2ICEB

Crig bound to c3c
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
183
structure length
183
Chain Sequence
DEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3 beta chain
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 183
sequence length 183
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 2iceB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iceB02
4S1QH 4JJHA 3UTTD 3ALXA 2RCSH 5E95B 2GK0A 2JJVA 4FQXC 2XYCA 4PJDB 1CFVH 1YN6A 3GIZL 3ULVL 1CFNA 4P2OD 2IF7A 4ZPVA 2DOCA 1J18A 4LSVH 4PJCE 3MJ9L 3ZE1F 3S34L 5K9OB 3WSQL 3BKMH 4B7LA 2UZXB 4O2EB 2MMXA 4G9DB 5ID0B 4XX1E 3LEYL 1H3PL 5D6DA 1I1AA 5CFHA 5CZVH 3GBLA 5FXCH 3R1GL 4JJ5B 3EYFB 4N0CD 2EKSB 4XP5H 4YHZH 1HXYA 2ZWLT 1QVOA 3QIUC 1KENH 3MRJA 4HIHB 3HRPA 3IKKA 4OCXL 4LCCA 2AI0L 5B38B 3RIFF 4I4WB 4Y16D 4Z5RA 1RUKH 5D72H 4XMPH 1D6EB 3KPLA 1F8TL 3QIWD 1OF2B 2EDEA 1BZ7A 3MJ6A 3L5WB 5L2JA 2AKRA 5EIIA 5D7LD 2CGRL 1SJEB 4OIIH 5ESAA 3JZ7A 2Z93A 4U6XA 1A7PH 1OP3K 4MS8D 2P5WE 3WNMA 5JW5A 1NBZA 1KJ2A 1QLEL 1X6NA 2EDQA 5GGTL 4L8SA 1MCHA 5IF0A 4RCAA 5TH2A 3ZO0A 4BSVA 3DUHA 4FQ1H 4HIXL 3MLSH 4OZIF 1K3ZA 5I74C 2DF3A 3L3HA 3RKPA 5FF6A 1S9WA 4U05A 4WI4A 4X5XA 3ZHLA 3QPXH 4O58H 5F89B 1NKOA 1MI5B 3IDIA 1R5WA 4NKIL 5C0GB 3HE6C 3SGDI 4S11A 1PSKL 4K71C 3GJEB 3H3KA 3H9SE 4PLKC 5D7IF 4F8QA 3MA7B 4CUCA 2VLKB 1KC5H 2NTFA 5HYQB 3VD3A 4LSPL 5FYKL 1LEIB 2WP3T 2AJYL 2DQEH 3MOAH 5D7KD 3ZE0F 4WFGE 2HTLD 2GITB 4JGJA 3GO1H 3ALPA 1UM6L 4JFEB 4M3KB 4M6ML 3VDBA 2CIIB 5I75B 1JHTB 4MA3B 1QSEE 3C5JB 3TV3L 4LPUA 3GMNB 4M61B 4IDJH 4CRPA 3T0EA 1BPVA 4XBEL 4LHUA 5FGCB 3VFWA 2QQNH 1NEZG 3P3YA 5I17A 2VERN 2F74A 2VZTA 4JM2A 1XIWD 4HUWB 1FFRA 3Q5YA 1LO0H 2NZ9D 4PJAB 1M6OA 3T4YA 4HKJA 3LV3A 1QBBA 2VQTA 3BN9C 1WLHA 2EIZB 1F02I 3PWPA 3LN9A 1NAMB 1DEEA 1I3RB 4OUOA 2YPLE 4LNRB 4YFLF 1ACYH 3AB0C 3VXRB 3MYZA 3VWKC 2QHLA 1K9TA 2W59A 1MCEA 3VMOA 3HG1B 1K6QL 3KPSE 3MXWH 4PJDF 1J5OL 4JANB 1T89C 5D70L 4R96B 3JTTB 3KJ4B 2C7UB 4HLJA 4Y2DB 2E7MA 5D7JC 3FO1B 4QOKD 3WV0A 4ZUSB 1X5FA 3P11H 3WNLA 3BAEL 2GJZA 1A3LL 2VDOL 3GMMB 4CADB 5FM5M 4MNGA 4ZSOE 5F88A 4ZUVA 2DJ4A 1ZT7A 4MJ2A 5IVZB 4S1QL 2RCSL 3G5YA 5E08L 3GHEH 1K2DB 3DNKA 4XVJH 3OAZH 4BFGA 4DEPC 2X4NB 1CFVL 2DB8A 1XAUA 3FZUD 5DJ0B 3RNKA 5IOPB 4JKLA 4ORZC 1Z3GH 4UTBH 1WUNT 3FCTB 3U9UA 4I0PD 3MGAA 4LSVL 4ZUWA 4JFXA 2E7CA 3GUTB 3ZKXB 4MNQB 2YPVH 1D6VH 3LKNB 3B9KD 2J8UB 3OG4B 2CPCA 2Q1EA 3BKML 3VRLE 3C5SA 1FNHA 1DBAH 4OF0A 4PYHA 1B6DA 2A77H 1RJCA 2XV6B 2F53A 4JKPH 2AEIT 5CZVL 5L8KB 1AKJD 1MFAH 1A0QH 1LHZA 4D3CH 2R56H 4UUJA 5CBAA 5GGVY 4C58B 3VU2A 4XP5L 4YHZL 2CLVB 4JFYB 1WFTA 1KENL 1N64H 4NN7B 5DUMH 3MRDB 2VLMD 4I2XB 1FE8H 1RUKL 5D72L 5IV2A 4H88H 4XMPL 4P23A 5KSBA 4KTYA 1VFAA 4JFED 2OR9H 3D69A 5IJKC 2G75A 5F7EH 3KPRA 3JV5A 4KJPC 4KZDH 4OIIL 2GK0B 2H2SD 2YS4A 3MBEC 1OCWH 4WI9A 1YN6B 1A7PL 1C7SA 5CKAA 1BD2E 4E9LA 4ZPVB 3FONA 3EJZC 1MCLA 1INEH 1HHIB 4PG2C 4FQ1L 3MLSL 1ES0B 2X89A 3RTQA 1FNSH 4M8VA 4QHKI 4W6XB 3QPXL 4O58L 3J8F7 5DI8A 2IC2A 3G08B 1I1AB 3W11D 2GYSA 5D1QB 4PJEE 5HBBA 3HAEG 4W81A 1QVOB 4KK5C 4BFEA 3MRJB 1ND0A 2ZUXA 1N4XL 3ETBF 1KC5L 1JRHI 4LCCB 5KTEH 1TZHA 1UA6H 3Q6FA 4KRPD 3TA3C 2DQEL 3MOAL 5JORB 4Z5RB 1F45A 2VSCA 2A38A 5F97E 3KPLB 5IHLB 3GO1L 4PJAF 4TNWK 1BZ7B 1UCBH 5E2UH 2FYYA 5L2JB 2CRYA 5EIIB 3GRWH 1O7VA 3VG9C 4X9GA 1AXIB 5ESAB 2BSRB 4OBSA 2I60H 2IJ0C 5IK3A 1I8MB 4IDJL 2Z93B 2R0KH 4U6XB 2QQNL 5IVXF 2OR8A 3UPCA 3CH1A 2FB4H 2VQUA 4NFDA 5JW5B 1NBZB 1KJ2B 2IQ9H 2LVCA 1T7WA 4L8SB 4LKCA 5IF0B 1I7UA 1LO0L 2AXJA 4MNQD 4YHNA 5EU7C 1OTSD 2WUBH 5TH2B 4XGZA 4BSVB 5JOEA 3MO1A 4HGWA 1FCCA 2BFVH 3L3HB 5FF6B 1S9WB 4EN3A 4X5XB 2E3VA 3PUCA 3IDIB 5B4MD 1R5WB 1ACYL 3QFJA 2OR7A 4KI5F 2FEDC 4OQ1A 3WCYA 3WUZA 4FQQA 1RU9H 3TCLA 1MF2H 3QDJA 3MXWL 1R6VA 2XG5A 4DVBA 2V5MA 2NTFB 3X17A 3H9SD 4WY7H 1KFAH 4MA7H 4QRSA 3P11L 3EO0A 1N5YH 1S7QA 3T8XA 3LKQA 2J8UF 2FH8A 1P7QD 4PUBH 5JOPD 3BRDA 2JCCE 3GHEL 4XVJL 1FH5H 3WJLC 3G6JA 4LHUB 3VFWB 3UAJD 2O61B 3TPKA 5I17B 1SJHB 1Z3GL 5CIPA 5L9DH 4UTBL 2VYRE 2F74B 4JM2B 4H25A 1FQ9C 4HUMB 2VZOA 1S7UA 2JELH 5DJXA 1M6OB 2YPVL 3EZJB 1D6VL 3T4YB 3LV3B 4KRLB 2R0ZH 1DBAL 3UTZA 2A77L 4QRPA 2PTVA 1DEEB 5E1HB 4BM7A 4JKPL 4HC1A 5GSRA 2WV3A 1MFAL 4KVCH 5D1QD 3KPMB 1A0QL 4Z7UA 2YPLD 4D3CL 2R56L 1H9VA 5J3HC 4CKVX 5D9SA 1N64L 4H20H 1KEGH 4Y89A 3MMEA 1D3CA 2GJZB 1FE8L 2EXWC 4H88L 5I73B 4MNGB 1RJYA 5F88B 4ZUVB 2OR9L 1ZT7B 5F7EL 1KPVA 4HQQH 4Y4HD 3SPVA 3G5YB 4KZDL 3QZWA 1OCWL 5I16A 2CXGA 3NFPA 1CF8H 1NDGA 3EJJX 2Z35A 3U9UB 3I75A 2QBWA 2N1KA 3OB0K 4JFXB 1EBPA 4R97C 5J11C 1INEL 5F9WB 5JLZA 1FNSL 4CGTA 1OLLA 5CLWA 1CE6A 4K9EC 2BC4B 1CR9H 2F53B 3W0WB 4F7MA 3O2VH 5C08A 2DBLH 1MFNA 3BESR 4UUJB 3ZTJH 2EYRB 5CBAB 4JFOA 3D0VB 4YZFE 2AQ2A 1HHGA 1UG9A 1J1OH 1YQVH 1KV3A 4FS0A 3QAZC 5KTEL 1J05A 1UA6L 4F7EA 2NY2B 1JWMA 5IV2B 4PJ8B 4P23B 5KSBB 1VFAB 1N8ZA 3EOYG 1UCBL 5E2UL 3D69B 5B3NA 3FT4A 4J3TA 3PV6A 3KPRB 3GRWL 3JWOC 3AS3A 4G43A 2I60L 1NGXA 3FAWA 2A83A 2R0KL 3BDYH 2I07A 3B9EA 2FB4L 3QHTC 4MAYD 4D9QD 5IEHA 4JM2D 5E7FA 2IQ9L 4YBQD 1IAIH 3U46A 3FONB 3G5ZA 