4NQSB

Knob-into-hole igg fc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antiparallel Conformation of Knob and Hole Aglycosylated Half-Antibody Homodimers Is Mediated by a CH2-CH3 Hydrophobic Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 35
structure length 207
sequence length 207
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqsB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqsB01
4K2UH 3EOTH 4YHOL 3IFOB 1NFDF 1A3LH 2A6IA 3G5ZA 1AO7D 3NFSL 4O02H 2A1WL 4K7PX 4OJFL 5IVOA 1HEZA 3TIDB 5LQBL 2R0LH 1X5JA 3FONA 3OKLA 2HLFC 1U8JA 3QFDA 1EZVX 2B8OT 3N1MC 4U1NA 5EIVA 3OKDA 4U6XA 4A6YL 3GNML 3C5SA 5F1SA 3V5DB 4XNYL 2A74B 1FZMB 3DPBA 5BV7H 2KBGA 3P3YA 3KPQA 1CFNA 4XCEA 1KLFA 2NYYC 4HIHA 1FCGA 1T66C 2NLJA 3HB3C 1G7JA 3TH2T 3QNZB 1MREL 1XGRB 2AK1H 2CSPA 5HVHC 5C07E 2WW8A 4ZXBD 1BZ9B 3U9PL 2X4UB 2YBRA 2CLVA 2XFXA 2C1PB 1GC1C 3DO7A 5SWZA 2V2TB 3MXVL 1CTOA 4JFFB 1ND0B 5ENWA 1JHKL 2VWEC 4JQXC 1TZHA 5F9DC 4C59B 3UYPA 4OD3H 4Q6YA 4JPVH 1FYTA 5DD0H 4XXDA 4JJHA 1I1FB 5HPOA 4ODVH 3AB0C 4XCFL 4KROB 3QIBC 4YHIB 2DQUL 5DZNA 1U3YA 2W0LA 1CIDA 3LH2H 1XF3A 1FZMA 4KRPD 5JHDA 2W9EH 4M6ML 2AKRB 5EC2A 4HLZH 2NTSP 4AH2B 2YD9A 1O5DT 1I8MA 5J13B 4O51B 4P9HC 1MFCH 2R1YA 1CFSB 4X7SL 1LEKA 5C0FA 3O45A 1QEWB 4JFZH 5CSZB 3VD4A 1Z9SA 3ARBD 4RMVA 4PTTB 5E5MA 2Z91A 4JZOA 2LU7A 4U3CA 3QRGH 1UCBL 4FQHA 1NL0L 3HKFA 3GIZH 2Y1VA 3FO1B 4C56D 3GI9L 3FO2B 3WO4C 3O41A 2DICA 4AEFA 3JWNC 1A6VL 1X3DA 4Y5VB 2P8MB 3CDCA 5JMOC 1RVFH 4WO4B 1YYML 1FL5B 3QEHA 2EXWC 1KIQA 5I71C 5DJAB 5DD1H 3BIAX 2FL5A 2BDNL 1PZ5A 2NX5D 1S7TA 4RISH 2VR4A 3O0RL 3DXAD 1BX2B 3UTZA 1X5LA 4NC1E 1AKJA 1H3UA 3U0TB 3ZDYF 1QRKA 2PO6A 1KEMH 3HC4H 3T3PE 4LSRH 3WIIL 1YPZF 2P24B 3CXHJ 4QHNA 5C0RH 3K2UL 1UB6A 3Q6GH 4P5KA 5HHOE 5DVLA 3CVIH 5JOPD 1KPUB 3MCLL 3VFRA 3REVA 5I6XB 4TTDD 3MOQA 1UWEL 3OAYK 5J6GB 4NZTL 3QEQA 3VXUE 2HKFL 5F89B 3SQOL 5DGRA 3G5YA 2VKWA 3H2WA 4NO0A 1MHCA 5D1XC 1T83C 3O3DA 4MA3A 2ZKHL 2XZAL 5ESQB 4R8WH 4D2NA 1GGCH 5SWSE 5J6HB 4U1LB 4LFHD 5I9QC 2HA1A 1T1ZB 4XPFH 2V5SA 3RQ3A 4NUGL 1UQSA 1C5DB 3QWRD 5SX4I 5I73B 4NKQB 2DI8A 1G9ML 4ORZC 5IB5B 1XR8B 1A6PA 4MNHB 3S5LG 5A2KH 1NMCB 2X10A 1FNAA 4PJAA 4NP4L 1B4RA 1KGCE 1Z0NA 5HYQA 5F7EL 1IZKA 3DYMA 1MCEA 4PGCB 4XP5H 2D03H 1ZWIB 3QWQB 2NY5L 4LLWB 1OSPH 4HCRA 4CKVX 2VLKE 4MNHA 2OL3L 1G7PA 2JJSC 3X17A 5HBBA 5JUEL 3O6MH 5FGCB 5MERA 2FJFB 2EZ0D 4UILL 4X6DE 4JRYB 3L6FA 5FB8A 3BPLC 1JNLH 4G8FA 3BXNB 3VXUA 3BPNC 5KTEL 1JGUL 2V17L 4R2GD 1JPGB 4L4TA 4U6YA 1YJDC 2HT4D 2JCCF 2EIBA 2X09A 3CFCL 3O6FA 1A7RL 3I3DA 4IOSD 1UGNA 1ZXQA 3TT3L 4KMQA 4LF3A 5F1NB 1QFWM 3CX5K 4NCC1 1X5KA 1R6VA 2NY2C 4U6HB 2ED9A 2WANA 3O6FD 4JZJA 3HPLA 2QHRH 2ZCLL 4FQPA 5KG9A 2YPVL 4DN4L 4MJIE 2WNGA 5ICXA 3ZDZF 3H9YA 1NGPH 1DBKH 1EO5A 3DARA 4XCCL 2QSQA 1BVLB 3T0BA 2NY0C 3BRDA 3UYOD 3UJTH 3MRFB 1JRHH 3BP4B 2EC8A 1GIGL 1GC1L 4NJAL 1FJ1A 3WFEH 1EFQA 2YD4A 3T4AB 4UV7H 1LP9B 3RPKA 5I1JL 4QHNB 4HLZG 5JUEH 2E27L 5EUOA 1AH1A 1QVOB 2IJ0C 1TVBB 1AQKL 3QFJA 5T1LA 1Z0MA 2R0ZH 1MRDL 3JWOH 5T1LB 2R9HD 1DANU 3LZFH 4HIXH 1H0DB 1PBYA 1IBGH 1RV6X 3CFKA 1N4XL 1KCVL 2OJZL 1Q38A 3L5WA 3VXRB 5EZJB 1ZT4B 2CLZA 1FC2D 5EU5B 5F6HJ 1PEWA 3FQXB 3P30L 4YHPB 3U48A 3U9UB 4KUZL 4JRWA 1RZIA 3ROOB 4LDOB 2X4PA 5L2KB 3IAQA 4NO3B 3WNLA 4U1JA 1EA9C 1EUTA 4ZAKC 1ZTXL 4JDVA 5E95B 3ULUC 3B2VH 2MCPH 5IBUG 2Q7NA 2OXGA 3MR9B 3QISA 1Z9OA 3O3BB 1I7TA 4PP1D 4MQXD 4QRRD 3BWUC 4XCNB 4ZFGH 1MEXH 4IMLB 3MRKA 2VR9A 4X4YA 4HBCH 4YFLF 1LE5B 2VXQH 3PWPA 4GW5A 3CGTA 4EN3B 1U8MB 4H5SB 5TDPA 3RWGA 5J06A 3QIUA 3SE8H 4NRXB 1BBJA 2FECL 4NKIH 1I85C 1S7RB 3QCVH 4OF5A 4QHKJ 2VDRL 3O2WH 4PR5A 2Q76A 4NNYA 3MLZL 5CGTA 1B6DA 3CSGA 4A2MA 1H5BB 2NY6D 4PBVC 1OCWH 5K9OB 1YN6A 3SN6N 2F8VA 2CR6A 2C4FU 2PCPA 3BGAA 4ODHL 4LCIH 3CX5J 1JK8A 1GPOL 3CJJA 4HIIA 4P3CH 4TVPE 2Y7QA 3TBTA 3HG1E 3PWVA 3IDYC 3S7GA 4OZIA 4CMHC 1K6QL 3BSZH 4FRWA 1IM9A 2JLLA 1K85A 3LKSA 4PGBB 3BYYA 5L9DL 2QQNL 3AMKA 4MHHG 5IIEA 4J3WA 3ETBF 3R0NA 2PF6A 4B50A 2D31B 2HG5A 2KKQA 2OMNA 4G9FB 3MLYH 1K4DA 1Q94A 3CSYB 4R8WL 2JKXA 4I48A 1D9KD 1S9WA 4P5TA 2W07A 3PP3K 3GEWB 4MAYB 3BWAA 3CFBB 3OJVC 3BGFB 4LCYB 5E1AA 4NM8L 3F5WB 4L4JA 1RK0A 4HBCL 2YPLD 3HE7A 1J1PH 3EDFA 4Y4HC 4F58L 3B83A 1HH6B 2UYLB 4M1GH 3K1KC 2X9YA 3KNBB 3NCEB 3N85H 2BNUB 5B22A 2VLRE 5HVFB 3V52L 1KN4L 4MLIA 4ZUTB 3QDHA 1HEZB 4MB3A 3BD4A 3SY0A 1TIUA 1A4KA 2YKLL 1HI6A 1MAMH 3TYFA 4NIKB 3HG1A 2BSSA 4L4VA 3DVIA 3H42H 1QBLH 2QL1A 4Z7UB 3WEXA 4AG4H 2QBWA 4JHWL 2H6PB 4TULH 1JWUA 1DANT 4NT6B 3D0VA 2DM4A 4H25A 1OAQL 4GAJL 4HT1L 1L0XA 2XT1B 3P0YL 4NHUA 5ANME 1X9QA 3MRPB 4WUKH 4PB9L 4QF1B 2DLFL 3DBXB 4N8PA 2NY0B 1A7NL 1G6RA 5HDBF 3TBYB 2F5BH 4OF6A 4WUUD 4X8XA 4HWBL 1PJ9A 4X4XB 2X4RB 5DS8B 5CGYC 2QQLH 3L7FA 2A6JA 4PJIB 3RBSA 5DJYB 4N1CA 4JQIH 3HI1A 3UAJD 2OTWB 4PLKD 1U58B 4KPHH 1INQA 5KVFH 1BBDH 4JRXA 1TETH 3U6RA 3FHAA 3BVNB 4LQFL 1GOHA 5ESAA 1MRFH 4MX7B 2ITDB 2JIXD 4HH9B 4RMWA 4B5EA 2EDYA 1R5VA 3TJHD 4RWHA 1G9NH 1UH2A 5MHSD 1MREH 5TF1H 1UACH 1LO5B 5KW9H 3LKOB 3O11A 4HV8B 3QDJE 4QOKE 4GKZA 5E8NB 5L88L 1XF5A 2H45A 