4NQSB

Knob-into-hole igg fc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Antiparallel Conformation of Knob and Hole Aglycosylated Half-Antibody Homodimers Is Mediated by a CH2-CH3 Hydrophobic Interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 207
sequence length 207
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqsB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqsB01
3ECBB 1INDH 1BFTA 2P5ED 2QHLA 1R5VA 1X5XA 2DLFH 4IRJB 8FABA 4IMLA 1TCRB 1ZT1A 4Y5YA 4GJTB 1B2WH 3RGVD 3DROA 5B8CB 1GIGH 3MROA 3HNVH 4HEPG 3OGCB 5FYJU 2XIDA 3OXSA 3ARGC 1MIEL 2YR3A 4RFEB 3S3SA 5IVXB 3IDMB 3EDEA 4G43A 3VXMB 3GMRB 3TT1H 3QDJA 1QFUL 3DVNA 1NFIA 3SDAD 5E6IB 5H8DA 3OKDB 4R26L 4NWUH 3FOLA 1DBKL 1I8LC 3C6SB 4G8GE 3MOQA 5GZOD 1S7XB 3WDHA 3ARBD 5TE6H 3RVTD 4HUXB 5IJVA 1GC1C 5C2BH 1ZHKA 4R7DB 5HJ3A 3W11D 2YXMA 2VLRB 4PJXA 4ODWA 1A8JH 1X5HA 2LV4A 3E1F1 1MOEA 5TE4L 5H35A 4L9LA 1I7RB 2FCBA 3SCMD 4JN1L 4JR9L 4PJDB 1HZHL 2YK1H 3VH8G 4P5MB 5DK2B 4FQ1L 1I3GH 4I77H 1MJ8H 4NQEE 4RGOH 3QHTC 3UYPA 3MV9A 2W1NA 3IU4H 4ZYKB 1G0YR 2EDYA 4K71B 4N0CD 5CEYA 2E27L 3GSOB 5HPOA 2GSGA 3VMNA 2CO7B 1ZA6A 3ZKMD 4YE4H 4P46D 4ZSOA 1ZWIA 4MA1C 3FFCD 5FYLL 1UWEH 5C09E 2NY5H 5IVXE 3ZYJA 4MJ4A 5IHZB 5ID0B 3EOAB 4WFGE 3BJLA 2E9WA 5I1GH 2BNRB 4UDUB 1JHLH 5IWLC 3VFOA 1Y6KR 3LY6A 4W70A 4XNYL 5JMOC 5DJDA 1YECL 2VLLB 5LWYL 1RU9H 3MLTB 3T08A 2ICCA 3IDGB 5C3LD 4K9EC 5EDXA 1EEQA 2VLRE 5EC1B 1WC7B 1L7TH 2EZ0C 1C5DA 4ZPTB 5JDSB 3X11B 1S5IH 3O2WH 1NGQH 1MCIA 1HHJB 1AGBB 2YWYA 5EO9A 5EC2B 4PJDE 4PRNB 4CAGA 2XTLA 1QNZL 5DHVB 2JCCF 2JE8A 4XBPA 3CX2A 1CD0A 3P9MB 5T1MA 1JGVL 1ED3A 1HOCB 1UXWA 1IC7H 1ZS8A 3RTQA 2UZIH 1J87A 4UV4L 1K4DA 1CDGA 4Y19D 5BVPL 2I9TB 1MH5A 3DX7B 1CE6B 4P23C 4JJHA 2ICEA 1CL7L 2VN4A 4QY8A 2CK0L 3EYQD 1VERA 2X1OA 3GBML 3PGCB 4PJ8C 5CGTA 3LKQB 4L4VA 2A38A 1J1OL 2NY6B 3HI5H 1DQDL 1AD9A 2MCPL 5EA0L 2A83B 1J8HA 25C8L 1NMBL 2HT2D 1YEGH 2BNRE 1EFXA 1YN6A 3A6CL 4FQIH 4JFYB 2JLLA 2UVEA 3FO2B 2C3VA 1ERNA 3G6AB 5TDNA 3SY0B 3GNMH 1JK8B 4XMPH 3ARWA 2AGJH 4GMTH 2DQUL 1HINH 1UA6L 2V5TA 1GZQA 4PJCA 5MEND 3QDAA 1RUQL 4S1SH 3U30C 1RJZA 3G08B 1U3HC 3K0WA 5T5FH 5HGBB 1T6WA 3WXVH 1RUAH 2AJXL 4H0GA 3WN5A 1JZ2A 4Z8FL 4XCFL 4UOW0 4JRYB 4YIQA 1H9VA 1KCUH 3FT3B 2R0KH 4NQDB 3FN0L 5ITFA 2VLJA 1MWAL 4QRTB 5EZIH 5GS0D 2CKNA 3TFKC 4YDKL 5D7KE 2IADB 3ZMRA 4LAJH 3DETC 3MRLB 4KQ4H 4NJAL 5D7LA 2B1HH 3UYRH 1NCAL 4X9FA 1A9BA 4LSPL 4M7LL 4PG9A 3M8OL 2NXZB 1RJLA 4K23H 3I9GL 3LPWA 1NGZB 3MRNA 2XZAH 5JHDB 5HYSG 3UAJD 3LKPB 3BGAA 5A2JH 2KZ1B 4IRSC 1JMZA 1UQSB 4RCAA 4R90L 3LN4B 2WLZA 3ARFB 1P1ZA 1RIHH 4J4PD 4LASL 2VDLH 4JLRB 1EGJL 2VXVL 1TJGH 3V0VA 3PIQA 3EOBA 3DUUA 3CU7A 3JSSA 4L5FL 3FJTA 3FB6B 5CBAB 4JO3L 1CGYA 2YMXL 3L3KA 4F15B 4AL8H 5M95B 1VFBB 4JRYE 4ZDHA 4NQDE 1HEZB 2NY4C 1OARL 3SKNA 4ZS7H 3QDME 1KTDA 3PQYB 4I3RL 2HMID 1QA9B 5JIPA 4LPXA 4TPRL 5DTFA 5AYQA 1T5WB 4XP9L 4ERSL 3AREB 4R2GC 4HJJH 1LEKA 1P7KA 3O9WB 4KHTL 4LHUA 4Z78B 4EUPH 3EHBD 3QO1A 1KJMA 4H5SB 3C5SA 2DDQL 5JHDE 3EYOB 1A3RH 1FNLA 5J57B 5DWUH 2VYRE 5IW6B 3R0NA 3JV6B 1ZHBB 4I9WE 1AY1L 3B5GA 4EI5B 1MQKL 2XN9B 4V2CB 3BN9D 3V4PH 5IMMA 1WK0A 1W0VA 4BA8A 3EZ8A 1EX0A 5CMAA 2BC4A 1A1NB 1A7OH 1YEHL 5DI8B 4CVUA 4NHCL 1FVDA 4WTZA 5BZWB 2H2SD 2PO6D 3B8YA 1K4CA 5I16B 3NPZB 4ZFGH 5I1IL 4YUEL 3OHXB 4XGZA 3BUYA 3VXRD 4MCZA 1YN7A 3SJVA 3GHEL 4MD0B 5GRYA 4NFBA 3BX7C 4F9PA 3CDGB 4Z7VB 4M7KH 2XWTB 5ICXA 1A0QH 3PQYE 1AD0A 4Q0XH 3V6FB 3C09B 1T21A 1A7RH 5KAQF 2NY0D 2ZPKL 3V52H 