1T7YA 1VFOA 3P40A 2WUBL 3PDOA 4LBEA 1BHGA 1HN1A 3RTQB 1U8LA 4YHKH 2BFVL 4UAOC 5DRXA 1A14H 3S3SA 4U4BA 5DI8B 2C4FT 2Y25A 1X3DA 1U8IA 1NGPH 4F37F 1I1CA 1RU9L 1L0QA 4ZFOA 3K7UA 4ENED 1ND0B 1RUAH 1TZHB 3Q6FB 4JM2F 1KFAL 4MA7L 4WY7L 5DURB 8CGTA 1N5YL 3WS6C 4QY8A 5BXFA 4P57A 1U3HC 3FQWB 3KDMA 4PUBL 2FYYB 3TO4A 3T3ME 2I5YH 4QHMA 4CJ1A 4C54A 3NCMA 1FH5L 5IK3B 3GJFK 2BNUA 1IZJA 1OQXA 4NPYA 5GS0C 3V8CA 1EDQA 2BVUA 5L9DL 1HOCA 2WIIA 4L8BA 2ZUSA 4R0LC 4X8JA 2NY0B 4PD4K 1B6UA 2JELL 1WAAF 1I7UB 4NCC2 3DX8A 4YHNB 4XGZB 2UWEE 2Q87A 1B90A 4DK3A 3MO1B 3ZT7A 4HGWB 2R0ZL 2R2EA 3CZFB 4JCMA 5TGBA 4EN3B 2VZ1A 3W5NA 5D96B 2VXQH 3W0WD 2DMCA 3KS0J 4KKBC 4FFWC 1A9BA 4OCNC 3O3DA 4KVCL 4FQQB 5DFWH 3TCLB 1IBGH 3QDJB 3K8MA 3GHBH 1IM3A 1YECH 1Z9SA 5ALCH 5HYIA 1WZLA 2Y23A 4H20L 4UZGA 1KEGL 4QRSB 5HGHA 3KYMA 4PJ8D 5H94B 1S7QB 4W4NA 3SBWC 3T8XB 3LKQB 4OGAC 3FFDA 3GK8H 4ZOAA 3F6LA 4HQQL 4G8GA 1XF4A 4JM4H 4LMQE 2V2XB 3QYCA 4LVNC 4Y5XC 3UTOA 4OF7A 1CF8L 1Z0MA 3ARGA 4L9LA 4R4ND 5TJWK 1CFQA 2I24N 3GFUA 1XCQB 5GS3A 1S7UB 5DJXB 4KXZH 2QQQA 1CU4H 3RTQD 3L3KA 4XP9H 3WE6A 3UTZB 4QRPB 4KROC 4ONGH 5DK0A 2PTTA 1VEOA 5KSBF 1CR9L 3MREA 2X4SA 4KJYA 5JIKA 4DCQA 2CUMA 4LEXH 4XMLH 3P4MA 4XI5D 3O2VL 3U48A 2DBLL 3K80A 4Z7UB 1RZJH 3SGJA 3O2WH 4P2QA 3CSPA 3SO5A 5I6XB 4HEPG 4YHMH 4ZTPH 3GM8A 5D9SB 2OX5A 1J1OL 1YQVL 2YOCA 3GMQA 1XFPA 3QIBD 3MMEB 5KAQG 5KSAD 3MRIA 3HZVA 3V6BR 4YXHH 2H6PA 1RJYB 1KPRA 2VDKH 5SX4I 1QFUH 4PGZA 3SPVB 2XQYG 1CDIA 4TOYH 1AC0A 2W60A 1J8HE 5I16B 3QXDB 3U4BH 3ARUA 1BJ1H 3BDYL 3NFPB 3ULVE 1OD9A 1NDGB 4I18C 1NUDA 2Z35B 5KOMC 2VLRD 2W0LA 2BOBA 5F9OH 1N7MH 3I75B 5D1XD 1IAIL 1Y0LB 3FKUS 3RGVA 4BZYA 3JWDC 3MUGA 3UJTH 5L88H 2DDQH 3LEVH 5JLZB 1OWRM 4YHKL 2IEPA 1CE6B 1A14L 4PRPA 1XF3A 4X83A 2VN7A 3L5IA 5BOZG 4ZS6D 2NCMA 5C08B 4LDOB 1LE9A 1NGPL 2P48B 1E4KC 2HLFC 2VDMH 4JFOB 3QDJD 4DGVH 2Z91A 3TN0A 3EDFA 3TJEH 1HHGB 3PXHA 5CSBA 4AY0A 1BBJA 1RUAL 3M17A 3ZT5A 4F7EB 1JWMB 3ARBC 1FV1B 4XXCA 1GGIH 2H9GA 1A6VL 3WN5A 3FT4B 1ONQA 3PV6B 2F5AH 2I5YL 4YHPA 4G43B 1ZLUH 1NGXB 5MEPA 4EJ1C 2A83B 2I07B 4I77H 5IEHB 4OCLC 3U46B 3PP3H 4NN5C 3WXWH 1JPFA 3PDOB 4LBEB 3C08H 3RA7H 4EIGB 4EUPA 1U8LB 5HY9A 5IB1A 5DRXB 3OB8A 4YHYC 1AC6A 1T1YA 5MI0C 1BVLA 2VXQL 4G9FE 2LTQC 2Y6SD 4N0UE 4OKDA 5EO0A 1U8IB 3QULA 5SX5H 3HAEH 1WCBA 1IBGL 2Y5EA 3GHBL 4ZFOB 2FIRT 1YECL 2BY1A 2XPGA 4N68A 5ALCL 3G04A 1MY7A 4L8DA 4Y5VC 2GJ6E 2JIXA 3SGDH 4Q9QH 3FHAA 3BHBA 1YY9C 4QY8B 3RHWK 5BW7C 5BXFB 1ZOXA 5L0QC 3KDMB 3GK8L 1SVZA 2VWEC 4JM4L 4WHCA 5C6PB 1H8SA 4QHMB 2OZ4H 4P59H 2BHUA 2BNUB 3G5XA 1NC4D 5EORH 3OKEA 2WIIB 1W0WA 3ARFB 4L8BB 5K9JH 2ED9A 2XKSA 3NFSH 1AO7E 1T83A 4QRTA 3DX8B 4U6YA 3MV7E 4XPGH 4QGTA 3R8BB 4RIRA 5MENA 1CU4L 4Q6IA 1OAZH 4XP9L 2R2EB 2JJTA 3SE9H 2FJGA 5TGBB 2YC1A 4ONGL 4PJHE 3VGDA 5JA8B 4LEXL 4XMLL 1A9BB 2H32H 2Z8SA 3O3DB 4ORGA 5DEFA 1RZJL 2R2CA 3O2WL 2FX7H 1CE1H 1IM3B 3T3MF 4JQXC 4ZTPL 4YHML 2Q7YB 2XTJD 3EYVA 1I4FA 4S0SD 3BI9X 5GJTH 5HGHB 2D7PA 1KXQE 4WNQA 3KYMB 2AAVA 4AH2A 4YXHL 2VDKL 3FFDB 1QFUL 2NZIA 4G8GB 2VABA 5KSUA 4TOYL 4IRSC 4LPCA 2KUTA 3QDHA 5LJYH 2Z31A 3U4BL 1M7DB 3ARGB 1OLZA 1TVHA 4L9LB 2J88H 1CFQB 4MD5B 2A73A 2VUOA 5F9OL 1N7ML 4LSUH 3S37X 4X7DC 4CAGA 4NNYA 1D5ZA 4PGDA 1TTGA 4X80H 2VDRH 4OLUH 3HC3H 3UJTL 5CS7A 5L88L 3EGSA 3LEVL 1BAFH 2DDQL 2EC8A 3L3KB 3WE6B 2WWKT 4UU9A 4OGYH 1CD1A 5DK0B 5FIEA 2PTTB 3BEWA 3U7WH 5A3IC 3MREB 5F93C 2X4SB 4KJYB 4DCQB 3P4MB 1NJ9A 4HGMA 3QPQC 3I02A 2VDML 2NW3A 4P2QB 3O8XD 2W0KA 4DGVL 5DJZA 2L4OA 3TJEL 1OT2A 1UYWH 3Q3GA 3GMQB 3TO2A 3MRIB 3C8KA 2O93L 3P2TA 4Q74A 1JZ8A 3VXMA 3TNNA 1GGIL 3K8KA 1KPRB 2F8XC 2LQRA 4MQXD 2FHFA 1DQDH 4LLQA 5F8QC 2F5AL 2QKIA 4LEOB 4JVUA 3ILPA 3H0TA 1D7FA 3I3EA 4P3CH 4Z7QE 4GRWH 3ARFD 4I77L 1PDKA 2BOBB 1JYNA 3ULVD 4X5LA 4ETYA 3RGVB 1DBBH 2AV7A 3NA9H 1F4WH 2X40A 4NZDA 3WXWL 5A16A 3MUGB 5E2VH 3C08L 2YD4A 1I1FA 3RA7L 2WZPD 1FO0A 4EDXA 3IKCA 4PRPB 4HCRH 1XF3B 3HMWH 3RZCC 2DBJA 1YEHH 1CBVH 2BNQE 1LE9B 1F42A 3ARDA 2ICWJ 32C2B 3HLAA 2EH8H 2Z91B 3TN0B 3V5HB 1BBJB 3RU8H 3QWQB 3M17B 4Q9QL 4HAFA 5EOTA 4FTVA 1RZFH 3LH2H 4JKKA 3RNQB 5BV7C 5AD0A 1W2KT 3WN5B 1ONQB 3QI9A 1JRHH 2X6MA 4YHPB 1EGJH 3VGBA 1BF8A 5EBLA 5MEPB 2OZ4L 3FB5A 4P59L 4OIBA 5ILTH 3MFGB 4WO4A 5EORL 4LFHG 5DR5H 3UROR 5DD0H 5K9JL 1T80A 4Z7VE 3NFSL 1TNNA 1A7OH 2PXYA 1Y6KR 1OTTD 1JPFB 4NRXA 4UOW1 4XPGL 5FYLE 1OAZL 4EUPB 3SE9L 5HY9B 4U1JA 4FQHA 2A74A 1BVLB 4BUHA 5I1JH 1MCKA 4K94C 4S1RH 3KLAA 2P5EA 3TESA 3T2NH 5EO0B 3QULB 5FKPB 4P99A 4GXVH 1MQKH 2VZUA 1WCBB 2ZUYA 4G9FD 4C83A 1ORQA 1AD9A 1CE1L 1CLOH 4NZUH 1REIA 1MHEA 1Q9OA 2FO4A 2XPGB 3G04B 3B2VH 1F3JA 5I18H 1VB9A 4G5ZH 2JIXB 4WCYH 5GJTL 5FYKD 5JTWA 4PRHD 3BHBB 2GJ6D 5FA3A 1JPGA 4OLVH 5FO8A 1UADC 1X7QA 2FL5B 2BOCA 5IWLC 4IRJD 3Q2CA 3VXTA 1MCOH 1V8HA 2LU7A 3G5XB 3ET9F 3OKEB 2ARJQ 2J88L 1CT8A 1W0WB 3QUZD 5DZNA 5L6YH 2MHAB 1BQHA 3NPSC 4LSUL 4PJ5A 4QRTB 5DD5H 4U6YB 4X80L 2VDRL 4OLUL 1Q38A 5E8DH 3HC3L 5MENB 1AO7D 4QT5A 5TDNA 4Q6IB 3VI3F 1BAFL 1BREA 3MV7D 4JRXE 2FJGB 4ZXBC 3UTSA 4OGYL 2YC1B 5CBEA 3U7WL 5EBWA 1EO7A 1NFDB 5DS8A 5DVLA 