3KM2A

As-isolated tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical properties of tomato chloroplast sod
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3km2A00
1N18A 1CB4A 1IBFA 1CBJA 1XTLA 2AQSA 1MFMA 1B4TA 1SDYA 1COBA 4U4IA 2AQNA 1F1DA 3KH4A 1FUNA 4N3UA 1OAJA 3F7KA 2WYTA 1JK9A 1DSWA 3PU7A 1Z9PA 4MCMA 1F1GA 3SODB 1EQWA 1PTZA 2WWNA 1SXCA 1OALA 1U3NA 1TO5A 1SXSA 3ECWA 1IBHA 3HFFA 3KH3A 5KBMA 5KBKA 4A7SA 1OZTG 2WYZA 2K4WA 1IB5A 2Z7WA 3CQPA 2C9SA 4B3EA 3KM2A 2AEOA 3ECUA 4BD4A 2WZ6A 3GZOA 3CE1A 1OZUA 3RE0A 4A7UA 1SXAA 1E9QA 3H2PA 3KBFA 1JK9B 1Q0EA 3KM1A 2JCWA 1SXNA 1F1AA 3GZQA 3MNDA 1SOSA 2ZKYA 4BCZA 2AQRA 2WZ5A 2Z7UA 2R27A 2VR8A 2VR7A 1KMGA 1SXBA 5CU9A 2E47A 4L05A 1E9PB 4A7TA 1JCVA 2ZKWA 2AQPA 1YAIA 4A7QA 1SDAB 1QUPA 1B4LA 3QQDB 2C9VA 1E9QB 2Q2LA 4N3TA 1SRDA 2WWOA 3KBEA 1RK7A 1S4IA 1TO4A 3CQQA 2WKOF 2C9UA 3HW7A 2WKOA 2Z7ZA 1OEZW 2AQQA 1F18A 1AZVA 2Z7YA 1EJ8A 3L9YA 3GQFA 3K91A 1PZSA 1UXLA 1SPDA 1IBBA 1IBDA 2APSA 1BZOA 2GBUA 4A7GA 1L3NA 4A7GF 2VR6A 3L9EA 1XSOA 1ESOA 2E46A 3ECVA 1P1VA 2WZ0A 3S0PA 1YAZA 2SODB 2AF2A 1XTMA 2ZKXA 2NNXA 1DO5A 1N19A 2XJKA 4OJAA 3GZPA 3T5WA 2XJLA 5KBLA 2LU5A 1HL4A 2AQTA 3GTTA 3GTVA 1PU0A 2ZOWA 2JLPA 4MCNA 1UXMA 4BCYA 1E9OA 1BA9A 1SXZA 1HL5A 1YSOA 3F7LA 3LTVA 3QQDA 4FF9A 4A7VA 3MKGA 1E9OB 2GBTA 1Z9NA 2GBVA 3H2QA 2V0AA 1E9PA 4OH2A 3HOGA
chains in the Genus database with same CATH superfamily
3V6FB 1JNLL 1EAQA 3TBSB 5JQ6H 4DO4A 1D5MB 3T4AA 2Z91A 3BSZH 5FLVA 1DUZA 1SDYA 5SWSB 4GW1B 4X7CC 4ZSOA 1ZS8B 3LS5H 4FEIA 3MJ9A 2AEPL 1MZYA 1UADC 3FMGL 4FXGB 3OMZA 4PRIB 4BH7A 1C16B 4ORGB 4A6YA 5MEQB 4AXWA 3WEAA 5C9JB 1XEDA 3VXUA 2DIBA 4ZMTA 4LP8A 4HXAL 5T3XE 4R6UA 4WW1B 3NJKA 3QQ3A 3IS1X 1PZ5B 3ZIMA 4MJID 3F7PC 4OLUL 4ELKB 3MRJB 1TO5A 1QKZH 4JZOA 4Y19A 3V52L 3AADB 2R1WA 3QULB 4HSAC 1RY7B 1GGBH 5IQ7H 4HBQA 1R75A 3VI3E 1A4JA 1A14H 1WCBB 4ZTOH 5ITFA 3IWVA 2F8XC 4L9LB 2EXWD 5IQNA 2VYRE 1NCAL 4BFJA 2YBRA 4ZUTA 3ARFD 1MFEL 1RUPL 1NDGB 4Z3HA 2OBGA 1FGNH 1IC1A 3GSNB 4LRNH 5HGHA 4XGZB 1NFIA 3ARFB 1KY7A 5JIDA 2DTMH 2VERA 4Z7QB 1XSJA 1JGLL 1FH2A 4FXKB 1HEZB 2ODHA 1J7VR 6CGTA 1H9DA 3PQYE 2EEBA 4CVZA 3QXAB 3ELAT 1GY2A 1QPXA 1XH0A 4GFXA 2A74A 5D8JH 1I8IA 2BSED 4QJ5B 2FEEL 4HJ1A 4M9PA 4ORZC 4TSBL 1I1RA 3MLSL 1JUFA 4FQHA 3EBGA 4QUOA 1WFTA 3CQQA 4MNQA 4NDMA 1LNUB 2CUHA 1NL0H 2QR0A 3D2UB 4OLUH 3WKMH 4BM7A 5JXEC 3IVKB 1G6RH 3ATEA 5IEKB 1NJ9A 2AK4A 1FYTE 4MXWL 1TCMA 3UO8B 3WUZA 2EDXA 1OM3L 4QHNA 1KCLA 2WLNA 4HWBH 2FJHB 5TF1H 5I1LB 3HG3A 3QG6B 1A22B 2YPVL 2AXGA 2VERN 4LMQI 4WI6A 1TTFA 3GMLA 3IVKA 4RRPG 3VXPA 4BSVB 3MBXL 3WTXA 3JWDC 5JZ7D 2Q8AH 1YN7A 3BVTA 4HLEA 3MO1A 1BA9A 3ULUD 3QIWD 3B2PA 2G2RB 3OGCB 3CIAA 4JGMA 3RIAF 5CZVL 1WS8A 3F7LA 5JHLA 1GGCL 3M1OA 1JNHA 3QP3A 4LNRB 4XAWL 3RFRA 4V1DB 1GHFH 4D2NA 3LN5B 3UEQA 1RVFH 5I1JH 3ZKNC 5D1QC 1I75A 3VFWB 1DR9A 3BN9D 3TFBA 2EDBA 1SFDA 3ARFA 3OLEA 4Q52A 3VYOA 3S3SA 4FA8A 2FBRA 3MOAH 3L3GB 1EIBA 5F7LB 3O6FC 4IDJL 3U2SA 3BHBA 2HUHA 1I3GH 3QR0A 2W60A 5CCGE 4YLQT 2V5TA 32C2A 1E4WL 4GQ9L 4KO9A 4UAOB 3EBIA 1HQ4B 1S5HA 3FOMB 4WWID 4BGLA 3EJYD 2WSDA 1HZKA 2XN9D 4MQTB 1MNUL 2DQTL 5F9WB 2C34A 1D9KC 4KUZH 3V4UL 3UJIL 2QGCA 2OJEB 1TZOA 1H3XA 3GSRA 1MLCB 1C16A 2QQKH 3HAEH 4A6YB 4L0PB 4FXGA 2AV7B 3EBAA 2XG4B 5I15H 2Z35A 1F3DJ 4KVPA 1VFBA 4HWUA 1KPRA 5CBEB 4RAUB 2Z91B 3D07A 1G43A 3O2VH 4YGAB 2AJYH 2WLMA 4L05A 1I8AA 3HZKA 1FL6B 2CNZA 5K5YA 3PQYA 3BDXA 3PQYD 3AMKA 2ZUYA 1R9FA 5FM5M 2ZWKA 1Z7JA 4DNLA 1T66D 5JLZB 3O11B 4L5FE 1UACL 4DFHA 5CF3A 1I1AD 4GRLB 3B83A 5BS0B 1A25A 3CFDB 4JFXB 4URTB 2WYHA 1NCHA 1BZ8A 1FBIL 5IJCC 1RHHB 1N5AA 2ZP8A 3L6FA 2IMMA 5FCUH 3ZHNA 1BHGA 2V7HB 4JFQA 3ZE2F 3LRSB 4CMHC 1EFXD 2IGLA 2XTLA 2X42A 2GHWB 2YA0A 1MJJA 1RZGB 2BVQA 2XPGA 3EGXB 5HDQL 2DS4A 4N9GB 1QKZL 2XJLA 3TBCA 4B5EA 2YSTA 4ONHA 4I7ZC 5E03A 4PHZA 4G9FA 1CR9H 1VZIA 3N85H 4PAZA 4BEIA 5IF0B 3TCXA 4IGBC 3SQBA 3FQ1A 5I66A 1QNIA 4OF3A 5HDWA 4WF7A 1SHWA 1HINL 1U8OA 2DQIL 2VL5B 3H56A 3BAEH 3LKRA 1JRHI 1X9UA 2DJMA 2NY0C 2MKWA 4W93A 3BUQA 4MD4B 2BC4A 2GBTA 1FGVL 4X8JA 1FRGL 3MOBH 4AIZA 4XNYL 2DTML 3LZQA 2IOIA 1HIML 2RCSH 4NZUL 1AXTL 1I9EA 3FSAA 4JRYE 4I5BB 1EJ6A 4X99B 5DD3H 2F2HA 5IROC 4NHCH 5BUPA 4WY7H 3I6LE 3ERXA 4IRSD 1MCOL 4GLRH 4PP1D 4UTCA 3F00A 3AQYA 1MH5B 2B1OA 2UV3A 4Y5XC 3BCFA 5AW5B 1YO4A 2KZ1B 5E94A 1CXIA 3CLEL 4JG0H 5CILL 3G5XB 3BZEA 2MOVA 4JRFA 5J6HA 4XMPH 2EO9A 3O3AB 1ERNA 2QTVA 1SXSA 2PCPB 2PPEA 1C5DB 3L4TA 5A16B 1AYRA 1FZJA 5BW7A 3D0AA 1MY7A 4IOFD 2XN1A 4JQIL 5ISZA 1ITBB 1IKOP 5C0AE 3RKDC 2BVEA 5HP5A 3K5RA 2X41A 1R3IH 1UD5A 3U6RB 4A2LA 1ZVHA 4PRNB 2XI9A 1SVZA 1QRNB 3RWGA 3WDJA 4MAUH 4G6AD 3V4VA 5K1JA 3Q6GL 4AZ8B 3B9DA 4LB8A 4PJ6A 2I25N 3DJTA 2K6ZA 1AXTH 4QRRE 3FYEB 5IMKA 2O5ZL 4P2CG 5L7XL 3QHZL 4JFOB 2X10A 4PB9L 4DP7X 2BY2A 2JKIS 5F6IB 1RERA 3JTTB 4HUWA 3SZKC 4A2FA 3TIDA 4H88H 4D0DA 4BSJA 3DVFA 2ICWJ 4QT5A 3LKRB 1WHOA 4F8QA 5EUKB 1QP1A 2VL5A 4PJ9D 1G6RA 4PBWD 4B9YA 2WCSA 2DYPB 4EF3A 1K8IB 4ZS7H 3DX6A 3RVWD 5A2BA 3LZNA 1VLXA 1WUNT 1EJ8A 3IJ8A 2YKLL 4GRWB 3EJCA 4XX1G 2D03H 