1JCKA 5DQDH 2NW2A 3VXNA 4I0PC 3CXHK 2W38A 5GS1C 2AXGA 3KPTA 2ESVB 2ORBH 2XTJC 2DLIA 2R23B 1ITBB 1DN0A 5KOMC 3HFMH 4HBQA 1GGCL 4MNQB 2LQRA 3MV8B 4O2EA 1IMHC 4DGIH 5JPMA 1G9NH 4LCCC 2FSEA 4OLYH 2VE6B 2XN9E 1OTTD 3GGWB 4UU9B 1NGPH 2XNAB 3BESR 1N0XL 3TYGH 3NCFB 3MV01 2CMRH 3CX5J 3GKZA 2R0LL 4QRRA 1R0AH 3T65A 5EOCL 2XXMB 4Y4KD 4EQ2A 4OUUB 1UT9A 1J8KA 5FYJE 2CGRH 5CZVL 3U6RB 3UJIL 4WI7A 1K8IB 2MKWA 5BZDA 2M8XA 2PR4L 3IKCB 4XVTH 1XCTA 3ZZ1A 1A22B 4HPYL 1OT2A 3OAYK 1OWWA 4JFQB 5D7JD 5IQ9B 3WIHH 1TJIL 3H42L 3RKDC 3HAEH 4XMKL 4Z7VE 3GO1L 3HLAB 4JJ5A 5LCVL 1HNFA 1DEEA 3HUJB 2Q7YB 2HA1A 3VFUA 3I50H 4D0DB 1BFOB 1MHEA 2A9MH 4MQTB 3SE4C 1P4LA 3FQNA 3I6KA 2ZCLL 5C0FB 5ITBH 2JJSA 3BQUB 4HLZG 1FG9C 1YEJH 2AQ2A 4F58H 4WUUA 1WV7T 4U1SA 5AG8A 1YNLL 3D69A 2ESVE 2F8OA 3RL2B 1CF8L 4YHKL 4L4TA 3BD4A 3U48A 5J6HA 4G9FB 1E6JH 4MNQE 3WFEH 5BS0A 1T03H 3MV8E 1MAML 4OZGB 2GY7B 4LGRB 1UC6A 2HTLC 3VFSA 2IAMB 3EJZC 4MMXC 4X98B 1DVFB 3B9AA 3X3FL 1FO0H 3QEHB 3LS5H 3WJLC 1DUYB 5LG1A 1IGMH 4JFXA 3L1OH 3TCLA 3T3MF 2JELL 3T77B 4F57L 1SY6H 4F9LC 4J8RB 4A6YA 3LQMA 4CL7A 5D8JH 2ARWA 5DD5L 1F4WH 3WNMA 1IZKA 2Y7QA 4KJWD 4ZPVB 1AO7A 1TPXC 2BVOB 4XTRD 4IOIB 3CSGA 1NPUA 4F3FA 1CICC 4ZUWB 2XFXA 4YO0A 3VCLA 3WHXA 5KOVC 2XQYK 2CLZA 3IFPA 5KTEL 3PXHA 4OZHB 5D1XC 2QQNL 1D5XA 3HUJE 3DXAB 3FONA 3VMPA 4NRYB 4WHCA 2FO4A 1N3NB 1N2RA 4GKZA 4LBEA 2A6IA 2A6KB 3WIIH 3KPPB 4YC2B 4X83A 1HWGB 5AZEH 1ZVSB 3IFNH 3T0AA 4G9FE 1U8OA 2P5WD 5E03A 3MGAA 2P47B 3RA7L 4OZGE 1QBLL 3DHJA 3O4LA 1VFUA 2DIAA 5HYJD 3P4LA 1NCWL 1QR4A 2H32H 1KJVA 3DNKA 5JNYB 5HHMB 1I3RB 2BSRB 3K46A 3KJ6H 5CWSB 3MZTA 2EKJA 2P8LB 4HZLB 4ZMAT 1CN4A 1OAQL 2PXYD 2CPCA 5JW4M 3H8NA 1WAAA 3IJHB 4X6EB 3N9GL 1D9KB 5SWZB 4EVNA 3O6LH 1T1XA 1YY9C 5C9JA 2IFGA 5DVMA 3REVA 4LLYA 4CADA 3UBXB 1RULL 4PY7B 3E2HB 5K9JH 5L8LB 4H26B 3SBWC 2IG2L 4D0BA 4GBXD 2DYPB 3BOVA 3GMOB 2NCMA 3RUGF 4KZEL 1AFVL 3M1BA 3OKMA 4XPAH 1FIEA 3HMXA 4DUVA 1OVZA 4NUGH 4GRMA 1XGYH 3DXAE 2A6DA 1WZKA 3IXTA 3MGOB 4GFTB 4PYHA 1OGAB 2LTQB 4FOMA 5DK0A 4HV8A 1NMCC 3RI5K 2VIRB 4HDIB 5FB8A 2VWEC 4RGNC 3DUHA 4X4ZA 3LN5A 1A2YB 1U92A 4JZJA 4G6JL 3ZTJH 1E0OB 3WNKA 4XAKD 4XMLL 1AE6L 4M6OL 3MBED 1G7JA 4JM2D 3QI9B 3T2OA 2FWOB 1T20B 3EOTH 5FUZL 4EDWL 3FQUA 3OWEA 4U1JA 5HHME 1EO8L 2DRUA 3OJMB 3RKPA 1I7TB 1MHHA 5KZCB 3QIWA 4U33A 4QF1A 1OAUL 5E5UB 4MSWB 4ZUUB 2Y07L 1H5BC 4LLQA 4PLKC 2O5ZL 3WKMH 4UV7H 1BF8A 3VXUD 1WBYA 3EO1A 3QO0A 4LAQH 1FLRL 1TCMA 4P3DA 5DJ8B 1DE4B 4ELMF 1S9WB 3CD4A 1S78C 3C6LD 4R4ND 4XP4H 4F7CA 3Q5TA 2PYFB 3NFPA 1M7IB 4NQCB 2PYEB 1UACL 1HQRA 1R3LB 2FNBA 2EXWC 1IGFL 1KIPA 4X6DA 2QQQA 2X4QA 5EU6D 4KKNA 5C0CA 3MJ9H 2GTZB 3KDMA 4M6NL 4P0DA 3ULUH 1JWUB 1C7SA 3P9LA 4JPIA 3OKOA 2P43B 4X9GA 1NBVL 2OP4L 5BV7L 5DUBA 1I1YA 2V7NB 3L3IB 3HZMA 3HE6B 1OGAE 1S7RB 3CVIL 3U1SL 3H2WA 4HIXL 3F58L 3SDXF 3GM8A 3TA3A 1MIEH 1LEIA 5F89A 2FHCA 3S6CA 1BBJB 1QFUH 4HWEL 3TIEB 3S88L 1JP5A 4X9IA 4NKDB 4R26H 1C16B 2AK4B 3HI1B 5JOFB 3DUSB 1DBKH 1IGCL 4EUPB 3ZE0E 2MQ3A 4KI5F 4LEXL 2DICA 3S36H 4AH2A 5FV1L 3TP4A 5BMFL 5GRJL 5KBNC 3DYOA 5ESAA 1V3KA 2VQ1B 3H9SB 3QUMA 4P4RA 2B2XL 2FECI 5TE4H 3DRQB 2PYEE 3BEVB 4JG1L 4Y4FA 3C5ZC 1K2DB 4Z7UF 1BIIB 1KB9K 4JN1H 4JR9H 3ULVC 1HZHH 5DJCA 4NN7C 4L8DB 4X4MA 4PJ5D 4U1IB 4FQ1H 1G9EA 1I7ZA 1J1PL 3MA7B 2WANA 1KOAA 1QFWL 5IFJA 3ZKXC 3SGKA 1R3KA 4DZBA 1FL6A 4PIRF 5JLZB 2E27H 3IVKB 2IH1A 1EPFA 4N68A 4CW1A 4BELD 5DJ6B 1D7FA 3T2QA 2CDFB 1SMOA 1M05A 2X5PA 4PJHF 5FYLH 4NKMA 4OF3A 4Z76B 2YD2A 3HKFA 4F7PA 