3KM2A

As-isolated tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical properties of tomato chloroplast sod
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3km2A00
4MCMA 1F1AA 1CB4A 1PTZA 2XJLA 1E9PB 1PU0A 5CU9A 2SODB 1ESOA 1FUNA 1IBDA 1TO4A 3QQDB 2ZKXA 4A7QA 3KBFA 1XTLA 3PU7A 3HFFA 1SPDA 3KH3A 1F1DA 1HL4A 2V0AA 2AQSA 4A7GF 2ZKYA 1IB5A 1OALA 1Z9NA 4U4IA 5KBKA 2Z7YA 1L3NA 1TO5A 2LU5A 3H2QA 1SDYA 1HL5A 2WZ6A 1DO5A 4A7SA 2VR6A 3H2PA 1B4TA 3LTVA 2AQTA 3GTVA 1S4IA 3GZOA 4BCZA 4A7UA 2WWNA 1YAZA 4FF9A 2AQNA 1OAJA 1E9OA 3S0PA 4A7TA 2E47A 1PZSA 1JCVA 2C9SA 2NNXA 3MKGA 3ECUA 5KBLA 1AZVA 4MCNA 1EJ8A 1E9QA 2AEOA 4BD4A 1F18A 1SOSA 3RE0A 3T5WA 4OH2A 2JLPA 4N3UA 3KM2A 2AQQA 3ECWA 4B3EA 3GQFA 3HOGA 2VR8A 3KBEA 2WYTA 2VR7A 1UXLA 1B4LA 1SXCA 1OEZW 2APSA 1IBHA 2JCWA 2Z7UA 2ZKWA 1KMGA 3K91A 1SRDA 2C9UA 1EQWA 1E9OB 1SDAB 2R27A 3HW7A 2ZOWA 2XJKA 1SXZA 1P1VA 1UXMA 3CQQA 5KBMA 3ECVA 2WZ5A 1YAIA 3F7LA 1YSOA 1OZTG 3KM1A 1QUPA 4A7VA 4BCYA 1JK9A 1BA9A 2AF2A 1XSOA 1IBFA 4L05A 1SXSA 2Z7WA 1OZUA 1SXBA 3GZQA 1F1GA 3GZPA 2WKOA 3L9YA 3CQPA 2GBVA 1E9PA 2WZ0A 1E9QB 3L9EA 1MFMA 4A7GA 1DSWA 2E46A 2C9VA 1SXAA 3SODB 2K4WA 2AQPA 1N19A 1Z9PA 3KH4A 1XTMA 3F7KA 4N3TA 2Z7ZA 3GTTA 1JK9B 1COBA 1RK7A 1N18A 1IBBA 3CE1A 3QQDA 1CBJA 1BZOA 2AQRA 2GBTA 2WKOF 2WWOA 2GBUA 2WYZA 1Q0EA 2Q2LA 1U3NA 1SXNA 4OJAA 3MNDA
chains in the Genus database with same CATH superfamily
4HXBL 4U31A 2ICEB 2QVTA 4FGMA 4YE4L 1TO4A 2E9IA 1NLBL 1OAXH 3CFJA 3MJ9L 1YMMD 1JWUB 2LTQB 4JKPL 3N9GH 1KXTA 1CE6B 1XAKA 4XNUL 1J9CT 3P4NA 3ZZLA 5J9PB 1TNMA 3EG9B 5F93C 3ARFA 4URTB 1PY4A 2PW2A 5IFJA 4UQ2B 6PAZA 2F7PA 4P23C 4AV0A 4YZWA 4E42A 2LTQC 3L13A 2HFEB 3HKFA 4F7EB 1LNUA 1NGWB 3WFBH 1AY1H 5HHOA 1JRHL 3O2DL 5AZ2H 4M48L 3A24A 1ZHBA 4KKCC 1EV2E 4JFUA 3KVDD 2I9TA 2CO7A 3LKSA 4FFZH 4OCSL 1U93A 1T1YA 4FMVA 4K7PH 1E5CA 1I7UA 3D85A 1RURL 4LOUC 3ZTCC 2WTPA 3EDJA 1EEYB 4QY8B 4P49A 4ATWA 2X28A 2GJ6D 3RBSA 5IIEA 1AXSA 3A6CL 4FZEL 4K8RD 5IJKA 2BIIA 3RB7A 4YSEA 3TA3B 1KBVA 3SGJC 1XSIA 3RVVD 1KCVL 5AENA 1MFCL 2FT7A 1RJYB 2F8IA 2KZWA 5ISZB 1V7NL 4DVRL 5DEGB 1JDCA 2X4UA 4R2GC 4U6XA 4XP5H 4LGSB 1DP0A 1HHIB 1Z9LA 3EKCA 4JVPA 3HS9A 5DJYB 1F4XL 3SGEI 4X4ZA 1TJXA 5BRQA 2JB6B 2GJ6E 3Q5TA 5E9DA 3B7UX 1WA0X 1KTDA 2EINB 3BX7C 4YHOL 5B3JE 4WO4D 3NJXA 3OAZK 5I6OA 4NDMA 1G87A 3MRNA 4YAQA 5GZOC 5J13B 3AXIA 2EDXA 2WIMA 2J8UA 1VGEL 2VXTH 2ITCB 2PYFB 3ZKSD 3H56A 1KCRL 1ES0A 2X4SA 3HE6C 3FFCE 3W81A 2EXSA 3O3EB 4MA3B 4X80H 5DUBB 1RULL 4CVWA 1XGUB 4LSDA 3APCA 2Z7WA 3FU7B 3PGDB 4YDLC 2F9BT 3VM5A 4XO4A 5I0DA 2ADFL 3X12B 5E6ZA 3IM1A 5ICZA 5ALCL 3RGVC 2F2HA 3MXVH 4H40A 4RMVA 3ZTEA 1ASPA 4XAWL 4DTGH 3VDBA 2CXGA 1G0YR 1QLEB 2Z7ZA 4J4PA 1W0WA 1COBA 2V7HB 1YNLL 2AQRA 3VA6A 1V55B 2EIKB 2JK5B 3CFEA 5KWYC 2E6QA 2WZPD 3T0BA 4FULA 4U1HA 4AYBA 1LK3H 3PNWA 1NANI 1S2EA 4OLYH 4FABL 3AVEA 3Q48A 1P4BL 4UIMB 1I3GL 5KSVA 3VI3F 3AG2B 3FZUD 2HH0H 3LMJH 1T5WB 4WI7A 4GS7B 5EUKA 1XL4A 1EZLA 3T6VA 1AO7A 1PU0A 2QTVA 1MCQA 2CUAA 1A9BB 2P3YA 5FB8A 1A14L 1E4WH 1U36A 5IB3A 1JZ5A 4GO9A 4U49A 3AY4A 1M6UA 3MBWA 3B5TA 4WJKB 4FFZA 5CJQL 4YHLH 1CGSH 4M1CD 5FLUA 3B2UC 5DI8B 3RL1A 3S34H 3WS6A 4HZAA 3Q0HA 3MRMB 5I1AB 1AFVH 1OTSC 1DHKA 1SY6H 5DZ9A 4BZYA 2LU5A 2HA1A 5HP5A 4M1GH 3WTXA 4X4KA 4OLUL 1BQSA 3TH3T 3KYAA 3SE4A 3UJIL 1UACH 3QJXA 5AUMB 2J88H 2A9CA 2WKGA 1A5FL 1UXSB 2Z8RA 2V7NA 3MOAL 5IVXA 1BM3L 2D73A 1OAJA 3QCTH 4N1CA 3RWHA 2P80D 1QSZA 4QMEA 1GGBH 5J89A 1BLNB 4ODVL 2ATAA 3L1EA 2DQJH 2BVUA 1L6ZA 1JXGA 1F0LA 2ZWLT 3P11L 2PW2B 3G04B 4PRAB 3SKJH 3U0PA 3K1KC 4XI5D 4BFGA 3ARGC 4O5LH 2J5WA 1AHWB 4XNYL 1JNLH 4G83A 5KSBA 5FUOH 2RHEA 5MENE 4MFHA 1J18A 2AQQA 4B3EA 4FQLL 2WMPA 3PHOB 2D03L 5FF6B 3WL9B 4MAYB 1DBMH 5CJXC 2VAAB 3NAAL 4HU2A 2DF3A 2K0RA 4WUUE 3QJFB 2J88L 1ZANH 4PBVC 4X4ME 5DK0B 2YD3A 3O3BB 5DZJA 2CRYA 2EO9A 4GXUN 4DEUA 1PZCA 5ISZE 3BVDB 4LOEA 1A7PL 3WUWG 1CFNA 3CU7A 5L4FA 3NRPA 5F96H 3BAEH 2QVFB 2DQDH 4QRBA 1C5DB 3O9WB 2KQMA 3PAUA 4V2CB 2M2DA 1ETA1 1I7ZB 4GSDH 2R2HA 2W94A 1OZUA 2IPTH 1VSCA 3FTGA 1TMQA 3AJ7A 5EOTB 3NTCH 3AS1A 2R23B 3DJTA 3HNSH 1SN2A 2JB5L 4N0UB 1OB1A 1ZT1B 4P4KD 4YBLB 2R2BB 4NZTH 4JO4L 4M3KB 3TT1H 4PCKA 4XO8A 1HWWA 3TEZA 1RK7A 3B9VA 3RNQA 4GT0A 2B9BA 4D0BB 4ELKB 2FIKA 2K4AA 4HV8A 1TNNA 4CBPA 2E7BA 2R51A 2JTDA 1BFVL 3AS2A 3DUUA 3QNZB 2AJ3B 4I48A 2APVA 5CSZB 5EO9B 5L8KB 3QAZB 2WJ5A 1UWEL 4U33A 3V9CA 1IO4C 2Y9RT 3E6HB 4XOAA 3D18A 2GYSA 1HXMA 2B2XL 1A3LL 2NSMA 3IJHB 4JRFA 4PJFB 3FO1B 4F7MA 3L4TA 4DTGL 2BNUA 1A6VH 2QQQA 4XCNA 1IQDA 2IBGA 2Z1PA 5CILH 1WBXA 2YO3A 2APFA 3W39A 3VI4A 3UAFA 4WHTB 4U1MA 4UAOB 1QSEB 4KVCL 1BVNP 5C08E 3DPBA 3FFCD 3OB0K 4A7GF 1TPXC 1E43A 2EDFA 3RIKA 5JHAA 1G7PB 1U3HD 1TO5A 4HJGA 4XNQA 4L4VE 4E9VA 4DERA 3FO0H 1QNZL 1UHVA 2EDRA 2YN5A 1SMDA 3AXLA 3D33A 3WIFB 4FA7B 5IQ9B 1L0QA 4M03A 1RP9A 2OP4L 1ZWIB 1MHCB 4LDOB 3ZDZB 3DROA 4KUCF 5LGYA 2HKHH 3BSZL 4FOMA 1JAEA 1CE1L 4CU6A 5DFTA 1UZ6F 3PHQB 4ZFOA 1LYQA 1WJ3A 3VSTA 5KANI 2P46B 1EMTL 2GTZA 3FHAA 2Y5QA 4UU9A 1IGCH 2OR9H 2VDRH 4CADA 4N8CH 3B9KB 3WFEH 5E5MA 