2ICEB

Crig bound to c3c
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
183
structure length
183
Chain Sequence
DEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3 beta chain
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 183
sequence length 183
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 2iceB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iceB02
1TQBC 4JFHE 4FOMA 3MNVB 4NBXB 1RIHH 4OBRA 3IDIB 2G9HA 4R9HA 4P2OC 3U4AA 3NOIA 4E41B 4MQXC 4LEXL 3QEQA 2C3HA 5ALBH 1GAFL 2UYLA 4XNZB 4LVHB 1OAXL 1Q38A 3MLSH 1JNJA 1IGMH 4JGUA 5D4QA 4P5KA 1RZ8B 4XP5H 3X3GL 4L4TA 3EBAA 2FO1A 4Z78B 3QCUH 3NN8A 4JN2A 2WQRA 3ARYA 1HXYA 1MVUB 4F33B 1UACL 4LCUA 3RWHA 4K8RH 2VLRA 5DHYA 2XXCB 1IL1A 5D7LA 4FQ2H 4FRWA 4FXGB 4MXVF 3VFMB 1M6OB 4AM0A 5DXWA 1KGCE 4A2LA 1NMAL 1I7TB 4U7KA 3VFSB 5EUKB 4LSUL 1FVCA 4ORGB 4ZFGL 5KSBE 3B9KD 5ILTH 3HR5A 1DQMH 2A1WH 4PJFE 4U1LA 3NTCL 5F7LB 3D85B 5CAYB 1L7IL 1KN4H 5HD8C 1XH3B 2CIIA 1INEH 3JTSA 4P3WA 2ADIB 1RZFL 2FO4A 1Y6MR 4WVRA 2NY0D 4Z77A 4PJCF 1QKZL 4XCYA 2VDMH 5CHNA 2IG2H 1QO3A 5IFJB 5K9OB 5C0FB 3ARUA 2DQTH 2VXVH 5DO2C 5D7JD 2GUOB 1T66D 5EUOA 2Y7QA 5DK3A 1VFOA 3MA9L 4XPFH 3T0WA 1M4KA 2OR7A 1S9YB 4G6JL 4KDVA 4NO3A 4XVTH 2NY2B 2XOTA 3VXMD 3BP7A 5D9SB 1WBXA 1FQ9C 2VIRA 5I1IL 1EEZA 2UWEE 1S7RA 2VR4A 2VJXA 5HVGB 3RRQA 1NFKA 5IFAL 2M2DA 4HIXL 3JVGC 4JJ5B 3MRKB 3STZA 1HHIA 2IMMA 2CD0A 2PKDA 5EWIH 2NY1C 3QDJA 4KMTL 3WLWD 3HI6H 1Z0NA 4UQ2B 1I8LC 2AJSH 4OQTH 1AXSB 3HC4L 3FO2B 5GZOC 2ADJB 4LDOB 5FA4A 4JDVA 3L7EB 1ZLVH 3L5IA 3SGJA 4YNYB 1ED3A 5C6WH 5J1SC 4EBQH 1FSKB 4PPTA 1JPTH 4WTZG 2WBJC 3AM8C 2BVOA 1WIOA 3WDIA 1LO5B 2EE9A 2YA0A 4HIJB 5DEGA 3HI5L 3CVHL 5DK0A 1S7QA 4DVBA 3M07A 3DXAD 2ZUQB 2DQUL 3KYMA 5DD0H 4X9BA 4KK8C 3JZ7A 4DW2L 5DGQA 1F4XL 1G6RA 3CC5B 3SDCA 3OZ9H 3IT8D 3JWOH 4NFCA 4PRIA 4F80A 2RGSA 4WW1A 3G6JB 4WUUE 1DBAH 4NPYB 3MRHB 4HXAL 4FQ1L 1GC1L 1ZLVK 4QRPE 4H1LA 5JOFB 5MI0C 3IFOA 5GGRB 1CDJA 2R0WL 4JG0H 3UTTD 1ZVHA 2VLJD 4XCFL 4JDZB 3HG1E 5CD3A 5L6YL 4L9DA 4CDHA 5JHDE 3OKNA 4X5WA 4DZ8A 1RU9L 2FATH 2X4PA 5HHVH 1AY1H 4YGAB 4HWEL 1UH2A 3CXHK 3W5NA 4UNUA 4I5BA 3SGEI 1EDQA 5E1AA 3VWJD 5IMMB 5DK2B 3ZKXB 3GM8A 4OLVH 5AG8A 2ZJSL 1U36A 1Z2KA 4O9HL 2H3NB 4M61A 1DZBA 4OZHB 4ZUSA 5GRZA 3U79A 2ZPKH 4XPHL 1N2RB 2VMFA 3RX7A 1QR1A 5I16A 5MENB 5D2NA 1JPSH 2V2TA 4DKFH 3V0WH 4CMHC 1ZHBA 5INCA 4N8VA 4OKDA 2J1KA 4EDXA 1BAFH 1YMMD 3RDTD 1CDGA 1AO7A 2HN7B 3TBWA 5EULV 3PWNB 1XT5A 3VXUD 1T04A 4QTIH 5F7EH 1BBDL 4YC2B 4CBPA 1XCQB 1CFNB 3QG6A 4M7ZB 2Y9RT 1I1RA 1LMKA 4Q9BA 3BD4A 1LK3L 3RVWD 1R5VB 1NEZB 5E5MB 1H3PL 2F15A 2NY5C 2XN9A 3SCMC 4ZXBC 2O61B 3IFPA 5HI5D 5DC4B 2FNBA 3QDAA 3BRGC 1AGCA 4PS4H 1JGUH 1BQHA 3PXJA 4ODSL 4U1JA 3DO7A 1K6QL 1UWEH 2F8VA 2D0HA 4WTWA 3C5JA 1H8OA 1NAMH 5ESAA 3GMMA 4RAVB 1BOGA 3BFOA 3EYUL 2IALB 4HUXB 3K74B 3OHXB 2ZUYA 3F58H 3L6FB 4N9GB 3WNLA 4N1EA 5IMKA 1NBVH 4X9HA 1CL7L 2RHEA 5E2JA 4OT1L 5C07A 4JFPB 5D1QB 3LQAL 5A16B 1OGAE 4WY7H 3MRCA 5I0ZA 3O11A 2D3VA 3HAEG 1KFAH 1I8IA 1CU4L 3HPJB 3QNZB 4PY8J 4W6XB 3GJEB 1NGYA 4PJEA 3TH4T 5HHQB 5FYJE 5T5FH 2O93L 5F7HA 1IE5A 1WWCA 3E2HC 3T0VA 5CBAB 3FCTB 2IFFL 4O00A 5D1XA 4GW1A 4KK5C 1XZ0A 4WU5A 5I66B 4RWHA 5L0QB 1JGEB 2R4RH 4YO0B 1OGTA 1C5CH 1JYVA 2JCCE 2V5SA 4OF5A 1A7RH 1T1WA 2BCKA 3SE8H 5CCKH 5I8OL 2W0PA 4HIEB 2Q20A 4PJXA 2A77L 4ETQA 2GJ6D 3ULUE 1MCDA 4PJHE 1C12B 4FQCH 4KUZL 2I5YH 3QUZC 4KKNA 1OTUC 5F1KC 1NANI 3VD4A 4G6MH 5FDYA 4LNRB 3V79C 1E4XL 1MCWW 4TUOA 2KZWA 4XAWH 3WFEH 4DAGL 4GBXD 4JFFB 3B9KC 2WINA 4KROC 1FO0B 4WEUD 1VDGA 2Q7YA 3TYFB 1RZKL 4HWBH 3QP3A 3F12A 1QP1A 1J1PL 5KSUA 1DANT 4DWHA 1FFNB 4QHMA 3FZUD 1BWWA 3NA9L 4K8RC 1H8NA 4YFDB 1NDGA 3VGDA 5D7JC 5KSAD 4OD3H 4OB5L 1NAMB 2G5BA 1A6ZB 2IANA 1WISA 3O6KH 4XVJL 2L4OA 1OAUL 1K2DA 4ZTPH 4MA3A 3FFCB 5H8DA 1JPFA 5IQ7L 4NQXB 5IVXF 3UYOD 1CTOA 5C6TL 1I7ZB 2QQLH 4PJEF 4ZPTB 4BZ1L 1A0QL 2HJKA 4ZFOB 1NAKL 3RL1A 1GGIH 3VFOA 1IQDA 2LAAA 1VEOA 3P11H 5ENWB 4AY0A 2A38A 1N64L 4ODHH 1QA9B 2P44B 4XX1E 4Q97A 5ID0A 1BBJB 2C3VA 3NH7H 4TVPE 4P5MB 4D9RD 3LKNB 3VW3H 3Q3GA 3UTTA 5GGUB 4RMRA 1CXHA 1EFXB 2VLJA 3VDCA 1VFMA 5A43C 4ZUWB 1XR8B 5DQJB 3NABL 1PEWA 4EQ3A 3QQ3A 1MI5D 3FAWA 2VN7A 3GMLB 3X17A 4EXPX 4YE4H 4HSQA 1A1NA 1QRNB 4JANB 3MLVL 2EDLA 4KI5E 3BMWA 2R1XB 1RZIA 2DLFL 5ID1B 3W0WD 3F7YB 3ZE0E 2DTML 32C2B 4ZMAT 1WFUA 5GRVL 4UNVA 1LO3L 4NQED 1Q9LB 4AH2B 4I18C 4QXUL 4X80H 3VXTB 5GISH 1QVOB 1RUPH 2FJFB 1KOAA 4WHYG 3T09A 1OY3B 5FM5O 1HZHL 4JLRB 3WIIH 2X9YA 1I3GH 4EDWH 2VDLL 3RDTA 2XWBA 3B43A 2J3SA 4LIQH 1F3JA 5C0AE 4XHJD 5C0DB 4EI5D 4GXVH 5T1DL 1FNAA 3GSOA 3VWJC 3QEHB 3TLRA 3ZTJG 2E8YA 1CE1H 4NN6B 3QIBB 2BHUA 1L6XA 5DZNA 4S0TD 5HI3C 2YBRB 2AXJA 4Q6IA 3JWOC 2YPVL 3CH1A 4PGBA 1A7OH 2VDRL 1GGTA 1MHHB 4G7VH 1EHLH 4GRMB 3D69A 1L9NA 3AY4A 4XX1G 4JZNB 5T1KB 1Q9OA 2DWEA 4X7EC 3TBVB 4P57A 4BYHA 2FBJL 3DI3B 3UTPD 4G7YH 1AQDB 4PD4K 3FTGA 2P49B 4JJHA 2HTKC 3LPGA 3MNZA 2AGJH 4ESKA 3CH8A 4GAGH 1B4JH 5HDQH 5DQ9B 2X4SB 4WU7A 4QRTB 3RWEB 3MRGA 4XNUH 2VDQL 1Z3GL 3SDAA 1F00I 1XF5A 4MD5B 3RVWC 1ZGLA 2Q86A 4NUGH 4OCXH 