5JO5B 4MNGA 1LO0L 4UQ2A 2B5IC 2CIIA 3FO9A 4KGLA 3SPVA 1S9KC 2AK4E 3BSZL 4FQXB 1T7ZA 1VEPA 2VDPL 3THML 4XNYH 4FZ8L 5F6IC 3CXDL 4IM8A 1BLNB 4I18C 2DQFB 1YECH 3CFDB 5LWYH 2FYYA 3H9SE 3KPNB 5DHXB 3KYNA 1HDMA 2E6PA 4S0SD 4YEEA 3ARGD 1UWGL 2HVJB 3ZHDA 1QNZH 5LGJB 1QPXA 3OKLB 3MRQB 4PRBB 1JGVH 1T4KB 3VXTB 1PLGL 3QISA 1U8LA 4UV4H 1IM9B 5HGHB 2FL5B 4WTZG 4ZO9A 5BVPH 2AV1A 4G8IB 3IDIB 3HI6L 5EOCJ 1LILA 4YXHL 1FGNL 4PJAF 1HHKA 5MEPB 2RBLA 3QEGL 3WUWA 1CL7H 1AR1C 2CK0H 4Y1AD 3GBMH 3S5LA 4QRQA 3U9PL 2JB6A 1J1OH 4PJEB 3GMNB 1DQDH 4F33B 5F6HI 2GSIB 2MCPH 4R97C 4L8BB 5EA0H 3T1FB 25C8H 3EO9L 1NMBH 3EW3B 4KJPC 4OGXL 5ERWB 3T3PF 2GAZB 5T1KD 3DURA 3LKOB 1L6ZA 3A6CH 2HFEA 1QQDA 5FOBB 3O11A 1TLKA 1A1OA 4YWGL 3BD3A 1UM4L 3EDKA 1YPZB 3Q48A 3L6FA 3STZB 1K6QL 1IARB 2DQUH 4JKPL 1UA6H 4JRXA 4CGTA 3QAZB 1RUQH 5KSVB 5DRNB 3DX8B 4BQBA 1EAPA 2HT3C 2BOBB 2VXTL 1NH6A 3G5XA 5JW5A 3VRLF 2AJXH 3W0WD 5ACZB 1YZZA 3BZFA 5K93A 4Z8FH 3PWVB 4XCFH 3WUZA 5CJOL 5E70A 3IDYB 3G6JF 1IRAY 2ITCB 3FN0H 5EPMA 1MWAH 1QLFA 1FRGL 4E41A 2P4AB 3VFPB 4YDKH 5A40E 3EO0B 2DLHA 1IEBB 5CEZD 4NJAH 3IS1X 1NCAH 1I1AB 4OBSA 4LSPH 4M7LH 3M8OH 4PJEE 4MNHA 2EZ0D 3I9GH 3F5WB 2EDTA 3WFBL 2V9QA 3K7UA 3W5NA 2AEPL 1BM3L 3SGDI 5HYIA 4APQC 1T1YB 4U6XB 3TBTB 3WS6C 3VWJA 3QH3B 4WFED 1OQOA 1H3TA 2VL5A 3D85A 3LKNA 4R90H 3TO4B 1AR2A 1XF5A 3DTXA 1IGJB 1YPZE 4KDWA 1NCUA 4LASH 1IT9L 4L3ED 1EGJH 2VXVH 1DJSA 2H32B 1VACB 4ZXBC 4QT5B 1MQ8A 3MRFA 4L5FH 4P23D 3C08L 1KUMA 3QIUC 5J1TC 4R4BB 4JO3H 2W65A 2YMXH 3LD8C 5CP3H 1TVDA 4PJ8D 3CFCL 1KEML 4WI9A 1G6VK 2HG5A 4JPVL 1UENA 1PKQA 1OARH 1QRNB 1T0PB 1CLYL 3RVWC 4I3RH 1G7HB 3MYJB 4TRPL 1L7IL 2OTWA 4TPRH 1GGTA 2W60B 4XP9H 4ERSH 1MCWW 4LSSL 3SKOA 4P4KB 1U58A 4KHTH 1ORQA 1VPOL 4JPWL 3L95A 1I7UB 4KI5C 1LDPL 1U3HD 2X05A 4HWZB 2DDQH 4U05A 5E4IA 5F3BB 5FHAL 2ATPA 2HVKB 2C1OB 3BVNA 1E28A 5FKAB 2FJGA 2WQRA 3VFRA 3X13A 5DQ9B 3F12B 5EWIL 1AY1H 1KLGA 4TTDC 5IB2B 1MQKH 4JDVA 1ITCA 2H3NA 2EDEA 4Z7WF 4QHMB 3TFKD 1YEHH 3MFGB 2ICES 3FO0L 3MNVA 3B83A 4NHCH 3DETD 1JVKA 4S1DC 3BIBX 3MV11 1T83A 5KG9B 1IM3B 1OWRM 4R96B 5I1IH 4YUEH 1X5YA 4WW2C 5E1AB 3KWWA 5I19L 1YNKL 2DM3A 2PW2B 1I85A 1TITA 3GHEH 4G3YH 1U8HB 1QRNE 3RL1B 1IAIL 4NSKA 1MLBA 4NRXB 4IRSD 2QADB 2EKSB 1ZSDB 3ZO0A 5TDOA 3BI9X 5C0BD 4KGJA 2ZPKH 1PQZB 5JIIA 1TMCB 1GL4B 1Y6NR 3BKYL 5CLTA 1DEDA 3BWAA 1QSEA 2VLKB 1RPQA 2X4TA 1EERB 1ND0A 5KS9B 4IOFC 4DN3L 3IXAA 4P5TA 3QEUB 1G6RL 5DEGB 1GGCH 3MGTA 5B38A 4X6BA 1IC5L 1MPAL 3H7LA 4HCRA 4MWFA 3GB7A 1N7ML 1WEJL 3U0PA 1MI5A 2NY4D 1QEWB 3R06B 2HRLA 3GJFA 3JUZA 3D9AL 1N0XH 3QFJB 3ARDB 2V2XB 2R0LH 5DZLA 3QUZC 3GSNB 1A9EB 5EOCH 5I1AB 1OQXA 3CDCA 2QL1A 2X41A 2O93L 1AH1A 2X1PA 5CZVH 5F97E 4IJ3C 4L1HA 2DQTL 4XCNB 3UJIH 1RZIA 4R2GD 4XXDB 1KIQB 2PR4H 4OD3L 3V6ZA 4GRLC 2FRGP 5F21B 1HSAB 4HPYH 4ODXA 1DQJA 4MDIA 3QXAB 1TJIH 3H42H 2JF1A 3V7AG 4XMKH 4O58L 3GO1H 1HNGA 3CSYB 5LCVH 1CZ8L 1CS6A 4NO3B 5HI4C 3ULUE 1XMWA 3TNMA 1I8IA 1UGNA 4NDMB 1NCBH 4PRPB 2GJZA 3V6OC 3AY4A 5KVEL 1R3HA 2ZCLH 4XNUH 5ISZD 1MHCB 4WHTB 3KPLA 5KS9E 1YNLH 2AKRA 1CF8H 4YHKH 3GMPB 1X5AA 2YD6A 1F00I 1H8SA 4X7TA 1Z9MA 3TIDB 2Y9RT 3OKEB 5ICYB 1MRFL 1N26A 2FR4A 1MAMH 1OT1A 1MNUL 2AS5M 4OCWL 1PFCA 5F44A 4RWHA 3X3FH 3V9FA 1IKNA 3MYZA 5CD3B 2X4SB 4M43L 3K8LA 3BW9B 4M3JA 3QFJE 4TQEL 5J6GA 5D6CA 3QXTA 3MOAL 2WP3O 4NM8L 2W0FA 2JELH 1NDMA 2CSPA 5TFSL 4ETQA 4F57H 1JRHI 1NDGB 4I0PD 5DD5H 4JDZB 2BY2A 2F74B 4PTTB 1REIA 5JXEC 3UROR 2R1YA 4XP5L 1P69B 4Q74A 4A6YL 4NRZA 2UY7A 1JYXA 