3KM2A

As-isolated tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical properties of tomato chloroplast sod
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3km2A00
3GTVA 3KH4A 5KBMA 2AQQA 2ZKWA 3KBEA 2C9VA 2XJKA 3PU7A 4MCNA 3QQDB 1IBHA 1P1VA 1XTLA 4MCMA 1DO5A 5CU9A 1UXLA 1SOSA 3H2PA 2WKOF 1SXAA 3ECVA 1E9OA 1PTZA 3HFFA 2Q2LA 3KM2A 4A7TA 1B4TA 3KH3A 2VR7A 4U4IA 1OZTG 1F1AA 4B3EA 1BZOA 2WWNA 1BA9A 2ZKXA 1TO4A 2WZ0A 3CE1A 1E9OB 3ECWA 3H2QA 1OALA 3MKGA 4FF9A 3T5WA 1E9QA 1YAIA 5KBLA 1SXCA 2JCWA 3HW7A 2WKOA 1CBJA 4A7SA 1SXZA 2APSA 1EQWA 2WWOA 1E9QB 3CQQA 3MNDA 1JK9A 2VR6A 1B4LA 1N18A 2AF2A 3LTVA 2E46A 1KMGA 1F1DA 1E9PA 1IB5A 2Z7WA 4A7GF 2E47A 2C9SA 1SPDA 1F18A 1TO5A 2Z7YA 1IBBA 3CQPA 1SDYA 1JK9B 1HL5A 1SXSA 3F7LA 1HL4A 1EJ8A 1PZSA 1SXBA 1FUNA 1U3NA 2V0AA 3HOGA 1DSWA 4OJAA 1CB4A 2SODB 1Z9PA 2Z7UA 3F7KA 2ZKYA 1JCVA 4L05A 1UXMA 2AQNA 1ESOA 2AQRA 4A7UA 1COBA 1YAZA 2GBUA 1SXNA 3RE0A 2XJLA 2Z7ZA 4OH2A 1Q0EA 4BCZA 2WYZA 4A7GA 1IBDA 2NNXA 3L9EA 2AEOA 1F1GA 2AQSA 3GTTA 3GZQA 1S4IA 3SODB 4BD4A 3L9YA 1QUPA 1L3NA 1Z9NA 2C9UA 2WZ6A 2GBTA 1E9PB 1SRDA 4N3UA 1MFMA 2JLPA 3S0PA 1N19A 2WZ5A 4N3TA 1XSOA 1YSOA 2AQTA 1OAJA 1SDAB 1OZUA 2AQPA 2WYTA 1RK7A 2K4WA 3ECUA 3KBFA 3GQFA 1IBFA 1OEZW 3KM1A 2R27A 3K91A 3QQDA 1PU0A 3GZPA 4BCYA 2ZOWA 2LU5A 1AZVA 4A7QA 1XTMA 2GBVA 4A7VA 5KBKA 2VR8A 3GZOA
chains in the Genus database with same CATH superfamily
1JFQL 1SHSA 4JL1A 1GGIL 2ICWA 3ARDA 3B9KA 2KI6A 1VFAB 3Q06A 3D87B 3WFZA 4TQEH 4HVBA 1IC5H 4PJFE 1QMUA 1GMIA 1ZDQA 4WJ5A 4AZ8B 3KPMB 2I07B 4G6MH 2UUDH 1SEQH 3O2DH 3WTXA 5BVPL 4AE0A 3B83A 5FGBA 2B16A 3C60A 5HI5D 2YEQA 3H7BB 1LWJA 1WP6A 2JELL 3V4PH 5EZIL 3QZWG 3T2LA 1NOLA 3CFJB 3MLTB 5H4YA 2AZAA 2DQ6A 5J1AB 1RL1A 1LNUB 2N7BA 2QPEB 4UT7H 3TYGH 3AROA 5DJDB 2CIIB 2V3DA 4JY6B 1NDMA 3GJFB 4M29A 3ZDXE 5CKGA 2VQ4A 1LTXA 4ZAKD 5FO7A 4AG4H 2JH2A 5DMIL 1UD4A 2VN7A 1UH2A 1WO2A 4AQZA 1O5PA 2AJUL 4FP8H 4QHLB 4OLYH 3ZKMC 1S6NA 3KHQA 3KPSE 1JK8A 5GGSA 5J9PA 3AVEA 4LAQH 4B9KC 2D7NA 3REVB 3ROOB 4LCUA 2ED7A 2G9HB 1S9VB 4J3OF 4JFXA 2QSQA 2Q7AA 2QQLL 3CBJB 5CCKL 1DJZA 4JM2D 3KS0J 2PXYA 1J86A 3L4UA 4YZFF 2F74A 2XN0A 3G6AA 1NQBA 3K8KA 2NCEA 3FQ4A 4LDCA 4G9FE 2ENYA 2L7JA 2ZXQA 4F2FA 1KT2A 3CWGA 2NOYA 1ZVHA 4ANVA 1D5IH 2FUTA 1AJ7L 4NBXB 1IE5A 3KXFB 3V0VB 3RNKB 1BOYA 4RA0C 1MLBB 2DEXX 2MQ3A 3UO1L 4Z7WE 2XJLA 1CZ8H 4J3SA 2HRGA 4MMZA 1MAMH 3ZJAA 3WG7B 4LCVA 3K6IA 5CEZL 3I9AA 3LKOB 3D85B 1MDAA 3NABH 1ACCA 1I8KA 2PW1B 1KELH 3VB9A 3LEVH 4G1EB 3EO0A 3ERXA 2WZ5A 1HT6A 3GSQB 1TKWA 3CFBB 2VDPH 4OY9A 3DSNA 4H44C 2WYTA 3HFML 3OWRA 4RX4D 2QTVA 3PQYE 3RWJB 5SX5H 2IAMB 1ZVNA 3QI9B 1XF4A 2VE6A 1RUKH 4G8FB 5K69A 5JHMA 4J2XA 4XVJH 4NUGL 5E4EB 1ADWA 1QSEB 2A73A 3AAZB 4ANWA 5F7LB 1IZJA 5AZ2L 1RZ8B 2GTWB 1UWYA 4MFHA 5T3XL 4ECNA 1OSZA 1RZGB 1U8OB 1TDQA 5J13B 2VDOB 4QKTA 5IMKB 1I3RA 4Z7UA 2BH0A 4HUWB 4PWHA 5HY9B 2NY6D 1QWHA 3MBWA 5EZOH 1TTGA 1ZEAL 4LSVH 5C0RH 1BFOA 2PO6B 1BQLL 4XBPB 2NY1C 2QTEA 4Y1AE 3GS0A 4J28A 4WI8A 2A77H 3QPQC 3ZU8A 3OD3A 4G7YH 3SZ6A 3UBXG 5DC9B 1LD9A 6PAZA 3ZZLA 5JPMB 3G9VA 3S5LA 2XXMB 4Y16C 5CZVL 1GYAA 4KZEH 43CAA 3T6VA 1HXKA 1TT6A 3L3DA 1RUPL 3P4NA 4IM8A 3JTSA 4G6AC 5I6NA 1YRKA 4TQPA 4AL8C 3EOYG 1XIWB 1GOGA 3SDAB 4JO1L 3GB7A 5F1OB 2KZKA 3VFUB 1X5XA 4MXVE 4WFFE 4E9SA 5BRZE 3ZKQD 4BA0A 1I7ZA 1KB9K 2UZXB 5C7XH 1UM5H 2X3CA 4HKBB 5DFVC 4LSTL 2Z91B 4Q2ZA 2E46A 3VRLF 3L9RB 3HAEH 1V7NH 4WFHE 4PGCA 4R3SB 2BW5A 1R34A 1HH9B 2JCCE 3OWEA 2O6CA 4U1KB 5CEXA 1HL5A 1MF2L 2Y6SC 3HVNA 3OKOA 3ROLB 4I18A 5JPNA 4RAUB 1XF2B 4M8UA 4KK8D 5JW5A 1RZKC 5D1QE 4N86A 1F4YH 3S48A 3AY4C 2AQRA 1WEJL 4AYDC 4LLQB 4L8CB 1JMZA 1OTTC 5E95B 5B1KA 4M6AA 3NA9L 3D12B 3O8XA 1IE4A 4UI2A 1U2YA 4RFOL 4Z7NE 5A7BA 1RZ7L 5ACZB 3MXWH 3G7TA 1WIPA 3L2LA 1ZT1B 4LPCA 1OB0A 3HZYB 3L9EA 3PPEA 1KNOB 2P8MB 2B20A 4C4BA 3GMMB 4LKXA 3KCPB 5HPOA 5DZAA 2WTPA 2VH5H 4JJ5B 3UDWA 1I85C 5I18L 5KYNA 4UOW0 5IQNA 3FL7A 1XSOA 4AMWA 1S8DA 1FN4B 3TN0D 3KEDA 2F19L 3BKJL 4KNTA 2UX7A 3L81A 3V6FA 3C87A 4G83A 2MPAL 32C2A 4BFGA 3QNYA 4WY7L 3VRIB 3MV01 3FQTB 1BM3L 4YHKL 4LSUH 4WK0B 3PWJA 1CD8A 5DRZB 2JMRA 4GRWF 2YPVH 5ERWA 1S7TB 2VOTA 5I75B 1J8HA 1TNNA 3ZUNC 3G3LA 4I1NB 2Y22A 4GS7B 1RZQA 2IWEA 3PGDB 1T80A 2MCAA 1A7PL 2YEVB 5AL0A 5DDHA 4FXGB 1PZBA 2VN3A 2ENSA 4WTZA 1UXLA 2WUCL 1JNNH 2AZUA 2WWMC 4FNQA 3FQNA 4BKTC 1WFTA 1MHEA 1ITBB 5IVZB 4Z3TA 5ICXB 1BPLB 1E28B 3K2UH 3LNHA 2W65B 3D69A 1NSNL 3L4TA 3AU0A 3Q48A 2IGLA 3VXNB 3CSTA 3RU8H 3IYLW 3FOLB 4OQ1A 4X50A 3QS2A 3DROA 3GI9H 1TVBB 1ETB1 3ETBJ 5GGTL 3BPLB 3DIFB 3BRGC 4PLJC 3L5WB 4QXTB 1DJHA 4JPWL 1SHWA 2JKXA 3Q0HA 5GGRY 3RNQA 2ZTBA 4N26A 3ZQ9A 4EI5D 3RJOA 4Y9GA 4JQXA 5D1ZD 4B9CA 2DQHH 4MDIB 1JXDA 1VGEH 3ZTNL 2NX5E 2C4XA 2VLJD 1XT5A 1T1XA 3IXTB 5AOKA 4BZ2L 3VG0L 3GSOA 2DYSB 4OFYD 4YXKH 2L7EA 4ZYKA 2QZQA 3GXTA 5IB4A 1DQQB 1SBSH 2VXUH 5D72L 3WY1A 4Z76B 1T7YA 2AEPH 1KTBA 1TITA 1WLHA 1YEKH 3OZ9H 4LGPB 1BQHA 2NY7H 3CNKA 4JG5A 2E6PA 5I28A 4IRSC 3UTZA 3D18B 5GS0D 1EV2E 3HS0C 3R0MA 3NK3A 4PN6A 4KU1A 1AXSA 1RAMA 2BVEA 2RCSL 1ZLWH 5J1TC 