5EU5B 4F7MA 3D2UB 4GXUM 4M62L 4NJ9L 3K7UA 5HSFA 1F4WH 2OMBA 4XWOD 2NY7H 1G7IB 1M71B 4WHTA 1EUUA 4NKIH 5SWSE 4OIIH 5EO1B 2B0SL 1KLGA 1BEYL 1QSFB 3GIVA 4G8FB 1FYTD 3HZKA 4WW2B 5FF6B 2HKFL 2VC2H 2VL5A 3BKML 3SDDD 4AEIL 4PP1D 1LNUA 1U8OA 3INUH 2ZZUT 4OM1L 2EXYD 2CLRA 2VERN 4ZPVA 4CN1A 2BVTA 3KPSB 1S5IH 3CJJA 5E7FA 3TPUA 4NWTH 1FORL 3LCYA 1BJ1H 1JI2A 1OVZA 1UM5L 4RZCB 2VR9A 4Y5XB 3KJ4B 4G80B 1UC6A 4MJIB 1XGQB 4G6AD 3U4BH 1G6RL 2CMRL 4OD2B 4KHTL 1E4KC 2YWZA 2XPGB 1OAZH 3BDBA 4GBXA 1EO5A 1J1XH 3BDYH 1SBBA 3ARFC 3RTQB 2IC2A 3DYMA 2BSTB 3X14A 4PJIE 1KJ2B 3V6ZA 3GNML 2X6MA 4OKVA 3TC9A 2BNQE 4TNVF 2FL5B 3TBYA 4UUJB 4P4RB 4D0BA 4X6FB 4L3ED 3BISA 5DLML 3MOBH 4DN3L 2FX7H 1MWAA 2VXQL 3MREA 1D3CA 1G7QA 4NP4L 3H9SD 1BFTA 1FVDA 3LEVL 4TUKL 4Y5VA 3NZHL 5CJBA 1CFSB 1NLBL 2B1HL 2IPTL 5FA3B 3KYKH 4UB0H 3QFJB 2HH0L 1KF9B 2BNUA 3GSQB 2D31A 4LLAA 5E8EB 3CMGA 3OKKA 2VQ1A 5E95B 4NYLA 4UU9B 5KSAA 2NY5L 3NCEB 1MJ8H 3MRRB 2KUTA 1KCVL 4O5LH 4QXGL 4YK4C 3RWIA 4L5FL 2NW2A 2KBGA 1L0XA 3IFLL 4PP2A 4LLYA 1FH5L 3GMPA 5HYQA 5FGCE 3RIFF 1ITCA 4GUPA 3VXRE 5DJ8A 3QHFH 2OJZL 2Y06H 3DHMA 2WIIA 2AI0L 5E03A 2WLZA 2JJTA 4IBLT 4LPCA 3HCVA 1ZOXA 3FZUC 5I8KL 4HGMA 1YEEL 3REVA 5C71A 1P4LB 1HHJA 5EBLA 4DGIL 1IAOB 1NGZB 1R24A 5SX4H 2ADGB 4RFEB 1RUQH 1QTYT 1NMCB 2GFBA 3K4DA 2R4SH 4IMLA 4UQ3B 3HMWH 4P2RD 2GHWB 4WWKB 2R2EA 1KTDB 3FOLB 1FHGA 4D9QD 1DLHA 4JKMA 4GRWH 4K3JH 1MI5A 1T7WA 2GCYB 2WQ8A 4HQQH 3SJVA 3T1FA 4NHCH 3O8XD 3S3JA 1CE6A 1RUKH 1RSFA 3VGHA 1FL5A 3WIFB 2AXGA 4PLOB 5KSBB 2ATKA 4JO4L 3EDKA 4LAJH 2PCPB 1JNHA 4NCC2 3NIFF 4BELD 1I1FA 2OTUA 3GBLA 4PRBA 5FGBA 3OAZH 2YD6A 2R15A 4UTAL 25C8L 4YHOL 1KB9J 4H0GA 4G43A 1MLCB 1UZ6F 3G5ZB 1R3HB 1UYWH 3EO1A 1RIHL 3QXAB 4I3RH 2HJFB 4EUPA 4G42B 2ZG2A 1N8ZB 2ZOLB 4CADB 5HHOD 2WLYA 4GRLB 3FOMB 3RJDA 5IEHB 1YNKH 1SEBB 1UA6L 4X8XA 5F6IC 1W72A 5FK9A 1NC2D 5KZCD 4LKXB 2Z35A 4JPWH 1CXEA 5HGAB 4OLWL 4CVXB 3LSOA 2UWEB 1YPZF 2HVJB 5EZJB 1IGJA 3B9VA 3K2UH 3U2SA 1MELA 1JF1A 3RBSA 3BZFB 2DL2A 4K8RL 3KXFD 4N0FA 1S7XA 3VFRA 4BQ6A 1KSRA 2W38A 4FHBD 3V4UH 1JP5A 1CFBA 4XHJC 5DJYA 2WUCH 4Z0XA 2QHLA 3GO1H 4JB9L 1CICD 1ZA3B 2V9TA 3FN0H 2QR0B 3CSYB 4M43H 4RISL 5IHUL 3S5LG 1BZ9B 3GSWB 4M7KH 4M8QA 3I84A 3KLHD 4U6TA 1O7SA 2A1WL 1LP9A 3JTTA 4OFIA 2EDXA 2NX5E 1JZ5A 1INEL 3LY6A 1H5BC 3EDDA 3V6BR 4MGXA 1LEKB 1CZ8L 1YUHA 4FQIH 5FO8B 4APQC 1JWSA 1KCSH 2GKIA 4QY8B 5IJKC 4F58H 4RBPK 1HWGB 1P7HL 1S78C 4PJ5E 5ANMA 4UV4L 1YNTB 2P5ED 4PJ8C 2D2OA 1QACA 1RZGB 2DQTL 4WUUB 2YD7A 5D93C 5FYJH 4X6EA 5GGQL 3WJLA 3AGVA 3WIHA 3K3QA 3CFJA 3WL9B 3IDGA 1KTKE 3ZDXE 4QRPB 2BOCB 4HWUA 4EQ2A 4TTDD 3T0EB 4XVTL 3RGVB 1ZHKB 2GAZB 4A6YH 1J1OL 4YR6B 3HG1B 4HK0A 5HDBE 3ROOB 3QUYD 2H45A 5GIRB 3L3KA 3SKOA 1AQKH 1T20B 3VH8A 1OPGH 3QIWD 3SDXE 3HAEB 1JMXA 3A67H 3IRPX 1KCUL 2YD8A 3T8XA 3VRIA 5EWIL 2PYFB 3EYQC 1RULL 1JNNH 1X6NA 4YGVA 1QNZL 3SDDC 3DTXA 4CJ0A 4O4YL 5EU6D 2APWA 4L3EA 1G7JA 2BERA 2EDTA 1QPPA 5J6HB 1YNLH 2Q7NA 4HPOH 4EJ1C 4K3DL 3KYAA 4LASL 5B8CC 3KG5A 1J10A 3VFGH 1JPTL 4P3CH 1KB5H 5DJXA 3TO2B 2AJUL 2AXFB 1Y0LA 1I9IH 4G6AC 2X05A 3IJYB 1D9KC 3D3VE 3MRFA 4QCIB 5L2KD 2Y23A 1KTLA 2F74A 3MBXH 1KTRL 5DD0L 1HHHB 2YPLB 1YYLH 3JWOL 4HS3A 3CPLB 4ELMA 1I7RA 4KUCD 3UJJL 3SBWC 3ZDYE 1LP9F 1UJTA 8CGTA 3QCTL 2DJSA 2E7MA 4QT5A 4JG1L 2ADFL 1XGUB 2OBGA 3K8LA 3M1BB 3PWVA 3KPOB 4FA8A 4FQXC 4EOWL 5KS9E 1T1YB 4QWWD 4WO4C 1J86A 2VDPH 4L8DB 2RBLA 3MRJA 5M7QA 4Y4KA 5F7DA 4OLVL 1VFUA 3BN9C 2VLKE 4WFFE 1OGAB 1E4XI 5HDLA 1P6FA 4G5ZH 4OTXL 4P2RA 4MJ6B 3V5HB 3H42H 4LCCB 3VXOA 3D39B 4WEBH 4UIKL 1NCUA 2G2RB 2D03L 2ICWI 4LP5A 3PGDB 3V0WL 3TO4D 2EC9U 3P2TA 3O8XA 4TVPH 3ZTNH 1HI6B 4ZO9A 1BLNB 4CGTA 5EU7E 1BAFL 3FMGH 2EDEA 2OR8A 1OB1A 2HYMA 1A7QL 1I3RB 2X1WL 1T83C 1XIWC 2JCCB 5I9QC 1AGEB 5F7EL 4P5TB 3B5TA 2YD5A 1VERA 3C6LC 4PJDA 2APFA 3QI9D 43CAA 2R0KL 1IFHH 4Y8DC 5CKAA 1U58B 5HYSB 4FG6D 1ES0B 5I71B 2Q8BL 4KRPD 4JM2D 2H9GA 4PS4L 4KKBC 4OM0H 1JGUL 2DI7A 5BRZB 4D8PB 5F7FA 1BX2B 2ARJB 3REWA 5IM7A 5HHOA 5HYIA 4HJGA 2H6PB 1UWXH 3U46A 4GKSA 4NO2B 4ENEC 2EIBA 2EXWD 4BA8A 1J8HE 3FB7B 4Z7VE 3D0VA 3F58L 4LLMA 5HJ3B 4G8GE 3P73A 1NBVL 3O45B 3ARDC 4RMTA 4G9FE 5C08B 5IK3A 1NFDE 3QJFB 4M6NL 4MA8L 4TPRL 4ZO7A 1YMHA 4K3EL 1I8MA 1ZVYA 4GT7A 3U6RB 5E6YA 1Q9WA 4S1SL 3HNVL 3KXFA 3NCMA 3RL2A 1RZ7H 2HFGH 5KVFL 3S36X 4NN5B 2DMKA 3W82A 4Z76A 3V4VL 1ORQB 2ERJB 5T5FL 3I02A 3UTQB 1A02N 3BPNC 1A1MB 4PRHB 1UB6A 3GI9H 2Z93A 2JJVA 3BO8B 2UUDH 4K3GA 2R4RL 2AKRA 4DGYH 3SKMA 4GG8A 4LSRL 4JHWL 1A7RL 1U95A 4NUJB 5FXCH 5E9DA 4HF5H 3MYJB 2PXYB 4X7SL 4JY6A 3VXNB 5IOPB 2FEDC 3OXRB 1FNLA 1VACA 3DSNA 4ALAL 3AB0C 3V6FA 3HMXH 4FQCL 2IH1A 2P5EA 1R3JA 2I5YL 3QIUB 2B5IC 1NUNB 3KNBA 4N0UE 1JTOA 1G0DA 1CICC 1MH5B 3PQYE 4MX7B 2BRRH 4UIMB 1QLEL 4QHNA 2YUZA 5DDHB 3KLHC 1EX0A 3R06B 3GDBA 3T4AA 3RBGA 2R2CA 2UUDK 4U1KA 1UQSB 3GMNB 1HOCA 1KPRB 3QUYA 4U1NB 4Z7NE 4MDIA 3DARA 2OL3A 5GSRA 1VFAA 1OAKH 1C5BL 1CLOL 2HA1A 4AENB 3QIWA 1UM6H 1MRFH 2MFNA 1MCSA 3WN5B 2P24B 2I9TB 4GRWF 4WGWB 3IVKA 4YHZL 2VWEE 2X7LA 2HT2D 1RJYA 5F8RC 1RUAH 3LD8C 2C3GA 3BEWB 3FB6B 4UDUA 