRI 5E5RB 5F7FA 3LMJH 2BSSA 2QSTA 3QCTL 1M6OA 2C3XA 2DJSA 1KCLA 3DYOA 5DUPH 5BO1H 4TN9A 2YPLD 3ARBB 3BP5B 2Q1EA 1ZA6B 4Q0XH 5KANG 1IQWH 4NFDA 2Z9TA 1WC7B 4GG8B 4H1LG 1GZPB 4Q7DA 1J05A 2Y07H 4AMKH 4JZJB 4HH9A 4E0RA 4N9OB 2CJUL 1GGCL 4RMWA 1IGFH 2X41A 5IOPA 4JDZA 4XNXH 4GW4B 3CVHB 2XN9E 3RWFA 1SMAA 3V52H 4R90L 5DC0A 1NC4D 4CMMA 1RIUL 1A4KA 4NOBA 4HPYH 5A16A 1AKJB 1R3IH 5HDQH 4R0LA 5JHLH 4LLWA 5IBUB 4IDJH 4U2ZA 4QTHB 3U0WH 1JZ4A 4OF0A 1D3CA 1LO5A 3UTTE 2EC9U 2OL3L 1T22A 4NYLA 4NZTH 4KTEH 4JFDB 3IS1X 3O8XB 1UQSA 2EKSB 1FPTH 3QFJD 5HHPA 1AGBB 2A6IA 4MD4B 1SJXA 4O4YL 5D7IF 5DD3H 4IMLA 1FL6A 1K6QL 4JANA 5TDNB 3AFLA 1A9EB 4Z8FH 5JIPA 1MRFH 1I1FA 2EDFA 3MBXH 1KLFA 1Q9WB 3FO2A 3DVNB 3BWAA 4RISL 3S3JA 3K1DA 3S35X 5ANMB 3LD8B 4C56E 1NAMB 5SWSB 1JWSB 1SYSB 5JHDD 1G7LB 4L8SC 1RHHA 3CMGA 3PHSA 3UCRA 4YHML 4L3CA 4L5FL 1NC2B 1P1ZA 4HMCA 1VGEH 5F6HJ 2IFFL 3EOYG 2E7HA 3NCFB 3MRGB 1I8IB 1W72L 4APQC 6FABH 4NZRH 3WCYA 1T89C 4OIIH 5E2JA 4KDVA 2EH7H 5E9DE 1FBIH 2IEPA 1QKZL 2DQTH 3L5XH 4NN5C 3N06B 4OBSA 4X6DB 4IRJC 4OLWH 1CL7L 1I7ZB 1PY4A 3GMRB 1BQLL 4DZ8A 5ITFA 3T4YB 1EEZB 3BDXA 3KJ6L 3QUML 2JKXA 3KPLA 4MA3B 3QCTH 3QPQC 1SJEB 5GXBB 5DXWA 2ZG2A 4XCFH 3T0VA 2OTPA 1MI5E 4NQXA 3SOBL 3F7RA 3TV3L 4U49A 4NHUB 4JFED 4JGJA 2NR6D 4JZNA 5C0FB 4U4BA 2OI9C 1NGPL 3TH2T 4TUOA 4M03A 3S97C 4I0PB 2VXSL 2CJUH 4AENB 2JIXB 1GGCH 3OR7A 5IR1B 1EO8H 1ZWIB 5D7JA 5KN5A 5JMOC 3BZEA 1GC1L 3CMOL 2HWZL 5TH2A 5IW6A 2G2RA 3T0XA 4M61A 1JUFB 4R90H 3SDDD 2CH8A 2R23B 1RIUH 4HS6B 3NPSC 5B8CA 3LEVH 4MB4A 3MJ6A 1EO5A 3GGWA 4GQ9L 5DT1L 4XMPL 2DI8A 3HE6D 5IESL 2IPTL 3JWDL 1XR8A 2XFXA 2Q86A 1L9NA 3V6ZA 3RWDA 4JVWA 1TXKA 5MENA 3QXUA 3L3GA 1LGVA 3CFKB 4O4YH 4OCWH 3T1FB 4X4MA 1K6QH 1G7HA 1OB1A 2Q76A 4OCSH 1RJYB 3M07A 4PJEA 1P7HL 5FYLD 3F5WA 4PG2C 3ROLA 4J7RA 4RISH 1E6JH 2FATL 1OL0A 1TVDA 3WJJA 4XVTH 1QUNA 2GJZA 3B8SA 3D0LA 3RWCA 4YXLL 3PV6B 3BH8B 1AR1D 4TNVK 5JMRA 4P9ML 4YHMH 4AEFA 4L5FH 2R2CA 3SCMB 3X12A 2PTTB 3BEWA 4XPTL 2IFFH 2EYTA 3VFPB 1W72H 5E6IC 3SE8L 3KPQA 4Z7VA 2R15A 4FQHB 1TVBA 1X4XA 3IDIA 4MMXC 1BQLH 3TO4D 4P23D 1NBZA 3VXNA 3KJ6H 1AQDA 3QUMH 3WFHA 4NC1E 4OGXL 5C9KA 2AJYL 3X17A 1RJZA 2VE6A 3C8HA 4ONGH 3SOBH 4YQXH 3ZDZF 5F7UA 3QXVA 3TV3H 5JOPE 1ZS8B 3BRGC 1K4DB 3L3HB 4Z7WF 4Y4HC 4XGZB 5B38B 3KYKL 1QZ1A 4OZFH 1NGPH 2GYSA 4OKVB 3U0TB 3OKEB 5FM5M 3T77B 2VXSH 4JFFE 3CFDB 3QDME 1A6UH 1I8LC 4X80L 1GC1H 2HWZH 1I4FA 4NNYA 5IG7A 1U8LB 4GG6F 2MPAL 2A73B 4G8IB 5IFHH 4ZDHA 3GMQA 4JEGB 1FFNA 1FAKT 3NCBB 2GITA 1A1NA 1BQUA 3NIDF 4GQ9H 1EAPB 4JZOA 3CC5B 3CFJA 4XMPH 5DT1H 1URLA 3ZYIA 5IESH 3JWDH 3CZFB 4ZSOE 2VWEE 3UMTA 4XP9L 3TC9A 3EO1B 1QG3A 3PDOA 3QNZB 3X14A 3IF1B 1WBXA 2JJSA 2HTKC 2H6PA 1EA9C 2X9XA 4PJ9B 4J1UA 1X6LA 3MUZ1 3GZKA 3I02A 3SPVA 3TJHC 2W0FB 3W0WA 5D1QD 5E4EB 4Y2DC 3OQ3B 3FONA 5C1MB 4HH8A 3ZHKA 2WWMD 4NT6B 1A47A 4JKPH 1H8SA 3L3OA 1MAJA 4LF3A 3H9SD 1KIPA 2FATH 4DVBB 1PQZA 2BXYA 3PABA 2H41A 4KKCC 4OZHE 3QUYC 4XNQA 4YXLH 4HUUA 2OMNA 3QO0A 5DEZA 4P9MH 2BNRB 4S0TD 3FZUD 1UM4H 4DGYL 4EKXA 4D0CA 3TYFA 3BXNA 3I85A 1LEGB 4XPTH 1MJ7L 3DSFL 2YUZA 4L3ED 3SE8H 1HH9A 2BOBB 4F33B 4PJ5B 1EAJA 1CFNB 3VWJA 5I74B 1E4XI 3X13A 4PJAE 2XICA 3PNWA 4XP6H 4U1IA 4DUVA 4QHUA 2YWYA 4L4VA 5J7CC 4LDOB 4G43B 4PJGE 2PYEE 1YN6B 3QH3B 1WTGT 1CICD 2AJYH 3KG5A 3LKSB 1J8KA 3Q6FB 1LK2A 2NLJB 2A6DA 3DGCR 3IJSB 4QRPE 3MLPA 1P9MA 1IAMA 2R29H 4E41A 1ORQA 1NUDA 3SO3C 3KYKH 1WISA 5I8CA 5I1LB 1QVOB 3L7EA 3V6OE 1FZOB 4KH2A 