5JLZB 1RU9L 1WGOA 3L9RB 1U93A 3OKYA 2F8OA 3EJZD 1AQKH 2ORBL 4Y4FD 1CDUA 4ODUB 2EDNA 1IAMA 4Z95L 4X6DF 3T1FA 2O61B 3DWTA 5IIEB 5ANMA 2R2CA 1I1FA 1OP9A 3ZT7A 1M7DB 3VFUB 5MENB 3S98A 3CX2A 2X9XA 4OSUL 3U46B 1JZ2A 5FB8B 4P49A 4O2CB 2QADD 4KUZH 1R3KB 4G5ZH 4JFFA 4QRQB 4KC3B 3PWVB 5DJDA 2O61A 2RCSL 2ZCHL 4AJ0A 3D2UB 3MUHL 1E27A 1FNGA 1LD9B 4PRAB 3DIFA 4IRZL 4G6JH 4GOSA 2AJXH 1EO8L 3BKMH 3ARWA 3WXVL 5JW3L 5EO1B 3KPLB 3LPWA 1QKZH 3SDYL 2H41A 4WFHE 5CFHA 5EORH 2QSVA 2B20A 5F1KC 5AZ2H 5K9KB 1XMWA 4IEFB 1IEBB 1ZHLB 3HC0B 1JZ5A 3DI2B 3KYMA 1OARH 4PRPB 2CKBA 4OGYL 4OZFB 4WV1C 4YDLB 4RGOH 2PXYA 1BOGA 1BD2B 4OCRH 3MJ9H 3G6JA 3RWDB 5C0NC 1EDQA 2A6DA 4N0YL 3QHZL 2VDKL 4PG9A 4NKDB 5IK3B 2C1OB 1PYWB 2E9BA 5GZOC 4YPGB 4D8PB 1AO7B 5FCUH 2VZ3A 2R29L 3FT3B 4QOKD 5LCVH 5JXED 1IKFH 3RNKA 4L9LC 5IB2A 4IOFD 1HILB 4YC2C 1TQBC 5JR1L 2IALB 2VL5A 4P23A 4P2OA 3MRIB 2B7DT 1REIA 3DX9B 1IGIH 5DA0B 4Q0XL 4G43B 1IGMH 1QP1A 1TXKA 4NT6A 1FLTX 3BYTA 2RCSH 1MLCB 4DFIA 5IJVA 3TT1L 3BP7B 3SE9L 3E1F1 1HILA 3P4NA 3NTCL 1FPTH 1PSKL 4P9HH 1QVOA 3DROB 4RQQB 4F15C 2BY3A 4NWUL 5EUOE 3QQ9C 4LRIC 4WRLA 4RQQA 3F7YB 4ISVB 3VD5A 1K4CA 3MBEA 4WY7H 1ZAGA 3EZ8A 5EA0H 1R5WB 4IIQA 1MLCA 5IJVB 4ZXBB 2PR4H 3CMOH 2EIEA 1ETZB 5D7IB 1BQHG 4F7TB 1UENA 2DDQH 2VITA 1LO3L 1NCBH 5F7UA 4ENEC 4ODXA 1JYNA 3S3JA 1AI1L 4GRMB 4Y4KC 1L7TL 2GCYA 4JHBA 3U4BL 4YUEL 3LKRA 2D9QB 4PGZA 3NCFB 3OQ3B 2ZUQC 3FB8B 2VZ1A 3GBNH 4LARH 1X4YA 3LB6D 5FO8B 2Y07L 4L8SA 3KLAA 5K93A 5IMMA 1D3CA 3QXDA 2WMPA 3FOLB 5DFWH 1NQBA 5E4EB 4O2EB 1NMBH 2FWOB 4P2QD 4GKOA 4LRIA 1HQ4B 1E27B 3BDYH 5C0JA 3GSNB 1OSPL 1HNFA 4U1HB 3QUZD 2VOTA 3C6SB 3PIQB 3TO2B 4PJFB 1U3HD 5C6TL 1K8DB 4P2QA 4YDKL 4TSBL 1JGVL 4UTAH 3QJHB 5D7SH 1QR1B 1BGXH 2HWZH 1J88A 1P6AB 3N06B 3TZVD 2I9TA 3ZE1E 4OI7A 3NBNA 1X7QB 1KBGL 2DQGH 3RVWD 3UZVB 2PTTA 4P5TB 1FPTL 3KPLA 4YHIA 5DXWA 2F53B 1XGQA 5DMGD 3A6CL 1WC7B 1EGJL 1F4WH 4I2XA 4IMKA 1I1AD 2NY7L 1ZA6B 4KRMB 4UINH 4CMMA 3D2UA 5GZNC 1IFHH 4WEBH 1H5BA 4WO4D 1ACYH 4XVUC 3B6SB 1MCJA 3DVFA 3U82B 3ET9F 2YD5A 4KI5E 1CE1L 4XAWL 2BSTA 4JDTH 4L5FH 3MUZ1 3U46A 1F6LL 1BBDL 4NFBA 5EUKB 5DWUL 5BW7A 4J6RL 3ARQA 1AR1C 3ZT6A 2BFVL 4UIKL 4JFHD 1WF5A 1F13A 1JZ8A 1G7PB 2YOCA 1S8DA 3H9SD 1L9NA 3OHXB 1KLGB 3K80A 1IC7L 2GEEA 2PYFA 4UT6L 5I1DB 1MIML 4LKCA 3CXDL 4D0DA 5TQ0L 3L1OL 3OKNA 5E2TL 4GAFB 1F4XL 2XXCB 5MEPB 1JTTA 2WWMC 3OKOB 1OD7A 3CVHL 3BPCA 1I9JL 2YRPA 3JV0A 2EDLA 4XMPH 5TE7L 2KH2B 1MHPL 5BW7C 1QQDB 5D8JH 3ARFD 4YAQA 1CS6A 5ISZD 2A6JB 1RFDL 1NFIB 4OBRA 4IIQB 2PO6B 2J6EH 3L5XH 3VFTA 1CIUA 1UM5L 4LVNC 4DGYH 2BOCB 5EUOB 1BFTA 2R2EB 4V1DB 4Y16C 4CVXA 5H35A 4MVBD 3MRCB 4NQDA 2NXYC 2GHWB 3VFRB 4JDTL 2CIKB 2H2PC 4NQDB 3ILQD 4QHUA 5D1ZC 1U91B 3SDAA 5I8OH 4F2MB 4RBPK 4IHOB 2A38A 4LSDA 4Q7DA 1J11A 1QLRA 1EJ6A 2GFBA 2MPAH 3T8XA 3OKEB 4LOUC 3QG6B 5IWLA 2XA8L 4PRIA 3LN5A 2NY4B 1NC2D 5HI5C 3WSQL 2CKBH 4KKAD 2CDGB 3BPCB 1YEJL 3DHMA 2DBLH 2E7LA 1KT2A 2YMXL 4UOW0 5F7MC 1K4DB 2BNQA 3BMWA 3RNQA 1U3HA 5DJ8A 1MIMH 2Z35A 3IFLL 2R4SL 3V7AE 3VJ6A 1IL1B 1RZGA 2ZSWA 4Y4FA 3RIFF 3RVUD 4BK4A 2N4IA 5HGHB 4KKNA 4N9OB 1YEFL 4G8FB 4UAOC 1M6OB 3T77B 5F1IB 3WNPA 5EDXA 2UUDK 5E1AB 3FB6A 3AROA 4PJ7E 4ZUSB 3TT1H 5T3XD 3UTSA 3HC3H 4UT7L 4WWKD 2OZ4A 1A7BA 2H26B 3EBAA 4X98B 4QOKA 4Y19E 3JVGC 3G9AB 4G7VL 3W39A 3NIGF 3PHQA 4ZOBA 3U7WH 1HHKB 2VR5A 3ULUL 2H3NA 4ODWB 1NCWL 4DK6A 3CIQA 1HXMA 4DKEL 4WTWA 3CMOL 5DYOB 3LV3A 3ZKQD 5CEXA 1RZFH 4O2CA 3ALWA 1KJ2H 1BBJB 2H9GA 3NCJL 5E8PA 4PY8J 1CGUA 1FP5A 3PHQB 3MRMA 3GMMB 5FM8A 3QDGA 3ZYIA 2YPKA 3OR7B 3S96B 3B3IB 4M3JA 3BW9B 4F33B 2E7MA 4OLVH 2YPKB 5AZEH 2PTTB 3VXOA 2D3VA 3HMWH 2AV1A 1FVCB 4GW4A 4BYHA 5A3IC 4MYWB 1M7XA 1NSNH 2ZZUT 1XF2A 3GZKA 4NHCL 2L0DA 1ZHBB 4BZ1H 5MEOA 4HQQL 1HHKA 1URLA 4HCRL 5FGRA 4I3SL 4TUJB 5DQJB 3CCHB 2EICA 5JXEA 1UXSB 5B38B 1KLUA 4RFEB 2IQAA 3KWWB 2MKWA 3EFFB 1AD0B 3G6JE 3VRIB 1OT2A 4HWUA 1D5MA 5C2BL 5F88B 4F7PB 1YPZB 3RI5K 1V5JA 1NGQL 4K07A 3N50A 3QG6A 1MWAL 5KAQG 4PJ8B 4LDLB 3UO1L 5CSGA 3EOAB 4P4KC 2WBJD 5I1HH 4IRSC 1ZVSA 3FONB 4MHHI 3QEQB 2E7HA 3RZCB 1Q0XL 4ZXBA 1I1CA 1KJ2L 4YXKL 3AAZB 5FYLE 4HGKC 3VH8B 5HGBB 4P4KD 2ID5A 4D0BB 4MJ2A 5EZIL 1RJZB 3EYUH 2P5WA 1NJ9B 4JQIL 3JTTB 3TBVB 5DJCA 3IDMA 1OWWA 2E3VA 3GJFB 1NDGA 5TE4L 2KDGA 1ZLWK 2VDPL 4LQFH 5JPNB 2ZG2A 5A43C 4H8WC 4C56E 2VNCA 2GT9B 3EDEA 3WUWB 4HD9A 1HWGB 4IHOA 4ZO6A 3RTQB 4EIGB 3NMEA 5DHVA 15C8L 1JF5A 5DJ2B 4K7PL 2VE6A 3UAJC 2X4SB 1IEAA 1OAUH 3W5MA 5ICZB 2XTJB 4WNQB 3Q1SH 3TNNA 3KYKH 4FQJL 3ULUD 3K4DA 4HCRH 4I5BB 3FQWB 1SEBA 5DUPL 5IM7B 1PKOA 3U0WL 3ULUE 4GMSL 1RZKC 2CK0L 3OXRB 5HDQH 3VXUB 4HMEA 3RBGA 4UAOB 2NQCA 4TVSa 1CR9H 4JFED 4KQ3L 4FQIH 1DFBH 4PREB 5DVMA 1KCUH 1RFDH 4BH7A 2CXKA 1LP9E 3OXSB 4Z0BH 2R8SH 4JPKH 1YNKL 3B3IA 2ENSA 2C3VB 3GHEL 4G9FA 3IDXL 4BZ2L 1ZWIA 4JRXD 4L4TB 5JOPE 2VXVH 3UTOA 4Z7NE 4P57B 2FD6L 2FHCA 5B21A 3T0DA 3QI9D 4MMZC 3T09A 3CSBA 1CYGA 1NGXA 5LQBH 4V2BA 1N5AB 3QEUB 4MZ2A 5KZCD 1WK0A 3EYQC 2MPAL 1JGDA 4EN3C 1S9VA 3B5TA 1XF3B 4LRNL 2WIIB 5E08H 4ZUVA 2Y7QB 5D7JC 2H2SC 5MHSE 4JM2D 1GYAA 5SWSD 2H26A 2CKBL 2OL3A 