5I73C 1EGJA 4M1DL 4R3SA 3ULVD 4OD3L 4NNYB 4NKOA 4NKMA 1YEHH 4KDTC 4E41D 3L3OA 1CDIA 4HMCA 1ADQA 4NRZB 4QNPE 4X9FA 4ZTPL 1UT9A 4XCNB 3QQ4A 3KYNB 5I75C 4M03A 4YIQA 2LTQB 2Y5EA 5C0AB 5L2KA 2B2XH 4HH9A 3MJ7A 4WV1B 4L4JA 3OL2A 4L4VE 1JUFB 3MO1A 4IOIA 3FN3A 4JQXA 5I1AA 5J11C 2ZWLT 5CEYB 1GGIL 4YDVA 4JO1L 5F9OL 2E7CA 1I9EA 4W4OC 3P11L 1FZJB 1FGVH 4P23A 3VW3L 3ARGB 1YC7A 4L8BA 1E4JA 5B3JF 3OQ3B 3EJZD 4N9OB 4G6FB 2Z31D 5ISZD 1G6VK 3GJFK 1RJZA 3P4MB 1S9XA 1DVFC 2F53E 4M6OH 3CAFA 5DJDA 1W72L 2W91A 1T80A 2QKIB 4I0KA 1I9JL 4Y1AE 4KKCC 2BFVL 4I2XA 5DJAA 2JELH 1U8IB 3U30B 3WFBH 4JFDE 2RR3A 2VN4A 3LEYL 1B0RA 4LSVH 4XNXL 1T89C 1TJHH 3E6HA 3FQRB 2CPCA 2LAGB 3ARBB 4PV9B 1RUPL 3TO4A 2JTDA 3QPQD 4JGMA 1KEGH 1N3NB 2NY2D 3LZFL 3TGXA 1FZKA 5DTFB 3EFFA 1MCHA 5EO0A 2XRAL 5SWSB 3SQOL 1I75A 2CKNA 1WBYB 1EUTA 4LVOC 4GXVL 4XCEB 4NO5A 5FKAA 4HLJA 4POZC 3T4YA 4YFEA 5J56B 3WO4B 3UP1A 4K7FB 3W81A 5GS2D 3LS5H 2IADA 3QI9A 3SDYH 1KENL 1MQKL 2W65A 2GSIB 4D94A 2MHAB 4JGJA 1JTPA 1Z5LA 2J6EL 2OXGA 1RIVL 3EDJA 4NM4L 1J5OL 1FJ1B 4JM2A 4QKXB 1ZT7B 1QQDB 3DVGA 2EYSA 4G7VL 5TDOA 1C5DB 1EJOL 4YPGA 4F37K 2V7HB 1N6UA 4XI5C 3GMOA 3ZE1F 5B3NA 3TJEH 4G7YL 1AGBA 1FNGB 3GJFB 4PJIB 2BNQB 4GAGL 3V5KB 4KUCF 2F8OA 5FO9B 1DTUA 2HMID 1D5BB 1RV6X 2FSEB 3PWUA 4Q9QL 4Y16B 1DSFL 4CL7A 1KPVB 4LGSB 3U0PA 5I19H 4D0DA 5IB2B 1M7XA 4KRPC 4LLQA 1X5AA 3L3DA 3O3EB 4TTGA 1OARH 2NY7L 4XNMB 4LSSH 1UZ8B 4QRSB 1ZLWK 4NKIL 3O9WC 1NCAL 1NSNH 3MRIB 2EXWC 3QAZC 3KYOB 2KH2B 3QXUA 1AHWA 3L7FA 1A9BA 5DGRA 3WFDH 4R7NA 1C16A 4UV7L 4LSPH 1Q94B 3INUL 4F7PA 1AIFA 1KLUB 3KR3H 2LFGA 5FGCB 3NIDF 1IILE 5GZND 2PTVA 3DROB 1NGPH 4ZS7L 5FUCE 2IFGA 3VXRB 3IXAB 5C0ND 3IU4H 4KI5C 5JUEH 4PGCA 1BECA 2B4CH 5MEND 3T0XA 2MPAL 3V8OA 2QADB 4Z0BH 1RJLA 5GS0D 4OZGF 3GSNL 3QYCA 3DBXB 4GW4A 1OAZL 4MZ3A 3BDYL 4ZTOH 3VRJB 1CGWA 2I07A 1CD9B 4LNVA 1AGDA 5TF1H 3QHTC 3MYZA 2AK4D 5TQ2H 5KG9A 3S5LB 1ZSDB 3BH8A 1XR9B 4JM2F 2Y25A 1IGTB 5EBMA 3H9HA 1A4JA 5DFTA 3SKNB 3SPVB 3V0VB 4QHLB 3PDOB 1P4BH 1LE5B 3T2OA 3MNVA 3P0GB 3IDIA 2E5EA 5CJXA 4KRLB 5DD1L 1SY6A 4DN4H 3Q1SH 3O4OC 3RZCD 4OCRL 5JW4N 4E41A 1ZLUH 4ERSH 3QUMA 3ME0A 2V2XB 2D7TH 3LKOB 3EYFB 5JTWA 1A6WH 3UJIH 1RZ8A 4XXDB 5A40E 4Z78A 3M8OH 3NFNB 3J7HA 3ARTA 1MVUA 4F33A 3QHFL 2Y06L 2CJUH 4FZEL 1YY8B 2P8MB 2DBJA 4FXGA 4RMQA 1AFVH 1R3KB 1RVFL 1M6OA 3VFMA 2J8UE 5ADOH 1DQLL 4XNQB 5BXFB 2ILLA 3ULVC 1I7TA 2F5AH 1NGWB 4RGMB 1QFUL 1SEQH 3HE7C 3VFSA 1YEFH 2EDNA 5EUKA 1P69B 1V7NL 4ORGA 4ZG1A 3MOAH 3V5DB 4YDJA 3D85A 1MFCH 2FYYB 2VXUH 5GGSY 2C5DC 3BKCH 4K3JL 4CVZB 5E5RB 2ADIA 4BH8B 2AEWA 2AJXL 1C08B 3FJTA 2NXYD 2YS4A 4R0LB 2EKSB 3OKYA 4DVRH 4HIIB 3RWCB 3VI3E 3IDYC 3QUXC 3VFUB 5IFJA 5K9OA 5C0FA 5DJCB 4N90D 1RHHB 2XTLA 2NX5B 5I1CL 2GUOA 5DMIL 1DBBL 2L0DA 4F15B 1WZ1L 2R0LH 4F7TB 4Y0GA 1S9YA 4QHKI 1WAAA 5D70L 1BP3B 4X7TB 1H3TA 5D9SA 1IBGH 4XWGH 3B4NA 4O58L 4UILL 1PZ5B 1AD9B 2Z31C 2FGWH 4PJ5B 5HTSA 3UDWC 5A3ID 5ICXB 5CJQL 4MAUL 2HLFD 3MPCA 5F6HI 4JJ5A 3MRKA 5IT2H 1E0OB 1WICA 2FEEI 4D0CB 4NCDA 5F21B 1OSPH 4EIZC 1YNKL 1WLHA 3ULVF 4Q9RL 1A7PH 2AJ3B 4UQ2A 1AXSA 4I77H 3FO2A 2ADJA 5H37H 4HC1H 5EH1A 3BP6B 1OLZA 3V7MA 1S7VB 3L7EA 3FQUB 4YNYA 3S88L 3QPQC 1U3HB 5KTEH 5C92A 3SDXB 1HYSD 3OAYK 3ZHDA 2RJMA 5D6CB 1GHFH 1LO5A 4D9LL 3ZHKA 4HIJA 1JRHL 1PX3A 1D6VL 3RU8L 5FHAH 3QNYA 3OJMB 5IHBA 1IAIL 1R5WB 2DWDB 3ZL4H 2NTFB 5DWUH 3I9GL 3CC5A 3P30H 1AXIB 1IGFH 3BP4A 3U0WL 3TWCH 4H20H 3P0YL 2YSSB 4RGNE 3WJJA 3ESVF 2OL3L 3GRWH 3G6JA 2VDOL 3MRHA 1VSCA 3C5ZB 3QCVH 3CD4A 4FQIL 5JOFA 3D3VB 4UT6H 3DX6B 5GGRA 1RY7B 5HBBA 4PUBH 1KCSL 4JDZA 4F57H 1SQ2N 2ITDB 2BSSA 5IBUG 3V0AC 2P42B 2ZUQC 4PV8B 4K7PY 3IDNB 4DKDC 4LQ1A 2HMIC 4CDGC 1L4IA 5IMMA 5DK2A 1HDMB 3EYSH 2H3NA 4OZHA 1HKLH 3MRQB 3MRMB 2XIDA 5KS9B 1INDL 4X4ME 4P49A 2JJSA 1KG0B 3BX7C 2JB6B 2VL4A 1OPGL 4GQ9H 2XA8H 2DQDL 3A67L 5E4EC 2C3XA 5GRYA 2GK2A 1H3XA 1QBAA 1S9WB 2DQEL 2VLKB 3PV7A 2HN7A 4XMKH 1JNNL 4JCMA 3PWNA 4NZUH 4MXQC 4LMQI 5TFSH 1XCQA 2CXGA 3O2WH 1CFNA 3W11D 1YNLL 3HZMB 5GZNC 2FHBA 3I2CL 3PNWB 1KCRL 3IS0X 5IV2B 3ESUF 3O2DL 4M5YL 1NEZA 4Q0XL 5E5MA 2P8LB 1FAKT 4OQTA 4MLIA 3MCKA 2O61A 5M94B 3DX7B 1F90L 5FM5M 3EYOB 1YYMH 3S4SA 3MBXL 4LVNC 5BS0B 3I6GB 1K5NB 5T1KD 4RAVA 2IALA 1WITA 4HUXA 2AEPL 2ED9A 2OR9H 3OHXA 4IJ3B 2YHGA 1Z9OA 3N85H 3QPXH 3L6FA 4N9GA 4ZNEE 1OP9A 4MNQE 4OFYA 4JRYA 5C0BE 1AH1A 3BIBX 4JFPA 3CFKB 5D1QA 1U6AH 3ZKND 5A16A 1MFAH 2R69L 4PRPE 5CSZB 4NZRH 3V6OC 1QZ1A 3HPJA 3QNZA 3T3ME 1J8HB 4Z7VB 3GJEA 2VZOA 5I1JH 4LOUC 3D2UD 5HHQA 4G8GB 1A8JH 4M5ZL 1YEDB 5I8EA 4G9FB 3RZCC 3FCTA 5CBAA 1NUGA 5ITBH 1NFDB 4X6BB 2B4CC 4J23A 1BPVA 4JZOB 1QSFD 1AKJB 5I66A 1MFBH 4XCCH 1JGEA 4YO0A 1H3VA 2XXMB 4HLZH 4OZHF 4JVPA 4Y4FB 4LPWA 3EO9H 3TA3D 4HIEA 3VI4F 4S1DC 2VXSH 5TDPB 9CGTA 2A9NL 4F9PA 4O02L 4MJID 3TT3L 1C12A 1AJ7H 2YD4A 4YHLH 2MCPH 2EE3A 3WHE0 4JKPL 4LNRA 3HFMH 1SJHB 4FFWD 2CK0L 1G7MB 3C2AH 1RK0B 4JFFA 5GGRY 3HC3H 2G60H 1XGYL 1JZ4A 4K23H 1FO0A 2VITB 2LU4A 4K7PX 3TYFA 1QHOA 2NR6D 4N0UB 4LEOB 3QWOB 1QYGL 2FIRT 2NXYC 4HIHB 1LQSR 2Y36H 1FFNA 3OJ2C 2YD9A 3QFJD 1F2QA 3MLRH 4EEEA 