1BX2A 1XF1A 5BV7C 4R4FL 4PREA 2BC4A 3VH8B 1T21B 4X80H 2XN9D 4YHIB 1RZFL 2V17L 4M7LL 4ZFOA 2MPAH 3GIZH 3VGDA 3NN8B 4DEPC 4M48L 4GT7A 3VXUB 3OZ9L 1YY8A 4MJIB 2ZP0T 1R3KB 1WFOA 3MLWL 3LRSB 1UADC 1SY6A 1DUYA 1YMMA 4FFWD 3KLSA 4XP9H 4F9PA 4XBPB 2VABB 1CGTA 3AC0A 4DOHB 4WUKL 4XXDB 2IADA 3GMPB 3S37X 4CGTA 2WWKT 1F6LL 1FN4A 3HNSL 3C5ZA 4KK5C 4CRPA 4GS7B 3MA7B 4ZXBC 3K46A 3GHEL 1ACYL 5E2WL 3LN5B 3DX6B 1GJIA 1LO3L 2XTJC 2PO6D 2HG5A 3BWUC 5EIIB 4JFZL 4C56D 1MHPL 4QRSB 1ES0A 2UZIL 2C1PB 2P5WE 2IH1A 1V3LA 3H9HB 2GTWB 5TJWK 3PL6C 3SY0B 1B6DA 1OGTA 4TOYL 4GUPB 1XF2B 2CXGA 1MJ7H 3DSFH 3M45A 3MRBB 5HGHB 3HAEH 2L0DA 1PKOA 1CQKA 4F9LA 2GAZB 5KVEL 1KJVA 1J1OL 5A2KH 3PIQB 4GJTB 3U6RB 2BMKB 1MI5D 3O0RL 3UTQB 4N8VG 2AEPL 4PLJD 2JCCB 1JCKA 5D9SA 4FXKB 1AFVL 3QIUA 2CDFA 4LSDA 3RVUD 4B0MM 1AY1L 5C0JA 4EN3D 5C0GA 1MCDA 5IEKB 5D96C 3KS0J 2VDRL 4R4FH 2CIKA 5I66B 5C0ND 3RTQD 4XNMA 1ZHNA 1UCBL 1PX4A 1RZFH 2V17H 1VGKA 4M7LH 5D7LE 3UTTA 3RVXC 3EO0A 3UJTL 4M48H 3SDCB 3OZ9H 4U7KA 2BFVL 1V05A 3B4NA 4TUKL 4BZ2L 3MRPA 3MLWH 1XGYL 2NY4B 2ATKA 3IDMA 2BSSB 5EU4A 1M6OB 4YBLB 2BSED 2A6KB 2R56L 4A6YL 4X7DC 4N5ED 4ZUVB 5T1KA 2C4FU 4W4NA 4WUKH 2V9TA 4JO1L 1JGLL 4HKXA 3HNSH 1J05B 5JW3H 4HH9B 4E0RB 4KI5C 3GEWB 3GHEH 1ACYH 5E2WH 3OSKA 2XWJA 4JDZB 3M1BA 1LO3H 4RGMC 5HGDA 3RWFB 1J9CT 2NZ9D 3G08A 4JFZH 1MHPH 5D5MB 4CMMB 3R1GL 1A4KB 5E5MA 1QRNE 2UZIH 1IVLA 5E9DA 5A16B 4LCUA 2BDNL 4OJFH 2DIJA 1S5IL 3R0MA 1I3RA 3MYJA 4JPWH 1G0DA 5E94A 2EE9A 4TOYH 1LO5B 5DQDL 1T22B 2LFGA 4NYLB 1F4AA 1FL3A 1R3JA 1UQSB 4HXAL 4V2CB 4BFIB 1MI5A 2Y72A 2MJWA 5HHPB 5KVEH 2A6IB 3BO8A 2OQJA 1J1OH 1GGIH 5TQ0L 2D3VA 5JDSA 4IMLB 4P4KA 5IMLA 5J3HD 1CDJA 1FL6B 4JANB 1II4E 5MEOA 2C26A 4FN0A 5J13C 5EC2A 3O0RH 1I1FB 5FO9A 4RBPK 5JOPD 3FO2B 1FZJA 2AEPH 3BWAB 4I48A 4FQ2L 4PRPA 3RI5F 3VG9B 2YD3A 3RTQA 4M6ML 2OXHA 1Q72L 1AFVH 2NNAB 2BY2A 2NY1D 2I27N 1AY1H 1BFTA 5CSBA 3DVIA 3C87A 1RHHB 3EGSA 4QHLB 3QDMD 4L3CB 2QSQA 1P1ZB 2VDRH 4NOFA 1BQHB 4WY7H 1UCBH 3RDTD 4PV9A 5LGJA 2YZ8A 4M4RA 3UJTH 4GW1B 1T7WA 2Q3ZA 4KROB 5D71L 4D9LL 3TA3C 5IK3A 2BFVH 5FKPA 4GMSH 4TUKH 4DZ8B 5ITFB 1AGDA 4PGCA 4EXKA 1XGYH 3C60D 5AYQA 4MCYA 5SX5H 3KPLB 1MCQA 5EWIL 1XFPA 4HC1A 2R56H 3QO1B 5IQ7L 1J87A 3LOWA 4XHQA 4NQXB 4ZOAA 2D03L 4OCNC 2XG5A 1CWVA 4WUUA 2VKWA 4OCXL 3O4LA 4JZNB 2XZAL 4JO1H 1JGLH 1MVUA 4TUOB 5HYJE 3WD5L 1ZHKA 3OR7B 2EEBA 1BVLB 5D7JB 5KN5B 1S9YA 1CD1A 5HPMA 3BZEB 5IW6B 5TH2B 4YIQA 2G2RB 3RIAK 4M61B 3KLHD 4OD2A 1MNUL 3MLVL 4UOJA 3R1GH 4LCIL 4U7SA 1MLCA 5B8CB 1UJ3C 4K94L 3QBTB 2BDNH 3OKOA 5IFAH 1S5IH 3GGWB 4KDWA 5C0CD 5IM7A 4HJJL 1XR8B 1P84K 3GRWA 2Q86B 4WFFE 5DQ9A 3V6ZB 5DQDH 3RWDB 3MRKA 1T7YA 4U0QB 5MENB 5JUEL 4HXAH 1IKFL 2D7TL 4YFLI 2DB8A 4IOIA 2DM2A 2PYED 5TQ0H 4ODXA 3QB7C 3LPGA 1F4XL 1CDCA 2M8XA 2Z35A 3ARXA 1JPSL 1G7HB 5DVLA 1OB1B 2Q76B 5E1AA 4PJEB 1U8OA 4JFFA 1LO2L 5BQ7B 5J4MA 3F5WB 3ROLB 4FQ2H 3V0VB 4POZD 2YR3A 3TFKD 4M6MH 1FZKA 2IFGA 3MRNA 2K7QA 2GJZB 3D0LB 3RWCB 1J86A 5JTWA 1CN4A 2YPVL 2EE6A 4ZUSA 1SHMA 4MQTB 2NY3D 3O45A 3BEWB 3MC0A 2EYTB 1YEHL 4LVOC 5SX5K 3DRTA 3NZ8A 2GJ6D 4XXCA 5TFSL 4Z7VB 3EJYD 1UWXH 2OBGA 1TVBB 5D71H 2VLKA 3IDIB 4D9LH 4EUPA 3IXTA 3UJJL 4MMZC 3DSNA 2NYYD 4DKEL 2W0PA 3IETA 4XWOD 5EUOE 1NBZB 5HDLA 3VXNB 1AQDB 2X4RA 3WFHB 1UKQA 5EWIH 1RJZB 2VE6B 5IQ7H 4LRNL 4MSWA 1ZT1A 1I1AC 2DMKA 2D03H 3KVQA 4OZIF 4NQDE 4HBCH 4OCXH 5IVZA 3O81A 1LO4H 2XZAH 3QWQB 2DD8L 4GRLC 3WD5H 3BKYL 1MCPH 4F7MB 4JY5L 4TUJA 1I4FB 