4I0CC 2CK2A 4C55A 4M7JL 4UWQB 3S36L 5L88L 5I6NA 1RIHH 2BH0A 1QBLL 4L0PB 2NT0A 5EOCJ 1JZJA 3BCFA 3MRPB 4A37A 1QLEL 4FQXC 4K7FA 2JELL 4Z3GA 4KXZH 5B39G 3TH2T 2VJ8A 5H37A 4F15B 5F7MC 5AB0A 2WOBA 2O61A 4KKBD 2VR5A 3G9AB 5SWSE 2R29A 1R3LA 3EADA 5TE4L 1CE1H 2B1HH 4M8UA 2WQXA 1X5GA 1AZCA 2C7FA 3P0GB 3T09A 1QFHA 4DKTA 2CNYA 4MA1B 3R4RA 3SQOL 3ARZA 4XBPA 3Q01A 4F58H 4NERA 3VXTB 1GS7A 1L7IH 3L1GA 4JFDD 3OGOE 3ZE0E 3GRWH 4WHDA 1N0LA 5E2JA 4WO4A 5DD1L 1RZJH 4CNIB 4OFDA 1T2QH 5DRXA 5D1QB 2ZF9A 2GAZA 2W1NA 2XHNA 2ZCHH 4GRMA 4OZHF 1BM7A 3SQRA 3K6DA 2XY2A 5D2NA 3ARBB 1FVDA 1XD1A 3QCVH 2V5MA 2AJ3A 4IDJL 3QQDA 1N5YH 4P2CG 3LZNA 2VM4A 1I8UA 3HTLX 3L4WA 4GW1B 2IPUK 5IVOA 3ZGIA 5JHDB 3UTQA 3KG5A 3U2SB 3C8DA 5D1QC 5BRZA 4R7NA 4TVSa 1RD6A 2A74B 1XMWA 5C8JB 1NCOA 3RAJH 3MXVL 5DJAB 2YFNA 3KPTA 4CC0A 4EDWL 3U6RA 1PTZA 4FTVA 5FC9A 5C0GA 2CCLA 3D4ZA 5K93A 4J3WA 3WIHL 4XP1H 1A8JH 5C0CD 4DUXA 5K59E 5HDWA 4L3CB 4J3OG 3V4VA 5LKNA 3PWPE 1CGTA 2VUOA 2J71A 4YZFF 5KS9A 4LCUA 2QVKA 3HBQA 1HESA 2C1PA 3LNDA 3H9HB 4TULL 4DZ8A 1SY6L 2EIMB 3DTUB 1MCWM 5HYIA 3V7AG 2JCCF 5GSVB 4FZ8L 3GJFK 2ROXA 2YAHA 2BSBA 1BQLL 1RUQL 1NUNB 3T0VA 2DQ6A 2V2WB 1F02I 4FEMA 4I3RH 5D1ZC 5FKPB 3UEQA 1UENA 1NCUA 4N9GA 4UQEA 2BY0A 4C4KT 3MRGB 3MLSH 1T0MA 4KY2A 4ISVB 1JYVA 3R19A 4UZSA 1MZYA 5DD3H 3KPNB 2R1WA 3EH3B 1TSRA 1FA4A 5I16A 1KGWA 1ZTXH 1U8MB 4LL9A 4R96B 1MCFA 4NWUL 4Q2ZA 4HHAA 5FUOL 5FWQA 4QXGL 4NB7A 4H88H 3VFRA 3NABL 1IKNC 4GW4A 4TYUA 4UT6L 4N5UA 5EUOF 2VE6A 4YXLH 1QFWH 2OMXB 2ODIA 5FDWA 4PJXE 3ZKQD 3CFKA 3FSAA 3C5XA 2F7IA 5EU4A 3RPKA 4ATTA 3QSKB 3QIUA 4J1UA 2XJKA 3IMSA 3K7UA 4PRHB 4I9WE 4TLKA 4K5LA 2YN3A 3N41B 4Z7QB 4W6YB 4GW5A 4OCRL 5HJGA 4FQIH 4NN7B 5SWSB 3BZEB 2YGPA 1NLBH 1JPSH 3MJ9H 3OR7A 5EUOA 4JN1L 1KF9B 4ZT1A 2ADJA 2R29H 1XQ4A 2NY2C 3INUL 3LIZH 1OF2B 3VQMA 1T4KB 2AS5M 4Z23A 1GZPB 1UM6L 3Q3GA 5DVLA 1UD6A 2YK1H 1B0WA 3OVUB 1PLCA 1IBBA 2Y06L 3NCYS 1A3RL 4M62L 1NFDE 4XNXL 2JTYA 1EPFA 4IBVA 3BW9B 3DBXB 1TU2A 1KCKA 4GXVH 2XETA 5JXEC 2R0ZH 4P5TB 4LLYA 5E6IC 1YMME 3QXAA 1A6ZB 2AABH 2F5AH 1LO2H 1ZA3B 5IQ7L 3WYRA 1Q0XL 1F3RB 3VD1A 2XJLA 1AXTL 1K85A 3IWVA 3S98A 4MYPA 1U8QA 2Z6FA 5T3ZL 4U1MB 5GGTA 2Y1ZA 2ESVB 5C0ND 3N1GC 3CN2A 4HH8A 1ET5A 4ZW8A 4YHPB 1MXGA 3I75A 3W39B 5JW5B 5CLYA 3WEXB 3AITA 2PYFA 2V0AA 4J3VA 4HKJA 2BNUB 3WEOA 3O0RL 1KG0B 1QASA 4G8GE 4JR9L 1Z9NA 1KJ2B 3UYRL 2AV7B 2EKSA 4IOFC 2HMIC 1RPQA 2HRPH 4XMPH 1LP9E 4YVNA 1WV7T 3E6HA 4ERSH 4RISL 4KKRA 2PR4L 5BPPA 1T21B 3OKDA 1PZUB 1IC4L 4JL2A 4XPAH 5I1DB 4B95C 3HB3C 3D39D 4GRWE 4NNYA 2K9UA 4XNUH 4NM4L 3W9EA 5CM1A 3X3GH 1R24A 3FQ2A 1NBCA 5ICXA 5SWZE 2P4AB 2Y6TE 4F1SA 4RSVA 3TURA 4N0UA 5T3ZH 4OLVH 3OPUA 4BFBD 4GEIA 2EIZB 2YXVA 1MW2A 4HIJA 1U93B 1IT9L 3EFDL 3X3FL 1HHHA 4B96A 2I24N 1OHQA 2XPGA 3KLKA 4NWTL 3NIDE 2DLFH 4JS7A 4OZ4A 4AGQA 1D9KA 4O9HH 3CVCA 4UT6H 4NYLA 1OM3L 5JIDA 5C09D 2WSPA 3F7PC 5KBDA 3QGVA 3QORD 4KMQA 2YD9A 1D5RA 3LPFA 1A1MA 1AGBA 2IWEA 1FFQA 2GITB 4LARL 3QUXA 3GKWL 4XE0A 5K9OA 2G9HA 2BS8A 2HLEB 3ABKB 4ZRGA 5I74C 3O2VL 3VW3H 3G6JA 4DZBB 4BSWA 5AB9A 4DEPB 5AKSA 1U3ZA 1I82A 2R0WH 1DBJL 5T1DL 2Q7YB 5CIPH 1JK9A 3O41A 3VFWA 2J8OA 2MEJB 1ZE3C 4Z7UE 2X6VA 3REWB 2I27N 3BKCH 3EBGA 1ID5I 3AT9A 4LL1A 4K3DH 1NGZA 4HCRH 4ZPTB 1OM9A 3T0EB 2H32B 3QDGA 4M6AA 3G6JE 5C3LD 1I1FA 4PGZA 3VXRA 3VYOA 3V4UL 4PGEB 1RFDH 3D34A 3MHZA 3GEFA 2D7MA 3VTAA 1MAJA 2F8XC 1DJGA 2YEZA 3E7JA 1Z0MA 3FO9A 3QHTC 3QUMH 4BFIB 1OT2A 5I1HL 2H26A 2P49B 1EX0A 2P45B 3IJ9A 3FUFA 5DTFB 5EIIB 5KJ4A 4TOYH 1KIQA 1CB4A 1ERNA 4R2GD 3T0AA 3LN5B 4PRIB 5IB1A 3KPQA 1RZIB 2R1YB 4O51B 3U7AA 5AOIA 5F6IB 2FZ3A 2G3ZA 4YSTA 1OTUD 4EDWH 5EU6A 4GP5B 1BD2D 2HN7A 4FL4C 2FLRT 5B1KA 5M94B 3CMOH 2KUTA 1LWJA 2MFNA 3MBED 4UMSA 2BVEA 1RI8A 1EZSA 1HDMA 2NY5H 1Z66A 3BDBA 5FM5O 4WHCA 5DZNA 4X7DC 5F6HI 2GSGA 1T5WA 3P73B 3QWQB 4Y5VB 4JAMB 4OQTL 1HQRA 1VJSA 4ICXA 4X99B 4GMTL 3BCDA 4NSKA 1U2HA 4KX7A 3QRGH 1D5IH 5FUZL 1LP9A 3ZDXF 4QAMB 3O6FC 5FCUH 1TTUA 1R46A 4N90D 5GRJH 3QA3B 2QEJA 5JIMA 3FU8A 3KPOA 4XXCA 1L9PA 2OTUA 1UJTA 1VADA 4HUVA 4R0LB 4ELMF 1ZK9A 4LCCB 3PGFH 5L9DL 3B2PA 2PN5A 1T5KA 4WY7H 3VXUE 5BRPA 3OHXB 1JFHA 4UANA 5I18L 2OQJB 3P73A 4NP4L 5PAZA 2WVSA 4HS6B 3OHXA 4K3EL 1E9QA 1SF3A 4MAYD 3RTQC 2XWEA 5LGKA 4WVRA 1BWMA 1YEDB 3UOAB 4MDIB 5IG7A 3IMUA 4DP1X 5AW4B 3JUZA 2R4RH 3N1QC 4HDIB 4GRLB 3BO8A 3JTSB 1IC7L 5HY9A 3FW6A 3VGFA 4IJ3B 4N90E 3HEIB 1NC4A 3BPLC 2VN3A 3LYRA 4OV5B 3U79A 1KEMH 3B56A 4JAMA 3MUUA 5GISL 1YUHA 4S11A 5D5MB 5FM5M 4OV6F 4BK8A 1MJUL 1S3KH 3PPSA 2YRLA 5DJ8A 3LX9A 1YHPA 3LRLA 1NM4A 1S7TB 4I18A 4Q6YA 5I6LA 5JMOC 3D39B 2WWMC 1RUKH 1H15B 1ZHNB 1F4AA 1T22A 3NDZE 5D7LB 1AGFA 5LQBL 3FF8A 3OJDB 4G8EB 5IMKA 4AVHA 5KSAB 2HYMA 1D5MA 1G7HA 1EEZB 4P5RA 5E9DE 5HPOA 1PG7L 3MUGA 3QUKA 2ZCZA 5K9JL 3HG1A 4Y2NA 5DSCA 4G82A 2AJXL 2K45A 2I07B 4N6RB 3W56A 3MRHA 5E23A 5IW6A 3LKSB 3H9SA 3MRCB 4Z7WB 4U2YA 3ME0B 2EVGA 4K8RL 4C56B 1AMXA 1IAKB 4JM4H 3B9DA 4KTGA 1KTLB 5T5FL 4L4TE 1MCDA 4TQEH 3G6JB 1GW6A 4DZBA 2NY0C 4PJ9B 3KBPA 4NKIH 4CU8A 5CGYD 1NCTA 2DLHA 2EH7L 2EILB 