1BAFH 3F3HA 5FW8A 4OI9A 1P7BA 2WBXA 3SY0A 2NPLX 4CMMA 2FX8H 3HG2A 3S36H 2O5YH 2A4EA 5CHNA 4GXUN 4MD0A 2V9QA 3RFRA 3KPLB 4MYWB 1HL8A 3KJ4C 2MHAB 1JWMA 3MCKA 1DJIA 2Y5EA 4XOEA 2EXTA 2YN3A 1E8ZA 2V8MA 2YPLB 3FAXA 5EF0A 3QO1A 2AK1L 1D9KD 2C1OA 2XPGB 4E5XA 1R9FA 3IFOB 3P11L 2AAAA 4ZXBB 2KPWA 3MRRA 3MRFB 2CDGA 4C47A 2MIZA 3U7YL 3U4AA 3EYQD 3QQ4A 4JFOA 3MQIA 1CICD 4YXHH 3KVPA 4PTUA 3ZXAC 1NMBL 5H35A 1RQ5A 4RNRB 3KS0H 3VFRA 5CU5A 5K9OA 3PHAA 4FKKA 4KKRA 4XNQA 5E8NA 3SDYH 4X83A 4P2CG 1JF1A 1NPUA 4ELMF 3GMPA 1SJHB 3O11B 4NO5B 1DQVA 4OLWH 4PJFB 2B39A 3U46A 1QR1A 2QLYA 1D5XA 1YEJL 1RZFH 3IDNB 3RTQB 4HG4J 3IJ7A 4GEIA 4NDMA 3T0VA 4F8PA 3VMPA 4NN5B 4FNUA 4JY4A 4OGXL 3RGVD 3GI8H 2DAVA 1Z9SB 1K3IA 1XQ4A 1NAKL 1QP1A 4ZUWA 3BRDA 2VR7A 4M8VA 4K23L 1JV5B 3NZHH 1RUMH 3PCYA 3EF4A 3QFJA 5DTFB 3CE1A 2WZ0A 3ARVA 3GSWB 5E9DA 3QK0A 4ZUUB 1FO0H 1VF5C 5EUKA 3QDGA 4Q9QL 3LKRB 1QQDB 4ZX4A 3GMQA 1JXJA 3EYOA 3I6GB 3ZHFA 3UERA 3ZDXB 5KVEE 3L3GA 4KKPA 3CX5K 1R5VA 4QRUB 4YHZH 1Q9WB 2DI9A 4KHXL 4UWQB 3FCSA 2XHNA 5ANHA 4O9HL 2N01B 1PD1A 5GHWL 2APTA 3EXLA 1NLDL 4Y8AA 2EYRA 3KPSB 4N9OB 2FGZA 1DUZA 3VI4A 1M7DA 1JD7A 1G9ML 3LQZB 4EUPH 1QABA 3JWNE 2A2QT 1NFIB 4LLDA 5GS2H 1OSPH 4OFKA 2XU9A 2YKLH 2ODIA 2C9SA 4KVCL 4G6FB 2ZCHH 4EOWH 4RISL 1M9SA 4N0YH 2BY1A 1D5MA 4NKIL 4R8WL 5LBGA 3UC0H 1J5OL 5I6XB 1BVLA 1CURA 3QXTA 3U4KA 1A7RH 5BJTB 3O0RL 4GKLA 4RRPG 3OSKA 4UANA 1EERB 1HOCB 2AJZB 3VMNA 4IOIB 2CKBH 2N1KA 3C6SB 2BY2A 4G8IA 5L9DL 3DJTA 4NNXA 3FRPG 4Z3IA 4Z7WB 4F9LC 4GFTB 4RQQB 5DSCB 3VFTA 1EMTL 3O2WH 3RWIA 4HUUA 4KPHH 1SF3A 2FVNA 2CDFB 1A6WH 4W9CC 4C8XA 5FFGA 2AV7A 2IG2H 3ZDZF 1HSBA 4YNYB 5IGXL 2GAZB 2CIKA 2Z93B 1NLBH 5D9SA 4KKLD 5CAYB 4PB0L 4QHUB 2AQSA 2G60L 2XWJB 3HJ0A 2Y06L 1MW2A 3K3QA 2IAAC 4X5LA 1BV8A 1WWCA 4RRPA 4NC1C 4NNYB 1F11A 5GGVH 1UGNA 3H3BC 4BSVB 4LLYA 2H41A 3OLGA 5ENWA 2ARJQ 4MHHG 5CLZA 3W57A 3FRPA 1JHKL 4FFTA 4AM0A 2UVEA 1ECYA 4XI5D 4A6YB 3IDUA 3WNMA 1HYSC 4WO4C 4PS3A 4FXTA 1OGTA 4MQTB 3D85D 2R69L 2P8PA 9CGTA 5IB2A 2OSLA 4HIHA 3KYMA 4XR8C 3L5XL 3V6ZA 1A6VL 1T22A 4HIXH 5T1MA 4PR5B 5IM7A 5F7WC 1N59B 3BKMH 1UB6A 1RHHA 4I3SL 1U3JA 1AD9A 4GBXD 5HJ3B 4YBQD 3TX4A 4GRLB 1DQJA 3QUKA 3QI9D 2G75B 4PJ9B 4MS8C 3D07A 2XY2A 3AQXA 3HUJB 4ZOEA 4OF6A 1E3XA 1KY7A 2HFGL 1IGFH 1BCIA 4N2NA 4FC3E 4A7TA 4Z7UE 1TEYA 1VENA 3OF6D 3QNZA 5DS8B 4H1LH 2FJGB 3MOQA 4PJCF 4MD5A 4JKPL 3WJJA 4G7RB 2NYYC 1F42A 1GS8A 3S4SG 3C5SB 4Z7AA 5L8KB 1XBRA 1LO5A 5DEGA 3MNMA 1M2VA 2PO6D 3V4VA 3CJJA 1FJ1B 2EC9U 2K7QA 2VXQL 4PLNC 4ODVL 3BZEB 2DKSA 2CAKA 5GIRA 5HYQA 4LOFA 3IMTA 1KV3A 4PBDA 4WDIB 2QGCA 1AANA 5GZOD 5CFHA 1KCWA 1D7BA 1S9XA 3QDJA 4S0HA 4A7SA 1SM3L 4QF1A 4ZOAA 4ZSOA 2DI7A 3FZUC 4WW2F 4F7TB 3U9WA 5BZDB 3OJDB 2KDYA 3NCBB 3IF1A 3JV4A 2H1XA 1KYFA 2K1MA 3FHQA 1MRDH 4P5MB 2OMUB 2WQ8A 3VWKB 4F7MA 1IEBB 1XIWD 2NNAB 3EG9B 5CWSB 4PG9A 1IZKA 1BVOA 4N2OA 1F18A 2DMCA 4YIQA 5EC2A 2CJUH 5IMLB 2YD6A 5B1JA 2Z9TA 1A64A 2UZYA 3CXFA 1YUHB 4BELD 2YRPA 2VN4A 1CFMA 4JFDA 4JPKL 2W60B 3WFHA 5ABAA 5D1QB 4ISVA 4YBLC 1OD7A 2WVTA 3TS8A 2N0KA 4M7ZC 1T83A 3UACA 3VWJA 4QHPA 2ZX7A 5I9QC 2A9DA 4Z7NB 4KKCD 2FLBT 2GBUA 4YX2H 4Y5VC 3SKJL 3RTLA 3V7MA 3MV7D 4A7GA 4NUQA 2FWOB 3UGEA 5CUSH 3O2DL 3DJRA 5DUPH 1LO0H 5HGBA 5J6HB 5IR1A 3GUTB 3QZMA 3FU6A 1N64L 4NQDD 5C0BB 2I85A 3SOBL 5FAAA 5DZ9A 5DMGC 1K8DB 3O6ML 2A6DB 1GGBL 2Q7YA 1PFCA 2KT6A 3OTTA 4G7QB 4PJ5E 2D3VA 5SX4I 1OPGL 1XR8B 4AYBA 5I5MA 3LRLA 2YD7A 2NUPB 1I1YA 2AJ3B 4EKXA 1BVNT 5TGBA 5F2FA 4QTHA 5EUOA 4H5SB 4L3FA 4NRZB 5GISL 1AD0A 2H32A 1EEYA 4GW4B 1F45A 2VIRA 3D7PA 3EO1B 2X6MA 1P5VA 5MEPB 3QC6X 4D9RE 1AGCB 4E9XA 5LBSA 3IJYA 3I50L 4C54A 4P23C 4UT9H 5IESL 1AHWB 1RUQH 4RGND 4F37F 1T3FB 3ZE2F 3Q2CA 3BGMB 3MYJA 1J8HE 4FQJL 1UVQB 4P48A 2X4TB 3IJSB 4XXDA 2CM6A 4NPKA 4MB5A 5DJ6B 5FOBB 2ETWA 3IMRA 1FNHA 2FSEB 1TQUA 2ZYHA 2IEPA 3FQ2A 4Y9EA 5J3HD 2XA3A 2NUTA 1TSHA 1S3RA 2WXNA 3UBXI 3WNLA 2IJ0C 4FFYH 2HH0L 3LAFA 3TJEL 1I8AA 2CGZA 1MFDL 1XB6A 1MCWM 1C08A 5IFHL 2NX5B 2WIIB 1FAKT 3PGCA 4GH7B 3CFEB 3UZEA 3STBA 3FB8A 4RBPK 4DWHA 3VA2C 1CDUA 1WSST 4AGQA 4FFVC 1FBIL 1PY9A 4Z9KB 3ILQD 3KJ6H 1BX2B 4PJDF 4UOJA 2ODHA 4K3DL 3LEVL 4FHKA 3OG6B 1ZKAA 1Z3GH 1ZS8B 4ODSL 5DEJA 4DEPB 4UYQA 2IPUG 3K6OA 1ZD6A 3HMXA 3GSNH 3OC5A 2HN7B 2PTTB 2GJZA 3UXFA 5E2UH 3DTDA 1JNHA 4GMSL 3PHOA 1JCVA 4M5ZL 3NN8A 5HHOD 1A9EA 1D6VL 4CSPA 2Q0ZX 1KIRA 3VI3A 4XP6L 1J9TA 4TUUA 5FM8A 5JZ7C 4NOBA 4TVPH 1L9NA 1F58H 3QJTB 5DJCB 1BAWA 4LVOB 2BX5A 2H2PC 2VLRD 4APQB 1E2WA 1DN2A 2K8QA 1KCVL 2FJHB 4JVPA 4QTIH 2CHXA 2Y1YA 3DHPA 3VTMA 3DYMA 2YQ2A 3BJLA 2GCYB 2UWEF 2WQRA 2VAAB 1VFUA 1KBGH 3OPZL 3QR0A 5SWZB 5BMFL 5FCUH 2E9JA 4K5MA 1OAJA 3U4BH 1A66A 1SDAB 2LLLA 4KKAD 2E27H 1RK7A 4U6XA 5E1AB 2EIBA 4B97A 5AB1A 3II1A 1KPRA 3T8MA 1S7UB 1Q9OA 5FWRA 1G7IA 4FKHA 3RUGF 3G5YA 12E8L 2OMYB 2XTJD 4RLDA 3SY6A 4ZXBD 3T6ZA 1NFDF 1T20B 2OW7A 4W6WB 4NQEA 1FG2B 1J8KA 3LMJL 3U79A 3B4NA 3NBNA 1SVZA 5J12B 5FYKL 1ZOXA 2ICWB 3ARDB 3B9KB 2EINB 2QLVB 2EO7A 5DMYA 4AGMA 3NIFE 4FXLA 4UQIM 4F7EA 3HPJB 3BVDB 3II2A 2NNRA 4JO4H 4WJ5B 2Q2EB 