1TZGL 4Z7WE 5HYJE 2VLMD 4NO3B 4C56E 1X4XA 1IJ9A 5J06A 3PIQA 1NAMA 1Q1JL 2P5WE 4LCYB 3PHQB 1A6ZA 5EIVA 4F3FB 1GXEA 2XYCA 1EEZB 1S7RB 5GJTL 3P9WB 2K7PA 1RURL 3UCRA 3FFCA 3BPLC 5A3IC 4Q58C 2HLFC 3TT1L 4NQXA 4KZEH 3U7WH 1I7ZA 2MJWA 3MLYH 1ZKAA 3KPMB 2Y4SA 4ZPTA 2EDQA 4KJPD 3C60D 5I1LB 2QSTA 3EDFA 4ZFOA 5MHSE 3BQUB 1F3DJ 5DEZA 2DQGH 3C08H 4HS8L 2EH8L 4DGYL 5FUOL 4YAQB 2DDQH 5ENWA 5D7KE 3T0BA 4ZAKD 1QA9A 3TFKC 2EIEA 5CILL 1BBJA 4K9EH 4N0YH 3UC0H 2BVOB 1CGUA 5GGUA 1EFXA 1SBSL 4RNRB 1GRWA 4ZUWA 1XR8A 5DK0B 2O5ZH 3LHPH 3ULVL 4CMMB 4MB3A 5CLTA 1O5DT 3JV6B 3GMLA 1K8DB 1MAJA 5BV7B 3TNMA 4U1MB 1QRNA 2BRRL 2CDGB 4JANA 4UBDD 2R1XA 4HAGA 3S37X 2OSLB 4LDEB 3DURB 5ID1A 4OCSH 1FZMB 4XB8A 1JZ6A 1LO2H 1P84K 3F7YA 1U9KA 2Z8SA 2AQ2A 32C2A 5AZEH 1FN4B 3QRGL 1Q9LA 3DO3A 1PFCA 2XY2A 4Y4HD 2F53B 2EE2A 1OAKL 2KKQA 3ARQA 2X4NB 3VXTA 5CD3B 1QVOA 2FJFA 1EO7A 3OB0K 5D72H 4GAFB 3O6LH 4H8WL 4Y1AB 4B7IA 4DZ8B 2OX5A 2WZPD 4JLRA 4OLXL 5DRNB 5SWZE 1L0QA 3KPQA 1U0QA 3VE0A 2J7LA 3CLEH 4JFDB 2E7LA 2IWGA 5C0DA 5C9JB 3C9NB 5F1IB 5DZOA 2XTJE 4LCWE 3QEHA 4K2UL 4UT9L 3QIBA 4S1QL 4YWGH 4LDLB 2I26N 5BVPL 1N6QL 3L5XH 5DD6A 2YBRA 4WNQA 1MIMH 1LD9B 3TVMB 4HT1H 1MHHA 3STLA 4EDXB 3BGAA 4GRMA 12E8L 4JZNA 1ZHLA 2L7UA 5T1KA 3SGEH 1CD1B 3TBVA 1F4YL 1MRDL 5DA4A 2WUBH 3UTSE 4XH2B 4Q2ZB 3TZVC 1AQDA 2DKUA 1RI8A 4ZDHB 3JWDH 5ACZB 4QEGA 5E99L 5DQ9A 3DRQB 4JRWA 4HCRL 1FGVL 4KTDH 4QRTA 3EJJX 5F7KC 3RWEA 4MD5A 2W1NA 3NGBC 1DQDH 2PYED 1MQ8A 3S37L 3QO1A 5EU5A 1TJGL 4OIBA 2EYRB 4YDKH 5C09E 1OM3H 3X13B 1UKSA 1G7IA 1M71A 1NBZB 3MZGB 5I30L 3RVTC 1QSFA 5LWYL 3JSSA 3PP3H 4G8FA 3T1WA 4PB9L 1CK0H 4WW2A 4J3SA 4V1DB 4TSBH 5FF6A 4WUUD 2AJZB 5DFVD 3KPSA 1NDMB 4U7MA 2E3VA 5ESVB 2FLBT 5I15H 3U7AA 4XP4H 3T0ED 2YC1B 5L88H 3RGVD 4G80A 1WC7B 4MJIA 1XGQA 5IROA 1NCWL 5B39G 5LQBH 4OD2A 2K7QA 2IAMB 2V5RA 3OKOB 3Q48A 4OUOA 1VGKB 4XPBL 3VFPB 4JZJC 4DUXA 2XPGA 3MQIA 4KY1L 3ARSA 3LS5L 2J8OA 5EORH 4PJ8A 4Z8FH 4FMFA 3FQXA 3S35H 3RTQA 3PP4H 2BSTA 2R1WA 1KJ2A 2YKLH 2FL5A 3LMJL 4UUJA 2I60H 4P4RA 4PJXB 2ARWA 4QYOB 3AS0A 4NQCE 4X6FA 3FN9A 3TA3C 1MCQA 2BMKB 3BZ4B 2EE6A 3NFSL 2HRPH 3UZVB 2OI9C 4XMPL 1CFSA 2VAAB 5FA3A 4XP1L 4DGVL 4YHNB 5I1DB 4P2YA 3DYOA 2BC4A 3QFJA 3HNSH 4FQPA 5D8JH 1HIMH 1KXQE 3GSQA 1YEIH 2XQBL 5E8EA 2D9QB 4UU9A 2YPLD 4KKLC 2JKXA 3MRRA 1MREH 1JHLH 1CR9H 2VZUA 5GS0L 1U42A 2QLVB 3MGAA 3PL6D 5JZ7C 3H9YA 1NANH 3OR7B 3ZT7A 1PAMA 2QQNH 1IKNA 4QHUB 3T08A 3UPCA 5FYKD 1P4LA 2W9EH 5TDNB 3TN0B 1IAOA 4WW2F 5F88B 3AREC 1DANU 2ADGA 2E27H 5AZ2H 5BO1L 4TQEH 1DP0A 5T3ZD 3H3KA 1NGQH 1IC4H 1ZANH 4R4FL 1PQZB 1OGAD 1B2WH 4UQ3A 4CAGA 2DQFB 5F97E 4WWKA 1KUMA 5FGRA 1KTDA 4JHAH 3IU4L 3FOLA 4XVUD 3F5WB 3D39D 4YLQT 2GCYA 2BSRB 2HJKB 4Z0BL 1MIEL 4FQXA 5E08L 1DQJA 4KJPC 3C60C 3VFOB 4GJTB 4XGZB 4XMLH 5KSBA 2A6DB 3GM0A 4U33A 3DECA 3N1QC 2PCPA 1X6LA 5FYLD 4XPAL 2N56A 3GB7A 4F9LC 4ZAKC 2ICEB 3GKWL 5TQ2L 2V5YA 3FHQA 1REIA 5L7XH 1DQQB 1U8QB 1JZ2A 1DEDA 2DM7A 4CW1B 5JIKA 2A6KB 1MLCA 3G5ZA 2HTLD 3W2DL 3F7VB 3KVQA 1R3HA 5TE4L 5DJ2B 3QXAA 2R8SH 5IBLD 2BNRD 1N59A 5GRXG 2HJFA 3N06B 5BRZD 1A7NH 3Q1SL 3WNOA 1N8ZA 2ZOLA 4YBQD 4CADA 4XXCC 4MA7L 4GRLA 3FOMA 3RP1A 5IEHA 1SEBA 1TZHA 4HK3J 5F7WC 1X9QA 2D7TL 3FQNB 5IBUB 4LKXA 4IRJC 5INDB 3GI8L 5K59E 1H3GA 5HGAA 1A6WL 1S3KH 5C08D 4CVXA 2UWEA 3M8OL 4Y4HC 5EZJA 5ICYA 2AV1A 1LE9B 2NY4B 4OV5B 5F3HB 1WV7T 5KN5B 3VG9B 3C8HA 3BZFA 2CJUL 4OCYL 5DA0B 4K9EC 1P4IH 4PRDB 4LBEB 1YJDL 4NKQB 3RA7L 4L3CB 1FZOB 1XGRB 4K94H 1OWWA 2EDDA 1CCZA 1B6UA 2F5AL 3PUCA 4PRHD 2MQ0A 1ZA3A 2QR0A 1YEFL 3CSYA 1ZE3C 4PJCE 1BZ9A 3GSWA 1FO0L 1QBLH 1I3VA 4PGBB 1NKRA 4DK6A 2R9HD 1IKFH 4K07A 5IJVB 1OSZB 3BKCL 2PXYD 1LEKA 5JW5B 1Q9OB 1T22B 5FO8A 5C3TA 4KQ4H 4MDJB 4QY8A 4U2ZA 1AXTH 4DVRL 4GMSH 1BIIB 1GOFA 4RGNB 1YNTA 2PETA 1RZGA 4WUUA 4XAKD 3KPNB 4FFVC 3SDAB 4QRPA 2BOCA 5D7SH 3RGVA 1B0WA 1ZHKA 4J2XA 2GAZA 3RI5F 3MLXL 4YR6A 1IZKA 3HG1A 3BRFA 5CEXB 3ROOA 5JHDA 4TSCL 4X6DF 2QSCH 5GIRA 4QRUB 3PJSB 3VRLE 5D7IE 1T20A 5IT2L 1WTLA 3VG0H 3SY0A 1T2QH 2PYFA 3HZKB 1FG2B 1A7PL 3DETD 2VLRE 1HWHB 1NJ9B 5D7LE 4HC1L 4HGKC 5J7CC 3A6OA 1E6OL 5EZOL 5J6HA 5EC1B 2UWEF 1I1AB 5AUMA 5KTEL 2Y6SD 4XRCB 1UJ3B 5BMFH 1V3MA 2JIXA 3S3PA 2IJ0C 1U8PA 3TO2A 2AXFA 3EKCA 4GS7C 2CH8A 3FO0H 4JR9H 5FHAL 4QCIA 1CLYH 1BM3H 4H0HB 5AWNL 5I74B 1HHHA 4DKEH 2YPLA 2DQJH 2YUXA 1VFBB 3P30L 3L1OL 4OKVB 4TNWK 1Q0XH 3CPLA 2I9LB 4I1NB 1NBQA 4P4KC 3BGMB 4WGVB 1BZ7B 1V7MH 4IRSD 1WZMA 3CLFH 3TIDB 3BAEL 3BWUC 4AIXA 2CKBH 1C1EL 1I1YB 1XGUA 3LAFA 5FAAA 3M1BA 3KPOA 4OZIF 1W8OA 3JBG7 4LSQH 4HWZB 4O51B 4G6FD 1MRCH 2A83B 2D31B 3O6FB 1T1YA 4L8DA 5F7NC 1TPXB 4MNQB 4ONGL 1OQOA 1WQVT 1GAFH 1NFIB 2VZTA 3GSVB 1OGAA 3RUGE 5DYOB 5BVJB 4HW6A 4MJ6A 3V5HA 3CXDH 4PP2B 3X3GH 3RWDB 4PRPB 2Q8AL 4G3YH 4LCCA 1NBYB 4M9OA 3P3YA 4NM8H 2G2RA 1ODAA 4CKVX 2HT3C 3PL6C 1UACH 3PGDA 2NZIA 4GQ9L 3HCVB 3C6SB 4M1CD 1J7VR 4YZFF 1BLNA 3O81A 7CGTA 4S11A 3WFHB 2R0ZL 5EBLB 4A6YA 3MJ9H 4XMKL 1NMAH 3UYPA 1ND0B 4PREB 4DQOL 3LDBB 1I3RA 2JCCA 1AGEA 1OWRM 2GFBB 1OT2A 2DTSA 4LSUH 4P5TA 3LN4B 4HBQA 5DMJB 4OGAC 3NTCH 2Z0BA 2YD1A 