3KM2A

As-isolated tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical properties of tomato chloroplast sod
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3km2A00
3L9YA 2C9VA 1E9QA 2XJLA 2ZKWA 4BCYA 1QUPA 2WKOF 3L9EA 2WZ5A 3HW7A 5KBKA 3SODB 5KBMA 2AQPA 1JK9B 2JLPA 4OJAA 1OZTG 4U4IA 1E9OA 1YAZA 2E47A 2WYZA 4B3EA 1U3NA 4MCNA 3RE0A 1IBBA 1SXCA 3GZOA 1YAIA 3GQFA 1SPDA 3CE1A 1E9PB 2ZOWA 1SXSA 1Z9NA 1SXBA 1BZOA 4A7QA 1P1VA 2R27A 2VR7A 2AF2A 3KM2A 1CB4A 2C9SA 2C9UA 2SODB 3LTVA 2APSA 1IBFA 1SXAA 3GTVA 2Z7YA 3GZPA 3H2QA 2K4WA 1RK7A 3QQDA 2XJKA 4A7GA 2AQQA 2AQRA 4BCZA 3KH3A 2JCWA 1SRDA 1L3NA 1TO4A 1UXMA 2WZ6A 1E9QB 1FUNA 1OZUA 2AQSA 4A7VA 2Z7ZA 1F18A 1MFMA 4L05A 3ECVA 1SDAB 3ECUA 1N19A 3GZQA 1IBHA 1DO5A 2Z7WA 2WWOA 1COBA 1IBDA 1S4IA 4A7SA 1TO5A 2GBUA 2WYTA 1B4LA 3H2PA 1ESOA 1N18A 2LU5A 1F1AA 1B4TA 3F7KA 1XTMA 1EJ8A 3S0PA 2AEOA 4A7UA 3KBFA 2GBVA 3KM1A 4A7TA 2WZ0A 1BA9A 1PTZA 1OEZW 2Q2LA 2E46A 3KBEA 3F7LA 1HL4A 1OAJA 1PU0A 3CQPA 1JCVA 2VR8A 3K91A 1OALA 1YSOA 3PU7A 1DSWA 1SOSA 3QQDB 2ZKXA 1JK9A 1Z9PA 3HFFA 4N3TA 2WWNA 1E9OB 3T5WA 4BD4A 2ZKYA 1SXZA 2VR6A 2Z7UA 2GBTA 2WKOA 3MKGA 1Q0EA 1HL5A 1XTLA 1AZVA 1EQWA 3MNDA 4FF9A 5KBLA 2V0AA 1E9PA 1CBJA 1XSOA 3HOGA 1F1GA 4MCMA 3GTTA 3CQQA 4A7GF 1SXNA 2AQTA 1UXLA 1KMGA 4OH2A 1SDYA 3ECWA 4N3UA 2AQNA 1IB5A 2NNXA 1PZSA 3KH4A 5CU9A 1F1DA
chains in the Genus database with same CATH superfamily
1F4HA 2QSCH 2V5SA 1DBJL 5B22A 3VFGH 3OKEB 1JK8B 3UAAA 4HKJA 2VLJA 3FRUA 1NCWL 4KUZH 3SODB 1C8PA 3SOBH 3QO0B 4JB9H 2Z92A 2DM7A 1TZIB 2C3VA 4IIQA 2V33A 5TD4A 3FTGA 2AEPL 3PHAA 2HLFC 3RWGA 4RNRA 5L2JA 1CFNA 1CD0A 2DMCA 3QZOA 1TU2A 4U3CA 1E6JL 3SDDB 1WE5A 4JJ5B 1D3CA 4XOBA 4PRPA 4I2XA 4TVUA 5FW8A 3MRNB 2ROXA 4N5ED 1YY8A 4JFED 1AD9B 3QZPA 3L5WA 3X14A 4FFVD 4NWUH 3BGMA 1NFDA 4G8EB 4EEEA 4UZUA 2ALWA 3WDHA 1J5IA 4Y4FB 2BNRD 4KGLA 4EI6A 5T33H 5AW5B 2ADYA 5IM7A 3DDGA 5AAWC 4ONOA 1H3UA 3QIWD 3KXFD 3RX5A 4XE0A 5DK0A 3HZMB 1T1YA 4XN7A 5L9DL 2H1XA 4PEEA 4OZ4B 1U8IA 3FFCD 1IEHA 3L3IB 1MVUA 5K1JA 4E9YA 2WLNA 4BFEA 5F9JB 3PJSB 1EZVX 1EX0A 1N70A 4AG4H 4EN2A 1YNLH 5F2FA 1FL3A 3NEOA 1F11A 1GR7A 5CCHE 2LFEA 1BEXA 1VPOL 2ARJB 3WFBH 4F3FA 1KULA 4DW2H 5I9QB 1NGYA 1J5HA 4AQ1B 2CDFB 4ZD3H 1TMQA 2Z1KA 4LCCC 2OSLA 1NJ9B 3WENA 5CAYB 5HD8D 2K1MA 1XB6A 4PJXF 4X6CB 1GAFL 2CO3A 1P1ZA 3AG1B 5F9DC 4KRNA 5FO9B 4U1IB 5HHOB 5JNYB 2VDMB 2CBTA 2WIIA 5E6IA 1NCGA 1MRCL 1EO8L 3WLWD 3EKCA 3HMXA 3O6LL 3RGVC 3FNKA 2ZF8A 3BIAX 1HQ4A 4UILH 3V5DA 3WKYA 1QLEB 3BAWA 4Y4KC 2X4PB 3IJHA 3QXWA 1MHPH 4HJGA 1A7NH 3DSFH 5T3XD 1JN6A 3BIBX 3QP3A 3B9KB 1E5YA 4OF6A 2EO9A 3ZE1E 3ARZA 3NFNA 4L4TE 2NPLX 3FRPG 2JIXA 4LPWA 4IRSC 1TZGH 1W8EA 5I15L 1RVFH 1RZJH 1C5CH 4P9ML 3SPIA 3S2CA 1XF5B 4K3JL 4UU9A 3WXVL 3RVVD 1DBBH 4DO5A 2Y07H 5JO5B 3AW5A 4NO3B 4QRUA 2F19L 5F1NA 4TUUA 1YPZB 1LO0L 1D6EB 4PJGF 2VM3A 1OZTG 5AZUA 3VACA 1F2XK 4Y19A 4IS6B 1O5DT 3SDXB 4OM1H 5BZDB 4M6MH 4HMDA 1UH4A 2ITEA 4E9VA 5FM5M 4Z7WF 1C5BL 3T3PF 5LB1A 2WLHA 4BUQA 1X6NA 1PLBA 4Q9QH 1KEGL 3JTTA 4E9TA 2Z93A 4N8VB 1WAAA 1J8HA 2R0KH 2FR4B 1ZHBB 4M02A 3DYOA 3FU0A 5H37A 4URKA 4IOIA 4LPYA 3V0AC 4Q0XH 2WLLA 1Y18A 1XMWA 3MBEC 3V0DA 5GRXG 2QQNH 1A4JB 2Q3ZA 4FFTA 4TOYH 1MJUH 1KN2L 3C6LD 4UMSA 3VI3F 3GXIA 4ACPA 4AENB 3N50A 2APWA 3RL1A 2ZUQB 3GHEH 4OZIB 1V7ML 3LSOB 1E4KC 5E9DA 1E4HA 1KIUA 2QR0B 1PX3A 4L3CB 3MRBA 2DWYA 2DF3A 1DO5A 1NDGB 5D2NC 4HCGA 3WGUB 1MUJA 4NDMA 4ZSOE 4A39A 3JV4B 2QVMA 4H8QA 1ND0A 3GRGA 3POHA 3CH8A 4QPEA 5DZLA 1CU4H 4KXZI 3MRKB 3GXPA 5IQNA 4ZO8A 2BJML 2ZKHL 1TDQA 4JO3L 4Z3HA 3D51A 4HF5H 4BFRA 5DZOA 3B5TA 5ANMA 1E8YA 2OX5A 2R4RL 3M1CA 2FHBA 5B21A 4AKPA 1RZKL 5IQMA 2W60B 3HUJB 2VXVH 2Q8BL 4R5XA 1SLUA 5SWSA 2N1KA 4I0PC 1A6AB 3FPXA 4PJCB 3VYPA 4GBXD 2VNCA 2V8MA 4DGWC 5JZ7D 2OI9B 3CVHL 4GSDH 4KHTL 4EPSA 5EEZA 5HDQH 4OZHF 2HX8A 4MCYA 1KCKA 3O45B 5D4IA 5G4NA 4HSCX 2N0MA 1JHLL 4NWTH 1IAMA 3CFKB 4U1NB 4J3XA 4PRHD 2HKFH 4K7FA 1G7HA 4UNUA 3VMOA 1P4LB 5BJTA 1BM7A 2F1EA 3INUH 4YN3A 2PXYA 3Q48A 5FO8B 2EIZA 1G1CA 1CT8B 3VFUA 5HXMA 2A1WH 2AI0L 3QC6X 4JHVA 3EGXB 2R0LH 5EIIB 2BZ7A 2XDHA 3P3SA 4IBTA 1NCAL 4BE6A 3FB8B 5EZLA 4NCC1 3FFDA 1U36A 1HXMA 2PCFA 3VFRB 2EKSB 4LHUD 4XX5A 2GB2A 3FQYA 3FXIC 2V37A 3B9EA 3FU6A 5F6IB 4OLZH 1HZHL 2OXHA 5E70A 3VNZA 4JFHD 3UZEA 5BS0E 2OKMA 1IILE 5F0PB 1JGDA 3HN8A 1ZLDA 3IS1X 4OB5L 1B0GB 1NDMB 4FABL 2VQUA 1G7MA 5F1IA 1I3GH 3NFPA 4FQJH 3LPWA 2D3LA 4M48H 1SOXA 5AKRA 1A64A 4PJ8D 4U6VL 5D7JD 5F7DA 5CBEB 4V1DA 2JXMA 3S5ZA 5GGQL 2WLYA 4X7SL 2DQUH 2OMYB 1JWUA 2O61B 2C5DC 4KUCF 2BY1A 4I3RH 3RTQC 2YOAA 4G70B 3L13A 1NGWB 1NGPL 5E1HB 3TO2A 4XO4A 1EXGA 1CJYA 4XWOD 5E94A 5KZCB 3US1A 1CUOA 1FL6B 1DVTA 4IGBB 2EECA 4JRXE 1JYVA 1SY6H 5LUMA 2W5PA 3NIFF 5FA3B 1UACL 4JPWL 4S1SH 2EEDA 3HMWH 4NGHH 2X1QA 1H0DA 1WBXA 5HDBB 4ELMB 3ECUA 3DJTA 1KIRB 1JZIA 2WXRA 2Y6SC 3WE6A 4F58L 2LFGA 4YDIL 3AGVA 1GIGH 2FECI 1BVLA 2QV2A 3KNBA 3HE6B 2GJ6E 3AC0A 1IGYA 3RUGE 2YZ8A 5D1XD 1R4XA 1SNRA 1E8ZA 2ZWKA 5DS8A 5AVZB 3KJ4B 4S10A 5JDSA 4ZXBD 3BAKA 4LSRH 3WKQA 4UM9A 3ZKND 2BZDA 4M5YH 4PJDE 