1SHMA 4ORGB 5DEFB 3KPPA 5E8NA 2G5RA 1URLA 5L7XH 4YPJA 3MRRA 4UOJA 3EYVB 1I4FB 1UYWL 3FT3A 3RP1A 1U93A 3C09B 1CICC 4WNQB 2G9HA 3ESUF 4AH2B 3MRKA 5ESVB 2B0SH 2IH1A 1DQDL 3P73A 4JY4A 4Z95H 4BZ1H 2VABB 1JUFA 5KSUB 1IGCH 4S1DC 4KKLC 2PO6C 5DHVA 4P3CL 3D48R 4DZBA 3MRBA 3VH8A 5C7XH 2Z31B 1TVHB 2CKBA 4WFEE 4JFQA 4RQQB 3GI8H 2A73B 2ZCHH 4R26H 2P8MA 5CZXD 4NNYB 4PGDB 1DBBL 3NA9L 1F4WL 3U2SA 2XQBH 3WJJA 5E2VL 3EGSB 2XT1B 3OR6A 3VXRE 3CFCL 4HCRL 3ZTNH 2Q86B 5HYSA 1CD1B 1Q94A 3HMWL 3BEWB 2DQGH 1SMAA 1YEHL 1CBVL 1NJ9B 1JE6A 1RZGA 5EUOA 3C2AH 3I02B 1PFCA 4C59B 2NW3B 1G9EA 2EH8L 2IPKA 5DJZB 1WVZA 3Q3GB 1WITA 4J3SA 3TO2B 3RU8L 2JIXD 1UB6A 5HHQA 4K9EH 1ZTXH 3C8KB 4OI8A 1F5WA 4KUCF 1RZFL 3LH2L 2VLJA 3SKNA 4Y4FD 3TNNB 4LVOB 3VD7A 3RVWC 1UCTA 2KKQA 4LLQB 1P7KB 1JRHL 1EGJL 3ILPB 3H0TB 2W91A 4M9OA 1CIDA 5ILTL 4FOMA 2AXHA 5DR5L 4JGUA 5DD0L 1QZ1A 2ERJC 1A7OL 2AV7B 5A16B 1DL7H 1I1FB 1YJDC 1FO0B 3O9WC 2AQ3A 4EDXB 3JWOH 5IJVA 1R3HA 1FSKC 2ZG3A 3JVGC 4DTGH 3QDME 4LIQH 3VCLA 4J8RA 5IB5B 2ICWA 1RUQH 5I1JL 3F12A 4S1RL 2PKDA 3T2NL 4GXVL 4XTRC 1MQKL 3ARDB 3BPLC 2EO9A 4KTEH 3HLAB 1GXEA 2BNQD 1CLOL 1HYSC 2E6QA 4NZUL 3S37H 5ISZA 3B2VL 5I18L 3DMMA 5I1EH 5KZCB 4G5ZL 3LIZH 3AREA 4TYUA 2IADA 4WCYL 3CIQA 3IYLW 5EOTB 4P5MB 4FTVB 5IB2B 4PJGB 3MV9A 1T0NA 5J89A 2L0DA 5AD0B 4FXLA 3MLUH 3VXSA 5IFJA 3LZFH 3QI9B 1AGDB 3MCLH 1NGQH 3FOLA 4D2NA 4CU8A 5EBLB 1D9KC 1MCOL 2VL4A 5D93C 1EVTC 2NXZC 1C5BH 1NFDF 4WO4B 2D4DA 4NGHH 4ODSH 5HI4D 3RVVC 5L6YL 2E9WA 1Q9WA 3O45A 3WIHH 2CSPA 5JPNA 3S4SA 5DD5L 2PXYB 4LHQB 2IQAB 4NRXB 5E8DL 3UYRH 3T3PE 4OCMC 1E4JA 4U1JB 4FQHB 4QTHA 2OI9B 2A74B 3HNSH 1KLFA 5GS0H 1NMBH 3KLAB 2P5EB 3ILQC 4J4PD 4MD4A 4TPRH 1ORQB 1AD9B 1IEBA 4P9HC 4PPTA 5L7XL 3RY5A 1MHEB 2FO4B 3OZ9H 5F8RC 1F3JB 2NY4C 4HUUA 3SE4A 1GOGA 4V1DE 2J6EH 4HMEA 5FA3B 1JPGB 2NYYC 5FO8B 2LAGB 2B0SL 2AGJH 1X7QB 2BOCB 4X6CE 3DURA 4BZ1L 2DKSA 5MHSE 3RVXD 3TBVA 1IGCL 1BOGB 3VXTB 1AI1H 4HJ0D 3ULUC 2DKUA 1U95A 5C7XL 3IFLH 4KK6C 4NC1C 1CT8B 5TFSH 3GI8L 2ZCHL 4R26L 3IXAA 1PX3A 1BQHB 2JB6A 4PJ5B 5ITBH 2CQVA 1E4XI 3HR6A 4YPGA 1IEHA 2XQBL 2YBRA 4LDLB 4GRMA 5TDNB 4EKXA 2WP3O 1U41A 3UTSB 1JGLH 3ZTNL 4XPAH 4S0TD 4L4VA 5CBEB 1RIHH 1EMTH 2DQGL 3D3VA 5EBWB 1P9MA 4JAMA 5DS8B 4FG6C 3OJ2C 5DHYA 5F1KC 2HFTA 3C2AL 5LWYH 3KPPB 3HR5A 5ERWA 3MRRB 4HFWA 2NY1B 3FT3B 2B1AH 2LV4A 1U93B 1UXSA 1U42A 3I2CH 3MJ8A 4K9EL 1ZTXL 4XXDA 2KZWA 2G9HB 5CEXA 3EFDH 4R2GB 2WUCH 3MRKB 2RFXA 3WO4C 5DO2C 3PWLB 2EC9T 3T0EE 3KYAA 2IH1B 4OZFG 2PYEE 4N90D 4JY4B 3P73B 2A0LC 1IC4H 4NWUH 3JXAA 2R2BA 4DZBB 5DA4A 1RI8A 4JFQB 2PF6A 3AVEA 1FORH 2XNAA 5SX4H 3UCRA 2P8MB 4YWGH 2GEEA 3O6MH 3V6OE 4U1GB 1BQUA 2ILLA 3FT2B 2XWTA 2YUVA 3PWPE 1DL7L 1S9VA 4TSCH 4XHQA 4QRUA 2DWDA 3JWOL 1UEMA 1UH4A 3OR6B 2VR4A 4DJMA 5HYSB 4PJGF 4DTGL 4YEFA 1Q94B 4LIQL 2AQ1A 1K4CA 1RUQL 4M6AA 2P5ED 4I5BA 2K3TA 3FAXA 1RZGB 1I85C 1ZK9A 4K8RC 4XPFH 4KTEL 1UZ6E 2IPKB 3S37L 4AYFA 5HDBE 3AY4C 3LIZL 1UB6B 2DI8A 5HHQB 3TT1H 4XNXH 4XAWH 1L4IA 3D85D 2V9TA 1C16A 2VLJB 3SKNB 5I1CH 1KIPA 1GC1H 3ZT6A 3MLUL 1T03H 4AIOA 3MOQA 3LZFL 3MCLL 4HK0A 5D2LE 1MWAA 2DM3A 4OI9A 1NGQL 4CVZA 3DARA 3L3DB 1YPZA 1KB5H 1C5BL 2HRPH 3UZQA 4NGHL 4ODSL 3NAAH 5HGGS 4ONFH 4GRLA 1VSCA 3WIHL 2BRRH 1KCUH 1MRFH 3P0GB 4M93B 3MR9A 3UYRL 3VXOA 4UNUA 5IJVB 1R3HB 2ZSWA 5E6YA 2XOTA 4TRPH 3HNSL 4J8RB 1U3ZA 3SDAC 3VCLB 1CL7I 3SGKC 4JB9H 5GS0L 3F12B 1NMBL 5J12C 3VW3H 3QDMD 5FM5O 5C0AB 5E56A 4TPRL 4Y4KA 4CVXA 1EFXA 5C0EA 3OZ9L 5IBUB 5ISZB 1B2WL 3O4OC 4ZPTA 5FUCE 3ZMRA 4WUKH 3DMMB 4PYGA 2DYPA 3AREB 3LAFA 2IADB 5DMGC 2NPLX 4O5LH 3KPRE 2J6EL 4RFOH 3MV9B 1T0NB 2QL1A 3O6LH 5D2NA 3VXSB 5B39G 5IFJB 2AGJL 1IMHC 1LO4H 1DUZA 4ELMA 3PWUA 3X11A 3FOLB 4YDVA 1OAXH 2LVEA 1AI1L 5GRYA 3N1QC 3NIGF 3IFLL 3C6LD 1DVFC 3DJ9A 3WYRA 2YN5A 1ZVSB 1MFEH 1NBYA 5TFSL 1Q9WB 3O45B 5JXEC 1NC2D 3B8SA 4XX1G 4L8CA 5JPNB 3DETC 3S4SB 5ITBL 5JHLH 2X44D 3DRQA 3FO2A 4W6YB 4K55A 3FO0H 3IXTA 3BO8A 2HFFA 3IVKA 3CFEA 5ADOH 5I8KH 2R0LH 4QTHB 4C4KO 1JGLL 4XPAL 4JO3H 4KY1H 1RIHL 1EMTL 4XPBH 2XG4A 2PW1A 4PP1D 3AU1A 5DJ8A 3QQ4A 3BOVA 1UC6A 4MD4B 3BXNA 4GMTH 5LWYL 4GLRI 3TYGH 5INCA 3ZHKA 2B1AL 4HUUB 2HFGH 2CUIA 2MQ0A 2J2ZA 5EPMA 4KRMB 3I2CL 4WWID 3ME0A 1OAQH 1PEZA 3EFDL 3BYTA 3HKFA 2WUCL 2VZ3A 5DGQA 2AJ3A 2B5IB 5B8CC 5E2TH 3O6KH 1HZHH 1BX2A 2KQMA 3O11A 3DURB 4Q2ZA 1IC4L 3KAAA 4NWUL 3TBVB 4HGKC 4U2ZA 1EUTA 4OGXH 1V7MH 1U95B 1KLGB 5MHSD 1V7NH 3QUYC 4ZAKC 4PJ7A 1FORL 2YRLA 3IXAB 4YWGL 3O6ML 2JB6B 4XVSH 2BVTA 3TF7C 3ARTA 4GG6A 1M7XA 4YPGB 2YBRB 3SDDC 4GRMB 2H45A 1UWXH 4TSCL 2NY6B 1S7SA 3QFJE 1KNOA 4UTAH 2AW2A 3F5WA 4NNXA 3TVMC 4L4VB 3RI5F 4KKAC 3D3VB 4JAMB 1PYWA 5EZLA 3VXNA 5DHYB 3UBXA 2IBGA 1GZPA 1Q1JH 1LQSR 5C0AD 3QEQA 3MRMA 4XPFL 4N0YH 4LGSB 3HR5B 5ERWB 3VGAC 1WZMA 4NNPH 5ISZD 1TJHH 4HFWB 4X6DA 3GJFH 1UXSB 3ARED 3MJ8B 4IM8A 3T0WA 3TT1L 3LDBB 4XXDB 4XNXL 3MNWA 5FGSA 5I1CL 1PKQE 1HYRC 2RFXB 1YEEH 4OLXH 1T03L 3G6JE 1JTPA 4X0KA 3C5ZA 1FVEB 2VMFA 5DYOA 2GI7A 4GSDH 2PYED 3WUWG 5I2IA 1KB5L 1GGTA 1T2XA 1G6RA 2HRPL 3MX0A 4G3YH 4ZMAT 3NAAL 1FNFA 4ONFL 3L3OA 1FFOA 2XNAB 2NR6D 