3HG1A 2Z93A 3MROA 5D7IB 1CTMA 4P2OA 2H45A 3RILA 4FA7B 1MJJB 3HS0B 3WJJC 5C7XL 4R97B 3S3DB 1PAMA 7FABL 1SHSA 1FNEA 1U8NB 1L6XA 3WIFA 5MEPA 3DKHA 3QA3B 4IBYA 1YEJL 3L3OB 1QD0A 2OZ4A 3SGDI 5E0FA 4JFXA 2X6UA 4YDMA 2PW1B 3TO4D 3ZSTA 1EBPA 4M1GH 2EE6A 5E8EA 5AZEL 1UYWL 1XDTT 2FATH 3D1MC 3GSVB 4JW3A 1F4WH 3P02A 4AYMC 2DY2A 5KS9F 3GMMB 5C09E 2YWZA 4PY7B 1F3JA 4NKMA 2Q9OA 1DTUA 4QCIA 2EKSB 5GGSY 1OP9A 3TPUB 4UANA 3V4VL 3IAGC 4V2BA 4AM0A 1F3DH 2X0WA 4FJ6A 5E9DE 2BVOA 2WJ7A 1KWGA 5E9AA 4HIJB 1YQVH 2IALB 3TPKA 4IMLB 4O51B 4YHMH 1QO3A 2LLGA 3EJRA 4KPHL 3HUJE 5DQ9A 5GRVK 4D9RD 2TAAA 5IVOA 2ENPA 3ILEA 5FXCH 3WIHH 5I73C 3H9SB 1DLHA 1TQSA 1YEKH 2E27H 4MDJB 4OLWL 5DS8B 3TT1H 4ERSH 4GT7A 5JIQA 2DRUA 3OGOE 1UD2A 3SSGA 1IBHA 2KMWA 2M2DA 1MXGA 1BD2D 5SWZA 1B0GA 3O45B 2PCFA 2FATL 4N2IA 4N0RA 3H9SE 4GINA 3TJEL 1RIVL 1BJ8A 2WCPA 3NSYA 4POZD 4XP9L 2R1XB 1NGWB 4CGUB 3FXIC 3G6JE 2ORBH 4FQXC 5EIIB 4MZRA 5C0ND 5FYKH 3LH2H 5FYKE 4YSDA 4DWHA 1OAXL 2A6JB 4ELMA 3JSSA 4NKDB 4OLZH 4XBMA 2WHVA 4MYWB 2A6KA 2EUXA 4G6MH 2A6IB 3SQRA 4AQAA 1M56B 1X5LA 1H8NA 3Q8EA 2JQMA 5DZAA 1KN2L 5HHXL 2FL5B 4DUVA 4WFED 1I1YB 4HWZA 1S7QB 4LNRA 4JKPL 5D1QE 4PJ7E 4Z7OE 1FGVH 1DEEA 2JF1A 3QUYA 3BWAB 5DYOB 3GLZA 4XE0A 43C9B 2VGLM 3B2DC 4L8CB 3EKCA 5DVLA 2DWDA 5F6HJ 2PTUA 5L4IA 3BP7A 1AD9A 1JJUA 2ZCZA 3ABLB 4ZTEA 2VW6A 5F97E 1PG7H 3MJ7A 5IB3A 2XKNA 1FFNB 4QTIH 2P5EB 3IMWA 4M61A 4WI2A 1QWHA 3UTPE 1SQ2N 4G8IB 4K5OA 4XP1L 4X7FC 1RV6X 3G5YA 4YHPA 5GS2H 2K3HA 4PJBB 3K6SB 1RZJC 4DN4H 3ZE2B 1XMEB 1XTMA 4OJAA 3P0GB 1QA9A 1DYZA 2DV6A 4C59B 1F8TH 4MQXC 1RJZB 3N04A 1J5OH 1GPOL 2H9GB 3WAJA 2VLKE 2FGWH 4Q2ZA 5AQ0A 2GPZA 3L1OL 4JQIH 2XQYA 3UP6A 5F3BB 4YXLL 3HE6B 4LCWE 5C0BB 2YN3A 3SE9L 2P47B 4Z7WF 4ICXA 1U95A 1KB9J 2DQGL 4JRXE 4OGAC 4UT9H 4Z3EA 4LPTA 1D5BA 2KQMA 4ZOBA 4F8TA 4ZFOL 1UOLA 3QT2A 4LHUA 4ZPVB 3D0VB 1HEZA 4BH8B 2B20A 5D4QA 2WXPA 3BUBA 4MBRA 3KH4A 5F9JA 5HGHB 1I9IH 1AKJB 1QSVA 4LVHB 1QFUL 2CKBA 3PLYA 5AYUH 1G4MA 4UDUB 1S5IH 2XCMC 4LSDA 4CL7A 1WCBA 4M3KB 1ZWIA 2VDLB 5L9DH 4MKTA 1OXYA 4NI3A 3GMNA 5I1AA 5DZLA 5J8OA 2FLRT 4Y4FB 3CDGA 5IBTL 1UFGA 3G04A 4YEFA 3MRJA 3QQ9C 3P9WB 3C5SA 1A7QL 4P3CH 4XVTL 5IUCA 5MERA 3T0DA 4S2SA 3STZA 5JPNC 4F9PA 5L2JA 2EXSA 2GEEA 5C97A 3PGDB 2OL3H 3HCVB 3HS9A 3O2DA 4FHBD 2WGNB 1IM3A 4KHXL 2AQRA 2E9GA 1KJ2H 5GS2D 3PWUA 1SYVA 5IMOB 1IM9D 1XQ4A 3D39E 4ZFQA 3FO2A 4W9CC 3BRGC 1NEZB 2XETA 4FS0A 4XMKL 3RDJA 5FCSH 3VI3F 4RZCB 1CD1B 2CRYA 1KNOB 4OLXH 4OAWA 1CDIA 5KVFE 3OAZH 2EIBA 1RU9L 3QQDB 4J6RH 2NSQA 4N3TA 4LCUB 2Y6TE 1L9TA 3Q0HA 4FXKC 3ML8A 4KHTH 2WP3O 1HYSC 1BX2B 1ZTXH 1XR9B 1N0XL 2HTKD 4XOAA 4ZMAT 4P2RE 2O61B 4TL4A 4OQTH 4FQ1H 4N8VA 4YIQB 1GIGL 1RH8A 3KAAA 1KWKA 2ZXEB 2A6DB 5IB4A 4Z7VF 5AKRA 4R4BA 3QCTH 1O9VA 5A3ID 1F6AB 3C5ZC 2C9XA 2VQ4A 3MPCA 3D06A 4NAJA 4CW1B 4FCHA 1KOAA 1MQKH 2GY7B 4PJHE 5ICUA 2ZKXA 1NGZB 3D30A 3TONA 1QVOB 3AXIA 4YHIB 5HPOA 1S9WB 5EA0L 5AVWB 4WGKA 3QB7C 3MLZH 1TYJA 4IJ3B 4X5WB 3UADA 1GA2A 2VLJE 3KVDD 4GW4B 5J13C 1EFXA 2EIDA 3LSOB 5IWLA 5BQ7A 3HNVL 2YQBA 3ZDZF 3MXVH 4XXCC 5FV2A 4AYDC 3GYRA 1LD9A 1MDTA 3BP4B 3HC3H 4BCXA 2R23A 4HJIA 5KJRL 2YD0A 5B21A 2HX7A 2Z8WC 3VFTA 5E8OA 2W0FA 4G8GD 4LKCA 1M7DA 4JN1H 2WZAA 3BE1H 4PV1C 4TVPH 3VCLB 3WFBL 1MJ8H 1S8DB 3D69A 5F93C 2OYPA 5I1CH 1VKXA 2I27N 2WB1A 4XB7A 3H1ZA 1YYML 3HG4A 3ISYA 5B3JE 3L5WA 1JZFA 4F57H 2W95A 3OR6B 5CZRA 3CFCH 3EO0B 4YBLB 4PRAA 4HCRL 4UNUA 4QHUB 4KKCD 3H6JA 4JHZA 4WW2F 4L48A 1A6VL 3TBWA 4OZIB 1FI8C 1MDAA 2D73A 3VSQA 3MLXL 4Y5VA 4Q89A 3L54A 5C0GA 3RIFF 5BVJB 2VDNL 4FTVA 3OVUB 2VAJA 4EDWL 4NQVA 5I30L 1E2ZA 4JRLA 4F7EA 1A3LH 1MF2L 2MPAH 5CD3A 1IGJB 4WFHE 2FR4B 3MXVL 2WLZA 4K7PY 4JPIA 3ELQA 2WZ6A 2ROXA 5LGJB 3R4RA 4OCNC 4IJ3C 4HJEA 4MS6A 2E5EA 4L4TE 1Z32X 4NQUA 3NIGF 4MASA 5GGQH 3VGFA 2CLVB 4UAOC 1ND0A 3FT3B 1KB3A 3KEDA 3QUHA 1FAIH 2IV8A 1FG2B 4APXA 1S9YA 5JOEA 4ZRGA 1FFQA 2FJUB 3BESR 5INDA 2Y5EA 1EO5A 1G94A 1KG0B 2MKLC 3HE6D 1OARH 2V9UA 4MCZB 4MXWH 4DQAA 5LUMA 2VR8A 2D8KA 4NPJA 1V10A 4FFYH 1KMGA 3QEGL 3VA6A 4PJFF 2UZYA 3OJVC 1MI5A 5KW9H 1Z9LA 4KKLC 4XMWA 1JPGB 4JK0D 3KWWA 3FSZA 5JOPD 3GXTA 1G5AA 1WBYB 1OAZL 1IUZA 5DC0A 2D3VA 1HE8A 2B59B 1O7SA 2J2ZA 3MN8A 4U1IB 4DP8X 4P46D 1E4XI 5IR1B 5EU6D 1YEDB 4ZFFA 4L3FA 3LKPB 3SJVB 3L7EB 3AT8A 3NRPA 4H7VA 3FONA 3F64A 5I30H 3OF6A 4I0CC 4LCVA 2OCCB 4BK4A 3CDCA 2UYLB 1EZUA 2YGPA 4WEMB 1LO0L 3DGDA 2BX5A 3F7YB 1JHTA 1WZAA 3MRKB 1CE6A 3CK0L 4B9PA 3BJ91 3MFFA 1JG9A 3V9EA 3UYPA 3GGWB 4MMZC 5GZOC 2IDSA 3ECVA 1OPGL 3PP4H 4HEPA 5E99H 5ID1B 4WFGE 1J88A 5C3LD 5L9DL 2XJKA 4X98A 2CKBL 5AKTA 1A9BA 3TWCL 3PYCA 4K94L 4D0BB 4TQEL 3W39B 2IWKA 4U3HA 5J3HD 4XP5H 2I9LB 5KVFL 2HWZL 5D96B 1QEWA 3CZGA 4IDJH 3N42F 2VLJA 3U0PA 2E9JA 3RGHA 1ZLSH 5HI3C 2IWFA 3V79C 2CKNA 4JFUA 1YJDL 5DHMC 3QZWB 1KIPB 4WWKC 2HKFH 1G1YA 3MRCA 5L7XH 3NH7L 4Z7QE 4C8XA 1GC1H 3LIZA 3IDXH 2VXUH 2O5XH 3IT8D 2ICCA 3ARUA 1TTUA 5KS9B 1HJCA 2L04A 2M1KA 2FZ3A 1FNSL 5FO9A 3WJLC 4A2GA 3WELA 1PDKB 5LVEA 3BIBX 1UCBL 4ZG1A 5LNGA 1KPUA 3JTBA 3RWEA 2LTQC 1DVXA 2LW3A 2YGNA 2X87A 4IIQB 