1PSKH 4KKBD 3ZY7A 2YK1H 1BOYA 2CIKA 3B2UC 4MNGB 4ZTEA 4DK5A 2QGBA 2ENPA 2YARA 5I73B 4U2YA 3CTTA 4PS8A 1W72H 1D2OA 1O7SA 1MW2A 4DGUA 1XIWA 5I19L 4OF8A 1HL5A 3CDGA 5FECA 1YEJH 4TLUA 1VACB 4HISA 5TE4L 1CLVA 3OG6B 3L5XL 3KCPB 3V6FB 3IE4A 2AJSH 3ARTA 1N6QL 3CZUB 3A67H 4FX5A 1U8MB 1SXNA 3FJTA 3OTTA 1JPSL 1YN6B 4Y2DD 3B8SA 1UYWH 3CXFA 4PGEB 1KC5H 2B2XH 1JXKA 3JZ7A 4OLUL 3GMRB 4JKMA 2FBRA 4GQPH 3DGDA 1UZ8A 2F61A 4RMTA 3NRQA 2UUDH 4KRMB 3PP3H 4ANUA 3ZDXF 4KDWA 3BVNA 2H1PL 3AU1A 4OT1H 3RVWC 3MMEB 1WSST 3GSNH 3GMOA 1KOAA 1QLRB 4F2FA 2WNWA 4YSOA 1UHVA 3X12B 1Z3GL 4N2NA 4QXVA 2MHAB 1YEHH 3QQ9D 1JK9B 4XZ4A 4Y1AB 1JXFA 1NWPA 1DVFD 1SJEB 3GEWB 4JFFB 3VI4A 3PWUB 3KZ8A 1JNLL 3TASA 3TM6A 2JK5A 2X89D 4K7PH 4Z0XB 3Q3GB 5DYFA 2P8LB 3TBSA 4OLVL 4XI5D 2QFPA 1I8LA 2W07A 4UM8B 5DJ2A 1VKXB 1G9MC 3ZE2F 3TV8A 3MLWH 3U4KA 2R69A 3WJMB 4GYBA 3G5VB 4PWEA 4QEGA 2GABA 4OD2A 5IW6A 4OQ1A 3V5KB 3FT0A 4GRLA 4YAQB 1BXXA 2VLRB 4NM8H 4C4KO 2ZJSL 4QAMB 1DQIA 4OD1L 3CIAA 3TP4A 5A6MA 4K3DH 3GSQA 4F91B 5IV2B 5LCVL 2EDHA 2V5YA 4U7MA 2YXMA 1GYVA 1SBSH 2GC4C 1SRDA 1AD0B 2ZWSA 3QE5A 2EUVA 3ULVC 3I9GH 1NKOA 4URTB 4TNEA 2OMWB 5DA0B 2NUTA 5IKCA 4WUKL 3N9GL 4Y2LA 2DLFH 3N44B 5A3IC 3K6DA 4XO5A 4D8OA 2XBZA 2I25N 3KPRE 3H9ZA 1L0XA 5ADPL 5DLLA 1WAEA 5AB0A 3AABA 3LNHA 1CBVH 2XN1A 2Q0ZX 2W0PA 3DYPA 5C7XL 1SVZA 3UGUA 4Z7NF 1P2CB 1MELA 1P5UA 4ONFH 2CPUA 1CC3A 2DQ6A 1FFTB 2NMSA 4U1GB 2FCBA 4BSVB 3TA3C 4P2QA 3IFNL 3FQNA 3ARPA 4KVCL 2OTWA 5D7HA 1DEEA 4U1JA 2BOBA 5F89B 4DN3L 5I6XC 3QGVA 4Q7DA 4B9ZA 5KUKA 3MFFA 4L8SB 1NIEA 3LMJL 3BZFB 3PHOA 5G5DB 3GSRB 1JGLL 1CZ8L 1KTBA 3UTZB 2OMUA 5DHVB 1JZ6A 2BH0A 3KD4A 4AUUA 4MNQD 2CJ3A 1J88A 4P5TB 1ZK5A 4OCWH 3LKPA 3RQ3A 5CJXC 4GNKB 2ICCA 5I0XA 4TLKA 2OMVA 4EBQH 2EINB 5IF0A 1HHGB 3NFSH 2EDTA 5CSZB 3EUUA 3WHE1 4F8QA 3U46A 2CGYA 3MOBH 4ODVL 2OZ4H 5DO2C 4AKQA 1CFVL 1RLWA 2YBRA 4NO0B 4F7MB 3FHEA 2EDBA 3LRSA 4N0UE 3ZIMA 4PJGB 5EZIL 3HI1A 4I9XA 1MNNA 3A4FA 3DROB 3VXQB 3TXAA 2Z65C 4CVWA 5AW9B 4PUBH 4XCFL 1KENH 4LKXB 3L1OH 2XVKA 3V4UH 3PWLA 3SPHA 4DO4A 4Z7WB 1YC8A 3T3PB 2VDKL 4KMQA 5DRZB 3NAAL 5C2UB 1CGXA 4YHYC 2FO4A 3P77A 1KBPA 4PREA 3DBSA 1MAKA 1MFAL 3WSQL 3HB3B 3TIDB 4DPBX 4EDWL 1ZKAA 1FVDA 4X6FB 2Q6WB 1PDKB 2QHLA 1I8MA 3IJ9A 1XCWA 3AXLA 1DJXA 4P23D 5TE7H 1CQKA 2J6EH 1OHQA 4C58B 4WV1C 4U6XA 2ADFH 4FXLA 2BCMA 3QXDB 1MLCB 2UWEF 3WNOA 4PY7A 1HYSC 4O2CB 1PQZB 5L2KE 2UZIL 3TX4A 2CR0A 3VI3B 2XWBA 4MB1A 3WE1A 1ET5A 3G5WA 3ARED 1D9KC 4L3EE 3SCMC 3DURA 5LNDA 2XN9A 4JQVC 2Q3AA 4DEPB 1OAYL 2ZCLL 2VL5A 2YQBA 4L29A 3T6VA 4Q89A 4ZFQA 2Z1PA 1AMYA 2IDSA 4PY8I 1FCCA 3T3MF 3U9WA 4XR8C 2R0WL 4M9OA 1INQB 2Q86B 1M2VB 4HKXA 7CGTA 4TQ8A 3ZUCA 2Y5EA 5ACZA 4JGJA 3ISYA 4WNSA 1RIUL 1TFPA 4QXTA 4QRRE 2OXGB 3RWFA 1ZT4B 1UENA 3QXAA 4N5EC 4OZHB 4ZT1A 2MQCA 2VQ4A 2YD0A 5HGDA 4MDJA 3ZE0F 5AD0A 4FFVC 1NBVH 5GSVA 3PNWA 1OT4A 1XAKA 2E7LC 1TKWA 3NCXA 5IVNA 3I84A 2CLZB 4FQHB 4N9GA 2X05A 1RZQA 4PQXA 1GGCH 1IQDA 2VTFA 2XZAH 5KVFH 1CD1A 3QIWC 4HH8A 2FWSA 4UV4H 3ZMNA 5GJTL 5ID1A 2Y72A 2W9LA 1VFAB 1OO2A 4ZAKD 1FG2A 5I1KH 2FEDD 2BIQA 1A4KA 4PB0L 3WNLA 1FNGA 4DHLA 4WFEE 2WOYA 4BZ1H 4O5LL 5D6DA 2YRLA 2XIIA 4H26B 4PY8J 1ZGLB 1ZWIB 5GS3A 4NYLB 4UQIM 3LXBA 3W9EB 4F8TA 5C2BL 5KVDH 5K9QG 2ZXGA 5IQ9A 5KYWA 5EZJA 4ENZA 3Q6FB 2X42A 1UXLA 5DWPA 2Z91A 2O1AA 4Z1PA 5CLWA 4WHTB 3T8XB 4B9IA 3A47A 4TSCH 4J23A 1XT5A 3HZVA 3MSPA 2QSCL 4KQ3L 2X9YA 3VWKB 7PAZA 5HD8C 1JYWA 4FS0A 5IROD 3O6FA 3VFGL 1QQDA 4U6HB 2Y5TB 4P9HC 3VA6A 3NZHH 3QULB 2XV6B 4OTXH 4JB9L 4DSYA 1ID5I 5DRXB 3O9WA 1LP9E 2ZXDA 1G4RA 4HHAB 1Z0NA 4H0IA 1AGFA 4TSBH 2XTLA 3BFQG 5CSGA 4YBHA 4KI5E 3VFSB 1LEIA 5TF1H 2NY0C 3RJQB 25C8H 3NIFB 3F58L 3D1MC 3P11H 5DYOA 3LEXA 4FZEH 3T0VA 4HIHA 3FQWB 4YDJB 3UJTH 3H3KA 1KBBA 4P3DA 2HLAB 4E68A 4NQQA 5A2FA 4E41A 1EHKB 3W0WE 3BP6B 3D30A 4NWUL 1EHXA 4NQDA 3RVVC 5T33L 4MQXD 2HMID 1C16B 2CA4A 4PWKA 5DK3A 2EE6A 2E7DA 3ARFD 4EVNA 1GRWA 5FGBC 1DLFH 1TO4A 2G2RA 1QUNA 1A3ZA 1W0WB 3WO4B 5KYNA 4PV9A 4X8CA 3WIFA 1L9OA 1CN4A 3QORB 4YO0B 3RNQA 4GMTH 4MMZB 5E4AA 3MRFA 4AG4L 3MRPA 1YNLL 3WFHA 4EIBA 4WHYG 2PTUA 4ZW3A 2FBOJ 3WFBL 5C08A 3KM1A 4DW2L 1KTDB 3SKUD 4BXSV 4U6TA 4ZD3L 1XGRB 1U3HD 1DANU 4RAVA 1GZHC 3VFOB 3C6LC 4N8CH 1TYJA 1QABA 1I82A 1W80A 5HYJE 2J1XA 1D5BB 5LGKA 3T0EE 1MI5E 4YJZL 3APDA 4JZJA 5F0JB 3VJ6A 1WWBX 2QPFA 1G7PB 5KSAA 2QKIC 2R29H 4JEGB 2P5EA 4QXWA 4WTXA 1XTLA 4KXCA 3S4SG 2AVGA 4UILL 5HHPB 2W88A 3BJLA 1INDH 4I9WD 2NY4D 5E6UB 3MGTA 5CD5C 1I7ZB 3ZDXB 4N28A 5C07B 3L95B 4UQCA 1MHPL 3O3AB 1A7NL 3DSFL 5I82A 1CLCA 1E4XI 3QCVH 1NC2D 3Q2WA 5D1ZB 3NESA 5MI0B 1BWWA 4GBXC 1BHGA 4L1SA 4WI6A 1TZGL 3KWVA 1RVFL 5JZ7C 1J11A 1C5CL 1RZJL 1RPUA 4G5ZH 4YPGA 1WP6A 4KKLD 4LDOB 4U7SA 2Y07L 3BPNB 3ARUA 4NENA 3PIQB 1P9MA 3PG2A 3LYRA 4HIJB 4NEHB 2AK4D 1H8LA 1ES0B 3TT1H 1IVTA 1I9EA 1FFOB 2C9QA 5DS2A 4OM1L 1NUGA 5TQ2H 4M6ML 5I28A 4K8RH 1G7QA 4NQCE 4ZMTA 2BNQB 5LXVA 4Q9QL 1I3RA 3NJFA 3G6JA 4NN6C 2DWEB 5MEQB 1A7PH 2R0KL 2GTQA 2I9LB 4Q0XL 3GSUA 4F8PA 5L88H 1K85A 4PM1A 4A6YB 2H8PA 2BVEA 4WI0B 2QQNL 3T0AA 4X80H 1N5AA 