1TITA 3CAFA 2VDPH 2BRRL 2XWTB 1KCUL 1MRFL 4M48H 1GHFH 5F7HA 1GZQA 4NRYA 1S9VB 4YK4C 1OSPH 4QRUB 2DWDB 1H3WM 1FZMA 4CNIB 3BSZH 4TRPL 3C87A 3VXQA 4PLNC 1RZIA 1K4CB 3LN5A 4JB9L 3U0WH 4I5BB 3VW3L 5L2KE 5HXMA 4RAHA 1W0VB 2EZ0D 3O4LE 5GXBB 4WUKL 1S7VA 3TJHC 4YNYA 5AZEH 3CSYA 5EU3A 5E2WH 3TCXA 4O5LL 4RFOL 1T6WA 1C16B 1FVCA 3BP7A 2BSED 4XAKD 3O6LL 4HFUH 1QKZH 3QH3A 1EV2E 4HK0B 1MWAB 3PQYB 5F7NC 4CVZB 1OAXL 3D0LB 4F33A 5DJDA 2WBWB 1YPZB 3IFOA 2BERA 2VE6A 1WT5C 1MFEL 5TQ2H 4GRLB 1UJ3C 3NIDF 1OHQA 4LU5H 4XNQA 5JHLL 2NY3B 4ZYKA 2ORBH 5C0FA 4L3ED 2YKLH 3WS3A 3MR9B 1UZ6F 4X7SH 2CUHA 3VXOB 4PRIA 3FO0L 1CXFA 3IAQA 2GW5A 1ETZA 2OTWA 2NY6D 1N5AA 5JNYA 2ZSWB 5I8KL 5ADOL 4Z7NE 2R0LL 4JO3L 3C60A 2APBA 4KY1L 2Q3ZA 4XPBL 5LGHH 5KANI 2NY5C 3QCTH 1LEGA 2H2PC 3EO9H 4GMTL 4PRAA 4GQPH 4TUJA 4F15C 4Y4KB 1H3VA 5GRVL 4CVXB 3TYGL 1EFXB 4XNUH 5C0EB 4ZPTB 5EU6A 2P8LA 4LLVA 5TDOA 1R3LA 2HFGL 1GRWA 2UYLA 3N1MC 3O3AA 1OAQL 5CSZA 4G8EA 5D2NB 2UV3A 3V7MA 5DK2A 5E2TL 3O6KL 3U30C 2QTEA 2GK2A 1DUZB 1HZHL 5D8JH 4ELMB 3PWUB 3X11B 1I75A 1LK2A 2CRZA 3MRNA 3TGXA 4OGXL 4UDTA 1V7ML 1V7NL 1NBYB 3X12A 1QLFA 4MYWB 4L8CB 4H5SA 4XVSL 5GRJH 2C1OA 4PRNA 5HGBA 1M1SA 5HHOE 5HVHC 3N50A 3DRQB 4Y88A 4BQCA 1YMME 3FO2B 3KYOA 5F9AC 2JK5A 3IXTB 3BO8B 2HFFB 4L4TB 1M71A 3IVKB 4Y19D 4LK4A 4UTAL 4JKMA 2PW1B 1IGMH 2LFGA 4OZHA 4PJIA 5DJ8B 3QQ4B 1NCUA 1Q1JL 4HW6A 2I9LA 4N0YL 1QSFA 1L9MA 5INCB 4NNPL 1FJ1A 1TJHL 3PL6A 2J3SA 4NQXA 5EPMB 5SV4A 5C09B 3IJSA 3U0PB 1VFUA 2AJ3B 1YEEL 5I9QC 4OLXL 3D1MC 3KPNA 5DVNA 1BX2B 4Q2ZB 3O11B 3PQYD 4DKAA 5BS0A 4GSDL 3DYOA 4BELD 4N8VG 2HT2C 5KVGH 4G3YL 3RIFK 4PJ7B 3OQ3B 4P46A 3HE7A 2NY3D 2VDPL 4GG6B 4OZGA 5IHUH 4M48L 1GHFL 2N4IA 5C6WH 2JJSA 2MWCA 3GSRB 1OSPL 2RAMA 1P53A 3IDMA 3UDWC 1S9XA 1S7SB 1KNOB 1ZE3C 3F5WB 3BSZL 4NNXB 2ESVA 2DI9A 1X4XA 4PRBA 3U0WL 3RJDA 1VESA 1XF5A 1PYWB 3VXNB 3UBXB 1GZPB 2H32B 3QEQB 3T1WA 3FQUA 2V9RA 4ZQKA 1T5XA 3BGFB 3KPQA 1EFXD 3HZKA 4TSAH 3MLWH 1YPZF 1WIUA 4HKZA 4X6DB 4NQCA 3CFJA 4N5ED 5AZEL 5DC0A 5E2WL 2ZCKL 3MNWB 3RWHA 4O51B 4L3CA 4G8GE 1Z5LA 4OZFH 4HFUL 1QKZL 4CBPA 1JZ7A 3EDKA 3ZDZE 4X0KB 1OP5K 3C5ZB 3OMZA 1KF9B 5DYOB 3GGWA 1KELH 5I2IB 1A6AA 3QIUD 1G6RB 4RNRA 5IESH 5FGBC 3L3OB 5TQ2L 1FFOB 4ZO6A 4P3WA 3HMXH 3CDFA 5BV7L 4LU5L 1QSVA 3NH7H 1NCDH 2ORBL 3UTPE 1D5MB 2YKLL 3Q5TA 1LGVA 4P3DA 4X7SL 2WANA 1GZQB 4NRYB 1YDPA 1A02N 4L4TD 1FZMB 5JMRA 4DEPB 4NT6A 3VXQB 2X05A 1SY6A 1RZIB 4TSBH 3HB3C 3LN5B 5JOFA 5LGHL 4LMQI 5K59E 1ZLVH 2V9QA 1RAMA 4ELMF 5EU7E 3EO9L 3MJGX 1B0GA 5L2KD 1FN4A 4XNUL 4QO1A 5HHMB 4J12A 4DN3H 1S7VB 1YEDA 3S9DB 4YNYB 3E6HA 3SDDA 3CSYB 5EU3B 3O4LD 1IC7H 5KANG 4U3CA 5C09D 1YN7A 3STZA 1FVCB 3DUSA 4ZOCA 3HE6D 3QH3B 3EOBA 4WRLA 5E5UB 4JZOA 1IC1A 4F33B 1ORSA 5DJDB 4Y5YA 4PLKD 4HK3J 3IFOB 2VE6B 2DN7A 2Z0BA 2ZUWA 2MOVA 1U2CA 4YEEA 3G9VA 1R3IH 1CQKA 1WC7A 4XNQB 5GRJL 4CMHB 4OT1H 5C0FB 1SQ2N 1QBMH 4L1DA 4PRPE 3EZ8A 3BQUA 3VWJC 4GUPB 1ETZB 2OTWB 1N5AB 5JNYB 12E8H 4XP6H 1FGNH 2ZUTA 3C60B 2ADIA 1UVQA 3NA4A 1OGAA 1IGML 2NY7H 3HNTH 1LEGB 4WW1B 3QEQD 3SE3C 2YD5A 4TUJB 2APTA 1UKSA 1M05A 5EU6B 2P8LB 2AK4D 5TDOB 3V0VA 1R3LB 4PJ7F 3TLRA 2UYLB 5F7KC 4YFDB 3K8LA 1S8DA 4J3UA 4GG6F 3DXAA 4JN2B 5C9JA 5DMKA 3CFIC 5CSZB 3F65A 4G8EB 5BCAA 5DK2B 4GBXC 4Q58C 4R6UA 3C5ZD 1LK2B 3SCMC 4CN4A 2DQFA 3MRNB 1LD9A 3TP4A 4UDTB 1N0LA 2LAAA 3GMPA 2D2OA 4K2UH 4PR5A 2GSIA 5KVGL 5H8DA 5JDSA 1QLFB 3X12B 2Y9RT 3U1SH 4H5SB 4KDTC 2ITCA 2C1OB 4PRNB 1KJMA 5IHUL 3TBWA 4X6DF 4FHBD 5HYJA 1L6ZA 2JK5B 4HLZG 1M71B 1WZ1H 5HHOD 4KJQC 1YMMD 3ULUH 2JB5H 1E4XH 4PJIB 1J0HA 4MA8L 1IAKB 1I8KA 3TYFB 2E6PA 4TSAL 1QSFB 3MLWL 5HHMD 2Z8WC 1FJ1B 2YR3A 3BPNC 3PL6B 4WIQA 2A9NH 2G5BA 4NQXB 3G6AA 2FD6H 2EDFA 2P24A 4OCRH 4JZJA 4P2RA 5HVWA 1X5XA 2MQCA 3IJSB 1Y6NR 4HSQA 5CZKA 1W8NA 1IM9A 4JDVB 5HGAA 1MHPH 4NP4H 4U0RB 3KPNB 4HXBH 1QUNA 5BS0B 5C0CA 2WQ8A 4PJFA 2HLAA 1KELL 1JWUA 3LKPA 3MRCA 4XPTH 1NANI 4GKOA 1IQWH 4JPIA 3WFBH 5IESL 1KSRA 3HMXL 4IOSD 3AC0A 4RGNE 4P46B 2DMKA 1A8JH 3HE7B 3NH7L 4M1CD 1NCDL 5D5ME 4OZGB 2HJLA 2XN9A 4JHZA 3IDMB 1S9XB 4KJPD 3HNVH 2WBJC 4QHLA 4NQEA 3QUXC 3C60D 4TSBL 2ESVB 4QXWA 4PRBB 4UDUA 1X5ZA 2W92A 1XF5B 3WNPA 4QYOA 1B9ZA 3OJDA 4X7TB 3FQUB 1KBGH 4ZQKB 1T5XB 3F7PC 3OJMB 3HZKB 3EJZD 3IU4H 5I1AA 1EK3A 4HKZB 4DN3L 1J9CT 4Q9CA 2XFXA 4K3EH 4NQCB 1EIBA 1HQRA 4CU6A 3CFJB 1SVCP 1QFPA 1JIBA 1BQSA 4GRWF 5SWZE 2F8VA 4NN6C 1IC7L 5IBLD 4HHAA 4L3CB 3LS4H 4A2MA 1G7JA 3HS0A 4RSVA 2K7PA 1IGYA 4P4KC 4K8RH 2B8OT 2CK0L 5LQBH 3GGWB 2E27H 1MCPH 4APQC 1A6AB 4KK5D 4RNRB 2GSGA 2BXYA 3O6FA 3LN4A 5C2BH 4JRWA 5DHXB 3TA3D 3AFLA 4HJJH 3V7AG 3V0WH 1R3IL 3KVQA 1V3MA 4OT1L 5CJ5A 5LGJA 2E8ZA 1QBML 1T4KA 5LBSH 1KXTB 4LCWE 4P3DB 1YDPB 3UTPD 5IEKB 2IG2H 12E8L 3BIKB 1NFKA 4XP6L 1P5VA 2EIBA 4NT6B 1FGNL 3GEWB 3MYJB 5JOFB 4JY6A 2NY7L 2XXCB 3HNTL 4CN6A 5HVFB 1IZKA 1S7RA 4GXUN 4A6YA 1B0GB 1FN4B 2IAMA 1XGTA 4ZO8A 6FABH 1CL7H 2RQ8A 2ZZUT 5TQ0H 3VXME 1YEDB 3WDIA 3E6HB 4PB9H 4YUEH 3ZE2E 1WV7T 4N0CC 3JV0A 1YN7B 3RX7A 3DUSB 2KDGA 3M8OH 2VC2H 1F4HA 2FEDD 3EOBB 4JZOB 2PNDA 5BS0D 4M6OH 1A21A 1X4YA 1ORSB 4Y5YB 