4MMZB 2FNWA 1HWGB 5FYLD 1Z5LA 4EZKA 3WOVA 2Z7WA 2AJZB 3KPRA 4ZNEA 5GSVB 3W5NA 1WFNA 4FQLL 3WE1A 1UZ6E 5F1NB 4UF7C 2CHWA 1T20A 3FTYA 3GMRA 2WTPA 5HVWA 3W9EA 4TQ8A 1T3FA 4MDRA 1SDDB 2E7CA 2BS71 4OFPA 1IV8A 1MAKA 3PHSA 1PYWB 3O6ML 4R7NA 4H25A 3FFDB 2WYIA 3DHPA 5CU9A 1RZKH 5BO0D 1E28B 1J18A 1MPAH 2IDQA 3BE1L 2Q2LA 4HQQH 4UDTB 1CT8B 3ZN6A 3MV7D 3IDIB 4IKNA 4C56D 2HLFD 4KNSA 2YS4A 2NY7L 1INDL 5CZVH 2Z0BA 4JG1L 1DN0B 1KJMB 5I8EA 1BM7A 5MEND 1UJTA 5EO9A 2NR6C 1IBYA 5K9QI 3ULUC 3W81A 2BCKA 2EEFA 2GIXA 1GW6A 4AEHH 3FFCD 1CLZH 5AOZA 2AJSH 5I1EL 3PAUA 3S5LG 1I8UA 3LN9A 2FQDA 2C9RA 1ZOXA 2UXVA 4I48A 3ZKND 4C54A 5I19L 1FV1A 2JB6A 1NDMB 3MLYL 3ZBMA 2A2QT 3QJTB 3VH8G 5H37H 2BDNH 3HS0C 2FTAA 2OKMA 3GSNH 3BPOB 2R2HB 1S78D 3TO4B 1LP9E 4BELD 2QPEB 12E8L 2C3HA 3QWQB 1Y1DA 3LXBA 5FK9B 3MJWA 5BMFL 3QNYB 1JVOA 2WIMA 4M4PA 2F18A 1S3RA 3N06B 5EDXA 4MTMA 4H8UA 2MCAA 5J7CC 2AKRB 2DQCL 3A22A 2XFGB 1CK0H 1MZZA 1X5YA 4UM9A 5JW5A 2CK0H 1H15A 5JNYB 3WFCL 4B9JA 3MBWB 1CB4A 4P5TD 1UT1A 1G7HA 1WAAF 1DQMH 1TMCB 4ETYA 2R2EB 3E6HB 1VENA 3CFBB 3BXNA 3QFJE 4P04A 5DHDA 4DP2X 1PGRB 2HLAA 4GI9A 3J8F7 4PS8A 3NIFB 4PSRA 5DJZB 3STBA 4WJ5A 5LBSH 3EZ8A 1KSRA 3F7KA 2APVA 4P46B 1GZHC 2WM0A 5IW1B 5LG6A 2EC9T 4KZEH 3C6SB 3CUPA 3VW3L 4J3WA 2FH6A 2Y3AA 2B3RA 3MRMB 3UTPD 1EXGA 4RFEA 1N6QL 1THCA 5KVGE 3P73A 2K4WA 3UOAB 3QW9A 4X6CF 2IQAB 2Y5TB 5INCB 3SGJC 3WN5B 1UWGH 2CXGA 4X0KB 4DERA 1CLOL 1QBMH 1VGEH 1UA7A 5TQ0L 1U8KA 5BMFH 4WHCA 2WXHA 1G9HA 1TMQA 2XA3A 5IVZA 1Z66A 3BPOC 4G8GB 1Q9KB 3DOSB 2E76C 4XCCL 1AR2A 3HNVH 3T08A 3O3DB 1IKFH 2VDOL 3CVIH 2VR7A 3BKYL 1MVYA 3B9VA 1GR7A 2ID5A 1OSPH 1OP4A 3EOBA 4N6RA 1A1OA 3ILDA 5EBGA 2X88A 1YY9C 1BBJB 2J8UA 1R3KA 2JCCE 3WS6A 3JWNH 4X7DC 3FRUA 4LARL 3TCLB 2R29A 2WQAA 4NOBA 3LZLA 2CK2A 3CHOA 1MCWM 4AEIH 3K6IA 3N91A 2XWEA 3Q5YA 5A2CA 5JW4Q 2HKHL 5HHVL 1E27B 5DA0B 1ES0A 4A39A 2E9IA 4Y2DC 4LSTH 3APFA 4R4FL 5HYQB 4HS3B 1U8CB 1ONQA 3BGMB 4JDVB 4KY1L 5T1KA 5C0DA 3BO8A 1GMEA 3IRZA 4B5ZA 2AGJH 4Y88A 3NTCH 4P9MH 4X6EB 3W5MA 4GAGH 1T2JA 3NACL 2MPAL 2AP2A 1TPXB 1CICC 4YPGA 5HHQA 1P4LA 5F7DB 1NC4A 1GOFA 3KGTA 3F7VA 8FABB 4DZBB 3SDXA 3QFJB 4PEEA 2FWSA 3U6XS 1VCAA 2Y5QA 4BFFA 4KROB 3MACH 3OLGA 1BBDL 4JPWL 3BP5B 1RK0A 5TE6L 5TPWH 2DAVA 3HHSB 1TKWA 3OKDA 1FC1A 5C0CE 1Z9MA 3LTVA 4GO8A 3BUYA 3ECBB 3T8MA 5SX4I 5EU6B 1W15A 1M53A 4HJJL 2QSTA 1IAIH 1CGSH 2KC0A 1PJ9A 3JV6A 5EB9A 5DMIL 4LPWA 3VI4A 3TL5A 3VXTB 3AS1A 2QQKL 4MMXB 3KWVA 2YXWA 1JTOA 3L3JB 2VDKL 3D87B 5E8PB 1F0LA 4YXKL 4U3CA 1XL6A 1EJFA 2AJVH 3WNNA 5GS0D 5IHUH 2DIEA 2JB5L 1MREH 5MENB 2DMHA 2HFFB 5CJOL 3D05A 2H1PH 3ZQXA 3ARVA 1SEBA 3V8OA 1DZ0A 4DW2L 1S7TA 3BKJL 1J0YA 2AV1B 4J4PA 3FB8A 3NJGA 4XOCA 5KBNC 1CICD 3PNWA 4AGNA 4K15A 5IREA 1PKQE 1N59A 3PCYA 2JTYA 4IS6A 5C6TH 4X4ME 1KN4H 4ODHH 3OB0K 2NUTA 4HAFA 1CICB 4XP4H 3BPCA 3E38A 1YN6A 1OTSC 3FB5A 4IOIB 4IRZA 2XWRA 1Q94A 4LSVL 3A47A 1G6VK 4NKOB 1OAKL 4JGUA 5FPIA 2IOOA 2HCZX 3G5ZA 5D6DA 2CO6A 2NY2B 3P30L 1BZQK 3H7BA 4YHYB 1F58L 4FN0A 4NQTA 4TNFA 4LCCA 4Z78B 4IHOA 2KUTA 1KCWA 2ENJA 4N0YH 5B38A 5AZUA 2OSWA 3FCTA 4GRLD 1UACH 2BNRE 1U42A 1G7PA 2VC2H 3MA9L 3CBJB 5FYJE 1MJ8L 3LYRA 3CLFH 3R19A 4N8CL 4QTFA 2PYFB 5C0IB 1DQVA 4MAZA 1TJGL 3VWJA 1U92B 2NCMA 4KOCA 1QYGL 2JV6A 1AZVA 1QPKA 1FNGB 1CUOA 2DB8A 5EHFA 3ALPA 3IGAA 4MA1B 3ATDA 3CX2A 3KS0J 3ROLB 1OK0A 3VQLA 4YDIL 4Q9CA 1MWAH 5TK4A 1QR1A 1KTDB 3HTLX 1B2YA 1CD8A 2F7RA 3L17A 1AFVH 3L3HB 1QFPA 2PO6B 2VLKA 4LSVH 4XCYB 2ZCHL 3AU0A 2WVVA 1SLVA 5I16A 3C5ZB 4LPUA 4RDQF 5FDWA 3TT1L 3PXLA 1J11A 5EO0A 1S5IL 1EJOH 2BZDA 2ZUUA 4LZKA 4R7DA 4O58H 4I2XB 4JY4B 5C6WH 4RZKA 4MRBA 5F1KC 4N8CH 3KL0A 4GPVA 1RK0B 2ZICA 1OARL 3FNKA 1RZFH 3QJQB 3QUMH 3P0YH 4KTDL 3FSWA 3AM8C 4OGAD 4YZFE 1KCUH 5JDSA 2IEPA 4KNUA 4AVHA 3KJ6H 1GAFH 1NC4B 4NSKA 1OD7A 4F2FA 2YLHA 4I3SL 2OL3L 4PRPD 1DVQA 1F4XL 1QLFA 1TZHB 3BVWA 5F7KC 3LNIA 3RI5F 5H8DA 2ZONA 4I8DA 1JL8A 2L7UA 3QUMA 3MRBA 5LXGL 1DBMH 1P5VA 2G75B 3WFDL 1M57B 5SWQA 4O2EA 1DEDA 2Z31A 5CEXA 1E3FA 1XL4A 1XIWD 4XBGB 4U1GC 3UG4A 1DBAL 5E5MB 5FIEA 1TVHA 2DLGA 2ADGA 1MCKA 3UYRH 3QI9C 5J89A 4LU5L 1BEXA 1BBJA 4I4WA 4GG6A 5H35B 1Q9WB 3BVDB 3CDFA 4GB9A 3IGUA 3MDJA 3CFNA 3U9PL 3BD3A 4LOEA 3A6CH 2EXTA 3WU1A 2O5YH 4XP6L 2WGXA 4PCKA 4WGVB 2WUCL 1AGFB 1ZGLP 3T2OA 2HFGH 1FJ1B 3RYMA 5C0EB 4MS8D 4AK2A 3PV7A 1MSPA 4YGVB 1Q9KA 5J56B 4MQ7B 1UJ3B 2OTWB 3BWUC 3SCMB 4GBXD 3K72A 1XV8A 4JFFB 2Y24A 4NZTH 2FEDC 5I8KL 4RFNB 3ULVH 1ZVSA 1WPCA 2GTZA 4IHBA 4OFIA 3ZKXB 4WFHD 4K9JA 1KXQA 3X13A 1HOCA 4E42A 1HZHL 2Z4QB 4QRSB 4KUCF 3FU7B 3SYQA 3KE0A 4L1HA 3Q05A 1IBBA 1W72L 2P5WB 4IBZA 3BKCL 2N1TE 5DZ9A 5DMKB 4XWGL 5E8NA 1JZ6A 3S35H 3BGFB 5I0VA 2IAND 2HLAB 2V2WB 4U1GB 5D1QD 1HS6A 1XGUB 4K3JL 4TOYH 3CSGA 5EBLB 5GGUA 1XBDA 1OB1A 4KBPA 2FHCA 5KN5B 4N85A 1LQBC 4ZXBD 4RBPH 4X5XB 3K7UA 1FZKA 2IOMA 3LD8B 5F7MC 3RVVD 5JOFB 1O9ZA 3WD5L 3ARBB 1FZOB 4CRPA 1TZIB 4RRPA 5AZ2L 1R0AL 3O4LA 2CR3A 3SDDD 3H9SD 1CLYL 3AROA 1TJMA 4PJCA 3AT0A 3UTTA 1R5VB 4YNYB 5D7KD 5FW7A 2P49B 5CLWA 4N2FA 5HYJA 2F19L 2OMUA 2YA1A 1OAXH 2IIJA 5A43C 