3KM2A

As-isolated tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical properties of tomato chloroplast sod
rcsb
source organism Solanum lycopersicum
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3km2A00
1COBA 1QUPA 1PU0A 1RK7A 1F1GA 1TO5A 1B4TA 1HL5A 1Z9NA 1SXSA 3GZOA 4MCNA 3ECVA 2AQSA 2AQPA 3S0PA 2C9SA 1HL4A 1U3NA 1Z9PA 2WKOA 2ZKYA 2Z7UA 1B4LA 2WZ0A 2WZ6A 3GTTA 1KMGA 3GTVA 4A7TA 2WYZA 5KBMA 3KM1A 2GBUA 2VR8A 4MCMA 3QQDB 3H2QA 3T5WA 3ECUA 1BA9A 3KBEA 3MKGA 2WKOF 4B3EA 3HFFA 4N3UA 1PZSA 4BD4A 2ZKWA 1YAZA 1F1AA 1SXAA 1IBHA 1YSOA 1UXMA 2XJLA 1TO4A 4U4IA 1OZTG 4A7SA 3ECWA 3H2PA 1SRDA 2Z7ZA 1XTLA 3KM2A 1N19A 1F1DA 2LU5A 5CU9A 2AQTA 3CQQA 2Z7YA 1SXNA 1EJ8A 1PTZA 3GZPA 1MFMA 2AQQA 2WYTA 3F7KA 3L9EA 3HOGA 3L9YA 1YAIA 3RE0A 1SXBA 4BCZA 2E46A 2GBVA 2VR7A 3KBFA 1IBBA 4A7GA 2AEOA 3MNDA 1OEZW 2WZ5A 1SXZA 1SPDA 1DO5A 4A7QA 1IBDA 2XJKA 1E9QA 1BZOA 4N3TA 2AQNA 2GBTA 3SODB 2NNXA 2Z7WA 1EQWA 1IB5A 4L05A 1OAJA 1OZUA 2E47A 2JLPA 4A7GF 2C9UA 1E9OA 1IBFA 1E9PB 1OALA 1SOSA 3CQPA 3GQFA 2ZKXA 4OJAA 2WWOA 1E9PA 3KH3A 1JCVA 3CE1A 4FF9A 1XTMA 2VR6A 2R27A 2APSA 1CBJA 1F18A 1ESOA 3LTVA 4A7UA 5KBKA 2V0AA 2ZOWA 1CB4A 1SXCA 2Q2LA 3HW7A 3K91A 2WWNA 1Q0EA 1P1VA 1E9QB 1AZVA 1S4IA 2C9VA 3KH4A 2JCWA 1SDYA 1SDAB 1XSOA 1N18A 3GZQA 1FUNA 1E9OB 4OH2A 5KBLA 2AF2A 1UXLA 2SODB 1L3NA 3PU7A 4BCYA 2K4WA 3F7LA 2AQRA 4A7VA 1JK9B 1DSWA 3QQDA 1JK9A
chains in the Genus database with same CATH superfamily
4FXLA 5EU6A 4JPKH 1CFVH 2N7AA 2YN5A 3BDBA 1ZVSB 3FO1B 1SXSA 4A2GA 4DP5X 5HI5D 5FO7A 3EW3B 2XBZA 1R3JB 4N1EA 4EVNA 1N0LB 3TIDA 1HSAB 1F4WL 3KGUA 4LOVA 1BD2A 1X5XA 2F2HA 4JANA 3T0VA 4YHKL 3VM5A 1UFGA 3LKRB 3KW7A 1UB5B 5E7BA 1EEZA 4A66A 5I2IB 3UTQA 1Z9MA 3QUKA 1XZ0B 1MRDH 2YGOA 1GJWA 1XEUA 3AJ7A 3EH2A 3MNWB 1OTSD 1KBWA 1DQMH 2BSEA 4K71C 5BV7C 2QVTA 1JXGA 1YPZA 4K7FB 1NCTA 4DP0X 1DBAH 2LLNA 5HSFA 1MEXL 2OTWB 1M3JA 3WXVH 3UTSB 4XXWA 1ITCA 3P1VA 3C12A 2CG9X 3CBJB 4PJXA 1BYNA 1NCOA 1FYTB 3DA0A 3UROR 3GB7B 1MNUL 5E2VH 1A6TB 5HYJE 1H6TA 3PNWB 5JDSB 3MRBB 5EUKB 1TSHA 4UB0L 3EO0B 2RJMA 5E2TL 4BZ1L 1UOWA 2AQTA 3GI8H 4QCIA 2OP4H 1NCCH 1ZTXL 1SF5A 4KK6D 4ZFQA 4QRRA 3ABMB 4M7KH 3LZFL 4QRPD 4LF3A 2NX5A 3GSOB 4TVPE 5IB5B 5L2KD 5F89A 1DQLH 5EBGA 5CLTA 1OCWL 2GBVA 2B5IC 1PZCA 5KSAD 1QSFE 1C5DA 1OEZW 2YGNA 2ZUTA 1J9SA 3VXRD 4L48A 1W0WA 4GW1B 1FLRH 4GFXA 5CMAA 3D06A 1UD2A 5AB1A 3WIFA 3VW3H 1HEJC 5DUML 3TF7C 1YEDA 4NLHA 1L7TH 2F53E 2MRYA 2RCSL 4WI6A 4KKLC 4I0PD 3ARBB 3BGFC 4J7RA 4G9DA 3QFJA 3RHWF 2EIMB 3ECBB 4X5WB 4KKNA 4YDJA 5BRZA 3QW9A 3TM6A 2FT6A 4QRSB 4YSCA 1ZGLM 4KRLB 5TQ0H 1BQHG 3QUYB 5MEOA 4EIUA 2JLLA 2ZG2A 3FTVA 4MD0B 3FQTA 3OF6D 2A74A 2E7MA 3K6DA 1S8DB 5FXCH 5CFHA 2X3CA 4XHQA 2WQVA 1O9ZA 4NC1C 4L23A 3S97C 2ZXGA 3LPOA 3MJ9L 4P4KD 5SWZD 5DJ8A 1X5HA 3SBRA 2C4FT 1V55B 4JY5L 4Z7UB 5HYJD 4OFIA 4CMHB 3H3KA 3RDTB 4BM7A 4O51B 1HKFA 1MWOA 2AI0H 2OMUA 4OZGF 1XX9C 3P4NA 1ZK5A 1OGAE 3ISRA 4BFEA 4GRWH 2F5BH 2Y36H 2YPLB 3D0LA 2HLFD 1SVZA 5IG7A 1U3HB 4LNRA 1YEEL 3MV9E 4TVPD 2WBWB 1KPRA 2ZWYA 4EKXA 2ZPKH 4LVNC 2JKRM 5HPMB 1GKOA 4LQFL 3QR0A 4L3FA 1QSFD 2P80A 5GS0H 4U3SB 3Q9QA 4G1MA 4I18A 3X3FL 2UXGA 2I07A 5GZNA 3BAIA 3QS3A 1GYUA 5I28A 3V6BR 1E43A 1I9RH 3PV6B 4ZX6A 4GXUM 5EO9A 2F53D 5D4IA 3G5XB 3DX9A 2QGCA 4S2SB 4OTXH 4AMKH 2FH8A 2I25N 4JJOA 4OD2B 1QSEA 5DUPL 1X4ZA 3W5NA 4DGIL 4UQEA 1NM4A 1FZOA 2JFCA 2WWKT 4HLZG 1EEUA 2X4PA 5CU9A 2VR4A 3QEQA 4YHOL 5FYKH 3EJSA 1G9ML 2VW7A 1E3FA 2WXOA 4MJIA 2NW3A 4EI5C 2BHYA 4CSZA 4XP4L 1MFMA 3JTBA 1DO6A 1YC7A 4AYFB 5C3LD 2J43A 1JV5B 5GIRB 3QNFA 3VXPA 1KTDA 4GP5B 5E0QA 4UV4L 3SHSA 2HT2D 1JNLH 2CRZA 1EERB 4B7IA 1KDJA 3SSGA 2WTRB 2NY7H 4WY7H 1MW0A 4HK3N 3LPFA 3WMSA 4WO4B 2HTKC 5F3FA 1IZKA 1UJ3A 1HHKB 1MQKH 3OJMB 1PEZA 1NCBH 2Y06L 3QUMB 4KHTH 2BP0A 4Q0XH 5LKNA 1MCJA 3VWKA 4PJ5B 1OGAD 1CGWA 1FVCA 4G7QB 5DRXB 5AL8A 3K46A 1IJNA 2UYLA 2VR6A 3RWJA 8CGTA 3BZEB 3BSZA 1JF1B 1CBJA 4PS3A 3QZNA 4LK4A 1JWMA 1FAKT 2VMFA 2YPVA 1HSBA 4X6CA 3TA3D 3U9UB 4R84A 5DZAA 4JGUA 5GQBA 1LJMA 1RIHL 4OGXL 3S6CA 5LVEA 3TJHD 4ICWA 5ACLA 3RHWK 4J5VA 3TBWB 3JV0A 3QUXA 2DJMA 4IKNA 4DPAX 4WKZB 1JWSB 4KKPA 2XG5B 3L3JB 3KR3H 3U30C 2F61A 4ELMF 3QC5X 5AAWC 1O7SA 2QBWA 1YO4A 2DWTA 4MMZB 4NLAA 3JWOL 4FG6D 4HC1L 4JR9L 5F6HJ 4CNIB 1BQKA 2OSYA 2YUVA 3SYOA 2KPWA 3L5JA 4HPYL 5CWSB 1TIUA 4P3DA 3MO1B 3KPQA 4HXAL 4F5CE 4GUOA 4HISA 3U4EA 4UIKL 1DLFL 5E6IA 3T4AC 1EAQA 5CM1A 2IBZY 5SWSB 4D8PA 4E5XA 3LKSA 1NGYB 4Z8FH 2C3GA 3QDJA 1QLEH 5JQ6L 4IOIA 4AIZA 5IY5B 3THMH 2IAMB 2E7DA 2CBPA 4ZO8A 3DX7A 1RXLA 3CLWA 4PRAA 3ZKXC 2VDPL 2X6BA 1Z5LA 2X6CA 4GBXD 3K6IA 4HU2A 1XFPA 4POZC 3L1EA 5F1IB 3FRPB 3VU1A 2H9GB 4JRYE 1THAA 5EC2A 2NY4C 1XQ4A 1CI3M 3KW8A 3ARZA 3QT2A 1G6RL 2QR0B 4K8RD 1P4BL 1KIQA 5HDWA 3NIFF 5IHZA 4R83A 4Q9RL 8FABA 3P2DA 4PHXA 1FV1B 3GXUB 4PB9L 1S3RA 4R5TA 25C8L 2CLZB 3ILPB 1I7TA 4NO0A 3VXMB 4ZFGH 4NOFA 3VFWA 4WUUB 1PF3A 5IEHB 2VXUH 4I4WB 1CLOL 5F3BA 4B5ZA 3KLAB 5TE6L 1MRCH 3ARDC 2OMZB 4NWUH 1S7TB 3BZ4A 4TMPA 3M6DA 2FQGA 2WUCL 3FT1A 4X9YA 4QTIL 3EYOA 3L4XA 1FL3A 1MJ8L 3BP7A 4M7LL 