1ZT4A 3JXAA 3BP6A 4O4YH 4B27A 3BAYA 4OIBA 1PEWA 3FT1A 3MRKA 4HBCL 3SGJC 2EQDA 1RZKL 3C60B 5FO2A 2KLSA 1LO4H 4LT7A 3RTQD 1CDBA 4HS8H 2IC2A 2WLZA 4X7SH 5E8OB 2CH8A 4OCSL 5JLZA 2ZYRA 4Z3EA 2A6JA 3DX8A 3MRHA 1DQML 2ZXGA 4AGPA 1ZWIB 3QFJE 5GGUA 1DBJL 4YDIL 1IGJA 1AMYA 5E9DE 4JHAH 4U6VH 4NKMA 1NDMB 2Q8BL 3QDGE 1A7NH 1EGJA 4U6YA 1OAZL 1ZTXH 4XHQA 1CLOL 5JUEH 1DZ0A 4YXLH 4S1QH 1ZSDA 4G72B 4QKXB 4G5AA 4WWKA 5FO7B 2PPCA 4AEIH 2X5PA 5CS7A 5EC1A 1GJWA 2UVFA 4M9OA 4L3CB 1CFBA 1YVLA 4RMRA 1ZA6B 2A9AA 1JK8B 3VI4E 3JYBA 1MXDA 5J9PB 1RSYA 5GJTH 5GRJH 4CILA 4LCUB 1WAPA 3KPSD 5DJ0A 5JA8B 3DK0A 2ZKYA 3E6FA 4JFXB 4MMYB 1U8CA 4PRIE 3PXLA 2VDNB 4TNEA 2Y07H 3CDYA 3BUDA 2PXYB 2PWHA 2F74B 2OMWA 3G6AB 3RPKA 1BDYA 1OAQH 1EZLA 1OTUD 4G6FD 4NI6A 3UJJH 4FA8A 3CFTA 4F2ME 5IREA 3ULVC 5FK9A 3L4XA 1KT2B 3Q2VA 4Y16A 3UROR 2KZBA 4G9FD 4HJ0D 1SOKA 4IJTA 4Y4KD 3ZE1F 1JP5A 4A2EA 4LE8A 5F7KC 4OFQA 1AY1L 3W11C 5H4ZA 4MMZB 2GTZA 1BW8A 3TPUA 2R2CA 3A21A 3S0PA 3HE6C 1NMAL 4U1SA 1QSFA 3Q2LA 1HNGA 4K7PX 4L2YA 1I8KB 1FVCA 3IBOA 3LQAC 4QOKA 2Y9RT 3MJGX 1UA6L 4TM9A 4AKQA 3E9TA 3EO0B 5I66B 1PF3A 3K91A 1D7CA 4LSSH 3FUIA 2V37A 1TKWB 3P0VL 2VL5A 4IKKA 2CHNA 5D6DC 3DSNB 2B0SL 3WNPA 2FNBA 1W72H 1T4KA 2E76C 2PWDA 2YRLA 3FKUS 4HQQL 4OLVL 5ID1A 5LNEA 1NFAA 1E4WH 1XF4B 3K72A 3NJMA 4S1SH 4ZRGA 1RIVH 3FQXA 2OMTA 3PU7A 1EO8L 3VFPA 4EI6B 3PQYD 3EFDL 4GAGH 2AK4B 5C0EB 5CU9A 1OSZB 2VM9A 4OFDA 2IFFL 4S2SA 2Z8WC 3HN3A 3CVHA 1CGUA 4GIPD 2MNJB 3FB7A 4LSPL 4DO4A 4IRZL 4QXUL 3TIDB 5DUMH 1BFOB 2HUHA 4FJZA 3ZQXA 4JCMA 4HKXA 4U7KA 2ZKXA 4KXBA 2IQAA 3QUMH 3IFNL 5BW7A 1LD9B 4Y1AD 5LAXA 3KLHC 4NN6C 3S5LB 3TZVB 3VG9C 3Q13A 1SY6A 2YD2A 1MCLA 4P05A 4D9LH 2KS0A 43CAB 4DGUA 1YEWA 2ORBL 1OTSD 3L3DB 1BBDH 3CIQA 5DRNA 2HKFL 2IQ9L 3DOIA 3JTSB 4UV7L 4F9PC 3DPDA 2FBOJ 3WV0A 1NBVL 4HWBA 2HT3D 3MBXH 3GB7B 2CLRA 3UG5A 1MREH 3BFOA 1Q72H 2ZCLL 2VR6A 5G4MA 3VGAB 1RP8A 4PRDA 5JHLA 2P5PA 1DFBH 1OGAE 2FECL 4LCYA 1I7ZB 2VUOA 4M7JL 3SDDC 4WFFD 5C0IA 3QDJE 4I13B 4NZUL 5BRZD 2IH9A 3LB6C 4LFHG 3U36B 1DQLL 1EHAA 2YGVA 3BWSA 2EUZA 4N2HA 5HVFB 4JFED 5E8DL 1RI8A 3OV6A 4OZIA 2CA4A 2LOEA 3LN9A 4JB9L 4F37K 1W80A 4PGCB 1K72A 6FABH 1X6LA 1CGYA 5GZND 4DQOL 5IT2H 1N5YL 3C5XA 5CEXB 1OB1A 3CAFA 1THAA 2D73A 4YDZA 4WFHD 3VWKD 3NQKA 3QXWA 2ZWNA 2YQBA 4N22A 4I18B 4KMQA 4MZ2A 2QT6A 3TTSA 1UHVA 3PHSA 1HH6A 4JFDE 1AACA 1R6VA 3TU6A 3KVDD 2E3VA 4L8DA 3E8UH 3RVWD 4KNUA 4OH2A 3V2AR 4TLTA 4YHIA 2XWTA 3L3OB 3VTTA 4LKCA 3O8XB 5D1QD 2Q86A 4ZPVA 4LQFH 4XC3H 2O6FA 2VMDA 4ZMTA 1KWGA 3RURA 5K9KA 4KUZH 2D8KA 2DQTH 4UOZA 1ZDSA 4NAJA 1UJ3A 1UWGL 3BN9C 1FO0L 3EUDA 5EORH 2UXTA 2K4WA 1U21A 3D4CA 3PDGA 4GXVH 1YNTF 2ZOWA 5D93C 4D8OA 2H1PL 1F6LL 1IU1A 1CFTA 1ZK9A 4I7ZC 4R4NC 3BAEL 3CK0H 2J55A 1IJ9A 3V6FB 4ESKA 1KB5L 32C2B 2EVJA 4DPCX 2B77A 5FIEA 3QNYB 3OXSA 1OAXL 3AXLA 5EIIA 1Q94A 3CMOH 3ASNB 4IRSA 5F1SA 2AI0H 4HLZG 5EUOE 1QLEB 3HS0A 5E4IA 5ERWB 3VCLA 2LT9A 3LS5H 4FABL 3H2WA 4I0CC 3HKFA 2VZ3A 1J8HB 3DI3B 4AIXA 5BV7L 4MLIA 2YLHA 1T0MA 2EIMB 1E4XL 2HT4C 2QSVA 3GF8A 4NO0D 5DDHB 4HOWA 3WTUA 2RBLA 1Q0XH 1EZVY 7PAZA 1MZZA 5ETUA 3FQNB 4ZS7L 1MHEB 1IC7L 4UQAA 4X6CF 1ZE3H 1BHGA 3D69B 2YAMA 5D2LA 1BLIA 1JRHL 1NGZA 2Q76A 2HMID 3PGFL 4M1GH 4KZDL 6PCYA 3DROB 2WTRA 3NAAL 1CXFA 2GG1A 2OMVA 3QYMA 1E50A 1NANI 5HYFA 5E24E 4P5RA 1AP2A 1ADQH 4K94C 4WI2A 3LXAA 5KVGE 3RNQB 4YO0A 3ARFD 1DSFH 1D6EA 3MNDA 4XNYL 2VW4A 3Q9QA 1UCBH 3QPXH 4N6RA 4PVBA 1T1XB 3C2AH 3UAFA 1OAKH 4LPUA 4RIRA 5KVMC 5CGMA 4FQ2H 3QXVA 2NX5D 4NUPA 4A6YH 1RJZA 4ZYKB 3TA3B 4RWYH 3O3UN 2JFCA 5IB4B 3JYCA 3AW5A 5E99H 3LPGA 1J9QA 2FHBA 4XMUA 3CHSA 3PWNA 4Y89A 3ZBMA 1P4BH 1KGJA 4NQQA 4TSBL 3SBWA 4LSQL 4PW9A 4U1JB 1B0IA 1MLCA 3LNEA 5E8EA 3UTZB 1XH3A 1HQ4A 2BVPA 4PJ7F 2C4FT 1FZOA 3SJVA 2IPTH 1AXSB 2IPUK 2FEEL 2YUVA 1A4BA 3T77A 3AG4B 4X0KA 5BOPA 5HP5A 1KYUA 1UWEH 1WV7T 2F7PA 1ND0A 1SQ2N 2G3XA 1JPST 3ZL4L 3SY0B 4CMMB 4F91B 5B7MA 1BF8A 1CLZL 5IBLC 3VI3E 5CHNB 1KBKA 4WU5A 1R5WB 1SMDA 1U6AL 3QXDA 1H8SA 2F54A 3GIZL 3QQ9C 4MD0B 4WLCA 4S11A 2DQJH 3CZEA 4Q4EA 3NMEA 5CP3H 5DZVA 1MHCA 2BCKA 3JTTA 3M46A 4MLSA 5TFSH 4K9EL 3LCYA 1AE6H 3QO1B 4E5XB 1KTDB 2C1OB 2XCMC 4K73A 4R9HA 4P5SA 3MRRB 2CDGB 1EHLH 4JFOB 4ZMLA 4APQD 1IKFH 4PTUB 1KIQA 5TE4H 1W2KT 4AK1A 4XP5L 4K71B 3V0WL 1CDIA 3TTYA 3MA9H 2IH8A 2JJWA 4Q9CA 4XNQB 4LEOA 1BMWA 5T3ZL 3GXNA 1T7WA 3EZJB 1F3RB 1JF1B 1QFHA 1VERA 3ZZQA 1A4AA 2YD8A 1IX2A 1K4DA 2AXGA 1YHPA 3NIFB 4WFGE 4P57A 3S88L 4X6DE 3ULUH 3L4YA 1ACYH 1LEKA 3U46B 4NQEE 4N0UA 1QR1B 4EDWH 4HW6A 1D5XB 2QADB 3MTRA 3LNDA 4F9LA 4NDMB 4J4PC 1AG6A 3FFDA 4QRBA 1PG7X 4R26H 4UILH 2DJUA 1RIHH 4ZUWB 5AZUA 4F33A 3B9KD 3ARDD 2A6KA 1NCUA 2L04A 3B9EA 3QFJB 3GTNA 4J3UA 1OLLA 2Y36H 2VT0A 5E9DB 4WWPA 3L7FB 1INEL 3QDGB 1AI1H 2VJ0A 4IJ3B 2WUBL 1LO0L 3GMQB 3EYOB 3R7RA 3L3GB 3OHXC 5HSFA 1R5VB 2DQEL 2ZAGA 5IQ7L 4WEBH 3C60D 4N0CC 1WFIA 3RQ3A 3OKKA 3QG6A 2KZWA 3WEBA 4JQIH 2EYRB 2NY4C 2BIMA 2HYMA 1M7DB 3HOGA 5G55A 1SXBA 4D3CH 2O5ZL 1BD2B 2X89A 1EJ6A 1T5WA 5BUGA 5BRPA 2HVJA 4PQXA 4LRNL 5IEKB 3VDCA 3LD8C 3LIZH 5HDLA 2DBLL 1ZY9A 