1CQKA 5IHBA 1HFUA 5K39A 2G5BB 4HPHA 4P0DA 3FOLB 4EMZA 5BOJA 4AEHL 4HCGA 4FULA 3LKNB 3DTUB 5HHOA 4AGQA 3ETTA 2DM7A 4PJHB 5DZPA 3PGCA 4ZD3H 2YGOA 4L3AA 3K80A 4V1DD 3R4DA 1AHWA 2AGJL 2YOCA 4J8RB 3S6CA 1AXSB 3PFUA 2WBJD 5GSRB 4A37A 3VG9B 4BZ1L 3HI6H 4Z9KB 5ENWB 3NZSA 3D51A 4ZJ9A 1QHPA 4OCRH 1I3RB 1TCRA 4UMSA 3FH5A 1Q0EA 4MQ7A 5E23A 3N50A 1I7ZB 4U1KB 5DFTA 2F9BT 4OUUA 3W11D 2JJSA 1BVLB 4C4KO 2MJWA 1CLYH 4RGND 4NO2B 1FNHA 2UY6A 4L3ED 5FX3A 3CN0A 4NFCA 4Q7DA 3SKOB 5B1CA 5F7EL 3WE6A 1D5RA 2DQHH 2G5UA 1KCVL 4XCEB 4G80A 4O9HH 1FNAA 4M5YH 4A2DA 1WFUA 3MVSA 4WDIA 2VN3A 3ZHFA 1G87A 2C9VA 4XP1H 5JIHA 5F0MB 5C7ZA 3D9AL 5LNEA 2UXFA 2YUXA 4XVUD 3DSNB 4Y5YC 3U1SH 3KPRB 1MRDH 4LBAA 4W9LC 1LO3L 2ZYRA 3VDCA 1NAMB 4Y2NA 4QO1A 5AAMA 4TS6A 3BCDA 4PREB 2VDLH 2X4TB 4IIQA 3DJZA 4E9TA 1H6EA 2BK8A 1A9VA 2WQUA 4HAGA 2J1WA 5CINH 4YUEL 2OJ1A 3TEZA 3CJJA 4OT1L 4X8XA 4QI3A 3DMMB 2AF2A 4GUOA 3LN4A 1DBML 1Q0YL 3CMOH 4FQ2H 4KXBA 4PG2A 4UQEA 5DJ6B 2EDWA 2DDQH 5L0QB 5C0FB 5DWUH 3VXQB 3T5WA 4OCSL 1A1MB 3MNVA 4RFOH 5F88A 1MHCB 2WQ8A 1A3ZA 2XVKA 4FFTA 2G0KA 1CIUA 5D71L 3FQTB 5B4MD 3GTTA 5IHZA 3W1ZA 3RL2A 1XH1A 2R39A 4IRSC 1QQDB 3DUUB 2DWXA 2GJRA 3V0VB 4NIYE 3ESVF 3VJ6A 4XPGH 3O4OC 4ZI8A 5F9AC 4MYPA 2ITDB 2K70A 3MYJA 1U8IA 4QIRA 2JI1A 3HMXL 3FN0L 5DR5L 1PLGH 2E6QA 3TP4A 3A6CL 2X44D 1LO2L 3N43F 4LO9A 1NKRA 1OAUH 2ZUTA 4UTAA 1KLGB 4ODUB 3NZ8A 4LCWB 4PLKD 1SMDA 3UZQB 3DX7B 4L37B 1F1DA 1W80A 2DZEA 1BVLA 4PJCE 4LLVB 4NGHL 1SZNA 1C5BH 3OKKA 4U2YA 3TZVA 3ZVVA 4FYSA 1RZ7L 4JFPB 2EXYC 3L3HA 4JB9H 4I85A 4KJYA 2R0LL 5DMGC 3MFFB 3OZLA 1JHLL 4GSDL 4LSTL 1JFQH 3VFSA 3LZOA 1J1XH 4PJBE 5JZ7C 5DD0H 4PJFA 5C8JA 1QTSA 3BLKA 3VNZA 2HB0A 1RUAH 1GSKA 5AAWA 1U41A 2P5EE 3EG9B 5A2KH 5HVHB 5D72H 4Q0XH 3LKNA 4ZXBC 4ADJA 2HLEB 1ECYA 3CE1A 1IO4C 3ZHLA 4JAMB 4MDIA 1CWVA 5MP6L 2IXQA 1GIGH 1JXDA 5D8JL 3QUXC 5H37A 1WWCA 5EBMA 4EI5A 1JPSL 1B9ZA 3BP6A 4YDVA 3DTXA 3J07A 3VAEA 2FWUA 2IFFL 4WWKA 4PJ7B 5K1VA 1JXGA 1WWWX 5GHWL 2ZWYA 1HDMA 5I1EH 3NFPA 2Z7UA 3H7BB 2MCG1 3TWCH 1BLNB 4TUOB 1SXBA 5I19H 2DL2A 1S9YB 3F5WB 2FJFB 4R7XA 3AXLA 1AG0A 2EABA 1R47A 4CNIB 1CFVL 4ANKA 4M93B 1FFOA 1N6VA 3T1FA 4OZFG 1GCFA 3WNKA 3NJFA 4Z3GA 1SOXA 4PJXF 4X5XA 1KBBA 5E70A 3G6JB 1WTGT 4IS6B 2B0SH 3MCLH 12E8H 5HXMA 4Y16A 2YXFA 1TQBB 5HI3D 4QR7A 5LG1A 4LLAA 1T1YA 1B2WL 3P4OB 4A7GF 1SF3A 4MJJA 3E7JA 4HZAA 3S0PA 4D9RE 4ZOCA 2LVCA 2PCYA 1LMKA 2RALA 2P5WA 4J4PC 2DQJH 2F68X 1LP9A 5F9DC 3VGHA 3HR5B 2RQ8A 1IGIL 2FEEI 3DDFA 1Q1JH 5GJTH 4L8DB 3MLRH 4X9BA 3JTSA 3VCLA 4PJGE 4JFVA 1FIGH 2Y7OA 1M7DB 5FC9A 4EDWH 1T0MB 1YSOA 1M2VA 4OF5A 1GS6X 4HKZA 1T83C 3HHSA 2OTWA 4IEFB 3C6LD 1J8HE 2GJ6B 4FADA 3CH1B 4RWHA 1JPFB 1IIIA 4DZBA 4JREC 1BMGA 2ZYSA 4JM2D 3AREC 4OGYL 1AIFA 1IQDB 5EEWA 1JV5B 2HT3C 5DJAB 1AO7B 4DPRA 4U49A 2H26B 1X5IA 3V4UH 1RP9A 1NGZA 3AWFA 1T6VN 2KH2B 1JK9A 1D5XB 4W4NA 3WMPA 2FBOJ 1I9JH 2HJKB 4NN5B 4NFBA 3DV4A 4MMXC 4J3OD 4QLWA 1OHZA 4Y5VC 4MZIA 1QW8A 4NJAL 3GB7A 5IQ7L 4YDIH 1OZTG 1IL1B 2EH7H 1TETL 2NDFA 5D1ZA 4Q9QH 4JGJA 4PJ8A 4Y89A 2QQLH 1Q4NX 5D1ZD 5C07E 4BD4A 2CM5A 4GBXB 4JFFD 4KQ0A 1AMXA 4S1SL 2C9QA 2K4AA 5DHYB 2A9NH 4OB5L 4OAWB 3VA2C 1Q1PA 4LHUG 3BFQG 1R24A 3SDCD 3PDGA 3EOBB 3TJHC 2NY5C 3QPXH 1PMYA 4DKEL 4IBWA 4ODTL 5IMOA 3S98A 2VW7A 1GSMA 5FO8A 3ZYIA 1G1KA 1QSEE 1KB5B 3CH1A 3N42B 5I75C 1KGCD 1OTTD 4N8PA 3RWDB 1INQB 2LFEA 4AL8C 1M2VB 4JFEB 4U1HA 4Y0GA 4EN3B 2NY1D 2NLJB 4N9OB 4D9LH 1YEIL 3QAQA 4NHUA 4CN4A 3GZKA 1MJUL 1IC4H 4E0RA 1PKQB 5KTEL 2BIHA 4L9DA 1PZSA 3A24A 4HLZH 3C9NA 2PW2A 3IE4A 3HKFA 1BPLB 4YMPA 3NJHA 1K5WA 1UWXK 4WWPA 1AR1D 2CKBB 2JFCA 5IESL 1NCUA 5JIKA 2X1QA 1HWHB 2EXWC 3EYUH 1T1XA 3WY1A 4GBXC 4IKKA 3J2PA 2B77A 2BIOA 3D4YA 3QIBB 3QJVB 3QPXL 1RUMH 5ICXB 2Q6WA 4BK5C 1V3LA 5D72L 2EDYA 4Y16B 3ZY7A 3DO7B 1D5BB 2WQVA 1X9QA 1OGPA 1A3LL 1O7DE 3HNTH 3QYCA 2XTSA 3E8VA 2XWCA 3EYOB 4QKTA 1U95B 5IFJB 1MFCL 1NFDE 1KY6A 3TBBA 3CLWA 1G7PB 1NSNL 3FCSA 5GS3A 4H40A 1SM3H 3DI2B 4M8VA 5CR1A 1W0VB 4UAHA 4E9QA 3GSQA 4Z7IA 1L9SA 4XCCH 3SDDA 3X12A 4KITB 2B8OT 3HI1A 1ZA3B 1JF1A 5GS0H 5AVYB 1U0QA 4QNPE 3M8OL 3DMMD 4NRXA 1J5DA 2RFXB 3TNNB 1BF2A 5L2KB 4JUSA 2IXQB 1P4IH 3IJ7A 2P8PB 4OKVA 3PV6B 3CVHB 4WKXA 1EK3A 1QI3A 4KK6C 2XKNB 2J1XA 3ASNB 3MJ7B 5GGVY 4ZFZA 1EGJL 2EP6A 5AVTB 5I8CB 2EDNA 2Y2TA 3BD5A 4I3RL 4N25A 5HJGA 1KTLB 3RIFK 4U1LA 2F0CA 1OP3H 1A9EA 2WWMC 2YA2A 3BWAA 3IF1A 1QW9A 4KKLD 4ONGL 5DYOA 2QV2A 1NLBL 3LQAH 3GZQA 2GJZA 4BSWA 2Y7QA 4LLVA 2IPTH 5C08B 2CBPA 4MB5A 4PWIA 1ZANH 3JZ7A 4R7NB 5GGSA 2VDOB 4LDLB 1LK2B 3WKPA 5D2NE 4F5CA 4G3YL 3DVNB 3LPFA 3B3IB 1EZVX 3AXHA 3BISA 4M29A 4XZ4A 3HNSH 1YYLL 1OM3H 3GNML 4XNUL 3PWVA 1MQKL 1QSEA 2BMKA 4PBDA 4HZLB 5ISZD 1TKWB 3JYBA 2LABA 1QG3A 4IBTA 2HRGA 1P4UA 1OGAD 1KGCE 3QSKB 4ZAKA 3VRJB 2W0KA 3MJGX 3RA7H 4R5TA 1MFAL 1OK8A 2UWEF 4XPBH 3KWXA 3SDXB 3MLYH 4LSPH 5FO7A 3VE0A 4CMHB 2FWLB 4NRZA 2IO5A 3HN5A 3T65B 1CF8L 1WV7T 1G7JA 3QJOA 4LL9A 2NY1C 3KLKA 4E36A 5CIPA 1U3JA 5EEYA 1FVCB 4PLJC 3WTVA 4GXVH 4ZFOB 4RCAA 3V4LA 5ABZA 2DW5A 4XX1E 1CU4H 3O2DH 1BIIB 1U8CA 2VDML 5KS9A 