2DQTL 4LBEB 4X6CF 3UTTD 1NUNB 1BLNA 1N5AA 3QEUA 5BS0D 4Z5RA 2H2PD 2VXSH 3HAEB 1AP2A 4KY1H 3S9DB 3OWEA 1XGYH 4ZTOL 4JPIB 5J89A 1DVFB 3INUL 1EAPB 2A9ML 5CGMA 4ELKA 1HXMB 4NPYB 2W65B 4E9LA 3EOYG 3IFLH 5GS2D 2IG2H 5TF0A 1A22B 1RULL 1KXTB 5F9WC 3DMMC 3QFJD 1LILA 3VRLE 1BREA 2LQRA 4JHAL 1JF1B 4CVZB 1DBMH 1JHKH 3H9ZA 4ZUUA 3HG1D 3BEWB 2LU3A 3T3MF 5IFAH 1P4LB 2WUBL 5JOFB 4HFUL 2PYEB 4W6YB 4AEIH 4GKNB 4OFIA 4OZHB 4G7VH 2YHGA 3CSPA 1FE8L 5DA4A 3DXAE 4XPTL 1RUQL 1FH5L 4Z7VB 4UDUB 4ZTPH 5HDBE 4K3DH 3NTCH 5F89A 4RZCB 1S7TB 3CU1A 3MV9A 4O4YH 1OGAA 1KG0A 5HTSA 4N0CD 3TO4D 1B6UA 4UQ3A 1QSFE 4MAUH 3MRCA 4A6YA 1KT2B 4L8SC 2NY2B 1K4CB 2AXFB 3MBEB 4YLQT 3X12B 3WUWA 1DLFL 3CDGA 3KPRA 2QSCH 2VDQH 3VD3A 2JELL 3DBXA 5FGSA 5IR1A 4KZDH 5IVZB 1GGIL 5IF0B 4PV8A 2VLRD 1K3ZA 4GBXD 4OB5L 4X83A 1FFRA 2XOTA 5DR5H 4TUOB 4LARL 4NO5A 1WIPA 3TH3T 3I6GB 2D7NA 4YBHA 3RZCA 3VCLB 3TVMD 3QO0B 2F53E 1OTTD 2XQYG 4MSWB 5DHYA 2AQ3A 1A1NB 2DAVA 4MQ7A 1NCAL 5FYKH 2XXMB 3BISA 2E9WA 3O3UN 3DV4A 2GTWA 4MXVF 1I85A 1WWCA 2M8XA 1RURL 2I25N 2VC2L 2VISB 5F3HA 2BDNH 5FECA 3C8KB 5HYEA 2ZWLT 4LPXA 2AEWA 3EYVA 5DMIH 3L3HA 4MNGA 2XG4A 2YUWA 2X1QA 4I0CC 4BH8B 1NMAH 3MLSH 1LEKB 1CFSA 3Q3GA 2UWEF 1JPSL 4ZS6D 3V6OA 3HC0A 1ZHLA 1ES0B 5E2UL 4JN1H 2HFGH 3IDGB 5E0QA 3BKCL 3MRNB 4CW1A 4KUCD 1BD2D 5A16B 2JJTC 4TYUA 5B8CC 1H3GA 5H94A 3BXNA 5DEGB 4I3RL 3SDXF 1DLFH 4HJJL 4YNYB 2AV1B 4OZ4B 1LD9A 4Z8FL 1FG9C 1NANH 4R9HA 3ULSB 1BD2A 4O9HH 4JGUA 4O58L 4X6EB 2FJHA 1K2DA 3DX7B 2ZKHH 1U9KA 5JZ7C 1WZ1H 3VWJB 4PGDB 5CLWA 3O4OB 4XXDB 3UTSB 1JPFA 4XP4L 2A9NH 4I3GA 3RX7A 5K9KA 3SJVE 4F9LA 5HGAB 4DKFL 3K8MA 4PJFA 3NABH 2Q86A 5GS0D 4R97B 1W72A 1JV5B 1YA5A 1CFVL 3ARRA 4OM0H 2GK0A 4Z7WF 3F12A 4Z9KB 2FEEL 2VAAB 3GK8L 1CD8A 1CGSL 3P4OB 4XZUA 3PGDB 5BXFB 4PRAA 1NDMA 1FL6A 1IMHC 2YA1A 4NQSB 4ZFOL 2Q7YB 1W8NA 3P9MB 2CRIA 1GJIA 4JFZL 5EPMA 5D71L 4PRNB 3SGKC 3IJHA 2V9QA 1TJHL 4OZGA 1BJ1J 2WQRA 3IAGC 4WFGE 4UDTB 5B39A 4L29A 1I9RH 35C8H 2D7TL 1QA9B 5EU4B 3ZKMD 1A7QH 1VENA 2D2OA 3QH3B 4DZ8B 3LRSA 4HIJA 4GKSB 3UTPE 3UPAA 5E6ID 5C8JB 4GW5B 1UZ6F 2C7UA 4Y2DB 3KPMA 2X1OA 5CIPH 3ULVF 4XNZC 4YIQB 1U91A 1DBJH 3D39E 3BKJL 1ULVA 1I9IL 3WYRA 1I7TB 3HNSL 2DD8H 1BD2E 4CNIB 3DX8A 5IHLB 2OLDA 3FQUB 3ARBA 3BKYH 5AWNH 1KEML 4X7SH 2CXGA 3WO4B 1V05A 2IH3B 2FX9L 1T21A 3QIBB 5DJXB 1GHFL 2BCKB 2OI9C 2A9NL 3RVTD 1N8ZB 3FQXA 2YA0A 1UH4A 3U7AA 1KJ3L 1JGLH 3RGHA 5HGBA 2VZVA 2CIKA 2HJFB 3SJVD 5IVZA 3BRFA 1T21B 2WBWB 3QDME 4Z7WE 3V6ZB 4XPGH 1DE4B 3MV8E 5D71H 1DE4A 3X12A 3SDXA 4G8GD 2HJKB 3VFTB 5J9PA 4R4FH 2ZSVB 1VADB 4UV7L 2Q20A 4GSDL 3CMGA 1IVLA 1N2RB 1J1XH 5F9AC 4M61A 5GS1B 3T65B 1ZHKA 1MJJB 2F19L 4HS8H 3BN3B 3MNVB 1U8IB 3A67L 3DURB 5FM5O 1C5CH 5HHXH 5ICXB 2X7LB 5HHMD 4CN1A 5LXGH 1SVZA 3V8CA 2COQA 4QRSB 5EUKA 1MFEL 1EHXA 1L7IL 3PHOB 5IEHA 5KS9F 3T0EB 1CE6B 4ORGA 2NNAB 1CK0H 3P0VL 5C6PB 1D5BB 5BMFL 3LCYA 1MCIA 1A02N 1PY9A 1A4KB 4LSTH 4OGAC 1MNUH 1O0VA 2D31A 5EO0A 3RDTC 4NZRL 1CXLA 5FYLL 2LABA 4HLJA 1CICA 1TQCC 4LEXH 2IH1B 1FRGH 4YHYC 3RWHA 4L8DB 3ZDXE 1SYSA 4G6MH 3VFNB 1KJ3H 2KZ1B 1GSMA 3ARXA 1AP2B 5AZEL 5HD8D 4GG6E 3IAPA 2DS4A 4FXLA 1RK0B 4DZ8A 3HMWL 1T20B 1FFOA 4PRDA 5CEXB 3VXSA 4P4RA 3BE1H 1EBPA 4QY8B 3DX7A 2ED7A 3HI6H 3N1QC 2A73B 2A1WH 1NC4A 5ISZB 1FFQA 5CLTA 2PO6D 3QPXH 1BAFL 3TT3H 2YUVA 1VGKB 4HQQH 1GCFA 4DOHB 3SGEH 3C60A 2ZUVA 5F71A 5E00A 4ORGB 2F9BT 1VHPA 4MD4B 5IROC 1I7UA 2IGFH 2GY7B 3QQ3A 3OKKA 2EIZB 2H32A 5J0BA 1AIFB 1JPSH 5I73C 3TLRA 3U6RB 4S2SA 5D7IA 5GIRA 5TFSL 4WW2A 4JO1L 3R4DA 3FMGH 4JVPA 1WBYB 5GSVB 5L9DH 1GGBH 3GSOB 4JPWH 3O3DB 4HJJH 4MS8C 3L7EA 4NN6C 4YHOH 3RWFB 5HY9A 5T1KB 4PS4H 4MXQC 1WUNT 4M7JH 4OJFH 5DD5L 4KI5F 2NZ9C 4OLYH 5I8CA 3LKRB 4RA0C 3FTGB 3CU7A 1G7LA 5H37G 1IBGL 3RJQB 5F1OB 1AD9B 5GZOD 4X9BA 3EYSL 3D18A 4FHBD 1VGEL 1B90A 2RFXB 4X7FC 4KTYA 3KPNB 1JMXA 3JV4A 1QSFA 4O2FA 5L7XL 5E99L 5EWIL 2ZSVA 1A6WH 4Z7UA 3WEXB 3WL9B 2XKUA 4X4XA 1HYSD 4IDJH 3BUYB 3VD7A 5I71B 1MSPA 4V1DA 5EU3A 1RJYB 3LHPH 1EFXD 2CPCA 3IS1X 2AEQH 2AXFA 4UV4L 4N90D 3TA3A 3BO8B 5IUSA 1BIIB 1MAML 2GAZB 4LGPB 2PETA 2EDTA 3MUGB 4L1DA 4POYA 3SKNB 2DJSA 4Z0XA 2E27H 2EDHA 3FN3A 3FB5B 3MLXH 4ZFZA 5SX5H 4HF5L 3DRQA 5JMRA 2XKSA 5IG7B 4D3CH 5K9QI 4PJGF 4NUJB 5D72H 1J8HE 2ADFH 5T5NF 1K5NA 1P84K 5IHBA 5AYQA 3LH2L 4X5XA 5D7LB 3VI3F 3DNKA 4MXWH 1A14L 1A2YB 4Q6IB 2DD8L 5CILL 3GSUB 4PS4L 3PQYA 1EEUA 4K9EC 2DLFH 4R4BB 3RIFK 3RIAK 2R1YB 3FQTA 4QRUA 3QRFM 3O0RH 2MCPL 1QFUH 3LIZL 1N59B 4PB0H 3OAZH 4HWBH 4LCWE 1XF2B 1IT9L 5FK9B 1V8HA 3ARBC 4OZFA 2E6QA 1R3KA 5C0BA 4ELME 5J11B 3EKCA 5D5MF 3AREC 2D7MA 1SJVA 2DQTH 3S34L 1I75A 1EXUB 3BWAB 3CFBA 3LEVH 4BSVB 3WIFB 3LEXA 2GITA 4ENED 3P9MA 1XCQB 3UC0L 1XCQA 4PJ8D 3JTSB 1FZKB 5KW9L 1PX3A 3D9AL 3LV3B 4D9RD 5TH2B 5M95B 5TDNB 1VA9A 2ORBH 1MOEA 1TTFA 1ZT1B 1PKQB 2VB5A 1J05A 5HGDA 3DXAB 1KN4H 4K3HA 1CFNB 2CRMA 1NCCH 3E3QC 1FE8H 3BZFB 3MLTA 4QXUH 1CTNA 1S9VB 5DRWA 5DJYA 4U1LA 4QXGH 3UBXB 3T0VA 4XCNA 2C3WA 3CFDA 3G5VB 2DMKA 4HAGA 1LO0H 4LCWB 4EDXB 1SY6A 3KDMB 4NN6B 2AJUH 1ZHNA 3QUYD 3B5GA 1MNUL 1QFUL 3LIZH 4PB0L 3MCLH 2XKNB 