2HTKC 4Q6IC 3S37H 2YAHA 1D5MB 1BVLB 2GB2A 1QACA 4BSWA 2FX9H 5DQDH 4YK4B 1RJLA 1MNNA 5EEZA 4NNPL 4LPXA 4KI5E 4WUKL 3BT2L 4A2GA 1NIEA 2OPCA 4NNXB 4UTAL 3PABA 1PSKH 3VFTB 4WAFA 1S4IA 2BIIA 3TP4A 2AHIA 1X7TA 4LVHC 5EN3A 5A2AA 2PXYD 1CLYH 2AV7B 1YJDH 4N3UA 1QFWI 1GA2A 4Q56A 5D9SB 4NOFA 1IAIL 3FAWA 3P4LA 1R33A 1IBZA 3QCTL 4LU5H 4HPYL 5EBMA 2VZUA 1V5JA 2DTML 2FJFA 1F11B 2P49B 2X2HA 4XP9H 4BCYA 4LLYB 2NYZA 3LNFA 4PJHA 1QSFE 3FRPB 4LMQE 4AM0B 1LE5A 5EBWA 1SFDA 1LE9B 5HGAA 5I5IA 4QOKE 1EHKB 3Q8CA 3RYMA 1OGTB 2QVKA 1MPAL 5LWYL 3EJZC 4YSUA 4HIHB 3V6ZB 1T22B 3MLZL 1T66D 2SEBA 5T1MB 3H53A 5IM7B 2QMKA 1OWWA 1E27A 3UJIH 1UB6B 4G70B 1RHHB 3ZSTA 4HD5A 3LPWA 1CE6A 4NFDA 4UT6A 1DQJB 2OULB 3QUKB 1JV2A 2ICCA 1UM4H 3AABA 4TUOA 5CSGA 4M4RB 4ZFGH 4CGUB 1NJ9A 4OVVA 3KZ8A 3VFWB 1WT5A 3QNZB 5B3JE 5B7FA 3BQUB 4FNLH 3EJRA 3WLWC 2VRKA 3SE4A 2VR3A 4Y2DB 5AVUB 4K5PA 1LO5B 2GBAA 5DEGB 5IVXF 4X80H 2GK0A 1M2VB 2CO2A 2HJFA 3V4VB 1EQWA 1OM3H 3RZCA 3IT8D 2DLFL 2WBJD 4PB9L 5GIRB 3C6EA 4ZFOL 5HYQB 5I73B 4JQVC 3NPSB 3WXWH 1WGVA 5C1MB 1UURA 4M7KH 2O5NA 1S9XB 3QDJB 5K59F 3WJLA 3VFOA 5AVTB 1KXTA 3E1F1 4QF1B 4ZSOB 1FNEB 4P04A 1JGEA 2WLHA 3N1PC 4XTRD 2G2PA 4HGMA 3JV4B 3NFNA 3L48A 4J8RB 5DURB 3SE8H 4TNWF 4F7MB 4GINA 4H88L 3KPRA 1CDJA 5GSVA 4PG9B 1UB5A 1JGLL 3CSFA 2WQWA 3HC3H 4MQXC 3T6WA 4OF8A 5EC2B 4YIQB 3D33A 1XVSA 4KKBC 3QJOA 3PHQB 3SQBB 2J25A 4BYHA 2UZYB 4P23A 4UZSA 4PJGA 1MWAH 3QUYC 4JFDB 3RKPA 4OZIE 3BIKA 4J3OH 3WFHB 3MLVH 1C7TA 1IM9A 1DVFA 2WW8A 4ISVB 1G6RH 3VWJB 5KAQG 1GTFA 3NRPA 5FYJE 3ZT7A 1XGPA 1MCHA 2BSRA 3BVNA 4MKTA 4JKLA 5KYXA 2R83A 1BGXH 1BG9A 4LEEA 4K07A 2CCWA 4LLVA 1MFMA 3FU8A 5D96B 3D06A 2FBRA 4LIQL 1MZYA 5HGBB 3WFCL 5IR1B 2C4FU 2VSKB 3LN4A 2JV6A 4U1IB 4JO8A 4XCFL 1ZPLA 3DVFA 3ZLQC 4JG1L 2W80C 3O8XD 5LHDA 4OZ4B 2DS4A 2Q7YB 1WD8A 2LGNA 2WPGA 3QEGL 5CR8A 4X9YA 5IMOA 3N43F 2EP6A 2G2NA 2ARJA 1D3CA 1IGYA 4N90E 1WD9A 5FYJU 1ZTXL 1QKZH 2KQMA 4PJDB 4Q9BA 3S97C 4MCNA 4PJ5D 3FUNA 5TGBB 5F88A 4QTHB 5CN3A 1AD0B 2H32B 1L0QA 5SWQA 3ZTJG 2MOGA 3V5HB 3FTXA 2VIRB 2H1LM 2ZOUA 5L6YH 5DVKA 1P5VB 2VDLB 4KVNH 2V3EA 2XVKA 4L8BA 5BZZA 3F8UB 2BXYA 2MNUA 3ZMRA 5E5UB 5CBAA 2OJ1A 5HYJB 5EF1A 4D9RD 35C8L 2OYPA 3DO7A 3EW3B 4ZS6D 2WTOA 4N2FA 1S2EA 4TOYH 3MYJB 4XXDB 1LM8V 1O6VA 3HNSH 5JIQA 2X1XR 3DV6A 2PCFA 2FK9A 5I0DA 4KGJA 2P5WE 1J8HD 3P3YA 4UQ2A 4YSAA 3ULVL 1CDGA 2NUTB 1WIOA 1ZCRA 2QZ5A 3FUHA 3OAZK 2JCWA 3SN6N 3LKNB 1KEGL 1HEHC 5FYLE 5IB5A 5D2LE 1C08B 4MCZB 3MSPA 5DHYA 1KGCE 3OZLA 1VAHA 5JNYA 3CH1A 2C3VA 3PGCB 5T1JA 1CD9B 1TCRA 1R4XA 3AMLA 3FB8B 5TPWL 4ZMYA 4B95C 4YC2C 2X4UA 4C4UA 4DUWA 5J0BA 3LQAL 2ROXA 1XGRA 4M93C 3KGTA 2VW7A 3ZHDA 3H9ZA 1NMCC 1RJYA 4M6OL 3NQIA 2Z7UA 1A9VA 4ODWA 3GC3A 1W72L 3MODL 2KZ1B 1MIEH 1NFDB 4MZIA 4HWEH 5I19L 3U2SA 1E43A 3QWQB 1QBML 3D4GA 2FDBP 3VA6A 4GAGL 1JNHB 3T4AC 3PHOB 3NN8B 5K9JL 2WXHA 1RULH 3IU4H 2W92A 3GIVA 1NCNA 1A9EB 4Q9RL 1M6OA 3RFZA 4F8TA 5EU4A 5SX4H 2OZ4A 1KIRB 4YDNA 2V9UA 4PY7B 2VNCA 4MRBA 3SJVE 4EIZC 5KSAC 3HC4L 3U2IA 3KL0A 1XEUA 1J9RA 2Z92A 4M61A 4IDLA 2R0LL 3S3BB 1TETL 2AJVH 4J3TA 5DQJA 3TT3H 3OX8B 1I9JL 5BRQA 1MCOH 4DGVL 4BKSC 4FFZA 3GQFA 1B6DA 2F54E 1WIUA 4ZUVB 3GZPA 1QW8A 4Z6AT 3AWEA 3R7QA 4U6XB 3DIDA 4BGLA 2XZQL 3WKQA 2N56A 2IXQB 1AQKH 1TYJA 2CXKA 3QIWC 1Q9OB 1TLKA 1TVHA 3WYRA 4XPGH 1HXMB 1CK0L 3ATAA 1B88A 3G5YB 4A66A 4F80A 4MCMA 4E68A 1IVTA 5HI5C 3MROA 4R4BA 2X2JA 3QJRB 3L16A 3VQLA 4NQEB 3F12A 3WTTA 4P2QA 3TFKD 5D71L 2BZDA 1S78D 2H3KA 4HHAA 4MAYA 4YLCA 2AXFA 3KM2A 3BISA 1MCIA 1BJ1H 1JVLA 3PP4H 2CMRL 5BVJA 4M8RA 4GRWH 2XZZA 1HDMA 4F15C 3ARPA 1CL7I 2GITB 4F7EB 1EBAA 4UMSA 4N0UE 2DL2A 4ZAKC 3GKWH 2VERA 3EOAA 4H13C 1NWOA 2EDYA 1ZT4B 4UDTA 5E0QA 1KGWA 3V52L 1DZBA 4AVKA 4UYPA 5AZEL 3KWVA 4LARL 2Y5TA 1X5HA 2YEZA 4KY2A 3VH8G 2RQEA 4U2YA 5KSVA 5AW3B 5JLZB 5IV2A 3CXHK 2EEAA 2BIQA 2A6JB 3DX8B 2W0FA 1TJHH 1OSEA 2HUEA 1MFNA 5GGUB 3LOWA 4FMFA 2XKSA 1IGJB 4XO9A 1P9MA 4NKMB 4JZJA 5D6DA 2DM2A 3BP4A 2BSTA 3QFJD 4U6YB 5D7IA 2DM3A 3ARGA 4BRVA 3IRCA 5E9DD 1FGNH 1ZSDB 2DMBA 4WWKB 5HI3D 2WKGA 1ZGLP 3QDGD 5T1DH 3RHWF 3MYZA 1PJWA 5I30H 5ADPL 3B9VA 2F2HA 1RERA 2XPZA 3FB6A 3VD7A 3CK0L 2C8NA 3A5VA 4NHCL 2IOOA 1OP3K 5DJ0B 3GGWA 3P0YL 1U8CB 2AEQL 4P2YA 4HOMA 2AANA 1NKOA 2IDSA 2NY1B 2VABB 2OMWB 4PRID 1I3VA 1S9YA 2VXVH 1QVOB 2FD6H 4OM1H 4UB0H 2AEOA 1E0OB 1QUPA 5FK9B 3EGDA 3WEXA 3UPRB 2KH2B 3TH2T 3DRQA 5HVHB 1UD5A 2WXOA 4DKEH 2IANA 5A3ID 2WLKA 1EVTC 4KRPC 2VDRL 2WN2A 4F9PA 1N6VA 2GTZB 1AR2A 1K6QL 2B15A 4M1GL 5DHVA 3VXRA 1XX9C 3HJEA 4PRNA 4XPHH 4EZLA 3V79C 3QNXA 3SGEI 4U1SB 1BPVA 3I84A 1FVCB 4TLSA 5EDXA 3SDDA 3T2QA 3FTSA 3MV9D 5C0FA 2EE2A 1JWSA 4HYTB 2J1ZA 3V0GA 5KW9H 5IHUH 3WL9B 1T4KB 4OQTH 3CGTA 5ID1B 4PJHE 1FFTB 1NGPL 2H6OA 3K72B 3FK3A 3QVAA 3LH9A 3VFGL 3ELAT 1H3GA 3FQXB 2OMTB 2X0WA 3VFPB 3IKKA 4AENA 3L2NA 4X2UA 4MJJA 4CJ0A 5E99L 2P80A 4S2SB 5GS3A 3TBWA 2WQXA 5GGVY 1UT9A 3CVHB 3IE9A 4RMWA 4QT5A 3FB7B 3O4OC 3N44B 4Y4HC 1F4XL 1OQXA 3B3IA 1CWVA 3I74A 3LXCA 3I75B 3DUUB 3MFFA 4IHBA 3GXIA 4FQIH 4I0PC 3EHBC 2R4SL 1HIMH 2QMJA 3ARBD 