3K2MC 1MNUH 4NNYB 1NKRA 5IG7B 4PJXF 3MSPA 3MLVH 4J4PD 5JDJA 3GSRA 4ZDHB 3GMQB 1FFNB 2P5WD 5HHOE 2R1YA 4ODWA 4MHHI 3WO4B 4K94H 2GITB 1IGYA 4JZOB 3CFJB 5KOVC 4HJJH 5I16A 4HJ0D 1TPXB 1XCQA 1CIUA 3V7AE 5IW1A 4CBPA 4KGLA 3PDOB 3X14B 3O4OB 1F6AA 3FN0L 2KL6A 5JUEH 4MZ3A 4P3DB 5KSUA 3BD4A 2D7TH 4KK8D 4OZFG 2H6PB 2H8PA 4L9LC 4QRPA 5IVXF 3NIGF 3AY4A 3I02B 3D69A 1U95A 5DURB 3W0WB 1F4XH 2CLZA 4QO1A 3CXDL 4ZG1A 2RBLA 5HHNA 4CVXB 5D1ZA 4HIEA 3FONB 3V6OA 1Z3GL 4X9BA 2W1NA 1J11A 3KPMA 4X99A 1LO2H 3L3OB 4LF3B 1KIPB 3I6GA 4QWWD 1PQZB 2F19L 3PABB 1DN0A 4XNQB 5JXED 2Y6SD 3AMLA 5E08L 4HUUB 5GGQL 2YPVH 3QO0B 1SEQL 1MJJA 4ELMB 1BP3B 1RUKL 5DHXB 4D0CB 4KTYA 4MA1B 3TYFB 4DN3H 1N6UA 1ZAGA 4D8PA 3BXNB 4CJ0A 4F3FA 4JQXC 1YEHH 4O9HL 5D7LD 3BP4A 1HH9B 5TFSH 5LAXA 4MA8L 4QHKI 1E4KC 3KAAA 2BNRD 3VWJB 1TZHB 3X13B 5KAQG 3UJJH 3VA2C 1FFOA 3PNWB 4R8WL 3RHWF 3HC4L 4U1IB 4DKEH 3N1QC 4QHUB 3NBNA 4L4VB 4YGVA 3FAWA 2XY2A 5D2LE 3GK8L 2PCPA 5DJZA 4H25A 1DQML 1LK2B 2ZCKL 2A6DB 4LRNH 1L4IA 2F58L 3Q3GA 5JIIA 4E41B 5T5FL 3RX5A 1ORQB 4Y4FD 3WUZA 1HHIA 5I8CB 5CGMA 2DD8H 1A5FH 1YEDA 3BKYH 3SBWA 3ULVF 3HE7A 2AXHA 2XTLA 2GKIA 5L2JA 4PREB 2BC4B 4JY5H 4M93C 25C8L 3RAJL 4JN2A 3IDUA 1IM9D 1T7VA 1ORSB 2IPUK 4UTAL 2MCG1 1FORL 4ZFOB 4U1LB 1U3HD 1YY8B 1YQ2A 1HIML 4OCYL 1CGVA 1A0QH 4XH2B 4NP4L 1DUYB 3UX9B 1YMMB 1O5DT 2W0KA 5GGSY 4UNVA 3FN0H 3SE9L 1Q0YH 3OJVC 1OOAA 3NPZB 3T0EC 4P3WA 2Q3AA 4KC3B 1IGIL 3SDDC 1FN4B 1EBPA 3CXDH 3C5ZB 1YPZE 4HCRL 2EIEA 5C86A 3S36X 3HC0A 4XT1C 5EZOL 3HE6C 2E9JA 3CLFL 5ELIA 2YD9A 2HG5B 4HMEA 2DMBA 1YEGL 2F19H 3SDXE 1JNLL 1ES0B 4NO0D 5JR1L 5CKAA 5E08H 5GGQH 5HY9A 4Q2ZA 4BK4A 1JTTA 1SEQH 2IH1B 1RUKH 4F15C 2VXUL 1OGTB 4HT1L 5IBTL 4O9HH 2IJ0C 5DRZA 3LQMA 3QUXA 3QPXH 1FYTD 1KB5L 4MA8H 1XMWA 3RNKA 4GLRH 3ZO0A 1OTSD 4R8WH 5HVGB 5EU7C 3HC4H 1KJVB 4L1HA 4KVNL 5MI0B 4PG9A 3GK8H 2VUOA 4KY1L 1DQMH 3L7FA 2J12B 1AR1C 2X9WA 2ZCKH 1L0QA 2IAND 2F58H 5T5FH 5D9SB 1L7IL 1H9VA 3QIUB 4LSTL 5CJ8A 1EFXA 2CDFB 5C0JB 1QRNA 4R4BA 3GSNL 5H37H 2QQKL 2QLVB 1CZ8H 2CIKB 3HAEG 25C8H 3RAJH 4XNMB 1P5VA 4K7PX 1ZHNB 4P23C 3RBGA 4UTAH 1VGKB 1FORH 3UTTB 4TSAL 3EO0B 1MHCA 3JUYA 1JF1A 1GHFL 2OP4H 2VZUA 4JB9L 3UZQA 2N56A 1HIMH 4OCYH 3MRPB 4M7JL 2EDRA 4WFFD 5JNYA 3BRFA 4NWTL 1N64H 4NP4H 4LQ1A 2ATKB 2ZNWA 4JFXA 5AYUL 5EU4B 2N4IA 4WW1A 1MCNA 5D6DA 3MFFA 3X11A 3O6FA 5D1XA 4MAYD 4HKXB 4Z0XB 3UP1A 1XGRA 2KZ1B 2X10A 3TVMA 5IV2A 4NO0A 2XWJB 2XQYG 3P77B 4Y7MA 4DGVL 3M1BB 5HGDB 5EZOH 1Q8MA 3CLFH 3E6HA 2BVYA 2VXTL 3G08B 1RUML 1YEGH 1F13A 3O9WD 1JNLH 5KG9A 5E5MB 5EOTA 5JR1H 3D39E 3Q1SL 3MPCA 3OKDB 2AK4A 5E9DB 4LCUB 4LLDA 3VDCA 4K8RL 1OT1A 1SVZA 4S1QL 1FG2A 4ZYKA 1I3RB 3MREA 4WEMB 1UWGH 2VXUH 4HT1H 5IBTH 5D1QC 5L8LB 1FL3B 1R3JB 1KB5H 2Z4QA 3HMXL 2WWMC 3B8YA 1NCCL 3ILQD 4X4XA 2OQJB 3TBWA 5JDSB 1JTPA 4KVNH 4WI6A 4HIXL 4P4KB 5IMLB 2X1WL 4F7PA 3ETBF 5MEOB 5HYJA 1M4KA 4KY1H 5DDHA 5EC2B 5FO9B 1TLKA 2I9TA 5CZXD 2HA1A 1T1WA 4NQDD 4ZTPL 4I48B 4PRPB 5F97E 5I73C 3ZSTA 3VG0H 4YHNA 3ZT6A 1L7IH 4LSTH 1A3RH 2HP4A 4YC2B 4PGEA 4MXQC 1SJVA 5EU5A 1PG7L 3GSNH 5B4MC 3EGSB 4YH6A 2QQKH 5DD5L 4PV9B 5LGJB 1K8IB 3Q0HA 4CNIA 2CLRA 5DRWA 1KC5L 2D4FA 4Q58C 4TSAH 5HHOD 1CICC 1CE6A 5HPOA 3NZHL 1GHFH 4JM2A 5IK3B 5FKPB 2EC9T 3C9NA 2IAMD 4M7JH 1AGDB 3RY4A 4PGCB 5I6XC 4NWTH 4TRPL 4MCYB 5AYUH 5KW9L 3LKQA 1J1XL 3MCLH 3QI9A 3V4VL 4XMLH 2JELL 2F54A 4WUUB 3O4LB 5CD5D 5F1IA 4RQQA 1MVUB 3A6BL 4FABL 3QZWA 1BQSA 4OTXL 1ZHKB 4ZS6D 1S9YB 4PJ8A 