2MJWA 5E4EB 3QIWC 4K2UL 1PGRB 4M7JH 3QAZB 1H3TA 3TH3T 1T7XA 4P46D 3U1SL 3QXWA 3O2DA 1WC7B 3GSOA 4F7CA 1UZ8A 3BQUB 1A6UH 1H15A 5EB9A 3WFDH 1WZ1L 3U79A 3ULUL 3AM8A 1KCRH 2JB5L 4J7RA 2ADIB 4X4YA 1UVQB 1E4XL 1VADA 4NHCH 4FXKA 1GJIA 1A4JA 4ZDHA 5DD1H 5D7SH 1ZANH 3RUGE 3RKDC 5EOCJ 4ZNEE 1AGEB 3ARRA 3LRHA 4AG4H 5C07A 1CDJA 1M05B 2FWOA 3V0AC 4RX4D 2A9NL 3O3UN 3V0VB 4DOHB 2J12B 4HMCA 2FD6L 1A7QH 4EZMA 1SEQH 4OCRL 3DXAB 5C9JB 1ZA6A 4GLRH 5DMKB 5I71B 2NX5E 1AXSA 3GBMH 5F6IB 1TNMA 2A6DA 4NP4L 1Z2KA 2D7NA 4HXBL 3JBG7 5J3HD 3EDDA 2HTLC 4XPTL 2P47B 3GMPB 4PR5B 1OT1A 2GSIB 1IQWL 2AJZA 2OXHA 3WFBL 5JDSB 1OD7A 1RHHA 2EDXA 2EXWD 5ETUA 1KJMB 4DFHA 4YFLI 1T1XA 2E9BA 1YC7A 3TBWB 5IHBA 1CIUA 3VXUB 5HYJB 4LHJB 3V8OA 4ODTH 5AAMA 2FO1A 2CDEA 3HNVL 1G0DA 5AUMA 2HP4A 4G6FB 4FQLH 3FRPG 4KMLB 1AHWA 1KBGL 5M94B 3IU4L 3QNXA 3ZKQD 4K3EL 1BZ9A 4M6NH 3C8DA 2G5BB 3G6AB 4HIIA 4ODUB 4P2RB 4JZJB 4WV1A 3LS4L 1IM9B 5HGAB 4F37K 5F1IA 1TCRA 2RIKA 4K8RL 4M43H 3RWJA 2PYFA 5LQBL 5C0CB 4PJFB 2HLAB 5F72S 3BISA 1A6WH 1JWUB 4XMKH 1EZVY 2E27L 1MCPL 3LKPB 3MRCB 4W4OC 4ODXA 2MKWA 5DJYA 1BFSA 5F44A 4JPIB 4XP1H 5SWSE 1BFVH 1H3XA 5C2BL 3SJVD 2WLZA 4HJJL 4X4XA 3V0WL 4KKCC 3KXFA 2HJLB 2MFNA 5LBSL 3FQNA 4WUUD 5KAQF 2XN9B 2IG2L 1Y18A 4QHLB 3QO0A 4NQEB 3U4EA 4JG0H 4POZD 3W82A 3BDXA 5EO9A 4QYOB 4E41E 4UBDC 1ZGLA 3R4DA 5I1AB 3EFFA 6FABL 1N3NA 2XFXB 1CL7L 1DJSA 1HQRB 4H1LA 5TQ0L 3TFKC 2DQTH 1KB9K 4PB9L 1NCCH 3HRZB 4L1HA 4YUEL 2WINA 3DXAD 4HHAB 3VFRA 1ZHNA 4HIJA 1UB5B 1G7JB 3M8OL 3HS0B 3MV8A 4RA0C 4CU7A 5HDQH 3NGBB 3GSQA 1IGYB 2VQ1A 5C6TH 1AY1H 4M6OL 3IDYB 1GCFA 4JPWH 1E6OH 3VGEA 1TXKA 1OTUD 2GSGB 4G6AC 4M7JL 3O6FB 3W5MA 4CL7A 1QRNA 3QHZH 5I75C 4GKZA 5T5NF 3L7EA 5I66A 5LGJB 2VWEE 5GJSH 1T4KB 1U3HD 1A6UL 4YXLH 3VXUD 1ZS8A 3WFDL 3NCYP 5SWQA 3SDXA 1QFHA 5EUOE 1EEQA 1KCRL 4ODVH 2CRMA 4NHCL 4JY6B 1UKQA 5GS0D 5DD1L 5D7SL 1NBVH 1NMCB 3K4AA 1ZANL 3ZYIA 4A6YB 4UMGA 5I8CB 2IAMB 2W07A 1XGTB 2OK0H 4AG4L 4MJID 2I27N 2B39A 1NBQA 1A7QL 1OAUH 3W11C 1SEQL 4ZUUA 1G1YA 4LSTH 1T66C 4WJ5A 1MCWW 1IM9D 3GBML 2NY5H 4FFWD 3KJ4C 1RULH 3SEPA 5JHDA 3LQZA 4Y2DC 4HWBH 4UILH 1H3UA 2YHGA 3VMPA 1KCKA 3CFBA 3FL7A 2VO5A 4F7PA 2X9XA 4KI5C 4NM4H 2R15A 5ICXA 2F8OA 3ARBB 3GSOB 4F7CB 3HA0A 3GSXA 4M4PA 1UZ8B 4OGAD 3BP4A 1H15B 1EHNA 4TNVF 5F1NA 2XN9D 1HNGA 3SQOH 2QJDA 1M4KA 4ODTL 5F7WC 1FC1A 5JW4N 4LSSH 3IB4A 4QXUH 2R29H 4X4YB 4FQLL 1VADB 3ZKXC 4FXKB 3ZE2F 1A4JB 4APQA 3TZVA 4FQ2H 4ZDHB 3ZDXF 4P5TA 4P4RA 1BEYH 3UTTA 1TDQA 2BRQA 4U33A 5C07B 5IIEA 5CKGA 2FWOB 3MV9E 2OBGA 4M6NL 5IW1A 4XCCH 1FRGH 3N1GC 1F4AA 4Z9KB 1MPAH 1ZA6B 4P2OA 1AXSB 1ULVA 2A6DB 4NN7C 4ZO9A 2NX5D 4M43L 5AG8A 3PG2A 4X7FC 3BKCH 1A6WL 4XMKL 3D87B 2PR4H 5KSVA 2AJVH 1MCFA 2AJZB 4XP1L 1BFVL 4GAGH 4R8WH 2OSLA 2OL3H 5ETUB 4YGAB 1DEDA 4NJ9H 1QP1A 4HLZH 4L5FH 3UAJC 1JN6A 4YC2B 4OZIA 2CDEB 1RD6A 5B38G 4Y16A 4JG0L 2CH8A 5DEGB 3HPJB 4AEHH 1MUJA 1AHWB 2A6IA 1S3KH 4PJXE 1GYAA 1ITCA 2IAMD 1E0OB 1UENA 1WWBX 5DTFB 5D6DC 1I1AC 3C2SA 2DQTL 1NCCL 4HIIB 3DTXA 4WV1B 4J3XA 1HIMH 4LVEA 5HDQL 5F1IB 1TCRB 3UO1H 5LCVH 4LCCC 5C6TL 1AY1L 2HLFD 3RWJB 2PYFB 4OD1H 3RRQA 4BFIA 4X9HA 1MCWM 3VI4F 3K1DA 4JPWL 1X5HA 1E6OL 3MV11 3DOSA 4ODXB 5DJYB 1CG9A 2F19H 4CDHA 1QEWA 2HFEA 3ARBD 3QHZL 4X4XB 2VDLH 2RB8A 4AMKL 5GGVH 3AS2A 5GJSL 3FQNB 4YXLL 4L4VE 2R39A 5E03A 3FJTA 1Y18B 3QO0B 4L8SC 4ODVL 3U4EB 1JCKA 5BRZE 4JREB 5EO9B 4Q6YA 4CW1A 5DQ9A 1NBVL 1ZGLB 1QNZH 2BX5A 1QA9A 3MLYH 1LP9B 4E41D 2OK0L 3EFFB 1PKOA 1N3NB 4ZODA 4H1LB 4YR6A 3JTSA 1OAUL 4AK1A 3UPAA 1PVHA 2WINB 2NMSA 4LSTL 5KVFH 1IAIM 1ZHNB 3VFRB 3B5TA 3U4AA 3MV8B 1XIWA 2NY5L 1NFIA 3GSQB 1RULL 3MRPA 1LWRA 2VQ1B 3N06B 1B0WA 4HWBL 1P7HL 4UILL 4I9WE 3VFNA 4G9DA 4KPHH 2LU4A 2WAHA 3CNKA 5FHBH 5E8PA 2HJFA 3QNZA 4NM4L 2D4FA 4J2XA 1QRNB 4GKZB 3L7EB 2G60H 3DIFA 5I66B 5T1LD 4D9RE 5CSGA 1ZS8B 3SQOL 5IB3A 5JMOC 5SWQB 3SDXB 4JM2C 4LSSL 4QOKA 4QXUL 4YBQC 2R29L 2D9CA 4W4OA 4FQ2L 1FFQA 2O5XH 1Z0NA 2VTFA 4JFPA 1G84A 5DK3A 1U8JA 1BEYL 1CTNA 4Q97A 4WI2A 1TQBC 3IFNH 3X3GL 4HF5H 4XCCL 1FRGL 1BQLH 4ZUUB 3BP6A 4JO1H 4KTDH 3MLZH 1MPAL 2HAZA 4MXVF 1DBMH 4I0PA 2J1KA 1EERB 4ENEC 2A6JA 3MJ9H 2AJXH 1NAKH 1P4IH 5JHDB 3LQZB 3B9KA 3L3IA 4RAVA 3BKCL 5I73C 2PR4L 1EFQA 2AJVL 3CFBB 3DX7A 4F7PB 5ICXB 4GAGL 4U6TA 4R8WL 5CJBA 1AKJA 4PG9A 4K7PX 5K93A 1CXLA 2OL3L 2YEZA 3RVTD 3GSXB 4WTZA 5DXWA 4MNHB 3NIFE 4NJ9L 3BP4B 4NBZB 4L5FL 3V6ZA 5F1NB 1SEBA 1FFPB 5HYQA 3H9YA 4IRSD 5DZLA 4EDWH 3TZVB 4AEHL 1ADQA 1I1YA 5F9WC 1P4LA 3HUJE 4P5TB 3CX2A 1S3KL 3P9WB 4P4RB 3UTTB 2CGRH 3OG6B 1NUGA 3C5JA 1JZ5A 5IIEB 2V5TA 4GXUM 3EHBC 1B4JH 5IW1B 2J5LB 5D2NE 2Y07H 4TULH 2UUDH 4F2MA 1HIML 1EBAA 3MV8D 4P2OB 5A3ID 3D39D 1C5CH 1AR2A 3RL1A 3NCFB 5HI5D 3UO1L 3QPQD 4IOFC 5LCVL 4QRRD 4OD1L 2NY2C 1TZIA 7FABH 2EIZA 1HNFA 1U91A 4PJ8C 4S2SA 4P23C 5KSVB 2F19L 1FG9C 4FQJH 1PZ5B 4MCZA 4NKIH 3I6KA 5IVXA 1QRND 2FECI 2OSLB 2COQA 2VDLL 3GSNA 2IGFH 1TPXB 1LP9F 5GGVL 4P49A 1LO3H 1JN6B 1NANH 1GGUA 5KS9F 4U2YA 3W2DH 3CLFH 4Y16B 3BPCA 4CADA 2R1XB 4OQTH 4HH9A 5DMIH 1MUJB 2ED8A 3RTQC 5J57B 2OTUA 2A6IB 1KB9J 1QNZL 1G9NC 