1UCBH 3GPEA 4HIJA 1IVTA 2TSAA 4XN8A 2RR3A 4R0LC 1YY8B 1V3MA 3NIFE 1EHNA 2YEQA 4M56A 2A7BA 2IG2H 3WN6A 2GC7C 5AW8B 1SJHA 3T0EB 3BGFC 3T0WA 4LCYB 2EO1A 4QCIB 2YFNA 4M5TA 3LKOB 3VRIA 3GMOB 2W91A 1SXZA 2D0HA 3RWCA 3P77A 1MW2A 5FLUA 2BSRB 1BXXA 1KYUA 4RVBA 4XNYH 1SBSL 2E27L 3FTXA 4WFGD 4JZJB 3KJ4C 2ED6A 3K2UH 3NJNA 5D7KE 5KEZA 5HI4C 1DANT 2VXSL 3ZMNA 4MWFA 4XNDA 5A1AA 3VD2A 3FPXA 5EMYA 3KLAA 3WNJA 3MUZ1 5KANI 5ADPH 4J3BA 4NHCL 2DQTH 5IOKA 5I2IB 3E3QC 4U05A 4H20H 1HT6A 3L3OA 2N1KA 4HUXA 3N0AA 4KVCL 2FX9H 3CVHH 2WXKA 4MZ2A 5BW7C 2XXGA 3VU2A 5HYEA 4MNHB 5FOBA 3DBXA 1WICA 4TL5A 7PAZA 4XO9A 3WEBA 5TFSH 4MJ5A 4UT9A 2DOCA 1IGML 5ENWA 1CVSC 4ZTPH 2X9WA 4JKWA 5INCA 4U0QB 3KPMA 3OZKA 4TVPE 1J5HA 3ZZSA 3SE8H 1UB6B 1TJGH 2NOYA 1ACXA 3MRMA 5DRNB 1QLEH 1YEDA 3VH8B 3KGRA 4ZFFB 4GRMA 1NCOA 4KKAD 1UXSB 5I5JA 4IGBD 2ZX5A 5HHVH 1PG7W 2IPKA 5KSBA 2UXGA 1SF5A 4YDKL 5H4ZA 4HG4J 1SBSH 2XC8A 1JWMA 1XX9C 3PJLA 3NCXA 4IRJD 4LARH 5D71H 1ZT4B 4Z3JA 3QHZH 3VD1A 2OMNA 1KCSH 3W57A 1VEPA 1DDHA 4OVUA 4Z3TA 3RDTD 5ADOH 4OJCA 4QTIL 4JZJC 3HB3D 1CDBA 4K3DL 1JWMB 1MAML 5D93C 2H2SD 2IDUA 2CLVA 2R1YA 2JMRA 2JQAA 3RIKA 1H8OA 2W65B 2VN4A 5CP7B 2WLKA 1VFAA 4H0LC 3ZMRA 2ZJSL 3RX8A 1UB5A 1KXQE 2LR4A 1MCDA 2HRPH 4H0GA 1ZLUH 4R97C 2XV0A 1P53A 2QKSA 5KN5A 1DBBH 2GI0A 5B1BB 4HXBH 1E30A 2EZ0D 2JKNA 3F2LA 3QO1A 3SKJH 2FSEB 1BZEA 3UTZB 4P2OC 1TZGH 2JE8A 1UM5H 3Q5TA 1KJ3H 4F2EA 1W72A 5FHBH 3RY4A 3TBWB 3CXHK 2AJ3A 3IAPA 2C1PA 1DQDL 3M17B 2ZWZA 5DMKA 2EVFA 5BO1H 4UT6H 4OY9A 1OT2A 4JHVA 5LAPA 4X99A 1ZLWH 5L4MA 4PIBA 2DQMA 3ARSA 1B3IA 3WG7B 4DTGH 1DQJB 2P5WD 4ABVA 4L8SA 5KSAB 1I8KA 5DRZB 5I8EB 1U8JB 2KI6A 4JZJA 4BFKA 3F7RA 4Z18A 1U8PB 3HRPA 3O4LE 3AGVA 5E6IB 2X6MA 1KELL 1E28A 1N8OE 4R2GD 4Y1AE 4F27A 3GMOA 4TUKL 4EN3D 5CJ5A 3QDHA 5TE7L 3F04A 15C8H 2EEDA 3IJHB 4KJQC 3KPNA 4PRPE 3O4OB 4WK0B 2JKXA 4XO5A 5D2LB 1U3HB 1NUFA 1WZ1L 4FHJA 2B15A 4N2KA 5ALBL 3UTOA 1BZ7A 2DLFH 1QVOA 4ZFOA 2DQEH 1FVCA 2DI7A 4PJAB 1HHGB 1ZIAA 3E1F1 4FL4C 3P2BA 3FUDA 3AVEA 4JO3H 5D2LF 5DO2D 7TAAA 3FSOA 4XBGA 3T65A 3RZCB 5BS0A 2ZPKH 4LSPL 4PVBA 4GRLA 1M7XA 2XA8H 3IU4L 1YG9A 3CFQA 2QFRA 3K3QA 2A6DA 2MOGA 3PUUA 2YAHA 4AEIL 3BIAX 4DTGL 1J0HA 3VRJA 3H55A 4JFED 1Z6JT 4FABH 1B4RA 2ZOLA 2AVGA 4FQCL 4XCFH 4X9IA 2BMKB 2Y2YA 4TLTA 3EFOA 1UOVA 3O2DL 4HULB 4PWGA 3X1BA 1BF5A 5HI4D 4CA4A 25C8H 2QLVB 4IJTA 3VWJC 5JHMA 3VG0H 2LU3A 5KVDE 3POHA 1MW3A 2QFPA 5D1XC 5CGYC 4YVNA 5IROD 1KULA 4F7PB 2ZKWA 4JG5A 2VDRL 4WW2A 5TDPB 4EAEA 1T2QH 3S7GA 2NY6B 1E9QB 4LCCC 4N2CA 3UO1H 2UUDH 2I5YL 5B22A 2XWTA 3UERA 2IH3B 5JXED 3LPOA 3ZT5A 4PRBB 2V6HA 1QMUA 3KPSE 2O93L 4LSQL 3G04B 3GHPA 4NM4H 5AFAA 2DKMA 3LCYA 4AG4L 1DHKA 2W60B 5BXFB 4LHJB 2YD2A 3DVGB 5DJ8A 5D9SB 5L2KA 1GY1A 4NRXB 1L9OA 3FL7A 3VFUA 2CA4A 1CURA 3L95A 3TA3B 5ID1A 3HE6C 2OZ4L 5F9JB 1ZA3A 1KTDA 4B6ZA 1NEUA 2ICES 1DZBA 1AZRA 3IGAB 3ROLA 2WIIB 3KYNB 3DX4A 3D4GA 4J23A 5T3ZD 1WFMA 1Z3RA 3VXSE 3VM7A 4N5UA 2XQBH 3X3GH 5AB9A 2DYPD 2JLPA 3UIYA 3LQAL 1BSIA 3HHRB 3LKPA 2Q76A 4NM8H 4UYQA 4KPHH 1LGVA 2E8YA 2CM6A 2OSLB 1JD7A 2GT9A 3REWB 5IFJA 3ZU8A 1F4XH 3Q6FB 1KYAA 3F7QA 3L4XA 2OR8A 3QAZC 4PJ9C 5T1DL 3KWWB 4HIXH 4GUPA 1AE6H 2Q7YB 1H0DB 1DQLH 4J3OG 4XRCB 2X28A 3FDWA 2AEPH 2PLTA 3BQVA 4YSEA 4RISH 1UUSA 4LU5H 4I89A 1C1EL 2FQGA 3WLWC 3WS3B 4O2CA 2VM3A 1PZCA 2JCCF 1UKTA 2FYVA 2OXGB 3UTSE 5JQ6L 3QXDB 2G9HA 3ZSSA 3D50A 4GXUM 1XD0A 5JPMC 4M7KH 1CDHA 3NCWA 4G9DB 5DC4B 2WO2B 5AW3B 3UCQA 1EQWA 5JPNB 4KUZL 1FFNA 4M02A 2O6FA 1ITCA 2Q87A 5KBMA 5LAXA 1TTBA 4KI5F 3VFGL 2DWYA 4AGPA 3MBED 2C9SA 3N55A 1NTDA 3AB0B 1UHVA 4GY4A 3K81A 2AV1A 3MLTB 3OBAA 4HEME 2UZIH 4U1HB 1S7TB 5I76B 2Y36L 1SEBB 5AW0B 1OAZH 1D5ZA 1E9QA 3DPBA 3EH1A 3MOQA 4PGBB 3UTSB 3O3EA 1I1YA 4CKQA 5HBBA 1KB5L 1VJSA 4L3CB 1LK3H 2PWFA 5ESAB 1NFDF 4NXSA 2BCMA 1AGDB 2X4SB 4KO5A 1JWSA 2GVYA 4HSCX 3ULVL 2PXYD 4LOFA 4N28A 3WS6C 1LO0H 4M8QB 1DBKL 5HJDA 1B0RA 2G9KA 3HBPA 1VKXB 4NQDE 1W6WA 3B9KD 3OQRA 1NSNH 1JXJA 2VT0A 3LNEA 6FABH 3NK4A 1DJGA 1ASQA 2LGNA 1AY1H 4JHWL 4S10A 2WLLB 4D3CL 3HE7D 3RPBA 4Z7NF 3EO1B 2FGWL 3ZGHA 4OM0H 1WEJL 1Q90A 1YA5A 3VACA 1VFUA 2OYLA 2ZUQB 4WWOA 5I6XC 1TLKA 2VSCA 1BOYA 3QQ3B 1CF1A 3T6VA 3MV7E 4U1JA 5EV7A 4A7GA 2WMPA 4MDJA 1BAGA 3EZJB 3H9SA 1U8HB 3ZMEA 5K9OB 1UWEL 3JWNE 4AXWB 3UC0H 3DHMA 4KMQA 2IJ0C 4PJEB 3WHE0 5FUOL 4HK3J 5KVMC 2IALA 3I9IA 1JV5A 3IU4H 3CAFA 1RZ7H 4PUBH 3IDXL 4NO5B 2LU7A 4YLBA 2JNZA 2WKLA 1UATA 1SJVA 1GZHA 3QUKB 4YIQA 1G0DA 1MFNA 4AYEC 4YDKH 2FD6L 2XXFA 3QWRD 3DI3B 3BI9X 1JZIA 1T4KB 3WIAA 4QRPE 2PR4L 4W4OC 3QIUB 3PL6D 3QIBC 1T0MA 4M7JH 3V9FA 3K5SA 5ADOL 2CO3A 4OSUH 1CE1L 1B3JA 1PPIA 3VG0L 1YPZB 1J0KA 2CHDA 4KC3B 4O5LL 1CBJA 2X4RB 1HCVA 3TV8A 4Y7MA 1CDYA 2BXYA 4XC3L 2YOAA 3AAZA 3II1A 1Z9SA 2X4SA 3RFZA 1AGDA 2I85A 2PYEE 3PWNB 1JNLH 1OTSD 4IRJB 1KN4L 2ZOOA 4G8GA 3O3EB 3DPBB 1W72B 5KZCB 5DHEA 2QL1A 5F70A 5L2JB 2HT2C 5FUOH 1JAEA 3ZE2E 4FOMA 3NPSC 4PGEA 1R3IL 5M94B 2CPCA 2H3XC 3ULUH 3QO1B 2J57A 1A6AA 4PB0L 4WI0B 5JHLH 3TBVB 4QXUL 4RFEB 3TYGL 3L08A 3TF7C 1FG9C 5ESQB 1DE4B 1MCNA 2X9ZA 5I1HL 1UB5B 