3DIFB 4C57C 1GGYA 4IIQB 1WFOA 1Z9MA 1U58A 4FQQB 3UZQA 4AIZB 5HYSA 5H2BB 5DHXB 1ES0A 4UAOB 2FX8L 3O3UN 1X5ZA 4Z95L 4OLEA 1MCCA 5IIEB 1L7TL 4L9LC 1T5WB 2YRZA 4D8PA 1J0JA 4PJAF 3FT3B 1BX2A 2ARJA 5DC9B 5GXBB 5CKGA 4MAYC 1X5HA 2XZCL 1JNHB 4NO2A 3N85L 4PG2C 3FB7A 4KJQC 5HJ3A 1FC1A 4X4YA 2WP3T 3MROB 3O45A 1G9EA 4YHYC 2GEEA 4XTRD 5C08A 1KJVA 2GITB 3QJFA 4G6JH 1DUZB 2Z8RA 2FHCA 4G43B 1IT9H 1FNEB 2Q87A 1MFAL 2ZG3A 5I1IH 5E24E 3UYRL 3T2QA 4J3OC 5IFAH 4Z5RB 4HIXH 3HUJE 1JE6A 4YDLB 1BMGA 5I1EL 1ORQA 3IF1B 3UTQA 4J4PC 2OZ4L 5ITBL 5HYJB 1A1MA 4YBQC 4PRHA 1XF1A 5FK9B 4C56B 4GO6B 4U4BA 4FTVD 3RWGB 3MV7D 4GLRI 1RUML 4Y5YC 4J6RL 5J89A 1AO7E 4MWFB 4NUJA 1S9KC 3EO9L 3MYJA 2PXYA 3VXNA 5IOPA 4N0FB 1ZK9A 1OD9A 3OXRA 3KHQA 5AAWA 4MNHB 3PABB 3HI5H 3AU1B 1A6AB 2ZOKB 5DJYB 2DQUH 4AEFA 3QIUA 4R2GB 4P46D 5E2WL 2QADD 2NY3D 1MH5A 4MX7A 3MUHL 1RD6A 3H7BA 3DMMB 1DR9A 4UIMA 4BSWB 2ZSVB 3GSRB 5DDHA 2ZG1A 3LS4H 3R06A 4M3JA 1T0NB 1KV3A 1T7VA 1DL7H 2EDWA 4HXAH 1GC1H 1UQSA 1YUHB 3GMNA 1KPRA 2ORBL 4X5XB 5EBGA 2AV7B 2BSED 4JRXD 2R0WH 5L6YH 3WE6B 4AENA 4Y2OA 3WN5A 2YPKB 5HGDB 2P24A 4NWUH 5ANMB 2Y36L 2I9TA 3WDJA 3B6SB 1EEYB 5IW6B 4HWEH 5IP4A 3O3AB 1J0YA 3AMLA 4X6EB 3MLRL 3TESA 2C7UB 1OOAA 5IVXE 5IW3A 3BEWA 2I24N 3DVNB 3FB6A 4TUJB 3V7AE 2ZJSH 4RQQB 4K94C 3P4LA 4NNYA 3UMTA 4XPHH 2C1PB 1NL0L 2C9AA 2FZ3B 1J88A 4NRZA 1KC5L 4JQIH 4TRPH 4XCNA 5SWZB 4J3XA 3KYNA 3LIZL 4KZEL 3T8XB 5C0AA 1MHEB 3MLYL 3QXDB 4WV1A 4X83A 3SO3C 1JUFA 4YGVB 2XTJB 4LCWB 3TBSB 1INQB 4WENB 5CEYA 2IGFL 3KHOA 5B39B 1MJ7H 1BBDH 3WFCH 1TVDA 1P9MC 1FZJA 3T2PA 1CLCA 4F7CB 4NN7B 3QQNA 1LK3H 2Y6SC 1H3PH 3ARGA 1CGVA 3GBML 1KPUA 3MNWB 3L5JA 2DQIL 3VXME 4KVNH 3WXVH 1XGPB 2JE8A 2FIKB 3IDXL 1KTLB 3DV4A 1K6QH 2A6IB 2LTQC 1AR2A 3DX9A 3EYUH 2QKIA 3TYGL 3VCLA 4ELMB 1FGNL 4DTGL 4OCSL 4KJYB 1IGCL 3CVHB 1CL7H 3FT2B 4GAJH 3P0VH 3HMXA 5E2VL 3BKJH 4OT1H 4IRSC 1LEGB 3LQAH 3HE7A 4DFIA 2X9WA 1UXWB 1CXIA 5DVNA 3FQRA 1T7YA 3ARBA 4HKBB 4PV9A 1BJ1J 1CU4H 1N3NA 5C09B 1K85A 3BIAX 5DTFA 2DYPD 2BVEA 4PGJA 5SWSA 5DEFB 5GGTA 4PJ5D 2J5LC 1WBYA 4TULH 3KPPA 2O5XH 4Y4KB 5CZVL 3WV0A 3AS3A 1T2JA 3ZYJA 2PO6C 2E7HA 4NQDD 4XCEA 2YK1L 3DXAE 4K7FA 5DUML 2XI9A 5F1NB 1TQCC 2GSIA 1G0XA 1T1ZB 2MHAA 5GRUL 3F65A 4MA1B 1MIML 1FJ1A 4I0PB 3CVIH 1ZT7A 1QQDA 3NAAL 2A77H 2V7HA 4HBCH 4M1CC 4G8IB 1DN0B 2CRZA 3UTTE 1GGBL 4U3XA 1FNGA 3GJFA 1E4XH 5CP3A 2CLZB 4PJIA 5DVLA 2BNQA 4JFED 3LB6D 3V5KA 4DAGH 2LQRA 4LRIA 3MBED 3QR2A 5FO9A 3RY5A 4F8TA 1D5BA 4CN4A 4KTDL 2FSEA 4NO0B 4L8SB 4E0RA 4Y16A 1KPVA 5FV2A 3UTOA 2Y07L 2V17H 4C59B 5IB2A 1RZKH 2WAHA 4WI2A 3LKSB 3MLTA 4BFBD 1J1PH 3O3EA 1JPGB 3QH3B 4XNMA 1UZ8A 4QRSA 3D0VB 3OKLB 3P73B 1SJVA 3MRIA 3N1GC 3DI2B 1YMME 1CK0L 1R3LB 1UKTA 1NMBL 3V2AR 1Q94A 3MCLH 3MX0A 4OB5H 4U0RC 3ECBA 4GAYB 1KLUA 3VXUE 1BJ8A 3CK0L 5I15L 2AEQH 5JXEC 5D6DC 5HYFA 5J6GB 4XVJH 1FPTL 3DROA 5DJZB 3VXRA 1F6AB 3IXAA 1FRGL 5GS1B 5C6TH 1GSMA 2APVA 3HE6B 1QFWM 3VGBA 5LQBL 4LU5L 5BZDB 5C2BL 4DK3A 4BZ1H 1DBKL 1R6VA 3PGCB 1NAKH 2A6JB 3HZYB 3DBXA 4OF3A 2V7NB 3WUZA 3UPRB 1OTSD 3VRJA 1P7KB 2YKLL 2C1OB 5DURD 5KVEL 1ZWIB 3TM6A 5C0GB 3S4SG 3S5LA 1ZSDA 1XR9A 4WI6A 1IGTA 3NABH 5FYKL 4X7FC 3SKNA 3SPVA 3V0VA 3GHEH 4QHLA 3PDOA 4W4NA 1LE5A 1F8TL 5T3ZL 5E56A 1VESA 3HNSL 4JDTH 3ROLA 3MLVH 5D1ZC 1E28B 4P46C 5F9WC 1HIML 3HB3D 2DLFH 2NY3C 2ZUVA 5BS0D 4N8CH 4PR5B 2DTMH 5AYUL 1A6UL 3QHZL 1LO3H 2V2XA 1MREL 5C1MB 3LKOA 4QXUH 3TJHD 3EYFA 1QHPA 1VFAB 5E1HB 3PGFH 2MQCA 4XXDA 1TENA 4FN0A 2HFEB 5L9DH 3NFNA 2HRLA 3QEGH 1UKQA 1JHKH 2IBGA 5FYLL 5E8NB 1A4KB 4OF7A 3AFLA 2R39A 1RJYB 1YECL 2GJ6E 4J3WA 4S10A 2P8MA 1BF2A 1R3KA 4G8GD 4JHZA 5JXAH 4XNQA 5BXFA 3QEQD 4NZJA 1NGWA 4EN3B 1FNSL 1AKJD 3BSZL 5HGBB 3WKNA 5T5NF 4CVUA 2DLGA 2YPVH 4L4TD 4Y2DC 2NY6C 4LRNL 3V5DA 3NIFE 4YIQB 4X6CF 2FYYA 4AG4L 3IDMB 1F97A 1TQBB 3L5HA 4URTB 1GC1C 4DOHB 4CVZA 5IQ9B 2BVYA 4BH8A 4NJAL 1P6AB 2FBJH 3VGAC 4KC3B 1C08A 1RHFA 4F37F 3GSUB 2ZUTA 4R0LA 4P2OB 4XBPB 4XP6H 1R3IL 4HIIA 1PG7X 2P46B 3DUSB 5DHVH 5LBSL 3RWCA 3VFUA 2YA2A 2W07A 4JFZL 5DJCA 1RHHA 1CQYA 2NX5A 1Z3GH 2ENYA 5F44A 1VCAA 4F7TA 15C8L 1TTFA 1F2XK 1RJZB 1S9XB 5HGHB 1PZ5A 4NJ9H 3KWWB 1AD9A 2X40A 2DQCL 4PJ5A 2W9DL 2R8SL 3HHRB 3MJ6A 1YPZE 5ICXA 5GGVL 4MS8C 1IC7L 1CLZL 2V5TA 1A6PA 1A7NL 2B0SH 4OI9A 4WI5A 3QXVA 3DGGB 2A73B 5TF0A 4U6HB 2AJ3A 4OM1H 5TGBB 5JW4Q 1R0AL 1S3KL 1FORH 4MCYB 5F8QC 3FQUA 4PB0H 1UM5H 5B4MC 4FNLL 5D7IB 4FABH 1U3HA 1K3ZA 3SDXA 4D9RE 1J0IA 3KGRA 3GBNL 5D6CA 2PTTB 1BHGA 1G6RH 1HQ4B 2CMRH 5DR5L 3VA6A 4KHTH 4NO5B 3T4YB 5HHPB 1WSST 1F3RB 2IEPA 3QDJD 2DWDA 4U7SA 2NTFA 5E6ZA 3BQUD 5L2JB 1MVFA 2FB4L 3GNMH 4H1LH 1JZ8A 4Z7UB 4QLRA 2YSSA 3W0WE 4AJ0A 5DLMH 1IKFL 4M93C 4DN3H 4NQEE 4NP4H 3C5ZA 4YBHA 4J8RB 1PG7L 3NZHH 1DLFH 3D3VA 1L6ZA 3LQAC 2ZKHH 1QBBA 5KSVB 5EOCL 5KJRL 3VWKC 1MCOL 2W0LA 2ITDA 4GMSL 4R7DA 4I3GA 3DUHA 2NY1B 3L95B 2FX9L 4PV8A 3MBEC 3IDNA 4PRID 1KCVH 1JGVL 1HDMA 4QXGH 4L5FH 3H7LA 4Y19B 1UVQB 1MCPL 4B50A 2B7DT 2BK8A 3MRQA 1S7UB 3MRMA 3IFLH 5HVFB 5DHVB 5KS9A 1FH5H 3R8BB 3VJ6B 1KG0A 2WBJB 4MMXC 2OJZH 1CXFA 5ADPL 4NZDA 2JB6A 5D96C 