5IF0B 3OPZL 2XTJD 3UDWC 3O8XB 4OFIA 4UIKL 4FQQA 5BXFB 1T7XA 1F42A 2BVQA 2X4PA 5FA4A 5KTEH 4PV9B 5EN2B 4LLUA 2QQNH 3VWKB 3P77B 4PRPE 4P2RB 4TUJB 4B5EA 4WDIA 4OFPA 1NCCL 1SYSA 1N4XL 4JQVC 2BK8A 4PRIA 2WUCL 3UP1A 3VW3L 4OI9A 1C12A 5IMKB 3FQWB 2F53D 4JGUA 5GPRA 3RA7H 4ZODA 1QBLH 5C0AD 1NCWH 3HC0B 3KLDA 1NAMA 3D39B 2ADIB 3RKDD 3NH7L 1U0QA 3AM8A 1S7UB 2E7BA 1NEZA 5D93C 1OAQH 1M71B 4WWKA 2CUHA 2HFFB 5EZOL 5IMLA 1F4YL 3AAZA 3N9GH 3QUYA 3UTPE 1P5VA 4OGYL 2YUXA 4PJIB 4YDJB 3MREA 3PHQB 4L8SB 2Q76A 1RULH 3G5YB 3JWOL 3VD4A 3SKMB 3GEWB 3GJEA 2IG2H 1HCVA 3TVMA 4LRIA 1SM3L 4AEIL 4KZEH 1AFVH 1MRCL 5FUCE 1IQDA 3HB3C 5BQ7B 1Z0MA 2HTLD 4P2RE 3EJZD 1WTGT 2KQNA 1E6OL 2VKXA 3RU8L 4Q9RL 1TETL 5C0JA 1MWAB 4KKLC 4PPTA 4P57B 1NUDA 2OJZL 3MRPB 4NBXB 5I71B 1WIOA 4LPTA 5D6DA 5A16A 4G6JH 4WTWA 1BOYA 3QXDA 1U3JA 1MELA 3UJTL 1MJUL 4XMLH 1AE6H 3PJSB 4M6OH 3WLBB 1ZHNB 2WINA 4XPFL 4EDWH 5KSAC 5FUZH 1OHQA 3IJSA 4M4RA 4CVXB 1WWBX 3D39E 1CICD 1EO8H 3WUWG 3CMGA 1OAUH 3AU1A 1QR1A 2Y07H 3S5LG 4QXUL 5D1XD 3MNZA 2O5ZH 5DO2C 1EIBA 5FF6A 1LE5B 2XXCB 4HS8L 2W9LA 4AY0A 5ESQB 2ZJSL 1P2CA 1FLRH 2OR8A 4J3TA 1AGFB 3NIGE 1CGVA 4PJIE 2R29L 4OFYD 1IFHL 3N1FC 1NUNB 1UACH 2HKHL 4M7ZC 5IOPB 1IGFH 1OLLA 1A4JA 2BFVL 2J4WL 4M6NH 4G8GA 4YK4B 4G80B 3VRJB 2FD6L 3G04B 1YNTB 2OI9B 5D1QA 4WI2A 1NBVH 2OP4H 5BV7H 1F8TL 2XWBB 4K7PY 3CGTA 1SJEA 1LEGB 3OTTA 3CVIH 3U1SH 4JVUA 4HIXH 1YEIL 3F58H 1T80A 5L2JB 3WYRA 2P24B 4DTGL 1ZA3A 5D9SA 4LGSB 2OTUA 2VZSA 1CDCA 5LVEA 2EDDA 4I4WA 5DK3A 4Y5VC 2CLRB 3G5VA 1FNHA 1X4XA 1P4IL 2EC9T 3ECBA 4NQEA 4RX4A 3S88H 1YY9D 3S7GA 4IRJA 4LEOA 3RY6C 5FDWB 1IGCH 1BZQK 1TCRA 4Y8AA 4AIZA 5E9DD 4LEXH 3LDBB 4IOSD 5D2NB 3DECA 4WGVB 4POZC 2BCKB 5B8CA 3H0TB 5HVHB 2EDBA 2YD5A 3OGCA 3NIFF 5BMFH 5GRJH 4RFEA 5IVXA 3IDMA 4JO1L 3VXMA 2VDML 3AVEA 3E6HB 3GMRA 4H8WL 2B2XH 5E6IA 3OKDA 4JG1H 4OLVL 3N06B 3OX8B 5JQ6L 3QUML 1MFNA 4RGND 4YR6B 2ZZUT 4NT6B 2CRZA 1NANI 2OJEA 3C6SA 3GK8L 4CUCA 4O2CB 1S7XA 1J1PH 2G60L 4AEEA 2BVUA 1QFWH 5EZJB 4HUXA 5E0QA 4R7DA 4G7VL 2VLRA 5D2LB 3IT8D 1F4XL 3F65A 5IK3B 2VDRL 2LU7A 2Z8WC 4E9LA 4PLKD 1EO5A 3CLFH 3ZLQC 4PJDA 4O02L 5DT1L 1LO0H 12E8L 4P5MA 5DK2A 4JFFE 4R0LB 1S78D 1Z2KA 4WEBL 4KK8C 1JWMB 2DN7A 2F58L 1ZANL 3ZYZA 4ZYKA 2X2YA 2EXWD 3BSZH 32C2B 2XV6B 4KY1L 1BIHA 2VDPH 3THMH 5FUOL 2ED9A 3GSOA 1H3VA 4HPOL 4FZ8H 2VZ3A 3RWFB 3CXDH 5D2NE 1A02N 2X44D 1QFHA 4LU5L 4N8VB 3TWCL 1AGCB 4WHYG 1X5JA 4LCYB 5I1KL 5IHZA 4FHBD 5ID0A 3DMMC 3EOAA 3LRHA 5B3JF 1FG2B 4Z7NF 2BNRA 4NIKB 4UDUA 1UWGH 5GJSL 3DWTA 4NO0B 3QCTL 2W0PA 4QHKJ 3U4EB 1KYOJ 3NAAL 4FQCL 5I8KL 4J3SA 2VLLA 1PLGH 3MLTA 3H7BB 5DGRA 3QEQB 3IDGA 3RZCC 2XYCA 3CLEL 3CZJA 5EC1A 1WC7A 4QRPD 4YGVB 5D2LE 5JDSA 4ZPTA 5EB9A 1UADC 4NQCD 1ETZB 5AD0B 3HI6H 1HHJA 2FECL 2X89D 4HUWB 4YFLI 1FGNH 1AGBA 1OAXL 2DAVA 2FGWL 4YXHH 2EEDA 3QEGH 1T2XA 2Y1VA 3PWPB 3DLQR 5K33A 4YHZL 5EC2A 4PRNA 4KKCC 3MLZL 3U9PH 3ARXA 1TNNA 5SWSD 5SX4H 4ZQKB 2IAND 3P9MA 1NBZB 5D5MF 1HOCA 1DZBA 3B9KB 5J12C 4DOHB 3C5ZD 3EO9H 2BVEA 3IYLW 4OGXH 4UT9L 3HE7C 3MV7D 3ULVD 2I9TA 5IVZB 3DX7A 4YWGH 5BJTB 1CE6A 2Z93B 3NCEB 1UM4H 1K6QH 4M1CC 4MDJB 3PGCA 1N5AB 4JKPH 4XT1C 4N8CL 1H3XA 2RB8A 3LKQA 2WWMD 4WUKL 3MJGX 2A83A 2VXTH 4WO4B 5A1AA 4HGMA 4XX1E 1BD2B 4JFYA 2BERA 3FO2A 2W92A 1IAOB 3G6AA 2H9GB 4PJXF 3RWEB 3SY0A 1JK8A 1CWVA 3KJ4C 5CJOH 5TDPB 2EH7L 3CMOH 3NABL 3QEQE 4W68A 1NC4D 3TN0C 3MRCB 1F11B 1FRGH 3ARPA 4JFDB 4JFOB 3WDIA 2IALB 3G08A 4L9DA 2Q87A 1CGWA 4EI6B 3Q1SL 3PWPE 4NHUA 5HGBA 1KF9B 4N9GB 