4FZ8L 1RU9H 1ZWIB 3CN3A 1YDPB 1FFOB 1HNGA 2KL6A 5JHDD 1P9MC 4GG8B 1VPOH 2D9QB 4GMTL 1AKJA 4KXZI 3F5WA 3LJ3A 2C9PA 4RLDA 2X4OA 2F54E 4HJTA 4G1MA 4W9HC 2EICA 3L9BA 4ZPVA 4P5TB 1XF4A 2BSBA 1KELH 4TQIA 5DURB 5G5DB 1H15B 5JNYA 1FQ9C 4GUPB 4E5XG 4NQEA 4W9JC 1DQQA 4BE6A 4AVJA 3RDTA 3G7TA 3K2UL 3WTWA 4APQB 3U36B 1NGYA 3E9UA 4GRMB 2GAZA 1JP5A 5E1IA 5ISZB 3HE6A 3NEEA 2R2HA 3ARBD 3POCA 4M1CC 4ONFL 5DD6A 2BOLA 4BXSV 4DOHB 3MRGA 3ULUL 3MR9B 2P5PA 3MRFA 4FG4A 5J4MA 5M7QA 1K72A 3KYNA 4WHTA 1CGTA 1O6SA 2RTTA 3HB3C 4X7SL 4GQPH 4UNIA 3S5YA 4BE5A 2EE2A 4BFOA 2AQ3A 2FQEA 5D96C 2LQRA 4ZTPL 2NNXA 4YR6B 4KZDL 3LIUA 3X3FL 3JUYA 3FHEA 3DVGA 3SE8L 2XWZA 3HI5L 1HESA 2CDGB 2NY1B 3SQOH 5BXFA 2FO8A 5ELIA 2R29H 5T3ZE 2EYTB 3GTVA 3PRZA 1XGRA 2AXFA 5DD5L 1BQRA 1L7TL 1T5WA 2W92A 2J44A 5E9DB 1F90H 4ZFGH 5KVDH 1CT8A 4NZUH 3T3MB 1RUQL 3U4BH 4J2XA 1LK3L 3MLXH 2QQLL 2EEAA 4G71B 1BW8A 4HF5L 2VN5A 1A47A 1KFGA 4PV8A 5DD3L 5DJDA 2JTDA 3Q13A 3R1GL 3IDGB 2ENYA 5MP6H 4E9YA 3IYLW 5CFAA 5IF0A 4HT1L 4A2MA 1KEML 1JHLH 4X4YB 2EE9A 1KDIA 3CDYA 3PXHA 3H9YA 1Z0MA 1A3RH 2CJUH 2F15A 2K9FB 4QEGA 4RGNB 1KBKA 2XTJB 3V7MA 1CBVL 3V0DA 4FG6D 3LN4B 2I7SA 3EGSA 3DJRA 3GS0A 4GRLC 4F58H 4QXGL 1NGWA 4W9EC 2LT9A 5EG6C 3O6LH 2VQ1A 1USZA 3L4VA 3NSFA 5BV7H 3T77B 3SQOL 1NAML 4UM9D 1DFXA 1CN4A 5FO7B 2R2CA 4JG0L 5GRVL 4O02A 3UZEC 2OK0L 3EAKA 3ZYJA 3ECUA 3K4DA 3V6ZA 5LBSA 5GZOA 5IT2H 3H85A 4ZMPA 3ZR6A 4ZMYA 4HW6A 5D6CB 3RA7L 4HEPG 5CGTA 2FSDA 5KUMA 2F8VA 3S3JA 3F58L 4Z7VB 5EC1B 3EGSB 2A4CA 2V3EA 2H0JA 4KVNH 4OTXL 2XVLA 3B2UC 5FO9B 1BZ7B 3T2NL 1KGUA 3MMEA 1JPEA 4ODWB 1RPKA 2FGZA 1FFRA 2VDKB 3WNLA 5T5NG 4PGJA 1N8ZA 1PZ3A 4FD0A 1HCZA 1AGBB 3D4CA 6FABL 1LE5B 3QZLA 3KHQA 4AM0B 1VFBB 1G7MA 2ICWI 1MVUA 2QVKA 1D7DA 3S37L 4I0PD 4P5MB 2CDEA 4F15B 1SDAB 4H26B 1ADQL 3GSRB 1A5FL 1P6WA 3UGUA 2OJEA 3AS0A 4KXCA 4FNRA 4S0SD 4NCC2 3BSGA 2X4UB 1XIWB 3I75A 4B41A 2ED9A 1CYXA 5E6SB 3NPZB 1G1OA 4Q4EA 4PG2C 1FIGL 5DRZA 2HTLD 5IBUB 4MB1A 4YBQD 2J4WH 3PGCB 1JCKA 5HHNA 1HKLL 1P0SE 2GTWB 4MZ3A 2CUAA 1PD6A 5T3XH 3U83A 1QI5A 3PV6A 4NAQA 1DJSA 1C08A 2P24B 3JWOH 1TEYA 3MI6A 4X5PA 4ZO9A 2ZYHA 4XNBA 2IGTA 2OLDA 3RTQB 3EYSH 4MHHG 5CO1A 2OMUB 1UA6L 1O6SB 3SDXE 3V0EA 1UEMA 1RIUL 2YWYA 2Z93B 5D7IA 4AMKL 2UZIL 2FX9L 4GSDH 3VFWA 5JIPA 1RSFA 1P4IL 2AANA 5FKPB 2MRYA 3N5AA 3L7EA 3EXJA 3OAZK 3L3KA 2DD8L 5BZXA 3QPKA 1KGXA 4N8UA 1G6RB 3P2DA 4YDJA 5EUKA 3VXRE 4U1IA 2D0GA 2YPLE 5E8DH 1X5HA 4PJDB 2B59A 2J2ZB 5KSAC 3FT4B 1G9MH 5E1HB 5G5DA 3CSYB 3WNPA 4AQ1A 4P5TA 2C3XA 5DU7A 4TULH 5BJTB 1RVFL 5I1JL 1DDHB 2W88A 4W4OA 4AGOA 2X4OB 5INDB 2XXCB 1LILA 4FP8H 1JYXA 1IFGA 4XP4L 3LNGA 1KIRB 4R2GC 1XHHA 2AI0L 5I23A 1HILB 1HXMA 3GSWB 2QZ5A 1MIML 5KYWA 3BWZA 3EYSL 3B4NA 4S0HA 1FSKB 1AHMA 3QDGA 4MVBC 1K2DB 4BRJA 4LOUD 5I8OL 4FJYA 4Y9FA 1QRND 5CD3B 1MNNA 3ARRA 4NQCE 1KEGH 3CQPA 2PWGA 1TTCA 2ZJSH 4JFYA 5IG7B 4QYAA 4WKZA 4N0UA 5CUSL 3I6SA 3DBXB 4H8VA 4WFFE 1CVRA 3UAJC 3B5GA 4MFHA 3LIZH 3MLPA 1FJ1A 4BBWA 3DHUA 3FQWB 3NAAH 1M1XA 2DWEA 4UB0L 1MRDL 4EZJA 3SDAB 2DMBA 5IP4A 4HUVA 2A74C 1E90A 1IE5A 3O2VL 2WTRB 3SY6A 4JLRA 4FQ1L 5HDBF 1PX4A 2PR9A 3QC6X 1M05B 5DVNA 1S7UB 1EH9A 4I1RA 3B5TA 3P77B 1ZRUA 4QRQB 2H2SC 3V5KB 1L0YA 1U8OB 4LEXL 1TO4A 1UCTA 4EUPA 3FRPB 1Q9OB 3NZHH 5HJ3B 5A3IC 2CO2A 4ENED 3OAYH 4TUUA 2Z31B 5CN2A 3ZL2A 2FX8H 1IFRA 2O5NA 3UAAA 4JVUA 4G9FB 2HH0L 5IGXH 4KY1H 2XPGB 2QVTA 3EGXA 2JI2A 3NFSH 1H19A 4ZMZA 5ABAA 3PG2A 4PJEA 3HIZA 2R69H 1Z0NA 2VWEE 3O6LL 4ANVA 1N5YH 1YCSA 2DI8A 4YHLH 5ITBH 5A2LH 3TYGH 4P23B 5DJAA 2XFXA 4S1QL 1HHKB 3N44B 2IDTA 4XO3A 1SN2A 4KOBA 3EO9L 5D4IA 3V6FA 4GAJH 3TA3C 1VPOL 3F3HA 1U8MB 2ZNWA 1D9KD 3GRBA 4NWUH 4Y9BA 1HL5A 3VXMA 3ME0B 5IQ9B 4A68A 3PE9A 3NH7H 3TBYB 3QQDA 3BH4A 4NWTL 1GGIH 1KNOA 3KG5A 1AS6A 1CD1A 4RMBA 4WO4D 1TVDA 4J3OC 5AB2A 3FB6B 3FO2B 4K0OA 1XAKA 3O6FD 3PABB 4K9EL 1UWGL 4UT9L 1COBA 5EU3A 4BZ2H 1KZYA 2OX5B 2OI9B 4Z7VE 4PM1A 2I69A 5DGQA 3N43B 4W1TA 3QUXD 4L3CA 3SE3C 1W91A 5CD5C 3B7RL 3MZGB 2P3YA 5B1JC 1FZMA 5GRWA 1N5YL 4ELDA 1NC2B 5D7HA 3B8YA 3VXSD 2GK0B 4YHML 4B96A 4PWKA 5I26A 1W0WB 1S5HB 1N10A 1U3HD 1UVQA 2J88H 5G2NA 5IBLC 4DCQA 1T04A 2NZ1A 3G6JA 3H3KA 1JYVA 1KCKA 3E0GA 3FH7A 3HN3A 2E9WA 3RWIA 3F83A 3I2CH 3BHBB 1MRCL 1F3RB 1MFAH 1R33A 2B4CH 3WMSA 2XTJE 1AZUA 2IANE 3V2AR 1YYLH 3FKUS 4MXVF 3ARTA 4WV1A 2L3BA 4N0UE 4NWTH 2APWA 2QV4A 2X9XA 3CSFA 3FCTB 4ZBJA 1N70A 4UT6A 3WS3A 4IHOB 4YDZA 3SDDB 5E2TH 2ILLA 4KI5E 1RZKL 3Q1EA 2EDFA 3TFKD 4BZ2L 1DUYA 3AU1A 4PJGF 1T7YA 1KTCA 3G5ZB 3GI8H 4U0RB 4AJVA 4Q6YA 2NPLX 3NSXA 4L4VB 4OZ4A 2GT9B 3FK3A 4NX0A 5D1XA 3REWA 1SRDA 5JTWA 1S4IA 4NQED 3LNDA 3FQUB 1YN7B 2OMVB 3DHJA 3DROA 1I3UA 4YBLC 4AQEB 3EYFB 3QXVA 4AYBA 2V17L 3HPJB 5F3BA 6PAZA 1K5NA 2RB8A 4HUCA 5D7SL 5TD4A 2EDOA 1ZTXL 3RGVC 1AZBA 5AVRB 5CEYA 1H3VA 3K2MC 3MRQA 4N24A 4WUUB 2YK1H 3MC0A 1XSOA 3QCVL 4OLYL 2Z1PA 5I1LA 4PI0A 1OOWA 2OR9L 4QHNB 3C6LC 1E6OH 4H20L 2P8LA 2VZ3A 3NJIA 4HK3N 1D6EB 4YHPB 4M7ZC 4JHUA 1TNMA 3C9NB 3PWJB 1IAIM 3UZQA 1N6UA 4OFYA 1OW0C 2AK1L 1UH3A 4QRRD 1OT4A 2VITA 2GFBA 1F13A 1MLBB 