3V6ZB 1AS7A 5D2LE 3OKDA 3EBGA 4PJDE 3AQDA 1JPTL 2BVYA 4HHAA 2Z4TA 1DVZA 3F6IA 1DZBA 2W81C 1DCLA 1X7QA 3ZMRA 2X1WL 3EGSB 3GKZA 1FGVL 3MV8E 4LVEA 2XQBL 5I18L 1CBVL 3I2CH 3EXJA 1YEHH 3SN6N 1JE6A 4J3XA 1PKOA 2NY6C 2WQ8A 5CP3H 3PJLA 5F7KC 1Q9KB 1CT8B 2AXGA 3EOAB 1XMWA 5CLZA 3U7WH 3T0BA 3S5LA 4JRXE 1KCWA 4XN9A 2JSFA 1REIA 3ILQD 4ZUUB 2WO2B 1K5WA 4CL7A 5MENE 1F6AB 3P73B 5I1IH 3NFNB 1F90L 4NZRL 2B0SH 2XWTB 3MBWB 3MUY1 4LU5H 5LG1A 1VGEH 4JRYD 3P54A 4KDTC 2B1HL 2IADB 3U0TA 3KD4A 4RX4D 4FI6A 3FU0A 3O41B 2ZOLA 5IT2H 2CK0L 3KPPA 3MRLA 1TQSA 1XB3A 2CHXA 3GRWH 4WK4B 5EZLA 5IB4A 2Q5BA 4TQEL 1UACL 1DL7H 2ISDA 4UYPA 2DQTH 4YQXH 5SX4H 3UYRH 4QKXB 2EKJA 5B4MD 4M8VA 3U4KA 4X5LA 3LZPA 4PJBA 5J9PB 5T5FA 4B9ZA 4LEOB 2VL5B 5ITFB 2UZXA 3P9MB 3PQYB 4KVCH 4XNUH 5FGRA 2F18A 3S3PA 1IGCL 1QFWM 1XIWB 4HJSA 3RFZB 3CH1A 1ZS8B 2ESVD 4LKCA 4MMYA 1RK0A 5KSAA 2OA9A 3IDMB 3DHMA 2NR6A 1HYSD 5DMGC 3T3MF 5AWNL 3WE6A 2P26A 4G7VL 2IIJA 1MNNA 2OCCB 1FORH 1NWPA 4KU1A 2AEQL 1CIDA 2V17H 3EDEA 4XPBL 1Y1DA 1T0PB 3MV8D 4X42A 2NY2B 4I0PA 4OFDA 4XNYH 3TCLA 1W2KT 2XZQL 2EIJB 4GRWE 3IETB 3VD2A 4IHOA 3WNJA 4HH9B 1ADQL 1RUAL 1TO4A 4GAFB 1KTLA 2AVGA 1M7DA 4GUPB 1HH6B 1CZ8H 2GSMB 4LLVB 1E0OB 3IKKA 4K07A 4DKAA 1RSFA 4BWWA 2DQFA 2ZYSA 4JRXD 1DBKL 5CN2A 5DEZA 4ZAKB 1ASQA 2VDRH 5C92A 2R56L 3WEAA 2OI9B 1U58B 4L4VB 4R4FH 1WEJL 1R9FA 5F96L 5KG9A 5IJDC 4N24A 4I7ZC 3ENEA 4R2GC 4HUNB 3A21A 3UG4A 1HEZA 4F8PA 4B5EA 3P0GB 3AXIA 3HE7D 4HSAC 4X4ME 1DN0B 4YBLC 2O5XH 5DJ6A 4JHAL 2FX8L 2H0JA 3BMVA 4IBTA 4PJGF 4RBPK 4RFEA 1TJMA 2IWEA 5SWZA 4BSWB 3BVNB 1L5GA 2IDCA 3X1GA 1MCPL 2R0KL 1KYOJ 1LD9B 5HYJA 4U6YA 4JLRB 1OO2A 3VFMB 4QXUL 4YR6B 1PQZA 4J3TA 2KQMA 1IV8A 1M3IA 4ZOAA 1OZUA 2Q3XA 4AK1A 4I85A 3Q5OA 3WGVB 4GRLA 4ALAL 3IBOA 2KLRA 4N0UE 3HCVA 1HHHB 1K3IA 3DMMC 2NSXA 2WNWA 3WDJA 3NBNA 4WDIB 3D0VB 2F5AL 4P2QE 1L7IH 2Y0SA 3NZHL 4MRCA 3BUBA 1X5MA 4MJ2A 2MPAH 4JG5A 1QSFA 1MY5A 3FU7A 4OLYH 3UBXG 3BKCL 5L7XL 5IKCB 2ZT9C 1RHFA 1G7PA 1HINH 1NGXA 4H88H 3EOBA 3E9UA 3VA6A 3D9AL 1HJCA 2F53A 1D7FA 3FT3A 4PWHA 5JQIB 2XKNB 3WENA 2Q20A 2VB5A 4UANA 3KZ8A 1J1PL 4ZBJA 3GIZH 1IGTA 4P48A 1R3IH 1B3JA 1PU0A 1PLGL 3B8YA 5D9SA 2F8IA 3OKMA 1IIIA 2AQ1A 3CFQA 5F7HA 5GS0D 1SN5A 5HYSB 2CLRB 2YOAA 4PPTA 3HAEG 4AQ8C 2MNWA 3REVA 3A4AA 2BSRA 3VU2A 4HWEH 2DLTA 4LLYA 2BPBA 1HEHC 3GKWH 3MUUA 4JCWA 4NQTA 4PSPA 3V5KA 3IXTA 2EIZA 2AJYH 3PAUA 4UM9D 4UUJA 3B3IA 5J6HB 4D8OA 4JY6A 2VYRE 5GJTH 2H1PL 1SJEA 3S34L 3MR9A 3ECUA 3UAJC 1VFAA 1A1OB 4I2XA 5C0AD 2WLIA 1BPLB 1KCSH 1IM9B 1EX0A 4MA7H 4HVBA 1OGAA 4XCNA 1TJHH 3EYFA 1QFUL 1I1AB 2C9AA 1F4XH 5KYXB 3VGAB 5CN3A 5ANME 3O3AA 5I1HL 4PB0L 2ZXCA 4P2QD 2QSCH 3NSXA 4ZUVB 1KXQA 1XHHA 4O4YL 1HAWA 2J44A 3HE6B 5D6CA 4AQEA 1VEOA 3BPNB 5KBNC 2OTUA 4AG4H 1HZHH 2BNQB 2WBKA 4JDEA 3VFUA 4GG6E 4QHLA 3V4VL 3HLKA 1WT5C 5KW9L 2YOCA 2Y7SA 4YHNB 1FYHB 2I60L 3BP4A 2AFNA 4L3AA 1MAKA 4TQ8A 1IFRA 3WELA 3MLWL 4MDJB 1UWXK 3QI9B 4FZ8L 2XWDA 1AJ7H 4W4NA 2FZ3A 5F9OH 3N6YA 4U2ZA 3ULUE 4PS7A 3F04A 4G80A 4DVBB 2PCFA 4Z3HA 4KKRA 4KRNA 4JGNA 2HT4C 2JKLA 1J10A 3QFDB 5T3ZL 1O0VA 2NY3B 1WIPA 4HMDA 3MOQA 4YFLI 3KYOB 4XN4A 4L9LC 3VWKC 5DK0B 3PGCA 5AB0A 1IQDB 2FB4L 5D4QA 1CGSH 3QDGB 5GS2D 1EZSA 1MCKA 4QWWC 4BFGA 4F9PA 5JIQA 4GW5A 2ADGB 1JI2A 4QHKI 2MSPA 3GJFK 3ZDXB 4N0FA 1MJUH 1CFQA 1EHAA 3WIIL 3WIHH 5LJYH 1R0AL 1E4XI 2LABA 4DEWA 1KJ3L 3DUUA 4H8VA 2CIKA 2BDNL 5GGVY 3M07A 2KT6A 2Z92A 1Q9LB 5D7LE 5CZKA 4ZS6D 3SQBB 1PGRB 1NSNL 2YZ8A 5HY9A 2YWYA 5AVWB 3OHXB 3K6OA 4BWUA 2FNWA 4M56A 2F7PA 1ORSA 2ZWZA 1PS3A 4KK8C 2QADC 4G8FB 4XC1L 2VOTA 5EHFA 4NKOB 5CJXC 1FL6B 4YHIB 5KYNA 4O2EA 4LO9A 1N0XL 2WN3A 1T1WB 1KB9K 3TN0C 2XPYA 1OSPH 2NY5C 4ZUWA 2VR8A 1FNLA 3JTSA 4HK3J 4N2DA 4ZSOB 4MKMA 3Q2LA 1A9VA 3N44F 3LMJH 1IZJA 2YRLA 5JA9A 2UZPA 1B6UA 1QTSA 3E1F1 3UJTH 1M1XA 1N3NB 3ULUD 1MJ7L 3BISA 2VDLL 5TE4H 1EHLH 4BZ2L 1PDKB 4MX7B 3FQNB 3KVQA 4HJTA 5C0GB 1VACB 3KLLA 3TBBA 4QT5A 1A7OL 4R7LA 1W16A 3BPCA 3H9HB 4H1LB 4KKBC 5DHYB 2BRRH 2R2HA 4G8GA 2Y2YA 1XCWA 2A9BA 1ZEAH 4LKXB 2VZUA 1K4CA 5IMKA 4HS8L 2QFRA 3ABLB 5IOPA 4PCYA 1IKFH 2EVFA 4WW1B 2HWZL 4NP4H 2R0WL 3C60C 5EN3A 2DQHH 4JRYA 4ELDA 4ZMAT 5FCUL 1BZ7B 1BVNT 4QR7A 4RX4A 2FR4A 5EWIH 5DZPA 1VZIA 3QORD 4NJ9L 3VG9B 5HGDA 3RU8H 4PGJA 2H26A 3OX8A 3ABZA 1GZQB 1I7ZB 4K94L 5BW7A 5D7LD 2PABA 2A6JB 1RP8A 4WSJA 1WE5A 3L95B 3QUMH 4FLQA 4GKNA 4DFIA 5IFAH 1U93B 3CQPA 1KV7A 3RWDB 3ZDYB 1QNIA 1MG3C 3TTSA 1CICA 2IALB 5CJQH 3GXMA 4MZ2A 4PJEF 2ESVA 2XT1B 5HI5C 3MHZA 3NSYA 4HJUA 3MAWA 2F54E 4KUCD 3SGDI 2UWEE 3DXAA 2N0MA 3QJOA 4H2CA 4LL1A 3S2AA 2CNYA 3IAGC 4TM9A 3M1OA 1QBBA 5AVXB 2QFPA 4LPCA 3MV8A 3U0WH 4JVPA 2PWHA 4UYQA 5C0DB 2Q10A 2GI7A 1OTSC 4LHJB 4GSXA 4Y2NA 3JV4A 2Z8SA 4APQD 3CZFB 4XNXL 4FTDA 5LQBL 4JHUA 1IL1A 3FB8A 2JIXA 3B9KD 2IBZX 3CXDL 5DMIL 1F1GA 5HI4C 4FQJL 1B0GA 3L2NA 4R7VA 4UMGA 4UOQA 1NLBL 4AJ0A 4Z77A 1QTPA 4M8RA 5K1NA 5JIHA 2ZUUA 3ZW3A 1OM3H 5DDHB 3AU1A 5K33A 1M42A 3DRTB 4IMLA 1TVBA 2WBJB 3GXPA 4GLRI 2AJVH 3PHOA 4RLDA 4LCUB 3ZN6A 4C54A 4HDIA 2VLRA 3NAAL 1MFEL 1N68A 5IHWA 5A2FA 4KK6C 4PW9A 