2AI0H 5DT1H 5K9JL 4IMKA 4KRMB 4PLKD 4G9DB 1S9WA 2RFXB 2VLKA 4DGIH 3RUGB 2WBKA 3ZDXF 5BZWB 3QDHA 4BJLA 3CDGB 4JFDD 3QBTB 1UWGL 4NQSB 3HZMA 1EK3A 4Q9CA 3PNWA 4AL8L 2SEBB 5IV2A 3TP4A 4QTHB 4H26B 5MI0B 3SE3C 3SDXF 5L8KB 1J0HA 4MD0B 3DX7A 4MJ5B 4TYUA 3TVMD 2LU3A 2OTWB 1CLYL 1BM3L 2AK1L 3BMVA 3I6GA 1K5NA 1RZKC 2BY0A 4KK9D 4ODTL 4JO4H 2CDFB 4JM4L 4PJ9C 4Y7MA 3SE4C 4PJ7B 3RVUD 1TNMA 3GZKA 4PYHA 5KG9B 4UTAH 2KZ1B 4NIKB 1V7ML 1FYTE 4RRPG 1PD6A 2CKBL 5IB3B 25C8H 5JNYB 4H5SB 4KJWD 1A4JB 3CFKA 4F7EB 2ZCKL 2EDFA 1ZAGA 1DN2A 2XN9D 4LSQL 3ZT6A 2EKJA 4HMEA 1FAIH 4U6VL 5CSZA 3OAUH 5E5UB 1MRCL 4OLYL 4CMHB 3GRWA 2X9XA 4JPVL 1J8HA 3IYLW 4RMVA 4Z7VA 4IDJL 4CUCA 1A47A 2OM5A 4G8GA 4HG4J 2P47B 1YEDA 3IJSB 4RFNC 4G9FA 2VKWA 1NFDA 4X6BA 3QUMB 1UA6H 1RZJC 3ZDYF 4JZOA 5CSGA 5E6IC 1AKJA 1W0VB 3CU1A 3LQMA 1CIDA 4OLWH 3CXDL 1P1ZA 3MV9E 1ZA6B 4V1DD 5C07D 4G3YL 5DD5H 5IFHL 4Y4FA 3V9FA 3GKZA 4HS6B 5ACMA 4NM8L 3DVIA 3HUJB 3SCMB 1MCEA 4ZXBB 5DMGC 5TDPA 1U2HA 4Q7DA 4M48H 3H9SE 3ARZA 1G7HA 2VB5A 2R29L 3MJ9L 4HUUB 4LCIH 1I9RH 4JB9H 5JOPD 5HVHC 5D1XD 2IH3B 4RISH 3G08B 1HSBB 5IHUH 1CT8B 7FABL 2CXKA 2DM2A 3EGSB 1JYWA 1SJHA 1G7MA 3M17A 1Q72L 1RJCA 4YDJB 1RK0A 3Q2CA 3QDGE 4O2EB 1CZ8H 2VITA 3HN3A 4CN6A 1V5JA 3CFDB 4OQ1A 4YXKH 4N0UA 5AD0B 2CSPA 4LEOA 1H3WM 3QWOA 4LARH 1G7LB 4HIHA 4UV4H 4RGOL 3E2HB 2JJUA 5GGQH 3ZYIA 1JWMB 3WHE1 1JK8B 4JZJA 2NYYD 5IB5B 4C55A 1K3IA 5CEZD 1J1OH 1IT9L 1BJMA 4LCYA 3PHQA 2Q3AA 4F3FA 4MVBC 5C8JB 1BQLH 4GMTL 4U49A 4MJ2A 4D9QE 2Y5TB 1KCUH 3EOYG 4Z7VF 3KPMA 3KPRE 5JIPA 3NCJH 1PKQE 3QUZB 1RULH 3PWJB 4BFGA 4AEEA 5I1LA 1CXKA 3BQUA 1QNZH 2W0KA 1T21B 3UBXG 1KBGH 3HLAB 5CIPH 4O4YH 1QFHA 4PYGA 4YAQA 3B9KB 3TN0D 3EZJB 3K1KC 2EH7L 4K3DH 4LASH 1I4FB 4KROB 2IAND 1FYHB 2X89D 3X11B 1PLGL 2EDJA 4MHHI 4ZSOB 2AJUH 2AJVH 4RNRA 2UZYB 5TPWL 1NCCL 3K8MA 3QNYB 4W6YB 4CMMA 3JV6A 1K8DA 1G9NH 4U1MA 1UB5B 1UGNA 3VXSB 2NXZC 2CDGA 3BP4B 3O3BB 1MSPA 5DD3L 1YN6B 5IB4B 2OSLA 5D7JB 1ETZB 3DURA 3LS4L 4GRWE 1FZMA 5HHOE 3UJJH 4WFGD 1X5GA 3QCTH 3SGJC 1FN4A 1DL7L 2BY1A 4JG1H 3VXMB 2ADFH 2EO1A 5TE7L 1F42A 5SX4I 2XNAB 4P9ML 1UENA 3TNNB 2F53A 1BF8A 2X4NA 4EOWH 4P9HC 4HUVB 5C3LD 4AMKL 4NWUL 1QSVA 2BSSB 4Y1AA 4JCLA 2QQKL 4X8JB 1U8NB 5DRNA 3KXFE 2CO6B 5FUZL 5C2UB 4JFDA 1MOEA 3EUUA 3BKYL 5C9JA 3C9NA 1UM4L 4HKJB 5F1IA 3SDCC 5E4IA 2D7OA 5EUOF 1TETL 4OTXH 3WXWL 2MQ3A 3OF6D 4MHHG 3Q5YA 2GJJA 1NGXB 1QBML 4UIKH 3ZSSA 2D03H 2CDEB 2D7MA 3P9MA 4JQIL 3AUVA 5IBTL 4TRPL 4M7LL 1LD9A 3TVMA 2NY4D 4GFTB 3DXAB 4QOKE 1A7QH 5B3JE 1CD1A 2BZDA 2ZSWB 5ITFB 4XH2A 4Q2ZA 1MJ7L 1QLRB 1VHPA 1DE4B 4ZDHA 3WFCL 5ECJE 1ZVSA 5ACZA 8FABB 4X4ZA 1P7QB 2R0KH 3DRQA 5EU3B 2PR4H 4I18B 35C8H 4JREC 3MCKB 5BW7A 2Q8BH 5D2NC 4KVNL 3WXVL 1KELL 5CIPB 5DJ6B 3CFCL 2XWTB 5EN2B 3S4SB 2EYRA 2VRAA 3BZDA 3FO1B 1TJIL 4DCQA 4YH6A 3X13A 2UZXB 1NBZA 3G5YB 4JRYB 3VWJB 1EH9A 5E8DL 4GAJL 3P0VL 2P8PA 4RGND 3RVUC 4V1DA 3BKJL 2ZCHH 4M6NH 4MA8H 4TPRH 4K3EH 1KJ3H 4ISVA 3RKDC 2AJZA 4I3SH 4KJWC 3SDAD 1GIGH 5IESL 1NDMA 3RIFK 5EU6E 4S1SH 5ESVA 4YHML 3HNVH 4U1IB 2YC1A 5KVFH 4NNPL 5FIEA 3V4VH 1WT5A 3GMQB 1OL0A 1WC7A 5I8EB 4TULL 3LRHA 1YMMB 3B8YA 2O5XL 1OW0A 4KV5F 2EEAA 3BPOC 3MRPB 2IAMA 4M1GL 3OKOA 3UAJD 1VGKA 3VFPA 1JWUB 3VXUB 3BXNA 2EDYA 4LSRH 4JHWH 3CXHJ 2ZNXA 1FBIL 5FB8B 5JW3L 4ZOBA 4X7SH 5MP6L 4PTTB 4QYOA 4BSVB 3VMNA 5CZXD 3CVIL 4ALAH 2BMKA 3BZ4A 2VZVA 4HBCL 1YN7B 2X4UB 3GUTB 2GYSA 5KW9H 4IOFD 4GW5A 1BVLB 2VAAA 4YHNA 5I1DA 3WS3A 3ZKQD 1FFPB 1LO0H 5D1XC 3HKFA 1QLEH 5C70A 5SWQB 4QO1A 5HHNB 5IMOB 1AGFB 4ELKB 3KAAA 2LABA 3RX8A 1TCRB 1Y18B 1CVSC 3PXHA 3PWPE 1J0ZA 4ACPA 2OK0L 2V17L 1C5BH 4HX1B 1CLOH 4UDTA 1W0WB 2NY0C 1EBPA 1EXUB 3OR7A 4YHZH 4AT6B 4M7JH 1OD7A 2GIYA 4ZD3H 4QHUA 1T66C 1T7ZA 3EHBD 4M1DH 3N1MC 4MNQD 3MCLL 5TDNA 3TN0A 3ARFB 3PIQB 5F88A 1EFQA 4OZGE 3BIKB 3R4DA 2X89A 5D71L 3L3GB 2AEQL 3WNMA 3A6CH 3AXLB 1PQZA 4C83B 1MHCB 4LPVA 1GL4B 2DQFA 4UTBH 3F5WA 3FFDB 2GJ6B 1I85A 1VGEH 1RZJL 2BSRA 4HEME 4WWID 3UTZB 1MF2L 4WCYL 3WLWC 2FDBP 4O2FB 4JO1H 5F9OH 4EXKA 3OSKA 4XGZA 5HYSG 2D7QA 2DM3A 5IVZB 2A6DA 4HULB 3T65B 2D4DA 4PJGE 1MFNA 4ZS6D 3AAZB 2ICEA 4YK4B 1GZQB 3QFDA 4PJXF 1DQQA 3NCYP 1U8QA 2HP4A 4EUPH 3CFEB 4CW1A 2A6KA 3I3BA 5I2IB 3GHEL 3F7VA 3TNMB 2FH8A 3SJVD 5DJ2A 1W72H 3U48A 4JDTL 1I8KB 1I9JH 1J05B 2BFVH 3DLQR 3MA7A 1WZLA 3QT2A 4N8CL 3HPLB 5A2FA 1VKXB 3OF6A 3LEYH 3D9AL 4XNXH 1X5JA 4FQHB 3BUYB 3FQNA 5INDA 3PGFL 1IAKB 3Q6GL 5EOQL 2XV6B 3LZFH 1YPZB 5CJOL 2IBZY 1LE9A 5L9DL 2XRAH 3QEGL 4OV5A 5F3HA 1JHKL 3BJ91 3SQOH 5KN5A 2VSDA 2H32H 3RVVD 3KPQB 3VE0B 3OR6B 4PRDA 4LBEA 1K4DB 5IG7B 1SMOA 4L3CA 3I50H 4BUGA 1FZOA 1XGRA 1ZEAL 4JHBA 5JXAL 3G5XB 1MQKH 1KENH 1JNLL 5I1HL 3H3PL 1G9NC 5DQDH 1FIGL 1LK2B 5DD6B 2J6EH 1RIVH 1U8KB 4NM4H 1J5OH 1TITA 4WNQB 3MFFB 2WP3O 4LPUA 3STLB 4PBXA 3DVFA 5IJVA 1OSZA 4OAWB 1EJOH 4WFHD 3R8QA 3K81A 2AEIT 1ZHLB 5JW5A 1T22A 3RDTC 3BUTA 3VG9C 2HT4D 3WIHH 1A14H 1IQWL 4MDJA 3VFNA 2DICA 3W5MA 4XP6L 4M4RA 3WUWG 3BGFC 1BIIA 1BWMA 4R2GD 3A6BL 5F6IB 4ONOA 1U91A 3QULB 3KPNA 4Q9QH 4OLUH 3DMMD 4NQEB 4Y8AA 1DSFH 3MRLB 3ULVE 5HHMB 5JLZB 