5T1DH 1MJUL 1MCPH 4F2EA 5CO1A 1PZAA 2KT6A 4NQXB 5EU3A 2MMXA 5K9OB 2XVBA 4OKDA 4XRCB 2NYKA 3GHEL 1JYNA 3B5GA 3NEXA 3GS4A 2MPVA 4F33B 2DKUA 2EE3A 3DXAD 3LZRA 1R17A 2IAND 3ESUF 3MRDA 4MD0A 4FOMA 2EYSB 4K3HA 1Q9LB 5DJ6A 3VFMB 1CU4L 3TWYA 2ZWZA 4UT6H 2CWRA 4XMXA 4OBSA 5FGRA 4MWFB 1JXGA 4OZFG 5EZPA 4XCCH 5T1KD 4HF5L 2HVKA 1FH2A 4ZFZB 4ZUVB 1RZ8B 3C5ZD 3HBPA 2VXVL 4ONGH 4XWOC 4JPKH 1MAMH 1MREH 3VAEA 5JPMA 5J6GA 2AJZB 4KX9A 2VCOA 2QVTA 2ED6A 4QF1B 1OAJA 3BW9A 4GSDL 2VJ8A 4GAYB 5HDQL 5DUMH 2QELA 3N3EA 4PBXA 1EAOA 2WAQA 2DWDA 3MN8A 2RH0A 1C5DB 4XP9H 2XG5A 1WC7B 2NQCA 4H0GA 1QA9B 3SSGA 1FVCA 2HKFL 3D85D 2J44A 3IAQA 4MDIA 4IBUA 1KJVB 2OZNA 1NAKL 4WW2C 5MERB 3EF4A 1EQWA 1XSIA 1VEOA 3INUL 5C71A 2YSSB 2J1KA 4N2IA 5D1XC 1KB9J 1YLBB 2F8IA 1I9JH 4PYGA 1ZJBA 4NIKB 1NFDF 4ZO6A 4ZXBC 4TQIA 4BK5A 1B6UA 1L3WA 2DMBA 4JFDA 3ES6B 3BZDA 4G2AA 1I8KA 2A1WL 3ROOB 5ITBH 2R0LL 3PQYD 2YQGA 4JRFA 1GZQA 4YIQA 4KKBC 5C0CA 3B1UA 4JG1H 3OKMB 4FKKA 2RA1A 3QEHB 2E9GA 4N2BA 2VZ3A 1IB5A 1HCFX 1KCSH 2IQAA 1F6AB 1XB8A 2UWEB 15C8H 2HRLA 3UTSA 5D6CA 3BLBA 5BW7C 1Q94B 1C8QA 2MNJB 2AEQH 1JS4A 5C0BA 5GS2D 2GJZB 4OLZL 5DHDA 3HAEB 1W0VA 1C7TA 3M88A 1XH2A 5GRJH 2IBBA 3FUMA 1I3GL 2AGJH 4FQJL 1T80A 2FL5B 1XFPA 2YGPA 3IDIB 4M48L 4M7ZC 3TPUA 2D7NA 1MCOH 4POZD 5IJDC 2DIEA 3L3JA 4OZFH 1KYOJ 4PH8A 4HS3B 3IXAB 2VMFA 2DQUL 5HSFA 3QSKB 4I3RL 4Y2DC 4QRSB 4J3SA 5KSUB 4AMKH 4NRXB 3CN2A 2ADIB 3K4DA 4JFWA 5LN8A 1GGIH 3T3MB 2SODB 3S35X 1N6VA 2FQEA 5CS7A 1FZJA 1SY6L 3WEBA 3PXLA 5ICYB 2BHUA 2ED9A 5EBGA 4Z7QB 7FABH 4KXBA 3GYRA 3LKNA 4S1SL 3CFJB 3HMWL 3EO0B 4JJHA 2MCPH 3ZE0B 4M61B 1DVFC 2GCYA 4CSTA 2RIKA 2YIHA 1W8OA 3CU1A 1I4FA 1HS6A 1EH9A 3ALWA 5ICXB 2VZOA 4JZOB 2CPCA 3JWNG 5HHNB 3WIHH 1GIGL 3MV9A 1UG9A 4PV1C 4CADA 4KVNH 1SDDB 3S37X 4QOKA 4ZUTB 3ZGIA 2MOGA 1DSFH 3EYQD 3MYJB 2WXLA 2X09A 1DVYA 3LZPA 2LTQC 3M46A 4LSRL 4LQ1A 1PYWA 4ES8A 4IJ3C 3S0PA 1Y07A 4M5YL 1BQHA 3BP5A 1YG9A 2F53B 4XH2B 2YK1L 4B5EA 1KFGA 2CRYA 2VUYA 4HEMA 5EBMA 3ROLB 1JUFA 2K6ZA 4C56A 4XNMB 3FSVA 2HYMA 4FXGC 2YPVH 3TEYA 3EJPA 3PJLA 4HLEA 4KMTH 4BQ8A 1FL5B 1W72L 5DEJA 4E0RA 5DD0H 1WBYB 1N59A 3BQVA 4U49A 4YBLB 3RLSA 4KK8D 1ZV2A 4J3VA 3MNDA 2FYYA 2AJSL 3O4LE 4R97B 3BH8B 3GO1H 1ZLUK 3WN5C 5C0AE 5TH2B 4DPAX 4I89A 1E27B 4S0HA 3A67L 3HR6A 2KHAA 4BWWA 3VM5A 5AAPA 4RSVA 5AAWA 4XBPB 2WSKA 1UJ3B 1UYWL 2X6MA 3FU5A 3R1GL 5HVGB 4LMQE 1P84K 1KC5L 2BDNH 3OG4B 3VFWB 1QBAA 2ZZUT 4PP2A 4H25A 4JZNA 5EWIH 3O3EB 2HH0L 4YHOH 4OT1L 4JJOA 4G6KH 1HQRA 3GSNL 3E9UA 2WLKA 3VGBA 1DQTA 1YEHL 2J8UA 1U2HA 2XA3A 3D39E 3LH9A 3VRJA 3DX9A 5KBPA 2L7EA 5CJQH 1OE1A 4K7PL 2CLRB 1GGTA 4LPCA 4Y16D 1EEYB 4FNRA 4UOJA 3VVVA 1JDDA 3KWTA 4LCCA 5I66B 3I9PA 2P1YA 1E9PB 1GC1H 3MLWL 3QUXD 3S5YA 4P57B 4KZDH 3EFDH 3F7PC 1BZOA 4U31A 4AGPA 32C2A 4UYPA 5T3ZL 2PABA 4NM8L 1LWHA 1KG0A 1T1WA 5IB4A 3LTVA 4A67A 1EEZB 3ZDYF 2WBJB 3ETTA 4K3DL 3STZA 5G2NA 3RGVA 1SBSL 2B4CL 2YFOA 4BFIB 1C12B 4TKWA 4NKOB 3I9GL 2BS8A 5IHLB 2BS71 4P23C 1OK0A 2V7HA 3FQTA 4HUVA 5H8DA 1T7VA 1GYCA 2DLFL 3TIEB 5EUOA 5I30H 4JO8A 1MCIA 5EA0H 8FABA 1LYQA 1P7QB 1S9VB 1AO7B 2ESVE 4IRSA 3L3HB 1CICD 1CBVL 2APBA 2IIJA 3HBZA 4FTVA 4X6EA 3DKHA 4KRPB 5AYTA 4AJ0A 4E9RA 3SKOA 4PWGA 3IETB 3K8MA 2NCEA 3AREC 4NXKA 4MJ6B 1L6PA 2ATPB 1TNNA 4X5XA 1UOKA 5CGTA 2IPUG 1S9YA 2YPLA 5DQJB 5T3ZE 4UQBA 3TJPA 3N42B 3PAZA 3OMAB 4ABVA 3RWDB 5KBDA 3K71A 4JCMA 5GGSB 3RRQA 3D12B 1ZT7A 5L6YH 1IFGA 2NSQA 3CSGA 4QYAA 1A6ZB 4UT7H 3RNKB 5EOCL 1IJ9A 1N0XH 4OCWL 1FYTB 5AEAA 1X5LA 1HT6A 1NAMA 1ZANH 3GDCA 1XGPB 1VFOA 1ACYH 2WYHA 3F5WB 3NFSL 4TQEH 5KANG 1PD0A 1FNLA 1TVDA 3CC5A 3MOBL 5I24A 2OZ4L 3JUYA 4QHLA 1RIVH 3MREA 3EGSA 3H8NA 3SGJC 2XPZA 3LKOA 3OKDB 3O0LA 1KJ2H 3O2DA 1BLIA 1JGEB 2J12B 2WKGA 5A1AA 4N2EA 4D9QE 1E4KA 1KENL 1YEDA 3L1OL 4XHJD 1A2YB 1FNEB 1Y7VA 2DEWX 5D71H 3V4UL 3RDTB 5D2NA 3AQYA 4D7PA 3P40A 2GQHA 4OV5B 4ZAKC 1F1DA 3MUGB 1AS7A 3SJVA 2O5NA 2RFXB 1FAIH 1BPVA 3TBTA 1DDHA 2WKOF 3MRRA 4D0DB 1IE5A 4LVHB 3DDFA 3FH5A 5TE7L 2J6EL 1V3LA 2ADFL 4U1KB 5F9OH 5I6NA 4YDLC 4I0PA 5DJZB 3HZ3A 2GUOA 4NO2A 4OCLC 1RFDH 2YSTA 4XP6H 2XIBA 4QRFA 1FZOA 4ZBJA 3RWJB 4XVJL 5TDPB 5CLTA 4OI9A 2PWEA 4DTGH 3NSXA 1L0QA 1VFUA 4NERA 2OYKA 5BOJA 1AHMA 3P4OA 4HGWB 5J12B 1E42A 1F3JA 2DD8H 5IROC 3RFRA 1MWAB 4U2ZA 4TNFA 4L8DB 5CCJA 1J9QA 4BK4A 2VDNH 2EC8A 4JRYE 4ZUUB 1MW3A 3QQDA 4MXWH 3HKFA 3IPBA 3B2DC 3SB3A 2GPZA 3MNVA 2JKWA 4X5QA 1TYRA 1UWEH 4HKJB 1CGUA 2VLJB 3FRUB 1LL1A 4H2CA 5G4OA 3SCMA 5J11B 3BGAA 4TF4A 3FUKA 4JVWA 2Z92B 2BOCA 2VWEE 4MBOA 4JREC 3G5XA 5DVNA 2C3VB 4IIQB 5BO1H 3T8MA 1KCWA 3FTGB 2EKJA 4Z0BH 3RWGB 1NBVL 2IH9A 4LVOB 4N1EA 3A21A 1CFNB 1UATA 4RNRB 5L2JB 1TU2B 1N64H 1CMOA 4MQXC 5JMRA 2HMIC 4I2XB 3C8KA 1GGCL 2QQQA 2ZX7A 3K6NA 5KVFL 2GIYA 3ARFC 1YY8B 4UV4L 3L5WB 3VI4F 3X14B 1MCHA 3BGMB 1NFDB 5EEUA 2VDPB 3KPSD 5I1KL 2VR3A 3IFLH 2WN3A 4EI6B 4J2QA 5IM7B 4PG2A 3KLKA 5JQ6L 2IWEA 3BUPA 3NVQA 3RTQA 1ADQA 2IAMC 4BZ1L 1WHPA 3OGOE 5DK0B 3IKKA 1T1YB 1T20A 4TNWF 5J13C 4APQD 5GGSY 3DX8B 4FQXC 5KVDL 1MVUB 2P48B 1GTFA 3JV5A 1ML0A 1U3HC 1H6UA 4YDZA 2JKRM 