1K8DA 4DNLA 1EEYB 5I0YA 1MXDA 2CLVA 4ODWB 5TE7H 5E8OA 4A2HA 1KBBA 2D9QB 3QCUH 4OZFA 4AZ8A 5E00B 5IMLB 5D5MB 2VW4A 5KSAC 4XO3A 4JFUA 5IQOA 3AS1A 3CZUB 2FGWL 3DUSA 2ICWI 2YQ3A 3QEHB 2COQA 3X14B 1WQVT 1MFDH 3JTTA 1FGNH 4OJFH 1WFNA 5EOTA 2HH0L 3L81A 1RZ7H 1INQB 1X5JA 4PBXA 3SPIA 3L4TA 5FGSA 2RAMA 1C7TA 3GBMH 1DBBH 1D2OA 4ZFOB 4WI9A 4GIOA 3NN8B 3RWCA 2C4FU 2EDEA 3UTSE 4RVBA 3UZVB 4HGMA 5BUAA 4Z7VB 1N64H 1P69B 2E75C 2WZ5A 3T77A 3U4BH 3KPNA 5FA4A 2BWIA 3GSWB 2LQRA 1ILUA 3H56A 2NCMA 4DF9A 4P4KC 1A1MB 1VPOH 4YDVA 4ONHA 3UZQB 1OPGL 1E3ZA 3KPOA 4OJAA 4ZODA 5HDQL 3WUWG 3ZMEA 2VXTH 2DD8H 1VGKB 4MAUL 1T7XA 4FJYA 4QRTB 4X0KA 1OCOB 1JXDA 1OV8A 2DM2A 1FNHA 1CLVA 2YEZA 1XAUA 2OMXA 1AR1C 5C0AA 2W0LA 5I24A 4HCFA 1EAJA 4PCSA 4JS7A 1A1NB 3O4OB 4LBEB 2OS7A 1BFTA 2GTQA 2AF2A 1L3NA 3DIFB 4IEFB 3NEOA 2MOGA 1DDHA 4OQ1A 1A7NH 4N0UA 4IIQC 1MJJA 4FFWD 1GIGL 3GUFA 3JWNH 4P2QA 4TLSA 3U1SH 4Z23A 3IXAA 3SQRA 5IROC 3J8F7 2X2IA 3O2WL 5FUZL 4W4OA 4MCYB 1H3UA 2BIMA 3PP3K 3GMMA 1U8LB 4MA3B 3M1BA 4L5FH 4LRIA 2QV4A 2V5YA 4AC2A 5IVZB 3ZPDA 1LEGB 4DN3L 2WQRA 3ES6B 1MWAB 1TZ8A 3FOLB 3UTSD 4RAUB 4O02L 2AITA 4XNQB 4OZIA 2C1PA 4DP6X 2DV6A 2FBRA 3WXWH 1FO0B 2CDEB 4Z7UE 1IEBA 2BJML 1V3KA 1A0QH 2HT2C 1F86A 3QCVL 3KGSA 4N2CA 1QWUA 4NQXA 5FW6A 2P5EB 1MUJA 4M7JH 3FQ4A 2WNKA 3L3OB 1CC3A 1GS8A 3VFRA 5D1XB 2NYYD 4R5XA 3RNKB 3HJ0A 2IJ0C 2CGZA 4OM0L 1JVOA 3PPEA 2X38A 4XN5A 5JORA 1X5IA 5CILH 4YHLL 4X7CC 4FNUA 2FUTA 3B9EA 2B1AH 4PJGB 4ZS7L 2R29A 1NOFA 4ICXA 5H37H 3ULSA 4WRLA 3MNZB 4E5XG 4LAQH 4AJVA 1R3KA 4KGLA 5B1AB 4XX5A 4U1MA 3HNSH 4L37B 1B2YA 4ZQKA 3TA3C 1Q0XL 4URKA 5C0IA 1RZKC 5F88A 3ARBD 5F7YC 4AYBA 3VWJD 4KI5E 3TJHC 1FDLH 2B4CL 3DROB 3QO1B 5HVHC 2ICEA 3U79A 1IBDA 5LGHH 4D0CB 2CJTA 4FXKB 4QHPA 3BAWA 1LNUB 4TL5A 1MAML 3B7RL 2C3VB 3AFLA 1CFSB 4GG8B 4M48H 3LZLA 1OF2A 4TVSa 3KNBB 4YSQA 3FO9A 3QARA 1ZT4A 1BWMA 2NUPA 2OXHA 2XNAB 1OHZA 2H3KA 4JFOB 3UTTD 2WJ7A 3VAEA 1UM5L 2Y5TB 2CO7B 5T1KB 4JKNA 1YDPA 1F41A 2KMWA 1ZHKA 3PIQA 4PRPA 4UOW0 1JHLL 5EA0H 3MLRH 5EFIA 1OAUH 3QJHA 4NCC2 1IGML 5H94A 1W72A 3WDIA 3KYNA 3TJEH 5AEAA 5CR1A 4M9OA 1EGJA 3ZE2B 2DBLL 4GBXC 2CGRH 1UZGA 1UXLA 3JXAA 1LK3L 3BN9D 5EZOH 1ACYL 2N4IA 2QLVB 3HZ3A 2VXQA 3LKQA 2CCLA 2X6AA 4MCMA 3LXUX 1KJ2A 2DYRB 4BFRA 1NGZA 1GW6A 4F2EA 1IAIM 3LRKA 5C0JA 5AD0B 3K8LA 1P9MA 2GJJA 3J27A 2I9TB 2ERJB 5EZJA 4N8UA 4PGEB 3VH8G 2V8LA 3S5LG 1S2EA 1S3KL 2XWJB 3T08A 2GTWB 5T5NG 4UWQB 5CHNB 3E6HA 2OX5A 3DOHA 4P4RB 1S7SB 3V0VB 3WN5B 4ONFL 1QFWL 1G9NH 3FSAA 2G9HA 3BIBX 1OAQH 4HIHB 5HHVL 3QORA 4FFYH 3GTTA 3NMEA 4GXUN 5LAXB 1E50A 3FRUB 4KI5D 3SY0B 3PXJA 2FWOA 2R15A 2P8PA 1UM6L 2NXZC 4OGZA 3BLBA 5IHBA 5C6WH 1JPGB 3SJVB 1BVKA 1U3JA 1ZVHA 4N3UA 3B9VA 2DOCA 3IJEA 4WEEA 4OCMC 2BOCA 4BD4A 4X8JA 3QUZB 2HKFH 3TV3H 1W0YT 1QEWA 4IS6B 4LPWA 2X7LB 3UTPE 4KQ3H 5ALBL 4PR5B 5EBLA 4DN4L 2BHZA 3BUPA 3CDCA 2D3NA 3ECWA 3W9DA 3DKHA 3CU7A 5GGTA 4E9QA 5BRPA 2A4CA 1HTYA 3L9RA 1FN4B 3HNVH 1F13A 2A5UA 2YMXL 3CFDA 3SPJA 5F0PB 2XN9B 2ZKMX 3QCTL 4R4ND 1T5XB 4Y16D 4L1LA 3LQAL 1DQDH 2Z7YA 4A68A 1DQTA 3GZPA 4F33B 1OGPA 3ILQC 3CX5K 3UIZA 4Z5RB 1JZIA 4Z0XA 5EU7E 3MUZ1 1ZT1B 3IJSA 5D1ZI 3G5YA 5IZ7A 4MJ4A 3FF8A 2W0PA 2MKWA 2ZF9A 4QXWA 3T65A 1R5IB 3L16A 1J1OH 3IGFA 3MNVA 4OAWA 2FECL 4QGTA 4K0OA 1JOIA 3B9KA 4NENB 2FD6H 2K9FB 4G70B 3VXME 4FQQA 3DJRA 3HZMA 3KE0A 1J1XH 5E1AA 3LXCA 4OCXL 1F00I 2WWOA 3SO3C 4Y4KB 5B4MC 1UWEH 5IW1A 4V2CB 2F58L 4JCMA 5I1JH 2DYPB 3L6FA 5D8JH 1B6DA 2YUWA 1ZXQA 4LSPL 3S8FB 3VSQA 4KKAC 2X3BA 2WM0A 3K91A 5C9JB 4W9DC 2LU7A 2V5SA 5FEBA 4LHQB 1MCIA 2R69L 4DVRH 1KFAL 2NPLX 1HYSC 4YXHH 3ALXA 2FX7L 2Z8VC 4AE0A 1LO5A 1H3PH 5JPMB 5C0CB 3DBXB 4RZCB 3UC0L 3MDJA 4A2EA 4X80L 5CZXD 5DC0A 2GJRA 4JHBA 4JO2H 5FECA 4FQIH 4FXGB 4U1GB 5JPNB 3R19A 4FYTA 2GT9A 2E8YA 2EUVA 1YNLL 1UCBH 1BV8A 4FKKA 5DI8B 1UA6L 35C8L 3MROB 7FABL 1EBAA 3NIGE 2Z4QB 1T1XB 1O75A 2VM9A 3QVAA 3WL9A 4Z7AA 2ZP0T 1WAAF 5HGHB 5AB9A 1JS4A 5CIPB 4W9JC 5FDWA 5KBMA 1Q90A 4YDMA 4XMPH 2EP6A 3JWNE 3HE7C 3HMXA 2DQIH 3HFFA 3VXSB 2FWSA 2CDFB 1WBYB 2JCCB 1FH5H 1T20A 4YE0A 4X8GA 5AVSB 2G3ZA 3MFFA 3EH3B 4AGOA 4L5FE 4LLUA 1GMIA 4H1LH 1I9JH 3ARXA 4GAJH 1P7QB 3RDJA 3MUJA 2D4DA 4UT7H 1XBDA 3N85H 1B0RB 1HCVA 4WV1B 1CXKA 5DLMH 2IGFH 3BD3A 3VTMA 4XB3A 3W1ZA 3WKNA 3LNGA 43CAB 1E6OH 5IMMA 2OW7A 3DPBA 4KAQL 1TG8A 4D0DB 4LHUD 3TL5A 4JFDD 3IYLW 2PWFA 3VRIA 4ZXBB 4KZEL 1WFIA 3WFZA 4MDIA 3ARGB 1JNHA 3ARTA 2HX7A 3IMUA 1LP9B 1Q4NX 4OCWH 1TMQA 4LDLB 3UABA 3WEMA 4L4VE 4FADA 1VA9A 4A67A 3WTSA 2XWZA 1WZKA 4R8WH 4AVHA 4HIXH 3AS2A 2Z35A 5DD5L 5GS0C 1T03H 4HH8A 2HZHA 4NNYA 3FBQA 4QAWA 4JL2A 4M7ZC 5HVGB 2CH8A 5TGBB 1KIPB 3C2AL 4XVUD 1MKFA 1KCBA 4EBQH 2BXZA 2H3XC 1EJOH 2XV0A 4WLCA 2E9GA 3O6FB 4R9HA 1E2ZA 4WJ5A 3BQUC 2EICA 5I1KL 1UASA 4A7VA 3FN0H 3V0DA 3BUTA 4XPGL 4W9KC 4JFWA 3MMEA 4JPQA 4L8SB 2YAHA 3FL7A 1G7HA 1PYWA 4OFPA 4PJHF 2HYMA 4YSUA 2WD0A 5E5RB 5ID1B 3QXUA 3DDGA 1PEWA 2ZAIA 1IC5L 5G55A 1BEYH 3OPZH 1Z9SB 3AROA 1A5FL 4JN1L 1TTAA 2YSSB 1KNOA 4WEBL 2NY2D 1Y18B 3VWJA 1HHJB 1KY6A 3VCLB 4XVTL 1XH3B 15C8L 3H9ZA 5FYLL 