4Q6IC 3QO1B 1LEIB 5HI5C 1PW3A 4E41E 1EO8H 3VFWB 5CEXA 5FO7B 1N5AB 1XCTB 5E2TL 1F4HA 1DBJL 5F70A 4QRUA 3AY4C 3PJSA 2X41A 2Z8VC 3R1GH 4E42B 2R56L 5IKCB 1X4ZA 1NCAH 1AP2B 2Y1VA 1ROWA 2DRUA 3MLUH 4R26L 1FG2A 4UV7H 1LVEA 2BHZA 1T0MB 1NJ9A 2VTFA 1XF2B 4GG6B 4P9HL 5DI8B 3DNKA 4X4MA 5E8OB 3VA2C 4PB0L 4ZS7H 4BZ2L 3UO1H 5EC1A 4FABL 3QEUB 2A0LD 1I1AA 2VZSA 3WDHA 4XRCA 1H5BB 1UJ3A 5FYJU 5BV7L 1O0VA 2I27N 1DEEB 4APQB 3O2VL 2ESVE 2MPAH 4M7LT 4ZODA 3VXQA 1C8PA 1KXVC 3GSNH 4ZO8A 4KVCH 5ISZE 5EFIB 3UAJC 1PX4A 3KPTA 4PJ8B 1ZHNB 1N0LA 1FE8H 1SVZA 3FQXB 3MV8B 1H9VA 5DRZB 2R1WB 1VFBA 4LCWD 5IHLB 5D93B 1DBMH 2NQCA 3SE9L 2I9LA 1NEUA 1Q9KA 3BGMA 3CX5K 1BZ7A 1HINL 5C0CE 3TIDA 3JUYA 5SX5H 5BQ7B 1I1YA 4XZUB 1DLFL 4KTYA 1MY5A 2ZKHL 2BC4B 4HWZA 3WLBB 1IM9A 1HNFA 4O51A 2A83A 3O6FA 1HE7A 5DD1H 4ZNEA 4MNQA 4NOBA 1BZQK 4BQCA 4OCRH 2VNCA 2IBZX 1FYTB 4GBXC 2QSQA 2OTPA 5BJTB 3SDDB 4PD4J 4FXLA 1NFIA 2X4RB 3MRBB 3GSVA 2YRLA 4XC3L 5DYOA 5BVJA 5IHZB 1TVBB 2E6PA 3RWDA 4PRPA 2EICA 1SM3L 5B8CB 4BK5A 1NBYA 1WCBB 1WIPA 1WTGT 4Y5VC 3U7YL 1OTTD 4FZEH 5DT1L 5A2KH 5C09D 3C6SA 2D0FA 3TEUA 1D9KB 1RVFH 4JEGB 3WFHA 1UH3A 3EOBA 4P99A 1YDPB 5EU4B 1DQLH 1F4AA 1ND0A 4PREA 3EHBC 5F7YC 3MV9B 4Y4KD 5KSAC 2BRQA 1QFUH 4N0CD 3VDBA 5EB9A 4OV6F 1V7NH 4OSUL 4PBVC 5MEPB 3LN4A 4LHJB 3UBXB 3DIFA 4IIQA 1SVCP 3FQTB 2VISB 4FQQA 4AIZA 3H9SB 5H2BA 4FQXB 1J18A 1YQ2A 4I0PD 1DQJB 4KFZC 5IW1B 1OP3H 5FDWB 1SYVB 5IIEA 5KVMC 2AJXH 4UNTA 3NMEA 1T5WA 2JJTC 4WO4B 3LKPB 3FT3A 5IWLA 3QDME 1SJEB 5FCUL 4PJFB 3GB7B 1RMFL 3OJDB 5I1CH 5DMIH 1DBBH 4ZS6C 3MROA 1WZ1H 3GSNB 3QDGB 3DV6B 2GITA 4NDMB 3VGEA 2J2ZA 1DUZA 5D70H 4NO0D 4O58H 4UILH 1FNEA 3X3FL 5CGTA 1FAIL 1N59B 3OAUL 5K9QG 3EZ8A 5E94B 1IC5L 5CJQH 4MAUH 4Z5RA 1MEXL 1JGDA 1IGYB 3IF1A 3VI4E 5MENE 4Z7WA 1TZHB 5HYJA 3MXWL 4Q9RH 1XIWB 1MUJB 3B2VH 3SGDI 5I9QB 4C56A 3RWGA 2C3WA 5FGBC 3C6LB 3NPSC 4XPTH 5DD5L 4MWFA 3S88H 3OAZK 2MMXA 5ICYB 2AV1B 1BFSA 2AW2A 4B41A 2F54E 2AK4E 3KPRB 1PKQB 3AS1A 4MNHA 3S96B 3U9PH 3RVVC 3PABA 4M48L 4D9LH 1JRHH 2DIBA 3AU1A 1D6VH 3ZKMD 1A6AA 2ZOKA 4LCIL 3RU8H 1I9RL 2KDGA 4EI5C 2DJUA 1QSEE 1OT1A 1IAIH 2Q3ZA 4HJ0D 4LVEA 3V6OE 5CEZL 4XP9L 1QG3A 3I9GH 4P2QE 1OP5H 2YXMA 1I1CA 3DMMA 3U0WH 3P0YH 4BSWA 2ZSVA 3GSRA 1ACYL 2OL3H 3ARDB 3ORJA 3ZE2F 3PV6B 4NSKB 1T0NA 1D5ZA 3TV3L 4TNWF 2VDOH 4GOSA 5E9DD 1FDLH 3CCHB 4LGPB 1BFVL 4X5XA 2AV7A 3NA4A 1CDHA 2DLEA 4YXKL 5FFLA 5CGYD 3WE6A 2CRYA 4LARL 4MMZC 2YPKA 5DRXB 5HGDA 1X4YA 4PY8I 4YBLC 3CDYA 3CDCA 1X3DA 3BPNB 4GRWB 1I3UA 2PNDA 1EEYA 3B6SA 5IW6A 1AR1D 3O3AA 2C7UA 3L3IA 1NC2B 1PBYA 3DVNA 4TUJA 1FLRL 4RQQA 3BWAB 2C1PA 4UINL 5JHDB 1INDH 5EA0L 4U6YB 4HFWB 1VENA 2FZ3A 5HI4D 4KQ3L 3OKEA 1BQLL 4XWOC 5SWZA 3HS0B 3AB0B 2DQDH 3SY0B 1MHEA 3NCJL 3ULSB 3OV6A 3QXDA 4U1GC 2DQEH 2B5IB 2DMBA 4AQOA 2BJMH 4LCWA 3TBSA 1CICB 1T3FB 1INQA 3U4EB 2EZ0D 3IAQA 4PP1C 1KBGL 2EXYC 5B39A 3T3PE 5I1KH 1BD2E 4XBGB 1JV5B 1BGXL 5AUMB 2YN5A 3I2CH 5J13C 2A74B 4F7CA 4F2MB 1KCRH 2BP3A 4N90E 1ZLSL 2JIXB 3GHBH 3MMEB 2A0LC 4XBEH 3O2DH 3UZEA 4M5YH 4Q0XH 4PJBE 2APXA 1U8PB 5FECB 2AJVL 2RIKA 2FEEL 4PGEB 3MNWA 2VUOA 4QOKB 1XGPA 1F90H 2FIKA 3UTSA 2JLLA 4ZYKB 2A6IA 3HZVA 1G9NL 2AEPH 4EVNB 3QG7L 5JPMB 3LD8B 3LPWA 4KJYA 3H9ZA 5I73B 3RY6A 4P2OD 2H41A 3FRUB 3CVHA 3FT2A 2NW3A 4P23D 2N7AA 3RWJB 1LEGA 1UXWA 3MGOB 3UX9B 2R69H 4HKBA 5C09A 5I75B 1GGCH 1XF3B 1OAQL 5GPRA 2H8PB 5DEFA 4M5ZH 3WS6A 1YEGH 5J11B 1JTTA 3EAKA 3JV5A 4GSDL 1KN2L 1KJMB 2HG5A 4ZUVB 4UOW1 5F1NA 4JPKL 3SQBA 1T1ZA 5J12C 1UG9A 3RPKA 3K4AA 4I0PA 2A9NH 3S97C 5HD8D 4A6YB 1DVFB 4G8IA 1DN0A 2FJHB 4O02H 3TT3H 2YD2A 5CJ5A 1Q8MA 2UY6A 1D5MB 5GHWL 4JKPH 5I0DA 3MODL 5MERB 2CLZA 3TBTB 2CK0H 3DUUB 3T2NH 4NQCA 1ZGLP 1A21A 3DPBA 4NO0A 3RKPA 2PR4L 1XGYH 4L8SA 1MLBB 1ZS8A 2Z92B 2A9ML 1G1CA 35C8L 2BY3A 4NZTL 3G6DL 4PJHB 3TIEB 5SV3A 3O8XC 1OF2A 1U41A 3LKSA 1QYGH 5J3HD 1JPGA 4QF1B 2X2YA 3QH3A 4LVOB 4OZ4B 1KB5B 4NT6B 2JJWA 1Z0MA 3OKLA 4A2MA 4X4YB 4R4ND 3O4LE 4MXWH 4ELMF 1TZGH 1KJVB 4OCMC 2UVEA 2IPUG 1R3LA 2R2BB 2ZCHL 3PWPB 2NY1D 5GRWA 4ZFFB 5CP7B 1KJ3L 4GAYA 3PDDA 1Q1JH 1GIGL 4I3SL 3I85A 4GKNB 3UXFA 5J6GA 4Y19D 5GJTH 1YA5A 1A3RL 5DJZA 3TH2T 1RURH 5FCSH 2XZQH 4KHXL 1F6AA 3D18B 4FZ8L 1CD8A 2OLDA 3TT1H 1CBVH 4JY5H 5GS1A 3CIQA 1HQRB 5IVOA 3HE6A 2WBJD 4PBWD 5BZDA 1PG7W 5I6XC 3PGCA 2A6JA 3HZYA 5JPNB 1UWXK 4OZGB 4WFEE 3GIZH 2EH8H 4HS8H 1S7SB 3GK8L 1V05A 5FUOH 1MWAL 2V7NA 3EOTL 4KXZH 3UPRA 3UJTH 4KK8D 1P7KA 4Q6YA 1MJUL 5CILH 5H37G 2C1OA 4N68A 2VOTA 3IGAB 2WNGA 1ZWIA 5C0GA 5KVDH 1HN1A 3D5OF 3D25B 3T77B 1SBSH 2DI9A 4KRPB 2COQA 4NGHL 2PW1B 5KW9L 3ULVH 1J12A 2VZ1A 5I76B 4NFDA 5T3XD 3Q5OA 1LO0L 3H7BB 3O9WB 3IFNL 1E28A 3QAZB 4PJGB 4K7PH 2JF1A 2OS7A 2CGRH 5IUSA 3KPLB 4PR5A 1A22B 2JB5L 4PJDF 3GSXB 3C09C 3QRGH 3P4OB 4NOFA 3WUWB 3L5WB 5DJ0B 1MAML 1RK1A 1KXTB 5CGYC 3WKML 4H8WH 4D3CL 5ERWB 4B53A 2HFEA 4OLXH 3RIAF 4IS6B 4M7JL 1A4KA 5E8NA 1CWVA 1AR1C 3LKRB 2XZZA 2ED7A 4JVUA 4ZD3L 3S36L 4X7DC 3RJQB 4UT9H 4K2UH 3MV01 2APTA 5KAQG 4TTDC 3LKQB 1PKOA 3OXSB 4EN3A 4S1QH 3A6CL 3DJ9A 5DVOA 1ZT1B 1S7WB 5BVPH 1N6QH 5HGBA 5IMLB 3QUYC 4UTBL 