1CD1B 4YLQT 4DGVH 5D7KD 4YIQB 3I75A 4L8CB 4JRYE 4OD2B 2VXTH 4N5UA 1RUMH 4LEXL 4OQ1A 4W68A 4G6FB 4KGJA 1X5GA 2J88L 2UY7A 1MLCB 3Q1SH 3AREA 1FO0H 3OKOB 4K8RH 4S1QH 1LP9E 3HR6A 5IM7B 3MRCA 5EUOA 3BUTA 1VFBA 2QBWA 1E4XL 1ZSDA 4D2NA 1E4WL 4D9RD 1JYNA 4Z0BL 5CSGA 3EFFA 4YPJA 4IOIB 1NCCH 4Z7OF 3I6LE 4QNPE 5KSAD 4RCAA 4JHWH 4ODXB 1SYVA 4MNGE 4HIXH 4OI9A 2Z35B 1U8JA 1WV7T 4Q97A 4HK3N 3QDJE 4LVHB 3ARTA 3OKMA 1A02N 4JFFB 3ECBA 4ZTPH 1U92A 2XWBA 1FZKB 5DMGC 3MRNB 1YZZA 2XI9A 2BVEA 1QLEL 2F5BL 4ZUSB 1PG7H 2NXYC 2X1PA 3P0GB 2QHRL 4G9FE 1T4KB 4J6RL 1Q9LA 4M1CC 4HXBL 3O45B 1WWAX 1YY9D 3NZ8B 1OAKH 1KC5H 1NUNB 4EUPB 2VLKB 3NZHH 3IXTB 2V5MA 4WO4C 1UZ6E 4JCLA 4PLJC 4KRPB 3IETB 5DJ6A 1RIHL 2D7QA 4P5TA 2DBLH 2X4RB 3DBXA 1N59A 5TE4L 3QUZA 1J1XH 4IIQA 1T83A 3K81A 4MSWB 5BCAA 3SE4A 3V4VH 2B5IC 3BQUD 3ZKXC 5TPWL 3UTZA 3QG6A 5IVZB 5FGCB 1BOGA 2FRGP 3L3KA 3ARPA 4WHCA 4JFPA 2BHUA 5BW7A 1U2HA 4UNTA 3GIVA 1F11A 3CX2A 4FABH 3K4DA 3LV3A 3MLTA 4OTXH 3BMWA 4NJ9L 2CUIA 2XA8L 4L4TE 3STZA 1GOGA 4TUJB 4HKZB 3QWOA 4JJHA 1MJ8L 2O5ZL 2W9DL 5GZND 5CJXA 3G5VA 2BNQA 4LEXH 1R5IA 3GSRB 5SWZE 2J88H 2CK2A 2FJHA 1WK0A 2R1YB 4ODWB 3QIBA 2NXZB 4ONHA 1UFUA 5I71B 4GKSA 2DWEB 4LPWA 3W39A 3WLBA 5I16B 2KPNA 1XCQB 5IW1B 4P4RA 1E4XH 4TVSa 3JXAA 5D2LA 1E4WH 1F6AB 4G5ZL 5JPNA 4Z0BH 5KSUB 1H3VA 2H8PB 3ARBC 3MJ9A 3GI8L 4HJGA 4UOW0 4QRPB 4F7EA 1A1OA 3KLAA 3D69B 1U95B 1XF5A 2CLZB 5IB5A 5HHNB 4PJHF 4JZJC 5D1ZB 4HIEB 4MYWB 3SKNA 1BPVA 4AZ8A 4X99B 5FDWA 4HS3A 4GH7B 1QR1A 3I6GB 4FMFA 1VFOA 4HFWA 1KACB 2X7LA 1DN0B 3S88L 1QLEH 2F5BH 1JHLL 3HN3A 1IAKA 3EYQD 4J6RH 3DECA 3FQXA 2HT3C 3U7WL 4D8PB 4HXBH 3LSOB 4BKLA 3DI2B 5M7QA 4F3FB 5FUCE 4YHYB 1OCWL 2LAAA 3BP4B 3HA0A 1OQXA 5LAXB 1KPRB 3HG1A 5AZ2L 5LGKA 3O8XC 1YYLL 3MNVA 4XRCA 2X1OA 1T20A 1FFOB 1ZHLA 1RIHH 4YGVB 1G84A 1FHGA 4X5XA 4LBEA 2PCPB 5DJZB 4H25B 1PSKL 4GMTL 1REIA 4JDTL 5TE4H 1KB9J 4H8WL 3Q3GB 4PRHE 5ACMA 5TPWH 5C0AA 3JV0A 3BP6A 1EXUB 1V3KA 2D0GA 4MD5A 3RDTC 1X44A 1HHIB 4UQ2A 3LD8C 1KCVL 2HT2D 1J0JA 2FJFA 4QEGA 4Y5VC 1RURL 3ELAT 4HSQA 1YEDB 3HE7B 3DRQA 5GJSL 4NJ9H 3GSVA 2XA8H 4FFVD 5L2JB 1GGUA 1I3UA 5K59F 4JN2B 1MJ8H 2O5ZH 2W9DH 3HPLA 3FHAA 3V7AG 1U0QA 1BM3L 5I18H 5E0QA 4A2MA 4J3SA 4PRIE 3LQZA 4OF6A 4X83A 3GUTA 4G6AD 3O3AA 4M5YL 2X9YA 4WJ5A 4PUBL 2Y1VA 4GOSA 3OJMB 1ZEAL 4G5ZH 4LRIA 3U9PH 4P46B 3LKOA 4H26A 2OX5A 4JREC 5IMOA 3GI8H 1FVEA 3FQTA 1G9ML 3L6FA 4HUWB 4W4OA 4GXUN 5J11C 4DAGL 1NGXA 4I0PC 5DWUL 5AZEL 5CEXA 3AM8A 1WZ1L 1YEKL 3S5LA 1P5UA 4I3GA 4X9GA 4AQOA 3BOVA 2C3WA 3OGCA 1CTNA 2ZOLA 3K4ZA 3QSKB 1A1MA 2Z91A 1OPGL 5JXAL 4XCYA 1IGJA 4X5WA 1JHLH 5HY9B 4Q2ZB 2HFEB 3ET9F 3J7HA 3J8F7 2E6QA 4K8RD 3WNKA 3VDBA 3U7WH 3BKML 1P6AB 2JJWA 3P0YL 3KYNA 5HI5D 1OCWH 2HN7A 1CIDA 5D2NE 5DRZB 4KK6C 1JGDA 1UM6L 3QUXB 3DHJA 5AZ2H 1NFDE 3RNKB 1YYLH 2E6JA 2NY0B 4E42A 1O7SA 2P46B 4MXVE 1MUJA 1PBYA 12E8L 4QOKD 5F71A 3UAJD 4JHZA 3G5YB 3TFKC 1LDSA 4NPYA 3BPOB 4PG9B 5K9QI 1PSKH 4GMTH 4JDTH 4M5ZL 3RGVD 1BZ9B 4H8WH 3WHE1 1JZ8A 1JNHA 5ITBL 4HK0A 1KJ2L 3VDAA 1EFXB 4FQXA 5KOMC 3ZTJH 3VE0A 1YUHA 2ARWA 1KCVH 4OFDA 1RURH 3T3PF 3IKKA 3EJYC 1QRNB 5IWLC 3D39A 4R4BB 4K3HA 5GJSH 3KPRA 1NPUA 3FL7A 2NX5A 1S5HA 1FNHA 3SCMC 3KYMA 1Z2KA 4JRYD 5HI3D 4B7LA 1EVUA 2FIKA 3UPRA 1MHCB 1BM3H 1JF1B 4ZNCD 1BFOA 1RZJC 3A67L 2YD6A 1MEXL 5JNYB 2FHFA 1EERB 1RPQA 4JFXB 1RZIA 4M5YH 4ZOCA 4WW1B 1KUMA 3QHZL 3LS5L 3FCTA 4PUBH 2ERJB 1ZEAH 3MFFB 2C9AA 1X4YA 3O6FB 3MR9A 5D1XB 3WNNA 3MTRA 5H37G 