3GSQB 5DLML 3Q6FB 2ZG2A 3PL6C 4N0YL 4EN3C 1VFMA 4JRYA 2JCCB 3FT3A 3WFBH 4DOHE 4NQDA 1JGUL 2AEPH 1BM3H 3R8BB 3WO4B 4PP1C 4QRTA 5DHYB 4MZ3A 4IRZL 4QOKD 2IADA 1MCOL 2WBJC 3MRLA 5AWNL 1X6LA 1IT9H 4PJ9C 2F19L 4X7EC 5JHLL 1NGZA 5JHDA 3C08H 4RZCB 5F7EL 1TVBB 1AR1D 1BD2E 3LKPA 1D5IL 1UQSA 3CFCH 2FEEI 2APWA 3LN4A 5DFVC 3UTSB 2F8XC 3ARFA 4WU5B 4JPVH 5IFHL 4KJPD 1G9ML 2X4OB 4LHJB 4JLRA 1XF3A 4K3JL 1CLYH 2EC9U 5E00B 3QUXD 1KV3A 4JFDE 4GAFB 4BFGA 1AHWB 4TRPH 1L7IH 1SJXA 5B39B 3MRMB 1ZGLM 4KKBC 5BOZG 2R9HC 5IP4A 3FB6A 35C8L 5CBAA 4LSSH 2IF7A 4JGMA 3ULSB 1VPOH 4JPWH 5EU3B 4YDLC 3FCTB 1VFBA 2JCCE 1HEZA 2HT3D 5FHAH 5C92A 2OM5A 3C60B 3PQYA 4N9OB 3RIFK 1T0MB 1QA9A 4UDTB 5EWIH 1ZVYA 3IB4A 1T5WA 1LDSA 3AREA 3O9WA 1O7VA 3RIFF 4Z78A 2FX7L 2P45B 3UTOA 5IT2L 4H5SA 4O4YL 3VGAC 1MRDL 3FO0H 3KPMB 1SBBA 1FIGL 4PG2C 3EYOA 4C56B 5CKGA 1D5ZB 4Q6YA 5IW6A 1OTUC 5I73B 1CGUA 3JV6A 1ZHBA 5I19H 1YNKH 3LRGA 1NEZG 3UTSE 6FABL 3PXJA 4WV1B 1CXKA 4EI5A 4WI3A 1TZIB 2XN9A 5D1ZB 4APQD 1S5HB 2DQIL 1IAIH 2WUBL 1A1NA 5EBLB 2R0WL 1PG7L 5BZWA 5I16A 4LSQL 3BKYH 3CFEB 3OHXA 4QXTB 3QQ4B 4S1QL 4ZXBD 2OMNA 2BHUA 4MD0A 4HKBB 4DN3H 1FNEB 3QIUD 3CDGA 4Z7VA 2XWTA 5FO7B 1G6RH 1KT2B 4JQXA 3V6FA 1IC5H 1MPAH 4YX2L 3TC9A 3EDFA 1N7MH 1WEJH 2GW5A 2QR0B 1UM6L 4HCRL 3D9AH 3QJHB 2CIKB 3RVWD 3DVNB 2JB5L 4DKEL 3SDCC 4AM0B 2ESVA 3OKYA 1Q38A 5I9QB 3D3VD 4C56E 2DQTH 2R23A 4XB8A 1OPGL 4OD3H 2VKWA 4MNQA 3CSBA 5E6ZA 3MV8A 4KI5D 4U3XA 1HHGB 5BV7C 2VE6A 2ATKA 3GGWA 4O58H 1XFPA 2XNAA 4MD4B 1CZ8H 3PWLB 4OUUA 1ZLWH 4Y5YC 4WCYL 3DVFA 5KVEH 4TTDD 5DRZB 1QG3A 3P40A 2HRPL 5MP6L 1K8IA 3EJJX 3IKCA 5IBUG 2R1XB 4JFQA 4P48A 4KUCD 2NZ9C 5IQ9A 5DURD 3HLAA 4FQJL 5IFAH 1LP9B 1MRFH 1EMTL 4HKXB 2Q7YA 3HUJA 5GGSB 4D0DA 1MNUH 1BFOA 4OCWH 1IGYB 1TENA 5E9DE 4M43H 5C0FA 1G7LB 3BQUA 1AC6A 5JXAL 2W9EL 4TQEH 5INCB 4P46A 3MOAH 5DJYB 1BQUA 4NM8H 3RL2A 5AAMA 5TFSH 5FA3B 2PCPB 5T3XD 2OZ4A 2L4OA 4PJFF 4NKIL 1KB5L 4L9LC 4G9FA 5DZNA 4XP5H 3BZ4B 1ORSB 4A6YH 4OZGA 2Z8SA 2IAMA 3OPZH 4IOFD 5F9AC 4X98A 1DVFA 1KENL 3ALWA 4UIKH 3QEHA 3UBXI 5FYKL 1DUYA 2AQ1A 2DM4A 2IPUG 4J12A 5EFIB 3KPRD 4L4JA 4GW4B 5EO9B 3T77A 4J8RA 1NCCH 5C9KA 4OLUL 1N4XH 4WENB 4ZPVA 2BVOA 1TFHA 2WUCH 1UXWB 3QUZD 4MAYB 4GKOA 3VW3H 4ZUWA 4DAGL 4S1RL 1AI1L 1KYOK 3VE0B 2DTML 2VZ1A 1LP9E 2VDOL 4GRLD 1D5MB 3OF6A 2WMPA 4MCYB 3DXAA 3TCXA 4YFDB 3FT2A 4QY8B 2EIEA 4NRYA 4JVWA 3NH7H 1N3NA 1L0YA 1QHOA 1WUNT 4UNTA 5HI4D 1SYVB 4M7LT 1P7QB 5EZOH 3O6ML 2A6KA 3O3AB 3KPPA 3MRJB 2BDNL 4DJMA 1ZVSA 1YN6B 4OGYH 1RAMA 1A14L 1KXTB 4CVWA 3RVXC 3LAFA 2AJVL 3JWOH 5JNYA 4ZAKB 4OZFG 1I3RA 2BSRA 4FQ2L 1EHLL 4PJCB 5CWSA 2MQ0A 1UCBL 2P8LA 1SM3H 4AEIH 4HZLA 3RTQC 3MRIB 1MRCH 3DGGB 4K7PL 1FZJB 1ZLWK 3IJHA 4LSVL 4X6EA 3R0MA 3Q0HA 1CLZL 1Q9OB 1K8DB 1JRHL 1D9KA 2NY2C 1E6OH 3RU8H 5SWZA 3RVVC 4Q9RH 4KXZH 1TETH 4NM4L 1U8JB 1S9XB 2RIKA 5I1CL 2OJZH 2FX9L 3UBXA 1FH5L 4PY7A 4M7JL 2RQ8A 3HG1D 3K2UL 4H26A 1FGVL 5GSVB 3GMOA 3HS0B 3UJTH 1MJUH 1DTUA 5JXED 5DS8B 3W39B 4XPFH 1CLCA 4HD9A 3D87B 1SJVA 5KSUB 5J3HC 1TIUA 3MV7E 3MA9L 3IAPA 3MGOA 1OGAA 5F8RC 1NMAH 1CFSB 1BJMA 4QXUH 1IGIL 1DLHB 2Z31B 1U8NB 4HS8H 2VIRA 4HDIA 1J05B 1EVTC 2ZJSH 1A2YA 3TJEL 2YOCA 4JHWL 4I0CC 5ENWB 5F9WB 5FYLD 4UIMB 4Z7QF 2R29H 1ZLVH 2OQJB 1IFHH 1OP5H 1KXVC 2HKHH 2R15A 3HPJB 4M93B 3QI9A 5J1AB 1V7ML 1T20A 2FWOA 1JPSL 5E8EA 1QBAA 3KAAA 5E1HB 3WN5C 4MA8L 2J4WH 2BFVH 2DKUA 4NQTA 1Z9SA 3VFTB 2FD6H 4ZUUA 3V0VB 1KCLA 1GCFA 3AS1A 1UCTA 4TULL 1VFAB 1F8TH 1BFSA 2B8OT 4NBYB 2OCFD 4MQXC 