2V6HA 4G6JL 2AJXL 3DI3B 3LS5H 3QDGD 1JZ6A 1CQKA 4WNQA 3TNNB 2YEZB 3TPUB 2R0WH 1YUHB 2H8PB 5F7YC 4OM1H 3ISWA 4WW2C 2W1NA 3P0YH 2V5TA 1MHHA 1JNNH 1U8OA 1ETZA 3O8XC 5EFIB 1CXHA 4FP8L 5CJOL 4ZQKB 1E28B 4UBDD 2OR7A 3NZ8A 4OBSA 3ZTNH 1BIIA 1YY8A 4FOMA 3SGJC 4JFHE 2FLBT 3E6HB 5CEZH 3TBVA 2DWEA 3V6OC 3MRBB 3L5JA 4J12A 5FKPB 4HG4J 3VCLA 3X14B 5HHOA 3D69A 4MA7H 1JWMB 4M8QA 1YY9D 4NP4H 4XNQA 2DKMA 1S9YA 5I2IA 1OTSD 4DVRL 2J5LC 3H42L 3RAJL 4BQ9A 4MDIA 5DI8A 1FORL 1UB6B 1ZGLB 1XIWC 2WINB 1U6AL 5JDSB 4HEPG 2R4RL 3S5LB 2R1XB 3HPLB 5D2LB 1T1YA 3TJEL 3MFFB 4NQXB 2DB8A 4APQD 1NCUA 3MLWH 3O3EB 1S9XB 3QULB 1EFXA 5E5MB 3MGTA 1HZHL 4N0FA 5CWSA 5BS0B 4NGHL 1T80A 2YWYA 3GMLB 4OGXL 1TTUA 5KSBE 2V7HB 4HX1A 4NZUL 1BVLA 5ACLA 1PDKA 3IDYB 1AGCB 4EUPH 1TJIL 3D85D 1X5AA 3IDNA 1MQKH 5IWLC 4FP8H 1QA9A 5EU4A 1J7VR 4DCQA 2EDFA 4XP4H 3MXWL 3WHXA 3RWEB 4XPAH 5EU7C 3UTTE 1MFBH 3KWWA 1CCZA 2PYED 1E6OH 1VFAA 3P30H 4EVNB 2QHRL 4PRNA 3PDOB 5BRZA 1W0VB 1H3VA 1FO0A 3VFWB 1ZHBA 3HMXL 4HMCA 3NIFF 2HTLD 4C58B 1DBAL 1TJGL 3WIHL 4DQOL 4MQSB 2LTQC 3CZJA 4P99A 1CLCA 1Z9LA 2ZJSH 3FFDB 4HUMB 3RA7L 1ZSDA 5GGVL 4HKZA 5GGSY 5HXMA 3C6LA 4L8CB 1XGTB 4U31A 3LEXB 4OCRL 5EBGA 1UWXK 4PJIF 5D1QD 4P3WA 2G2RB 3QA3B 3MLWL 4FZEL 3I2CL 3X13B 4CADB 1MVUA 3ESVF 1YYLL 2X42A 3RDTB 4HUUB 1HCVA 3CD4A 3MACL 3REWA 3KPSE 5KVEH 1A9EA 3MLZH 3RVXD 5E9DB 2APWA 2UWEE 4YBLB 2R0LL 1F3JB 4HH9A 2WBJC 4OT1H 5L2KA 5L2KD 1SJEA 4A6YH 1MFDH 1KSRA 4OD1L 3MRJB 4XVSH 2L4OA 3KLAB 4POZC 3NIDE 1QHOA 3KPQB 4CN6A 4P5KB 5GS1A 2YD7A 3BZDA 1B0WA 4PJGA 1R3HA 2Z8RA 2A74A 3U0PA 4QRTA 3AREA 4QO1A 3MYZA 3O3BA 5IR1B 2EIDA 1IAIM 2OR8A 4MQ7B 9CGTA 1G6RB 1VKXA 1AXSA 2R2HB 4OD2B 1X6LA 2Z35B 2IPUK 2XWJA 3G6AB 1F2XK 4GT7A 3FRUA 2X4SA 2GAZA 5HHOB 1VSCA 3E3QE 3STBA 1R24B 3BDXA 5I8KH 3N9GL 5F7WC 5C86A 4X6CA 4JG1L 2BOCA 3KAAA 4LCIL 2DI9A 4KTEH 3W0WE 2EDBA 3KVQA 3KPSA 1F8TL 4LLDB 3VH8G 3HRZA 4IOIA 3V4PL 3TCXA 4HZLA 1INDH 2HT3C 1ED3B 4EIZC 3TVMA 5E03A 1CK0L 3P0VH 4U7KA 4NZDA 4BUGA 1CBVL 4M9PA 3LMJL 4YXHH 1CFQA 4RWYH 4RGMC 1A1OA 4PJ5B 3GGWB 4LHUD 1WLHA 5LKNA 1JFQL 3OHXA 4RGNE 1MFAL 2EC9T 4HUWB 4BKLB 1RY7B 4ETQB 2XZCH 4RX4D 5GGSA 3QDMD 1HN1A 4MAYA 4UDTA 4UZGA 4FABL 4F3FB 3SDCC 1BEYL 5J11C 5MERB 4PJ7A 5JNYA 5C9KA 4H0IA 4JM4H 5HGDB 3GMMA 3BN9D 4OZIE 5E6IB 5I17B 1PKQA 1FL3A 1N64L 4ALAH 3ES6A 1WISA 4MJID 3MV9D 4Y4KA 5I19H 1RMFL 5TDNA 3H3KA 1Q0YL 5GHWL 2CRYA 3VWKB 4KTDH 1JZ3A 4OCNC 3N9GH 3MA7A 3W0WA 2LVEA 5E6IA 5I17A 2BVYA 1RK1A 2NY6C 3PWUA 5CEZD 4K55A 3BEVB 4LSVH 3BZFA 3MLTB 2FJHB 3IKKA 4UIKH 3JSSA 2V7NB 4LLQB 4LAQH 4UTAL 1VEOA 4EUPG 5IOPB 2HWZL 4TNWF 3QIBD 3S4SG 3QT2A 1BJMA 2H9GB 4JREB 4PGCA 5HSFA 3V5DA 2ARWA 5D7JD 3T4YA 3V5HA 1H8OA 1UWEH 1YMMA 2VXUL 4PR5B 3LMJH 2L7UA 4UT6H 4WUKL 5HPMA 4Y8AA 2AJYH 4QHLB 2DQIH 3FQWA 1S5IL 5FUZH 3C6LC 1IFHL 1FL3B 1FSKC 1IGTB 1FZJA 1OP3H 3VXNB 3VFVB 4EN3A 1NCDH 1KPUA 2YUXA 1F90L 4D9QE 4HV8A 3CVHH 2IQ9L 1A4JA 4JO4L 3ARTA 3OR6B 1FAKT 1AGBA 3H7BA 3MRKB 4JY5L 1KIPA 3QUYA 4U1MB 1VGEH 2FGWL 2ICWB 4Y5YB 4GQ9L 4U6XB 1IL1A 2ZSWB 3BPOB 5DJCB 1U8LA 4KK5C 4ZOEA 3NGBB 5HHMB 4IDJL 3GSNA 1MRFL 3AB0B 4JFFD 4Z0XB 1KXVC 3C09C 2EYRA 5F7EH 4UV4H 5TF1L 1CF8L 4DKDC 5EORL 2R2HA 4KKBD 4YC2B 2BVEA 1T7YA 4PJIE 1DDHA 1H3XA 3MCG1 2GJ6A 3SKOA 4GG8B 4HWBA 2DQJH 3S37L 1EHAA 2GCYB 4K3JL 1FYTD 1OARL 2DRUA 1AGDB 2J3SA 5HJ3B 3SDDA 3NA4A 1JMZA 5IB3B 2VLJB 1QLRB 3DV6A 4MJ6A 3DRQB 3ARYA 2C3HA 2P8PB 5FM5M 1N5YL 1WBZB 3SE4A 1Q9KA 2V9TA 4K7FA 3AY4C 4HC1H 1S78D 1FV1A 4N9GB 1I8MB 2HTKD 4Y19B 2VZOA 2VLMD 1P4BL 1N0XH 4TVPD 5DJZB 1RI8A 1I3UA 2C3GA 1DSFL 5J8OA 4FQXC 5C07D 1S8DB 3KLHC 2AJSL 3OMZA 5C0DB 5LGHL 1YEHL 4XXCC 5TE4H 3C08H 1D5XB 2YPVH 2P5WD 3TEUA 2CUMA 2ZUQB 2DJ4A 3FFCE 4FN0A 4X4ZA 2APBA 3PGFL 4HC1A 5GRUL 4J3VA 3QEQE 1H8SA 1KCRL 4PRPD 3VXTA 3LRSB 3MLVH 2DLEA 5LJYH 2PW1B 3O6LL 1QACA 4EOWL 1BQUA 4XAKD 4Z7QF 4NC1C 1DVFA 3I02A 1EJOL 3AU1B 4WU5A 1F4HA 3IJHB 3KYKL 2VO5A 4GW4B 3ARUA 2P44B 3VFGH 4HZAA 4NCC2 1V7ML 4KVNL 1MELA 5F7KC 1KCKA 4X99A 3RY4A 2DDQL 4BSVA 5HDQL 4F7MA 5EBLB 3OAZK 1F8TH 1H15A 4YHML 1DTUA 3MRMB 4U1KA 5GSRB 1N7ML 3QQ3B 1NGXB 2FDBP 1OAKH 4NBZB 1JI2A 5TH2A 3OKDB 1NLDL 2Y07H 3QAZC 1D6VL 4Y4KB 2NCMA 4FMFA 3GMOB 4KMTL 1UFUA 3KYAA 3TIDA 1M1SA 3MJ9A 1NEZG 1Y6MR 3D39B 3PWLA 3WFCL 1BF2A 1MCHA 2JB5H 3DVGB 5T1DL 5SX5K 1MRCH 4RIRB 1OM3L 5IFJA 5LGJA 3I02B 4GXVH 3DSFL 2BSRB 3WJJC 5LGHH 3RVVC 1NAMB 4LRNH 5D2LA 1ZE3C 3VFUA 5EIIB 5TDPB 3KPPB 2H1PL 2ZOKA 4ZYKA 1FBIH 3Q3GB 3BPOC 1IC4H 4S1SL 3N0PB 4D9RE 5CCKL 4TNVK 4FG6D 4ZTOH 5JLZA 2GJ6D 2IADA 4WUUE 5CD3B 3RWJA 4OIIH 2XY1A 3MR9A 2OJEB 3NIFE 3BPLB 4KVNH 4L9DA 1FNSH 4FA8A 3DTXB 1UKSA 3LKPB 3VI4E 4XC1H 3ULVE 4PJBF 4NNPH 3R0MA 3NH7H 4JB9H 5HVGB 3TIEB 3TN0A 3QO0A 4JRYD 5CHNA 1FAIH 4G80A 1IAKA 5JDSA 4NO5B 1YEGL 2FX7H 1S3KL 3MBXH 2QQNH 4LVHC 1KXQE 2DQDH 1UM4L 1JUFB 1ZEAL 5KS9B 3LQMA 4FQJH 2XY2A 3CH8A 3TZVB 1AGDA 5HJ3A 3UO1H 2DQIL 1JL8A 2ATPB 1S5IH 5FUZL 1R3IH 4OUOA 4UUJA 4P5TD 5DMYA 4D8PA 3AS2A 5GS1C 2XN9A 2NY7H 2IQ9H 4CAGA 4H20H 3A0OA 3ESUF 3ARGC 2GJZB 5D1XD 1K3IA 1JP5A 1S7SA 1R3JB 3FT2B 3QQ4B 4ZDHA 