5AWNL 3ZL1A 4N4YB 4LCWD 2EEXA 3KYKH 1J1XH 4M62H 1CFSA 1MCFA 5L4JA 3EGSB 3E2HC 3BD4A 3KHOA 5DRNB 4P46C 4ADGA 1FDLH 2GSMB 4X4XA 2N0MA 5ALCL 5ESQA 1SDDB 5DWUL 5ISZA 3Q6FA 1KCSL 4XCEA 2CLRB 1B4JL 1WWWX 2CD0A 3NTCH 1TZGL 3JWDH 1T2QL 4O02A 5E5LA 4PRDB 2ICEC 4NLAA 1MCKA 2X4QA 4LF3A 5C0IB 4YDKL 2XQYG 1ULVA 5KBNC 5SV3A 5C0DA 4P9MH 1OGAD 4D0BB 2EIDA 2OP4H 4W81A 3QDJD 2FRGP 3EGXA 2DWXA 5DMJB 5D4QA 3D6GA 5E2TH 5EO9A 3KPRE 2X7LB 4LVNB 1OB1B 4PWJA 2GI7A 1OK0A 2DWEA 1RVFH 1NCCL 2HLFC 2XETA 4PJGE 1J1OL 4XGZA 3TEXA 1HH6B 3HHMA 4ZNCD 2QKIC 4L8DB 4IHOA 2G4EA 2XQYA 3TN0C 4YHIB 5I8CB 5JW3H 3Q01A 4HHGA 4I2XA 4JFDD 1X5JA 2K78A 1WBXB 4LKCB 3QCVH 4H8WH 3V4UH 1XSJA 2Q86B 4ZPVB 5I23A 4YUEH 1A4CA 4NCC1 2GJ6A 4Z23A 5K9KB 4CA4A 4GI6A 3VWJD 1JGUH 1TZ8A 1VFOA 1XGQA 5IHLB 4NGHH 3L3KA 3PWPA 1JZ6A 1PU0A 1I3UA 1UJ3B 1JPTL 3IDJA 2OKMA 2KUTA 3TV3H 2QVFB 4M43H 2C9QA 4ANKA 4ODXA 5L0QB 4MX7A 5IWLA 4DF9A 5DZLA 2IPKA 4XP4L 2AXWA 25C8L 2OFQA 4DZBA 4YLQT 2ATKA 1AR1D 3F84A 1CFTB 3EOTL 2Y72A 2HWZH 1X3DA 3JV6A 4PS7A 1UEMA 3H6JA 4DVRL 5LCVL 5LXGL 3GD1C 3OXSB 1Q94B 2BVYA 5HVGB 1B4TA 4JPVL 4UNVA 4DERA 4UQEA 1A3LL 1NM9A 1U3HC 2WB7A 3HS0B 3N3EA 3VCLB 5ITBL 2B2XL 2EDJA 2VL4A 1DJYA 2VC2L 3LRGA 3LIZL 1TZIA 1GAFL 4IIQA 2O5XH 2F08A 5D1ZC 1T0MB 2WLIA 2O61A 4L5FE 1DR9A 1RPKA 5TDOA 2FATL 4FQ1H 2X9XA 5ETUB 1VDGA 5JHDA 1NGYA 4KOBA 4JDZA 1NGZB 2AJSH 5A6MA 2Q76B 2VLLA 3T4YA 4GQRA 2WTRB 4JREC 2OMVB 5AKVA 1AP2B 3IMUA 3LS4L 5GS0C 4GY4A 4YO0B 3HLAA 4IYKA 3OSVA 4YFLF 4N6RB 4XB7A 4LOUD 4OJFL 4Z7QF 2DMHA 3HA0A 1JPFA 4PY8I 4YLBA 1RJZB 4A63A 2VDQL 1LP9A 2GI0A 3CHPA 3K4DA 3SQOL 4G43A 4LSRL 1OCWH 4AYFA 2Y7SA 2J8HA 2UYLA 3P2TA 1KCUL 2EYSB 2WNXA 1MLCB 5E1HB 5E8EB 1XH3B 2AQ2A 2BVPB 1DBMH 1FC2D 1INQA 1FZOB 2CO3A 3RWEA 3SJVB 1TUPA 3RY6A 3LH2H 4OZFG 3M7OA 3E7JA 1HHKA 3T77B 4ZI8A 4X0KB 4URKA 5DQ9A 5L4MA 3D25B 3DX1A 2EC8A 5I1DA 2XUWA 1N19A 3PWLA 2BVOA 3V9FA 5E6ZA 1RFDL 2E7MA 4WU5B 3A22A 2DQUH 2GJJA 3QXDB 2F54B 3P9WB 5LNGA 1QASA 4QRPD 2DMKA 1MHCB 2BCKB 1QBLH 3OHXA 1OF2B 4UQDA 3NZUA 5A6LA 2E7HA 3JTTB 2X6VA 3FF7A 4X80L 1FPTH 3A4EA 1DFXA 1CI5A 4OZFA 1TU2A 3UP1A 3RHWK 1NBZA 3J07A 5AYQA 2D9CA 3RGVC 5TE7H 5E94A 1P1VA 2CK0H 3A6BL 4ORZC 1F41A 3WS6C 5KJRH 1EX0A 1KIQB 5J1SC 1IAOA 3BPCA 1B2WH 4OCRH 1UGKA 2WSKA 4CAGA 3PV6A 2OL3B 2DQCL 4LEOB 1V05A 5IW1B 1FFQA 1PZ3A 2F58L 4Q6IA 1NANH 2VLME 1K4DB 2AXGB 3FT4A 4U4IA 1P4LA 1G9NH 3ZKMD 2OTPA 5BOJA 1L4IA 2F7OA 4FQXA 4WF7A 2OK0L 4P2QE 4WFGD 3RRQA 3NSFA 2EDMA 3QR2A 1BFTA 2EDRA 2WNWA 2GVYA 4NQED 1DVQA 5E2WH 4PCYA 5SWSA 2AKRA 4KO6A 1G6RL 3FFDB 2JB6A 5CJOL 2CBQA 4Y9FA 3SDCB 3TXAA 3HRZC 4F33B 1XD0A 2A6KB 2R0KH 4JN2A 5JTWA 4IDJH 4AGLA 2QHRH 3D50A 1ZLUH 2PYFB 3MN8A 4L3EA 3VD4A 2JB5L 4AV4A 3B2UD 4LEXL 4RMUA 3D0AA 3AT9A 2V5SA 1G6VK 5J4MA 4LOEA 5F0LB 1PZSA 5DEFA 3NT0A 1MHHA 4P9HL 3RIFF 7FABH 2CRZA 1NEZG 2HRLA 3OKKB 3RVUC 2YLKA 3QG6B 2VZVA 4IBWA 1A14L 5CSZA 5IJKA 1PYWB 2PCPA 4P3CL 2G2RA 1MW0A 5D7IE 1HZHL 1J8SA 1T5WB 5I1EH 2HVJB 3B1UA 3ZZSA 3VW3L 3GSUB 1OXYA 4KKLC 3HMWH 2CO4A 3BZFA 1QI3A 3BKCH 2VDKL 3EBIA 2VDLH 4O5LH 4WWKD 2VXQA 2W1NA 1K4CB 4JY5L 1B4RA 3QH3A 5KVFH 4MNGA 4BSWB 3RWGB 4XPAL 3PFUA 1RJLB 3DX6B 2EXSA 3AM8C 5LGJA 1FLRH 4ZOCA 2CJSA 3LH8A 5TE6H 3DOSA 2JLPA 1MWOA 4XI5C 4A2LA 1NINA 4N3TA 2E4TA 5LGHH 2EE0A 4ZW5A 4KI5D 5IQ9B 4MAUH 1AG0A 2NY1D 1M2OA 1Q9LA 3SKNA 5T8IA 3Q1SH 5AKSA 2BZCA 4AWJC 1KJ2L 4DN4L 3QPQD 1XTMA 1KTKE 3QRGL 1C5DA 4GFXA 1JI1A 1JGVH 2DEYX 4N2DA 4Y16D 5EBMB 4F3FA 2IANE 1NICA 2IAMC 3IDXH 2FJFB 3QI9C 1T5XA 4W9IC 2XWRA 3VXRE 2GQHA 5E4EC 3VD2A 4IU3A 4G6AD 1Y7VA 1LE5B 2E74C 2P48B 4PS4L 5EBWB 4GQQA 2XZAH 5J13C 5HGAB 2EIKB 1QSFD 1AFVH 1E5AA 3HG3A 1NIFA 1CF8H 1U8QA 3BH4A 1QA9B 3F58H 1JDAA 3OG4B 3D0LA 4L1TA 4QOKD 1OARH 3O2DA 1Z66A 1HJCA 2PO6C 2SEBB 1AGBB 2GHWB 2AMGA 4B7LA 3V4PA 1E27B 2WBWB 1REIA 4KI1A 1MIEL 5DFVD 4XNXH 2HRPH 1DVSA 3A6CL 4MASA 3C6LA 1CE6B 3CN4A 5T1LA 3IRPX 1FV1A 5A2CA 1TJXA 5JPMC 2DQIH 1JV2B 4XXCA 4GNKB 5GRYA 1RULL 4FG6C 3SZKC 4N1EA 5D4HA 1NJ9B 4AT6B 4JHZA 2QSCH 4MA8H 5IOPA 3PLYA 3JWOH 1KTLA 2APSA 2P42B 1PKOA 2Y4SA 3DX3A 1W9XA 5FUZL 3SDAC 2DRUA 5I76A 1SHMA 2KPNA 5F6IB 2BSCA 2GK0B 4ALAC 1E8XA 2HJFB 4X4ME 1L9SA 1OTTD 3GNML 4HWNA 4M5SA 1VADA 3TIEA 3QB7C 3RZCB 4I3RH 5C2BL 1ZVSA 3DSFH 3D4ZA 1NGWA 3CN3A 4KNQA 3GBML 4FFWC 3BDYL 1X9RA 4PHXA 3ZYJA 1I8LA 2BNUA 3C5JA 2W91A 3E6HA 4W4NA 2QJDA 1D5ZA 1KXTB 5LO7A 2A38A 3MNZA 4K4KA 4X8CA 3V5KA 1BQRA 1JS4A 2NY2C 4CW1A 2OMXA 4KKCC 4PU2A 5ISZE 1JGEB 3ORJA 4HCIA 1AQKL 1SLUA 1MEXH 3QORA 4Y7MA 1P7KA 5EZLA 4HAFA 5GSVB 5F70A 1QFWH 2C5DC 4MXWL 4XCCH 2R1YA 1WAAF 4H2AA 4PTTB 5C0CE 4ZZKA 2BFGA 2B08A 1TMCB 2EDHA 4P23B 4NXSA 4PJGB 4K5NA 1T1YA 4HH8A 5A7EA 4NRYA 5K39A 3MLXH 3BIKB 3FSZA 4DCQA 1IM9B 4WI9A 1DVFB 2BP8A 5KVDE 1D2OA 1OO2A 2ZWZA 4OLEA 1GYWA 3F5WA 5F8RC 1UWXH 5AYUL 3P02A 1PLCA 1RMFL 3DO3A 2XT1B 2J56A 3KCWA 3D0VB 1H15A 5FYJD 4KQ3H 3QZOA 4HOZA 3F7YA 2WWMD 3CFDA 1LEGA 4UZGA 4I2XE 1YEHH 4GQ9H 1GC1C 3LN4B 3VGHA 2Y2WA 2ZCKL 2GJ6E 4X6DF 4J39A 1E6OH 3ABZA 4BUHA 5B21A 1NPNA 5IB1A 1WFJA 2R56H 3PWPE 4PLJD 2VR5A 