3HC3L 3DX8A 3RVVD 2H2PD 5FECA 4J4PC 1XGRB 1GCFA 3TVMB 4DAGH 5DJYA 5IV2B 4LNRA 2DQIL 2Q7YA 4JKLA 4R26L 5AZEH 4GRWB 3VWKA 1WZ1H 1YEKH 3ZL4L 1FO0A 1QRKA 3E6HB 3V8CA 3D3VE 2DQJL 4HJ0C 3ME0A 2D9QB 1OPGH 5JXAH 5EOTB 5KG9B 1SJHA 1ZV5A 2AK4B 4G9FD 4LLDB 1FG2B 1PZ5A 4IOSD 4KK8C 4XPFL 4FG6C 3MREB 3BKMH 1X5HA 4LIQL 1MCWM 1NBQA 1L0YA 1FRGH 1UM6H 2WNGA 1DUZA 2Z4QB 1HXYA 1AXIB 4I0KA 2QEJA 4PJ9C 12E8H 4Y19E 3TBWB 4CDHA 5JW4M 4ZUTA 1HNFA 4PJ7F 2C4FT 4BH8A 5KSBF 1KJ3L 2DM4A 5HYJB 5BS0D 5DDHB 2UYLA 4M5ZH 2I9TB 4LDLB 2YZ1A 1KELL 2AW2A 3QEQB 3FRPG 3S5LG 4BZ1L 5E00A 3HZYA 1KJ2H 4ZAKA 4YHNB 1C5CL 1AGEA 3BD5A 1DLFL 5EU5B 1MCBA 1EH9A 3MCKA 2VISA 5I30L 4OLZL 1EK3A 1TQCB 1LP9A 4RRPG 1EFQA 4WFHE 4YK4B 4KWUA 4Q9QL 2CLRB 5SWZD 5DRWB 2OTUA 3MV7A 1U93A 1CE6B 4LIQE 3H3KA 2UZXB 4JM2B 4U6XA 4Z7WA 1IARB 2E7CA 3A67H 5J1SC 5EBLA 3U30C 3CNKA 1MEXH 2OYPA 4CUCA 4OIBA 3IGAA 1LEKA 3IDNA 1HE7A 1JZ6A 2K1MA 5DI8A 5KS9F 2D7OA 5T1LD 3LKQB 3QHZH 3LS5H 1MJUL 3QDJA 1UACL 1D5ZA 3QI9B 4FTVD 2F54B 1FJ1A 2DBJA 3AAZA 1F90L 3HC3H 4QGYA 5LGHL 5F1IB 4RQQB 2OR8A 4LPYA 3QZWB 3TN0A 3D87B 3BH9A 2DQIH 4R26H 1DBAL 2HFGL 4LHUA 4PJ8B 2DQDL 2DLHA 3I75B 4NRXA 2VR9A 5E4IA 4WTZA 5EH1A 2DQJH 5C0BD 1F8TL 1J0HA 5IMMA 5I1EL 2AI0L 3B9KA 1QLRB 2NY7H 3AREB 1BHGA 1Q0XL 2ZG1A 3IDYC 4CU8A 4MD0B 3DROA 2AV1A 4KKAC 1NSNL 4XPFH 5CAYB 3MRCB 4UV4L 5EUOB 4LIQH 1VFBB 3MRHA 1VADA 3T04D 1ZSDB 4Z77B 1B3JA 3WMSA 1XF4A 3AU1A 4OZIE 4OCLC 3EFFB 2NY5H 1TJHL 2JB6A 4NBXB 4DUWA 4HIIA 1SYVB 4M1DL 4BQ9A 1CCZA 1U8JB 3U4EA 3LRHA 4GS7C 3OKMB 4UDTA 2Z92B 1KELH 4PRHD 4L4TA 3ECBB 3F7YA 4BZ1H 1B0WA 1U92B 2F5AH 2XWBB 3IAQA 5GSVA 1C5CH 3ARGD 1N6VA 1C5DB 5DZLA 1DLFH 1IEAA 2QSCL 3L5WA 5I30H 4OLZH 1WIUA 5TDPA 4XWGL 3FKUS 3T0AA 2BZDA 3EYVA 4U1SA 4Q9QH 2QHLA 3QT2A 1Q9KA 1B88A 4PRID 1PVHA 1OAYL 4HAFA 4TULH 1D9KA 4WFGE 3RJDA 3QYCA 1F58L 5DJ6B 1HYSC 4P5TB 4PLKC 3GO1L 4EQ3A 3DBXB 1N59B 3MGAA 3AS2A 4IOFC 1AO7E 3QUZB 1MJUH 4IIQB 1UACH 35C8L 3VFVA 1R0AH 2YC1A 3UTZB 1DVFA 3QG6B 5LGHH 1BOGB 3L3KB 3EIFA 4RSVA 5MERA 4JFPB 5KVMC 1EEYA 1F11B 3GIVB 3LV3B 3MLTB 2D31A 3QR2A 5CSZA 5ISZA 1J8HE 3STZB 3VRLF 3IFOA 2CO7B 4K7PY 1DBAH 2HFGH 2VZVA 5IKCA 1RZ7L 3G5VB 2BNQB 1R5IB 1F8TH 5I1EH 5FO8B 1YYMH 2FJHB 4KUCD 3U46A 1I1RA 3QIBB 4ONHB 1Q0XH 1LK3L 4J3UA 3S96A 1NSNH 2GK0B 5DGQA 1I7TB 4GKSB 4EI5A 2OJEA 2VYRE 4MAYC 3W39B 3WLBB 2JJTA 4UV4H 2NY4C 4UIMA 5E6ZA 3SEPA 4P4RB 2V5RA 5D2LB 1JZ5A 1X4ZA 3EBAA 5ADOL 2NXZD 5I1KL 5JPNB 4WV1A 3WHXB 4ENED 2J4WL 1XH3A 1FQ9C 1I1YA 4HJGB 5DK2A 5AUMA 4F7EB 1TJHH 4PRHA 1A1OB 3KLAB 4M1DH 1XF5B 3MV9E 2R1WA 5IB5B 5FGBA 2R0WL 4OGYL 4YR6A 1B4RA 2DIBA 4Y1AA 5FDWB 4LHUG 4HS3B 1QR1B 1CGWA 4HFWB 4WTZG 5ALBL 5KVFL 2X7LB 4KKBC 3RPIA 1MIML 2X44D 4U1MA 1IAKB 3C8DA 2R4SL 3HUJF 1A7OL 5I17A 5K9KA 5GJTL 3FQXB 5CCKL 4OM1H 4XWGH 2JE8A 3DTXA 4RMVA 1U58A 2AK1L 3MRJA 1CVSC 2J5LB 4HIJA 4MAUL 3GB7A 4LQFH 4LCWA 1FC2D 3NGBB 3HG1B 3ARVA 1OAYH 3MNVB 4N0UE 4XRCB 3KYOA 3GSXA 5CZXC 4NM8H 4OLXL 1F58H 4RAUA 4IS6A 1PKQA 2FX9L 3GO1H 4X5XB 4LBEB 3MRRA 5EU6E 3NABH 1MWAA 2Y5EA 3O2WL 35C8H 4N9GA 1P4IL 2XIDA 1IAOA 5C0AB 4V2BA 4PBXA 3GBLA 3VG9C 3BP6B 2A0LC 2BY3A 4XB8A 3VI4F 1GOFA 4H5SA 4UQ2B 2FJFB 1FNLA 3LQAL 4WEBL 3EJZC 3DRQB 3EO9L 3GSVB 1NGQH 5IJKA 2VLJD 2Z0BA 4WU5A 1AI1L 1U3YA 3CDFA 4JGMA 5D72L 3F12A 3HPLB 4YDVA 5D2NA 4DGIL 3IU3A 4KROC 3LQZB 4FQIL 1PAMA 2A77H 1FDLL 2F8VA 3ZE1F 2MOVA 3GUTB 3O3AB 5CD5C 5IB1B 3RWJB 4JM4L 2G5RA 3VMPA 5ADOH 5DHVH 5I1KH 3MLZL 5EU3A 