2FGWH 1A1MB 5TE7H 2WZPD 4NDMA 4OZHF 1LEGA 1OSZB 3GSQB 4ZPTB 1QSVA 3ZYJA 1HH6A 3OJDB 4YK4C 3BZEA 4G8IB 1MCSA 4Z6AT 4ZNEE 3HS0A 5IK3A 3BIKA 4OZGB 1WTGT 1FNSL 3C60B 1OD9A 5GSVA 1EV2E 1HYRC 1NDMB 3S37H 3IJSA 1F02I 3P4OA 2XRAH 5H37H 5FYJE 4YHNB 5GGVH 3VXSB 5FFLA 4K71C 4KQ3H 4GLRH 2DQHL 5JA8B 3EO9H 1NAMH 1ZMYA 3QH3A 4W4OC 4OCXL 5AD0B 4WI7A 1DL7H 3NFPA 3PWNA 2FX8L 3U4EA 2IG2L 1OTUC 5KVEL 2BOBA 12E8H 5I18H 4H26B 1LNUB 3MA9L 2O5YL 4KHTH 4NRZB 3UMTA 3DYPA 4KK6C 1VFAB 2LVCA 5FUCE 1E4WH 4LCUA 3GUTA 4ELMF 5GISL 3F7VB 2Q86B 3BH8B 4PRHB 1UA6H 5E2VL 3QUXC 5EU6B 2X2YA 3DVNA 5EULV 3T0EE 5B4MC 4NQDD 5HGHA 4BSJA 4GRMA 4X0KA 5ELIA 3VJ6B 3MRQB 1INQB 2NY3B 8CGTA 5GRVK 4EBQH 2XA8H 2FR4A 5ID1A 3VDBA 1Q9LB 2NY6B 4JN2B 3WSQH 1IRAY 3ZKSD 5DUMH 1JE6A 1NC2B 1CFVH 1VADA 1YEJH 3DV4B 3OAYH 1EEZB 4G7YL 3TVMC 3TBWA 5D7LA 3OGCA 5D2NC 4UI2A 4FTVD 2AGJH 1A7OH 2RQ8A 43CAB 1YECH 2CQVA 2XZQH 4GRLD 5LVEA 5F3BB 4X5LA 1IKNC 3UEZA 3I6GA 4NUJA 4LNVA 4H1LA 3T3ME 1MCBA 5ISZE 4W68A 4AEIL 3VI4F 5JZ7D 3X11B 1OQOA 3D85B 2R2BB 2EH8L 2ARJA 1JHTA 4RAHA 4XPTH 3BO8A 3WFDH 4OZFG 2HJKA 2WP3O 1MWAB 1YZZA 2HN7B 2BC4A 3OB0H 4QRPA 4GG8A 4X6FA 2CDFA 3PWJA 4Q9RL 3WXVH 5DTFB 1D9KB 32C2A 5IB1A 2GUOA 3E8UH 4RFOH 2YD2A 4UUJB 4ERSH 2AV7A 2W9DL 1RZ7H 4YBQC 1RIVL 5BZDB 4YEFA 3I50L 5JHDE 1CVSC 2YPLB 1KF9B 2CDEB 3IYLW 4FQLH 5DK2B 5CJQH 4PG2A 2VDQL 2H1PH 3H3PH 5IT2H 5MEPA 5F96H 5I1CH 2GSIA 1BOGB 5JHDD 1EEQA 1U8NA 2FYYA 1FL5A 1MCOH 3BI9X 3ZMRA 3OX8B 3TFKD 1ZGLP 1LO4H 5F3BA 1YNTA 5FYJL 2H32B 4M1CD 1A8JH 1KTLB 3HLAA 1IGJB 4IRJC 3IGAB 1LGVA 2DYPB 1C16B 2NW2B 2AI0H 3C6LD 4OIIL 5D1QB 1DUYB 2KQMA 4OZGE 3THMH 3HE6D 3RWFA 1QYGH 2Z8VC 2ZNWA 3LKNB 5DJ6B 5FCUL 3WMSA 3HUJA 4YDLC 4LVOB 4ONHA 2JJUA 5ISZA 4O5LH 3V0WL 3FN0H 1WZ1L 5A2IH 5KJRH 2X1PA 2EKSA 3NN8B 5C0IB 1KB5L 3F8UB 1Z3GL 3JZ7A 4P2OD 2W59A 4Z5RB 3LRGA 3WN5A 3DVNB 1WZMA 3A67H 2ZCLH 5J1AB 4L29B 1R3IL 1KJMB 4P2YA 4PV9B 3GMQB 4P59H 4AEHL 2FB4L 3SCMA 1IC1A 4LGSB 1B0RA 1T0MB 1DQTA 5AYUH 3VXSE 1U93B 1B0RB 5FEBA 3GSNH 4Y5XB 1MCDA 1BP3B 3DUUB 4YDIH 3QEQD 3M1BB 1FFOB 5DEFB 2HT3D 3W2DL 2UZXB 2DJUA 2F15A 1M7DA 1QG3A 4M8VA 1XR8A 2JIXB 4QRSA 4HUVA 4ZPVB 4DW2H 3UJIL 3VXMD 1L7TH 1YEDB 1JIBA 5F97E 3S4SA 1C5BL 1RUPH 5CEYB 4K94C 1SJHA 4Y16A 4PREA 1Y0LA 4MMXC 4BZ2H 1QYGL 2BMKB 3L3DB 2IBZY 4OQTH 1EHNA 2Q76B 2UY6A 4Q6IA 5D2NA 4I77L 2R15A 1IGYB 3Q5OA 1CF8H 1W0WA 1HINH 4IJ3B 4I18C 3NACH 4M00A 4TQEH 4EDWL 4YHKH 2ATPA 3ROOA 3HZKA 4QT5B 3RWCA 4FXGA 3DETD 3ZSSA 1Z3GH 4TSBH 5MEND 1D5XA 5F7LB 3T04D 4DVBB 2D7TH 5T3XL 2WM0A 2EC9U 1NH6A 4KJPD 5C0DA 1AFVH 3CDFA 5C08B 1F3DJ 1N8ZA 1T0PB 1DFBL 2ZG3A 2W38A 2R1XA 5BZDA 2FECI 5ALCH 4Z0BL 1A7PL 4S1DC 5KSUA 4HHAB 4Z18A 1FDLH 2A9MH 4PJ5A 2AAVA 1UJ3B 4HC1L 3W11C 2HN7A 4QRPB 3C60C 3ARZA 4YDIL 1IAIH 3AMLA 2HMID 5HHNA 1QSFB 3ZKXC 3MO1B 1IGFH 3QDGE 4TUKL 3MRGB 1YMHB 4JDZB 4JLRA 2WUBH 3RTQA 2QTEA 3VXRA 4F15B 1I7RA 4HFUH 3ARGB 4YFLI 3QUMB 2P43B 4OTXH 1G0XA 5KZCB 4TSAH 3DECA 1F3DH 3MRDB 4HXBH 1XF1A 1MPAH 1T1XB 1CD1A 1ADQA 3PGFH 3I84A 3OZ9L 2Q8BL 5SWSB 4PTTA 1BZ7B 2BY2A 3UTTB 4D0CA 4N5EC 5BQ7A 5CUSH 1HI6B 3LS4L 5DEZA 1A7OL 2CO7B 4KRNA 1DVFD 5TGBB 4RZCA 5J7CC 4F7EA 3IS0X 2VRAA 4NPYA 1A9EB 4KXZH 2EDQA 4LMQI 4YWGL 2CD0A 4TVPH 1CDGA 1KJ2B 2R39A 1MHPH 5D8JL 4YHMH 5D93B 5A2FA 4F58H 5IFAL 4U1KB 5HHXL 1QFOA 4M1GL 4PJ5E 5ALCL 1VCAA 2NY3C 4XPFL 4ZUUB 1FDLL 1MJUH 3OR7A 3PXHA 5TE6L 3S96A 1I9EA 3ZDZE 1BAFH 3NA9H 3RX5A 3VXNA 1RHFA 3O9WA 4X9HA 5DDHA 1PLGL 4U0RB 5TDOA 3QXVA 1J8KA 3UX9B 3F62A 2Y06H 2BVOB 2HVJA 4V2CB 2CLVB 1ONQA 1Q1JH 1P4IH 3NFPB 1MRCL 1OM3H 4YK4B 3HMXA 1ZA3A 2BVPA 3HZYB 5I1GL 4NYLA 1CFTA 1JCKA 3C2AL 3O9WB 5SWZE 3X13A 1ZOXA 5E8OB 1T3FB 4KMLB 1WIUA 4NZJA 5ANMB 4HIHB 1P5VA 3VG9C 3PWPB 3M17A 3D3VA 4X6BA 3WJLA 1QO3B 1OAQH 3EFDH 3L3JA 4ZAKB 3FHQA 3L9RA 2I9TB 2VLJD 2A6KB 4N0UA 3ELAT 4P2QB 1YNLL 2GJJA 1RJLA 5DMGC 3DRTB 5KANI 1KFAL 4CW1B 5DVNA 5TJWK 1JGUH 3OKLB 1A6TB 3QUZB 5KJRL 4LLUB 1GXEA 1P53A 3A6BH 2HRLA 4YHZH 3VXPB 1U3HB 2W0PA 4R2GC 2JK5B 2BNQE 5IB5A 3TVMB 1MCWW 4PJGE 3PQYB 2NR6D 1A1MA 3P40A 4ONGL 1B9ZA 4GAYB 2VYRE 4Z7OE 3QUMH 4G9FE 4RDQF 2ZUTA 1CL7H 4N68A 2VQUA 3MV11 5HI4C 4QYOA 5FECB 3HCVB 3QHFL 5INDB 4OM0L 1U8NB 1CDCA 4MCZB 4GO6B 4HXAH 2EECA 4JPWL 2DTSA 1NBYA 4WCYH 5CKGA 4U6VL 4YX2L 5L8JB 1R0AL 1C1EH 4H20L 1T2XA 3U30B 5L2JA 2RB8A 1TCMA 3B9DA 1GGUA 3WHE1 4OLYL 2ZUUA 35C8L 2A83A 3C5ZC 3HRZB 5D1ZA 2DWEB 1D6EA 2BC4B 4Z8FH 2GK2A 5INCB 3QG7L 4I0KA 4KKLD 4P2OC 1MRDH 4KI5C 3MV7A 4QTHB 2CJUH 3WLWC 1OAXH 4LIQH 3UTSD 3VD9A 3OKNB 3QXWA 2F54E 2ZCHH 1Y6KR 1MHEB 5DURB 2BHUA 4DKFH 1KG0B 2EEBA 4TN9A 3S36H 4AENB 4WI9A 1KIQB 2UZIH 1CQYA 3FO9A 3PL6B 4Y4KD 5T3ZD 3S88H 4K3EL 4AMKL 4DK3A 3QNXB 4DVRH 4GMTL 1S5HA 4ZQKA 1MVUB 1OWRM 1TZGL 1L6XA 5DRWB 3EW3B 4R0LB 4NN7B 1EPFA 2ICES 2B0SL 3QHFH 3AM8C 1IILE 3SBWA 1KLUB 5C71A 3M17B 4MQTB 4V1DD 3MRQA 4KJQC 5C09A 1JF1A 5FOBB 4WFED 3BX7C 3UC0H 2VIRB 4KHXH 5JIKA 2CKNA 1IEBA 5IHUL 4MXWL 1E0OB 4N0YH 4MNQB 1A3LL 3CXHK 3EGSB 3BRGC 5BRZE 3ARDD 3E6FA 1IGFL 4L8BB 5I66A 2WV3A 3QCUL 1CXFA 1KPRA 2FZ3B 1G7IB 1G0YR 1FN4A 5FO7A 