3BKML 1PLBA 5HDQL 1R5VA 5D96C 3RWDA 4ZPTA 4P5TD 4F8PA 2A9DA 4PR5A 4OGAD 1YYLL 5JR1L 4GBXA 1UVQB 4ELMA 4X6FA 4BUHA 3GMOB 4PP2B 3E3QC 2WPGA 2LOEA 2ZJSL 4JY6A 4KI5F 3UTSA 4AEHH 1CZ8L 4QRUA 1HAWA 2X2IA 3D5OF 4IBTA 3EZ8A 4GQQA 4OZFG 1UWFA 5GS0C 2EO7A 4LLWA 3MACH 4WFFE 5H37H 3RY5A 1H3WM 4GSXA 4Y4HD 2WIIB 4KKPA 3SGEH 4RQQA 1R3JB 1XCTA 3ZY7A 5IM7A 3U4EA 1OSPH 1R24B 5T3ZD 3ARTA 2XZCL 1FP5A 3FRPB 1B2WH 4H8HA 4UT9L 2IAAC 1UYWH 4XXWC 1JZ8A 1UM4L 4YFDB 2NNFA 1PIGA 3Q8FA 4UQDA 1IJ9A 1KUMA 2BFVH 3CDGA 3CSGA 4JZNA 3X1GA 4ZTOL 4CSPA 4FTDA 3HC4H 1Y6MR 4P2QD 1V10A 4JW3A 5GHWL 5TGBA 3F01A 1L4IA 1N64H 1ZT4B 2UXVA 4NO0D 1BECA 4OFYD 3CXHJ 2VJXA 2W65B 3VXSB 2Y5TB 4NNYB 3RX8A 2C3GA 1JJUA 2WQAA 1CF1A 3MNZA 5GHWH 1CDJA 2FH6A 2EXTA 3K71A 2HKAA 3KXFA 4RWHA 4B41A 2Z7UA 4X6CF 3BWAB 1J1OH 4WWID 1WSST 4HPYL 5DHMC 1C12A 3FB7A 2IADB 1HVXA 5FUCC 3Q5YA 1C16A 3AU1A 4AEIH 4IRSA 3PFQA 2LAAA 2DQMA 4BCYA 1HCZA 3MKKA 1PD0A 2XN2A 4WWOA 3MV7B 3GMLA 2AK4B 2B4CH 1F4YL 1YECH 3NSFA 3ZUNC 3SDAD 4PTUB 3P9LA 3GMPA 1UC6A 3APNA 1E6JL 3BP4B 1NCWH 5ILTL 5FFLA 1J9RA 1HN1A 2FH8A 2HRHA 3ZYIA 2WO4A 1E7UA 4AIEA 2J5LB 5G4OA 2QMKA 4N2AA 1DQDH 5ERWA 3W3BA 4Z7WE 3CSFA 3QIUB 4IIZA 1IGYB 4J1UB 4PRHA 3V4PB 4HMEA 2NQ3A 4NZRH 1CO1A 4AG4L 5CLWA 3X1FA 3GSOA 2VXSH 4UDTA 1IUZA 2WXJA 3FUHA 4R5XA 4YDIH 3RL2A 4OJAA 3GS7A 1UB5A 3CXDL 4PLOB 4K9EL 4LCIH 3CK0H 4HHAB 3QIUC 2VKXA 1KY6A 2A6DA 1GS6X 4RGOL 4N8VB 3HN8A 3OG6B 3TL5A 1LL1A 1CG9B 4NJAL 2YAFA 1GZQB 3DX2A 1JGVH 4P46B 2OMXA 1IKOP 1L3NA 2BSRB 2NY7H 4Q14A 3RTLA 5AD0B 5DGQA 4Z3IA 4YC2B 4CVZB 3V4VL 4Q6IB 3SCMC 2FO4B 2IQ9L 3BPOB 1BXUA 3GHBH 2V4LA 1M7DA 1MCHA 1OV8A 4QI3A 1WLHA 1RLBA 1E9OA 4OAWB 3LQAL 4LLQA 5I5MA 1VGKA 1MPAL 3RPBA 5JDJA 1FSKB 5LN4A 4P2QE 1MI5B 2JXMB 2R0WL 3TT3L 5B3JF 3POCA 2UZIH 4LPWA 4I2XB 4IQHA 1D5IL 3WHE0 4BD4A 1RVFH 1CUOA 2QPDB 3ABLB 3FCBA 4WLCA 1D5ZB 5IOKA 2X87A 3ZRFC 4TUKL 3MRQA 3CX5K 1NKRA 1H6TA 2WLLA 5JW3L 2O5XL 2OMZB 1F3DH 4ZFGH 4X7TB 4L3EB 1YY9D 5ES4B 1A65A 3VXSE 2GI0A 5IWLC 3TVMC 5I1KH 3MPCA 1BAFL 1DDTA 5FFOA 4AZ8A 1T0NB 4M7KH 3M1CA 1QR1A 3C5JA 4Z76A 4ODWA 1FNSH 3L7FB 2OXGA 3HJ0A 1YSOA 4NFBA 5T5FH 3B7RL 3ESOA 3GSUB 5AKVA 1HCVA 1MELA 4NQDB 3CH8A 2Q2EB 4Y9FA 5E4AA 4BBWA 2D7QA 4FHBD 3CQPA 4LU5H 5AB1A 3U9UA 2W59A 4YSPA 4XNAA 4PJCE 1T5XA 5IQLA 3UTZB 1JPST 3GSRB 2V9TA 4WO4B 4AQ8C 4YPJA 3D0VB 3UACA 3D0LA 3E9TA 4DFIA 2LE9A 3VFSB 1GJIA 2HJKB 4DW2H 2GBTA 3FN0H 4M3HA 2AJVL 1O75A 2J4WH 1AC6A 3SY0B 3UMNA 3HRZB 4PP1C 4BELD 4ELDA 4V2BA 5DRXB 2BHFA 4KK6C 1NGYA 5IUSA 1JV5A 1KEML 1F86A 4HWZA 2ZUSA 3U46A 4AQ8A 3BRDA 4NM8L 1M7UA 4M7ZB 3S3DB 3SCMA 3GSVA 4XBPB 1YEEL 4YX2L 3F12A 4MMZA 4MZRA 3I50L 1HE8A 1YYCA 1CGUA 3G5ZB 3Q2WA 2FBRA 4AY0A 4NQCD 3HE7A 3ESMA 5DJCB 2YLKA 5CP7B 3TBTA 1WHOA 3V4UH 3PL6C 1VRSA 2BNRD 4LEBA 4R7LA 4WI5A 5LCVL 1CL7H 4P9HH 4F9PC 1O6SB 3EGDA 4BUGA 1FZMA 3BZ4B 1KENH 4LCWD 5AOZA 2E86A 5HI3D 4TNWF 1EUUA 1BJ1J 1PGRB 3N43B 5GXBB 1BGXH 3QCUL 4FKEA 2JQZA 3V79C 2P5WA 3LS4L 4LHUA 3MJ8B 1Y07A 1Z3RA 1PDKA 4BSVA 4PJHF 3WXWH 4JDZB 4OLVL 4BYHA 1WP6A 1P9MA 4R7XA 2NY1D 2WN3A 2YA0A 4HIXL 3S88L 3CC5A 3SDXB 3AXLB 3VSUA 1LDPL 2VLRE 1AP2B 4ODHH 1SDDB 4CN6A 4PJAA 2FHFA 4FD0A 1AS7A 1DZBA 4LIQH 1P4IL 2GTWB 5F89B 1FVCA 2XTJE 3GIVB 2B9AA 1J8HD 5B38G 2X89D 3C12A 3ARVA 1BREA 3ARQA 3C6SB 2HAZA 3L95B 3ZLQC 3ASNB 4GSUA 3ETBJ 4ZNEA 2I5YL 2YAMA 2LU3A 3UP1A 3B2UD 1MLCA 3K6NA 4IIQB 3U36B 1HCFX 4QEGA 1OAKH 1VEPA 3AG1B 5KVDE 5HYSB 1NFKA 1XEDA 1QTSA 1I8IB 3UBFA 2C3XA 3V9FA 4N86A 4HWBL 1FZOB 2BNQA 3MLZH 5EA0L 1G9MC 1UUSA 2J1WA 4JL1A 1A47A 1MEXL 3G6DL 3FUDA 4FFWC 4DFHA 6PCYA 4F91B 3QHFH 4LRIC 1A4CA 3K8LA 3VVVA 4UQ9A 4BWWA 1IZJA 2KZ1B 1OAQH 4MMXA 3O4OB 3C5ZD 4JRLA 4OB5L 5I8KH 1S46A 2O5YH 3QPXH 4Y2DA 4LVHB 3CZUB 3ZK0A 3UBXI 3S3PA 1Q9WB 2IMNA 4FHJA 1QZ1A 2XWZA 3MYZA 4KKNA 1HXMB 3QUZB 4LQFH 3ZKND 3MA7B 1BF5A 1PX3A 3DGGA 4JFFA 4A6YB 1C08B 1MW0A 4M5YH 4PEEA 3CVIH 1NDTA 3DX7A 5E5UB 2VLKE 1KGJA 2OXGB 5DZLA 1FGVL 1QR1B 3V4PL 4MAUL 1JPSL 5DFVC 4IK7A 4RQQB 3QUZC 1LE5B 4DP9X 2V3FA 1ET7A 3LPPA 3L3IA 4U05A 2PCFB 1B6UA 5DK0A 4QYOB 1HWGB 1UZGA 2BWQA 5IROC 1NFDA 1BVOA 4Q52A 1KT2A 1TEYA 4MAYA 4OJEH 2YQ3A 2ZKHH 4NUJA 4F27A 1XCXA 2EVIA 2NXZC 5DHXB 1DN2A 1FO0A 4YHIA 4PD4K 5DC9B 5F9WB 1MCIA 1IAMA 1MFUA 5HYEA 3L4UA 4BWTA 5CLZA 3NH7L 3C60B 2HT4D 4H26B 3VRLF 4ZS6D 5TFSL 5E5RB 4P05A 2BY2A 1MJJA 2FD6L 4N0UE 3AREA 1LO3H 3L5IA 1RVFL 2ZSWA 3N0AA 5IT2H 2YSTA 3F83A 1M2VB 3AUVA 2E9GA 1AACA 4ZUTA 5LXGH 2WMPB 3JVFC 5KTEL 3TXAA 4L4VB 4XP6H 5E70A 2DPKA 4RMRA 5DD0L 5AD0A 3MRLA 2C9SA 3RILA 1R3KB 2AJVH 2XBDA 3P0YH 3OZKA 5EC1B 3RX7A 4Z78B 3MRHB 3OAWA 3KJ6L 5FAAA 3FUJA 1KENL 5HHPB 3PDGA 2O5ZH 3MRMA 3UP6A 1FHGA 2VW7A 2ZP8A 3DV4B 3HMWL 2E8ZA 2XIIA 4Y4FB 3TCLB 3TNNB 4GKSB 3P0VL 1KJVA 2F7OA 2VR8A 2DKMA 1ETZA 3P3YA 4JO3L 1U8PB 3FN9A 3ZE0F 5DDHA 3O81A 2CALA 3SYCA 1QATA 2NQDA 3NSCA 1Y18B 2WVTA 5EUKB 3DX6A 1JBJA 3SOBL 2WTRB 4OZHE 3SYQA 1J5OL 1Q94B 2H1PL 3E8UH 3D69A 1F8TL 2P52A 4GAYA 3D06A 4FQHB 4P3WA 2FEDC 4KQ0A 2XIDA 2FT8A 3FT3B 2FTAA 1TTGA 1GY2A 4JFPA 2ZSVA 1E8WA 5D1XA 3MODL 1PPIA 