1CYXA 2BCKB 2APBA 4LRIC 5DO2D 3UJJH 3BT2H 1C9SA 2VKWA 2H7WA 1C1EH 4WTQA 5HJBA 1MFNA 5MI0B 2R2CA 2AJSL 4L4VD 3RZCD 3UTTA 5IQLA 4Z1PA 2A99A 1BZ9B 5MP6L 1U8PB 3QJUB 3BPLC 5JNYB 4WKXA 2OSWA 4Y5YA 4XGZB 1ZV2A 2AVFA 3SYCA 4HZ1A 2A2QT 4G42A 5B38A 2WLZA 2C3WA 4LCIH 4PJ6A 3U9WA 4ACPA 3OTTA 3II1A 1J5OL 2CO6B 4W68A 4MD4B 2NT1A 5DYFA 4M8QA 2G60L 4KOBA 2W91A 3BP6B 2VR7A 4XNMA 4PM1A 1RUML 3EJTA 1ZLVH 2QKIB 3B7SA 1U8MA 1TYJA 1AGBB 4NYLA 3OAZH 3U0PB 1RCYA 3SDDC 4ZQTA 1BAFH 5K1VA 2Y1ZA 1HU8A 4W81A 2ZE0A 4TUOA 3VGEA 4H20H 3GLEA 2EE0A 3BYYA 2ADFH 2R9HD 1XF2A 1P7KB 1MHPL 3Q8EA 1E9PA 5D2NA 2R7EB 1AC0A 3OGCA 2VQ4A 2LLLA 1J8KA 5DK2B 2GK2A 5K39B 3O8XB 3IKCB 3T3PF 1C5CH 2CIIA 4I88A 1KCLA 3ABKB 4NI6A 5LUMA 4X8CA 3VFPA 1PIGA 1KB9J 2H5UA 2PO6D 4ZTPL 3OMZA 1G7IB 5FUCE 2VLKB 5INCB 4XHJD 3FFCB 3NG5A 1OIOA 2UZIL 4URTB 1YEFL 3QHFL 5KVGL 2NDGA 4HQQL 4X7FC 4N85A 3ULUC 3JV5A 3PNRB 5I66A 4HGWA 1ETA1 1H8NA 3HJEA 2CDGA 4NZFA 5E4EB 2J4WL 4PTUA 5I16A 4Y16A 1ECZA 3I50H 4RETB 1UZ8B 3QDGE 1LQBC 5ERWA 1MF2H 4NHCH 3INUH 4XOBA 4J3UA 3H85A 5T1DL 3ZDXE 3P0YH 3QIBD 2IAAC 1C08A 2QGEA 1P9MC 4GLRH 5LDSA 3AY2A 3EFFA 3MRPA 1MWAH 5IQMA 2LFGA 1AD0A 4JB9L 4OLUH 4DTGL 1ND0B 4ACTA 4N5EC 1I1AD 3CUPA 4AMXA 2ODHA 4N2NA 4H8WH 4EO5A 1S9XB 4I13B 3DO7A 3FQXA 1A6ZB 2BVUA 2JTDA 3MRMB 1FO0H 3E8UL 4FXTA 4NT6A 3QRFM 4WGVB 5FOJA 2XICA 3NJFA 1C16B 2PXYB 3HE6D 5D72L 4TOYH 2DQEH 3HVNA 4WCYL 4Y5XC 3FOMB 1OOAA 3O6LH 4PJIA 5C09B 4KK5D 4JAMB 2K3TA 3Q6GH 3D52A 4OZHE 3T0EB 1DE4B 1XCXA 1KLFB 5F7DA 4N2MA 4WGWB 1AS6A 4MNQE 1FAIH 2IDSA 4M1GL 1YECL 2HPOA 3BE1L 3CQQA 1NCHA 1QNZL 2OPCA 2ZNWA 3QSKB 1TQCB 3K8MA 4PP1D 2PTVA 3MBXL 4ZUTB 3SE8L 2WYTA 2IWFA 3NCXA 4NQSB 1RJZB 4QD2E 3F64A 3FAWA 4IRJD 4PV9B 3PWNA 3MCYA 4ODSL 3DVGB 3H42H 4P5TA 4U6XA 1JGVH 3QH3B 5FHBL 4UM8B 1DSYA 3CCHB 2FQFA 1J5CA 3SDXB 3CZSA 1MZYA 2D3JA 4NZUH 2KPNA 2OFQA 3FQWA 2KDYA 4OZFG 4KFZC 5I74B 2GITA 3ULVE 3DETD 3HS9A 2G5RA 2EH7H 5I17B 4WHDA 6TAAA 1OLLA 1I9IL 3BH9B 3LN9A 1VCAA 4APQC 5CSZB 4CJ0A 4AQ1A 3CFKB 1I82A 1LEIB 3HUJF 3QDGD 1P4IH 1EZLA 1WCQA 1GGYA 2IOIA 2DEXX 2G75A 4ERSH 3ESUF 1IAOA 5I8KL 4DKFL 3UAFA 2EKSA 2RMNA 4ODUA 3HC0B 1MLBA 1PL3A 1J8HB 4S0TD 2D7TL 3RP1A 2BSBA 2VQTA 1INDH 3ET9F 5INDA 1LK2B 3QJTB 1A6VL 2CSPA 5B1CA 2YD8A 4ELKA 4KTDL 1PSKH 2K6YA 4MSWA 4ZUSA 2XXFA 1R17A 1YG9A 3L7FB 5ADOH 2WKLA 5AYQA 1HQ4A 1ETB1 4JHZA 4XP1L 5PAZA 1XF1A 5F1NB 1NKRA 3ARVA 3ZDYE 4RMBA 1T5WA 2AMUA 4MDRA 4NI3A 5K59F 3D85A 4H25B 2YBRA 5ISZA 1MCNA 3NTCH 3BW9B 3BKJL 4FP8L 1I8KA 4NM4L 3P9WB 4MNQD 3BRGC 1OSZA 4PJCB 3VI4B 3MODH 5B3SB 5IBTL 1I8MA 2X1PA 1MCRA 2A6DA 2X6MA 4NUPA 2DIBA 3L1OH 1GGBL 1NPUA 1AS8A 1JN6A 1W72L 3A4DA 4K3EH 1DZ0A 4TUKH 2Z8WC 2BOBB 4GKOA 3L3DA 5JIIA 1PX3A 5AVYB 4B9GA 1EGJL 4LHUA 4PJAB 4JFDA 3DX6B 4MWFB 3WFHB 4RGMB 2D7PA 4CSSA 1X7SA 4GW4A 3ULVD 4YDKL 4IIZA 4KJWD 2J6EH 4B9JA 3Q8CA 2R23B 1MFUA 1R5WA 2OW6A 1OAKL 3AG4B 4WJKB 3LPPA 3LDBC 1ETJA 3LRGA 2VQ1B 4XMUA 2EACA 2L8AA 2NXYB 1HOCB 4OZ4B 5FW7A 1NBZB 2VUOA 3BP5A 3M1CA 4WWID 5HYQA 3SE9H 1QR4A 4F8TA 3VACA 5FYJH 1NANI 1AY1H 2AAVA 5AZ2H 5TDPB 1H3TA 1AMXA 1OARL 1PPIA 1D6EB 1YMMA 2DLGA 2WXGA 3BD4A 4GO6B 5DXWA 3V4PA 3C5XA 4NRZB 4OJEH 1KLGB 2VDMB 4P0DA 3LNFA 1TU2A 5D5ME 1BLNB 3C5ZA 3AQYA 2IDFA 3PDOB 1JZ6A 4AYDC 1JP5A 1URLA 2VZOA 1TQTA 1XGPB 3GMOA 2EYTB 5I82A 4BGLA 2HUEA 5BXFB 5K9KB 5JIKA 3GBLA 2IDQA 1L6ZA 2FIKB 1AYOA 4LSSL 5T3XL 4X6DB 1A7PH 2C9QA 4K9JA 4EXKA 5LGJB 3QGVA 1MHHB 2B1OA 1U0QA 1PG7W 1GCYA 3W9EB 1HHGA 2R4RL 3AXLA 3B2VL 1KXTA 4FFWC 1ZHBB 1BQHB 2YK1H 4HJ0D 1MIML 5ICZA 1A9BA 1A4AA 4ODTL 3TTYA 5T33H 3K72A 2MNJB 3P4MA 5EF1A 2P28B 4PJFA 2GAZA 4Z7VE 1KUMA 3QIUD 3HZKB 4BELD 1WAEA 4F7PB 4XAWH 5C0FA 2XXCB 1V5JA 5AW7B 2UXVA 1WFTA 4LVOC 3W81A 4U7SA 3UAAA 4E41B 5FF6A 4G8EB 3I6LE 3DOIA 4WW2B 4QLRA 3X1EA 2FJHA 1WZMA 5EUOF 1CLYL 2OL3A 1GAFL 3RZCA 4YX2H 3CXFA 3PWJA 4JCLA 4FI7A 2QHRL 3I9GL 5LBSA 1DUYB 2WBJD 3ZK0A 2YQ2A 4IGBA 4YNYB 5DYOB 2FJFB 1XF3B 2PCPA 5FKAB 3FUHA 2W9DL 3E80A 1T80A 3STLB 5I23A 1SM3H 2XPGB 1VF5C 1IAIL 4OCSL 3UPAA 5E23A 4HXBH 1JYXA 1A4JA 4H0HB 3KBHE 5AG8A 2C9RA 2EIKB 1SN2A 3CFCL 2ALAA 1R24A 4NQEB 2GHZA 1SYVB 3HG1B 2XBTA 1A4KB 1WITA 2CGYA 5D7JD 4MXVF 3MXVL 1NBYB 5CIPH 1BBJB 4YSTA 3QQDB 1FCGA 1E5YA 5EU5B 3ARBC 4GSUA 3VWJC 1T6VN 3WFCH 1F1AA 2LVCA 1HDMA 2BVQA 3BIKB 4P23B 4P99A 3DX8B 4HUMB 4Y9EA 4K7PH 1YMHA 4LFHG 5JIPA 3G6DL 3EGDA 5FDYA 5IQNA 3QUYC 1K2DA 2Z8RA 4GT7A 1U21A 3ARED 3QZOA 3QUGA 3CNKA 3UBFA 4YS4A 1H6UA 1TTRA 3CHXA 1EIBA 2EIDA 1HXMA 3R7QA 4YPGB 4KV5F 2XZAL 1JTTA 4DAGL 2PO6A 3QQ9D 4QPEA 1SOQA 3I6LD 4AM0A 4KVNL 4R0LB 2P5EE 3L2MA 4FFTA 4IMKC 2QQLL 5D1XE 43C9B 3DRQA 3IU4H 4JO4H 5I5MA 1AE6H 1E9QA 4Q2ZB 1RHHB 4R26L 5B8CB 2JI2A 5ADPH 1T1YB 3MBEB 1WAPA 4NN6B 4PG9B 4FA8A 3IAPA 4TQPA 5ALCL 4XPTL 1BSIA 1KENL 3PLYA 4N9GA 4NSKB 1T2QL 3SPVA 3FONB 2GBAA 1HL9A 1JZFA 2XA8H 4LLMA 4PVLA 2ICES 2NNFA 5F3HA 4C55A 5JHDE 3QIBA 3CN0A 1D7BA 4XVOA 5I1AB 3FO2B 4JNXA 1T2JA 3RB7A 3GMPB 3CC5A 4TULL 4EOWL 3G08B 5JHMA 3GK8L 3C6LD 1C8PA 2CQVA 1BJMA 3ZX1A 1NAKH 3HN5A 4YWGL 5I6PA 1JSYA 1DN2A 5AOKA 4KI5C 