2YN5A 4CN4A 5FFLA 3LKOB 4H26B 5BJTA 2J4WH 2YBRA 1UJTA 5IMOB 4Y19D 2WIMA 1FVEB 1E27A 5FDYA 3FQTB 4UNUA 5IJVA 5MEPA 2R0LH 5A43C 4IRSA 5FXCH 1NMCB 1NGXB 3IDGA 3FB5A 1KTLA 2R0WH 4OGYH 4JG1L 5CEXB 2C3VA 4HS8L 2NY2B 4OLUL 3S5LB 4Q74A 4UU9A 3QWRD 3OGCB 2ZOLB 3LH2H 2ICWI 1A1MB 5KVFH 1MFBH 2Z91B 1MIMH 3QRGL 1IGJB 4X5WB 2ADFL 5B8CC 2R4SH 1A7OH 3HZVA 5D7IB 3D9AH 5E8EA 4MX7A 2EC8A 5CCKH 4WFHD 5KSAC 4KJYB 5CP3A 1EMTH 2AK1H 3KYNB 4Q9RL 4P2RD 2HN7B 5JW4R 3BPLC 1JGDB 4K7PL 2WSKA 1Z9LA 2HLFD 2EDTA 4E42B 4U3HA 4BUHA 1MUJB 4QHNA 2JB5L 4TNVF 4OLXH 3GSUA 3MA9L 3WS3A 2UWEF 3VXQA 4F37F 2FX9H 4NPYB 1CFVL 3DNKA 4KQ3H 4WI3A 1JYWA 3VFNA 4XPAL 5EO1A 1P4IH 1JNHB 2WBJA 1ZMYA 4XAWL 5F7NC 3VFGL 3K4AA 4HK0B 3PF2A 4LGPB 2P44B 2OXGA 1XF3B 3WJJC 1QBBA 4FQXB 3D3VA 4X7SH 1YUHB 3VE0B 5T3XL 4ODUA 1DLHA 3LQAH 3D39B 1RD6A 4WEBH 3BKCL 3KPRB 5JA8B 3FFCA 3CCHA 2NX5B 1S5HB 5LQBL 1IEHA 3KYMB 2X4PA 1WT5C 4Y4KA 3U2SA 2O61A 1LD9A 5D72H 2FIKB 1BF2A 1A7PL 3IFLL 4DGIH 4WRLA 2EXWD 1A2YA 5JZ7D 1Y0LA 4FQIH 3PUCA 3BQUC 2NZIA 3ZSSA 1FDLH 4GBXA 3NAAL 4MNQA 1GL4B 1RI8A 2V5SA 2J6EL 3GDBA 3EKCA 4JM4H 3TZVA 1QR4A 2DQUL 2HRLA 3FCTB 4U6HB 3BGAA 3MLZH 3ZTJG 3M8OL 1CTOA 4FZ8L 4RX4D 3MR9B 1PD6A 4TYUA 5GZNC 3CIQA 3DX8B 4P2YA 2NY6B 1EGJL 2AQ2A 4I13B 4QY8A 4UB0L 4JRXA 1AGFA 1CGYA 3G6DH 1C08A 2XKUA 4LNRB 3VXRE 5T3XE 5ALCL 3DO7A 2Q7YB 4JG1H 3SDAA 1IGTA 3ARZA 3VWKB 3CFBA 4OLUH 4UUJA 5HJ3B 1FO0B 5GGVL 1TNMA 1K9TA 3RWEA 3U1SL 3OL2A 1OSPL 3UDWC 4Y16D 1SJHB 3QRGH 1MIEL 1E6OL 3WO4C 4LKCA 3IFPB 3VXTA 1WFUA 1PZ5B 1RMFH 3WKML 1X5IA 5BV7L 3ZE0F 4L29A 4P9HC 5T33L 5HGAA 3BPNB 2HKFL 4K7PH 5FOBA 2D2OA 1YNKL 2ENSA 3O4OC 1DUZB 3I9GL 4WFGD 5D8JL 3GMOA 4G80A 1HXYB 1X5YA 2JB5H 3P3YA 1CD0A 1L6XA 3MA9H 1YEFL 4ZUTB 3I3BA 1WIOA 1FYHB 4U0RB 2FZ3A 1AO7D 1CFVH 4BH8B 4RGNE 2WZPD 3S34L 4KU1A 4ZUUA 4GO6B 4YXKL 3EYQC 3L3DA 4XPAH 3WFBL 5HYIA 2ZZUT 1B6UA 3CZJA 5DLMH 3KPSA 3VFGH 5E00B 3HZYB 3QEUA 4ZAKB 2AKRA 1AGEB 3LAFA 4PGBA 2WWKO 2L4OA 3G6JE 5T3XH 4P2QA 2GSGA 3MCKB 5CUSL 2VISB 3CX5K 3BKCH 1IILE 3QEQD 5LQBH 1DN2A 1OTUC 2X4OB 3FQRA 4MA1C 5GISL 1FSKC 4G7YL 3RX8A 1IFHL 2OTUB 4WHYH 1A7PH 2ESVE 3IFLH 1U93B 3MV7B 4QRRA 2QL1A 4U6XB 3VWJC 4OZIA 4Z7WB 4HULB 1DBML 3VFRA 5EBLB 2FX8L 4V1DE 4P0DA 2DKUA 3MBEA 3NAAH 3TJEL 2ZUYA 1J1PL 3IGAB 1LEKB 1F3DJ 2J6EH 3IDNB 5DI8B 2YD1A 4PJFE 2J8UE 2DQUH 3QDJB 1D5ZB 1MF2H 2X89A 2QTEA 3M8OH 5TF1H 4FZ8H 4FFVC 1CS6A 1FJ1B 3AAZB 4HFUL 1P9MC 4PJXA 4GG6B 1JL8A 4K7FA 2PYFA 1EGJH 1IGML 3UTSE 5EOCL 1VESA 4UB0H 3RZCA 4CMHB 1QLFB 3TN0B 3BH9B 1TETL 3PGCA 5ALCH 3ILPA 1NEZA 4LHUB 3OHXA 1G0YR 2LU7A 3ZT7A 1EDQA 2DJUA 5GGVH 1HEZB 3FFDA 3U1SH 4G6AC 4XBGA 1OSPH 2V2WA 3MUHL 3B9KB 5L2KE 1MIEH 2H45A 4K3JL 3DROB 1CG9A 2FECI 2AV1B 3QIWD 5IVXA 3L3JA 1WITA 3WKMH 1EO7A 5BV7H 2GW5A 2A2QT 1IZJA 2F74A 3MRHB 4P5KB 5JW4Q 1VADB 1NJ9A 1YNKH 4P2OB 1XF4B 3AU1B 3I9GH 4G6ML 5D8JH 1ULVA 4APQD 2YOCA 1Y6KR 3H9YA 3A6OA 1YEFH 1JZ7A 4HIIB 3KPOA 1R5VA 3U4EB 2ZUWA 4IRJD 5EU6D 3C5ZC 3S34H 5E8NA 1EVTC 1F3RB 1QHPA 4YXKH 4UDTB 2ITCA 3WFBH 4L4TB 2VB5A 1J8HA 4RNRA 3F7YB 5I8OH 4LGRB 2PN5A 3QPQD 3C09B 1KIRA 2AGJL 5GSVB 3WNOA 2YD8A 5IT2L 1AXTL 4KTDL 2MKWA 5CUSH 3L5WB 4QRQA 4RFNB 5TDPB 2VQUA 3E6FA 3EYVB 4U1SB 3UAJC 4G9DA 3KS0H 4YNYA 4G7YH 4XNZB 1Q9KB 4OZHF 3I2CL 3TBTA 5EIVA 1TQBC 5DR5L 6CGTA 5C3LD 4X7CC 1D9KB 1BZQK 1DBMH 3QDGE 1OAQL 4F9LC 3L3IA 1EEQA 1WEJL 5ICYA 4PJHE 4KUZL 3TJEH 1J1PH 5E99L 5MI0C 2IQ9L 3MV9A 4O2FA 1QSZA 3VFVB 2YC1B 3OB8A 4X9FA 