5D8JH 5DJ0A 3NP3A 1FL3B 1F11B 3OSKA 2XWCA 4HJTA 1INEH 3VD7A 5SWQB 4MQ7A 2CHNA 3D69A 1K6QH 4F3FB 1HL8A 4EF3A 5B38A 4X7DC 4PJFA 3A6OA 3NZHL 4IEFA 4UOW1 5GGTA 4DIXA 4XT1C 1H3VA 4OTXL 4K07A 1DJHA 3OKLA 4HC1A 2OSLB 4P59H 3G9VA 2VN5A 2WZ5A 3WTUA 2QKSA 2VSMB 2NY4C 1P1ZB 2V9UA 2VC2H 5TF1L 2B16A 1T89C 1SZNA 2NY6B 2WIIB 25C8L 5E6IB 3P11L 5AKVA 1IBGH 4FZEL 1X5XA 4P5KA 3GWJA 4Y4FC 3W56A 1AR1D 1PD6A 1PEZA 1HQ4B 2BIOA 3V5DB 4X9GA 4I18A 1ASQA 1MCWM 2E75C 3IJHB 3PWPA 4KNTA 4HJGB 1AZRA 2AK1H 2VXQH 4KKLC 1JN6B 4NP4H 4NQVA 2ZOKA 4X6CE 4NNPH 3OJMB 5DURB 3QG7H 3NFNB 2JIXB 1R3KA 4FQPA 5E8EA 3PV6A 1SHWA 1DLFL 3NH7H 1KCBA 2PPFA 3BUQA 2WUCH 4UU9B 4RX4D 1UXMA 4PJDA 3GM0A 3TONA 1ZT1A 1Z6JT 5AW1B 1S46A 1TQUA 1BVZA 4OD3H 4H1LA 3CFTA 3QZWA 4GMTL 4OZGA 3ULUL 1QEXA 4AQ1C 1H6FA 4Y19B 4QI3A 3T2QA 2P52A 3WAJA 3MNWA 2EVHA 4A6YH 3F00A 2A73A 1B4TA 3HG1A 1NL0H 1XGUA 3JTTB 2MCG1 3KE0A 5L4JA 2WNKA 5D7LD 1IE4A 2XKNA 1J8HB 4N8CL 3FB6A 4KK9D 4S2SA 2WLLB 3E0GA 4G7VH 1YPZE 3WD5H 5E2VH 3WL9B 3V7AG 3AMLA 3BD5A 3L81A 2B8OT 5AW7B 5J56B 3SDXE 2R29L 4JO1H 2XPYA 4HWNA 4U1SA 1WTGT 3I75A 3D50A 3T8VA 3RL1B 3MRLA 1DUYA 3HNSH 1INDL 2UXTA 5T1LD 2BY2A 5E9DB 1KIUB 3ULUE 2F7IA 3MRBB 4BQCA 4WENB 4NC2B 3C5ZC 1MUJB 4NDMB 2X53A 4RA0C 3V0WL 1ND0B 4IDJH 4A2MA 5JHDD 1V3JA 3MLVH 2RHEA 2ZUWA 3HRPA 3GMQB 4L37A 1XCTA 5DFTA 3KPQB 5LNEA 1QVOA 1DBKH 5BQDA 5DVMA 1IGJA 5ANMB 2OX5B 2MKLC 4OCXH 4APXA 5JIKA 1L5GA 5SWSB 4F7KA 3ZTNH 4PFEA 4BA0A 5DO8A 4IU2A 4B96A 1BQKA 1A7QH 1E9QA 3D48R 3OAZH 1M4KA 3ZT5A 3TT1L 4AM0A 3QWRA 5DDHA 2YBGA 2JV6A 3DJSA 2YFNA 2JKSA 5TQ2L 3QFGA 1A7RH 2W65A 1RERA 4K8RL 5CSBA 4MCYB 5EC2A 5EH1A 4FHJA 3TA3A 3IVKA 3C60D 3ZDYB 3MA7A 4L8BA 5F6HI 2DQHH 5KYYA 1M71A 3TYGH 1HJCA 1A7PL 2Q87A 1G7HB 3HUJE 5BJTB 2WHVA 2X4RA 3S3CB 4KDTC 4C47A 2PXYB 4PJCE 4XOCA 2AJ3A 2EIZB 1AS8A 1CQYA 2DH3A 2ZUQC 1NA8A 2Y9RT 4X4MA 2LOEA 4X80L 1T3FA 5K33A 5T1DL 4M7LH 1SXAA 1MCPL 4I3SH 5FKAA 5CJXA 5GGRA 2JVUA 2G5BA 3H2QA 1FH5H 5EZLB 5PCYA 4LCYA 4AIZA 3FFDB 4FYRA 1HXMB 5F7EH 4BCZA 5FA4A 2L7JA 4G6JH 1V8HA 3E8UH 5E2WH 5DHMC 4LKCA 2FEJA 3RVXD 4CC0A 1PLAA 2R2EB 4E9XA 4MMYB 4Z7IA 4JM4H 1HWHB 1GS8A 3LAFA 2CBMA 4NBYB 4F8NA 2Z7WA 2OXHB 4UT6L 2X4UA 1JGDB 2EXTA 3X1FA 5J6HA 4XCCL 3RPBA 5F1IB 1G7MB 3NFPB 5CR8A 2X2JA 1EVTC 3DX3A 2VT0A 3S5LA 2VZVA 5F7DB 3EZJB 5B39A 4ONGL 4V1DB 2JXMB 4JPKL 1MAML 1MREL 2WO4A 2YAQA 4JY5H 5F6HJ 1JWUB 3APCA 3ZT6A 4YLQT 2WB7A 4OF5A 3LRGA 4WV1A 1BZEA 5DC0A 1TCMA 3MRCA 3TO2B 1ROCA 2YA0A 5DUML 5E94B 4X0NA 1ZOXA 3S8GB 2H3NA 4XP9L 5FV2A 2A74C 2NLJA 1WTLA 2F6AA 3QDGA 2BSEA 3NJGA 4HP5A 1JAEA 4TN9A 1EEUA 3WG7B 4M7KH 5EUKA 1G9NH 2WUBH 1D9KA 2BSSA 1H0DB 1WBXB 3EYQC 4OQTA 1I9JL 4JQVA 3WE6B 3HBGA 5ITBL 4RDQG 5EBLA 1BVLB 1XF2A 3KNBB 5E1IA 4JG1L 1IGYB 1NEPA 3DO7A 5DS8B 5JDSB 1M9WA 1RZGA 5FFGA 5L7XH 4Z3IA 4PGDA 15C8L 4UM9B 4FFZA 3U1PA 2GTZA 2AEQL 2CIKB 4HUXA 5HDBE 4ELME 1BF8A 1S7WA 3TU6A 3LN4B 1CFBA 4KK8C 4K5MA 4J5VA 5GRJL 3TYFB 2R4SH 1J12A 2FT7A 3BE1H 3CFEA 3FTSA 4JFEA 2AGJL 1DQVA 3ZGHA 1JL8A 3DIDA 1BP3B 3IS0X 1MCOL 3ENEA 4BDVA 2BNRA 1T2XA 3FS9A 3RZCD 1XIWB 4HWEH 1WRFA 5DZPA 5TF0A 1GSMA 2NXYB 2P5WD 3CDGB 4UMGA 5FECB 1CWVA 3B7SA 3QIWA 4MXVE 4AMKL 2OP4H 3KXFA 3QDMD 5LO7A 3HLAB 1TLKA 4KO7A 4CBZA 3T0ED 1MI5D 1SXBA 4YHLL 4GQQA 4XP5L 4O9HH 3EXJA 4MNGE 1RSFA 3UAFA 4NQED 4GAAA 3A4EA 2EE9A 3V52H 1KGUA 2PWDA 3X3GH 7FABL 4DZBB 1Q0XH 3BEWA 2Y22A 2A4EA 3RILA 3ECQA 1L7IH 1UZ8B 1UFUA 3GJFK 2MCPL 2GSGA 4NJAH 5CKGA 3REVA 3AU1B 4Y8AA 4HIPA 2Y0SA 2JQAA 1D7FA 4U6YA 4AITA 2VAAA 2LU3A 1ZEAH 4KVNL 1NANI 3Q1SH 1KY6A 1PKQA 2HRGA 3X3FH 1DSFL 4DGYH 3VI4B 1OB1A 4ZFGH 3BPLC 4AOFA 2JK5B 4MA1C 4UI2A 5I74B 1CURA 3TBSB 2Z4QA 3SKNA 3EADA 3E1ZA 1G6RA 2W07B 3BAYA 4FLSA 1T2QH 2AEOA 3H55A 5DJ2B 2Y3NA 4L0ZA 3NCEB 3FOLB 2QZQA 4M7JH 3F7LA 1WWAX 2BVOB 2YPVL 4OD2B 5IW6B 3CK0H 3AUWB 1EAQA 4GRLB 1JDAA 4KMTL 4Y1AE 1HE7A 4YQXL 4K15A 3G6JF 4JFFE 2EIBA 5DD0L 3GSQB 4LVEA 1UM5H 5B7FA 4XXWC 2WVVA 4KXDA 4FRWA 4AEEA 3MNZA 3MKGA 3GO1L 2NUTB 5IKCB 1BQRA 3SDAC 1YRKA 1J7VR 3UCQA 1ILSA 2A2QT 2ZOUA 4OI8A 3BUYA 2H3KA 3DHUA 3QWOB 4F37F 1LP9A 1OY3B 3ARBD 4N90D 3JYCA 3KAAA 5FGBA 1MXGA 4MASA 2VLRE 1T1ZA 2BDNL 3PDGA 1X3DA 4YDMA 4YGVA 4YXKL 1P5UB 4H13C 5EWIL 4HX1A 4YHOL 5F97E 4G6KL 1OQXA 4P2QB 2J5LC 5L8LB 5K39A 3TBYA 1QWUA 2OTWB 4XVOA 1DEEB 1O75A 3MI6A 2BOBB 4U1JB 4BINA 3U2JA 3EJQA 3V4PH 3MFFB 1RH8A 1JRHI 2J1YA 5JIQA 3PHOB 5CJQL 4PRIA 1D5MA 5CP3A 4X50A 1E9OA 1YAZA 3QYCA 1BD2B 3U30C 1GZHA 4QHMA 3C6LA 4YC2C 3EFOA 4HKZA 3LKPB 3GTNA 1NCNA 2WOBA 3TN0D 1GC1L 2OMVB 4C59B 4CN6A 5IF0B 1SPDA 4A2GA 4K5NA 3EFDL 4KZDL 2ITDA 2CXKA 3Q5TA 3TTSA 2YBRB 4NI6A 4UTAH 4GSRA 2QKIA 4AJWA 2OSXA 3LRSB 2XWRA 4P5MA 1LILA 1JJUA 5DVOA 1AZCA 3GMPA 4EKJA 4YX2H 5D5MA 3DRQA 1JZ4A 2GY5A 4N87A 1WLHA 3PWLB 4AXWA 2EUXA 4WWID 4AL8C 3FC8A 5I30L 3GSOA 5CJ8A 2FO4B 1OSPH 3P77B 3MKKA 5EA0L 2GK2A 4GBXA 4U1GC 3UAJD 1FVDB 2OW7A 4TVSa 2FUTA 1DZ0A 3AXLB 1FZMA 1S4IA 3GRBA 3OHMB 4CGUB 4DP1X 3OMNB 1J8KA 5FEBA 3DIFA 3O2WH 4PJGE 4U6XB 1OSZA 2BVUA 2QSQA 2ZAIA 1JZ7A 1RZIA 1NTDA 2H26A 2NY7H 4KPHH 