4FFZA 1PW3A 2WXHA 2IPTL 4PSRA 3DUHA 1DUZA 3LIZL 5E08H 3CPLA 5KYYA 1RU9H 1IM3D 1S7QB 1NDGB 4AIOA 2ITDB 1ZLWH 3CIAA 1O9VA 2XN2A 2ENSA 3DVNB 1FVEA 3GSNA 4PGBA 5CJ8A 1LO3H 1N26A 4LCWB 2W92A 2AQPA 1CE6A 3TOPA 3QZBA 4AC4A 1HL4A 1FJ1B 3IFLL 4CADB 2WKOA 1VZGA 3RPIA 3CFBA 4IRJA 1UHVA 2IGLA 3FNKA 1Z3GL 4Y16C 4IHBA 3AQZA 2OR7A 3IDIA 4JQIH 2N1TE 2X6UA 2P5ED 3NABL 2I9LB 5CLWA 2DLIA 2VMCA 3CDZA 4FHKA 1BVLB 1Q0YL 1VCBC 2BCMA 1XF4A 4NX0A 4FABL 3MJGX 2PPAA 4L9DA 1MHCB 2XU9A 3BO8A 1OQOA 3U46A 4AITA 4P3CH 4OF3A 2VDNL 5GRYA 5GRVK 2NDFA 2Z93B 4L3CA 3A4FA 3GO1H 4OLXH 1S78D 3HC3H 3KHQA 1A6AB 5DJDA 1OP5K 2L3BA 1FC2D 5KANI 5JHDD 2WTOA 3GMQB 4JFXB 4K7PX 2KLSA 5L8LB 4XMVA 3I9IA 4JG0H 4X6BA 5DUBB 5E4OA 3VGDA 4X6FB 1EZUA 2N0KA 2QTEA 4IOFC 4NQVA 2IPKA 5LBVA 4LSQH 4Y7MA 2DMHA 3ZSSA 5DZ9A 7PCYA 2GW5A 2N01B 5IK3A 4EPSA 1PCXA 2OMVA 1JV2B 3MJ6A 1KGCE 4Z7OB 1I7RA 4PLKD 4GSRA 1PZDA 5KJRL 5KSBF 4U1IB 3FMGH 2YC1A 4L2LA 3KPRB 5E9DE 4A7QA 3HMWH 5L8JB 5EBWA 4C83B 4MS8D 4OZHA 5TDNB 2GBTA 3GYRA 2DLFH 4OIIH 4YH6A 5AW6B 5FGBA 5TDPA 5FYJE 1RQ5A 2XN9E 1EUUA 3VFGH 3LSOB 4R7NA 5DJXA 3VTAA 2B5IB 3Q01A 3VFVB 3UBXI 4HKBA 3D18A 4GSDH 4W9ZA 5DC2A 1S7UA 3S88L 1F8TL 5MEPB 3HR6A 2V2TA 1KJVA 1TZIB 4KMTL 2FEJA 3LZNA 2WGNB 3BGFB 4RAVB 4O58L 5KVFL 2GJ6A 2X4UA 4N0CD 1KACB 4HZAA 5EU7C 5HHOE 1FWXA 1NFDB 5AW3B 2OZ4H 3RGBA 4P5KA 5C97A 5SX5H 2FEEL 3ZRSA 3JSSA 2P24A 2E7BA 1NTDA 4Y19A 4NGHH 3A24A 1YVLA 2XIIA 5JXEA 3VGBA 5DJAB 3CH8A 3H9SE 4JDTL 4CKVX 3DSFL 3QNXA 4MNHA 1A7RL 1BX2A 2AZUA 3EUDA 4PRDB 3HR5A 3B56A 1M4KA 3BWZA 4XI5D 3MA7A 1AI1H 3QEUA 5BZXA 5C6TL 1KN2H 4QF1B 4Z0BH 5I19L 4JJHA 2YPKB 3CZGA 4H0LC 3FUMA 3HI5L 3SE3A 4I48B 3AADB 3KPLB 1EO8H 1RKRA 4LSDA 2YN3A 3BEWB 2CO1A 4FZEH 3QUZD 1K6QL 1KGCD 4YZFE 3RUGB 3GTVA 2EUWA 1W8NA 1MPAL 5JO5A 2ZZUT 3WLWD 4JM2D 4OKVB 3BWAA 3CSYB 5E9DD 3N1GC 5CEYA 3T9WA 3QULA 3RY5A 2J1ZA 4GS7C 4L1DA 5FYJD 4A6YB 2WKGA 2XN9D 2FT8A 3BXNA 4MQ7B 3ZZ1A 4ANKA 4Y4FB 4DT2A 4POYA 4F92B 3VXUE 3IDUA 2XPZA 2OULB 1IU1A 2JJTA 3DSNB 3STZB 1QI3A 3H3PH 3SGKC 4G7YH 1S6NA 1OT2A 1RURH 2J8OA 3SKOA 4PBDA 4BSVB 3IMVA 4Z7IA 5JIMA 4OI8A 1N6VA 5J8OA 4JFYA 5GGQH 3U7AA 3RILA 1GGTA 3QIUA 1MQ8A 3MRIB 3D2UD 4QXTB 2Z91A 2QQNH 2P8MA 4UBDC 1SJMA 4DZBB 4HV8B 3K5SA 3FAXA 2C34A 5KS9B 3CHOA 4YDZA 5HHOD 1EAPA 2DM7A 3ETBF 5DZNA 2VR5A 4WFFE 5GRUH 3PHAA 4U1HA 2JCCE 3HUJB 1ID5I 3JWNC 3BAKA 3SD5A 2F1AA 3LX9A 4XVUC 1TKWA 2MQ0A 3P9LB 4IM8A 3CBKB 1AG0A 2WLLB 4FNRA 4OD1H 3HZVA 3H9SD 1WFJA 2A9NL 2WXQA 3JWDH 4A55A 5ILTH 2AGJH 1JGDA 1MDAA 1EBPA 3FT4A 4ZNEA 1IBFA 3VFSA 3QG6B 4KQ4L 2AJZA 4CU8A 3RFZC 1J9CT 3PGDA 5DD3H 3RWEB 4JM4H 4P2RE 5EN2B 5KZCD 1N7MH 4XCYB 1G1YA 5F9AC 5IHUH 3MRDA 5B38G 2UVFA 3AT8A 3FTSA 4MVBD 5D7JA 4AQAA 1DEEB 2PUQT 1RJYA 3TWCL 3ROOA 2WUBH 1ZSDA 4JZNB 1V7MH 2N7SA 3HFML 2IANB 2NY2C 4JQXC 5TF1L 3S35L 3FPXA 1O6VA 5E2WL 1D5ZB 4CW1B 2IDTA 5C08A 4EI6A 4E0RB 2C3XA 2H47C 2I32A 3GHEL 2NQ3A 3IDJB 1J48A 3MCKA 5IQ7L 3GMRA 1A4BA 2AXHA 5EIIA 4BH7B 2B59B 5D7IF 3VXUD 1E65A 3C08L 3ZL1A 4ZAKC 3MGOB 4O2CB 1WTGT 2KS0A 2A0LD 3M17B 1AP2B 1WFMA 3U83A 3RZCC 4ENZA 2KZWA 3MLXH 1TCRB 4J3BA 2BVOB 3U30B 3OAUL 3O4LB 4IBYA 5EPMA 4U1KB 4BBWA 5IB1B 5IESL 3FS9A 4NQDB 2HVBA 4Y5VA 4YXLL 2CRIA 3WAJA 1U36A 3US9A 4Z3JA 3SCMD 1KMGA 1YEGL 1S5IL 1XDTT 2WYZA 5DD0L 1IGIH 1R5VB 1U91A 3QAZC 5FM8A 3T4AB 1NEZG 1SOKA 5F7WC 1P7QD 3UIYA 2VXVH 1KWKA 1MH5A 1QQDB 2DQGH 5H2BA 1Q8MA 2DKSA 2KI6A 1A3LL 4GKZB 5B3JE 3WNMA 1AQDA 4LCCA 3RPKA 3ZE1B 2APXA 1GC1L 1F3JB 3KM2A 4P2RD 3UG5A 1ZANL 3MACH 2R9HC 4P57B 5F8QC 2NY4B 1U8NA 3MCLH 5D1ZD 4UT6L 1I3RB 5KSUA 1JPFA 3T1FB 3L4VA 4G6JH 2WXJA 3C6LA 3PXLA 4HAFA 4EIGB 1PTZA 1RVFL 4XO8A 4X4YA 5F9DC 4PRHE 1QPXA 1UC6A 5DRNB 2VDMH 1HS6A 4FNQA 4J3WA 3MLTB 4TSCH 3AGVA 4AYSA 3M45A 1UD6A 3MRJB 5J12C 1IM3A 3CX2A 4F7EB 1BZOA 1BAGA 4MGXA 1TT6A 4P2OD 5DMKB 5D7SL 5LCVA 3B7UX 2EDTA 2LTQB 3B6SA 2G9KA 2V7NB 3PWUA 4KZDH 5LNDA 3IU3B 3P4OA 4MRBA 1XTMA 1G9NC 4N2FA 4PRNA 4IU2A 3ECQA 4XRCB 4WNQA 3G5ZB 3MGAA 3L3KB 3IJYA 1F45A 4XMKH 4ETQB 4NRXA 1F02I 1HCYA 3O6FD 2JVUA 1ZXKA 3AAZA 2R4SH 2ICWA 2IG2L 1SXCA 1KEGL 2Q2LA 1M71B 3FT0A 4OLZL 3ZLQC 2EEAA 5ICXA 3IMBA 2WP3T 2J8UB 3L3HB 1I1AC 5D70H 1PAZA 1CGVA 1RIUH 5E2UH 3TYGL 3VGAC 1BQ5A 2WSDA 3SDCA 2EE2A 3IFOA 1CF8L 1JJUA 2BHFA 3HE6C 3QG7L 3BPNC 3F12A 4ZMVA 2BC4A 3DX3A 3I75A 5A2IH 4KKZA 3LKOA 4BH8A 1QHPA 4RQQB 4W70A 4KK5C 3W5MA 1RULH 5F8RC 1X3DA 4HUCA 1T0NB 4V33A 4CRPA 1RIVL 4V1DE 5IQ9A 1X5GA 3VI3B 5AZEL 4PRHD 5CCGE 2CKBL 1BCIA 4FTVA 2OQJB 4OJYA 3VJ6B 1T66C 3HLAB 4PP1C 2ZWLT 2PW2B 5BO1L 5B1JC 1MXGA 1UJTA 3OB0K 4Y1AB 5DQDL 5BUPA 2OL3L 4TRPL 4JPVH 1YEJL 5EU6B 3RY4A 5FUCC 1MEXH 5BUGA 2DQCH 2EC8A 4FQ2H 3RQ3A 1FA4A 3MRGA 5FO7B 2NY0D 4EVNB 5EDXA 3LRSA 4B96A 4HLZH 3TIDB 3TEZA 1QBLL 3DETC 1BD2B 3S36L 4JY4A 1IC1A 5E95B 3MREA 1BF2A 5K93A 1N10A 1RZ8A 3V7AG 2V9RA 5HHMB 4BZ1H 1GHFH 3NCYS 1MOEA 1BFVH 2PPFA 3QIWD 1FBIL 1EEZB 5BPPA 1WRFA 3UTQB 1ZTXH 4KH2A 3QUKB 1U8QA 5E9NA 1WS8A 1UXWA 2N1KA 4LIQE 4RDQF 4ZPVA 3C8KA 1YPZB 2CHWA 3WS3A 4FMVA 4H13C 1OCWH 4LRNH 3HOGA 3SE6A 1YAIA 2X89D 2BFGA 