4F1SA 1T1WA 2I7SA 2ARJB 4LB8A 1IGYB 1ZT7A 2B1OA 1BMZA 5F0MB 5I75C 4OF5A 1F4WH 5EZPA 1DVXA 3BH9A 3IN0A 2VO8A 3DA0A 4GS7C 4AEHL 2E9IA 4N90D 1NL0L 4XE0A 5SWQB 4XMZA 4FCAA 1V3LA 3ARQA 4HCRL 4PI0A 3DX7A 1IKNA 2Z1KA 4L1LA 4L8BB 4G71B 3HB3B 1UOWA 5CBAB 1A3QA 2G5RA 1ZA3A 4GG8A 2D9QB 3DO7B 5KBLA 2EO9A 3GMRA 3KWWB 4WSJA 2UZIL 2PKDA 3ILQC 4IRSD 4ZMZA 1NDGA 2YAOA 3DV6B 3N06B 2PCFB 3CFCL 5A16A 5DU7A 3MNVA 4UQ2B 2YSTA 5LN4A 5JHDE 4KFZC 1HL9A 1CS6A 1S46A 3NJKA 4XCYA 1HKFA 2P5WD 3WKML 5IB5B 1YEFL 2GABA 4QXGH 3OMAB 5IF0B 2WY3B 2EDDA 3HAEA 5FYLD 5JNYB 1Z32X 1HHGB 3CH1B 3DVGA 2C3VB 5AW4B 1FZMA 1K3ZA 3NH7L 1KGCD 1TCRB 2SODB 1O7DE 3WS3A 3OZKA 3QG7L 3NFSH 4H0LC 1TJIH 1DQDH 1HEJC 3DVIA 1ILSA 3QDHA 5JXAL 1LYQA 1XGRB 2WOYA 1U93B 2A0LD 3BAJA 2AC0A 1WFUA 4G11A 4RH4A 4X7DC 4ODWB 4NFBA 2YAQA 4KMTH 3U2SB 4M48H 1LP9E 1Z9LA 1YN7A 1BFVL 1LDSA 1X9QA 2OJZL 1U8IA 3AWFA 3CXHJ 3EJCA 5A2LH 3HG4A 3TV8A 4EDXB 3GIVB 1CGTA 1E9PB 1M6OB 3RFZB 5EU4B 3LEXB 5T5FL 4DAGL 3ML9A 3NCEB 2AERT 4EVNB 2BRQA 1UENA 2YMXH 4OZGA 4QUOA 4QHKI 4YFLI 1SUJA 1VA9A 3MJ8A 3RI5F 1UOLA 4Q6KA 4N25A 1QX1A 2Z92B 4M61B 4ZXBC 1DBAH 4FQIL 3SJVD 2XX0A 4RMTA 5L2JA 5DQJB 4OSUL 3G5WA 4IBYA 4OLZL 5CJXA 3RIFK 1M1XA 3NJFA 1URLA 1TYRA 4DP6X 5CZRA 4EIUA 4KUCD 3D9AH 2ZNWA 4GOSA 4MD4A 4FULA 4X6FB 1C8PA 2P46B 2YPVA 5I0XA 2F54D 1MH5A 3GBDA 1CUOA 3AUWB 1VPOL 1X7QA 3HNVL 2XVGA 1F02I 2H3XC 4FD0A 1TVHB 2J72A 3QXAA 5B39G 4YEFA 2YPKA 2LU4A 4H4NA 1E9OA 1HSAB 1KDIA 1CYWA 4JFSA 4QJ4B 2MWCA 3B43A 3MROB 3FPYA 3GO1L 4HJTA 3V10A 3F12B 5JR1L 4HZLB 4P2QB 4NN5C 4Y5YA 4HHAB 4MAYB 4U3SA 3UPCA 2AXFB 4OJYA 4YBHA 1JPEA 1NCWL 3AQZA 2MFNA 2BJML 3BEWA 4PRAA 4AQAA 4AYID 1LWHA 5BVJB 5CJ5A 1BYPA 4KDTA 1HDMB 1GGYA 2YD5A 3OKDA 2Z64C 3FCGA 4PWFA 2YUZA 5FHAL 4LP4A 4G7VH 5B7EA 3K81A 3KWXA 1NAML 3DYOA 2OYLA 5B39A 4YHMH 2VW6A 3EOAB 1P6FA 4UDTB 4HLEA 2F7RA 4QRAA 1F2XK 4P2RA 3NCYS 1T04B 3WIHH 4XVTH 1C9SA 5SWSE 5D70H 5AG8A 2Y5TB 3G6JA 3NSDA 2YEZB 4JMNA 1KMGA 2QFRA 5KSVB 4FZ8L 5MEOA 3V4UL 1BSIA 5IV2B 2J7LA 2W0FB 4U2ZA 3TC9A 3HCVA 4MZRA 1PX3A 1FVEB 4XX1E 5J8OA 3APMA 2CNYA 5J11B 1IQWL 4WJKB 4ODUA 4JZJB 4L3EE 4ORGA 5C09A 2BSTB 3ARZA 5D7IB 1OTUC 1UZ8B 3ARGB 5GSRA 1YMHA 4EIGB 4M43L 5D2NA 1WDAA 3UH8A 1G9EA 1TNMA 3HRPA 4GO6B 3TA4D 3D2UA 1XZWA 3SGKC 1LO2L 2NXZB 3ZKNC 1ASQA 4ABUA 3ATBA 5C3LD 5I6XC 4N2IA 2VXTH 5ADOH 4JM4H 2HKHL 5K9QG 1HYSD 5EA0L 3U82B 3GGWB 1DTUA 5KTEH 3W5MA 3VSTA 4JHWH 1QPPA 4Y4HA 2AVGA 2X89D 3IAPA 4CUCA 5AVRB 1S9YB 1I4FA 2X6BA 2A9ML 2ICWJ 3TO4A 2YD0A 4FCHA 1YA5A 4L48A 4MNGE 3RVVD 3X3FH 4Z7VA 1IIIA 3EGDB 4TQIA 4I0KA 3WEXB 4MS8D 1RCYA 4N85A 3V0EA 3DRQB 1MNUH 4XPBH 3VNYA 1MIML 4FZEH 3PXHA 3X11A 4P46A 3OJMB 2IANB 1FLTX 2IGTA 4HLZH 1LQSR 4FOMA 5DHVB 3VXRB 1WBZA 4PRNB 4FTVE 4N0FB 1AQMA 3MV11 3QNXB 4PY8J 2JQZA 2L3BA 3NACH 4D7PA 3OAZH 1CL7H 3V8OA 5MERA 5GS0L 1IL1A 4JFVA 5I1IL 4RESB 3B5GA 3L54A 2B5IB 4P5TA 5HDQL 1WICA 1JWSB 1OAUL 2PR9A 1CIUA 4GRLC 2B4CC 3NCMA 4PJ9C 3FZUD 2ATPA 3GXDA 4FMKA 4HJJL 3TCLA 4AENB 2VYRE 3FO0H 5A40E 3E8VA 1OCWL 3ZT5A 1UXWA 3RVXD 2WXFA 1FO0A 2HT3C 4LBEB 3SE6A 4BHUI 2XBTA 4QT5B 1MFAH 4KJYA 2MKWA 3MOAH 1QYGH 3RB7A 2A1WL 5I0VA 5JO5A 3ARRA 3EDKA 3I9GL 4Z3JA 3B3IB 2GIMA 3NJLA 3CQQA 3ZZ1A 3X1BA 2C1PA 4RA3A 5AKTA 4N5ED 2AF2A 1IM3A 1DVYA 3AUVA 4BFOA 2JKRM 3BYYA 4MAZA 4AEFA 5GZNC 2QBWA 3MJ9L 4XHJC 4X4XB 2R4RH 4MA7L 3VWKC 6CGTA 3ESPA 1R19A 3DV4B 5ISZB 3Q6FB 4MNHA 3T0EA 5D93B 5EBGA 3CZKA 1UC6A 5FHBH 4O02B 4BH7A 3CBRA 1PCXA 3GHPA 1CVSC 5DMGD 2X4QB 4LF3B 1JSYA 4X6BA 3S3PA 2CKBA 5C0DB 1KCLA 5C0NC 5DD0L 1GIGL 2DWSA 2X53A 5D1QC 5C92A 2OL3H 1U3HA 3G5XA 3EGXB 4GO8A 1EZSA 4IOSA 4AYEC 2B3IA 2JKNA 3GXFA 3RILA 1NFKA 5EO9B 3B3BA 3S36X 3SGEH 2JJTC 2C9AA 4PV9A 4ZTEA 3IFPB 1I9RL 4WEMB 1KC5H 2DWEB 4X5XB 5I8EB 3KPRD 5DC2A 3W37A 5AW7B 3H9HA 2W81C 5IFAH 4KTEL 4OLXL 2J2ZB 4HPHA 4ZO8A 3HC0B 4P23D 4PRPE 3TGXA 4XXWA 2CDEA 2VXSH 1U4EA 4OIIL 5FX3A 4RGMB 4I2XB 2NXYB 3D52A 3NRFA 1IM9D 3WNOA 4RFEA 5E08H 3U0WH 2GJ6B 4OD1L 1C16A 1QPKA 1KFAH 5LBVA 3ZHNA 1XGQB 1S7XA 2Y25A 5ESAA 1L7IL 2VRAA 1AZUA 3L3KB 4JG0L 1EHXA 5C6PB 3GS7A 4GMTH 4XBGA 4A68A 2R0ZH 2P3YA 1Q4NX 2OX5A 3L3HA 2CA3A 4MX7B 3L6FA 3U1SH 4DESA 5GPRA 2GTQA 4C56A 4N8CL 4GAJH 4NYLA 1ZHLA 4B6ZA 4G6JL 4Z7QB 4O51A 4CADA 3JV6B 1AHWC 5EBLB 3RA7H 1BA9A 4XZ4A 3EBHA 3EDJA 3APNA 4GKZA 4H1LA 4GUCA 4IOFD 2F7IA 2WOBA 1E5YA 2NDGA 1DE4B 2XN9E 4N2EA 5IJVA 3R06A 3QBTB 2ZP9A 2V5MA 1TZIB 4IIQB 5E4AA 3MBEA 1YJDC 3X3GL 4GSDH 2FWSA 2W0KA 3NIDB 5LG1A 5TDOB 4ACPA 5DHXB 3P3SA 1G4RA 1OP3H 5JHDB 1BREA 4HFUL 3EDDA 4UOQA 4P59H 1CGWA 1NGYB 1Y6NR 4J27A 5F72S 4ZFQA 1VZGA 4JDZB 1R17A 3H54A 4XN4A 2G3NA 2R1WA 3F6LA 3HE7B 1H6TA 4AW4A 1V27A 3T4YB 1MFEL 3FFCA 4LCIL 4M6NL 2BW4A 3EYVA 2F8OA 4G82A 4AYGA 1DLHA 1CLCA 4KZ0A 4K2UL 4Y2LA 6TAAA 1R3IL 4OT1H 2ADYA 4HC1H 3KLSA 3HLAB 3H9SE 2H2PD 4HIQA 4XH2B 2HPTA 4IKLA 1WRFA 5DJYA 4AQOA 2P28B 1FGVH 3DUHA 1VEMA 3DBXA 1L0XA 1YYLL 2P44B 4PEEA 2QR0A 3RE0A 3CLFL 4B7IA 1EDHA 4F24A 1BWMA 5EIQA 2XZAL 3H8NA 3U9PH 4CGTA 1LP9B 4JW3A 2VDOL 4G43B 1TVDA 3KPMA 4ZK8A 5BO1H 3CDFA 4OCYL 