2CLVA 4HFUH 4PJAF 1DVFB 5F89A 4PLNC 5T1MB 2CKBA 3GSWA 1GZQA 4PJGF 3QIUC 5MERB 1A6TB 3WN5A 5EOCH 1KCUL 1EEYB 2GUOA 4XP5L 1OY3B 5B3JE 1ZOXA 2D31B 3G5XA 1TETH 2HH0H 5CSZB 5ISZB 3IFOB 1E0OB 5IKCB 2RFXA 1BLNA 1QBLL 1UEMA 4KI5E 4L8SA 5IB4A 3U46B 3S96B 3AS3A 4EI5B 3T1WA 4X5LA 2OJEB 3VI3E 3SQOL 5EDXA 2EDYA 1CFSA 3MGOA 4O2CA 1MCIA 5CWSB 2FL5A 4O58L 4WV1B 4G6MH 1XH3B 1FIEA 5E6ID 1I1YB 5AUMB 5GGRA 1FFQA 1KTRL 3ZYJA 3B9AA 2I9LA 4EVNA 3NCEB 2R1WB 3MLRL 3U0PA 1BWMA 3G04A 1A64A 5F7MC 3G5ZA 4YR6B 1NAKL 4P49A 3WS6C 1A6PA 1NEZG 4Y1AB 1XCTA 4X6BB 3GKWL 5C08E 5E2UL 5F9DC 2AGJH 1K8DA 2YS4A 3V0WL 5KZCD 5IT2H 3LKNA 3RPIB 3CAFA 4U1MB 1U42A 2OR9L 4KTDH 3VGBA 3LIZL 1FNAA 5I17B 4Y4HD 4KFZC 5K9KB 4M62L 1HKFA 3WIHL 1JWMA 3DTXB 1AHWB 1U58B 4Z78A 3VGFA 3MRJB 4HIJB 5EO9A 5HVHB 3GB7B 5C0EB 4S0SD 2WP3T 4KRLB 3I2CH 2WLZA 4LCWB 2Y4SA 2F53A 5BRZE 3KYOB 3GSXB 5FA4A 3FB6A 1OAQH 1OGAE 5GS1C 1NCNA 1WEJH 1HHJA 4RAUB 4IS6B 4KUZH 1PKQB 3W11D 5E99H 4P4KC 3P4OA 4RMRA 5F7DA 2LAGB 1MWAB 5ECJE 4CKVX 2LTQB 3ULUC 4N9GB 1IAOB 3TM6A 3W9DA 2BSTA 1NCWL 4DW2L 3WHE0 4NRZA 3BJ91 4H5SB 4PBVC 4YBHA 4WTWA 4E5XA 4YC2C 3PWLA 4R2GB 4XP5H 5K9JL 5HVWA 4MQ7A 5TE6H 2V5YA 5T3XD 1RK1A 3MLXL 4LAJH 2QADB 3C08L 1U8HA 1QSEE 2WINA 3R4DA 4WU5B 4OB5L 2MSPA 4YDVB 1QBLH 2P7TA 1W2KT 5D2NB 4YBQC 3ARUA 3IU3B 3QRFM 1VKXA 2H2SC 1MAML 3PWPE 5C71A 3GBML 4KKCD 3B9EA 4JPVL 1S9KC 2UZYB 3MOBL 3SQOH 5DSCA 1G6VK 1HWGB 4OT1L 3RIAF 2P5EE 4QKXB 4K9EC 4JG0L 4O58H 5EU3B 3MRDA 5GGTA 5BJTB 2YBRB 1PGRB 2AP2A 3V5HA 1E27B 5A2FA 3T65A 4ACPA 5MEPB 5FYKL 1J0KA 3K80A 1KFAL 4KI1A 4RGND 2C4XA 4IRSB 4ZO6A 4RFOH 3IDGB 3MLRH 1J0IA 3QG7L 4G6JH 1KTLB 3CSBA 3R0NA 3JWOC 2C3VB 5T1DL 4JY4A 3GKWH 3ESUF 4UU9B 2RHEA 2I5YH 5E2UH 1NLBL 3V0WH 3LIZH 3O3BA 2HT4C 2Y23A 1CGXA 4OF8A 4M62H 5E8EB 3WIHH 2LU3A 3QXAB 3WSQL 3WNPA 3THML 5C7XL 4NZDA 2I24N 4JDVA 4EDWH 2ESVD 5I2IA 3T4AA 3TEUA 5HI4C 5DD0L 4NKOA 4QHNB 3MRIA 2EE2A 4V1DD 3VFMA 3GSUB 1DR9A 3WS3B 5F7WC 3VXQB 4BK5A 5HVFB 2YXMA 3WKNA 1KG0B 4Z7UE 5FYJL 5IBLD 5I75C 3KHOA 3ALXA 1OP5H 3SKUD 5FYKE 4LVHC 2B1HL 4OF3A 3VFNB 2CPCA 5EO1B 3VXRA 3EDEA 2WBJB 3ZYOA 1NCWH 3FOLA 4EOWH 4Y2DA 1KSRA 3TNNB 4ODUB 1DLHB 2ZNXA 4HUXB 3MLXH 3FFCB 3CCHB 2BVOA 2X4PB 4Y4KB 3U2SB 4KK5D 4ZXBD 3T8XA 1LD9B 1A6VL 2FWOA 1BBDL 3QUYA 4OB5H 5F72S 2QQLL 1U36A 5L2KD 1N4XL 2YEZA 2LE9A 1A2YB 5KJRL 1Y0LB 5DS8A 1E28B 1P4BH 3GBMH 4JPVH 4GBXB 1OF2A 4MNQB 3MOBH 4OT1H 3TZVB 4JHBA 3FT3A 2ITDA 2YPLE 5CIPH 4MZ2A 1JHKL 5FYJE 4JG0H 4WEUD 5FF6A 4CW1A 1UWEL 4WDIA 3QULA 5FYKH 3UBXB 1KFAH 4QY8B 3MRMA 4JRXB 1AGFB 2RQ8A 4GXUM 1C08B 2YD7A 1P7QB 1INDL 5M94B 5ERWA 2PXYD 3QG7H 3DO7B 3SDAB 5HSFA 3CFBB 3TH4T 4PD4K 4UUJB 3VXSA 1M7DA 3RWEB 2ADIA 3QAZB 1NLBH 2E7BA 3SJVA 2ZOKA 1HSAA 2EIBA 2ESVA 2NXZC 4HG4J 3IRZA 5I71C 2Q8BL 1QFWI 3WSQH 2ZCHL 3QXWA 5KS9E 1ADQL 1NCAL 5HHME 3THMH 5C7XH 4L29B 4LLQA 2XRAL 5EBMA 4R96A 5HGAB 1G9MC 1OP5K 5FOBB 1SQ2N 3QFJE 5F1NA 4PJBF 3WNMA 3GMOB 2Z31D 3BX7C 4G80B 5DD0H 1A9BA 3JWNC 5TDOA 2M1KA 1KCRH 4WWKA 5FYJH 5C07E 3UTSA 4ZUUB 1LHZA 2B1HH 3L3DB 1PW3A 3KPSB 1SBBA 3QEUB 3HPJB 3MNWA 5EO0A 5BZWA 3TCLA 4I2XA 2N7AA 4WGWB 2GY5A 4PGBB 4EZMA 3DX7A 4P2QB 2AXGA 2GSGB 3B43A 3FQRB 4MNHA 1GOHA 1A6VH 1BBDH 5IHUL 4KI5D 2QQLH 2CUMA 4LMQI 2X4SA 1RULL 2C5DC 3MXVH 4GAYA 1N4XH 4EI6A 4QRRB 2ZPKL 4XVSL 5CKGA 1AJ7L 2AJZA 4OZIB 3PL6A 4DCQA 3VFRB 2ZWLT 3MBEB 3VD4A 2BY0A 3B9VA 4OD3L 3L1OL 5HD8C 4P3CL 2W65A 3EYSL 2UUDH 4F2MA 5DUMH 1JHKH 43CAA 3PDGA 3L95A 5F9WB 