4MBOA 1KYUA 6CGTA 4QF1B 3MRFA 3IU3B 3T8XA 2ZQKA 4XP4L 3VXSD 4AUUA 5CEZL 1M3IA 2QQKL 1RV6X 4DGIL 1E9QB 4A7GA 4FX5A 1D3CA 2WXNA 2VABB 2MPAL 2YRZA 2ZP9A 3HUJA 2X4RB 3VI4F 4YLCA 3QHZH 3GXIA 3SPHA 5DHVB 4MA3A 3ALWA 5K9KB 5C7ZA 4PWFA 4KJWD 2VC2B 4G6KH 3LDBC 1JL8A 1N26A 4CUCA 1OCRB 4W4OA 1IM9A 2WWOA 1IC4H 4UNTA 5E7BA 1CFMA 2CR3A 4L48A 3WD5H 3PWJB 4NO0A 5FYKD 5EN2B 5F8QC 1JZFA 3L5JA 2SODB 3EYVB 4U0RB 5E8DH 3ZZSA 1JG9A 5HYQB 5IF0A 3PGCB 3GI9H 3IU3A 3V0JA 3LV3A 5ID1B 5JPMB 1S3RA 1WTGT 1VA9A 3ABZA 3ZL2A 1BF2A 3BJ91 5IESL 1DJIA 1RK1A 4QDGA 3ZOAA 4HUMB 3QCVL 5ICYA 4HIIB 1KIPB 5AYTA 4CDHA 5DTFA 1FH5L 1Z9SB 2J1ZA 1D5BA 4PI2A 2LFEA 4GUQA 2AGJH 2Q86B 3QNYA 4M7LT 1K8IA 4Q9BA 5DEGA 1T7WA 1A0QL 2DQFB 3BP6B 4QHPA 4F58L 4YDIL 2ADGB 5HDOA 3V0EA 2BFVL 3BZFA 3Q8BA 3OLDA 3WJMB 1GOHA 3SJVE 3G5XA 4IOSD 3OAUH 1U92A 7CGTA 3CSYB 4BH7A 3WN5B 2AEPL 2ITFA 3D85B 1JHTA 1ZGLA 2FSEB 4H0GA 3KLAA 3IGAB 3OM3B 3WUZA 4JN1H 2Y25A 3IJSB 3LPOA 4WWKC 4N0FA 1FFNA 4N3UA 3PV6B 3QIBA 1SGKA 4NAQA 2Q7YA 3ARGB 5GJSH 4NKQB 4GBXB 4H44C 5KSAD 5CKGA 3MJ6A 5SV4A 2N59A 4WRLA 4DUVA 3DV6B 1IBHA 3HZMA 3PJSB 3LKQA 4NKOB 5EU3B 5KYWB 3FQXB 3K6FA 1NC2A 1TT6A 4AEIL 4QJ3B 1CXKA 4N2EA 2VXVH 4XN8A 3V6BR 5F7NC 3DO7A 1FGNL 4BFEA 5CZVH 3IDIA 1GYUA 1T0PB 3LJ3A 3EO1B 5E6RB 1JWUA 4MQTB 4YHZL 1UB6A 3VMNA 3T1WA 3UZEC 3LPWA 5JHDD 5DD3L 4P46D 5BW7A 3FJTA 1PYWB 4GH7B 2YEVB 2WC7A 1E5AA 1MUJA 3DETC 4UYPA 5G4MA 4PJEA 2NLJB 1CJYA 4X50A 1CFTB 3JT0A 2VLMD 3AG4B 4M8QA 4U6VH 3SYPA 2FLMA 2ID5A 2K9FB 3WKQA 3O4LD 5D7LA 1H15A 3BQUC 3ECQA 1K6QH 4HT1H 1V8HA 4JFDB 4JFZL 4NUMA 3DX8A 3OAUL 2X1WL 1UM5L 2GBUA 3OKDB 1QLFA 3IXAA 4HIPA 4KKBC 4QAWA 5DQDL 2B4CC 2CRMA 4G42A 2DLIA 4MJ4A 1QAWA 4TUJA 1MW1A 5KZCD 4KO5A 3J2PA 1NC4B 2X44D 3ZHKA 3OKNA 2IDTA 2DTSA 3ZYZA 1FUNA 3N1FC 4RA3A 1KZQA 3IDMB 5ACMA 3TBVA 1NZRA 2G60H 1EBPA 1ITBB 3BD3A 3GXUB 2XWDA 4DIXA 4FNQA 4TNVF 1JV2A 4PRBA 4P2OA 4JDVB 2G3NA 1X5XA 4P06A 1NQBA 4K9EC 1GPOH 2VN4A 2WXQA 5KUKA 4FFYL 3UPRA 2AK4D 1BAGA 2W0FA 3BYTA 4BZ2A 3LKPB 1IGCL 2OR9L 1TJGH 2FX9H 5F0MB 3VGGA 4RA0C 3ZL1A 4A2DA 4F20A 1JP5A 5J0BA 4R0LA 1GL4B 2QT6A 1I8IA 3CVHB 4IBSA 4KJQD 2EEFA 1MF2L 2YGOA 4GXUM 1A6AA 3D6GA 5IGXH 2DS4A 1QUNA 1LP9B 3S0PA 1E4KA 2YC1A 5KANG 5I1JH 4UT9H 5CINH 2EVFA 4Y16C 1YMMB 4Y2OA 2IJ0C 1T4KA 2WO3B 1D7BA 2H5UA 3NIFE 4GRLC 4GNKB 3I85A 2QFRA 2Y36L 3IMWA 1BD2A 2GTWA 2VGLM 1EDHA 5FCSH 4OI9A 5IMOB 4HJUA 2IXQA 5EUOB 4NT6B 2YBGA 3OR7B 1DSFH 2BHZA 2WCSA 4KDWA 5ANME 4L8SC 1A4KA 4LSVH 4OIIL 1AE6H 4BWUA 1EAJA 1ZGLP 2YJLA 5HJBA 1INDL 1IILE 4CW1A 4LKXA 1XF2A 4TM9A 3DJZA 1AMYA 3MRJA 8FABB 4FQHA 4ZAKB 1CFQB 3CFKB 2OCFD 2ZCLL 3EOTL 3QJHA 1FGNH 4JN2A 1WTLA 4K55A 1OCWH 3QDMB 3QWRA 2WUBH 3PREA 4PS4H 2EH7H 4PTTA 4GRWB 4BFRA 1U8PA 2W9EH 4CGTA 3SO5A 3OC8A 5AOKA 4JPIB 1M9WA 4HKXB 2C9RA 3QIUD 4LVOB 2F53E 4EMZA 2PCYA 4OCNC 5D9SA 2EC9U 3CFBB 1RSYA 3EH5B 3HZVB 4HWZB 3U46B 1MWAA 4FYSA 1DSWA 5HSFA 2VT0A 3BMWA 5GRWA 2VDOB 1WS7A 2AW2A 5L2KD 3ARFD 5IB2B 1X9QA 5HDLA 1AGEA 1N0XL 2AJXH 4FNSA 1DJHA 1I4FB 5E8DL 4I1PA 4J8QA 3BXNA 5E8NA 5HJDA 5EEYA 3D25A 1F4WL 4O00A 3KMDA 2HJKA 3GJFB 3TTYA 4UQ3B 2C9QA 3S8WA 1L6PA 1PAZA 3TF7C 3M7OA 4KXZI 4EIUA 2KPWA 1NGXA 3FQYA 2EDKA 4XPGL 3VD7A 2YSSB 1F45A 3WKPA 2F6AA 4MXQC 4B9JA 1FNAA 3FTWA 1M3JA 2ETWA 2HXAA 3CFIC 1T04A 1Y0LA 3SPVB 4N87A 3GTNA 3HFFA 3WELA 1SN5A 2GHWB 4XCCL 3L7FA 2AEWA 5DMGC 3AACA 1HHHB 5H8DA 3T2NH 4TPRL 3WG7B 3G5VA 4EUPA 2CRZA 1JVKA 4AENA 1DO6A 3GPEA 2Y5EA 2W8CA 2X1OA 4N2DA 1IEAA 4F5CE 1AIFB 2AJZA 4QRPD 3SKJL 4HULB 4FRWA 1TZ8A 3VMPA 3H8NA 4Z1PA 1Q9OA 3P4OB 1OL0A 1NAMB 3FUNA 2ZOOA 5CBEA 4JPVH 2Y1YA 5EBMA 4CMHB 4YSUA 4QRRE 1TEFA 4B9GA 3EFFB 1XB3A 3LH8A 3BFQG 4N85A 1JNNL 3S5LA 2BY1A 4JFXB 5F1IA 4O02H 3VE0B 3WUWA 1TENA 4PUBL 5AZ2L 5DHYA 1Q9KA 5C09A 1P0SE 2YSSA 1E4XH 4DGWC 3HHRB 3P4LA 4A63A 1CGVA 2JXMA 4EIBA 4FQQA 1XEUA 2AEOA 4HKJB 4XPAL 1G6RA 4TQIA 3VSQA 1YJDL 1DLFH 4JG9A 2B5IB 3C87A 4OI7A 4HUXA 2OULB 1M7DB 3NVQA 2HG5A 4GKZB 4Z5RA 3OAYK 1E30A 1KLFB 1NMAH 3C5ZB 2HTKD 3FBKA 3LNIA 2NUTA 4MXWL 4QTFA 3RFZC 2CIKB 4K73A 2D9QB 3DJSA 5HJ3A 2JJTA 4JGNA 2BDNH 3X17A 3GNMH 3CSTA 3IJ8A 1E50A 1FZOA 1JHKL 4JEGB 3ESVF 3IMVA 4K7FB 4TSBH 1G7IB 1GZQA 3RU8L 4ABVA 1NCCL 3F7QA 3OMAB 2NW2A 3EYFB 1QFOA 3BT0A 3NJIA 4KAQL 4DP4X 2CLZA 3OJVC 4GRLD 5B8CB 2VQUA 2FO8A 4A2EA 4XVSH 4ZTPH 3HNVL 1Z9SA 5C2UB 4JO8A 3PS6A 1ZE3H 5JO5B 1MWAH 4NLAA 3DUSB 3SGJA 1J8HB 3V5DA 1EERB 5IWLA 1LQBC 4KO7A 1IT9H 1ORQB 1KCLA 4KRNA 4MJIA 5FA4B 4O2FB 3F5WB 2Q8AH 3GYRA 1JWSB 3CSPA 3G5WA 3QG7H 4OJCA 3WE6A 4KDVA 1EO5A 4KITB 4FLHA 1G9ML 4JFVA 3COOA 1Q9LB 2JQAA 2QADB 3U7YH 2DWSA 2OSYA 1YEFL 4XOCA 2CCWA 4YWGH 3U4AA 3QCUH 1WAAA 3VU2A 2UZYA 3D39E 5D72H 1VFBB 3PWPA 2C4XA 1J12A 2FGWL 2HCZX 5DA4A 1XF5A 4XPFL 2QSCL 3MVSA 4WW2C 4Y4HA 1H19A 3EGSA 4K2UH 2PYEA 4HHGA 1I3UA 4G80A 5INDB 1PEZA 4XN4A 2H3XC 3TH4T 2DKSA 2VUKA 4PRID 4JO5A 4F7KA 2X4NB 4RFEB 3C6LA 3CZFB 1NWPA 1XH0A 2JIXD 4MBRA 3FYIB 2ZSVB 1BQUA 3DARA 3IDYC 3ZGHA 2PYEE 1I1YA 1XX9C 4IGBA 4HFUH 3VFSA 4A2FA 3FTZA 2KDYA 4K9JA 1KIRB 1Q94A 3L3JA 3MNVA 4Y7OC 