1OCWL 2YPKB 5DJ8A 1DE4A 1S9WA 3T3ME 3L5WB 2PYFA 3QWQB 1M7IA 1YEIH 2PYEA 2YUWA 1R3LA 4DTGH 1MLCA 2C4FU 2GTZA 1JWUA 4OFVA 3E3QE 1P4IH 2CJUL 3KYAA 3HTLX 4R4FL 3B9EA 3FRPG 3QPQC 3RUGB 2V7NA 1GRWA 2V5MA 4X7FC 3L3IA 3HE6A 2D7TL 4X8JA 1S7RA 3VXOB 4QOKE 2EH8L 3AS3A 3HB3D 3ARVA 3DVIA 3MCG1 2V7HB 4JO1H 5FK9B 5B21A 2VDMH 1ADQA 1BBJA 4P2CG 4H8WH 3TIEA 2JJTA 4KKLD 4NKDA 4OLVH 1C16A 1ZVHA 2AK4A 3HI1A 3DUSA 5JOFA 3QUMH 5JQ6H 4EUPA 3GK8H 2ZUSA 3F7QA 2G60H 2FLBT 1RK1B 4WEUD 1JPTL 5KSAD 1PJ9A 4G7VH 1K4CB 1F4XH 1CYGA 3CAFA 2VDRH 2VQ1A 4W6XB 3H9SA 1N0LA 5DVLA 3DRQA 3BEVA 1XGPB 5DO2D 4ELMB 1GJIA 5E7FA 2J8OA 4K07A 1K2DA 5T1LD 1BIIA 1WFUA 4O02H 4HULB 4L8DA 5DT1H 12E8H 1NC2B 1AD0B 3FB7A 3MA7A 4WEBH 4DK6A 2X9YA 2F58H 2FO1A 1ZANH 5JLZA 4KY1H 3RUGE 3W81A 4K3EL 2YBRB 5IROA 5FUOH 4P2OC 3IVKA 4HPOH 4K8RC 4LU5H 4MXWL 5DJ6A 1QHPA 2A74B 1KBGL 2Y5TB 1G6RB 4MQ7B 3VDAA 2GI7A 1XT5A 3TWCH 2EE3A 2R69L 4Z76A 5JO5A 5I1KH 3SDXB 5F9JA 2VITB 3MRKB 2QSQA 5EOTB 1CBVL 4PBXA 4O9HL 4MA3B 2FSEB 4CVZB 2IH3B 3O6FB 4FQXA 5GJSH 5A2KH 3QCTH 1YC7A 3NAAH 4FQCH 1BLNA 4JFZL 2DQFA 1DFBL 5I8KH 1E4WL 2XA8H 4F9PC 3CFDA 1NSNL 4PJBF 3D2UB 3CLEH 3ZDZF 2E7MA 2IBGA 3S4SB 1PZUB 5TPWL 3KPNA 1UJ3C 4POZD 4TNVK 5JMRA 3BPNC 4BSVB 5KVGL 1OAXH 4ELME 5JOPE 2FGWH 3RDTB 4YHZH 3OKKB 3MLZH 4JJ5B 5LGJA 1EZVY 2EEBA 4Z7UB 3OKLA 3MRQA 4FFWD 4PRBA 4N0FB 3KLHC 1T4KA 3VXTA 4XBGB 3EYVB 4UT9H 1IM9A 2V6HA 5HGHA 2FL5A 2JJWA 4G8IA 3WIHA 3IDIA 3TYFB 4BUGA 3QDHA 4C59B 5KN5B 1RZJC 1FPTL 2DL2A 3GI9L 4N8CH 2QJDA 3SDXE 4HEME 4PJEA 3GMNA 4PJHB 4WUKH 4F33A 5L2KD 2H1PL 1LQSR 2GSIA 3T1FA 3D0VB 4L8BA 2ZUQC 5ERWA 2GAZA 3LKOA 2VJXA 4OCXL 5FOBA 4JFEB 4KK8D 2EH7H 1YPZA 4KI5E 3NABH 4OLEA 3STZA 4NKQB 3N1MC 4KV5F 2NX5D 1WBZB 1SEBB 5AUMB 4RMTA 5KSVA 1AO7B 5DRNA 3DX8A 1EXUA 1I8KB 2BOBA 4Y4HB 3Q1SH 2DBJA 2EO1A 2JJSC 3HZKA 2Y06L 5DLMH 5ACZA 4OF0A 4UOJA 4N0YH 4Z7UE 3PWVA 3NPSB 3P4MB 1HH6B 3DMMD 1SVZA 5DMGC 1JGUH 2ITCA 5I1JL 3P0GB 3R1GL 3IAGC 4KTDL 5DC9B 3VFPA 3FQRA 5HGAB 4IRZH 1XIWB 4RMVA 3EO0A 4OCRL 2DLGA 4PGZA 4M8QB 1MCOH 2FX8L 5AWNH 2DKMA 5E2UL 2F19H 1I1AA 3RZCD 4FNLL 4PJAB 3D5OF 5JHLH 2Z0BA 4PJHE 3LKSA 3BRGC 4CU8A 3F5WA 4MB3A 5DQJB 1V7NL 5GS3A 3OR6B 1CFNB 4HWBA 5F7EH 1LO5B 1OLZA 4CU6A 15C8L 1T1YA 1D5IH 4KKCD 4U6XA 3TBTA 3U4AA 1EO7A 3QH3A 4JFEE 3TO4A 1T7VA 1IGJA 2FEDC 3T4YB 2A2QT 5GXBB 5IFHH 5AAWA 1G9MH 1O7SA 4BQ6A 4K3JH 1RJCA 3HE7D 4XC1L 3TGXA 2VO5A 3AC0A 5HY9B 2H32A 1VACA 3BFOA 5CFHA 4QT5A 4A2MA 1XGRB 1YMMB 5KSBF 4N1EA 3G9AB 4M1CD 35C8H 4R4BA 3RGVC 1DBML 1G1CA 1MCSA 3MLXL 2VSDA 1MFDL 5I18L 2R56L 4U2YA 4H1LG 2EIZB 4DKDC 2Q3AA 3NGBC 4O5LL 4UAOC 5IB3A 5C6TL 1QRNA 4K7FB 3G6JB 3T8XB 1G7HA 3O6KL 3MYJA 3UZQA 1QFPA 1HI6B 2W60A 4YBLB 2WK2A 5IUSA 1X5KA 3PUCA 3LKRB 4P4KA 3TN0D 4PJAE 4PJ7F 1OSZB 3BKML 1RSFA 2DQGL 3ETBF 1I7UA 4OB5L 1DBJL 3EAKA 4O4YH 5C70A 1MRDH 3JVGA 2VDKL 4JGJA 1JZ7A 4HWZA 1FIGH 5F1OB 5F3BA 4WY7L 4HGWB 2HVKA 2C1OA 2Q7NA 5FKAA 1L9MA 4Q2ZB 3PL6D 3DRTB 3MUZ1 3T3PE 4EN3D 2F8VA 5DQ9A 3F12A 4ZOEA 6FABH 1LMKA 1CE1H 3EDJA 4NN6B 5IB2A 4PP1D 2H2PC 1AXIB 2DQIH 3VFNB 4QHMA 2CD0A 2WUBH 3Q2CA 2E8ZA 2ZNWA 2R0WH 1KIPB 1IGTB 1YMME 4LRNL 2WBJD 3E0GA 4U6HB 1PG7H 5IV2B 5F88B 5KG9A 1IM3A 2GTWB 4PJ9D 4R96A 4LSQH 5FYJL 1KCSL 1A5FL 4S1QH 5TF1L 4EXKA 3VRLE 1BP3B 2PW2A 4JZJC 2YPLB 4OZ4B 2EYRA 2BZDA 1U8HA 2P8MB 5CLWA 4C58B 3RL1A 1E4XL 3G6JE 4GUPB 1I3VA 4NRXA 2EKSA 1ZSDA 2WP3T 4YX2H 3MJ9A 5DFVD 1PQZA 4CU7A 3QIWC 1UM6H 1HILB 4HCRH 4BFEA 3O41B 2VLKA 4NOFA 4NGHL 2JB5H 3MODL 3KXFB 