3OC8A 3EGXA 4KDVA 1GL4B 4KJYA 4TNVF 2ITFA 1JWUB 3MOBL 4PJXB 1P84K 1WYJA 2MHAA 1FZMA 2ZG3A 1UM4L 3F8UB 3RVWD 2WWKO 4XPFL 2Z6FA 3T0EE 5B7EA 2FWLB 3APMA 3RRQA 2ZSVA 2PCYA 3BI9X 3PE9A 4X7DC 4FNTA 3KLHC 1AXTH 2AJ3A 2EDOA 3DARA 3FFOA 5MERA 1OTUD 2V9QA 1YN7A 3CE1A 4QRRB 5E2JA 4LF3B 4V1DD 4C4KT 2WVSA 5F89B 3OZKA 3HRZA 4LE8A 1TVDA 2J71A 4KFMA 5HYIA 2EZ0D 5IBUG 1B3IA 4E9YA 1C5DB 3S4SG 1Q9OA 1A02N 1CB4A 2JK5A 5C70A 5E9DA 4XWGH 5CGTA 1ANUA 3WNPA 1NEUA 4FNLL 1W0WB 3C5JA 3M88A 1FNAA 2IWKA 5CMAB 3WIFB 3P77A 3D4ZA 1GPOL 4J1UA 3DMMB 1YEDB 3PYCA 3QHZL 4XZUA 2OM5A 2ROYA 1VZHA 3MJ9H 4X5RA 3OAWA 5F1OB 1NBCA 1YYMH 2JKWA 4G9DB 2O6PA 3QFJB 4GMSH 5TTRA 3SDAD 1TQUA 1WLHA 3V6OA 1P6WA 3ULVC 1F4AA 3W2DH 1JK9A 2J6WA 4YDJB 5BRZB 4PGDA 1FP5A 2QEJA 4P04A 2J56A 4KXZH 4TTDD 4XMLL 4BYHA 1BXVA 5I0ZA 1KY7A 1SNRA 4OQTL 4UOW1 3MOAH 1YEEH 3FQTB 3LD8B 5F93C 1PG7H 4OCRL 3UFIA 1YUKB 2ITCA 5HHOA 5A6IA 2A74B 3MGTA 5E99L 5BVPH 1QACA 4LSUH 2F6AA 2OV0A 1I75A 5EV7A 4NNXA 2IXQB 3ZTEA 3VG9C 5C3IA 3EKCA 4YC2B 4J8RA 1ETZA 4UINL 3X3FH 4LPXA 3SE3C 3FHQA 3GXNA 1DVFA 3MYJA 4UT9L 3H9SA 3T0ED 3TCTA 1IT9L 1RLWA 2GUYA 2OMUB 3BHBB 5T1JA 3P4NB 3VI4E 4PJCE 4YDIH 4YHML 3K71A 5DUPH 2OTPA 4HEMA 4BFIA 3D0LB 5IG7B 4BA0A 4EF3A 4KZ0A 2DWDA 4LNRB 4F58L 3NA9L 4BK4A 1KPRB 4I89A 4O2FA 4TLUA 1DEDA 1G9MH 1KBVA 1LO0L 4GMTL 3RL1A 4B0MB 3CD4A 4FLOA 4HJ0C 5JW5A 1ED3A 4PJAE 2P47B 2AXFA 3N3EA 4TN9A 5GXBB 3U82B 3M46A 2JJTC 3LCYA 4JKMA 4G1MB 4I18B 5HPOA 2G3NA 2I07B 3GLZA 2HKHH 4M02A 3S37H 2JB5L 3REWA 3EJJX 5EO9B 4Z7WA 4UV4H 1PY9A 4ANXA 3DX9B 1HXKA 1OT1A 2DEWX 3NESA 4FQXD 3A6BL 4M5ZH 4N2IA 1DBMH 2DMBA 4YE4H 2YD7A 3QWOA 5CINL 5CF3A 1QSEB 4S1SL 2D7OA 2QSTA 4N86A 2GABA 4M1DH 1FZOB 2RACA 2NNXA 4AT6A 4UV7H 2W88A 2EDYA 3QEQB 3UZEC 5I26A 3P11L 4MJIB 2NW3B 4YO0A 3SD2A 1VJSA 4AEHH 2WBJC 5HHNA 4TNVK 1AKJA 4KPHL 5A16B 3EO9H 1YNTA 3VFOA 2XWBA 1KTDB 3FDWA 3IMWA 5I1GH 3SCMA 3ZQXA 4HWBH 3APFA 4PJ7A 1USZA 3UEZA 2A77L 4KDWA 3MVSA 4WHTB 2FATH 3GIVA 4X6DE 4Z95L 2BW5A 2F15A 4I0KA 3UAEA 1BQRA 5FM5M 2ETWA 1UJ3B 3CGTA 4G1EA 1SDYA 1BMGA 2VN3A 3IS1X 3VWKB 2MWCA 3WD5H 4XP6L 3VGHA 1FVCB 3JWOH 4HC1H 3IVKA 1PD6A 1W6LA 4P2RA 3APDA 5BS0A 4HPYH 3JV6A 2A9ML 5D1ZA 4HJIA 3WMPA 1JWMB 2E9IA 4X6CB 1HSBB 5HJ3A 4UIKH 1DLFH 1YN6A 1Z0MA 2ATAA 3D0AA 3CVIH 3IE9A 5IVXF 5DD1L 3AREC 1CXHA 3HC4H 5D4HA 1JFQH 4E41E 1FFPA 2W65A 4HT1H 4BHUI 2WZ6A 2ZXQA 2VDPH 1PG7X 3D34A 2EDDA 4G43A 5D2LF 3G6JA 1CDCA 3L4ZA 4N2OA 4PJDF 2Z64C 1ZPUA 2X4NA 1SY6A 3QQ9C 1GYVA 1FG9C 4GQQA 1RZKL 1OCRB 1P4BH 4G59C 3B2MA 4JRFA 3V0WL 4Q9RH 1LE5A 4A6YH 1IFGA 4P3DB 2DL9A 1MI5E 2OMBA 3QO0A 3KPQB 2VLJA 3U4EB 2M83A 3DI3B 5E6IB 25C8H 3TWYA 3M7OA 3FTWA 3W0WD 1EHKB 4F57H 4D8PB 4HJGB 3LKSB 3SB3A 3QDJB 3SQOH 1ZLUH 4IOIB 4LL9A 4AIZB 4NC0B 3TVMA 3VMOA 2ICCA 1M2VA 4L1HA 1N2RB 3DX7B 4QHNA 2B9AA 4CSTA 2WUCH 1BFOA 1Z5LB 2GUOA 2HJLA 3PWPD 5HDBB 3CSBA 3P30H 3CK0H 3GSQA 4JG1L 2AQQA 3P69A 4M7LH 2Q8AL 5EC2B 5CS7A 1O7VA 1AKPA 2HSIA 5FYKU 2DN7A 1SXBA 1V54B 3WNNA 5JHLA 1KIQB 2YFNA 3EDFA 5IHZB 5TFSL 4KHXL 5AW4B 2H6PA 2VN5A 3FBKA 3S37X 4YSPA 4TNFA 1FGVH 4N8PA 4MKTA 2XQBH 3NJNA 1CBVH 2WANA 1I7TB 1EO7A 1RZIA 4NO0B 1JZ2A 1T89C 4Y2DD 1ZTXE 3CZLA 5F3BB 4A7GF 2OBGA 5AOIA 1F42A 5F7EH 5BZZA 2V8MA 1D9KD 1E4XL 3BZ4B 5E1IA 3N43B 4MZIA 1E5AA 4A38A 5DTFA 4WI8A 1JGEA 1QRNA 4PRHA 3EYOB 1FL3B 3BP7B 4BRJA 2Y7NA 5D6DC 4E41D 4PG2A 2B08A 4H8WC 3OKDB 1INEL 4P9MH 3EJCA 5IFJA 4HHAB 3GZKA 1OW0A 1JNJA 1AZVA 1X7QB 1T7ZA 2Q3ZA 2V37A 2K0RA 5JMRA 5D1XC 4R3SA 4N87A 4GRWF 4UQBA 1MI5D 5EEZA 1UACH 2AXGB 5FHAH 5KN5A 3QZPA 5DHVA 5GGRY 4PUBL 3S5LB 3BRFA 1DQVA 3QIWA 4XO5A 3OXRA 3TH4T 3FO1A 4Z7NB 1JXJA 1S78C 1B0WA 3IJHA 1IGCH 4ETYA 1TLKA 2R83A 1QI4A 4LCVA 1HSAA 1QFWI 3V9CA 1AFVH 3KS0J 1QFOA 4E9WA 2BNUA 3U0TB 2FX9H 2NNAB 5ACZA 4OLVH 3Q1EA 2ZOLB 4OLWL 5C0EA 5ESVA 1BREA 5AWNH 2D31B 3NCCB 3KPPB 3TBYA 2X4SA 1LTXA 2DQ6A 3MRLB 4HX1A 5GGSA 1XZ0A 5EZLB 2AEQH 2VABA 2ZWNA 5IBLD 5JIDA 4IW4C 4XPBH 1YJDL 2HLAA 2IDUA 4S11A 3R0NA 4LEBA 4PLKC 2XZQH 2HJKA 2YD2A 2OK0L 4PJBB 4NAQA 3ARFD 4LARH 1ADQH 5LGKA 2ARWA 3IS0X 4JPKL 1DJSA 2WQUA 1CFVL 3BWSA 4JFED 4LCWE 2UZXB 2WQSA 1BOYA 4MS8C 3KPSE 5HGGS 4QRPB 1FG2A 2XFXA 3C8DA 4FULA 4V1DA 2UY6A 2WXFA 2JJWA 1FYTA 4FHBD 4EN3A 5ENWA 5KBDA 1DBKH 3GB7A 4QY8B 1SFHA 3LQZB 3PNWA 2R56H 4LKCB 4MMYB 3QDHA 4JKKA 1RK0B 5E0FA 2HN7A 5KSAB 3GUTA 1WEJH 3K1KC 3EO0A 5F96H 4RZKA 1BOGA 4BKLB 3VD0A 1NICA 3WE6B 5DR5L 1BBDL 1T6BX 3B8SA 4NEHB 4TUUA 2CK2A 2J73A 2ZD0A 1HH9A 1ROWA 3L9YA 3HBZA 3L4UA 4I0PB 3TCLB 3O81A 4IKJA 2FX8H 3K4AA 1A9EA 2FECI 2X70A 4IHOB 3RNQB 3SDAA 4N0CC 3TBVA 3VSTA 3H54A 1MW3A 4O00A 1KTLB 1M7DB 2JJSA 3WXVL 1MVUA 2HFTA 4PS4H 1MCBA 2YXMA 3TH3T 1S9WA 5E2VL 2AQ2A 1F3DH 3Q3GA 2PTTA 1J7VR 3O0LA 4R96A 4ALAH 4MB4A 1P6AB 2O6DA 4JRWA 1OD7A 5KG9B 2QHLA 2Z3FA 3GI8L 4X6EB 1HEZB 1NCCL 4FJ6A 3NZHH 3L7EA 4CVUA 2VXSL 4HIIA 4UTBA 4M7KL 2BVTA 4Z7OE 2QT6A 2O5ZL 3BKCH 1DQLL 5DJ6B 1KZYA 2DF3A 4E9LA 1KCUH 1OD9A 4QJ4B 5SWZB 1FPTL 1KB5A 4YHPA 3KPRE 2V4LA 1L5GB 2C26A 2CA3A 1NCDH 5HYJB 3D9AH 5AKVA 2CJSA 2EXWD 3QUZC 1PQZB 4MB5A 