1YEDB 4X4YA 1UUNA 1ETA1 5BPPA 1GGCH 4GRMB 4R2GB 3RWEB 2BY3A 2JK5B 1YSOA 3QCUL 4NM8H 4B3VA 4LVOC 2BO0A 3GFUA 4FYQA 2VR4A 5CD5C 1HHKB 4APQC 3HRZA 4JO2H 4U1NA 5DQ9B 2JJSA 4FMVA 2YJLA 5DFWH 1RZIA 2XTLA 1MFCL 5FYKU 1ID2A 5I1DB 4O00A 1VIWA 1M56B 2Q3XA 1ZLVK 4BINA 4AW7A 2BVOB 4GSRA 3FRUB 1YNKL 2XOTA 4NQVB 3W39A 2XWBA 2FTAA 4M1CC 4V2CB 1EDQA 3CVBA 4JO3H 2C9PA 3NCXA 3OHXB 4Q14A 1L6XA 2AJYH 4FQCL 4GG6A 1I9IH 2Y24A 4RDBA 4ALAL 4X8GA 4I3RL 1TU2B 2JVUA 3FTGA 4OZFB 3T8VA 4DNLA 5I8OH 2CHDA 1KJVA 4Q89A 5EEUA 3ZR6A 2RB8A 4NI3A 4UT9A 3ETBF 4XPTH 3MV8A 4ONGH 3UZVB 3MRQA 3BPCB 5J12C 1CFVH 4GXUM 2HFTA 2J8UA 1TZOA 3B9KC 3PV6B 4XWGL 3WGVB 4HT1L 4PMEA 5FM4A 4DP2X 4IBLT 1MEXL 4OLUH 3NRQA 4Q6IB 1IGCL 1NTDA 3CXDL 4NC0B 3FT4B 3HPLB 3KXFA 2I5YL 2XKNA 2W9DH 3RNKA 3D51A 4FFYA 1MLBA 4R83A 2VLMD 4XMTA 4L18A 3AM8A 1XZ0A 3V4LA 4FQXB 1XH1A 2BPBA 3B37A 5FGBC 3OVUB 2LTQB 3C60C 4P2OA 4IBVA 3M8OL 1XGYL 4BM7A 4XMWA 3A4AA 4P2QD 4WHTB 5SWSB 2AKRB 2R2HA 2DQDL 2JTYA 3P2DA 2JB6B 2PW1A 4L9LA 1A0QH 3CC5A 3QWOB 1F97A 3QUZA 2QQNH 4PWGA 5K1VA 3DARA 1I3GL 4JN2B 4NZ8A 4E36A 1WE5A 3JWNC 4KQ4L 4PJ6A 5KSBA 4P2RE 2YSSA 1F8TH 1PLAA 1ZSHA 3GBNL 2RALA 1R3LA 4L3EB 3T2NL 3MRJA 4J3VA 3GSNA 3AQYA 4JE0A 5LVEA 1S7QA 4G8AC 5E1GA 1GC1L 1UD6A 4WCYH 4WU7B 5F9OL 3WIIL 3W11D 2GTWA 5DEFB 1VRSA 5D1XA 4G3YL 5L4IA 4M7LH 3HE6D 5IMKA 4M5YL 1KGXA 4WI6A 2BMKA 4PJXA 2V4LA 4OZHA 2YJQA 1IBGL 2IWKA 4UQ3B 1NCDL 2FEDC 2G2RB 5EU3A 5C09E 2Z1PA 4BRJA 1MFBL 2W95A 5D2NE 3T65A 2IDCA 3D09A 1GGUA 4KNSA 1A3ZA 3T3PB 1MCDA 3VFNA 4DZ8B 2JI3A 4YR6B 4F58L 4AJ0A 3BZFB 3GRWL 3CZGA 4GUPA 1V54B 1UACL 4BKLA 3A4DA 1KGUA 2BSDA 3H4HA 4XNUH 4MNGB 1NEZB 3ILPA 4KXAA 2OSYA 5LGJB 1JNLL 3ECUA 4MMZC 2H26A 3DOSB 4B9PA 2NLJA 4OFVA 2C3WA 1FH2A 2A9BA 3VFUA 3GXMA 5E51A 3MJWA 3NCFB 4JS7A 3UADA 5GRZA 2ZSVA 3SKNB 1T66C 2ICES 3GLEA 3FN0H 4X0NA 2DYPA 3MA7A 4I9WE 1JZ5A 4FQHA 2ZZUT 2DICA 4R4FH 4UDUB 3TVMA 4G8GA 4F3FB 3HLKA 4G2AA 4JN1L 2QPFA 2W0PA 1T5XB 1JFQH 5C6TL 1I8UA 1I53A 1GGIH 1HH9A 4KHTL 1SLWA 5F9WB 3PAYA 2IAND 3V0DA 4DP0X 2BS71 3POCA 4JUTA 3VXRD 3ROLA 4ODTL 1I75A 3BJ91 4LHUG 2HVBA 2EIJB 5IQMA 1TO4A 1M7XA 2GFBA 5CCGE 3B2XA 1U8QB 5ICUA 2X6AA 2XV2A 5BVPH 3SDDD 2JELH 4LLQA 3S35L 5EZIH 3V4PB 4UTCA 3LB6D 3K4AA 5ACZA 4QHKJ 3C6LB 1FV1B 1IC4L 2EIZA 4OM0H 1NH6A 3CHXA 3TZVC 2ADFL 2AV1A 2WWOA 3QIUB 3I2CL 3KR3H 1KNOA 4DGIL 3UCRA 1Z9OA 3UBHA 4LHUA 1PZ2A 4UOW1 5IOPB 1A8ZA 1KTLB 1TJGL 5DMIH 2IF7A 3O0LA 5CBEA 5I76B 1J1PL 2AJUH 1FN4A 2RJMA 4HEPG 1RLBA 5DJ8A 3VGAC 4KWUA 2WJ7A 3QRFM 3N1FC 3KLAB 4KX9A 3TIEB 1VADB 3PIQA 1NGWB 2VMJA 5C08E 2GIYA 5GRUL 3FQ1A 3IGUA 4WTQA 2BNUB 4XVSL 4JGUA 5CCKH 3C5JB 1UKSA 3N40F 2HX7A 1UCTA 1D5ZB 3IPBA 5T1KA 4CW1B 3MNZB 2OMXB 3CIAA 4IW4C 5F3FA 5AENA 3T0EE 3QIBA 2Y1AA 3X14A 2G5BA 3QORB 2X4PA 4YWGL 3ZK0A 1P7KB 2FECI 5EZLB 2OLDA 1BQUA 1IGML 5ISZD 1AJ7H 2R1YB 2X9ZA 4K5OA 4ES8A 3L9YA 4F2EA 4PVLA 2W65A 3UO1H 4R4ND 2PWFA 5BZWA 5C0CD 1T1YB 2OZNA 4PBVC 4PG2A 5K9QI 4IBQA 3TEYA 2D03L 2D7TL 3VXNA 1FRGL 3L3OC 4NRYB 4V11A 5K39B 3L95A 7CGTA 1JYVA 5HHXL 3O8XC 5CEZH 2BOBB 5I1HL 3SGDI 4QTFA 1HE8A 2BP8B 3BCDA 3QJSB 4R7LA 1OL0A 3PNWA 4FXKA 4J12A 3MRPB 1O9VA 3AREA 3W9DA 2P5EA 4MDIA 2HT4D 1XV8A 1H15B 1RP9A 3MJ7A 3HFMH 3F7YB 3IXTA 3J27A 4YGAB 3CFDB 2VDPB 1LEGB 4ZPTA 3BC9A 3UDWC 1C1EL 1W72A 1SVCP 1OE3A 1WJ3A 2F1EA 5HDBE 2EDKA 3GK8L 5JW4M 1KN4L 1J18A 5AZ2H 3ZPDA 3KYOA 5T3XH 4JGNA 2WKOF 2NXYD 4MNQA 5DUJA 5IB1B 2WP3T 5I0YA 1E90A 1GS7A 5DZNA 1YPZF 2GJ6D 3HBGA 4U7SA 3CZUB 1ZEAH 1ZT7B 3GMNA 1F3DJ 1BQLH 3PWPD 2FO1A 1PQZA 1ZPUA 3BAIA 3ULVF 4C56E 1EJFA 5HHPA 2BNQB 4AH2A 1H3UA 3QUMA 2MH4A 5CZVH 1AZNA 1NC2A 2ZD0A 4TNVF 4OCNC 1RUPH 5DA0B 4B9JA 1QR4A 4UINL 2WM0A 1ZA3B 3EJUA 3A6OA 3CMGA 4GG8B 3LJ3A 4ODBD 1N5AA 4HOXA 3POHA 3GMRB 4JO1H 2MNWA 3EIFA 1E4XI 1S3KL 2APXA 4KJWC 1SOQA 1VEOA 3QEUA 5A16B 1U3ZA 1FCCA 1XDTT 1K8IA 2YK1L 2Z35A 3MNVB 4Z3GA 5FUCC 3G08A 3WNNA 1DEDA 3O3BA 4XCYB 3INUL 4LSTH 1JRHI 3WIFA 3MJ6A 3WJMA 5E23A 4IGBB 5IBLD 5JHDD 1ZJAA 1PNDA 3MZTA 4NO2B 1EPFA 5D5MF 3DVGB 1FZMB 2YBGA 3FCTA 4NO5A 3TA3C 1MF2H 1Z5YD 3CZJA 1HHHA 3HN8A 3H42L 5TH2A 3CVIL 3W2DL 3HTLX 1FVDB 3GPSA 4IEFA 2PWGA 4N9GA 3II3A 3EBGA 1RIUL 4K3EL 2PPDA 3RZWA 2M26A 1WEJH 4QWWD 3BZ4A 3HC2A 3WCYA 4BD4A 4D0DB 1HINL 3DJZA 1Z9MA 3NA9H 7PCYA 4DP8X 4RFOH 1RZ7H 1CDYA 2B4CL 2DLHA 43C9A 1E5ZA 3SO5A 3UO8B 3FPXA 3VM5A 2VMCA 1YN7B 4AKPA 3SCMC 1P6WA 3DURA 1U8IB 5E1IA 3SPHA 3MREA 5B8CA 1HU8A 3CZLA 3US0A 4QRUA 5I18H 2Q5BA 1JCKA 4OZGB 4JRLA 2FEEI 3G9AB 4A7VA 3GTVA 3KGSA 5LGYA 2F19H 3S34L 1E7UA 2HT2C 3JWDC 1MKFA 2X41A 4J4PD 4PAZA 4RAHA 2RR3A 4F57L 4JKKA 2MPAH 3CZFB 3D4YA 2F5AL 3THML 4WY7H 1J12A 5IP4A 1M1XB 4BQBA 1PNCA 4K71C 1BM3H 4X7EC 1IAKA 1VACA 4MD4B 5AAPA 2IFGA 1A7OL 4TTGA 1MH5B 4GG6E 4YPGA 4H2CA 2BLFA 3SGKA 2Z4TA 1DN0A 1X7QB 1SMOA 2WUCH 5BJTA 3QXAB 5TQ0L 2YPKB 4HUXA 5DFAA 1CFQA 1E9OB 3FMGL 4N0CD 2E75C 3U83A 4TQHA 5IROC 3S35X 4M00A 5KS9F 1LMIA 1QTPA 1A1NB 3MV8E 2QADC 4GXFA 1NSNH 5E03A 3RWDB 1WCBB 3ES6A 2NY4D 3FO1A 4L1DA 2HLAB 4HK3N 1I7RA 1N8OE 4Y5YB 4U3SB 2XACC 1GY1A 4ZZFA 