1GHFL 4DKEH 2NY7L 5KS9A 3FOMB 4KKBD 3QEUA 2R9HD 3STLB 4GLRH 4LMQE 4WJ5B 1OPGH 4HK3N 5DEGA 3T04D 4AK1A 5SX5H 4M1DL 4JO2L 2AXFB 1QEWA 3R06A 2GJ6B 3TT1L 3QFJA 3ARDA 2V2XA 3O4OB 3GSNA 1A9EA 3QHZL 4MHHG 4NWUL 1DBAL 2PTUA 4Z7WB 1A3LL 4WCYH 4XCNA 3QWRD 2HRPH 5HHVL 4XXDA 5MP6H 1KIQA 2AJYL 2D7PA 1HSAA 3TA3C 3QXAA 1FL6B 4HJGB 2YPLE 1IBGL 1K3IA 5EU4B 3CSYA 4FQJH 4NO3A 4QNPF 3IAQA 1OTUD 3MUJA 5E2JA 3U7WL 3WO3B 1AP2B 1EMTH 2KDGA 1CL7I 3L7EA 4NDMA 4PRPA 2APVA 1KN2L 1HH9B 5JXAH 3BPLB 2W9EH 1MHCA 4WHTA 8CGTA 1RIVL 3KXFE 5IKCB 3UTTD 1T1WB 3IGAB 2IQAB 3NFSL 2X7LB 3GMPA 2JK5B 4RSVA 2FZ3B 4NKIH 3TIDA 1KB5H 2K7QA 3OKEA 4Y4FC 5C86A 5ICYA 2OZ4L 5E08L 2HN7B 3NTCH 1FC2D 1CFVL 1FZMB 1KENH 5CD3A 2X4SA 2GJ6E 5FYKH 3SGKC 5D96C 3WNOA 1X5IA 4Z6AT 4N90D 2NYYC 4JANB 4Z7WE 5BW7A 5ALCL 5GS0C 1NDGA 5IVOA 4EUPG 4OLUH 4JDZA 3RWCB 2F74A 4PTTA 1CXLA 2BNQD 4YHIB 3OQ3B 3VH8B 1IKFL 3SDCD 2VABA 5IF0A 3O8XA 4NC1E 4UILL 4DAGH 4S1RH 5BXFA 1AI1H 4JO4L 2DTMH 4PV9A 4RQQB 5EN2A 2VDOH 3VWKA 3P77A 1XR9B 2D7MA 2X9XA 1BQHG 3KS0H 1PDKA 1MUJB 4P2RA 4TUJA 4BK4A 1GXEA 3NN8B 3TH2T 3GJFK 5I8EB 3I6LD 3MR9B 1CI5A 4J4PC 3O6MH 4TUKL 1TQCC 2VQTA 3HR5B 4FFVC 2BDNH 5IMKA 2E9BA 5DMJB 3FQWA 1A14H 2A0LC 3W9EB 3DX9B 5I2IA 5I1HL 3MCKB 3SN6N 4OD2B 2NZ9D 2AJVH 2VDQL 3HC0A 4KC3B 3TZVB 3D39A 5C6PB 2ADIA 5LJYH 1EHLH 1HYRC 2XQYG 1RZGA 3QDJD 1KLUB 1S7UA 1UCBH 4M6AA 4K7PH 1TQBB 1M71A 1B0GB 2HFFA 2PETA 2I9LB 4LSVH 2BOCB 4KVCL 5IR1B 1CLZH 4L3CB 1JRHH 4PJIA 4UZGA 3VG9B 1O0VA 4NM4H 5C2UB 4YDJA 4E5XB 3PHQA 1IZJA 5I1CH 2FX9H 4L8SA 1FH5H 3G5YA 4M7JH 3P73B 3BZEA 4HUUB 2OR7A 2AGJL 3PF2A 4IMKC 3K2UH 1FGVH 4E41B 3MRHB 2W59A 2KZWA 1BQLL 4RNRB 5FHBL 4GXVL 1BBDL 4XNQB 4NZRL 2XZCL 3MA9H 4XZUB 4GAJL 2IBZX 2YSSB 1MWAA 2ED7A 3MV9D 2ZKHL 1IGIH 4M5ZL 4P57A 5LAXB 3MRPA 3TJEH 4M61B 3VFGL 4JHWH 4JM2F 3DV4A 3SKJL 1HSBB 2VL5B 3PJSA 3WLBA 1ZHNA 3HAEG 2VR9A 1V7MH 1ZT4B 5GRXG 3X3GL 1J11A 4CVXA 5F7HA 4MA8H 2HJLB 1T2QL 1KCKA 4YHML 1XZ0B 2HFTA 3L9RB 4KQ3L 4YHYB 1F6LL 1LE5A 4LP5A 4TULH 5A2LH 5ESQA 3SE3A 1OCWH 3R8QA 1AGFA 5MI0B 5HHXL 2P1YA 3C2SA 1MF2L 1RHFA 4TN9A 4Y2DB 5IOPA 3CCHB 3T4AB 2VQUA 3VRJA 4G80A 4HMDA 1WBXB 1TJGL 1YNTA 3G04A 4PJ8A 4HMEA 2CJUH 4P2QB 4R4FH 4ZS6C 2WIIB 5CP3A 4QKXB 3RVXD 2XWBA 4XCYB 5DXWA 3VWJC 1LK3H 1LEGA 3MNWB 3ARTA 3RTQD 4NNPL 5L2JA 2EH8H 2P24A 3KJ4B 2DM2A 2VUOA 3FN9A 3U46B 2V2WB 2Y6SC 4D9RE 1E28B 4JFFA 2NY2D 2CLRA 3RVVD 1H3WM 4RAHA 3EFFB 3W5MA 1ADQL 1ZE3C 5FDWA 3QG7L 1A21A 4L4VD 4MXVF 2GUOB 3BDBA 2X70B 1S7WB 1H0DB 1T1ZB 5D2NA 4E0RB 5L0QC 2BCKA 1J8HD 3FRUB 2AV7A 3H0TA 4TVPD 5C71A 1JPTH 1EFXD 1AC0A 1T2JA 1OGTB 2CDEB 5J3HD 3QNZB 5DSCB 3E6HA 4ETYA 1S7SB 2D7OA 1Z3GL 4YR6A 4NT6A 5IBTL 4O2CA 2E7LA 4CNIB 4XI5C 4P2QE 2AJSL 5EZJA 2AK1L 1V3MA 5E5RB 4K3EH 3KYOB 1NLDL 5D2LA 2DJSA 4YNYB 4GKNB 5IK3A 3UZEA 1OOAA 4MXWH 3KHQA 3VXSB 1KBGH 3NCYS 2CXKA 2VLJD 2ID5A 2BVYA 1QVOB 3TO2B 1CIUA 2R69H 2NZIA 4MQXD 5FAAA 3QPXL 1QSZA 2X6MA 3LS4L 1MCFA 5FM5M 4R0LA 3UO1L 2FDBP 2LVCA 4LCWB 1JWMA 2CUIA 1CBVH 1T83C 1WGOA 4PBVC 5D7LD 4O9HH 3BO8B 3OKNB 1TTFA 2NW3B 32C2A 3HPLA 4XPGL 5I75B 2R39A 1TZGL 1AKJB 2GQHA 1P84J 5E6YA 3RWFA 1CGXA 4JFZH 1I85C 1DFBH 2MPAL 1RD6A 4S11A 5H2BB 4KROC 1NSNH 2V5RA 5EU7E 3SDYL 1AGCA 3QPQD 2D0HA 4LCYA 5JZ7C 2E9IA 4MAUL 3CK0L 5TPWH 1A6AA 2IEPA 2RHEA 1LVEA 4Y7MA 4ODXB 5ILTL 1FG2A 5KVGH 4WRLA 3ZTJG 5DD0L 4KJYB 4BQ8A 3TBSB 4G9DB 1NANH 4NO0A 3U4EA 3SE9L 3ZDYF 3QQ9C 4PV8B 2Z91B 2ADFL 4P5TC 3REWB 1FVCB 3H7BA 3A67L 3QEQA 2GJZB 5CINL 4YGVA 5F7KC 4QYOB 