1TVHB 4GSDH 5AUMA 1G9NC 3NVQA 3SO3C 4OTXL 4NO2B 5I1EH 2VH5H 4M7ZC 2DQCH 5IBTL 5D6DA 3SCMB 5F7HA 1T5WA 2E7CA 5K59F 2VDPH 4X98A 1T5WB 2P5WE 4LU5H 1C12A 2FX9H 1T3FA 2VZUA 1J05B 4QWWD 4XP6H 5BVPH 1OW0A 4NYLB 2PCPB 15C8H 3OAUL 4LLAA 1K9TA 2ESVB 4AQ1B 1JGLL 3OXRA 2NPLX 4XPBL 5ECJE 2B5IC 1S7RA 5BMFH 3OBAA 4G7YH 1IM3A 5GRXG 2Y6SC 4NFDA 1T03L 2VXTL 2VDMH 4YHLL 5BO1H 4RMQA 2UWEA 3MJ7A 4Q2ZA 2HTLC 5DT1L 2CR3A 1LE5A 1QNZL 1BHGA 4JFQA 3I6LD 4J8RA 5DVOA 3PF2A 1T1ZA 4EI6B 3NFNA 5GGSB 2IAMB 3GI9H 4JFXB 3ZE0F 3HUJE 5JPNA 2F58L 3O8XD 3RUGF 3UTQA 1QR1A 4AK1A 3CDYA 3SE3C 5IFHH 4UBDC 1S7XA 1RZGB 3HN3A 4LPTA 3LDBB 4LL9A 1QFHA 3F7QA 5DHYB 4OLZL 2VITB 4R6UA 3RIAF 1YYLH 2A83B 5B39G 5GRWA 2V7HA 5KSAD 3UYRL 2APXA 4WU7B 3GMPA 2KL6A 5DK2A 2D4DA 4JO3H 5IKCB 2VJXA 3KJ6H 3QQ4A 4MJIA 4L4VE 4XC3L 3BGMA 2Z8SA 4D0CB 4PP2A 1NBYB 5I1IL 4HS6A 4EQ3A 1LEIA 4MCZA 3C87A 5IBTH 5E2WL 5I1AA 2AABH 2FBOJ 1WFTA 4PLNC 3RWIA 3LN5B 4K94L 1T1XA 4OM1L 5L0QC 1DQMH 2P5EE 3IB4A 3J7HA 3JUZA 4AG4L 1D6EB 4QNPF 3QDJD 2E9JA 5IHZA 4K2UL 4Q6IC 4PLOB 3X3GH 5DRXB 3UZEA 2IQAB 1JWUB 5EOCH 1DUZA 1M4KA 4UIMB 5DC4B 1AGFA 1P7KB 3G5XA 4W70A 5IB2B 5F9OH 3V4UH 3IU4H 4R3SA 1TJIH 3ARBB 4X6DB 2VKXA 1RZ8A 1SHMA 1E4KA 4P48A 5DD3H 1J0KA 1R3HB 3S97C 1U2CA 2DM3A 5IW1B 2G2RA 4G43A 1P4LA 1V7NL 2P46B 4KKBC 4PRHD 1EBAA 3P4MB 4LQ1A 5GS2H 2A2QT 1EEYB 3CCHA 4M43H 5F93C 5M7QA 1FLRH 3JV6A 1ZSDB 3TJEH 4QTIH 1CGVA 3RZCD 1A6WL 1CFTB 3LPFA 4Y5VC 3JXAA 4DJMA 2X4NB 3MXVH 4QKXB 5TFSH 1T22B 2X70A 4CBPA 1VACB 3RP1A 5FYJU 5AAWA 2XI9A 1P2CB 4GQPH 4JANB 3MV9E 5E2WH 4JN2A 1EO7A 1PGRB 4NQTA 4P2CG 3IU3B 2KQNA 3QJFB 1JFQH 1UM6H 4E5XB 4NO0D 4FFVD 5C0CE 3BMVA 2G60L 4FTVB 4KDTA 1OW0C 1YEKL 5JQ6L 1RUAL 3X3GL 1ZV5A 2NXZC 4GJTB 4K8RH 4HUXB 3GSXA 1ONQB 3ROLB 3BH8A 4PJHE 1ND0A 4G3YH 2Q3ZA 3MTRA 2AJZA 5E8DL 1WZLA 5CILH 2ITCB 1T7ZA 4LKXB 1N64H 2P7TA 4ALAL 4NRZA 3BT2L 3RNQB 1YMME 1GGYA 4GRLA 4AL8L 4XVUD 5CZXC 1AC0A 1HINL 3NACL 5FYLD 3V2AR 2V5YA 4FNLL 4LDEB 1EFXB 3GO1H 3VGFA 5HYIA 5IGXL 3RL1A 3CNKA 5T5NG 5LWYL 4WEUD 1KTDA 4JY6B 5DF0A 1WAAE 4N0UE 4D9QD 4LHJB 1Y18B 2ADIB 5HDOA 4Y2OA 5HYJE 1Q8MA 5F70A 4XVTH 1KB5A 4BH8A 1KTKE 5B38G 4P2QE 4N0CC 3CK0H 4KQ4H 3DLQR 3FL7A 5GGRA 2C26A 5JPMA 4NJAH 1DQLH 3AFLA 5JDJA 4CU7A 5BS0A 1AJ7H 1HHGA 2ICCA 4YFEA 4C83B 1D5ZA 4L3CA 4OV6F 4HIEB 4G42A 1FGNL 3KHQA 4P2RB 5EZLB 1JHLL 2VTFA 1M71B 1CD1B 1CI5A 1MWAA 2P4AB 4XVSL 4RRPG 3LZFL 4HIXL 1A0QH 2BRRH 3S35H 2D0FA 3IXTA 1AGFB 3IVKB 1PKQE 3Q6GL 2WWKO 3SDDC 4I4WB 4AIZB 2Y72A 2VDLH 3D85A 3IDJA 1P5UA 4OGZA 3T65A 4AIZA 1SY6H 4P2OB 1CBVH 4GQ9H 1GL4B 1XZ0A 2VLLB 2QEJA 2Q6WB 1MCKA 2R69L 4P9HL 1JRHL 2ED8A 4J4PA 3GSRB 5KSUB 3CZFA 3KDMA 1F4YL 3PQYE 3VGAC 5DZOA 1WBYA 4JG1H 4YIQA 2ZPKL 4R96B 1AD0A 1OAYL 4FZ8L 5F21B 5DFTA 4ELMB 4LMQE 1HOCB 4W6WB 3F58H 4D0DB 2H8PA 1YQVL 3I3EA 4U1IB 1LK2B 3N1FC 4OFVA 3SPVA 1XH3B 1I7UB 1BFOA 5GHWH 3ABZA 4LCYA 5HI4D 1CD0A 4QXUL 4OFPA 5T1KA 3FB7A 1RJLB 1F00I 4RIRA 5EO1A 3B2UC 1LHZA 1CXIA 1CGTA 1QBBA 2ICWI 2VL4A 2XWBB 5E70A 4BFIA 3CFIC 3S4SB 3BP5A 3OJ2C 3LS5L 1PW3A 4ZUWA 2P49B 1CLZH 2CKBB 2IFFH 4GRWH 4PJ7F 3VXRD 5C8JA 1A9BA 6CGTA 1WWWX 4U4BA 1HXYA 3BH9B 1DCLA 2ZOLB 2EYSA 3BH9A 1HSAA 2FO1A 2VXUH 3L6FB 2XQBH 3JWDL 3UP1A 5F72S 1M7IA 1XIWA 3EJZC 1WITA 4XPGL 2X4UA 3P0GB 1CICB 4CMMB 4F8QA 1SEQH 5L6YL 4QRUB 1ORSA 3FOLA 2DF3A 4YHZL 3MQIA 3TF7C 3UPRB 1FN4B 5FO7B 2VZTA 1S7QA 2XYCA 1CT8B 5K33A 5E94A 3B2UD 4LAJH 3SDXE 4PJAB 4XMKL 4HUXA 1AR2A 4XNYH 4XXCA 5MEQB 1QSFD 2QR0A 3GJFK 4M43L 3GDBA 5GGUA 3S8WA 4QGYA 4HDIA 3L3GB 2MWCA 2FJGA 4JY4B 1MFBL 5FM4A 3IT8D 3QPQC 4P9ML 3ULSA 3NOIA 1MJJA 3MCKA 4UTBH 4LVNB 2CGRL 4ETQA 2DN7A 2PW2A 4UU9B 3BZ4B 5DQDH 3BFOA 1R5WA 1KJVA 3QUXB 4Y19A 4APQB 4NOBA 4MLSA 1S78C 4FFWD 1D9KA 2DM7A 4P2RE 3TH4T 1OL0A 3IGAA 5E56A 5FYLH 3U1SH 2YUZA 2PNDA 3DETC 2KPNA 3U0WH 2ENYA 3JWOL 2AVGA 5T3XE 3EZJB 1MUJA 1X5GA 5ICZA 4CDHA 4RFNC 4LNRA 4TUOA 1G0DA 3QZWG 2GSIB 2AK4E 5ABDE 1YMHA 1MCLA 3P73A 3ZKMC 1BVZA 3C09B 3BE1L 3EJYD 4DGIH 4IJ3C 1HHJB 3L3OA 3ARFC 2AEPL 4NKMB 2JCCE 3MNZB 5HI3C 1S9KC 3FQUA 2UZIL 2WLYA 4WGWB 5EOCJ 1OQXA 3TYFB 4WI2A 3KLDA 3Q0HA 1MFDL 3BZ4A 1KPVA 3JV4B 4FTVE 2CLZB 1B0GB 4U05A 3LN4B 2NXYD 2ZNXA 4KWUA 1UCBH 5A2JH 3GIZL 4JHWH 4POUB 5IF0A 4PRBA 4PY8I 1GOFA 4LKCB 2BCKA 3ZYZA 3CK0L 4JCMA 3UZQA 2WBKA 5C0ND 4JO1H 4QRTB 3PWPD 2EDDA 5FYJD 2DLHA 4XCCH 3TBSB 1N6QL 4LCUB 4RX4A 4RA3A 4R26H 4M7LT 2IEPA 1UWGH 2UWEB 3MJ7B 3VFMB 3QXTA 5KSAC 1QFWI 3BP6A 4WDIB 1RIUH 5CEYA 2BOBB 5CZXD 4QHLA 4PG2C 4ELKB 4AH2A 1H8NA 1M7IB 4OT1L 1DP0A 2HRPH 3UTSE 5JTWA 4F8TA 1P7QB 3GSXB 4PJXE 2V2WA 1OAKL 1R3LA 2MTPA 2AQ2A 1U8QA 3VW3H 2BSRA 1D5IH 1NEZB 2N56A 4YPJA 3BN9C 4U1SB 2X1XR 3PJSB 5DJ0B 3HRPA 3H0TA 3UTPD 1EO8H 1IGTA 4ZFOB 3FFDA 1JGDB 4LEOB 3H0TB 4W4OA 1T03H 2VDML 1P2CA 3DSFH 5IROA 3B2VL 4Z78B 4TPRL 5TQ2H 1EXUA 3VFGL 2YWZA 4XNMB 4DKEH 4E0RA 4GG6A 3LKSB 2EYSB 2XZAH 3FAWA 2NY1D 2JELH 3IDGA 4ZFGL 4H0HB 3WFBH 4OKDA 4MCYA 1BEYH 5E8EA 3T0ED 4N8VG 4XHJD 1U58A 2ZP0T 3UBXI 2CH8A 1JNJA 4BH7B 3TESA 1MAKA 3KJ4B 3FB6B 4OZ4A 1N2RA 5C08E 3X3FL 43C9B 5K9OA 2FX8H 4MA3B 3GMRA 