1L6ZA 4DZ8A 4PY7B 5FYJU 2DJUA 3CDZA 1JHTA 4R7VA 5CJOH 3FSOA 1I8IA 2XWBB 4PRHA 4Z7WE 3T3PE 1I1CA 5KN5A 5F9WB 4P5TC 1FNSH 3IGAA 3Q8CA 4GUCA 4W68A 3VYOA 1THAA 4DT2A 3DURB 2EYRA 5IMMA 2XN9B 5L6YL 3G08A 4UT7L 1SLWA 5E08H 3PGCA 2FYVA 2HWZH 5JW5A 4NKDA 1N0XL 2VL5B 2E7BA 4L29B 5EFIA 3GXDA 3UBXI 1A14L 3EDJA 3BSZH 2XY2A 3UBXA 3UTTD 1ZANL 4ODTH 3QYMA 4X8JB 1ACYL 4DNLA 4RWYH 4WU5A 1NM4A 1DHKA 4LHUA 3VI3E 1WIUA 4G8GD 1RIVL 3KLHD 4Z3EA 4HKXB 3WUWA 3U4EA 3LX9A 4N2KA 5ACZB 3DMMD 1OAZH 3OC8A 1XX9C 4Y8DC 4QXTB 2Y2TA 4PV8A 3V8OA 5I18H 2HP4A 4ZQKA 5F7MC 5ECJE 3RWFB 3QXAB 4FJYA 5AD0B 5HGDB 4MDJB 4PJ8A 2EDEA 3DK2A 5GSVB 3SBQA 2PP9A 3PNWB 1FAIL 1TKWB 1U21A 5B39G 4N9GB 4XMZA 4XVTH 4DOHB 1IQDB 3N40F 1CD1B 5K59F 2XX0A 5F9OL 1FG2B 2KLTA 3KS0H 4WKZA 3WTXA 1A4KB 4APQC 1RFDL 1KIPA 4XP6L 5I1JH 1U30A 4OZHE 3VGGA 1ZVHA 2TSBA 3BT0A 4DTGL 5I2IA 3QJOA 2K9UA 1T6VN 3BLKA 3NJNA 1DJIA 1M1XA 3JWOH 3PXHA 4V2BA 2DD8L 1BG1A 3TNMB 2WINA 1WDAA 5D55A 4XCEB 2VZSA 4Y9EA 4YHPA 5IQ9B 5KYWB 5FHBH 3HG3A 5EZJB 3N0PB 4AZ8A 3SE4C 1I1AD 2VDNL 4WW2A 2EDKA 2Z91B 4MXWL 3RIAK 3OQRA 5D1XA 3TT3H 3MXWH 3HZVB 3UYOD 4ZXBA 4OW6A 4LGPB 3O6FB 3DSNA 1QQDB 5EPMA 2LQRA 4WRLA 5A43C 2FQFA 2P9RA 3BKJH 1V27A 3OZKA 3HMXH 4HIIA 2V7NA 3CFCH 2ROYA 3NIDF 3O9WB 4PCSA 5GZOC 1SHSA 2R39A 4NZJA 1AR1C 3B5HA 5BO1L 1RKRA 4Z0BL 2DQJH 3WNIA 1LEIB 3IWVA 2HG0A 5BW7A 2DIBA 2G0KA 3EZ8A 3P0GB 1N64L 4RRPM 5DYOB 3ZO0A 3LEXB 4HIHB 1RJCA 1GGBH 4P3DB 4IHOA 3FUFA 3FOMA 4JM2D 4ES9A 1T7YA 3VDCA 5CKAA 1CYXA 4E41B 4K55A 3WBDA 3ZYIA 2BX5A 4GKSA 4NQDB 3M1BA 4DN4H 5JUEH 3IFLL 4L4VD 3QEUB 3ZRCC 3IGUA 3MUJA 4OIFA 4Y2DA 4IKNA 1X5MA 2BM3A 3UEQA 3GRWA 1F3DJ 4LIQH 2HA1A 4UANA 1KCUH 2G2RB 1Z3RA 3NIFE 4PV9B 4YHKH 5MEND 5E8OA 3WIFB 3KG5A 2QQLH 1OLLA 3RNQB 5JHMA 1FWXA 3MRFB 2ATAA 5H37H 4ZS6D 5IUSA 5D8JL 4M6OH 3WFHB 3OAYK 4KK9C 3NCJH 5I1CL 1DVFA 1PLCA 2PO6D 4Y88A 1INEL 2IOIA 3EBHA 2MTPA 2VQ1A 5KAQF 2X89A 1K6QL 1YJDC 1UD4A 3SY6A 1AQKH 3ALXA 3CVIH 4WTWA 3KH4A 5EUOF 4M62H 2ESVD 4YSPA 2KL6A 3Q9QA 4RAVB 4CMHB 4P59L 2PETA 4XVSL 4FQQA 4LSQH 5DUPL 3KWUA 3VDBA 2FQDA 5J1SC 1V54B 1FFNA 2VC2L 2W94A 1R5WA 4JZJB 3AS1A 3VJ6B 5KSAB 2IPUK 2NY2D 5E5RB 4PJ5E 4HFWA 1IBGL 5E2TH 4FNPA 3DLQR 4KXZH 3FQXA 1FNFA 2WLJA 2YD1A 1IMHC 3VGAC 1A6WH 1TQCB 1QX1A 3MGTB 3IMSA 4N20A 2NY3D 1JP5A 5FV1L 5IQOA 2F15A 2AK1L 2VXQL 2XTSA 4ZMXA 4ALAC 1WT5C 2A6DA 3QG7L 3QAQA 4HV8B 1XAUA 3NH7L 3WN5A 2BHYA 3Q2VA 4G11A 4MMZC 4N4YB 4YPGB 2WUCL 5GZND 3DA0A 1DVUA 5GXBB 4OD3L 2C8NA 4K9EL 2DS4A 4NENB 4GSXA 3M17A 3C60C 4MLIA 1PAMA 2EDRA 2PW2A 3FU9A 3ZDXE 5C07E 2VMJA 1IBHA 4IDLA 3SOTA 5I76A 4ATWA 1RV6X 4A6YL 1WHOA 1G7QB 1HHKA 4HD9A 1NL0L 2G75A 4IU3A 2DJSA 1I3RB 2B0SH 3CVCA 3F7KA 3G6JB 4MNQA 5BV7B 5LNGA 3HKZA 3ZYOA 2CMRH 3QUZD 3O4LA 4G6AD 4X5LA 1MLBA 1KBKA 2GW5A 3GSUB 4AY0A 1ILUA 2AAVA 4G7VL 3CZNA 4LLDA 3RB5A 1GCFA 2H8PB 3B4NA 3II2A 4V2CB 5E2VL 1WUZA 1UM6H 1N5AB 1J0YA 3CAFA 3H2WA 3ZVVA 3MX0B 3U0PA 2DH2A 4JO1L 4ORZC 4BFBD 4AM0Q 1KYOK 4YK4B 3GNMH 5EU3B 4AE0A 1OCZB 1CL7I 3QXUA 5HGBA 2BNQE 3HNSL 5IFHH 2BIHA 3BN9D 3GJEA 4G43A 1BWMA 4EXKA 1X44A 3KYNA 3MRDB 4MD0B 4BFJA 4ANVA 3QEQD 4LU5H 3MLVL 5DJ6B 4BSJA 1JMXA 3BPNC 2WV3A 1IRAY 1DBKL 1E3FA 4P23A 3RVUD 1SHXA 2AITA 3WY4A 3MLYH 3QXVA 2VSKB 4G6FD 1XCQA 4DKFL 5J6GB 3ZTNL 5JPMB 4QLRA 1PY9A 1ZSHA 5CEXA 2E5EA 3JWDH 4M56A 1A7QL 4LLQA 3B2XA 4UTBH 1WZAA 3HFMH 1G7JA 1UFGA 3BW9B 3LVTA 5EU4A 3W37A 2EACA 4UV7H 3AREA 1MJ8H 1A7RL 3PY9A 5B3JE 4RGNB 2HFGL 4OR1A 2DWDB 3BRGC 2XG5B 2DQHL 3RWHA 3EJCA 3MXVH 4ZNEE 2PCYA 1AXTH 3BT2H 4MDIB 4EI0A 2G5RA 2L04A 1NGZA 4GXVH 2D7PA 4NT6B 1IZKA 4MLSA 2PUQT 3Q0HA 2WD0A 3UP6A 3DJ9A 4WI3A 2DI9A 4AGLA 5E99H 1I8KB 1ASOA 3EBGA 4LHUG 4M7LL 4I3SL 4WNQA 1GZQB 4YIQB 5C0CB 2X28A 2X2IA 2EVJA 4BK8A 2XG4A 1FH5L 3HE7D 3QEGH 7PCYA 2UZPA 5F7EL 4OFPA 2IQAB 4G6JL 2Y7MA 1CR9H 1E40A 1JV5A 1WCQA 2L7QA 3E8UL 5FYJE 3SGJA 5A7EA 2B3RA 4XBGB 5D6CB 5EZOH 4JM4L 2B77A 3RZCC 5C0BB 3UDWC 3K1DA 4XPHH 1CLOH 2DTSA 4XVUC 1EUTA 3KVPA 3CJJA 4JN2A 4AIEA 1BQLH 1ZAGA 4GINA 3GGWA 5HDWA 5CGMA 2OCFD 4ZAKA 3I02B 2ZD0A 4PJBA 5GGVY 3TPUB 3ZT7A 1P53A 3H9YA 4JY5L 5DVPA 3SBWC 3L3JB 4PJFF 3E1F1 5EU6D 2GBVA 4X5WA 1BEYH 2UWEE 3U7YH 4MSWA 5FF6A 5D7SH 5I1AA 4L9LC 3F05A 3F12A 5HDLA 2I07A 1FZJB 1NINA 3NACH 5F7HA 1AH1A 2FH6A 4L5FH 4X4YA 1YNTA 2PCPA 3SDYH 2ZT9C 3LKNB 4M7KL 4X7EC 1G9NL 2WUBL 3IFPB 4XN4A 4Y5VC 1BQUA 3OWRA 1UB5A 3PAUA 5T1MA 5IROA 4BFOA 1V55B 2GCYB 5FCUH 4M3KB 4F7TA 4YMPA 1P4IH 1I4FB 3FO9A 4Z6AT 1HXYB 1FHGA 3ASOB 5EDXA 1I53A 3ESOA 3MV9B 1ZJAA 1F00I 3T3ME 4LCWA 4CC4C 3ZHDA 3OAZK 3FO0H 5E8PA 2ZAGA 4YSSA 2X1PA 3I6KA 3QK0A 1E5AA 5BQ7A 4DFHA 5JYMA 1FBIH 5L7XL 4PJDF 1PYWB 4Z7QE 3GM8A 2NQDA 4YHMH 3X1EA 2W0LA 8CGTA 3E6FA 5I6LA 1BQHB 2IXQA 3BP5B 5GS0C 3NCMA 4X6BA 1BJ1H 3ZE0E 5EBMB 4OZGF 1JUFB 3BXNA 1A02N 3A6CH 4C56B 3BESR 1SUHA 4OLEA 3A22A 3MV7D 5HTSA 2R4SL 4D3CH 3G04A 5LLIC 5T5FA 2HVBA 2ISDA 4PSPA 5ABAA 5LGJA 1U6AH 3BPOC 5L0QC 1AIFB 4P06A 4YS4A 2R7EA 4RETB 4FG0A 1MPAH 1BGXL 4LSSH 3WTSA 4E0RB 1USZA 3KYKH 1VERA 4FFWD 1N59B 2D2CC 1MHCB 2DQIL 4JDVA 5MEPA 1JWSA 