1PJ9A 2YMOA 1AVAA 2EDOA 5EULV 5IY5B 2C9XA 2ED8A 1HJBC 4Y9GA 5A3IC 1VESA 3NSYA 4GSRA 3DVFA 4JRWA 4DAGH 5C0FB 1I7ZA 2VDPL 4H4NA 4PHXA 1QSEE 4UINH 3LIZL 5C08B 4UYQA 4TSAH 3Q9PA 3MAWA 3TNNA 3MJWA 4LPTA 1WC7A 2YAQA 4HPOH 4V11A 1T6BX 4JG1H 4ZFOL 1A7BA 1OAZH 2ITDA 5T5NG 4POUB 1LK2A 5C8JA 4QLWA 1YEJH 5GRZA 2Z0BA 3O6LL 2DI7A 4G9DB 4XNZC 5I15L 5IEKB 4QRUB 3F04A 4RVBA 3MLRL 3VQLA 5KVEE 3FFDB 1IGMH 3LEYL 3HN3A 3MRDA 4K94C 4ORGB 3UXFA 1BZ8A 2HLAB 1BG1A 2HKFH 4X83A 2XWBA 5F3HA 5IQNA 3A6CH 5DUML 4JLRA 3TCXA 3C60A 4H26A 1LLAA 4A38A 1UM6H 1CVRA 3FZUC 2D0FA 3RWDB 5DF0A 2RALA 5AB2A 3JTBA 1YY8A 1N0LB 3K80A 4HOWA 5HBBA 4DGVL 3W0WA 4NPJA 2ZXQA 4YL4A 5BQ7A 4WFEE 5LWYH 3UZVB 4P57A 1ANUA 4UQ3A 4PJ9A 3WFHA 2PO6C 3VFOA 5E2UL 2WAQA 3OZ9H 4CVZA 5ALBH 1FVEB 4JBSA 3QO1B 4ZMOA 1AKJA 1DYZA 3IGAA 2VSDA 4R97C 4WSGA 2QGEA 5E4OA 4JFYB 4UTCA 2BJML 3ZTJG 4ODSL 4PJHA 4W93A 1OSEA 3JWNC 3IDGA 3DGCR 2XZQL 4KJQC 1CDHA 3ARDC 3DX7B 5T3ZE 3UABA 4E68A 4HKZB 3C8KA 3OJDA 1BZ7A 4G8EA 3ZO0A 3G6AB 4FFYA 3ULUD 4H1LB 4OM0L 5KVGE 2F74A 3QUZA 3T77B 2VDOL 1F3JA 3OPZL 3NUKA 3TBWB 4IOIA 5CSBA 4FFVD 5FM8A 3ENEA 5IK3B 3EO0A 3B9KD 3SPGA 1ICTA 3CK0L 1IFHH 4HWBH 5LG1A 5EMYA 5LN8A 4QRPB 4JRYD 5FIEA 3S4SG 1OANA 2P24A 3IKCB 1D6VH 1TMCB 1U3HA 5AYUH 5EDXA 1Z5YD 4ZQKB 3HHSA 3ALXA 1A4KB 2X9XA 2X4NA 2DI8A 4XMKL 1FZJA 5HYQA 3TN0A 3MOQA 3RIFK 4HEMA 2CHXA 2GABA 2PYEB 3MV9E 3I9PA 3EGSB 2WLNA 1KC5L 1HU8A 2Y2WA 4L37A 1QWNA 3GMLB 4PYHA 4E9SA 4R4BB 2RR3A 3CZSA 2OTUB 5I1IL 1FLRH 4G7YL 4KH9A 5ANMA 3RTQB 3QG7L 3T65B 2VLME 5D4IA 5MEPA 1O9VA 2ITCA 4PH8A 3FQTB 4IRZH 3RDTC 3UEZA 5ADOH 2ZOLB 1IAIM 4FXKA 1G7JA 4V1DA 3SDDA 1EVTC 2H6PA 3FO1A 4KVCH 1FL6A 2ENYA 4V33A 3SGDH 3LIZA 1TYJA 3IPFA 2EDEA 3GHBL 4LHUD 4LVHC 3KBHE 5F1OB 2W0FB 5D7IB 2AEQH 1JYXA 1CICC 1OW0A 1Z5HA 5JOFB 4QO1B 4WCYL 3KPPA 5EOCH 3DMMD 3P69A 3I2CL 4MD0A 4QRPA 4AQOA 2CIIB 2X70A 4M1CC 3Q8EA 1ZMYA 3BLBA 2C9PA 3AU0A 1IBFA 1G6VK 1WFNA 2XVKA 5EU7C 3EHBC 3DUSA 2E56A 3ZN6A 4NO3A 4PRIA 2EIDA 1E8YA 1T1WA 5JO5A 5GGRB 1G1KA 3TA3C 1WO2A 5DJZB 3GDBA 3RWGA 4KNTA 5GGVL 5MENB 5CMAB 1SUJA 3PNRB 4KVPA 1JPGA 1OGTA 1L9TA 3B5HA 5T1LA 2DL2A 3PWLB 2ZP0T 3L45A 5IJCC 1NGWA 2WIIA 4GAAA 5EWIL 3HUJE 4Y4FA 1UADC 3QWOA 4UMGA 4MWFB 5CJ8A 2HFGH 4I1NB 4PJEB 4PG9A 2GFBA 4QHNA 1AG0A 4HIHB 2BSED 3HNTH 4OIIH 2C8NA 5FYKE 3ARFB 1MCOH 3A21A 4FFVC 3OLGA 4PJHE 4ZFFA 1NDGA 4JY6B 5AWNH 3UTSB 3HAEG 3QJOA 5FLVA 2JKJA 4YBQC 1E4JA 4B97A 4NPYB 1L3WA 4JVWA 1KFGA 2ZSWB 3S36H 1JOIA 4CVXA 3MQIA 3NPSB 3AREB 3Q2LA 2J57A 4IRJC 5FHBH 4PJCB 2X7LB 5GZOA 2DDQH 2WUBL 5KN5A 3IPBA 3WGUB 1JI1A 2MKLC 1P7QA 4CN1A 5FO8A 1KELL 3GLDA 2NZ1A 3BFWA 2OMTB 5J3HD 2DQTH 5EBMB 4Q8BA 1OAUL 3BQVA 4YHIB 3THML 2Y07L 1DLHA 1IZKA 3C2AH 1XIWD 4UOW1 3RDJA 4BKSC 4FQJL 4IBZA 2OMZA 2X41A 4G59C 4DQAA 4GMSH 5J11B 2NNCA 3V7AE 4BH7B 3QYCA 1DEEB 4EKJA 2H7WA 1H3PH 1IVTA 3H3PH 1M42A 3BISA 4JFOB 4NQED 3T4YB 4G8GB 4AEFA 2IQAA 5AVQB 4XH2B 2OI9C 4DKDC 3AWFA 1E28A 1BMZA 4QTIL 2ZUXA 3MA7A 1I8LA 5ADPL 3HKZA 4PJEF 1E9OB 4OAWA 5ICYB 5C3TA 3K1DA 1UXMA 3WNNA 4PJ5B 3CDFA 5IFAL 3LN9A 4P0DA 1W0WB 5CJ5A 3MCLH 1NKGA 5ISZD 2ESVA 2X1XR 2BVQA 3LNEA 4RZKA 4QO1A 5AYQA 5AAWA 5IFAH 2VH5L 4M3JA 4JQIL 4QXWA 5A2LH 4YHML 5EDSA 4R4NC 4XCFH 3QEQA 4N2NA 5IFHH 1D7FA 4MGXA 1DBAH 1XF5B 3BVNB 4NQTA 1R34A 5CZVL 5G2NA 2X9WA 3LRSA 4G8IA 4MS8C 4HS8H 3DRTB 4GSDL 3GB7B 1DANU 1JGEA 3HS0B 5GRVK 3KPSD 5DHVA 2DZEA 2P44B 3C6SA 4NBZB 4PV9A 5E6SB 5IV2A 3MRJB 4X6BB 3WNKA 4D3CL 3H7LA 4KNSA 3ULUH 2WQVA 3DX9A 3R1GL 1FFRA 1C5CH 3RG1C 1FLRL 4ONHB 1UH4A 1RJLB 3QIWA 4Z7UB 2X2YA 1SPDA 1E90A 2QDVA 5LG6A 2YIHA 4PRPA 2NCEA 4W70A 5F1KC 2XFXA 3BKYL 2DJ4A 3I02B 4M6OH 4YHLL 5DURB 3EO0B 5T5FA 2EKJA 4PV9B 4U7KA 3AZUA 5D1QE 1RZ7L 4AIZB 4B7IA 4NUGL 2P43B 4PMEA 3WN5C 2DD8H 5DS8B 4X5WB 2OZ4H 1PEWA 1EGJH 2I69A 2FWOA 2X3AA 3JWDL 4UTAL 5I8CA 1H3VA 3QORA 3WLBA 3F12B 1DUYB 1TJIH 4XZ4A 1A4AA 3SCMB 4WNQB 1QD0A 1M6OB 2XQBL 2XC8A 3QUML 4FERA 4FG6C 2OYKA 3UPRB 4U7MA 3DOIA 2ENQA 3HR6A 4ZI8A 5E51A 4OCWH 4HZLB 3RX9A 3ZE1F 2M26A 4RETB 5AOMA 5HHOE 3A23A 4N1HB 2VDKH 4MHHI 2O93L 4L9DA 1FDLL 1WFUA 3DHJA 5EF1A 1KB5B 1UXWA 1W8EA 2GEEA 4K7PY 5F88A 5K39A 4KVNL 2JQMA 3B1UA 4UCFA 2ZE0A 2ICEA 5MHSD 3EDKA 5IVZA 3D0LB 2VQ4A 5MEQB 3UG4A 3LZLA 5HHOD 3BE1H 1N7MH 5DQJA 3OMZA 4S1QH 2F7QA 4U1NB 4H5SB 3AS0A 5AL8A 4F24A 2H8PB 1ZLVH 4BV1A 5EZPA 5IHZA 2BRRH 2APTA 2YPLE 2ZXWB 1K4DA 3KPRB 4LCWB 4EPSA 2WZ5A 1Q9OB 5CO1A 1D9KB 5ABDE 3DI3B 2YUXA 2DQHL 1I8KA 2G5RA 1KT2B 3O9WC 4LFHD 2J2ZB 1BBJA 1O7DE 3PJNA 2WSKA 1XO8A 3SDCB 5EPMB 3T4AA 1QO3B 1BDYA 3NCEB 1XCWA 3BIBX 3QUYC 4G6JL 2KMWA 1ADQA 4GG8B 1BZOA 2QVIA 4AQEA 1TKWB 3LZOA 2X3BA 3BPCA 2IDCA 1KN4L 2DIJA 3KYNA 4F9LA 3MNMA 4RLDA 5CCKL 4F15C 1AD9A 1FVDB 2ZX6A 5C0RL 4PPTA 3UAJA 1UURA 5MEQA 2DIBA 3I6LE 2VKWA 4CVXB 5LGHL 2EC8A 3QHZL 3TN0D 1QG3A 1AANA 3MV8D 4GMTH 1EHXA 2CHDA 3ZE1B 1MFAL 1TTCA 5EZLB 2B1AL 3CVIL 4O2CA 4OD2A 4Y2DB 3RURA 1ID2A 5IBLC 1NBVL 2Y3AA 5E8NB 3O2DA 1XTLA 1HHKB 3I75B 3MNWB 1M56B 5CKAA 1FFNB 4PCTA 3UX9B 1J10A 5EO0B 2FIRT 1G7MB 3MOBL 5B3SB 2ZKYA 5A3ID 3QC6X 