5GGTH 5LN8A 2APBA 1CQKA 2HX8A 3FB5A 1CBVL 3BEWB 4AQAB 3QQ3A 4JPWH 1KIUA 2Z93A 3GMOA 3OB8A 4NM4H 2ZG3A 3KXFE 4GEJA 1ADQA 2XWJA 2IMNA 2HTKD 4W9JC 4KAQL 3ZTNH 4TLKA 5B39B 4HIIA 4HG4K 3D3VA 4IJ3C 4BZ2H 4X7TA 3WTVA 1TO5A 4P2RB 3VG0H 2B1HH 1B90A 4KRPB 3MOBL 2GW5A 3G6JB 2NSQA 3MXVL 4A6YA 5G4OA 5D72H 3UMTA 1XFPA 4DKFL 5MEOB 1DDHA 3CCHB 3QUHA 5SWSD 5E08L 3TPKA 4KITB 3K6DA 5D8JL 3IGLA 1JERA 1QFPA 2A9CA 3IAGC 5KSBE 2YR3A 4N6QA 5HJDA 4EZJA 2YFNA 5DS1A 1WISA 2DKMA 4ORGB 4YSRA 5C09B 4Q97A 5JQHC 5GSRB 2VJ8A 5AOZA 1Q0EA 5D2NB 1QSEE 2W38A 1XF5A 3WTWA 2RCSH 4L3ED 4BH8A 1RZJC 3D2UB 4XAWH 5D1XE 3HUJA 2YA0A 1BQ5A 2NDFA 5K5YA 4PJXE 4KK5C 4OZHE 4YK4C 4G9DB 2ENPA 2A99A 2DH3A 5DS8A 4KO9A 5E6IB 3T3ME 4EN2A 1PY4A 2E5EA 3IJEA 4PJEF 4PJIF 5CP3A 4TVPE 1XH2A 5M94B 2XFGB 2CUAA 5HYSG 2AK1H 3FUJA 3P11H 4PCSA 4B41A 4H0IA 3TO4B 2CHZA 2YKKA 3DVNA 3KDMB 3U7YH 4OCMC 2JIXA 4ODHL 4Z7VB 1KOAA 3B7YA 5IUCA 2K6ZA 4HV8B 1NMBH 1IAMA 3BAWA 1HNYA 3MMEA 3DDGA 1KTCA 4HS3A 3VXTA 4F7TA 5BZDA 4JKNA 4P46B 3WAKA 4LZKA 2NQCA 1XAUA 3CDCA 4F1ZA 5IKCA 3ZDYE 3E3QE 4WW2C 3WLWD 1WBZB 3BE1L 3OBAA 1P6AB 2OA9A 4KV5F 1A6AA 4DEUA 1IAII 5HDOA 3JV5A 1RK0A 2MSPA 1X5FA 2VN6A 4FTVD 2YUXA 4HC1L 2ZJSL 4BFFA 1IL1B 1YEJH 1N2RB 4LL4A 4P5TB 4G8GE 4OI7A 2WWNA 3EDEA 3R8QA 5DGRA 4XOAA 1UD8A 4OGXH 3FCUB 4TMPA 4BZYA 1A3RL 2CR0A 2BSED 3UJTH 5CJQL 2H0FA 4NIKB 2BS8A 1NAKH 2J6EL 4ZQTA 4CKVX 4GAAA 2ATPB 3NPZB 4K23H 2WAHA 4LO9A 2WXLA 1RPQA 3TCLB 3MRMA 3OKMA 3B7UX 4JPIA 2CCVA 3LHPL 3BQUC 4HALA 4MQXD 1UXWB 4Q9QH 4OF7A 2E7BA 1U8PA 3N42F 1WVZA 1FO0B 4XMKL 3WJJC 3WDHA 1N18A 3VJ6A 4KHXH 4Y2DC 5C0BA 3QFDA 4O9HH 5JO5B 1KYAA 5H37G 2LV4A 3GM8A 5JQ6L 1NLDH 1DYZA 3SE3C 4YS4A 1G94A 2V0AA 3HKZA 2ID5A 5T1LD 4JQIA 1G9MH 5I73C 4TRPL 3UAAA 3NPSC 1XR8A 1IM3B 2X9WA 4YFDB 5DO2C 3P77A 5LCVA 5TF1L 4BFBD 1CTNA 4I4WA 1KN2L 4KVCH 2EUVA 1BJMA 4JHVA 4JO3L 5AVZB 4RISH 3LIZA 4NKIH 4R8WH 5BV7B 1J5OH 1X4ZA 3T0EB 5MEPA 5TDPA 3MLUL 4OZFH 3AJ7A 2IGFL 1URZA 2I25N 3K0YA 3O0RH 4MA3A 4N5UA 4QRQB 4BH7B 5B1JC 1XWVA 2HSIA 1G9NC 4XODA 5LJYH 1G87A 1AHWA 5C3IA 3EOBA 4WZ9A 2ZONA 4X6BB 4HIPA 4HZ1A 1T3FA 4YDVB 2CKBB 1WAEA 5I16A 1PMYA 4JFQA 4TNVK 5EO0A 4JPQA 2JKSA 1UVQA 2WZ6A 3KNBA 1EMTH 1U2CA 2EH8L 4OBRA 3G5XB 4K15A 3VWJC 5CJ8A 3HVDA 3LKQA 5IGXH 5T33L 2ADJA 4GPVA 4MJIA 4PB0H 4PV9B 5EIVA 2G60H 3VX1A 2D3LA 2Y06H 3QORD 5L7XL 2JKLA 1YN6A 4QYOA 1Z0MA 3OXRA 3H9HB 5D96C 3MRDA 4NHUA 2NSXA 3ZE0B 5AW2B 5KVEL 4IKIA 3AXIA 1X5MA 4PHZA 2CDEB 1JHKH 3KH4A 4R97B 4Y4FA 5HDBB 2WP3O 1PAMA 1K85A 3OKEA 4JREB 5IBTL 2JXMA 4PRPD 4RFEB 5F0JB 3HBZA 4JFYA 1QHOA 1C16B 2BWDA 4GQZA 2P5EE 1IT9L 2IV9A 2CBPA 2R69H 1S7XB 1B3IA 1JYNA 3L5XH 2W94A 1CJYA 1A6VH 1AIFA 1F00I 2WV3A 5JQIB 4KTDL 4XBGB 3F83A 1S7WB 4GLRI 5F7AA 3BWUC 3P4MB 4I3SH 4OCXL 4PVMA 2OX5B 3L3HB 1I1FB 3ATEA 3L6FB 2OV0A 4JHUA 4EN3A 1ID5I 2R15A 1HXYA 5AALA 4C56B 3NVQA 1ZHLB 3QDMA 4NYLB 2CQVA 4C83B 3VQ2C 4M7LL 5GQBA 2HFGH 4O51B 3GDBA 1OOAA 1WA0X 4CADB 1C5CL 1D5BA 4XNMA 4EBQH 4NJ9L 4Z8FL 4JKPH 2VDNL 5I1GL 4LASL 3G5VA 4AMXA 5IJVB 1MCRA 5D7JA 3VMOA 4B50A 1MVUA 3D2TA 2XN9D 1EJOL 4ODVH 3MBEB 3ZW3A 4JX0A 4MBRA 1QG3A 3FO9B 2XV6B 5H2BB 4FA6A 2ZP0T 2P43B 2RD0A 3F7PC 1SM3H 5SWZA 3ZO9A 3Q8BA 2V33A 4MCYA 4TTDD 2ISDA 1UA3A 2YPLE 5E1AA 2Y7OA 4CC4C 4GSQA 4OD2A 3NEXA 3FFCB 5KSAD 3EYVB 3SYAA 2PTUA 4G80A 2QVMA 1DLHB 1NZRA 3WUZA 3TCXA 4JFWA 3NCJL 2JF1A 4D8PA 5E7BA 1MWAA 4JPKH 4WI3A 4DK6A 1HQRA 4MA1C 2Z7ZA 1RU9L 3UTTA 1O9ZA 1SBBA 1CXKA 2Q3ZA 3H9SD 3DBXB 1G6RA 5IW3A 1H9VA 1M4KA 1VFBA 2QR0B 3SODB 2PWEA 3OB0H 2C9RA 5EPMA 3SKJH 3K0WA 3HPJA 4TUKL 3VFVB 3QIWD 2MCPL 1KFGA 4X4YB 3KMDA 1NCTA 3WFDL 2B7DT 4JRYA 2Q9OA 3D39A 2Y7NA 1N64H 3S96A 3SDXF 2GHZA 4RAVA 1HHIA 3SOBH 3QWRD 5E8OA 2C9XA 1AO7B 3EYUL 3O6MH 3MNWA 3Q2WA 4KVPA 4WEUD 4YHNA 5F7DB 5KBKA 4OM0L 1ZWIA 3HRZB 1GGBH 3FTVA 2CSPA 1TQVA 4U1NB 2Z8VC 3DTXB 4PJAF 5DYFA 2FWUA 1RZIB 2DLGA 1OPGH 4ZUSB 3KR3L 1KENH 4RGOL 1CG9A 1HCZA 2VCOA 3CBKB 4K7PH 2NY3B 4TUJA 1UZGA 2ESVA 4H25A 2DB8A 4Q74A 4FNTA 3W39B 2XWBB 5GISH 3SKMA 2VMEA 4L3CA 2ZUYA 1DBBL 4HISA 5LUMA 1ZA6A 2H3NA 4DHLA 4GG6B 1G1CA 3QZWA 3BVTA 3SB3A 5M95B 3I50H 3QARA 4ZFZA 3FTGB 3MLWL 4OGZA 5I82A 4DIXA 1KJVB 2VDML 4DVBA 2CBOA 4MMYA 5IESH 3ZSSA 2EDQA 3ECWA 4QIRA 3MV8B 3MRQB 1G0YR 5I8KL 4AC2A 4FQJH 2J8UB 3ECBB 3QJXA 2X6UA 3RDJA 1FH5L 3VO0A 3MLYL 1E3ZA 1SJXA 3GXUB 3AQDA 3FT9A 1G0XA 4U0QB 3R1GL 3RGBA 4PGEA 1GCFA 2EE3A 2HH0H 3DLQR 2XKNB 4ACTA 2Y6TE 3B2UC 3ETSA 3TJEH 1DO6A 5IUSA 3HZMA 1MFDH 3NOIA 1XZ0B 5IFHH 4BFIA 1ETZA 4PMFA 4WFEE 4P2OB 1QI4A 4B9FA 3VGGA 2YFOA 2R2HB 3VSVA 2ZF9A 2V6HA 4UTBL 1FBIH 4L9LB 2Q8AL 3CC5B 1E6JL 2FGWL 3UTPE 4K3DH 3QUZB 5I24A 4OF0A 4Q58C 4X9FA 4Z0BH 3I3BA 5I66A 1VZHA 5FA4A 4ODSH 3D3VE 1AVAA 3PWVA 3U2JA 4L05A 5KSBB 2YSSB 2OM5A 5L8JB 4LRIC 4WWKC 1R3LB 1OD9A 5A2JH 3MRJB 3GSNB 1Q90A 1S7QB 4P2RD 4EI6A 4UCFA 4KRPD 4QHNB 2AK4A 4GMSH 2WO2B 4M5ZH 3FSWA 5C0EA 2DTSA 1OAYL 5D1XB 2Z0BA 4IIZA 3WUWG 1D6VH 4PJBF 4WUUA 4A67A 2BMKB 1R3HA 1R75A 2BWIA 4OZHB 4PJXB 3GZQA 4XP6H 2A5UA 4Y2NA 3TBTA 1FE8L 5EU3B 3CFMA 5CXPA 4KI5C 3TIDA 3T3MB