3S48A 2ZX7A 1DFXA 4E9RA 1QMUA 1A6WH 3WLWC 3AY4C 4JM2C 4LCWD 1A8JH 2GIYA 3KPSD 3HCVB 4B53A 3MRCA 4ZX3A 5KUKA 1PLGH 4LSRL 3HS8A 1FVDA 5H35A 3T0DA 2XVLA 5AFAA 1AZRA 3G5VA 3RDTA 5IR1A 1QSFB 3FU7B 5TQ0L 3SY6A 1G7PB 5F0JB 4AEEA 5DA0B 1E67A 4Z76A 4GG6F 1UVQA 3RZWA 4EE2A 2F53B 4N2KA 3FT3B 4FQXA 4DO6A 4XXDA 2H1PH 3UPRA 2AABH 3ZKSD 2BY3A 2WYHA 2HG5A 4HWNA 4B7LA 1QBML 1WWWX 3QJVB 3V5HA 3IWUA 4WFHD 2OSLA 4X50A 3FSOA 1T04A 5D9SB 2V3DA 3FCSA 3OKMB 1YUHA 2GSIA 3FB7A 3PV6A 3Q8BA 5EIIG 1QFUH 2OMYA 4OF7A 4NN7C 5I1HH 4JQVA 2AI0L 2NZIA 3EO1A 4MMXC 3REVB 3C87A 2BSRB 2F5BL 4Q4EA 2Y36L 2PR4L 4OM1H 3V5KB 2VLLA 4LGPB 2V2WA 2UZYA 3IXTB 3QFGA 2LU5A 1HOEA 4UUJB 2IEPA 4GP4B 4NIYE 1KGUA 2DDQH 3LN4A 3LVTA 3B3IB 1I7UA 3RUGE 2AEWA 4JY6B 1SJEB 4J3OH 4JFZH 1P4LA 2WOBA 3MR9B 3I3BA 1VFAB 2E9BA 4EI0A 4YUEL 2WLIB 4MVBC 4AJWA 1VFBA 5JPMC 1OGAB 4LNVA 1I9RL 3IFNH 4XCNB 3EYFB 3VVVA 2M26A 4QJ3B 3FUKA 3EDJA 3O3AB 1BP3B 4AMKL 4U0QB 4U1GC 4PI0A 2AV1A 1Q94A 2DIAA 2DJSA 5D6CB 4AQEB 3FFDA 2C9UA 1E9OA 1IC0A 5TQ2H 5J11B 3ZY7A 5FYKL 4JDEB 3VFUB 2WN2A 3OB8A 4QHLB 2A0LC 3W56A 3U6XA 5ABZA 3BP4B 1B9ZA 2AKRA 4WTZA 5E1QA 1HIMH 1JDCA 3HG4A 4ABUA 3UP1A 3NIDB 2VCOA 2XI9A 4ZG1A 3KWUA 1JNLL 4U2YA 3D5OF 2FZ3B 2Y7LA 3SCMC 3R06A 1DSFL 1WJ3A 2NY7L 4WY7L 4G80B 2PCFB 4E42A 4FQCH 2OMWA 4A37A 4F15C 5C1MB 1J0KA 3L3JA 2JJUA 1MQKL 2IO5A 4NQUA 1NCBL 3PWLA 4Q0XL 4KHTL 3W0WA 4DGUA 1IMHC 1KULA 4JUTA 3X2QB 3GPSA 5KSVA 5IGXH 4YLCA 4ZOBA 1E4HA 1X4YA 4NUJA 3PGCB 4WV1C 1PBYA 2AQSA 3PWPA 4JE0A 1MHEA 4IU3B 3PF2A 1G84A 4FQ1H 4GW5B 2WIIA 5JYLA 2P3YA 3AACA 2EH8H 4N0FB 2LVEA 4C4BA 1P5UA 3VQLA 2E7LC 3WFDH 4F27A 3KDMB 3F65A 1DANT 1HWHB 2CIKB 4HFUL 4WWKD 4HS3A 4ZMXA 2IAMA 4ZXBC 2Z92B 3VRJA 4R7XA 4YJZL 5CAYB 2C4XA 3KR3L 5J0BA 1NIBA 3ARGC 3MZTA 1G1CA 1MJ7H 3T6WA 2H9GA 3GHPA 4X0NA 1NDMA 4G9FE 3VVWA 2YR3A 3WYRA 4X4XA 1ORSB 4M4RA 1D9KA 1A7OH 4HGKC 1WA2X 2IFGA 3O4LE 3RWIA 5E9AA 4P2OC 3H2PA 1ZD6A 1FV1A 4NQDE 4O2EB 4TQIA 4Z7QF 2VAAA 1OLZA 3ETBJ 4QO1A 3N2JA 4Z8FL 2HWZH 1QLEL 2G5BA 2JI1A 4ZUWB 2UWEF 3JTSB 4ZX4A 3DOSA 4X9GA 3BRDA 4NFBA 1HKLH 3LHPH 3O6FC 4QHMA 3UYPA 2IQ9H 1YY9D 3MZGB 5HVFB 1MI5A 2CA4A 4ELME 3WE1A 4QT5B 3TASA 3BPCB 2WQXA 2R2HB 4S1DC 4F8QA 4PYGA 2FQDA 4Q7DA 1IC4L 3RFRA 4M3JA 2H0FA 1K4CB 5IMKB 3EHBD 3V79C 1BEXA 3IDXL 5T1LD 3VSVA 2KC0A 1DYZA 4ZFGL 5HI3D 5IOPB 5GS1A 3VQ2C 4HKJA 2Q76A 2VXUL 3B3BA 4ODHL 5KVDH 1ZVYA 4JRYB 1F6LL 4NWUL 2JKSA 2APSA 2WXLA 1I3UA 2FR4B 3LN5A 1P0SE 3SIKA 3LXBA 3WNOA 5HGDB 1S7WA 3OX8B 2EE6A 5JA8B 2MOVA 2XWTA 3MBWA 1H15A 2W9EH 5TK2A 3SO3B 4K4KA 1FNEA 3T71A 3ARFA 1ZA3A 5FFOA 1SZNA 5MI0C 4G9FD 2QPDB 4JFEA 4GKNB 3N9GL 3NIFE 2PW1A 5DMJB 1TQVA 3V55A 1U41A 1MREL 3R0MA 3O4LD 1CICB 4M29A 3AB0C 2RH0A 5DMIH 4KK9D 4LT7A 2O6FA 1QI5A 2ESVB 4FQJH 1RZJL 4NQDD 3SBQA 2EXSA 1NLBH 2NY0C 3BSZH 1AC6A 2J2ZA 4GQ9H 4XNZC 5D2LB 3BX7C 5KAQF 2YPVH 2XC8A 3DXAB 4YSEA 1DFBL 1T0OA 4RFOH 2DB8A 4E9TA 5I1IL 2Z34A 3P9MA 3PQYA 3QQ3A 5DJZA 5A3IC 4MYWB 3QIWC 3VQ1C 2B0SL 3MV8B 3NAAH 3BZFA 4N2BA 3ZZQA 1QYGL 2Y5QA 4LU5L 2QKIC 1VGEL 2BSSB 4Z3IA 2L7UA 2JXMA 1JTOA 3ILDA 1WHOA 2ZCHH 5DRWA 5IT2L 2GTZA 2E0PA 3F62A 1IL1B 1JVKA 3FB8B 3KL0A 3VXQA 3GRWL 1AGCA 1EHNA 1X7TA 1TZHA 1B0GB 2WCSA 3NJKA 2DQTL 4N8VB 2WOYA 4Z77B 3UYRL 4NBYB 2EDMA 1A3RH 1LWHA 3RVWC 4XZ4A 2HFGL 5AAMA 3AU1B 4HH9A 1ZT7A 4IMLB 5EOQL 1A6PA 2MNUA 4N28A 3ZT5A 4HDIB 1FE8H 2VLRB 3TPUA 1OTUC 3NZSA 4WI4A 4XBPA 3JZYA 4IKLA 1FFOB 4LGRB 5EH1A 4XPAL 4WNSA 2CLVB 2J7LA 1JYVA 4HKZA 5E8OB 4ESKA 4U3XA 5EU6E 1KLUA 4OZFB 5J1SC 1UOKA 1MIEL 1KBGL 4FYQA 4AZ8B 4OFQA 2VT0A 1FORL 4ZD3H 5IB3A 3DUSB 2V17L 1GTFA 3EJUA 2BW4A 3BD5A 3KPSA 2Y6SD 4FL4C 4N6QA 3WJLA 3VMNA 2BZDA 2E4FA 3BVNA 1L9QA 3JTTB 4JO1H 1GA2A 5E4EC 5EOTB 5AYUH 5HHME 3KLSA 5HTSA 3SDAC 1EQWA 1OPGH 4YR6A 3VFMA 1BM7A 2X5PA 3BGMA 2JJSC 4H40A 5HDQH 3QJXA 1KPVA 3QC6X 3AC0A 2VDRL 1M7UA 4TTDC 5GISH 3DGGA 1YPZE 1AVAA 4GKLA 3UDWA 1M2OA 4R4FL 3GLDA 3OLEA 1FHNA 2P4AB 3IAQA 2D3VA 3RWCB 1FIGL 1GOFA 4CVZB 4NUGL 3T3ME 4LLWA 5EOCJ 5FO9A 3KPNB 1M6OA 5FA4B 1P1VA 2DQMA 5EZIL 4PQXA 2OYPA 1JZGA 2XTJE 4MAYA 4R7DB 2FYYB 3RGVD 4Z7UF 3UGEA 1IUZA 3V0JA 1GGIH 1PNCA 3DYMA 4M6NL 4YDVB 1VEMA 4ONHB 1HX0A 5T3ZE 2J1WA 3KPOB 4GYBA 1F0LA 2HX9A 4A2MA 5I8EA 3T0EC 2BFVH 2XKNA 3AG1B 2HG0A 4MB3A 4QRRE 1E27A 2NX5E 4NN5B 2E6PA 5EO0A 4IBLT 4X0KB 4QRFA 2FEDD 4AKQA 5FUZH 4F2MA 3MRKA 4WHYG 2WAHA 2YEZB 2EABA 1L7IL 2ZOKA 2BMKA 4KTEL 4YSRA 3D3VA 2OMXB 5BRQA 2MPAL 3PWVA 4OLYL 2MCG1 1DDTA 5C0AB 4XMZA 2WVTA 2ILLA 5EU6D 3LIUA 1WV7T 1EK3A 2F0CA 5IB2A 3PHSA 3IF1A 3BSHA 3QFJE 5I74C 3EF4A 4KI5F 4HBCH 4OIFA 4N0UB 1MJJB 3WHE1 3OKEA 2BJMH 3JWDC 3SYPA 4P2QB 1D5IH 5DFAA 2FHCA 2VC2B 2Y1AA 3GIZL 5T5FH 1R3IL 1XZWA 1NC4A 4OM0H 4X2UA 2DTSA 5ETUA 5IV2A 5D71L 3QBTB 3GMMB 3M1BB 4KX8A 4N2HA 2MJWA 1CL7L 4LXFA 1QP1A 4U49A 1MAJA 3PCYA 1FFNB 2B3IA 1YEKH 3D25A 4ZUVA 5TK4A 3GKWL 5J1AA 4HC1A 4UNTA 2Y2WA 2AJYL 4OZIB 4UAOB 5GJTL 1IEBB 1N8OE 3KPMA 2XTJD 2VKXA 2KDGA 4NQXB 3T2QA 2C1OB 1MUJB 4YAQA 4ZW6A 3EJRA 4NO3A 3VFRB 5T3ZD 3O0RL 3BGAA 5DFWH 3MLUL 4OT1H 3GXIA 4MA7L 1G7QA 2WWMC 2KUTA 5BMFH 