4XWGL 2YGNA 1G5GA 1SHSA 2HLFC 2Q87A 3S6CA 3CSYA 4PJ8A 4WJ5A 3TEUA 5D1XD 1JF6A 1J05B 1EEZA 1A6ZA 5EU5A 1TPXB 3PXLA 1LE9A 3ARED 4GAFB 1OPGH 3QXDA 1UA3A 2ADGA 1GJWA 5E6YA 5DZVA 3TJHD 3GTVA 4POYA 1FBIH 2AQ2A 3MUJA 4NQXB 2KLTA 5DO8A 3ISYA 3VH8A 3P9MB 1KBWA 4J28A 3EJTA 4B6ZA 2F7RA 4ESKA 3OGCA 2Z31A 3FT4B 3GIVA 3FUMA 3HBZA 5KBLA 2XFXB 1AQHA 3NZSA 2CJSA 4NC1C 2YKKA 4V1DD 3SDDD 4M5ZL 1B0GB 1RIVH 1VHPA 4NP4H 4TS6A 3ZZ1A 5E2VL 1YNKH 1MLBA 1JZ6A 4U1JA 3UDWC 5A40E 2GSIA 3UTTD 1GYWA 4CSTA 4FQXD 4G7VL 3FUIA 2X4TA 3VFVA 4D94A 3D4GA 5I1EL 1LMKA 2NY4C 5EN2A 4HIEB 5L2JA 3BEVB 2ORBL 2OPCA 4UDUB 5IHBA 2WUCL 3IXTA 3MREA 4NM4H 4UUJA 2BX5A 2E6PA 3S35X 3AFLA 3ATAA 2HJFB 3U4BH 2NR6D 4JZJA 5BZWA 3VRJA 4DAGL 5C0AB 3K72A 7FABH 3V0GA 1HTYA 3PDOA 4AM0B 2LLGA 2XWCA 1QUPA 2MNJB 3VI4B 4N6QA 4ODUB 1QW9A 4LVNB 4M1DH 1DVSA 2IWGA 3GZQA 4TVUA 1ZV2A 5C92A 1IQDB 1N6QL 1QRNA 2DLFL 4UAOC 1LMIA 3L3GB 3QEUB 3FOLA 4DP2X 1QHPA 4OLXH 4JRYB 3SY0A 4BA0A 3POHA 3BSZA 5FO9A 4KKZA 1FLTX 1FZKA 3V5HA 4OJFL 1U8KB 1INQB 2HWZH 3TBVB 4YEFA 4JQVC 4LPCA 2XQYK 1SYVB 4FG6D 5J5EA 5FYKH 3SPJA 4GUPA 1X5IA 3FH8A 3V6FB 1KY7A 4EUPH 1M53A 5GSVA 3TLRA 2F18A 4TUJB 4K2UL 5T1LD 5CAYB 5IW1A 4KZCA 1C5BL 2XZQH 4RFNC 3O3AA 3STZA 2YQGA 2UY6A 1QI4A 2BRQA 1H5BB 3CDGB 1ROCA 3GGWA 4G6AD 4K5OA 3UROR 4ZMQA 3NFNB 4FZ8H 4CILA 2D4DA 4K3DL 4B7LA 1JF5A 1KJVB 1YUKB 1ZXKA 2XIBA 4PGEA 3BVUA 3EFFA 4RFOH 1YEHL 5D6CB 2IO5A 2FJHA 4XP6L 1C5DA 3N9GL 1HL9A 4IIQC 1NICA 3NIFF 3TV3L 1BEYH 2BZ7A 4UT7H 1NUGA 2AMUA 2QDWA 4L4JA 3GBMH 4JMXA 4ZFZA 1JYNA 5I2IB 1TSHA 4OCYL 4R7NB 2BY3A 3GM8A 1ADQL 3QO0B 3K6IA 4HAKA 2EDHA 4EZLA 1FV1A 2XN0A 4F2MA 1RZFL 3V95A 4A7UA 2XQ0A 2B0SL 3VFMA 4MLIA 1IKFH 4HG4J 1Y0LB 3SPVA 1IEBB 5DUPL 1JN6A 3NABH 4OZIB 2HT2C 2IOMA 1P4UA 3HZMB 1X9RA 2VR9A 3C5ZC 4L8CB 3S9DB 1HC1A 4QHMB 4WI4A 1NBYA 2IH8A 1YEJL 3QG6A 1MRFH 4N0RA 1UQSA 3VNZA 4Q58C 1NGPL 3CGTA 1BEYL 2R2CA 2ZCHL 1UXSA 3N5AA 3ZL4H 4A55A 1XFPA 5TK4A 4NNXA 5FGSA 4WU5B 2GFBB 4ZFZB 3VXNA 2DEWX 3LS4H 1CXIA 1NMAL 1W72L 4K23H 1RIVL 1WAPA 3MXWL 3QUMB 4ZMWA 1SBSL 2XN9A 2NY6D 1REIA 2DQFA 2W80C 2EQDA 2XN1A 3LHPL 4LOUD 4XMTA 1OZTG 2X6UA 2VZ1A 3I84A 3PE9A 1MNNA 2HX9A 5GGUB 3QDME 4NQCB 1BX2A 4I0PC 4AJYV 1IGFH 4DNLA 1JF1B 4M00A 2YAEA 3NJGA 1RSFA 4S1RL 3L9EA 1KCUL 1VKXB 4HIIA 4OW6A 5EIIG 4KX9A 1I1AD 3BUYB 1WBYB 3GS4A 3VGAC 3QBTB 3UBXG 3SKOA 1RP8A 1EHLH 2GB2A 3HFMH 4M7KL 3B9EA 4ZS6C 3LEVH 4LCIL 1BOYA 5DMIH 5ERWB 5E00A 5BRZE 2LLNA 2NY1B 4Y16A 1JXJA 1AQDB 4LSRL 5F97E 3RAJL 1CIUA 4F8TA 3L1FA 5D7IA 3X14A 1YC8A 3U9WA 1A3RH 4XNXH 2MQCA 2UZXA 2IXQB 2IVFC 4BQ6A 2ZAIA 3H7BA 3MA9L 3P9LB 1ZT7A 5D5ME 1RK0B 2ZPKL 4P9MH 5E6IB 3TJPA 1ZLUH 2GEQA 3FB6A 3H55A 1MREH 3KLLA 3NFPA 3ZTJH 4FFTA 4OKDA 3H3BC 4N5EC 4OUUB 2QSTA 1EAPB 1HYSD 4X9IA 1KXQA 3D51A 3GXDA 3C9NB 1UD4A 4HETA 1ROWA 4KK8C 2X4RA 4OCRH 3S3BB 1UKSA 2AJSL 3W5NA 2PPAA 1FVCB 4ZW3A 3FU0A 5TQ0L 5A2AA 4MNGB 3H7BB 2CA4A 2DQEL 4KI5D 3F2LA 4Z0BH 3UJJL 4FAAB 2AV1B 4KVNH 1A4BA 1R5WA 4P2OC 4JJHA 4KTEL 4YFEA 4FNTA 4I48B 1DFBL 4ZUVB 5ITFB 2AEIT 5G55A 1VENA 1AZNA 2UZPA 3FO2B 4QTHA 3VDAA 4A7TA 4LCVA 2BM3A 2HN7B 2FYVA 3SKOB 2A1WH 3OAYH 2X2JA 3IDMA 2VL4A 3EBHA 4FFYH 2WK2A 4P2OD 2FEEI 2WB7A 2YPLD 3MKGA 2MMXA 4QHLB 4WI8A 1PD6A 4U1SA 1WHPA 4Y5YB 2WZAA 5DDHB 5FGBA 1N64L 3VFUB 4HLEA 3J27A 2ZIDA 1EH9A 5BVPH 3ESUF 4KPHH 3BGFC 4BFIA 1JPTH 3EYFA 4NAMA 4GG6B 3QR2A 3NACL 1K72A 3FRPA 4F9PA 1AXIB 5LBSA 3V9EA 3IE9A 3N40F 2G2NA 2ZG2A 3MRGA 1HZKA 3VXRB 3C6LC 4MD4B 1RIUL 2VZSA 5GSRA 2FNBA 5B39B 4HT1L 3VGDA 3HJEA 5KSUA 1WG3A 4X7CC 1QNZH 4YDVB 1MCWW 2F5BL 3GHEL 4WSJA 2LFGA 1MVUB 1TZHA 3VFWB 1XSOA 2PYED 3MLTA 3N6YA 4MZ3A 4PY8I 3W0WB 4F2EA 4P59L 5EZLA 4HOZA 2D0GA 1KJ3H 1T5XB 5F7DA 5E2TH 4P9HC 3UTZA 5T8IA 5KS9B 4HK0B 3ROOA 1LM8V 4PJ7E 2NPLX 3RY6A 3WEAA 1SXAA 1RY7B 2EEAA 3P3SA 1BLNA 2VDRL 1ACCA 1FO0B 2A3TA 3VYPA 5JYMA 1JNLL 2O5XH 2QMJA 4AQEB 4IJ3C 2OTWB 1J8HE 4HH9B 5DHVH 3E2HB 5A16B 2RMNA 2ZUQB 4XOBA 4OGYH 3U6RB 4ZUWA 2VH5H 3VU1A 2WAHA 1GPOL 4OF0A 5CHNB 5H4ZA 4Z7WA 5LXVA 5KYYB 1LE5A 3LSOB 3D09A 1VCAA 1HAUA 3BSGA 1A4JA 3N55A 4FXGA 3TT1L 5K9QI 1TQCC 1JERA 1FH2A 1F6AA 1G4RA 1ZA6A 3QQDB 2C5DC 3TOPA 3ZKMC 1F4YH 1YECL 5HYJB 2YWZA 4PP1D 1UZ8A 2WP3O 2IH3A 1B88A 1A64A 1F1DA 2PABA 4AIXA 4GG6F 2Q3AA 1ODUA 2VDLL 3BP6A 3OR6B 1BXAA 5D1QA 4RMQA 1K8IB 2NW3A 4EI5A 1RIUH 1UD3A 2B15A 4LEOB 5KBKA 1TJMA 2VDNL 4H5SA 5D2NC 2BXZA 3QK0A 1CGSL 3EUDA 1WICA 3CPLB 3M1OA 2GK0A 2XVGA 3FT1A 1RUKL 2ERJB 1CWVA 1WFTA 2HG0A 2VERN 2IC2A 2OMUA 5F88B 4ETYA 2ZKMX 4IBWA 1RK1B 2GJPA 2UX6A 1A22B 1FCCA 5GGVH 3T6XA 2OTPA 3BXNB 3B37A 3ZRSA 3KAAA 4JM2D 4P23A 3MZGB 1KBKA 4OU3A 3MLWL 3A0OA 3HCVA 4NRXB 1EO7A 2PWFA 1OCOB 3KJ4C 3KW7A 1SVCP 4ABWA 4ODBD 2X4PA 3O6ML 4OGXH 3MV9D 3OQRA 2ARJQ 3N3EA 1U8CB 1YYLH 3KPRD 3IMRA 3PWPB 4O5LL 5CD5D 4YXHL 1JTPA 5DXWA 3BESR 5ECJE 5ENWA 2M1KA 1OK0A 4NQEE 4XPHH 2ZD0A 1OEZW 2AQ1A 1MIML 1A1OB 3AMLA 3D1MC 4JDEA 3S48A 2AXFB 3NBNA 1MAKA 1WCQA 4H25A 1S5IL 3MROA 2JCWA 2W81C 2EXWD 2OBGA 2EE9A 3IXTB 1KEGL 4KKAD 1CDCA 1I9IH 4ZAKA 1W8OA 4FNRA 3K91A 2KKQA 3WJJC 