3TJHD 4IRZA 2OP4L 3ARFA 4KC3B 3RL2A 2PYFB 1T5WA 2FYYB 3CMGA 2F53E 2CHXA 1X9LA 4O9HL 1KPRA 3J27A 1OHZA 4X2UA 3L48A 1KB5A 2ED8A 4XCNA 1WCBA 1TCRA 2V6HA 4AQEA 4CILA 4GKOA 2IAMA 3V52L 2V2WA 5IB5A 3X3GL 1XSJA 3S9DB 3NIDB 1S78D 4HULB 4L1DA 4XXDA 1DFXA 1Q0XL 3RHWF 4PP2B 4H25B 4JZNB 4HEPG 1L7IL 4IBVA 3QDHA 4UWQB 4NJAL 4FQXA 2AQRA 9CGTA 1T6BX 4EUPG 1HQRB 4V11A 3EJZD 5F1SA 1HFUA 1U3HA 4PRAA 3CMOH 3OGCA 1ZEAL 1UT2A 5I6PA 3S88H 1ICTA 2J8UB 3Q1SL 3VRJB 4LB8A 1DVQA 3SPVA 5I16A 3ULVF 5HJDA 4YR6A 3X3FL 3B6SA 1S7TB 4ZFGL 2ZYRA 3CD4A 3IJ8A 4LOUD 4XBEH 1F13A 3OL2A 1ZXQA 2F58L 3UL4A 1EJFA 1K5NA 4XX1G 4ZRGA 1T2QL 2CO7A 4LCCB 1RUMH 2MQ0A 1U95A 1ZHNA 4K94H 1W2KT 2YKLH 1M05A 2KQNA 5JR1H 1ZS8A 1PD1A 4M7JL 3HS0C 32C2B 3CK0L 3FMGH 1T89A 3NJKA 5IB4B 1KG0B 1T1WB 4QWWD 3ZHNA 3BX7C 2F9BT 5D1QD 2XLLA 4G8EA 4NI3A 5DR5H 3LQAH 1NC2A 4Y4FA 3HS8A 5A2LH 3UAJC 2X9ZA 1RK1A 1ZD6A 2V7HB 3FQTB 4HUVB 4HCRH 3HZMA 1L6XA 2WC7A 4BH7A 1UASA 5GGUB 5EUOB 1FQ9C 5CZVH 2O6PA 8FABB 3BD3A 1IFHH 3L45A 4GXUM 4IRSB 5AQ0A 2AK4A 4FTVB 4X6EB 1PLGH 1W6LA 4BZ2A 3SKOB 1BBDH 4JN1H 4UIMA 5D9SA 2MOVA 2Y06H 3MC0A 1CD8A 4XMKH 4ACTA 2HG5A 2AVFA 4UQDA 5IG7A 3CFQA 4K8RD 4M5SA 3UEZA 4LLVB 3NDZE 4X5XB 3O6KH 3D4YA 2YPLB 4WHDA 2ARWA 5EULV 1P4BH 4EUPH 5I6MA 1YDPA 2VE6A 3V4PL 4XPBH 1ZT7B 3HC0A 4XNQA 1AO7E 1F8TH 3L5HA 2CBQA 4HHWA 5H2BA 4EDXA 3GXTA 3HJ0A 4WK4B 3KLHC 3T2LA 4Q6YA 5HHOA 2AV7A 1NAMB 1TJXA 2W8CA 3APMA 4GP5B 4MD5A 4PTTA 3DMMC 1AP2B 3W3BA 3GZOA 2WBJC 1TTCA 4WWNA 2MRYA 5I1EH 2ZOWA 1HHIA 3CC5B 2IANA 4QHLB 3MREB 1SBBA 3EGSB 3S3PA 4UTAL 3LKOB 2OLDA 2DLEA 3LNDA 5EO1A 1DEDA 5BRZB 1J8RA 3VG9C 3NCWA 3V9CA 1DLHA 1OARH 1KELH 4WY7H 4YX2L 5T1KA 3LZLA 1YEDB 3KPOA 2G5UA 5D2NB 1FYTE 4DVBA 3C5ZA 1P0SE 1U8OA 3ET9F 2P80A 3D18A 4MJIE 5IBUB 2JCWA 2Y25A 3SJVB 3D9AH 4QRTB 2UY6A 1OSPL 4MAYD 4HBCL 3TBTB 2E9JA 4BEIA 5KG9A 4IGBD 1DBMH 1DDHB 3MRRB 1M7XA 4XN1A 3BWZA 1Q1JH 3ESMA 4MKTA 3WS6C 2YC1B 2NY7L 4I0PB 4KPHL 3DECA 2GUOB 1QG3A 1Y0LA 4NO2B 5CJOL 3UROR 4Z5RA 1TTFA 1ITCA 1UWYA 1FZOB 3FDWA 4OGYL 4G82A 3D85A 3NABH 4N8VA 4JQIA 1AANA 1FNSL 1TXKA 4FL4C 2ZKMX 3P4OB 3HE6D 4PD4K 1F3JB 1IC4H 2Z8RA 3ATBA 3UG5A 5E8DL 5E08L 2HWZL 5FXCH 3PQYA 4I0CC 1G0XA 2ZWNA 2IGTA 3BSZL 3QQDB 4RMWA 1CFMA 4ODTL 3WMQA 1AQHA 3O2VH 3AM8C 4KDTA 4OFVA 4DKDC 3ZHFA 1T66D 4TUKH 4PB9H 4WFHE 2E6JA 4OZIA 1M56B 3MNVB 2A83A 2WQAA 1EHLH 4TVPE 5BZWA 3EOAA 3VRLE 3RDTC 2NYYD 1I75A 3SCMB 4XTRC 5KW9L 1OAZL 5I1GH 2OR8A 2O4EA 1CD9B 1DQQA 2BOCB 2E74C 3BRDA 2XWEA 5I18L 3G5XB 1MCBA 3CFUA 3MRKA 4JM2C 2YEVB 1BJMA 3NPSC 4FFYH 4LL4A 2Y4SA 2AJYH 4LVHC 1RIHH 2HAZA 2IMNA 5DS1A 3EDKA 4X5PA 1MFVA 5GRVL 3K2KA 4ZMLA 5T5NG 4XVTL 3C8KB 3KWWA 2G3NA 3NSFA 4R5TA 2MH4A 4R0LC 2UYLA 1OCCB 2B20A 2VLJE 4AW7A 3OLDA 5ECGA 3ZHLA 4BFKA 4BBWA 1DJSA 2YMXL 3AY4A 4FHBD 2Y7QA 2OK0H 1AGCA 5J12C 2QT6A 4NP9A 4QTFA 5I1JL 3RTQB 3HVNA 3VFNA 1A9BA 1UKSA 4HHGA 4CUCA 3P3YA 4A66A 1P6WA 4TXVB 2VXTL 4N6RA 1IM9D 4WFGE 3JWOL 2PO6C 3GMMA 4I2XE 2BMKA 2A74A 5IWLC 3IJYA 3NZ8A 5FHBL 5I71B 2DKMA 3OXSA 2HVJB 1NFDE 5DJ0B 2A38A 4G9DA 4PJAA 3TT3L 4WO0A 1MVFA 2WXNA 3MLZH 4MQ7B 3ARGD 3D69B 4N86A 2DPKA 4NBZB 4A38A 4MYPA 5B38B 4PJFB 4MVBC 3CH1A 1X6LA 3BKJL 2XYBA 4IEFB 1LP9F 3MRGA 3HMXL 3CFCL 3OKLB 4LVOC 1PIFA 3UPAA 4CU7A 3IDUA 4AMXA 3QG6A 2DQJL 5BNXD 3EJRA 2L3BA 1DCEA 4RMVA 4LNVA 5DJCA 5LG6A 5BRQA 4NXSA 1E4XH 2PWGA 4YLCA 5JW3H 2YWZA 4P5KB 3S3DB 1Q72H 5D4QA 4I18B 3PWPB 1GTNA 4DN4L 3EOTH 5JUEL 2ZSWA 2Q10A 2F54D 3IXTB 1ZPLA 4NQVB 1YSOA 3QUKB 1S2EA 4LIQL 5E8EB 3PV6B 4JFZH 2HPTA 3FQUB 1KCUL 2AABH 1MRFH 3O81A 2E6PA 4FCHA 1ZT1B 1QBLH 2YGVA 4YHKL 3FHQA 1GJIA 1BAFH 3L4CA 2MWCA 4H1LB 2B1OA 2QQLL 3QZWB 1KIQA 4OZGB 4YFDB 1AACA 1MIMH 3VB9A 4HT1H 4M6OL 3QUZC 4G6AC 1IKOP 3QJQB 3NCJL 2X4NA 1RUKH 1WA2X 5D5MF 3TA4D 5EU7E 3MNWB 2A73B 3HG1B 2UY7B 1AQKL 3O8XB 4UAOC 1U0QA 3CVIL 1F4YH 1E90A 2XKNB 3FB6B 3CZFB 3CPUA 4KU1A 2EICA 2H41A 4S2SB 5EG6C 1VENA 4LSQL 2B15A 2ZKWA 3F7YA 3BN9C 4B9GA 4LIQE 4Y19E 4EI5D 5JHLH 5E2TL 2P44B 3N91A 5CHNA 3F3HA 4U1SB 3I75B 5KUMA 2IBGA 1A6WL 1B3IA 5HHXH 1E43A 4M8VA 1WAAE 1J8HE 3RVUC 4PG9A 2IFGA 1G43A 2C9AA 1ZXKA 4LQFH 1GY1A 5HYIA 3OB0K 4XXWA 3KYAA 4L37B 2CKBB 1CICA 1XCTB 2X4QA 2VITA 1FZKA 3MTRA 1HESA 1IGJB 4OAWA 3SDAA 4F27A 1BDYA 4MS8C 2P42B 1XD0A 4Y0GA 4APXB 3AAZA 1L5GB 4B95C 2VDQH 1W91A 3CSFA 4R7XA 4YEEA 4E9SA 3QYNA 4IU2B 5F70A 3US0A 1E9QB 5E9DE 2WKLA 1QLRA 4AM0B 2Z31D 5DDHB 1XQ4A 4FERA 4B9YA 2QFRA 5C0FB 2W65B 5EC2B 3RU8H 3MUY1 3IVKB 3LNIA 5H94A 1B4RA 5DJ8A 3BPCA 3MA7B 1T04A 3PWVA 4L8BB 3AGWA 1M71B 4RGOH 3APNA 4PU2A 1Z66A 5ANME 2CMRL 3JTBA 4PJHA 5SWSE 2RACA 2X4RB 3FO1A 2IG2H 4DP8X 4UDTA 4JHBA 1M7DA 2AJ3B 2VLME 2XFXB 1FNAA 3TF7C 3GBDA 5HDRA 4J8RA 1T3FB 3MNMA 4MB3A 5C1MB 3ORJA 3BISA 5FKAB 3QUYB 2FJSA 4JRLA 2ZG3A 5GGRB 3FUJA 3LZOA 4GRWF 5LQBH 2G5BB 4LCYB 4AIZB 4ZW6A 5IFHL 3ZDYE 3KR3H 1G94A 1LO5A 4WI8A 5FA4B 3O41A 3SE8H 1JTTA 1AS6A 2OMWA 4ISVB 4MQSB 1KCLA 5C0JA 5C86A 1YEIL 4LU5L 4G3YH 1G1YA 2V0AA 3H9SD 2X4UB 4WW2F 1IV8A 1E5CA 2OMTA 1NKGA 3H6JA 2NY5C 5J6HB 1RZFH 1JPTH 3NCCB 4DP6X 1NZRA 