1U2HA 3MLYL 5E9DE 1ITBB 1RJZA 3WMSA 3U7AA 1WK0A 2WQRA 5DVKA 4XI5C 3MJ7B 4QNPF 2N56A 3DTXB 5KVFL 3FCTA 3RZCD 1A1MA 2PW2A 3CVHH 2P5WA 4E5XA 2W9DH 3LKNA 1HQ4A 1U8OA 4QWWC 3SDXF 2VN4A 4BFIB 3PJSA 2Q20A 4JHBA 4KPHL 4U6VH 1C12A 1CG9B 1RZ7L 1QEWB 2BVQA 2HFEB 3T1FA 4DW2H 3S97C 5DFVC 2G60L 5C3LD 3RL2A 1CYGA 1QTYT 4JFHD 4X4ME 4POUB 2VL5A 2AEPH 2C3HA 3H9SA 3I3BA 2NY0C 2WWMC 4FP8H 1VFBA 3TZVD 3UZVB 4CW1B 2O5XL 5DQ9B 4P5TD 1P7QA 3T0XA 5BRZD 4YDIH 1QA9B 1UWEH 4EN3C 5IKCA 2IANE 5E08H 5D96C 4X6BA 3IFNL 2LABA 4LHUG 4NCC1 5TDPA 5TPWH 1UM5H 4HF5L 4YR6B 3JTSB 1BQLL 3K74B 3KLSA 4JEGB 4JO1L 4KTDL 3MLZL 3ZHDA 3BJ91 1DBML 1XIWB 4HT1H 1NFIB 2AJXL 1NAKL 4MLIA 4RWHA 1P4IL 1HHIA 3MRPB 1C1EH 5JZ7C 4FMFA 1ES0A 2HH0H 3VFNB 3T0DA 4R7NB 2F5BH 5E8PB 3FRUA 4O02L 4LGRB 5KVEH 2HJFB 3QNZB 3G08A 5J6GA 3FQXA 1NLDL 4H0IA 5D1QA 3INUH 3DIFB 2YPLA 3BGAA 3OSKA 3ECBA 4U3HA 4FNLH 4GW5A 3B2UC 1RPQA 2FATH 2ADFH 3IDNA 5IB3B 3ULUE 4PJ9A 3WDHA 4H0GA 1KPUA 4NDMA 5FDYA 4P2YA 4QOKB 4NC1E 5JORA 4PJBE 3FQTA 4EDWL 1S5HA 3WKNA 4JFPB 1WQVT 4Y4HA 1U8JB 3DSNA 4WGWB 1OP5H 5D1ZB 2BSRA 5HI3D 1MSPA 3CFDA 1I8MA 4KV5F 1B4JL 2VAAB 5FA4A 2Y07L 4ZXBD 4TULL 3BP6B 5I6XC 3S88H 4I0PB 2AERT 5GS1A 3V4PH 4HUNB 1S78D 2A6JB 1DQQA 1QFWI 1C5CL 1FLTX 3B9KB 3ROLA 2L7UA 3ROOA 3L3GA 3L3IB 4RAVB 3SKMA 1VFMA 5IGXH 1F3DH 7FABL 3PF2A 4RMUA 3TT3H 3DX7B 4NQDE 4R3SA 4FQJL 2GQHA 4LSRH 1AKJB 4PG9B 4PRIE 2IGFL 2YEZB 3WIFB 1R3JA 5FCSH 3CLEH 2UZIH 4OM1H 4DKFH 1LO3L 3V6ZB 1SEBB 4JQVC 1N4XH 2V5RA 3SDYH 1KN2H 4KKNA 4HK3N 3W2DL 4S1DD 4KKLD 1HEZB 3CLFL 3FOMA 5H35B 1WICA 5ICZA 1FZOA 4OQTL 5DMIL 1I1YB 4M5ZH 1P4LB 5EU6E 5TF0A 1NGWA 5A2FA 1AR1D 1DQMH 1S7XA 4UIMA 1SBBA 4PGJA 4PBWD 3L95A 2O61A 3BP5A 1SJHA 5MP6H 5C0JA 4MAYA 2R1YA 4F2MB 1WWWX 3CVHL 3VJ6A 4CDGC 3RL1B 2W9DL 3D2UB 4BQBA 1KCLA 1TZIB 1XR8A 4PJCB 5J7CC 1U91B 1RSFA 5FYLH 4S2SB 4WTWA 4U6VL 4Z7WE 5CJQL 4MCZB 3I6KB 2P45B 5IVXB 1FYTE 4DW2L 3GNMH 3GSNB 3KPMA 1BFOB 1OL0A 5BO1H 3HUJF 4KQ3L 4GAYA 3RVWD 3SO3B 1WAAA 1MLCA 4PJEA 3SDCB 4C57C 4OZHE 4PJIE 4DUVA 2AEPL 4KRPB 3RVUC 1XF1A 1U8HA 3BPCB 4GMSL 4FP8L 3E8UH 1U3YA 5JW4M 4Y1AE 5C0ND 3ZL4H 4HH9B 4HWZA 2IPUG 3ES6A 2OTUB 2EKJA 4YDIL 1ZVHA 1UWEL 3IGAA 5D1ZD 1RJZB 3C6SB 4IMKA 4K7PH 1PY9A 2EIEA 1KJ3H 3F58H 5TPWL 5E9DD 1UM5L 3TIDA 3JV6A 3O9WD 4KK8D 5MERA 4OUUA 4JRYE 5CWSA 1WISA 4RGOH 3BRGC 1A1MB 4QRQA 4HT1L 2PW2B 2P5WB 4E5XB 2JLLA 2MPAH 4XTRD 1HQ4B 1U8OB 1C1EL 3PJSB 2HH0L 2F5BL 2BC4A 1C12B 4OZGE 3W0WA 5KVEL 4MQXC 3TO4C 2BVQB 3T1FB 3MUY1 1LO2H 3INUL 2J4WH 3RL2B 2EYRA 3D0VA 4FNLL 2FATL 2ADFL 2VL5B 3ARFC 5A2JH 5TE6L 3H9SB 3QXVA 5C0BE 1D9KD 2OXGA 1J1PH 1OPGH 4WFHE 5JR1H 5B3JE 3OAUH 5D71H 1VFBB 2NXZD 4PJ8A 2R8SH 4H26A 3RVVD 3VG0H 3MRGA 1P7QB 5IKCB 4UV4H 1KCVH 4X6BB 5TDPB 1QSEB 2CO6B 1JPTH 1EA9C 3T77A 1KT2A 3GMLA 3S88L 1OM3H 3TEUA 3V4PL 4OSUL 4GKSA 3ILQD 4X7CC 4HXAH 4KDVA 3VFVA 3D2UD 4RRPA 3OAZK 3QCVH 5IGXL 2A2QT 3CH8A 4LLMA 1XF2A 1NAMH 3TT3L 3FRUB 2IFGA 3R0NA 5DJ2B 5J6GB 3FQXB 4LSRL 1UXWA 1DANT 1I3UA 2YPLB 1LMKA 2GKIA 3ECBB 2NYYD 3BH8A 3CLEL 4DKDC 2UZIL 3BN3B 4GW5B 4OM1L 4C56E 4EXPX 4DKFL 4L9LC 3ARGC 3IDNB 3SDCD 4PJ9B 1KPUB 3KPSB 3KNBB 4NDMB 3SDYL 1KN2L 2YZ8A 1S7WB 5DJCA 3QIBA 3L9RB 1LNUA 5KSAA 2SEBB 3ULUD 1U8MA 1U92A 4R4FH 4XCEA 3FQTB 1LDSA 4KK6D 2BNRE 1S5HB 3LPFA 4M5ZL 3VD4A 3FQWA 4M1GH 4PJCF 1E28A 4Y4HB 3SKUD 1DQML 2Q8BH 4EI5B 3QZWG 1OP9A 3CFDB 4LARH 4PGCB 2B1HH 5FA4B 5E7BA 3BVNA 5MP6L 5FEBA 3SGJC 2VLRA 4XWOD 2EDNA 5GS1B 5D1XA 2P5WD 1O5DT 1DQQB 1FGVH 3FB6A 4FG6D 3ROLB 3ROOB 3L3GB 3SKMB 2CKNA 3CZFA 4YIQA 5FYLL 2WLYA 5J8OA 4R3SB 5AYQA 2P1YA 4JR9H 2H3NA 3GNML 1DQTA 3F8UB 3MRQA 5BO1L 3LY6A 1R3JB 5CCKH 3BZFA 2NLJA 5DO2D 1RUMH 3OAYK 1OGAE 2A0LD 2WNGA 1DUYA 3I50H 4QXTA 3R06A 3FOMB 3RGVC 3E8UL 5H94A 3B5HA 5ICZB 1FZOB 3ZL4L 3U6RA 1FL6A 1YEIH 1W72A 4WFGD 1NGWB 2JE8A 4JFDE 5AWNH 4I3GA 1S7XB 1D5BA 2V2XA 4K7PL 4UIMB 1KJ3L 3F58L 3HC4H 3L95B 4K3JH 1QSED 3BP5B 4UT6H 1AGCA 5C0JB 1HH9A 4MAYB 2BSSA 1XCQA 2EE6A 2VRAA 3K0WA 4RGOL 2R1YB 3T04D 1MAJA 3H2WA 3VJ6B 3TN0C 2DMBA 3OGOE 1BD2B 2MPAL 4JFZH 2DLFH 3CZJA 4K8RD 1XR8B 4HIEB 4XXCC 4ZFGH 5C9KA 3QEUA 1SYSA 3WN5C 2HWZH 2GT9A 5HYJE 3SGEI 2Y4SA 1LO2L 2J4WL 3LEXA 3H9HA 1I8IA 1FYTD 4GAYB 2C5DC 2QADB 2C3GA 2K1MA 1I1RA 1MLCB 2EDRA 4PJEB 4PJ9D 3RFZC 4WWKA 3KPSD 2VKWA 1J1PL 1OPGL 1U8HB 5JR1L 3OAUL 5D71L 4LPVA 3B6SB 4HWZB 2R8SL 3VG0L 3ES6B 4NO0D 1CLYH 4Y1AD 1JMXA 3IGAB 4UV4L 4EI5D 5DFTA 1N6QH 3VE0A 1KCVL 3AUVA 1T2QH 1ZA3A 3QXDA 5D4QA 3TIDB 3JV6B 1JPTL 1NC4A 1KJ2H 4JQVA 5MERB 4OUUB 5CWSB 5CP3A 2DLTA 1OM3L 1PLGL 4QRQB 2ZCLH 3P4NA 3HZMB 4PJFE 1Y0LA 4MB3A 3MNZA 4HXAL 4KK9C 1RHFA 3QCVL 3D9AH 4NKOA 1X5LA 5HHPA 1NAML 4PLOB 1IVLA 1IGTA 4M7LT 5DMGD 1JHKL 3B9DA 2BVYA 4JFFE 2OCFD 3VRJA 1I8LA 4NQEE 1B4RA 5CP7A 1ZXQA 3WHE0 3EYSH 1ZV5A 5EIQA 4IHOB 1U8PA 1T83C 2HG5A 1FV1A 5GGQH 1QG3A 4R4FL 1DVFD 5C0BD 4H26B 4RGNC 3MRGB 4Q6IC 4M1GL 2ZKHH 4WFHD 5JXED 2JJTC 2W9LA 2X5PA 3X3FH 2Q8BL 4LARL 2JCCB 3VRLF 3RAJH 3VFPA 5DQDH 2B1HL 3T77B 3JUYA 5E1AA 1KT2B 3RI5K 3GMLB 1NQBA 1XH3A 5JO5A 5DVMA 4GKSB 4M8QB 1FGVL 5DMJB 3TBYA 1BD2D 