4X99B 3ZLQC 2WWKO 2GJZB 3TCLB 1G9MH 4JQVA 3RGHA 3QIWC 2ZUWA 1VGEL 5DS8B 3IDMA 4XVSL 1HCFX 3SCMD 3ARPA 1G0YR 12E8H 1T1XB 1D7FA 1F4YH 5IQ9A 4MQ7B 1MRDH 4Z7QF 1DCLA 1PSKH 3CSGA 3EYVB 4ODVH 4LLDB 3GSUA 5EOCJ 1FCCA 3NBNA 4MQSB 4P2OA 4XBPA 3O0RL 3O4OB 1GYAA 3DUSA 5KBNC 3NCBB 5E99H 4HCRH 5ELIA 3WSQL 1RFDH 1RPQA 1KPUB 3D85D 2L7JA 4HAFA 3S37H 1TJGH 3DV4B 4RX4D 1X44A 1IEAB 1U92B 5HGHA 3KWWA 5GS2H 4BKLB 3DX9B 2FD6L 2E9WA 3VCLB 4JQXC 2F19H 5FHBH 5I30H 4PGDA 2W0FA 3DGGA 2XQYG 5LWYH 1V8HA 2A73A 1M1SA 3TH3T 4PB9H 3ARXA 4U6HA 4GXUN 3HE7B 1JMZA 5TGBA 4HUMB 4KK5D 3QWRA 4P23C 1QFWL 1AC6A 4LQFL 4MCYA 4LKCB 2YA1A 5D7IA 1EMTH 4DZBB 3P77B 4QWWC 3OKDA 1NCWH 2PTTA 3KPPB 2GI7A 1HQ4A 1WFNA 5IR1A 1TLKA 5C0EB 3I50L 3DOSA 4XPBH 5HHPA 1F58L 2XG5A 4KY1H 2DN7A 3IDYB 3QUXB 3QUZD 4QGTA 1OTUD 3ZZ1A 5IGXH 5K59F 1LHZA 5L2JA 5DQDL 3SOBL 4Z7UA 2ATPB 3LMJH 3SN6N 5DUBB 4HLZG 2PTUA 4DEPC 2Z91B 3TO4C 2ESVB 3NFSH 1LO4H 5J4MA 3VD7A 4KROD 4J8RA 4HMDA 2Z31B 4R97C 5ISZB 4XMPH 4XP1H 4DGVH 3WNPA 3WIHL 1A14L 5KSVA 2DS4A 4R96B 3JVGA 5D5ME 1TZIB 4YXLH 3MACL 4Y89A 4EKXA 4X6DE 2XQBH 5JDSA 4YHKL 1PY9A 1I8LA 4LPXA 3L95A 3QI9C 4E0RB 5C0CB 4OLUL 3VXSD 3ZHLA 4K8RD 3RHWK 1EV2E 3CGTA 4FG6C 4ZFZA 4Y19A 1UVQA 1HILB 5GS0H 2VKXA 1S7UA 1EO8L 4JM2C 4M6ML 3MXVL 3MLTB 5DHVA 3V52L 3BH9B 2FECI 3VJ6A 2WBJA 3AM8A 5ALCH 3R1GL 5J3HC 4WRLA 5D2LE 5A2IH 3L3HB 4TSAL 1UEYA 4G9DA 3MLUL 4R4NC 3OG6B 4PG9B 2RFXA 2NNAB 1IARB 3RUGA 3NCCB 2WWMD 3ECBB 5BZWA 3B83A 4LFHG 5BO1H 3CDGA 4AEHL 4I9WE 3MV11 3R0MA 4R4FH 3WCYA 4TOYL 3ILPB 4PY7B 2CRMA 4WEMB 3K2MC 4NQSA 3UO1L 5F1OB 3BYTA 3IS1X 1K9TA 3VRLF 1K4CB 2SEBA 4OGXH 5D7IF 4QTHA 4H26A 1PEZA 2Z4QB 4MYWB 3FKUS 3P9LB 2DM4A 1JGLL 1MIEH 1JI1A 2PYEE 5CINL 4MD0A 5E08H 2VQTA 4KVCL 4LK4A 4MJ5A 2LE9A 2OTWA 4TN9A 2UY7A 2HWZH 5TQ0L 4OZIE 3D0LB 1AHWC 5BOPA 1FE8L 1WK0A 1N4XH 1DBML 2CDFA 4Z18A 2ZNWA 4XPAH 4PJ7A 3GKWH 4OZFH 4Z7UF 1IZJA 2V5MA 3BD5A 1E6JL 1P7QD 5IB3A 1K8IA 4NC2B 5JNYA 4K71C 4H5SA 4OI7A 4JKWA 4F7EA 2KQNA 3W2DH 3N0PB 3KJ6L 2AJYL 1KULA 5EPMB 5TE4H 3T0EE 5HY9B 1XFPA 3QDMB 3ROLB 2MTPA 5EDXA 5JR1L 5LCVH 5E4EB 4NRXB 1DFBH 3KLAB 4MD4B 3D6GA 2HJLB 4MA7H 5GQBA 3IJSA 2ZP0T 4YZFE 1CI5A 3FO9B 4OFYD 4JRYD 3IXTB 3ALPA 3WD5L 1W0VA 3GI8H 1ZA6A 1CGSL 5D1QD 1WCQA 4MLSA 4HS6A 2VDKL 3HUJA 3SCMA 5HI3D 1MPAL 4ZXBA 4OCYH 1MNUL 1YJDH 1IAMA 3LEXB 3O3DA 3RA7H 2HT2C 1CYGA 5CJXC 4LVNB 3S8WA 4HUUA 3PF2A 5DMKB 3RUGF 3QO0B 2VXTL 2IH3A 3G08A 1HSBA 2AVGA 1CT8A 1NCBL 1FO0H 4PJAE 3EGSA 2HTKD 4YUEH 4XNZC 2WMPA 2ZUSA 1ZLUK 4LVHC 3QZWA 2F54B 2AK4B 4JFOB 2YPLE 4HD9A 3B9DA 1AI1L 4RX4A 3G6AB 5DFWH 2EDOA 4O2EA 5F9JB 1QSEB 3CFDA 1KIUA 3VU2A 2WANA 3FT4B 4O2CB 1MFEH 4L8CB 1ORSB 5AD0A 4P2QB 3NCYS 1S7TA 5B22A 1G7LA 4H8WC 1FP5A 3RZCB 3QSKB 1MHPH 1JWMA 1CN4A 1ULVA 4PRNB 2E8ZA 5FYKE 4PJ7F 4BM7A 1JK8A 4JFFD 1DDHB 3CFIC 4FXKB 5IB5A 4ONFH 3CZJA 5J8OA 3MLXH 3EJZC 1UXSB 5T3ZE 3NZ8B 4TSCH 5C8JA 1H15B 4OZFB 2Y5TA 5C86A 5EZIL 5J9PB 1G9MC 3D39E 5IVXA 3VFVB 1WUNT 5L8JB 3B2VL 3PWJA 3QUZA 4NRYA 1Q0YL 2R23B 3STBA 1LWRA 1T21A 2IPUK 3HLAA 2XFXB 3ETBF 1E6OH 4XPTL 5EZOH 3CZFB 3B9KA 3ARFD 2OJEA 1RIUL 5FYLE 2FR4B 2NY2C 3SKJL 4LSTH 2XY1A 1I4FA 3X11A 4ZUUB 3HUJF 3U9PL 4ZSOA 4W81A 3FFCD 5IF0B 2NZ9D 1MFDH 4WHCA 3E3QC 3DSFL 2NXYB 3C87A 5AWNH 2X4QA 1BD2B 2JK5B 1UB5A 2BNRE 3L1OH 3VXSA 3PDGA 1KYOJ 1D5XA 3O3BA 5SV4A 5BRZE 2I25N 2W9LA 5CUSL 1YN6A 3EJYD 5IB4A 5D7JA 1ETZA 3QA3B 1A6TB 4PJBB 3RQ3A 5HYEA 1U3ZA 4S1RH 1JJUA 3F62A 3BAEH 3P4NB 1FDLL 3HR6A 4HJJH 4HXBL 2J88L 2HFFB 1C1EH 4FS0A 3VXMA 4HHAB 5JQ6H 1YY9D 1FSKC 1EFXD 2XNAA 5C08E 3TNNA 2NLJB 2K3TA 3EFDL 3MUGB 4HUVA 3BPLB 3OPZH 2F5BL 2IQ9H 1EEUA 1EGJL 4R7DB 5AAMA 2XKNB 5GS3A 4G6KL 4X8JA 1U8NA 2CLVB 1DUYB 4XT1C 1QRND 4LHUG 4ONGH 5F89B 5F3BA 1ADQL 1B88A 4HKJA 5ACLA 5E00A 4OGYH 3WJJC 3ZDZF 1C7TA 3PE9A 1WAAF 4PRHE 2Q6WB 1KIQB 2Q8AH 1NGXA 4OCWL 2CDEA 5IVNA 1PYWB 2VYRE 5K9KB 3ES6B 3OX8B 3CMOL 1JFQL 4R4BA 2R0ZH 2BJML 3DXAA 3EO0B 4DQOH 5ITFA 2ZSWA 2BY2A 4POUB 2WWMC 3O6MH 1QLRA 1YZZA 1DE4A 2VDNH 5I1KL 4BQBA 2D4FA 3ZKXC 4OD1H 6FABL 8FABA 1P7QA 3IRZA 3QIBD 2WSKA 2EDKA 3N9GH 4XAKE 5EU3A 3GHBL 4XBEL 5C0NC 4M9PA 5LVEA 2ICWJ 2X1XR 4I18A 1F11B 3H2WA 2JJSC 4YFLI 2FX8H 1YEJL 4Z95H 3BJLA 1L7TH 5CIPA 5DJ6A 2VH5L 5GS0C 2XWTA 5EN2A 1IGIL 4LLUB 1GPOL 3CSBA 3FO1A 1HEZB 2XZCH 4LLWA 3G5YA 3D1MC 3VWJA 4XPGH 1UH4A 4YC2C 3G6JF 4M7ZC 1YEKL 2DMCA 5GJSH 5GRJH 3U9UB 2CIKB 4RCAA 1X5KA 4U1IA 5HHMD 3UYRH 1GGCL 4P59H 2E7BA 3EOAB 5I1EH 5J1AB 4BZYA 3GMQA 3O4LB 4RAUB 3ZYZA 1U3JA 2ID5A 2OZ4H 4POYA 1YMMA 1YEGL 1KJ2H 3DRTB 3MRPA 3RNKB 3TZVB 5FGSA 3W39B 1FCGA 2XQYK 4FQJL 1JWUA 1RUMH 3VXUA 1P1ZB 4J6RH 3G5VB 1A5FH 3QQ9D 4R90H 4NBZB 5FB8A 5D1QC 3KPSD 1KNOB 3QUKB 4PTTA 4BSVA 3NGBB 1OAYH 1G7PA 3FQWB 4RMWA 1CS6A 1G7HB 3GUTA 1YN7A 1QLFB 2X4UA 2YMXH 1P5VA 3V95A 4KDWA 1BVLA 4APQD 1VB9A 5E2WH 4JN1L 5LJYH 2DKSA 1FFPA 1URLA 1S78D 5SWQA 3M17B 3T2NL 4PJ8D 5A1AA 5HHNA 5IMOA 1AGFA 5L0QC 1D6EB 3RTQD 3MV8D 4ELKA 1TCRA 1NC4B 1Y18A 2DF3A 5B38G 4GH7B 2ORBH 4NQTA 1UCTA 5FEBA 4HUNB 4XHQA 4N0RA 4JVWA 1W2KT 2D0GA 4HX1A 2WIMA 5MEQB 3PQYB 5DZLA