3EO0A 3O2WL 4Y4FB 4PJBA 3SGKA 5KSVA 3LEYL 1UXWB 3RKDC 5C7XH 3GGWA 5BOPA 1Z2KA 4OFKA 3NAAH 4G8IA 3B9KD 2YZ8A 3ES6B 3VXTB 5JR1H 4D9LH 1XZ0B 2J1KA 1ED3A 1XGUA 4ZPTA 5GISH 4N0FB 5CWSB 4ZMAT 3KXFE 5EU5A 4M7KL 3O3EA 3LN4A 2IANA 3OV6A 3RGVC 5GRVL 2YK1H 3NZHH 2PKDA 5IHZB 1NMAL 4CJ0A 3D2UD 3KXFD 3RTQC 2VLJE 5J56B 1V3JA 4KROC 4MB5A 3QDMB 2EH7H 2AV7B 3CPLB 2OTUB 4Z7WB 5K59E 1QLFB 1VFOA 1ODAA 3MJ9L 1YPZE 2YPLE 4HKXA 4X7TA 1G7QA 4JDZA 1FIGL 5CBEB 1DEEB 4LFHG 1FQ9C 3B9AA 3F7RA 4NQEA 4XC1L 1T0NB 1XEDA 3ARDB 1FGVH 3EOBA 3GHBL 4UDUA 3MRIA 4KKLC 4JKWA 2MCG1 3O6FC 2D7PA 2I9LA 2M26A 5IMOB 2ICWA 4DUXA 4QXGL 4V1DE 3JTTA 3WCYA 1QQDA 2DTMH 3VRIA 3V52H 2IANB 1YN7A 3VXQB 1EVUA 1EEZA 1J0ZA 4KJPC 3O4LD 3HNVH 3LEYH 4PIRF 1KEGL 4OI8A 1U95A 3ZKXB 1MCFA 1MIEH 3GIVA 1Q9WA 5I1DA 5IEKB 1OP5K 4EXKA 1U8PA 3WJLC 1ZVSB 2XKNA 2AJYL 4WY7L 5CP3H 2GK0B 1UKTA 1TJHH 2W0FA 3RU8H 1X5ZA 1ZVHA 1YMMB 5FUOH 2VLRA 5D7SL 3ROLA 2ADIA 1L0QA 2PR4L 2V5MA 3U0PB 4XWGL 1ZLSH 4IS6A 4HPYH 4XX1E 5HD8C 1MH5A 2K1MA 4HWEH 2FEDD 1DJSA 3A6CH 3TBTB 3PL6C 4EI5C 1YEDA 3MRLA 4PJ8C 3KPSD 3MRHB 1JZ4A 1ZLUK 4RRPA 2UUDH 3WNMA 2I07A 3IDXH 4LLUA 2P7TB 5CP3A 4DOHE 1KNOB 4M93B 4PJDA 4GUPB 2EXYD 1X44A 3QEGH 2YXMA 4K9EH 5I66B 2AKRA 4XAWH 5EC2B 4ZSOE 4G9DB 5LAXB 3VFSA 2GW5A 2ESVA 2UVEA 5DHXB 2HP4A 3OF6A 1QSEA 3BQUB 1GOGA 5CBAA 2MQCA 3WHE0 4MA1B 3MLUH 1T0MA 3V8OA 1NAKL 5H8DA 1PG7W 3C08L 2LAAA 4YO0B 1F58L 5T3ZH 3LKQA 4OCXH 5ITBL 1KBGH 4FQXA 2VDKH 5DK0B 4I9WD 4HG4K 3BQUA 3QDJB 3AC0A 1UWGL 4EI5A 1I8KB 2IMMA 3DO7B 2XWTA 3HZVA 2AGJL 4XTRC 4JKPH 3GSNL 2N7BA 4OF0A 1H3PL 2FWOA 3V4VH 1J0JA 4X8JA 3LSOA 1FNFA 1CE1H 1IGIL 4M6AA 4PUBL 3O2DH 5KSBB 5DRXA 1BIHA 4EZMA 2AXJA 3ZKND 4Y19D 5TPWL 4ZDHB 5DWUH 2ICWJ 4JGMA 3UJIH 3QIWC 1KJ2A 4JR9L 2GJ6E 1UM5H 1NBZB 3CLEL 3MRDA 4KKCC 4XI5D 1TZIB 3VRLF 5GRJH 4DTGL 3GSRA 2NR6C 1MLBA 4ERSL 2P5WB 1AHWB 1BWWA 4P23D 4F7EB 3ZHLA 3G9VA 4YEEA 4JKKA 4KUCF 3R1GL 4XBPB 4AIXA 4QHUB 3KYOA 4A6YB 3REVB 3O6LH 1MJ7H 4KGJA 3WLWD 4GH7B 4I77H 3H3PL 5IT2L 1D7FA 1LO2L 3BAEL 2DLGA 5GS0H 5FO9A 3D0VB 4PJEF 4XHQA 2ZPKH 4YGAB 3V6FA 2H6PA 4PYGA 2G75A 1VPOH 3H7LA 4OQTA 3E2HC 1CG9B 3TFKC 2G75B 3MNWA 1G7MA 4LVHB 1IC4L 4LCWD 2EE3A 4L3EB 4JGJA 1J86A 4NC2B 5EFIA 3IFNL 5CINL 3DX8B 2W92A 4JCLA 4OB5H 3FN9A 3STLA 4YXLL 3VH8A 2J6EL 3L5XL 5DO2C 1G7HA 3D0LB 3D69B 3EYQD 1JBJA 1SJEB 3NAAL 4NCDA 4F9PA 5EBWA 5LCVL 4HKBA 3BD3A 3BPNB 1H3TA 1KENH 1P9MC 1TTGA 3L3KA 4J7RA 3T4YB 2YD3A 1U0QA 3ARFB 5EIIA 5I8OL 1OTSC 3QCTL 4WFFE 4JQXA 4IRJB 5EIQA 1VFBB 2F5AL 1HDMA 2I5YL 2ATKB 3C5ZD 4MWFB 4TSAL 1GVIA 5GJSL 1MPAL 5IW6A 5DQJA 4Q2ZB 4JFDD 4P4KA 4OZFH 4O51A 1W0WB 2DBLL 2LE9A 1JNHA 3F7VA 5FHBH 3VA2C 2J8UF 4JFFE 3V5HB 4TSCH 3B6SA 1BZ9A 4Y5XA 1HHHA 5CJXA 4CJ1A 2R23B 4L3EE 4LLVA 4JRYA 5T5FH 3RZWA 1A6ZA 4XCYB 3L3JB 5DJ0A 4M1DH 1WC7A 1FFPA 1C5BH 1RUPL 1FFPB 4RGMB 3MOBL 4WW1B 5JHLH 5CGYD 1WCBB 3ZHKA 5D1ZD 4OCWL 1LK3L 2LFGA 3HR6A 2MQ0A 4HWNA 2X89A 5DRNB 5IV2A 1UACL 5EBMA 3SE3A 2XIDA 1OB1A 3VXRE 3FO9B 3K7UA 3QIUB 3CFEB 4HX1B 4YZFE 4F7CA 2XA3A 1AC6A 4XNUH 2PYEE 5DRZA 3SCMC 5D96C 4M02A 5JNYB 1RZFL 3RKDD 5DHVB 3DUSB 1UADC 4ZO7A 5F7DB 2CIIA 3BQUC 4ZO8A 4FQ2L 4FABH 4D3CL 3FFCA 3EO9L 5IQ7H 1M6OA 3T77A 4HS3B 4R7DA 4WFFD 2ADFL 3ME0A 1FZOA 3OX8A 3EFDL 4DGIL 2EKSB 3NN8A 1AGCA 4NDMB 4BJLA 5IG7A 3PL6A 5JIPA 1N6UA 4JFDE 5ETUA 3BP6B 1JZ7A 1YNLH 1MI5D 5KAQF 1WICA 4O02L 2CDEA 3U9UA 1SM3L 1NBQA 4JZNA 5D70L 1KYOJ 2E9IA 5A2LH 3TYGL 1HH9B 3O2DA 3C60D 4M1DL 2J8UE 3WDJA 4I3SH 4L1HA 1QLFA 4HXBL 4Y89A 5KSBF 3HB3D 1J1OL 1TZIA 3P9WB 4I2XE 1MJ8H 1YPZA 1F4AA 3OZ9H 1X4ZA 1JN6A 3BDBA 3D3VD 2QQQA 4PJCB 3OKOA 3VXSD 2LU4A 4PGJA 1HSBA 5FUCC 5DSCA 3EYFB 5E9DD 4NQEB 5T1MA 5DJXA 3KYOB 3MLPA 1WBXA 1AXIB 1T1WB 4HXAL 5M94B 2IMNA 2IPTL 1CICD 3FRPG 3OKMB 3NGBC 4TTGA 2O5YH 1A47A 4JREC 1CR9L 3F7PC 3L3DA 5CZVH 3REWB 3UDWA 2V2XA 5I76B 4O2FB 4R4FL 5LGKA 3EYUL 2FLRT 5A3ID 4ZOAA 3EFFA 4FFWC 1EMTL 2F19H 4MCYB 5E8EB 1NCCL 2JTDA 1OPGH 3RWCB 1CDJA 1JPST 1NUGA 1I8LC 5CBAB 1J5OH 1ZANH 4J3XA 1Y18A 4U7MA 3HZYA 2APFA 2EDXA 3SKMB 1A6TA 1NAMA 3WFZA 4GG6B 3GKZA 5ENWB 1SBSH 3M1BA 4X4MA 2NXZD 2WAHA 2J8UA 1I1RA 2C1PA 3IDIB 1S7VA 4PJBB 4PJEE 4NKOB 2XV6B 1MI5E 4FG6C 2RGSA 4N0UB 4UU9A 4JFYA 2X9WA 3CFDB 5DK0A 3SDDD 5C0CA 2VDOL 4HFWB 1ZA6A 2OR9H 3V0VB 3AS0A 3BHBA 4RSVA 1WVZA 3MRHA 5FGCE 1B3JA 4TVPL 4QHMA 1JNNL 2Z31A 5CD5D 4UT9H 5ALBL 4XPHL 1MH5B 1IE5A 2BY1A 3GSVB 2J8HA 2ZOLA 3FT4A 3STZB 1TVHA 3GSVA 4MD5A 5FYKD 3ECBB 3QZWA 4OZIB 5GZND 1UB5B 4KHXL 1RVFL 3A6BL 2A77H 4WHCA 3PGCB 3ILQC 1X5FA 2W0KA 4NWTL 1FNGB 1JK8B 1OTUD 1HIMH 2NLJB 1NC4B 3O81A 2Y5TB 5EO9B 2UY7A 2WK2A 4QY8A 1QBMH 2DL9A 2X5PA 2P45B 3MODH 1YEHH 2PW1A 2DQCL 3QJHA 2FIRT 1HQRA 5IMOA 4PBWD 5GRUH 1X5IA 1T7WA 1AO7E 5C0IA 4K3DL 1TPXB 4KRLB 3RWHB 2F74B 2WQ8A 3ZKNC 5FK9A 3MLVL 3SOBL 4ELMA 4G8EB 4Q9QL 3QIWD 5EO0B 3QI9B 3GMLA 1Q9WB 2CK2A 4BZYA 1NLBH 3RVTC 4MDJA 1G7QB 2VWEE 5DK3A 3MV7B 5C70A 4JM2B 1FGVL 3SPVB 3QG7H 1G7MB 4Y5XC 1IC5H 2PXYC 1YY8B 4DW2L 1T89A 3IDMB 4R90H 1N7MH 3T2PA 4CU6A 2ADJB 1AKJB 1KB5H 2ESVE 1AD9A 3AAZA 3ARPA 3HAEG 4E41B 5DFVC 3S36L 