1UH4A 1LNUA 3P3SA 2A77H 5EUOF 3P3TA 2A9BA 4PJHF 2XA8L 4H8WC 4PRBA 3W56A 4W9FC 2EAEA 2CJTA 1PKOA 2VB5A 4WIQA 4QD2E 2J8UE 3RWDA 4OD1L 5GJSH 2F54A 3VXME 2OULB 3SOTA 1KJ2A 2FL5A 3E80A 3UABA 2EECA 1BEYH 3WUWB 3VXNA 3ZDZE 1A66A 3LQMA 4LLWB 1S7VA 4YPGB 2VR9A 3VYNA 5HHQB 1DN2A 3SPCA 4ELMB 4U1NB 2HPOA 2WJ5A 5DJ6A 4XT1C 3GSNA 2UY7B 3DJSA 4OI9A 1HVXA 1DVTA 3C8KB 2EH8H 3FB7A 3D5OF 4F1SA 4JDVA 5T1KB 1ETZA 1ZIBA 5I71C 4RA0C 4L1DA 4TNWF 4PJ8D 4CN1A 4HS3A 4IQHA 3LKSB 1WZKA 5HYQA 1BYNA 1OALA 3O45A 4GRWF 4WLCA 4K3EL 3G5VB 4WCYL 3PHQB 2NY4D 4XMZA 1CLVA 2FBJL 4B3EA 2XVGA 3O6FB 3RU8L 4B0MM 1S9KC 4M7ZB 3CZUB 2E74C 4JM0A 3LH9A 2V3DA 4HYTB 4PN6A 1ACYL 5C9JA 4PJAA 1MAMH 1JGDB 4RRPM 4FYRA 3SKJL 5A2FA 2BY0A 5EWIL 4GAYA 1IAII 1AO7A 2AQ1A 1JZGA 3KPPA 3IDJA 2BNQE 2MNUA 3G6AB 5EF0A 4EUPG 3SKUD 3RPKA 1I8MA 2VDMH 4DGYH 5L88H 3P4LA 4GXUN 5F2FA 4GT0A 4G6JL 2OP4L 1F3JB 3UMNA 2HLFC 5A7EA 4HCFA 4ODSH 5AALA 1DP0A 1OANA 4JQIA 1H6FA 3TFKC 1ZHLA 1U8KB 2LOEA 4KKBD 1U8PA 4Z77A 5E5UB 5EC2B 4M00A 5T33L 2EYSA 4YK4B 4APQD 2V3FA 4F8OA 3D85B 3GUTA 3MV7A 4ILDA 5BRZE 1LDPH 4YX2H 3SPVB 2OQJA 2NCEA 4YE0A 3FOLA 3WHXA 4YSTA 3JVFC 2X4NA 2DIJA 1HKFA 1A7PL 2NYZA 1YPZF 4B7IA 1RZPA 1NCWL 4ALAC 1XEUA 4ZZKA 1TZ8A 2F5AH 5BOPA 4A55A 4DN4L 3H9HB 3X14B 3CFBA 1W6LA 1WSST 1INEH 4TRPH 4DF9A 4JO8A 1SM3L 5IT2L 4KTGA 4Y4HB 4Y5XA 3CVBA 1H8LA 1VADA 3QK0A 4LNVA 2YKLH 4ZO7A 3HG5A 5GGRY 4R7VA 1FORL 3FW6A 2CA3A 2JK5A 2WQWA 4X6DB 4G6JH 3C6EA 3SBQA 2XZZA 3N3EA 1TTRA 1HINH 3QARA 4PW9A 4TQPA 2EIMB 2NY5L 1N2RB 3UXFA 2W65A 5CP7A 4PJIA 5IV2A 3BZ4A 4FX5A 4OZFH 1FPTH 3HPLB 1CXEA 1AC6A 4NP4L 4L1TA 3H42L 3INUH 2QADC 4HWNA 2ZAHA 4X5RA 4ANUA 4P5KB 1UC6A 1S9XA 1HIMH 2RCSL 3S37H 3V0GA 2ESVE 3NFPB 2GUOB 2ITCA 4ZW3A 5IMKB 1MW0A 3HMXA 1A6ZA 3O9WD 2JB6B 4AZ8A 3O9WA 1MWOA 4ZOEA 2XYCA 5C0JB 4KKAC 3UJJL 1H5BB 3CZJA 2IPKB 1X4ZA 4XAWH 4AW7A 2OJZH 2HH0H 1FYHB 1HSBB 2WXIA 2E7DA 5TQ0H 4GKLA 4QRSA 4PCTA 1HI6A 5DEGA 4F7CA 4KKRA 2PCPA 5GISL 3O2WH 4ZMLA 2WLIA 3NEOA 1U3ZA 4HFUH 3VFSB 5FECB 3IWUA 1MQ8A 1JBJA 1IEBB 2V9QA 4IM8A 4LSQH 4UDTA 3RZWA 4NKQB 3SCMA 5FGCE 3GNMH 5CWSB 1MXDA 2YAQA 3KCWA 3RVVC 3WIHL 3EO9H 1T0PB 5LDUA 3NIFF 1QX1A 4GKZA 3E9TA 4MQXD 4UUJB 3V0FA 4AOFA 5BVPL 5JQHC 5IEHA 2QADD 2VMFA 5I1KL 2EDJA 2ICWB 1B88A 2H8PB 2F61A 1RI8A 3CLFL 4FFYA 1XB3A 1MFVA 4I4WB 4GG6B 3IRCA 3M1CA 2HKHH 3MKKA 4P99A 1T5KA 2N0KA 4I0PB 3CFJA 3AC0A 4DK3A 4ABWA 2EDRA 4DGIH 3H3PH 5E7FA 1OP5H 3LEVL 3LKOA 3VXSB 5F6IC 4KK8D 4YHKL 1DJIA 1L0PA 3SQBB 1AQMA 1H3PH 4HISA 2HXAA 4QYOB 5TGBA 5TH2B 5IVXA 4DJMA 3OB0H 2OTPA 3DVIA 3NN8A 4O2EB 3S4SG 2H6UA 3Q3GB 3IMRA 1FHGA 1HAUA 5HDRA 1U4FA 4IIQC 5E95B 5C0FA 3UACA 3VRLE 5EBWA 4F2MA 1F42A 4P05A 4I77H 1L5GB 4P4RB 2Z0UA 3WN5C 5FB8B 1P5UB 1BDYA 2V4LA 1F2QA 4XVJH 3B2VL 3EJJX 2NW3B 4Q9RH 4H5SB 5JDSB 4QO1B 2MSPA 3BLPX 1CD9B 3ML9A 2IBGA 2WNWA 3L3OC 5JHLL 2BHUA 3QZWA 5GIRB 1H9VA 5C0NC 1KYOJ 1RZFL 3PHAA 4G6FB 5EWIH 1UGNA 3HAEG 3SDXF 3QQXA 4GSQA 3D08A 3NDYE 4G6FD 2YD5A 1AMYA 1IBFA 5EO0B 4URKA 3QZBA 3KVQA 3V4VH 3BH8B 4LLDA 3UAFA 4Q6IB 5AB1A 1AYOA 4HGWB 2IQ9L 3RTLA 3T09A 1NMAH 1FL5B 2WVVB 4OF8A 3R7QA 1DQML 2LV4A 2AV7A 2Y7QB 2VKXA 1GC1L 2QJDA 4ANWA 2GJZB 4C57C 3B43A 4JS7A 4FKEA 4PS4H 1ZLDA 1H3UA 4ZXBB 4BK5A 4U1LB 4AENA 4M03A 1JHTB 1FNSH 4XN5A 3S8WA 1N0LA 3CTTA 3GJFH 3LS5L 2WYZA 3QORD 3SJVA 1G7QA 2GITB 2AJXL 3S96A 4X7TB 3QDJB 3LXCA 1G9NC 3U30B 2AXWA 2ZOKB 3WHE1 3W9DB 2DF3A 4Y4FD 1I4FA 2ZKHH 4ZO6A 4OQTA 2WZPD 1FVEA 4WSGA 3KLSA 2BWQA 1HKLH 3UBFA 3ZZ1A 1OGSA 2F1EA 1OPOA 3EH3B 1KLFA 1KXHA 1QTYT 4KGLA 2W81C 2VQTA 2VXQA 5E4EC 5C0AD 3AS3A 3RVUC 4XOBA 1R5IA 4L18A 2Y1AA 1KGJA 1PZUB 4EVNB 1BVNT 5C3IA 1JE6A 3PNRB 3MRHB 3F62A 1RURL 4XPFH 5H37G 1ZHNA 4JKMA 1NCAH 3O4LB 4PUBL 7PCYA 4IOIA 2EO7A 4HH8A 2CR6A 5T1KD 3EYOA 2E6JA 2HFEB 1WQVT 1BQHG 4TLSA 2L7JA 5AYTA 5ICZA 4R4FH 4AQ8A 3UC0L 3L7FA 5KWYC 2JJVA 2MNWA 2A83A 1CGXA 2FR4A 1L9RA 1BD2E 1PLBA 3GMLB 4Y16D 3QDJE 2JIXB 1RJLB 2E6PA 3LB6D 4G72B 1L0QA 4RX4D 3F6IA 5BRZD 3GBML 4YSQA 3C2AH 5D7IF 1BWWA 3QORC 2VJXA 4J28A 2WZ0A 3FRPG 3MJ9L 2IWEA 3HG0A 2D3LA 5I1DB 4Q4IA 4GO6B 1A3RL 2CJUL 3RWJA 2Y1ZA 4PRAB 3PP4L 5E99L 2ZSWB 4LFHD 2Y0SA 1G7LB 3X1EA 1ZXKA 4ZS7L 4LDEB 3NA9H 5IEKA 4E0RB 2OW7A 4E5XA 3ETBF 4JM2F 5FYKD 3BPNC 3KCPA 2COQA 1KIQA 5ACMA 3CPUA 1P7BA 4LPYA 1LO4L 4EN3A 3FULA 5E4EB 3E2HC 3P69A 4FQHB 4WI8A 5DMIH 3SE9H 4QRTB 3TNMA 4DO6A 2V9TA 4G1EA 2O6CA 2VO8A 1LD9B 3WL9A 5CHNB 3QXAA 1WA2X 1E50A 2RGSA 3QFJA 1AGFA 3TT3L 5HY9A 2P52A 3MX0A 2F19H 2QSVA 4PRHA 5I17B 3D3VA 4ZX4A 4HD9A 1DLFH 2ESVD 4WSKA 1QFWM 4G7RB 1L9PA 4BQBA 1P6FA 1P69B 5EF3A 1I7UA 5J1TC 1Q9WA 1NDGA 1T80A 2VLRE 4HA1A 2XIDA 3PU7A 3ILPA 4TTGA 3O3UN 5AG8A 3A4EA 4RGMB 1BQHA 1TQCB 2DLEA 2JJTA 4LBEA 4P3DA 4OU3A 2BY3A 1ID5I 4ODVH 4FG2A 4P9HH 3Q1SL 5D1ZB 4R4BB 1NC2D 3UIZA 1NCGA 1ZT1B 2XT1B 4HV8A 4GP5B 3Q9QA 1E27A 4DEPB 1DJWA 2FVNA 4KZEL 2BH0A 2BOBB 2GABA 1Q9LA 2O61A 5GPRA 4UNVA 3GHEL 3HLAA 1TTGA 3BEVA 4LLQB 3KPOA 4LEEA 3DRQA 4YWGL 3TCLA 1HHIB 1M7UA 2IGFL 3FRUB 5B39A 3D85D 1D5XA 4LPCA 1ANUA 2OMTB 1A6VH 2GYSA 4HIHA 4KROC 