3IYLW 1M05A 3LIUA 2Y7OA 3II2A 1MJ7L 3DSFL 1P1ZB 5E1HB 1I7TA 5LAXA 3T0ED 2SEBA 3BSHA 4Z7NF 3QUYD 1A7RL 3WIFA 2GJJA 1G1OA 2MPAH 5A2FA 4XNQB 1CICA 2F54B 4PSRA 2GBVA 3QDJD 5IHUH 2YBRB 1QFWI 4P2QB 4YFLF 4XX1G 3CN3A 1F90H 4I2XE 4YSOA 2Z8SA 1YMMA 4W4NA 1E67A 5CBAA 2UY7A 3QZWA 3V55A 3WNIA 3OAZH 3HI1B 4EIGB 1BHGA 2DM3A 3BWUF 4OZFH 1GCFA 2K78A 2X2HA 2DN7A 2BIOA 3E8VA 1G7IA 4OCSH 4H8PA 1NCAL 1BJ1H 4HFWB 3BD4A 4OFIA 3PP3H 5E9AA 2ZXAA 5HHNB 1J05A 3L17A 4RRPA 2B3RA 4HGMA 1KZYA 2ZTBA 1MQKL 2GJZA 1BVKA 2BHYA 3SPCA 3U6XA 4QRSA 5IVXF 3WKML 2LGNA 2BOBB 3HE6B 2W65A 4PD4J 4RWYH 2X6BA 2PP7A 3B2VH 5B21A 3NK3A 4F7CB 4XXDB 5E6ID 3LKOB 2OYMA 2VDNH 5I6PA 5C97A 4LSPH 2JMRA 4BSWB 3VFTA 5FW8A 1ZS8A 3WD5L 3DVGA 4UF7C 3NA9L 1EJOL 1MJ8L 4QKXB 1KYAA 1JPEA 4UM9B 3CX5J 3LZFH 3HPLB 5GRJL 1SQMA 2MPVA 2VXTL 3L9RB 2Y23A 3KLQA 4N28A 3IAPA 2XX0A 4FC3E 5ANHA 4PB9L 4G8GA 4JFEA 2O4EA 3P4OA 3EF7A 4U3XA 4ODTH 5EIVA 4ANXA 2ATPB 1Q72L 4KX8A 4JRXD 3HC3L 3EO9L 4LQ1A 1AIFA 1FNLA 2LT9A 4GS7C 4L8SA 1OAUH 4MDJA 5E0FA 1XXDC 1HWHB 3TO4D 1J0HA 1XGYL 1FPTH 1MFVA 1F4HA 2DYPD 2JI3A 2WLLB 4G11A 2P7TB 2A38A 4M6NL 5FA3A 3ASOB 2G5BB 3PHSA 1TVHB 1HOCB 2EVJA 1IM9D 3PHOA 5T33L 4B9IA 2Z64C 2FR4A 4R6UA 2PO6A 5JQHC 3ECWA 4F7CA 2VYRE 3GQFA 4U6YB 1UVQA 3W9EB 1MXDA 2EDBA 3S5LG 2YOCA 3U6XS 5D71L 4X80L 3TIEA 1CLOL 3DVNA 1JD7A 2GJ6A 3LD8C 3HPLA 2ZXEB 3SE8H 5DVNA 4HF5L 3KNBB 2GAZB 2MHAB 4GRMB 1J5CA 3BPOC 5FHAH 3VG0L 1FG2B 1KG0A 3CQFA 3CV5A 4AJ0A 4ICWA 4I9WD 1M57B 4Z8FH 1NEPA 1I4FA 1DVFD 5CU5A 4ZFFB 3K4DA 2W60A 3KYOB 1J0ZA 2ED7A 3HUJF 4XAKD 3UYRH 4CC4C 3OV6A 5LQBH 2BC4B 3HMXH 2XG5A 1BEXA 1DVTA 3I6SA 2CBQA 3PWUB 4PG9B 1H3XA 3NIGB 4FE9A 3QVAA 1BAWA 1JMZA 3DMMA 3D0AA 1HI6B 1RZGB 3STBA 2F8OA 1URLA 2A6DB 5FYJE 3V5KB 4I0PA 1TJHH 4JB9H 1CD9B 3CE1A 1ZHNA 2C3HA 4XZUA 4PU2A 2FD6H 3ULUE 1WPCA 4UM9D 5EH1A 4L1HA 3AABA 4JB9L 4F33B 2WBXA 5D5MA 5DD6B 3REVB 3MLVH 5C0CE 1D5BB 4UDTB 5J8OA 2ZX7A 1S7UA 1ZV9A 5J6HA 1C8PA 1NGQL 5CU9A 4CW1B 3BO8B 1OO2A 4F57H 3AW5A 3SHSA 1LEKA 4R5VA 3DIFB 2QBWA 5IG7B 4BQ9A 4KKLC 2N7AA 4JJ5A 3NCJH 5I8OL 4OD1L 2E4FA 1WAAE 4TNGA 3QDJA 5C0EA 2BP0A 3GBML 2B5IC 1GHFH 1BD2B 2E7LC 3BZDA 4QKTA 4I13B 2XRAL 5LGJA 2JKWA 3P4MB 1FZMB 1TCMA 4G9FB 3U2IA 4HPOL 4WWNA 2YAPA 5IT2L 1F6LL 1GHFL 5I8EA 3K4AA 4LHUG 3WXWL 4FXKB 4V1DB 3SDDB 2OXHA 2Q76A 2ZOKB 2CO6A 4KTDL 2CO1A 1X7QB 2Z1KA 5E9DD 3TZVC 3KWXA 3L3OA 2FATL 4U6HB 3UL4A 5I16B 5DHDA 2VNCA 3KYMB 1KTDB 3IDXL 4LNRA 1BYPA 2XACC 1RZKC 3UO1L 2GK0B 1IEHA 2X4PB 2NNXA 2P28B 1G0XA 4JHAL 4LASL 1CS6A 2Z92B 2QZQA 5MERA 5JNYA 4KI5C 4YJZL 4MCNA 4EI5B 1JZEA 4GP4B 1XZ0A 4O02B 4P04A 5ACZB 5HYFA 2VXQL 4EE2A 4LNVA 3AY2A 1I75A 3KM2A 5C0AD 1RJZA 1YRKA 1ZCRA 3W11C 4PJ5A 1JZ3A 4ZMXA 3K5SA 3BAKA 1AI1H 1K8DB 4N2HA 2I9LA 4XNMB 4OJYA 1QSED 3O0LA 1ITCA 1AZBA 2ICWJ 3RWCB 4GAYB 2PCPA 4S0HA 2W07B 4MNHB 3D0VA 3UGUA 2W9DL 3VFPA 4X6DA 3JWOH 5J1AA 1TYRA 1JUFB 2AP2A 4FJZA 4KRMB 4TRPH 1BG9A 1FE8L 2VW4A 2HRPL 3CDZB 3R4DA 4XMPL 4FMFA 2W0LA 4PJAF 1A6UL 5DT1L 4OCXL 1JZGA 3TPUA 3UDWA 2P8PB 4C59B 2KZBA 3C8KB 4WAFA 3TCLA 2A5UA 1A1NB 2HFEA 4L05A 5FFGA 4F7EA 3E9UA 5E2UH 5A7EA 3QR0A 1FYTD 4POZD 3MGAA 1CFNB 4HF5H 2C3WA 1NCDL 5E1IA 1WEJH 1UH3A 3WDHA 2H1LM 4EN3B 5J4MA 2J44A 3K8MA 1K5NA 2VMCA 3GJFH 4S0TD 1CE6A 3IDJB 3IDIB 1T83A 1ZVSB 2F1BA 4XNBA 3B6SA 5I1LB 1NOFA 2OZNA 2X5PA 2IALB 4JHAH 1QSFE 1ZTXE 5DC2A 3FQXA 4OT1L 3IBOA 3MLPA 5DEFA 3RX5A 4PS8A 3MLRH 2DW5A 4Z7IA 4GIOA 3UZQB 2I5YH 4ZMZA 3QEGL 1UH2A 4PJDA 4XP9L 5F70A 4IKJA 2IAMA 2PCXA 3QJSB 3UGXA 4LLQB 4CL7A 2VMDA 4DN3H 3KBFA 3CAFA 3TBYB 4AL8C 2L04A 3Q43A 4QRFA 3RVUC 4PM1A 4N2FA 5IEKA 4JNXA 2BDNL 1GY1A 3W9DB 2UV3A 4U1SB 4PY8J 3CHRA 4TSAL 3TBSB 3UPCA 5C0IA 3QRLA 2Z7YA 4MMYA 4EJ1C 4HISA 4LOFA 2VLLB 3WY3A 4KQ3H 3QWOB 4Z7AA 3QS3A 4BE5A 1Y7VA 2WBJA 2XXFA 4P46A 4P8QA 5DT1H 3VXUA 3LB6C 4F57L 4Y9BA 4L29A 1BD2E 4DSYA 2NZ9D 4A66A 4RAVA 4YXLL 4Z8FL 3FT0A 4ZXBA 3TA4D 2X4QA 1X44A 3QPXL 3K8KA 4G9FE 3RI5K 3NZHH 5C0FA 5JXAL 3WCYA 1QVOB 3ULVH 4YHMH 5E8EA 3IFNH 4N2LA 5GGRA 1GOGA 4CC1A 5A7BA 1XGQB 4G8FA 1ULVA 1IIKA 2WXMA 4P2AA 4KNQA 3TWCL 4BKLB 3EBIA 2B14A 4IGBB 5K1VA 3U0WL 5KZCB 2X1PA 5BV7C 3OKEB 2VO5A 1CN4A 2Z3FA 1XCQA 3ISWA 2R69A 4HC1A 1OARL 1OAKL 3D3VA 2W38A 4J23A 2VXUL 1WWAX 4FI6A 3T2NL 1FL6B 2OKMA 4YWGL 5HGAB 1SZNA 2ARWA 3MBXL 4Y4HB 3N85H 3MO1B 1S7VB 1BXVA 3FRUA 4MVBD 4UBDD 4X5XB 3MV7A 3SDAA 1VAHA 3OKEA 5SWZD 1RPKA 5IBUB 4IDLA 4LU5L 1X5HA 2UZYB 4PWKA 4L37B 1UT2A 4LMQI 2WKOA 1LO5B 2AXWA 1F6FB 5D7JA 3SJVB 4B5ZA 3WAKA 1AOZA 3WFCL 3ZQXA 1IAOB 4KROB 4JY4B 4MSWB 4HUUA 4QWWD 4XVOA 1AP2A 1UFGA 3L5HA 3WE6B 3QJZA 2IIJA 2OMVB 2WLJA 2ZCKH 5HDBF 5JHLH 1CL7L 4P9HL 4U3CA 3ULAB 3L5XH 3JUYA 3MJ8A 2UWEF 4ZFGL 1DQQB 3I9IA 3R0MA 4YLQT 1L9NA 5FA4A 4ZTPL 3VB8A 2QQNL 5BRZD 1N8OE 1FCGA 4GQZA 1AXSB 4M43H 5MP6L 4ZX5A 4GW4B 3KWUA 1NCAH 4HCRA 1E5YA 1HJCA 4KZEL 4B50A 2YRBA 5FK9B 3WHE1 1JHKH 4Q2ZB 1S7SA 4NQSB 3L2MA 3QFJA 43C9B 5CIPA 1ZRUA 2ARJB 1M1XA 3JQOB 4ZD3L 3TYFB 3GSVB 4UIKL 5AQ0A 1EXUA 4MMXC 1G9NC 4XN1A 4YHYB 2RD0A 4L8CA 2DM7A 3V10A 1AKJB 3VWKB 4LLMA 1S7XB 