3FZUD 4EO5A 2DWTA 4MX7A 2W9DL 1P2CA 3FL7A 2X4OA 3MLYL 3S5LB 5B39B 1AZNA 3X2QB 4YHYB 2VDRH 3CZKA 2FD6H 1WD8A 1A3LH 1L4IA 1JPGB 2A6IA 2YPKB 1PF3A 3JWDL 4KTEH 5LAXA 4X4ZA 5F8QC 4UTBL 3HFML 4WV1B 2LLLA 1HOCA 1S7QA 3MRCB 4UV7L 5AVQB 1G9HA 5HPOA 1MJ8L 4XGZA 4AGNA 2HKAA 3IDJA 5IK3A 1ECYA 3L4WA 2H3NB 3PP4H 1MFDH 5IJKC 1BYNA 5F3BB 1ZHKA 2NLJB 3QDGB 1AXTL 2FECL 1CF1A 5B1CA 4B3EA 3V0EA 3Q13A 1XF4A 4V1DE 4KNUA 5EUKB 3QJSB 1D9KB 1HAWA 1ZLWH 3ETBJ 4WDIA 3UJJH 4KUCD 3S36H 3TBCA 3FFOA 4BHUA 5CSZA 1QEWA 3TLRA 5E99L 4CAGA 1YYMH 3ELAT 5EBLB 1XF2B 1JNNH 1PG7X 3VD5A 1S7RB 5J3HD 2D3JA 3QEGL 3DO7B 1A7BA 2WXPA 1RZGB 2NDFA 3WFZA 2QVIA 1CR9L 4WSGA 5E4EC 4PGDB 5HVFB 3AY2A 4ZO9A 5EZOL 2GTZB 4HUXB 4DP9X 4J12A 4H7VA 1S7WB 4XPHL 3RURA 1CLOL 5D2LA 2VDLH 5KVMC 3FUEA 3CFEB 3BD4A 4JFEB 1P6AB 2YQ3A 4Z18A 3IDXL 1GH7A 9PCYA 4YBQC 4Q58C 1AXSA 3KPSA 5E2UH 1EXHA 3HHRB 2UVFA 4BDVB 1JNHA 2BNRB 4OM0H 2WYTA 2L7UA 3TZVD 1F4AA 1A47A 4RFNC 2DN7A 3QIWB 1BEYL 3ZUNC 3KXFB 2YD5A 1S78C 3U7YL 3DHPA 1WWCA 4KO6A 2QLVB 2XWJA 1GZPA 2AQ3A 4PCKA 4APQA 2YJLA 3FFCB 4PJ5D 4PWJA 2I9TA 1N8ZB 3NACL 2DKSA 4BQBA 5FLVA 4KTDL 4I87A 4L5FL 4AYID 1WFJA 3SDYL 1GYAA 3BEWB 2D7MA 2DLGA 5CGYD 5L4IA 1KGCD 2GSGB 5FCUL 5SX5K 1P4IL 3REVB 2W95A 3K0YA 4YHNA 1H3XA 3A4DA 5IP4A 2FDBP 1G0YR 3E3QC 1S3KL 1NCWH 4QXGH 3FO0L 1PKQB 3V7MA 3L2LA 5I6KA 1OB1B 5ES4B 4PJ6A 3HC2A 1FBIL 5EC1A 4AEIH 2G4GA 1IEBA 1OTUD 1ZT4A 2BW5A 2Z4QB 4W9KC 4X6DA 3SKNB 3PCYA 4CSZA 5BMFL 2DYRB 1FDLH 1G6RB 4QWWC 3B7UX 3CX2A 3SYAA 5D72H 5E5UB 5GZOA 4MBRA 3ISWA 4XMLH 1SJMA 3AQXA 2ENYA 4FP8L 1B9KA 4MTMA 4LEOA 4PS7A 4L5FE 2A3TA 2NY0B 4EMZA 5CEZH 4Q4EA 5D7KD 2WVUA 3GBEA 5ADOL 1SLVA 1K72A 1MPAL 4LSSL 5JMOC 3VI4E 1KYDA 1FPTH 2FWOA 3KYKL 2VRKA 3QA3B 3WXWH 3DOSA 4QYOA 2WVVB 4XNXH 3E7JA 1PG7W 3MNZB 4G71B 4RX4A 4AYEC 2DLIA 4S1RH 3WUZA 4F2MA 4XBMA 4XMPL 2ZOOA 3BUYB 4LSUH 2EDMA 2VMDA 1TSRA 4PHZA 2EC9U 1T1ZB 2XZZA 3TBWB 2QADD 4YGVB 2D73A 3J07A 3U9UA 1D5XB 3QR1A 2C1PA 4HX1B 4LHJB 5F96H 4AJVA 1T5XB 1RK0A 5K39B 3CMOL 5D7LA 3TBYB 3RGBA 4BH8A 4CNIA 5CBAA 3S88L 1EZSA 3K8LA 3N1QC 1BXUA 3DUUA 2YWYA 4HHAA 2JJVA 3C2SA 4MQTB 4XBEL 1D5MB 5D93C 2LW3A 1UUSA 3T4AA 4QHMB 3C6LB 4KI1A 1QI5A 2Y7LA 2YUZA 1RUML 3DX6A 4GRLC 1OWRM 2DLHA 3EFOB 4HKZB 4K94L 3P2TA 4WO4D 2Y36H 2YKLL 4L0PB 2ATKB 3QVAA 5JR1L 4KV5F 5CFHA 4P2QE 2WZ0A 2ITDB 3VXUD 1HCZA 2HLAA 2Z6FA 1VZHA 2RD0A 3FMGL 4W9ZA 3BP6A 4PJ7A 1FIEA 2FX9H 2QKIB 1NUNB 3I3DA 5JHDA 5DR5L 4P5MB 4HZLB 2K78A 3LQAL 4GAFB 4Y2OA 5K5YA 3QJZA 1OK8A 3GMPB 1WGVA 1DSWA 2WXGA 5D5MB 3DRQB 1BD2E 1DQMH 2WGXA 1BZ8A 2HT2C 4AXWB 4RDBA 2O6EA 3HIZA 3L7EA 4HCRL 5EMYA 2JTYA 5I23A 5BUAA 2XZCH 1X5GA 1XL6A 1WT5A 3GSOB 3BFOA 1HOEA 3S48A 3V8CA 5CZVL 3L4YA 3FQRA 3QUMH 1CG9A 4GBXB 5DHYA 5ACLA 1AKPA 2YN5A 5DVKA 4F15B 5IY5B 4W9GC 1URZA 1FZMB 1WIPA 1PLGL 4ODSH 1HEZB 1KB3A 7TAAA 3DIFB 1BBDL 4FLOA 5HGHA 1OSZB 5E2JA 1RZIB 2H26B 2Y06L 4DZ8B 3P0YH 4P46D 4C8XA 3C60A 3PL6D 4XMKL 3CDZB 8PAZA 1JHTB 3MGAA 1I8IB 2AQNA 4K73A 4WJ5A 3O6KL 4PRHB 3T2NH 5KN5B 5E95B 1P4BL 3LXUX 3IGAB 5MHSE 4CVZA 3FTVA 3OZLA 1XZ0A 4XPBL 1T66C 2EYRB 5IMMB 3KW8A 1F8TL 3G08B 4YHIB 4PJBF 4NUQA 4NN6B 1HC1A 2BSTA 3PGCB 5JW5B 4NKDB 4DEWA 4IOSD 1ZA6A 1BFSA 5EFIB 1U3ZA 2NYYC 4I0KA 3UBXB 4PS4H 3QFJD 5CUSH 3EW3B 3ARDD 1N6UA 1HYRC 2PPEA 3C09C 4JFXA 5I1EL 3P3RA 4LHUB 1KF9B 4JFYA 4N0YH 2UV3A 3X1NA 1I7ZA 1BX2B 4M1DH 4GAJL 2J57A 4WWOA 1NUFA 4IMKA 3U4EB 3WUWB 1ZS2A 2AEIT 3FQ4A 4NZDA 4XPAH 3L16A 2XN9E 1OARL 2B59A 1KELL 1TZAA 1YNTF 2C9UA 4WY7L 4PV8B 2OFQA 4ZQKB 2XWTB 4PJ8B 5D7JB 3SE6A 3QRBA 1H3GA 3D9AL 4HLZG 2NZ1A 1XEDA 2P5PA 2JF1A 1PPIA 1UXWA 2X44D 3N1MC 2ID5A 1DBML 5AZ2H 1A5FH 4O2EA 4IK7A 5A2KH 2OMNA 1Q1JL 4TTDC 4XNDA 1JZ2A 4AH2A 4BQ9A 4ZX5A 4MHHI 4WKZB 2WWOA 2FIKB 4KKQA 3D3VA 1KIPB 4ZMPA 4QRAA 4GRWB 1H3PH 1TOXA 4FEMA 3NABL 3K8KA 3ZZQA 1SN5A 5I2IB 2JLLA 5DC2A 1T7ZA 2KKQA 3VYNA 5ETUB 4X9BA 1IC4L 2WINB 4DOHE 1N3NA 1MSPA 3ARGC 2BP3A 4YHPB 4AZ8B 3TH4T 2N7AA 2DV6A 2AI0H 2BINA 4WW2B 2CDEA 3MDJA 3O2VL 2DLTA 5D1XB 3OAUH 1SOSA 1XH3A 4TUKL 1LK3H 4ZXBB 4PB9L 5GJSH 3NQIA 3DSNB 1KACB 1I9IH 5EPMB 1NH6A 5CJBA 4XMWA 3R8BB 2RBLA 4Z76A 1EHLL 2IH1A 2WAHA 1UURA 2EE2A 5TFSH 4HIIB 5I1GL 2V7NB 4R90H 3VXSD 3OXRA 3WIIL 1Q9LA 5I17A 2C4FU 4JUTA 1XSOA 2EDOA 5GRWA 3RPKA 5D70H 1MDTA 1DVXA 4FFYL 2BFGA 2CCWA 43CAA 1QR4A 2EVGA 2AJYL 3RX9A 1RIHL 2AQTA 4W6YB 5J7CC 2ZCZA 1RZ8A 5DUBA 5FW6A 3UDWA 3RZCA 2I60L 3JWNE 2P5WA 4XCYB 1EZLA 4IHOB 3QDMA 3FOMB 5B4MD 3CNKA 4ZOCA 4HLZH 4KROD 1RP9A 4M7ZB 3EYOA 4QF1A 5DJAA 3UTPD 4LFHD 4GKSB 1DFBL 3M1BB 3SBWA 3CFDA 2OK0L 1LDSA 2ENQA 4HGMA 5EO0A 4NQEA 4Y2DB 1A3QA 5F7AA 3CPLB 1U8PA 1OSYA 3C6SA 4L9LA 1GOHA 1X5YA 4X7TA 1X7QA 4BKLB 5E8OB 4ZQTA 3TO4D 4OJYA 3KPMA 2QDVA 4E41E 1TUPA 3EH3B 3QFDA 3ROOA 4HAFA 5AZEH 4NQDE 1OOWA 2VAJA 4Y5VA 3VXMD 3U4AA 4KO9A 1DVFB 4GKLA 3M6DA 3M86A 3MLZL 1BQ5A 2VQ1B 3FQ1A 2LE9A 3WIAA 1MH5B 3INOA 1YEEH 2KQMA 1YYCA 4CC4A 4P2CG 4D2NA 4EI5C 2HB0A 3V5HA 2D0GA 1GMIA 2V3FA 4F24A 4FQQB 2LTQB 2VH5H 3RYMA 1E3XA 2HFEA 1FFNB 4IJ3B 4AYFA 1R5WB 3B43A 4DPCX 1CGYA 1K8DA 2FL5A 