1UWEH 4PJXB 1T6WA 4K7FB 2NW2A 3HI5L 5IHLB 3OJDA 2PYFB 5F93C 3F6LA 3MX0A 3RZCB 5A2JH 5DJ2A 4JQVA 3T0EE 1INDH 3PGCB 3SBWC 1L0XA 3HE7C 4Y8DC 4QT5B 3ILPB 2JLLA 1NEZB 3OHXB 3O11A 4Z7QE 5C08D 1I9IL 2VZ3A 3LEYL 3FFDB 3LN4A 1JGEA 4XBGB 3DLQR 4QCIB 2V2WB 3OF6A 3PQYB 1MCSA 2B0SL 3K0WA 1CG9B 1ZGLA 3PWVA 1KTDB 2DI9A 5IVXB 1QA9A 2YMXL 3L3JB 2Q8BH 3QDGA 5J0BA 5T3ZD 1ADQH 3EDDA 1NCAH 4PJHA 2F74B 3C6SB 2XRAH 1NJ9B 1CE1H 3F65A 1FV1A 5BRZD 5CBEA 4P46C 1OQOA 2VR5A 2OJZL 3PGFL 4O5LL 1WVZA 4X4YA 3KPOB 1R5VB 1FG9C 3TA3D 1BFSA 3X3GL 3WFDL 4JO4L 3IDJA 5E8NB 5HDBE 5EU7E 4Q6YA 1N8ZA 3VFUB 1VA9A 2ITCB 1FLTX 1HN1A 1J8HB 4RNRB 2ORBL 4H1LA 4OCMC 3AXLA 4IMKC 4KZDH 4CU6A 2HLFC 5GS0L 3FB7A 4OQTL 4QRQB 2XKNB 2PF6A 1F4HA 1UC6A 3NIFE 4G9DB 4YNYB 3TBTB 1RULH 4H88L 2UUDK 2UVFA 3GM8A 2ZPKH 1AJ7H 3D5OF 2NW3B 3PWPD 3UYRL 2Z93A 3C8KB 4Z18A 5ICYB 4MXWL 4WI5A 1OWRM 1XGPB 1S9XA 2BP3A 4OD3H 3L1OH 4P3CH 3BPOC 4WU7A 1ZLWH 1UGNA 2FB4L 3EYSH 4O2FB 4GAGL 3EW3B 3EHBD 2CLVB 2Q20A 3D2UD 3QQ3A 2CKBB 3GSWB 1GZQB 3NCJL 3HUJE 3WN5B 4LP4A 2GUOB 1RJLA 1UB6B 4XVJH 1ZVSA 1UH2A 1FCCA 3KJ4C 4OV5A 4Z76A 5ICXA 5CBAA 1I9IH 4FXLA 3LEYH 4UV7L 4DFHA 4NQCE 4S2SA 4PJIE 5KTEL 1HQRA 2C3GA 3DXAE 4L8SB 5IB4B 2B0SH 2VDPL 1KPUA 2MMXA 1A22B 3RL1B 4I1NB 2YMXH 3GJFA 3HMWL 1MPAL 4HUVA 1OGAA 4I3RL 4ISVA 3KWWA 3VMOA 3MGOB 4G8GE 1RU9L 3RI5K 2FL5B 4A2LA 2ERJC 3W5NA 5GGRB 4TVPL 3O6FC 5E8PA 2OJZH 4O5LH 4YHPA 43C9A 9CGTA 3ARFA 5LXGL 1FP5A 4EVNB 5FYKD 3X3GH 1HHHA 3WFDH 4JO4H 3U0PB 3G04B 3G5ZB 4KHXL 1RUPL 3ORJA 2ORBH 2FH8A 4CN1A 1ZLVH 1ITBB 5DMKA 1K8DB 1QSEA 4YDIL 3LKNB 1YPZF 4RWYL 4JFYB 2JJUA 1UA6L 4OQTH 1TENA 1TVHA 2H3NA 4HF5L 1GXEA 1CFTA 1JWMB 4JPIA 4Z78B 4LAQL 5EO9B 4XVUD 4PS4L 1TJGL 3SDXF 2E27H 1OAXL 4H88H 2P5EA 2F53B 1A6AA 4OM0L 4YHKL 5FA4B 3FB6B 3UYRH 2E3VA 4MXWH 1HHJB 3S3PA 2APWA 3V9FA 3NFPA 4TVPE 3WYRA 3P4OB 3TPKA 4BA8A 5SX4I 5F7DB 3U36A 2FB4H 3KXFD 5FYJD 1FLRH 5I1AA 3W9DB 2BSTB 4E9LA 1JPFA 1MRCL 4X4ZA 4R6UA 1TITA 3DGGA 4NRZB 4OLEA 2ARJQ 3O41B 2XY1A 3NCJH 3VJ6A 1JI1A 4E5XB 1WICA 2FYYB 3PWLB 4D94A 5C09A 4MQ7B 3ARDD 1RK1B 4PBWD 2YN3A 3F7QA 1TQCC 3U48A 1U8HB 3B2UD 2WINB 5J12B 4YK4C 4UV7H 5F3BB 1MREL 5KTEH 4QHKJ 5IFJA 2VDPH 1VKXB 2UWEE 4OZGE 1RSFA 3MV8E 4M6NL 4ZO8A 1DZBA 2QJDA 1EHXA 1MPAH 5CIPA 5HHMD 4I3RH 5DSCB 1S7SA 1KLGA 1ITCA 2AJVL 1P7KA 2YKLL 1RU9H 3KPTA 3ROOA 2VLME 3MRDB 1X5FA 1NCTA 3RUGE 3BE1L 3V5HB 4TVPH 1ONQB 5JW5A 4NGHL 5I1DA 1ZLVK 2J8HA 5C07D 3V6FA 1MCJA 3INUL 4NQUA 2P4AB 3L5HA 1I1AA 4C83A 5I1HL 4OGAC 3QIWC 4KHXH 1RUPH 4JY4B 3HHRB 4PJDF 3WFCL 4YDIH 4GRLA 3ALWA 1G6RL 5CJBA 3UPCA 2AV7A 3AREC 3CDCA 4RWYH 3GNMH 4MCZB 1UA6H 1QFWM 4HF5H 3G6AA 4KHTL 4KJWD 4PJ7A 3TH3T 1BBJA 4JKWA 3VRJA 1I8KA 5KSBA 4JDVB 4PS4H 1TJGH 1VENA 5I2IB 5K9QG 1OLZA 3T4AB 1OAXH 4P2CG 3VMNA 2YPLA 4OM0H 4YHKH 4NKOB 3H3PL 1KLUA 3VFMB 5HYSA 1T5XA 1H3GA 2DQCL 3QQ4A 2DL2A 5INCB 1NGWA 4OAWA 1YEIL 4XC3L 2ZUTA 4FOMA 1SMOA 4L9LA 3BVNA 3VXRB 3UXFA 1PG7X 3SGDI 1G7JA 1XGQB 3FOLB 3SGJA 4Y2DB 1NC4A 3NTCL 3W2DL 5LCVL 3T0ED 4G6KL 1CLYL 4HGWB 2OR7A 3ZE0E 3B5TA 3HI6L 2BVOB 4S11A 4MA7L 3NCYS 5BOPA 3D85D 4XTRC 3T8XB 5KS9A 2FWOB 2BERA 3QUYB 4M8QB 3BN9D 2FECL 4JRWA 3CVHL 1CU4L 4TPRL 2YEZB 5FM8A 3QFJA 2CQVA 1BJ1J 5DS8B 3HKFA 4M6NH 4LVNB 2OL3H 1OF2B 4ZTOL 2DQHL 4P5TC 2B4CL 3MRLA 2YKLH 3FT3B 5EG6C 5C07A 2ITDB 3T3ME 3QUZC 3VGAB 1XR9A 2MNUA 3TPUA 3F62A 3SE4C 5FF6B 3LQAC 3BE1H 3IAPA 4CW1B 4KXZI 4WDIB 5ESAB 4NGHH 4XPGL 4J2XA 3DMMB 4F57L 3QULB 3DURA