3VFVB 1J10A 5C92A 3NOIA 3C09C 5KW9H 4NYLA 4LLMB 1XF2B 1FDLH 3KPOA 4JR9L 4M9PA 1PZUB 1UXWB 5FM8A 4Y7MA 5CCKL 3EDEA 3O8XA 3OKDA 3BH8B 4OFYD 1MH5A 1RUML 2QADD 1X5KA 2Z31C 4RBPH 4YDLB 3T2QA 3P4LA 5HI4C 2E5EA 3UPRA 4NQUA 4NQTA 1FL5A 4C56D 5DJCB 5T33H 3I50L 3GKWH 3QIBB 1LNUB 5KSAB 1CK0H 1CFSA 1U8MB 1VDGA 1U92B 4XCEB 1BJ8A 1DN2A 3QUYD 2EIDA 1YY8A 1A6VH 1A64A 1YEIL 2GTWA 4NKDA 1YNLH 1E28B 4PFEA 1XMWA 2BNRD 5AWNL 1BGXH 3P9MA 3HC4L 4K3JL 4LRIA 4TN9A 1YC8A 3BVNB 3OGCB 4UT6L 3ARFA 2ICEA 2VLRB 3TVMD 2XZCH 1OARH 5D1XB 4KKAD 4V2CB 5GGSY 3FB6B 3MJ9A 4PJEF 1KLUA 5DJ6A 1F13A 4JFZL 4OD3H 2DLFL 1F11A 1MCIA 5E6IB 5IROA 4WI8A 4YIQB 2GFBA 4ZFGL 4HZLA 2XA8H 4LVOC 2HWZL 4GS7B 2H3NB 3MRQB 3BZFB 2NLJB 4HJ0C 2EDJA 3WL9A 4OIAA 1J0ZA 2Q7YA 4DQOH 3DX9A 1DUYB 2VXSH 4QXTB 3R06B 1V3JA 1ZHKA 4ONOA 4MB5A 1DE4A 1PQZB 3U6RB 1FL6B 1W72B 1CLYL 4POYA 3MGOA 4WHTA 1N6QL 1D5BB 1RMFL 3Q5OA 4IJ3B 4LSDA 1T2QL 4JFDD 3IDGA 1M7DA 2R23A 1KJ2L 5CMAA 3ARDC 1AGCB 1HH9B 4MD5A 2BSSB 5HSFA 5JQHC 5GGTA 2ZCLL 1IAOA 3BZ4A 1H5BA 5IW3A 1G7LA 2UY7A 3TBSA 2V5SA 3QQ9C 1G9NH 3D9AL 4EUPG 3FFCE 4F9PA 3B8YA 3VFUB 3V7AE 4ODWA 2OTPA 3TJHD 3QEUB 1SYSB 2BHYA 3QI9C 2GT9B 1YUHB 2XZQH 4U1NA 3LEXB 3H9HB 1I8IB 4G9FA 5GPRA 5FOJA 5F7DA 2JCCF 5T1KD 3NACH 2DQIH 4WO4C 1MCNA 4WWKB 1JYVA 4UT9H 1RY7B 3PWNA 3EYSL 1RIUH 1NDMB 1A6ZA 2PXYC 3JV4A 1IAMA 5GGQL 1H0DA 2F54E 4PRHA 2GJ6A 3OKOA 4EOWH 2ZKHL 2R9HC 4XVUD 1QPPA 4LPXA 3X3FL 2OI9C 4LEOA 4IRJA 1FP5A 3VE0B 4DGIH 3RAJL 1ZA3B 5I1KL 5DQDL 1NC4B 4HAGA 5INDA 3QUZA 3NVQA 3ZDYE 1MCDA 3P4NB 3E0GA 3GDBA 3MNZB 2H2PD 3FO9A 3WHXA 5LGKA 5MEQA 1PD6A 1AO7A 1VACA 5E6ID 3S35X 4EXKA 4F9LC 5KW9L 4NKOB 3MV7A 2EEBA 3MFFA 5HHPB 4UB0H 1FYHB 4NJAH 1CD9B 1IGTB 1YQ2A 1FDLL 1ZAGA 3F62A 5DZOA 1L0YA 3KXFE 3MOBH 4TTDD 2Z8RA 1NH6A 4LCIH 2XI9A 2YSSA 4YDJA 1KG0A 4PJHA 5GHWH 3VRJB 32C2A 5T1DH 5CP7B 3V5HA 2XTJB 1U0QA 2AJSH 5IUSA 4I48A 5T33L 3GKWL 2EEAA 5CAYB 1CK0L 1U8PB 3W81A 2HG5B 2X10A 3RNQA 3IFPA 4HWEH 2UZYB 1YEFH 5GRUH 5I1LA 2Q6WA 3WKMH 1YNLL 5KG9A 4XNYH 1BGXL 2ENYA 2X09A 2E7LA 3RY4A 4KVNH 2GY7B 5CIPH 3VFPB 1NPUA 3DVNA 5E1AB 1XH3B 4WFFE 5I76A 2XZCL 4XWGH 5JO5B 1OARL 2BK8A 2K9UA 1IKNA 4W68A 3TBYB 1QPXA 4Y8AA 2NY1C 1Z9LA 4OD3L 3DX6A 4NYLB 1QR1B 4YZFF 5E0QA 5IQ9A 1MFDH 4R2GC 4LOUC 5E99H 5K9KA 2XA8L 1MJUH 4HC1H 3MBXH 1QFWH 3KPOB 3NCYS 3GSUA 5DGRA 4BFBD 5FKPA 5DC9B 4MHHG 3Q6GH 4NFCA 3O8XB 3OKDB 1MH5B 4EQ3A 3V4UH 4WWKD 4DQOL 3UPRB 1FL5B 1BF2A 4AM0A 2VXSL 3BKYH 2FECL 2APXA 4U1GC 1CFSB 1YNTA 1OAKH 2CR3A 2HT2D 3FQRA 4CN1A 4Y4FA 3WJJC 1YY8B 3FN0H 3P4OA 2WIMA 4V2BA 2GTWB 2FL5A 4NKDB 2HT4D 4MA1B 2BY2A 2FZ3A 3P9MB 3DRTA 4HUVA 3HTLX 5ALBH 3MUHL 3MRHA 5MEOA 3DYPA 4HUXA 3PE9A 1J8HB 2ICEB 2MHAA 1IT9H 4O00A 3GM0A 5HHVH 2UVEA 8FABA 4F7TB 1KLUB 5DJ6B 4HS6A 5CJXC 3P77A 1G9NL 1F11B 3EJYC 1UJTA 1ZLUK 2HYMA 4FXGA 3PGFH 3RY6C 2GFBB 1QOKA 4HZLB 2LU3A 4YHIA 4MB4A 1IFHH 2CDGA 1CTOA 3PWJA 1NFDA 1ZGLM 3ZE1E 3T08A 2XZQL 2VAJA 2QHRH 1T1WA 4IBLT 4XVTH 5J13B 5B22A 2BNQA 3WL9B 1U36A 3NACL 2DQIL 2CDFA 1R5VA 4UT9L 3DX9B 1DBKH 2MSPA 1RIUL 2YUWA 3J7HA 3FHQA 1CI5A 1ZHKB 3QDGE 4QGYA 3TIEA 4FZEH 1FAKT 3T4AA 4M93C 1DE4B 5ESVA 4EOWL 3U9PH 1KTLA 4XRCA 3NN8A 3MGOB 2UWEF 4WHTB 4JO2H 5HYEA 4DGIL 5E24E 3T2PA 4JHWH 2J8HA 1Q0YH 4FFYH 5HD8C 4GO6B 3IDGB 2R23B 5CD3A 4OLYH 5CMAB 4OF6A 4RQQA 2A1WH 2OLDA 2ICWI 3MLTA 1J12A 1FNGA 3HB3D 4XNMA 4MVBC 1IAOB 3BZ4B 1H5BB 2X9YA 1G7LB 1F2QA 3DMMC 3TBSB 4Z7VA 4XC1H 3AREC 4IOIA 4D94A 1TQCB 1K8IA 4UB0L 1MREH 2Q86A 4NJAL 4P9MH 2VDNH 4ODWB 1TLKA 3MOBL 3CGTA 1INQA 4LCIL 1JI2A 5ANMA 1KGCE 3VFSA 4J4PA 4U1NB 4G9FB 5GHWL 4OZIE 5F7DB 4MZ2A 2FGZA 2HVJA 5T1DL 5K9QI 2YMXH 3EYOA 5FYJU 1KTKE 5GZOC 4X9IA 2AJSL 3PWNB 4IS6A 3ARZA 1F3RB 1BLNA 1A6ZB 2YPKA 3JV4B 1H0DB 4PRHB 4UINH 5E94A 5D7LE 2GJ6B 5EUKA 3OKOB 4HWEL 1YEFL 5GRUL 2D03H 2F54D 3WKML 3S3JA 4K07A 5D7IE 1P7KA 1F6LL 3HZYA 1JF6A 4IRJB 4XNYL 4TQEH 3WNKA 3VWJD 3ZE0E 4KVNL 4FABH 5INDB 1J8HD 1T7ZA 3QUZB 1U8NA 4XWGL 1BQHG 2PETA 3QXUA 3CD4A 1RQ5A 1PX4A 4HDIA 3FO9B 3WHXB 1MAKA 3SE4C 4OI7A 4NQVB 5MEQB 1AO7B 1VACB 3MV7B 1MFDL 3MFFB 1SJXA 3CFCH 5E99L 1CQYA 3DECA 1MJUL 4HC1L 3BPOC 3MBXL 5IB5A 1QFWL 4FFVD 4ODHH 4PY8J 2YSSB 4YDJB 1KG0B 3Q6GL 2EDKA 4M03A 3V79C 4JGMA 4PJHB 4DFIA 2P49B 4XCFH 3EKCA 1HWHB 5D7KE 3V4UL 4JO4H 4GBXD 4U1SB 4I48B 5IM7A 1GAFH 5FB8A 3BKYL 4AEIH 2XZAH 3ULVF 1CGWA 1OAKL 5IB2A 1N26A 4P5MA 4PJGA 3IFPB 1H8OA 2R4RH 4LCYB 3FN0L 4LLWA 4PJDE 5I1LB 2Q6WB 3H3PH 2NY6C 1AGDA 5AG9A 1I7RB 5AZ2H 5KG9B 5IMOB 4LRNH 4HWUA 4CJ0A 3DSFH 5ALBL 1P9MC 3QEHA 5IMKA 1HWGB 3VH8G 4MZ3A 4N1CA 2Y7QA 4KJQD 4HUKB 3DVNB 5I76B 1DR9A 1IT9L 4XNZB 4AT6A 5HHVL 1T22A 4WFFD 4G6KH 2IQAA 2V7HA 2HN7A 1S9KC 4X4ZA 3DX6B 4OLWH 1LO5A 3LDBC 5IQ9B 2XZZA 1J11A 3PGFL 1YEJH 4S10A 5K9KB 1EEYA 5HYSG 3CMOH 2DL2A 5GQBA 4MXWH 4FMKA 1IFHL 1AFVH 2N7BA 1EEZA 3GSUB 1X44A 5I0DA 3QWRD 2QHRL 4XVTL 3CMGA 3RGHA 5D6CA 1Q9KA 3KYKH 1CDGA 3BWUC 1DBKL 4AM0B 4F9LA 3S35H 1YNTB 3SHSA 3D85A 4FZEL 1TTFA 3FQRB 4Y4FB 3P4OB 3U9PL 3GRWA 4GFTB 4JO2L 4RA3A 1BOGA 2FZ3B 4JHWL 3DRTB 1Q0YL 4FFYL 4HUVB 4J3WA 1R0AH 4WW2A 3S3PA 3MRHB 