2I5YH 4PLOB 3H54A 1GTNA 3QG7H 5F7EH 4N6RB 1KJVB 3LQZB 1YHPA 1AIFB 5EU6E 1D5MA 3T4AB 3L2LA 3LY6A 4U3SA 1QNZH 1KBWA 4YXHH 1ZAGA 5DUPH 4M1DH 4AG4H 3NCYP 5ACLA 1TVBA 3U4KA 2V5SA 1CCZA 1OCZB 2AC0A 3LV3B 4IEFA 1F86A 3H42H 4G70B 2R51A 5IWLC 1EHLL 3TA4D 1BXAA 3MODH 1BM3L 1C9SA 3ZJAA 3T0EE 5FYKL 2EVJA 2N59A 3QIWB 3C5SB 1JZ5A 3LMJL 4X0KA 1F90L 4LE8A 3BKCH 4NBZB 5H94B 3DV6B 3WIIL 1BMZA 5FV1L 4U0RC 1INDH 3MLRL 3V10A 4FTVE 4NLAA 2G3XA 2ADIB 2EACA 3L1GA 3QCTL 3C5ZA 4TLKA 3AQXA 4XI5C 4LBEB 1XH3B 4FA6A 4WI4A 3V6OC 2FCBA 2CGZA 4QRBA 1A7NH 2AK4E 5EIVA 2VRAA 1IGFH 2VCOA 4GAFB 2R8SL 3K8KA 5GISH 4KKBC 1JGLH 2QQNH 3GZPA 3OKMA 2UVFA 1NIBA 3P4OA 3D39D 3TXAA 4H2AA 4BFRA 3H9ZA 4OCYH 1HU8A 3AY2A 4K7FA 4QPEA 3VQ2C 3VD5A 4MJ6A 4PVMA 4FMFA 1R0AH 4RQQB 3FTGB 2V2TB 1U92A 2OMWA 4I18C 1W2KT 1R3HB 4U7KA 5D7JD 3I02A 2AKRA 3QHFH 5AW9B 1CBVH 2XG5A 2YAEA 5CJQH 3VMPA 4Y19D 2MIZA 5JUEH 4R4NC 4XPHL 1HSAA 3KCPB 5HYJD 3KPRD 4FQXD 2J73A 3PF2A 3RIAK 4HGMA 4Z78A 1WF5A 3PIQB 3CSBA 1DSYA 1S7WB 2F08A 1G7LA 4LAQL 5TDOB 2FX7H 4PJ7A 1NC4D 4JKKA 4BIKA 3CN2A 1DJXA 5JHDE 4ZS6D 2YPVH 3F6JA 1Y1UA 4NJ9H 1DL7L 1XF3A 3GMPB 4MA1C 3IXAB 1WK0A 9PCYA 1WZMA 1BOGA 3UBGA 5B1JA 3EG9A 4O4YL 3HFFA 4TNEA 3U82B 3QJFA 3KH3A 4X4MA 3SE3A 3L5XL 3ZKMD 1U93B 3AUWB 2PO6C 2H1PL 2GTQA 3GBMH 4UQ2A 8CGTA 1MF2H 1BREA 5HYIA 1PLCA 3ETBJ 3T6WA 5KSBE 3T0XA 1NFAA 3MJ9H 1RZQA 3DX9B 3V4PL 4KJYB 5A7BA 3GXPA 2V17H 4G43A 4HXAH 1P4BH 3WO3B 5F96H 2CLZA 4X7SH 5IMMA 5MENA 3RNKA 3IU3B 2X0UA 3LQAC 4XP6H 4Y5YA 1T5XB 3IFPA 3FMGH 4H25B 4W9DC 4ODBD 2R56H 3CVCA 2XQYG 1R1CA 3MBEB 4LEBA 3NZ8B 4J3TA 3AT9A 4NKDA 1TJIL 4GKSB 1SDDA 3CFIC 1NFDB 3UEZA 4OI7A 3LEXA 2BNQB 2VABA 1RL1A 4HH9A 2I07B 3MSPA 2AEIT 1BVKB 3DTDA 4NC0B 3Q6GH 3GRWA 1U91A 3I6LD 4OLVH 4OGXH 2CGRL 5F1NA 4ACTA 4O2FA 4X7TA 4K9EC 3T0BA 4PLNC 4UQCA 3V6OE 1UXWB 1AACA 1B0GB 1SFHA 4HHAB 4AM0Q 1UA6H 1Z5LB 5E9NA 3ZDYF 1CF8H 4NZTL 1MHCA 3KXFD 4R26L 1EMTL 1UXLA 2ATPB 4OZHF 1U58B 4F33B 4N26A 1BMWA 1L3NA 2ICEB 2YC1B 1DBJL 1QYGH 4ZXBA 3GT6A 3RGVD 4GMSH 4NT6B 5CKGA 1ID2A 5F7UA 5F89B 4IMLA 2YMTA 4LLMA 1I9RL 1OKEA 4QMEA 3HMWL 4JDTH 5BV7C 5HGGS 2BRRH 1IT9L 3QUYC 3WFHB 4JG1H 3WXVL 2CIKB 3DGGA 1NMBH 4FQIL 1ES0B 1NBZB 3VD4A 4BWWA 1YNTA 3ZDZB 3VGBA 1TFHA 5DVMA 3BUDA 4TSAH 3DSNA 4G42A 1I7RA 1NGPL 5CZXD 2X05A 2VZSA 2NNRA 3RJQB 3UPRB 2B4CL 5DRWB 2Q10A 3WE6B 2Q8AL 3DYPA 3NBNA 4D0BA 3PS6A 4BFNA 4AEEA 1L5GA 3BKML 3GXNA 3NCMA 3T4YB 2FYYA 4YHOH 3F12A 2EDTA 4KTDH 5F89A 3SB3A 2JVUA 5MEPB 2WBJA 2V7NA 3S88H 3K6DA 5HDQH 2ADFH 2ZNXA 4I3SH 3TBTA 3DURB 3HJEA 4U6VL 1ZXQA 5B3SB 5GSRA 4N2GA 3OLDA 1FVDA 5IHUL 1AXSA 5KYYB 5IVXE 3MROB 3MGAA 4MXQC 2HUEA 4H1LG 3WN5A 3RVTC 2AAVA 2YKKA 5E0QA 2W9EH 2HRLA 3DX6B 1UXWA 4OFQA 1HL8A 2K6WA 4NNPH 4PJHA 4Q74A 3C8HA 5L0QC 2GCYB 1NANI 2YSSB 1V27A 4QT5B 2G5BA 1BVKA 3OKYA 5DI8A 5C0AA 3GMQA 4P59H 1XZWA 1NCJA 5I6OA 3IJEB 1E3ZA 2DLIA 2PKDA 1KBPA 3VFVB 2ZWSA 3GFUA 4CBZA 4NYLB 1MFDL 3QS3A 5GGVH 1HCYA 2GJ6E 2HTLC 2XQYK 3V0WH 1RHFA 2NY4B 1SJEA 2OMYA 3B8SA 3MUY1 6TAAA 1T5XA 4QRPA 3O6MH 3KWUA 2F53E 4FFWC 4AGLA 1Z5YD 3SEPA 4XNXH 5JW5B 3LZFL 3APDA 4PJGB 5CJ8A 4U6XA 3ARBA 5BRQA 4HKBB 3T8XB 4WSJA 5E2WL 3ETSA 1MNUH 4KKQA 4G5ZH 4PWHA 1I8LA 5BRZA 5B38G 1JXFA 4TMPA 3UJIH 2CCWA 4ECNA 3QJFB 3ZO0A 3QO0B 4OF7A 3K91A 4PJBF 5FM8A 3JWOC 1IBDA 3IXAA 1XF3B 3GMPA 5T1LA 4I87A 5F7NC 3MV9B 4P9HL 4RMRA 4BDVA 1E2WA 3KR3H 4P59L 2X89D 3SDCB 3JWNG 4X6BB 2CXKA 4D8PB 4GP4B 2BVPA 1NM9A 3N40P 2SEBA 3PWPD 1GS8A 1HOCB 4LSUL 4E42B 5I24A 5IIEA 2QMJA 4EOWH 4KKZA 4KTYA 5EO9B 4MX7B 1P7QB 4TSBH 4D9QE 1KJMA 5GRUL 3NESA 3HPLA 1ORSA 3K72B 4DETA 1KACB 1CGWA 1KGIA 3KNBB 3TCTA 1IGMH 3NRFA 3RU8H 1DVYA 3CC5A 2OA9A 4X6DA 1TJHH 1BECA 1NGQL 5K9KA 2V2TA 3U9WA 3TO4C 2FH8A 3GIVA 15C8L 2WOBA 2GIYA 3FFDA 2PNDA 5BQ7B 5HYJE 4ISVB 1EFXB 4KWUA 1TJIH 1L9QA 1TYRA 1BQLL 3BQUC 4K7PH 5AZ2H 4GUQA 1M3JA 4N9GA 2C3VB 3P3YA 3VFVA 1EHKB 5IW6A 4YHIA 3TC9A 3W9EB 2V7HA 5CN1A 3ZXAC 3GMQB 5ILTH 3GXMA 5CXPA 1F4HA 3SOBL 3FU6A 5EOQL 4RMUA 5FOJA 2XY2A 5C9KA 5JW4M 2DQIH 4HWBA 4K73A 1Q8MA 1VIWA 2K45A 3C2AL 4WO0A 3NZHL 3D85A 3OX8B 2JKLA 2WXMA 2H1XA 2XZAH 4G9FE 1KDJA 5IJVA 1Z1WA 1A7RL 2F8OA 1FVDB 4WUKH 3VDAA 4YSPA 2XBZA 1JTPA 2QQNL 5CILH 1HL9A 4XWOC 4N2BA 2JB5H 2QKIB 3NYKA 4IRSB 2FYYB 2ERJB 1EXUB 3MRDB 3QIUD 4QJ3B 4DPCX 4JO5A 1NEZA 4NN6B 2H7WA 2CDFB 3WYRA 5C70A 1I7TA 1CDJA 1YQVL 4NSKB 3ULVC 3IE9A 1QBLL 4JVWA 1ED3B 2J7LA 3ZQWA 2KBGA 3LHAA 4JE0A 1S9VB 3UGEA 4POYA 1IZKA 1MLCA 1EEUA 2VUYA 4XPHH 3ZYOA 1C5CH 1J8HA 3CPLB 4JREB 4TVSa 3ES6A 2VE6A 3STZB 3KPOB 3BJLA 1WAAE 1NUNB 4BFIA 4ALAH 1YNTB 4NM4L 2VLJB 5IQLA 3U0PB 4DP0X 2B1AH 5LXVA 3ARGA 1LMIA 4NC2B 1WFOA 32C2B 1PY9A 4KK5C 4GS7B 2XZAL 3X1NA 3CDZB 4NQCB 1DL7H 5GS0C 2E46A 1ESOA 4NERA 1BIHA 1KV3A 5I15L 3IDMA 4JVPA 5KYUA 2UY7A 1NIEA 4YDLB 1QR1B 5JHDB 1H3TA 5I5RA 4P3WA 3QAZB 3RDTC 3K1KC 4LHUB 2QLYA 4UBDC 1YEWA 1M1SA 2DMGA 2QKIC 3OJMB 4HKJB 1G1CA 2ERJC 3FYIB 4PTUB 4WZ9A 2V8LA 2EADA 1MCEA 1G4RA 1R3JA 1NWPA 3BYYA 1V7NL 4NUGL 4NP9A 5T3ZL 3BFWA 2V5YA 5FYKU 4KI1A 1SN0A 5IVNA 4PW4A 3AM8A 4PJDE 5HGBB