2F8XC 5JORB 3MLYH 1MAMH 1U4EA 1UB6A 2NX5D 2OJ1A 2J55A 1KYOK 4KO7A 1F4XL 1E8ZA 1XVSA 2XOTA 2R2BA 1J11A 3ULSB 5J06A 2IH3A 1W8OA 3GXFA 4G8IA 1URIA 5C0BA 1G6RA 1R3KB 1UM5H 1Q72H 3O3EA 2R27A 1HZHL 5IIEA 2AK4A 3QFDA 4U1MB 3MNMA 4NRYA 4NKQB 1CGTA 4ZQKB 2CM6A 1N59A 5DO8A 2O61B 5LNGA 5C0IB 4WWKA 3WU1A 3LTVA 5F88B 4RGMC 1QSEE 5DFVD 1KCRL 1QZ1A 4NFCA 1WBZA 1D5XB 3BVUA 3V0FA 4IDLA 1EUTA 3KLDA 2ADGA 2A4ZA 1DJGA 1AJ7L 4OZGA 4MJIE 1OF2B 3UOAB 2YBGA 5CBEA 3QJFB 3FO9B 4GY4A 1ZT4B 2R2EB 5DSCA 4BIKA 4GG6B 2NUPB 2OXHB 1SBSH 2PETA 4EIZC 1BM3H 3KLQA 5J3HD 4TVPH 3NFPA 1IAII 5ECGA 1YDPB 4PW3A 1ZHKB 3PIQB 4NZJA 3B4NA 4UQIM 4DKDC 3KYKH 3OHXA 1G4MA 4Q74A 2E6QA 4U0RC 3WY4A 3MJ7A 1IKNA 2EVHA 5EFIB 4YK4B 1OE1A 3OKNA 1KF9B 1XGTB 2EO7A 1W72B 5H94B 2EE9A 3KYNB 1CGSL 1QFWH 3H7BB 5HHVH 2TRHA 4BXSV 1FL6A 4FN0A 5E8DL 4UQ3A 2GSGA 1MJUL 1UM6H 3NJJA 5HVWA 2E8ZA 4L1TA 1KJ2B 1P5UC 2IOOA 5I15L 3L5XL 5SV3A 1NGZB 4FCHA 4Z6AT 1QRKA 5C0JB 1JZ5A 2DAVA 5ALBH 3CQFA 5T1LA 4DN4H 2NSQA 4RMQA 3K0WA 3CG8A 3ZZSA 1H3GA 3C09B 4AW7A 4J3SA 1URZA 3FQNA 2A1WL 1NJ9A 4OGYL 4UDTA 1KPUA 4Y2DC 5GZND 3H3BC 2YMXH 4WAFA 3E6HB 2OX5B 3MV7E 3NH7L 2G9HB 3LQAH 3QORB 1X9QA 2YSTA 1A3ZA 3O2DA 4DP9X 2P8PB 4Y5XB 5DEFA 1QSED 3OAYH 3CMGA 4WSGA 1QKZH 2ZCLL 3B2UD 2OCFD 4WW2C 1OSPL 1QHQA 2DJUA 3F7KA 3HAEA 4FNPA 3IJEB 4H5SA 5CR8A 5CBAA 2BOCB 4X8JB 4G9FA 3LMJL 4IRZA 4OF5A 1QEWB 4C8XA 5LLIC 3UJTL 4MJID 1E8WA 2GQHA 4FKHA 3HHSB 1EHXA 5TE4L 1JDAA 1EHLL 3ISWA 4UOZA 1J12A 4LLQA 5JLZA 1MLCA 2CRMA 3CFDB 2BRRL 1SMOA 1G1OA 3OJVC 4OCXH 1L9PA 1ZEAL 4W9LC 1C7SA 2YQGA 4HF5L 1U30A 5D93C 2F58H 1T83A 4D9QE 3RWDA 1EPFA 2KHAA 4QOKE 1PIFA 4F37F 3NIGF 5AW9B 4Z0XB 4F7KA 3IJSB 5AKRA 1N5YH 1MN4A 3G5YB 4LSPH 2P48B 2DQHL 4DPRA 5EDSA 4AYEC 5JYMA 2ZYRA 4APQB 5GS1C 4DHLA 1AO7A 4PY7A 3MNVB 1TJIL 3QS2A 2QSQA 3B9KB 2KQNA 2JKIS 2FX7H 2UX7A 1PMYA 1X5KA 3IGAA 4P23C 2VISA 2YS4A 1Z66A 3HZMB 5ANHA 1JK8A 2ZP8A 5E1AB 3UC0H 1H9DA 5B1KA 5IBLC 1I85A 4TSAL 3SDYH 4YEEA 3QUML 5IFAL 1CDBA 5IW1B 3F6LA 3TBTB 3ARFC 1P53A 3L6FB 3MV7D 2NNRA 4FG0A 5EO1A 2CU9A 1KT2A 3QUXD 4CN4A 3RL2A 1YNLH 1XEDA 4WIQA 35C8H 3FCGA 5IJCC 2OSXA 1JERA 1AANA 3IFPA 5DJYA 3F7RA 2ARJA 4IYKA 4UQCA 4R0LC 4TSBL 1JVLA 3MTRA 3AT0A 2WZ0A 4K8RH 2OMTA 4LCUA 4X9IA 3DURA 4YZWA 4QGYA 3CVHA 1LO5B 2X2HA 2Z31D 3FN3A 3U0WL 5IF0A 2QVFB 1KJMB 5B8CC 2GFBA 1A4CA 3OWRA 2XZCH 5E6ID 4CBPA 3S9DB 1EEYA 2MFNA 5CUSH 4NN6C 5FECB 2D03H 3OM3B 5A7EA 4LMQE 1UATA 4GJTB 2GT9B 3CFUA 3G9VA 4YIQB 4J2XA 2LU4A 3CZJA 3JT2A 4JZOB 2NZ9D 5EIVA 2I7SA 3P3SA 4D9QD 1K85A 1XCTB 3G04A 3DECA 4QOKD 2OJEA 4MJHA 2G4GA 4PJEE 1CGXA 3WL9B 1F1DA 4JVUA 2AJVL 3DV6B 5AAMC 2FHFA 5FDWB 5I6XB 3DTUB 2X4TA 4FQLL 1NL0L 5A2BA 4D7BA 2AJXL 2F1BA 4IJTA 3RGVA 2F74A 3L9EA 1XH2A 1BDYA 5F7NC 1BGXH 3GSXA 3U2IA 1UZ6E 3LZOA 3WJJA 4RGOH 5TE7L 3NN8A 3QCUL 1OTTD 3BWUC 4P46D 4PJ9D 2EXWC 3UZVA 2G3MA 4LLUB 1JYWA 3BDXA 5DCCA 3HTLX 1GRWA 4YSSA 1TCMA 2X3AA 1FGNL 2HCZX 4WO0A 3WJLC 3VGFA 3GQFA 2EQDA 1RZ7L 5DQ9A 3EJYD 2B9BA 4OD3L 2YFOA 4NO2A 4IBQA 2Y7MA 1EZVY 3GBML 1DBBL 1F97A 4DUWA 1IC7H 4OB5H 4U1SA 3LRLA 4NUQA 5IMMB 3DPBB 1HHIA 5I1DB 1OKEA 3VRIB 4CN1A 1FL5A 2FEEI 3WNKA 3HHRB 4MDIB 4DQOH 1JNHB 2X1QA 2YGQA 5I1KH 1NMAH 1IAMA 4F37K 3V4VA 4GIPD 5FWQA 2K4AA 3D39E 4UNIA 3DIFA 1VPOL 1G9MC 4BK5A 4L1BA 3WFBL 3VYOA 2Z35B 3O3BA 1OB1A 4XC3L 2EEXA 4LVOB 2W0FA 1B4TA 3V2AR 4GXVH 4NNYB 1FZJA 1ZAGA 1AZBA 2GY7B 5SWZE 1U3ZA 4F7MA 4Y1TA 4LVHB 3EAKA 4WTZG 1J8RA 1IFHL 2ZKYA 4MA3A 1E6JL 3HN8A 1T2XA 4U1NA 4YGVB 1MCOH 4XVTH 5IVZA 5I1LB 4WJ5B 1AH1A 5EORH 4AYID 5DZOA 3D6GA 2YD4A 4UDUA 5HJDA 1BA9A 5SWQA 4OF6A 3A6CL 3EYSH 2CDEA 5ELIA 1G7HB 1PYWB 1GW0A 5I6NA 4HZLB 4DFHA 2AJSH 3L5WA 4KROD 2NR6D 5E8PA 2ZXDA 1P2CA 3LH9A 4U33A 3KWWA 1EANA 1GSMA 5IMOA 3S8GB 1KNOB 1WWBX 1N4XH 3VWJB 5I8OH 1CURA 3KJ6L 2X2JA 5C7XL 4PJGA 3UGXA 3KMDA 1J5OH 1U8CA 2VZ3A 2G60H 4K23L 4DIXA 4OBSA 3V8CA 2BHUA 4OZFH 1RUMH 4ZI8A 4DP7X 3JWOC 3I3DA 4IQHA 1TVHA 1TEFA 2JELL 2X41A 2RTTA 3GJFA 4OY9A 3D39D 4HP5A 3UTTB 4YDLB 1TEYA 3KLKA 3W57A 1F58L 2ENYA 4UU9A 4FXKA 2WNXA 4Y5YB 2MMXA 1DJZA 3INOA 1JUFA 2C3VA 4NXKA 1MHPH 1NWOA 1DVYA 1RZQA 5B38B 1JG9A 4TQHA 4RRPM 1VRSA 3SE4C 3FCBA 3DX2A 4M8QB 2DTMH 4I2XE 4ZK8A 1UYWH 4BZ2A 3ZDXF 3PS6A 4QTHA 4LAQL 2CJ3A 4FLHA 4XNMB 1TYRA 1YHPA 4O9HH 1UENA 2JI3A 1BQSA 1U8MB 4GRLD 4JGMA 4NYLB 4XBEH 4CGTA 1AZCA 4ZTPH 2MQ3A 3U6XS 1FDLL 3WO3B 4U1LA 4I3RH 1M56B 1F4YH 4N20A 4P8QA 1KXQE 4HWZA 4Y4FC 2QTVA 5LGHL 2B14A 2UZIH 3QHFH 3VRLE 4F1ZA 2J20A 1Y6KR 3F7LA 4ISVB 3OGCB 4BFOA 3MA9H 4WU7A 3TT3H 1OPOA 3BEVA 3S98A 5GGVL 4OF8A 4NZ8A 5ABAA 3VXTA 2CIIB 3NIDE 2HX8A 4RSYA 3UACA 1D5BA 1IGFL 1P7BA 2WLHA 3VFPB 5FK9A 4UQ2A 1WPCA 2XWJA 3QXDA 4KXCA 5EA0L 3WUWA 2X09A 1OAUL 1QVOB 5LN8A 5EEXA 1KELH 2P43B 2ENJA 5B39A 2BVPA 4JB9H 2IWGA 4TNWF 4WGKA 3WTWA 1VSCA 4DPCX 1XB6A 1QPKA 1ML0A 1PY4A 1HCZA 3KM1A 3L4YA 3ZHLA 4XXCC 4JKPL 3GBDA 1PZ3A 3PL6D 5I66B 1BVNP 4HGWB 1YY9C 3SJVA 3W3BA 1WC7A 1ZGLA 5LWYH 1VFMA 4LP5A 4IJ3B 1ZIAA 4PTUB 4WCYH 1JMXA 5I16B 3HNTH 4Y16B 2VC2H 4IS6A 2J1KA 5ERWB 3O9WD 5CJOH 2BH0A 1RUPH 1RFDL