3AAZB 4HUXB 4OLYL 5MEOB 2WBJD 2A1WL 3QUXD 3H6JA 8FABB 2QSTA 4HS6B 1O7SA 3P77B 1A7RH 4XC1L 1MI5E 4FXGB 1XGRA 1V3LA 5DQJA 1MREL 4YHIB 4P9ML 2VDNL 5GISH 2CDGB 3PWJB 1LDPH 2FHBA 3QDMA 4JVPA 2E7HA 2VLKE 5ID1A 2PN5A 1T1WB 4ZFOL 1G9MC 3KJ6H 2BNQB 4CVUA 4WTXA 5IBUG 2GUOA 2YMXL 2CDFB 4HKXB 4P4KD 1R5VB 4F8TA 4GRLC 4JFEE 1OP3H 2E9IA 3SGEH 4F58H 2NY3C 3T0BA 4UINL 3TIEB 2HT3D 3T4AB 3EBAA 3RWIA 3PWLA 4YBLB 2D03L 1JFQH 3QDGD 1KTLB 3WHE1 5FGCE 3IAGC 4XRCB 3SKJH 5C3TA 5K9QG 3NN8B 4NO3A 3H7LA 4NBYB 4TQEL 4RMRA 1HE7A 3EYQC 4PLJD 4FABL 5CD3B 3C6LA 4XPHH 4PJAE 3FB8A 2ZOLA 3MLTB 4KJWD 4PJHF 1FNGB 1NC2A 4Y4KC 4PGBA 4XNMB 4GQ9H 1CDCA 3CU7A 3S4SG 3FT2A 1J1XH 4NOFA 4AQ1B 4EUPH 4N5EC 4UNVA 4Z7VB 4IOIB 4UQ3A 5IMLA 1P6AB 5IVXE 1K8IB 1RVFH 2BP3A 4M7LH 2B20A 2DLIA 3HG1E 5D2NC 1FPTH 2ADJA 4U7MA 4ODHL 3QRFM 2MCG1 1INQB 3N85H 5GSVA 2DAVA 5ANMB 3VFSB 2YA1A 3BYYA 1BOYA 1GH7A 2X7LA 3ZYJA 2HVJB 4KC3B 1RK0A 4XCFL 1KGCD 4JO4L 3EYOB 1X5YA 4RGMB 5C86A 4LASH 5CJXA 1BECA 4IS6B 2IMMA 1GAFL 1BLNB 4AEIL 5I30H 2XZAL 5DSCA 4KI5E 2YPKB 5FOBA 4E42A 1MFCH 3RDTA 3RY6A 2H41A 3E3QC 5E94B 5EOQH 5EUKB 2R4RL 1LK3H 3BWAA 4V1DA 5CLTA 1WJ3A 4BK4A 3H3PL 1M7IA 5AZ2L 3HZYB 4LRNL 3L3DA 1KJVA 4U7KA 2AEQH 3DSFL 5I1DA 4X6CA 3HI5H 3MZGB 3VXPA 4MNQE 2ZNWA 3ARYA 2J8UE 1U8NB 4E0RA 3QUMH 3C8HA 3UXFA 1IEAA 4PREB 4MSWA 4GH7B 1BJ1J 4G6KL 4HDIB 3KS0H 4NZJA 3VD5A 4OLWL 3BD4A 3RKDD 2YUZA 1YEJL 2EXYC 3CMOL 3BW9B 3BIAX 4MXWL 2P43B 4MX7A 1AFVL 4JRXB 5JPMA 1CDBA 3QQNA 4U1MA 5C0AA 3H7BA 1P4BH 3BDBA 5J6HA 2YRZA 4I2XE 5C71A 5A2IH 3LD8C 1F90H 5GZND 1JNLH 2DL9A 2I25N 3KYKL 2P7TA 3K2MC 3L3JA 5IM7B 5FB8B 4Z7QF 3BD5A 3AMKA 3B9VA 3S35L 1OW0A 3NABH 5JOPE 1UGNA 2IBZY 2DTMH 2BHZA 3K2UH 1F4XH 2D0HA 1MVUA 4LLWB 3UYPA 1W0YT 2DM4A 3RWDA 5KVMC 1JTOA 5ELIA 1E4WH 2PYEA 5IMKB 3RBGA 3ELAT 3QEHB 1R0AL 3OHXB 2Y7QB 1ZVSA 3MZTA 3BGFC 5DUPH 2XQYK 4AT6B 1MVFA 2XY1A 3UBXI 1BBDH 1T22B 2FBJH 2V7HB 1MCCA 2HN7B 1A7RL 3SY0A 3V6OA 1LO5B 3QP3A 2XWBA 3L5XH 3KLHC 3MACH 4KI1A 5E2JA 1GPOH 3S6CA 3MCKB 1EEYB 5FYLD 1IKFH 1T04A 5GISL 3EUUA 1EEZB 3HI1A 1LDPL 3C5ZC 4IIQA 2GAZA 2X4TA 1UQSA 1CFBA 4HBQA 3KJ6L 5D6CB 1RIVH 1B2WH 1CS6A 2D31B 1Q9KB 3L6FA 1MELA 4WENB 5E00B 4QF1A 4F58L 4AENA 2ZJSH 3D85B 4Z7VF 1JFQL 3SKJL 4QTIH 4KKCD 4OV6F 4EBQH 1KACB 4HJGA 1XGQA 5EZJA 5D2LA 1KLGA 4WW2B 3CC5A 4NIKB 4XPHL 4W70A 5E4IA 1ZVYA 4GQ9L 1R5IA 2CO7B 3STBA 1J1XL 4L3EA 3REWA 1FO0H 4UBDD 1JWSA 5A43C 4HG4K 1IC5H 1XGRB 5ITFB 1RVFL 4TVPH 1GVIA 5DQJB 5F7FA 4M7LL 1MI5D 1L7TH 3LB6D 3TFKD 1XGPA 4JRXD 1FPTL 3N85L 1ZT4A 3QDMB 2UVFA 2G2RA 4X5WA 5ID1B 5CD5C 3PNWA 3VDCA 4PY7B 2VLKD 2GUOB 3DI3B 3GIVA 4LASL 1KOAA 4NWTH 1IE5A 5I30L 4CMHC 3RX5A 2R2HA 5EZOH 4M1CC 1MFCL 2OM5A 1HILB 5EOQL 4G6AD 3RWIB 1LK3L 5EO1A 2CLZA 4NO3B 1FVEA 4F3FA 4LQ1A 3C60C 4TNVK 4D9QE 4BSWA 5F3HA 2AEQL 1NEZA 3HI5L 5LXGH 3C6LB 2CXKA 1CFNB 3FB8B 2ZOLB 1CVSC 1T5WA 1NC2B 4PGBB 3QUML 4WFED 2IFFH 3VFGH 4WEBH 3RZWA 3OAYH 4UQ3B 4OFDA 5IMLB 3PV7A 5IBLC 5F7MC 4Y19A 1ZGLP 1DLFH 4CNIA 1U8KA 1SM3H 4PGEA 2ADJB 1G0XA 3BUTA 4YBHA 2EDDA 1FZJA 5GSVB 1WAAE 3VXRD 2OJEA 1CXEA 4NSKA 3HG1D 3G6DH 1T66D 2VH5H 5DD6A 3SN6N 1J0IA 2X7LB 1P4BL 1HXYB 2YWYA 5J56B 5HPMA 1RK0B 2RJMA 2Q7NA 1W0VA 3OWEA 4NHUA 1F90L 3JWDH 4Y2DD 1JNLL 1P2CA 4MNGE 4D0DA 5AAWA 5TF1H 3ALWA 5DSCB 2CD0A 2KL6A 4C4KT 5FOBB 3NABL 4E42B 3RDTB 2FH6A 4JDTH 2DTML 3K2UL 1F4XL 3DUUA 1HSBA 4LVHB 3BWAB 4KI5D 4V1DB 1A6PA 2AKRB 1M7IB 1NKRA 2CMRH 5I1GH 3MGTA 3PQYA 4L4JA 1T0PB 3D0LA 4LLDA 1KJVB 1E4WL 1MOEA 5I1DB 4X6CB 1MCQA 2X4QA 3VXPB 5HYFA 5F9DC 3SKOA 5DUPL 4E0RB 1IEAB 2M2DA 3PL6C 1G1CA 4MSWB 1BBDL 1QSZA 2FBJL 2GTZA 1HH6A 2F53E 3L5XL 3W0WE 3WD5H 3MACL 1GPOL 1DBJH 4FQXA 3DGCR 3T65A 1IKFL 4X98A 1PG7X 3DVIA 4MX7B 5JPMB 4U0RC 3UBXG 4U1MB 3H7BB 3QXAA 1EZVX 1F97A 3X14A 5J6HB 2VITA 1RIVL 1VPOH 3QR2A 4WW2F 4J23A 5GRZA 2P7TB 5KSBE 3L3JB 4P46C 4QHKJ 3HE7C 4X9BA 5I8OH 2ZJSL 4GAJH 1MVUB 3HCVA 3OB0H 2JJSC 2EC9U 1RURH 3RWDB 1PKQA 4QTIL 5DHVH 4EBQL 1GSMA 2VDQH 2P46B 3T0EB 4UOW0 2CKBH 2PYEB 3QIUA 4LF3A 4D0CA 2DM7A 4R90H 3RQ3A 3BJLA 2JF1A 2FHCA 2VXUH 4HKJB 3N1PC 1FO0L 3SY0B 2XWBB 1IC5L 2BCKA 1N59A 1P6FA 3PHSA 4L4TA 3WFHA 1FFNA 3KR3H 4TVPL 2O5YH 3PWPB 4YH6A 4FQPA 1L7TL 1T04B 1TQBB 4DAGH 1I1AD 3HI1B 3LSOA 3MUJA 1FIGH 1NMAH 2Z8VC 4IIQB 2GAZB 2AK1H 2X4TB 5F70A 1UQSB 5EWIH 1JNNH 3HAEA 3FN3A 2AV1A 5KJRH 2Y5TA 5L2KA 3A67H 4OFPA 3L6FB 5DUML 4JVWA 1G7IA 3SE8H 1SBSH 4NWTL 5EULV 4QF1B 3O4LA 5EZOL 3RDTD 1OY3B 4AENB 4Z0XA 5IR1A 5C09A 3U0PA 4YGVA 4BZ2H 2YD2A 5E8EA 2DIJA 4V1DD 4KRNA 2VXVH 3HE6A 3ZKMC 5K33A 1NCWH 3CCHA 2ITDA 3NCCB 4R7DA 3PGDA 1HHKA 4RDQG 2VLRE 1XGQB 4HJGB 5CJ8A 3T3PF 5EZJB 2OZ4A 3RNKB 5D2LB 4U1LA 2CR6A 3CC5B 3VA2C 5LXGL 1WIOA 3KYNA 3E2HB 5EBMA 3QNYA 3BX7C 4EIZC 2YA0A 4ZUWB 1C8PA 2IFFL 1R5IB 3VFGL 2PUQT 5CHNA 4WEBL 4L3EB 3REWB 1AGBA 1JWSB 3ZSSA 3C5SB 3GSRA 5CGYD 1DLFL 1QQDA 1SM3L 5C1MB 1XGPB 2XWJA 1L0XA 3QDJE 2C1PA 4GJTB 1ZT4B 2G2RB 3G6DL 4X5WB 2VH5L 5GIRA 2H32A 3NMEA 2CRIA 2VIRA 3PNWB 2FJHA 4M1DH 4Y5YC 5HHNA 4X6CF 1PY4A 3B83A 5E4EC 5C0DA 3JWDL 2NTSP 4G7YH 4NKMA 3GIVB 1OGTA 2AK4A