3QJVB 3GHPA 2B3IA 1MFAH 1J0IA 1DO5A 3HBPA 5KYXA 2G5UA 2NY2D 1NINA 1R3HB 3EXLA 1DQLH 3LTVA 3FO0L 3CFNA 2WWNA 3ABMB 1QBAA 1WCBB 1UEMA 5BQ7B 3QG6B 1K5NB 1QABA 2XPYA 1QYGL 5DO2D 1UATA 1B4JL 2J1XA 1I31A 3HVNA 4UZUA 4N0CC 1YLBB 4PWGA 1RUAL 2R15A 1J0KA 2DD8L 4MJ6A 1IEBA 1SEBB 1MSPA 1T83C 3BPLB 2HLAA 4FYQA 3MRDB 4ORGA 3SJVD 4M4PA 4X5QA 1HZLA 4FN0A 2OMNA 2DMKA 4MRBA 5JW3H 4DWHA 5BXFA 5CBEB 5IFHL 1P9MC 1N8ZA 1TJGL 1MQ8A 5TH2A 1F97A 3F58L 1QFUH 4XCCH 1IAKA 5FO2A 1N5YL 4HGWB 4QRAA 1BVZA 1QFWM 2BS71 2OR8A 2JJSA 4OF6A 4TLUA 2FQDA 4Q9QH 4DVBA 4LEXH 5IW6B 3QW9A 3DSFH 2EJ1A 2E27L 3BVXA 2FJHB 3X11A 5DI8A 4XC1L 1LO4H 3FT9A 3VTMA 4UQBA 1QRND 1T21A 4FYTA 3MX0A 2HSIA 1AGDB 1XH3A 3NP3A 1XHHA 1USQA 5M95B 3EFOA 1SJVA 4K07A 3BUIA 4I2XA 3K74B 1NAMH 4J3OF 2BWDA 4HJ1A 4B9CA 4J3XA 4BDVA 3HG3A 3IFPB 2PXYA 5DC0A 4PS7A 3MSPA 3RKDC 5IGXL 3NEXA 3L3DA 4WDIA 4Y9CA 3TBCA 2R83A 4OV5A 4HWUA 4PV8B 3V6FA 3D25B 3DOSA 3SO3B 1MDTA 3T3MB 4IMLA 3BRGC 4X5LA 5DRNB 1T20A 3VQ1C 1G7LB 2RIKA 4AYFB 2W9EL 4OZIF 1E40A 1GGIH 2YD6A 3L4YA 1F1AA 1URIA 2Y07H 3BUPA 2A1WL 3NCFB 1YMHB 1N67A 2CGZA 5C0AE 4N8VA 4LCCA 1EMTH 5DWUL 1JK8B 3RY4A 1XGUA 2EDJA 4NQDE 3NTCL 4ZUSA 2NTFA 1SOKA 1ZSHA 5D7JD 2A83A 1E65A 2R56H 3RTQD 3ZDYB 1E42A 1Q9LA 4A6YH 4IEFA 5EEXA 3MCG1 3MV8B 5F96L 4EF3A 2B77A 4LPYA 1BVLA 5BOZG 4JRYE 2Z93B 4G72B 2MJWA 4PJBF 1ETB1 3ULVD 3MACL 3FQNA 1RUPL 4NNPH 4K0OA 5IQ9A 4F2ME 2V5RA 4FQ1H 1DBML 3BP4A 4P9ML 2MCPH 4U3SB 1MIMH 3CH1B 4OTXL 2FZ3B 1P5UB 3KEDA 5JQIB 1PZ5B 1E3FA 5HI3C 1LQSR 3Q1SL 1RPUA 1EFXD 1KIQB 1AZVA 5IZ7A 5SWSD 4L2LA 4XP4H 4F37F 1NMBL 4MRCA 1OW0C 4MHHG 4Z3FA 3RE0A 3DURA 4AJVA 3PDDA 5TF1L 4JY5H 4S0SD 3RY6C 1HHKA 2ZYHA 2JKIS 2R1WB 2G4EA 3HLAB 4NQUA 5BVPL 3T3MF 3TWCH 4OLZH 1OE3A 5C0DB 5BS0E 1HNYA 3MLWH 4Y5VC 3V6ZB 2APSA 4F7MB 1GSKA 3AM8C 2EC9T 4HP5A 1MG3C 1S8DB 2CKBA 1AHWC 3CN0A 2PXYC 3OPZH 3S4SA 2BCMA 1SRDA 1P69B 4M9PA 4QRPE 3SE9H 4X98B 4YDLB 4E41B 1A9VA 1MDAA 3DA0A 4X9YA 4PRNA 5MEOA 4JDVA 1S78C 2P26A 3CQQA 4Z9KB 3K2MC 1VIWA 4XI5C 2H2PC 3AROA 2MQ0A 5TJWK 4G1EA 4K94L 1M71B 1YY9C 4JUSA 2WXKA 5E94A 3B8YA 2XT1B 4OD3H 3GSRA 5T1MB 1EIBA 3WY1A 3SBRA 2P7TA 3FPYA 1OCZB 1N3NA 4FI7A 3B3IB 3ZE2B 4PVBA 1ZGLM 3ZDYF 4M7LH 1A7PH 1HQ4B 1ZLEA 1QRNE 3CZNA 3HRPA 1S3KL 5C07B 4WEEA 1QLFB 3VTTA 4EAEA 1T7XA 4W9ZA 3DGDA 3BP7B 4IU2B 2X0VA 4FNLH 4R4FL 1PQZB 3AB0B 5LBVA 4JFEB 1E2VA 5TD4A 4AZ8B 4GG8A 2F58L 3RVUD 5C0GB 1MY5A 3AADB 5HGDB 1UOVA 1OGAB 2CLRB 5EPMA 5SWQA 3T4AB 3V52H 3BFOA 5D7IE 3HPJB 4B60A 5BRZB 3UBGA 4NFCA 2YHGA 4JE4B 4W9IC 4OT1H 4ZW6A 4G9FD 3MRIB 2Z8VC 4J6IA 3WENA 4HG4K 2GCYA 2R0KL 5DWPA 4BXSV 4NXSA 4WU7B 3P77B 3CZJA 4JFSA 1EZVX 1M71A 3B7YA 4A7QA 1U8HA 2YAOA 1RZFH 3ZIMA 4QHKI 3BH8B 3WEMA 2YUZA 4NKIL 2VRKA 4IM8A 1HNGA 1PX8A 2BSTB 4OCLC 4HZLA 1OALA 3IN2A 4FG0A 3ZXAC 2FJUB 4NKOA 1J1PH 2FJFA 4MCZB 2AAAA 4PWEA 3VMOA 3ZSSA 2UVFA 1MCOL 1DUYA 1E8XA 3F6JA 4GQ9L 2CJ3A 1T66C 3FU6A 4TTDC 1T1XA 1XF4B 4DK3A 2AKRA 4OD1H 5K9QG 4TNVK 2FQGA 4ONGH 4XHJD 5DS8A 4J6RH 1TQSA 3RVTC 5D1QD 4ODSH 2RAMA 4PJIA 1KV3A 2UY7B 3VD2A 1O7SA 3N43F 2FX8H 3CJJA 2DLGA 5EV7A 1D2OA 2I07A 4B9PA 5F72S 3WY2A 4IKLA 1FJ1B 4NJ9H 1U92B 3N42B 2PTTA 1M6OA 1BVNT 2EYRA 2XTJD 2B39A 3A4FA 3BH9B 15C8H 3EJYC 4AYDC 2DEYX 1AI1L 2XA3A 3LEXB 2EIJB 2FCBA 2IGFH 2QR0B 2SEBB 1TZIB 4ECNA 6FABH 1KB9J 2D7PA 4G71B 3BHBA 5D4JA 1EEQA 2HPTA 1HKLH 2WYTA 2YUWA 4DGVH 5C0NC 4N2CA 2D0HA 1E5UI 2ADIB 1BQKA 1RZKH 2I7OA 1YNLH 3SB3A 4TLSA 4PJ7F 3X2QB 4RMBA 3V2AR 3TX4A 1WA1X 1XGZA 3MROB 5TDPA 2G3XA 4W9DC 3V4PA 1OQOA 2FJGB 3L48A 3WFDL 5GS1B 3KPLA 1A1OA 2CUHA 5D7JC 3DROB 3BQUD 5KBNC 3DRTA 1JTTA 5KBMA 1MHCA 1WDAA 4OQ1A 1LEIB 4TN9A 4LL4A 4ZZKA 4WI0B 3TO2B 4NT6A 5JW4N 2M83A 5JZ7C 3KYKH 3QNXA 3O8XD 2AJUL 2VDML 4KRPB 4AC2A 2QHRL 3TA3D 2J25A 5TE7H 1YEGL 3ULVC 5IV2B 4P3DA 1VACA 4UILL 2DWYA 3MUHL 4WGWB 2QHRH 5F3BA 4N68A 4N3TA 4ZYKA 2VN5A 2H1XA 3GXTA 4GUOA 4L1TA 5DS1A 4LRNH 4IMLB 4W9KC 4PG2A 1MCBA 3DOSB 1FL5B 1H8NA 2NX5A 3ESNA 3FDWA 4QXVA 2OMUB 5EU6D 5EZIL 3CVDA 3SZKC 2IAMC 4D9LL 1UEYA 4M7ZC 4OZHB 2WQUA 1WIPA 4PS3A 1IC1A 2RH0A 2XYBA 2MHAA 4ADIA 4OGZA 1HH6A 5FGRA 1U2CA 1OT4A 2VABA 4HSCX 2XI9A 4N2MA 1IGML 2BCKB 2GC4C 2H0JA 3EH2A 3MLVL 4YO0B 5JUEH 4OZGF 4OVUA 1HDMB 4XH2A 3U0WH 1HSAA 4TF4A 3LVEA 1I1RA 4EN2A 2A74C 1V7ML 2VDMB 4N1EA 3HAEA 4OBSA 1PSKH 2GCYB 3FT3A 3QH3B 1BIIB 2AABL 5HHQA 5IMLA 4JHBA 5IJVB 1FYTB 2HRGA 5IP4A 3GBLA 2E9BA 2IDQA 2CDGA 1ZTMA 3UC2A 5E2WH 1DUZA 4ETQB 4I88A 2R8SL 3JV6A 1U33A 5TH2B 2CO3A 2GHZA 2VDQB 5E8OB 5EEWA 1F13A 4XBEH 3P40A 4XX1E 3U4BL 5MI0C 3L9RA 1A66A 2ATKA 3LOWA 2BERA 5KTEH 4ZAKD 4FG4A 4OR1A 1SHWA 1KULA 2XZZA 1NH6A 1PY0A 1FFPB 1U3JA 4O02L 1EJ8A 3A22A 2VISB 5ACLA 1CBVH 3EG9A 4MVBC 3K0WA 4FQXB 4AKOA 2XXMB 5KVDH 1F18A 4G7VH 1GIGL 1Z7JA 2A74A 1YZZA 4RESB 4HCIA 1XIWC 3C09C 5IHWA 4OFYA 1NDGB 1TETL 5D7KE 2AXJA 3NCXA 1DL7H 2W88A 5HHME 5T1KB 5DEZA 4S2SA 1ZDQA 3PYCA 4P5MA 4Y1AD 3TU6A 4LSUH 4QHNB 1Z5LB 2XA8L 1E5BA 1JI2A 2JKRM 5C6TL 4OFVA 2D3NA 3DV6A 3PJSA 1F3DJ 4IOSA 4PREA 3T0XA 3T2LA 3QDAA 2YR3A 1TVDA 4O4YL 3VGHA 2HFTA 3X1EA 4NPYA