1QKZH 2DL2A 1UGKA 4UZSA 1E4XL 3AQDA 5JW3L 2XTJD 3O3UN 1HK6A 3FQXB 5I19H 1PS3A 2H32H 3U83A 1Q72L 4HK3J 1P7QD 4QRSA 3KLSA 2IALA 1D5IH 3EOTL 3QB7C 1N6QH 3QQ3A 5KYXA 5A16A 5DMYA 2A6DB 4AX3A 5HDOA 2YAMA 1IO4C 2YGOA 4JFZL 3KPNA 5FK9A 2C9RA 2AABL 2Z31C 1MRFL 2WNGA 3WN5B 2A0LD 4Y9BA 3MAWA 3R19A 4KHXH 1QBLL 2P5EE 3PDDA 4M61A 3K6SA 1BAFL 3CN1A 3M17B 1B6DA 2QL1A 1EXUA 2PW2B 4L9DA 1MIML 5HHNA 2VIRA 4HT1L 3FTZA 5A7BA 1HL9A 4FN0A 5I76B 1FYTD 1UZ6F 4MJID 5C0GA 3MYJA 1HHKB 2G75B 3U36B 4IU3B 2XVLA 3O4OC 3K5SA 4MNQB 1BJ8A 4OLVH 5DD6A 3ABKB 3UADA 4AQAA 4JY4B 3TN0A 4KY2A 1MLBB 2FJGA 4PWIA 4FQLH 1IKFH 4LLDB 5CIPA 3G6DH 1FG9C 3ME0A 3VUAA 1ZDSA 3U0PB 3W9DB 4JFVA 1I3UA 1Z9SA 5JHLL 1YMMD 4DETA 2COQA 1JZ3A 1S5IH 1IGTA 4H0LC 3ZKQD 2J43A 3FTXA 5HGBB 43C9A 3HS0A 5HHXL 3G6JE 3MRMA 1EAPA 2YAPA 3Q8FA 1PFCA 2XWXA 2EXYD 3FZUC 3GJEB 3QJRB 4OCSH 1XGYH 3KYNB 4WUKH 4LQFL 4XC3L 4OUUA 1IVLA 1UVQA 2EDQA 4KJYA 3MRIA 3FRPA 4Q9RH 3UAJA 4B9CA 4GQZA 5ALBH 4Y7MA 1BMWA 1KLFA 1QWHA 4P23B 3ARRA 4WFHD 2X4SB 2FHCA 4OZIF 1XCQB 1YUKB 4ODXA 2VDQL 2FRGP 1OPOA 5CEXB 3FN0H 3F6LA 1E65A 5FKPA 4LLQB 1UWFA 2JI3A 3MVSA 2PWFA 5K93A 3MV8D 1YEWA 2ZP9A 1G7JB 5BV7C 2HJLA 5EU4B 4CL7A 1OF0A 2VO8A 4HK3N 3AREB 3OC5A 2AAAA 4OQTH 3NCBB 3AROA 1IZJA 2BP0A 2OMXA 3BKYH 4CN4A 3RU8L 1ZMYA 3HC4L 3OJDA 1IBDA 1CZ8H 3AJ7A 1A4BA 3GXMA 3RWHB 2GC7C 4QDGA 5GSRA 2CJSA 3K7UA 3ZZ1A 4Y5XC 1OCOB 4TQPA 3UTTA 4F57H 1SQMA 2NX5D 5J3HC 2ZXWB 4DERA 3IGLA 4AWJC 1NGZB 1JXJA 1U8QA 3VA2C 3WDIA 3P9WB 3K6IA 4G8GA 4FFZH 1U3JA 3DTUB 4WSJA 2YKKA 4D9RE 3T09A 4WNQB 3GSVA 2WGNB 3DMMA 3T6ZA 1A6PA 3BDYH 4RGNE 1NKRA 1TQSA 2WBJA 2XG4B 2XXMB 4LASH 5FUCE 4J39A 2OYPA 3LKSA 4H8PA 4PRPD 4BFIA 3WLBA 4NKOA 5M94B 1JV5B 1JI2A 2JWYA 3D07A 3SE8L 2VJ0A 1URLA 3WV0A 2Z7UA 4ENED 3ZW3A 4G3YL 1LWRA 2WP3T 2GY7B 5JIHA 3TZVC 5IREA 3S8WA 3RWIA 5JTWA 4JN2B 1JPTL 1QNIA 4LEEA 5IB1A 4DUVA 3GGWB 5C0CE 3HRZA 1F56A 4ZAKB 1BPLB 4PJBB 3WOVA 3BP4A 3GSXA 2VDRL 2FD6L 1A3LL 2WBWB 4HS8H 3L3OC 4KTEL 3IJSA 2ATPA 2MFNA 4HUWB 4E5XG 3VGEA 3PGDA 4X5WB 1SY6A 2Z35A 4NJ9H 3BWAA 1QPKA 3B7TA 4MSWB 5FF6B 3UMNA 5I1AB 3WS6A 2K8QA 2J7LA 3L3GB 5C0BE 3F12B 3RWDA 5F88A 5GGSA 3OF6D 2I07B 3H7BA 3PP4L 5EN2B 3V0IA 4M03A 1I1AA 3WJJC 1KN4L 2WY3B 1B0WA 4X4YB 1OAYH 1NANH 2VMCA 4YZWA 4F1SA 2CM6A 1OGAD 3ILPA 3P30H 1EPFA 3IGFA 3PHQA 3UJJL 3VMPA 3S36L 3RE0A 1UB5B 5T1MB 4KFMA 4G59C 1PZ2A 4P9HH 4ONHA 2FK9A 3FO9B 4R83A 1O6VA 1YYML 1G6RH 4B97A 5EIVA 4NM4H 3TC9A 4LCWB 1JNNL 4B9FA 3AM8A 1KJMA 3PYCA 3EXLA 4B9KC 5E8PB 1D5RA 1JGEA 3U25A 3I6KB 2QZ5A 5BQ7B 4L3AA 3VE0A 3RDTA 2IXQB 5HJBA 1NIBA 1QSED 5IUCA 4X6BB 3CLEL 4GI9A 4M8QA 3BH4A 1ETJA 2RFXA 1FF5A 1W72A 3BXNB 4PRNB 2B9AA 4JM2A 5SWZD 3G04B 3MV9E 2X40A 1ETA1 4MGXA 4D0DA 5LGJB 2CA3A 3W57A 4GO6B 3MBXH 4QGTA 2R7EB 3PE9A 4L4VA 1L9SA 4OM0L 4RBPH 1COBA 4Q6IC 3W11D 5K59E 5LBSH 4JDVB 5DJZA 4L1LA 5MEPB 1OP5H 1GGUA 1JWSB 2Y7NA 4TS6A 4R0LA 3ARFB 3RL2B 5E9NA 5F7KC 1OIOA 1T5WB 4JHAH 2QADC 4O5LH 5DJDA 3RWCA 4HEME 4JFQA 1KPRB 4N24A 5I1DA 1KB5B 4C56E 4XCNB 1WCBB 2FH8A 5AW6B 5MENA 1SHMA 1OOAA 3SGEH 3PLYA 1XV8A 3KWXA 5DTFA 3FSAA 2IAMB 2V2WB 3IWUA 5IB5B 1F4WH 1Q9OA 4R6UA 3GSNA 4XXDB 4U1MA 3WYRA 2PO6A 4GH7B 3MRJA 1JRHH 2RCSH 3IBOA 5G55A 4EZMA 1R6VA 5IWLA 4PGZA 3EHBD 1OGPA 3VD0A 4KQ3H 2MQGA 3DETD 1TETH 2CIIA 4PGJA 1UXSA 1U3HB 3B2MA 4PRAB 4YDVA 3OGCB 3FCGA 1HIMH 4QXGL 5I16B 3SPVB 4WO4C 5KBLA 4YR6B 5ICZA 3B6SB 4W9LC 3RTLA 2WZPA 4WFFE 4ODUA 4AEIL 1F1GA 4D0CA 5BZZA 3NIDE 3ARXA 1K4CA 4AJYV 3VX0A 4ANWA 1FDLL 1K5NB 5IOPA 2CO7B 5EF1A 3N55A 2BWDA 1U95B 1ZHNB 5D72L 1U4FA 3F58H 1M05B 4XMLL 2FT8A 1ZS8B 1X4ZA 2ZUUA 2NY4B 5D96C 2IPKB 1XB3A 1G84A 2FTAA 2J8UE 5CEZL 1E8XA 4FNUA 5I6OA 1KDIA 3LY6A 3VXRD 1FPTL 1E30A 1NC2B 4PJ9D 4KMLB 2DQFA 4WAFA 1BVOA 3OJ2C 3WXWL 4PJHF 4XNXL 4GUOA 1RK1B 1AAJA 1CXEA 2AERT 3DHJA 3DVIA 2NOYA 4GB9A 1CE1H 2BVYA 4S1RL 2BY0A 4BH7B 1JG9A 2V5RA 4N2OA 4HJJL 4LSUL 3PL6C 2APTA 4XOEA 3DARA 3DX8A 1S5HA 3TVMD 2BVPA 3DO3A 3FB7A 3GKWH 4LP4A 2AK4B 2R9HC 1NIDA 5CN3A 1H8SA 3IE9A 4NKIH 3GHBH 1QHQA 5E1QA 4YL9A 1QSFA 2DI7A 2APSA 2LLGA 3ETBF 4UIMB 2KERA 5D9SB 5TJWK 3D0VA 1NLDH 2HG5B 5SWQA 1C08A 1MZYA 4GXUN 5F96L 1OT1A 2A5UA 5IG7B 3RIKA 3MCG1 3N44F 1QI4A 1NAML 3QUZA 5CILH 5ISZD 1U3YA 4HPYH 5CEZE 3BAXA 1YDPB 2VE6B 5EUOE 1U8HA 4KZEH 1JVOA 4GP4B 4LOVA 2TSAA 3ARDC 3HC0B 4XNQB 2OCJA 4HOMA 2YLKA 2CO6B 3NQKA 4FTVE 5H2BB 4EDXB 3ZDWA 2NY1D 2AV7B 2VDOB 4MD5B 4PTTB 2OZ4A 2Y36L 2X0WA 3CZEA 4OCMC 5GIRB 2LAGB 5TK2A 3P0VH 4WI2A 3VGHA 4AV4A 3FF8A 2CNZA 3V0VA 4XPGH 1HHIB 3DXAB 2YPLE 3HVDA 2IANB 3GB7A 2ZUVA 4YZFF 3QDJD 3QNXA 2FX9L 5DD3H 1MCFA 4H0HB 1JCKA 3QEQA 5EO1B 2GSIA 1HSAB 2QJDA 3GUFA 5AG9A 4QO1A 1DLHB 2BY3A 3MBWB 3TEXA 4FLRA 5T1KB 1DQML 3BC9A 3LH2H 3KPOB 4DVBB 3C5ZB 4LEXH 1U8OB 2WWNA 3D18B 2XZCL 4RQQA 2UY6B 4BD4A 2XBDA 1XHHA 3QUML 1U92A 3NN8B 3V0GA 4DESA 5KG9B 1G7LA 3SKMA 2AW2A 3U0WH 4WSKA 2R56L 1R5IB 4ODSL 2D4FA 4HIXH 2CU9A 5ANHA 5HHMD 5BRZE 3L3DA 3BRFA 4OVUA 1A21A 5E1AA 3P0YL 1Y0LB 1G9NC 2YZ1A 2AS5M 4Z5RB 3AB0C 4YUEH 5D2NE 3D85B 4NPJA 1Q1PA 1JPST 1QD0A 4NRYA 5EORL