2GQHA 3QYCA 1BOYA 2YXFA 4OQTL 4ISVA 4RFNB 3UYRH 4AEHH 2FB4H 2BSSB 4XH2A 3KJ6L 1RURH 1MQ8A 1R0AH 3QDMA 4Z7WA 1XFPA 4PG9B 3T2QA 1CGYA 4XP5L 1TZGH 4JPVL 5IQ7L 2QADC 5GPRA 3TV3L 2BNRE 4YQXL 2Z93A 3P11H 1AFVL 2Z91B 4JZOB 1FBIL 4ESKA 5J1SC 4M03A 1BFSA 1E4KC 3FTGA 3D48R 5CS7A 3EYOB 3TN0B 4YR6A 4Z7QE 1J0IA 3D5OF 4HPOH 3MBED 5FDYA 2W9EL 3M45A 4M6MH 3DRTA 4YDJB 1QFWH 1WEJH 1PG7X 5F9OL 4JKMA 3TCLB 3NIGE 1CGXA 4M7LL 1N26A 3VRJA 3OJMB 4FFVC 3TJHC 2YC1B 3PJSA 5C0EB 1IARB 1QO3A 4R90L 1I8LA 4GBXB 1UB5A 1OLZA 3B9KB 3O4LE 1QPXA 1S3KH 2XTLA 3MBXL 4ODSH 3KR3H 3WNOA 5IVXA 5IW3A 1IM9B 4Z7NF 1WFOA 3MJ8A 3NCCB 3R06A 2Y36L 5C0BB 3TC9A 1KOAA 4Z7VF 4G9DA 1I3VA 5FHAL 3AXLA 3FOMB 4E5XA 1VFUA 5J13C 5EPMB 1ZVYA 5BO1L 4EUPB 1T4KB 2J2ZA 2B1HL 4LEOA 1UT9A 1XF4A 5FDWB 5KN5B 3HUJB 1G6VK 3H9SA 3W39B 3G04B 2HFEA 4JFYB 5C0CB 3PGCA 4RMUA 4L8SB 1KELL 1VDGA 4QRQA 4QRPD 4KAQL 1LP9F 2DYPA 4YQXH 4PGEA 4R0LC 2BHYA 3U79A 1W2KT 5F44A 4CU8A 1NBVL 3GI8L 3EDJA 2BNRD 4LU5L 3TO2A 5I0DA 1IJ9A 4GW1B 4L4TE 3K2UH 4X99B 5DLMH 4HWZA 4YGVA 2DQUH 3MJGX 3KYNA 1HK6A 2HJLA 3OG4B 5E8DH 3PHSA 4JANA 1GAFH 3VG0H 2P5EB 2HMIC 1RZ8B 2DQFB 5FF6A 3PDGA 2XTJE 3HNTL 3IKCA 5BS0E 3OGOE 1ADQL 3QUYC 4LK4A 1DQML 3NPSC 2DMCA 1YNTB 1ZT7A 4FMKA 5EN2B 2HFFA 3LDBC 4UIMA 1LEGB 4OF8A 4AZ8A 3STLB 1WBZA 5DSCB 5HHVH 4PJCF 3ZE0E 3D18B 4APQC 1W0YT 4L3EA 2HLAB 2KUTA 2VXSL 2VMFA 3H9SE 1WFUA 1A6UH 1ZT7B 5J12C 2H32H 2W9LA 4HGWA 4KHTL 5HVHB 2BVQA 4JM2A 4X7TB 4GRLC 4WHYG 3UCRA 2BVQB 2NY1C 4MDJB 4CNIA 2CMRH 4LSPL 5FYKU 3P4NB 2X4PB 5K9JH 4OF7A 2IADB 4PJXB 2WP3T 4UQ3B 2ARJB 3BESR 2NY5H 4N8CH 4YAQB 4XMLH 4DGVL 4HMDA 2OP4H 3IDUA 5CJXC 1GPOH 4ONGH 1JI1A 4Z7VA 5E2UH 4JN1L 2ZOKB 4ZYKB 5EN2A 2BK8A 3HZMB 3O9WD 4B7IA 1MWAH 2R4RH 5D1XA 1XGPA 4PJGB 1KTDB 2OSLA 4LSRL 3WIIH 2EYTB 3TBWB 2RHEA 2DWDB 1CT8A 5HHQB 3EOTL 3V9FA 5CD3A 4WCYL 4U6VH 3HAEH 4P0DA 3RKPA 2WSKA 4LLYB 3DYOA 4OD3L 5E4IA 5GIRB 1IM3B 4AM0B 4KJYB 2FJGB 4JY4A 3DXAA 3EDKA 4ODVL 5H2BB 4DEPB 4XBEL 1II4E 4MD5B 4PGBA 2IC2A 3GNMH 1MQKL 3FFCB 4PJCE 2BHZA 3RL1B 1WQVT 3OR6A 4GBXA 3T1WA 3SGDH 4NQCE 1DBKL 3JUYA 1L7IH 3UPRA 3U2SA 4C56B 4AL8H 3OSKA 4WV1A 4LLVB 1XR9A 2P42B 1RZ7L 3U4AA 5K9JL 4JO2L 4LKXA 4YDVB 5HYQB 2AK1L 1I9RL 4M62H 2O5XL 1MFCL 3BIKB 3B9EA 3MLRH 1AR1D 4P57A 3T3PF 2YBRB 2ZCKL 5F96L 4RMTA 5HGAA 3MJ8B 3R06B 4GMTH 1KN2H 2D0GA 1ZS8B 3ZYOA 3VFNA 3RA7H 2B0SH 4G6ML 4PJ7B 1YNKH 3WKMH 2IBZX 3GSWA 4ZUVB 4WFGD 2FEEI 2OJZH 5BVJB 1A6ZB 1YYMH 4ZUSA 1JWSA 4DCQB 4KK8D 4BKLA 4NN7C 2CUHA 4L3ED 3T0EC 3M8OL 3IRPX 3TBSA 5LBSL 3EGSA 3LD8C 4WI8A 2DQEH 1IGJA 3TP4A 1XH3A 4XBGA 1YEIL 5BOZG 4JE4B 2VH5L 4ZFFA 2R1WB 3PL6D 4X4ME 3EJJX 5BQ7B 1A7RH 3MX0A 4HUKB 4Z77B 1P84J 2O5ZH 3EO1B 4XNXH 5EZJA 4KZEL 3ARSA 2GT9A 3EUUA 4LPWA 3QNXA 2IH3A 4M6NL 3QPQD 1QR4A 3ZZ1A 3NABL 1PZUB 2XN9B 4UTBL 3T0AA 2YS4A 2EE6A 4NRYA 3V6ZA 4EXPX 1WBXB 1F6FB 3IFPA 5MI0B 2ZCKH 4GFTB 3IFPB 4WTZG 2JJWA 4OLEA 1KC5L 1HSBB 1ZT4A 3GI8H 5ITFA 1AXSB 2QJDA 4JFEE 2R2EA 3F6IA 5CJ8A 2C7UB 1OOAA 3RGVA 5KVGL 3VMNA 5I1EL 1CG9A 3QIBA 1RZJH 4QYOB 4QRPE 5IVXF 1NFDB 1TFHA 3SCMD 1OPGL 1SMOA 2P8LA 2IAMA 1I4FB 4GRWB 3DTXA 1AGBB 3H7BB 2GY5A 4MNGE 4D0BA 4KJWD 5JORB 1QEWA 3MV01 3ARDC 3WD5H 4I0PB 3O3AB 2Z8WC 3SY0B 4S1RL 3HZKB 1GRWA 2ESVD 5IKCA 4GRLB 4LSQL 3MRRB 2D03L 2FR4B 4LHQB 1IT9H 2VDOH 4OD2A 1IGYA 3RI5F 5AWNL 4YBQD 1EAPA 5EU7E 2XWTB 3QIUD 3O6ML 2Y23A 4EI5B 3VE0B 2BNQD 4GKSA 4I1NB 4JZJB 2MJWA 4J4PC 1VB9A 4WFEE 3I9GL 1S7WA 1SJHB 4Y16B 1VESA 3GJEA 4QHMB 4DZBB 4AT6A 1S7QB 1J10A 5C07A 2OQJA 4Q9BA 1SEQL 3EJYC 4X8JB 5L6YH 3G04A 4NQDE 2K3TA 1PY4A 2QQKL 4NO2A 3V4UL 1T4KA 4R4NC 3T2NL 3IU4L 1J0HA 1JV5A 3ULVC 1FYTE 2OP4L 5T33H 4M4PA 2J8OA 5JHDB 2X4OB 3D87B 5DUBB 5D1QC 1FVCA 4MGXA 3QXAA 1CLYH 4NM4H 4OCSH 3MV7E 2HKHL 2HRPL 4DEPC 2PO6C 1WFNA 4LSVL 1OVZA 3MUJA 3C6LB 3V5KB 5DQ9B 3PWUB 4Q0XH 1B4JL 3RWEA 3HE6B 3L3IB 5IW1A 5T1LD 3VW3L 1F5WA 1OT1A 1TITA 4WHYH 3OPZL 4XP9H 2K7QA 4G6FB 2MKLC 2Z4QB 1DQJB 2EDEA 5KTEH 4NQED 4HK3J 3FQRB 1XGRA 1BM3H 4LSTL 4ONHB 2MSPA 5D7JA 2BX5A 3GIVB 1DN0A 1FYHB 2JJTA 3D0LA 4UOJA 2FATL 4O9HL 5J1TC 4IBLT 4OGAD 4XMKH 2A6IB 5D1QA 5L2KE 2AXGB 2R0KL 4QRRB 4X5WA 2V2XB 2EKJA 3MNWB 4WHDA 4NJ9L 5L8KB 1J1PL 4G3YL 5JW4M 3U4BH 1IEHA 5D5ME 4BFEA 2G9HA 2AEQL 5E6YA 1G9NL 1MCWM 4TOYL 4MSWA 4M62L 6FABH 4EN3D 1T0NA 5DQDL 4MA7L 5T33L 4Y1AB 4HGMA 1MY5A 2AJUL 4ACPA 3Q6FB 2HJFA 4NQCD 4OFDA 4YHPA 3EAKA 1MHEA 3Q6FA 1KN2L 2E7LC 3MRFA 3O2VL 3EYFA 2AJVL 1JJUA 3BDYL 5BRZD 3PV6A 4NSKB 1ACZA 3F7YA 5SWQA 3BGFC 3QEHB 5I1JH 2IGFL 5I1LB 4HGWB 3QUZC 3SDDB 4F9PC 5ESVB 3VI3E 4OLXL 3OB8A 3T0XA 3QSKB 4WI6A 25C8H 1UZ8A 2VABA 4K3JH 1TVBA 2GFBB 3T8XB 5E1HB 3ZT5A 1N6QH 4FQHB 4H88H 3QUYB 3ZSTA 2EZ0C 4G5ZL 3ARDA 1A4JB 4JFQB 3P9LB 4DVBA 4U2YA 2IWGA 1DQLL 4NBXB 5C0AA 2DQEL 4M8QB 1ORQA 4XNQB 3MROA 1J8HD 3MA9H 2JK5A 2FSEB 1FO0L 3WE6A 4RGNB 2FATH 4M3KB 1U8LB 3VGDA 3ZE1F 1A7NH 3I6KA 4OIBA 1NFIA 4L5FL 1J0YA 3UTQB 4Y4HB 3VGGA 1T2QH 5E7BA 1U41A 2P1YA 5C08A 1CFBA 2NYYD 4ZAKA 1B2WH 4MAYD 1F6AA 4HUNB 3RZCC 4XB7A 1ZLVH 2APVA 5KANG 3UJJH 3R8QA 1TETL 3W0WB 1PFCA 3QXAB 3RVWC 4X9GA 4KQ4L