1A7QL 4JHZA 1ETZA 5AD0A 4EKXA 5CKAA 4RBPH 1OB1B 3VXSE 4HUWA 4ONHB 4V1DB 2FH6A 3WIHL 3PWPA 1FPTH 3GI9H 3A6BL 4X7TB 5F1NB 1N8ZB 2H1PH 2PXYC 2AW2A 4LCWE 4ZQKA 5IHUL 1NBZA 3B9KA 4LF3B 2VB5A 3N50A 4JREB 2I27N 3D0LB 5I66B 2NY1C 4KVNL 2BXYA 4PRAB 3QRFM 1C5CH 4LHUD 4OCXH 4ZO8A 5L6YL 5IVZA 5EBMB 5BJTA 1RZKL 4UTAL 2Z93A 2F54B 1KB5B 4LQFL 3OSKA 3MJ6A 4Z95L 4OIIL 3QCUL 4MDJA 1U42A 2C9AA 3V0AC 1N5AA 2O5YL 3ZE2F 4X7CC 3NIFE 1ZKAA 1OD9A 2IBZY 1C8PA 1XF2B 4ORGB 1VEMA 2EDQA 3RNKB 3AY4C 4WO4A 4RAVB 2Y06H 1BD2A 2R4RL 1FSKC 3FQXB 1IAOA 3QXWA 5E24E 2H9GA 3RWEA 3SDDB 1NQBA 3ARYA 5TDPA 4Q6IC 3P4OB 1N6UA 4B53A 4EOWL 4P3CL 4WIQA 1DL7L 2ZSWB 5I1JH 3R1GH 3MRCA 4DEPC 1F11A 2IQ9L 4BFIB 4JFOA 4JFDA 4KTDH 1NGYB 3SJVD 2IALA 1HWHB 3OGOE 4OCRH 4YHOL 1NGXB 2DQCL 4POUB 2FX8H 4V1DE 4EI6A 1IKNC 1BVKB 5E2UH 4KRPC 4PD4J 2C4XA 4FNLH 4N9GA 3GSQA 3JV0A 3SO3B 1K9TA 3Q6FA 1FNSL 1V7NH 2JCCA 1JUFB 1CU4L 1AIFB 4DQOL 1BGXL 15C8H 5D5MB 1CDJA 2BSED 5DHYA 4XVUC 3D25B 3VA2C 3RBSA 3BRDA 4HWBL 5A43C 3N85L 4QWWC 2F54E 3KLHD 2YHGA 5HYFA 4NJ9L 2YXFA 4XC1H 1H15B 2B4CC 3WLWC 1RZ7L 4L3AA 4HXAL 2L0DA 4B7LA 4RZCA 1TVBA 5DYOB 2EDJA 4U1HB 1DBMH 2XQBL 3MLXH 4QRRD 1MFDH 4Z7NE 3L3GB 4FXKB 1OD7A 5I18H 2R56H 1I9RL 3BDYL 2IMNA 3UTSA 4O5LH 4WU5A 5ETUB 1PZ5B 5C6TH 2X4OA 3T0VA 5CGMA 3KGRA 5E00A 1GPOL 2XZQL 1KN4L 3O6KH 4RBPK 1TTGA 3L3DB 1AHWA 5GGUB 1QLRB 1MFCL 4FA8A 4U1KB 5B39A 3MRMA 3LB6C 1LNUB 4I2XB 2F15A 4PRHB 4JKMA 4H0IA 3HZVB 4PGEB 2FHFA 3ULSA 3QXDB 3BKMH 3P2TA 4WWKC 2DQGH 5EU3A 4OB5H 1DBJH 1NUGA 3FCTA 3DX6B 2OK0L 1EDQA 1E4KA 2VDKH 3QG6B 3QUYC 4RFOL 3TNNB 3ZT6A 5J0BA 4WY7H 3PWUB 5D5ME 3C60A 4WUUD 1T0MA 4UDTA 3BD5A 5I74C 1JJUA 4L4TD 5J13C 5DMGD 1ONQB 3TVMC 4LRIC 5E5MB 3SE8L 2DQEL 5BS0D 4LVOB 3VMOA 1SBSL 3LQAL 3WFZA 5HHOB 3KPMA 4LRNH 3EIFA 2VC2L 4FTVB 4C56A 1D5ZA 1M6OB 1RVFL 2J1KA 5FYJH 4RMUA 1KCSH 1A5FH 5TF1H 2JJUA 1MCDA 3PGFL 4WV1A 1TZIA 4PJXE 5CJBA 5B22A 2NXYB 2B39A 1DUZB 5D1ZA 1S5HA 1JNJA 1AO7D 3AXLB 3LEVL 1E4XH 5EBLA 2ARJB 3V4UL 2FEDD 5DC4B 4GG6F 4I2XE 3QB7C 3DSFL 4PRHE 1JHKL 4ONGL 3CFEA 1KGCD 4QXTA 3QQ4A 4Q97A 4NGHH 3KPSB 3SO5A 3MODH 1GHFH 4YFLF 5EH1A 2NY7H 4LEOB 3X17A 5IMOB 4HKBA 2QQLL 1FNEA 5ABDE 3QHFL 4AIZB 1J18A 4XWOC 1DCLA 2GCYB 5FO7A 1KT2A 1N5YL 4NO2B 1CDUA 5EIQA 1W8OA 4R9HA 4M1DH 2QR0A 4JO2H 5C09B 5DD3L 2DD8L 3QJHA 3DV6B 2CIKA 2M2DA 4PTUB 3OB0H 3O4LD 3QHZH 3ZKQD 5HHOE 4AM0A 1DBAH 1TZHB 1A3LH 4FTVE 1MFEL 2RGSA 2OJEB 4FFYL 3GSNL 4HUKB 1KTLB 5HHVH 2AJYH 3S36L 3UTZB 1HHGA 1IBGH 4R7NB 1G7QB 4PYGA 2AJUL 4Y16B 4MD4A 4IRJC 4P9HC 1TJHL 3U7WH 3PWLA 2APXA 5HHNB 4LARL 1KCVL 5DRZA 2EE2A 5SX4I 5B8CC 1KN2H 2H2PD 2YD7A 2R8SL 4PJGF 2Q3ZA 3T2PA 1RIVH 3KPSE 4HT1L 4NZUL 2R1XA 4OKVB 3NFSH 4HG4J 2WV3A 3SQOL 5CCKL 5MEOB 5SV4A 5E6IC 1LP9A 5F96H 1DANT 2OZ4H 2UWEF 4HKXA 2XRAL 4I48B 5GGSA 3RP1A 5E08H 5C08B 1A1MA 1ACYL 1CDHA 4JAMB 1CFVH 1IGYA 4MJIB 5C8JB 2R0ZL 1G7LA 5TQ0L 1ZGLP 5DFWH 5INCA 4GW5B 5TF0A 5DJYA 5A2IH 4HQQL 1KPRB 5MHSE 4YZFE 5ALCH 3QIWD 5FA3A 2PCPA 1CD8A 1ZHLB 4ZFZB 3INUL 3Q5YA 3BZ4A 1ORSA 2GJJA 1IKFH 4PP2B 4EXPX 4XNMB 3KPQB 1A64A 1NCTA 1Z0NA 4ZFOL 4OFDA 3GSWB 2YKLL 4UILH 5EFIA 4JO4H 1U8IB 4NUJB 4ZOCA 4K71C 5C0CD 3B5TA 4GW4A 2YS4A 2N1KA 4XPHL 1VB9A 3BP7B 4XNZB 4I1NB 1UWXH 3PDOB 4MAYA 3ZDXF 4TUKH 4HGKC 4QGTA 2DS4A 1JI2A 2VLMD 3GDBA 4KRLB 4TYUA 3VE0A 4H20L 4LLMB 1M7XA 3TA3D 1D5MA 5I1HH 2GT9B 3BPOB 1FCCA 4MCYA 4OF5A 3QDGB 5C08E 5DR5L 2VDQH 3JV5A 4MJIE 4WFFD 3MV7A 3HHRB 4WNQB 5IIEB 1SYVA 5GGSY 1P7QA 1FFOB 1OAKH 3O3AA 3MRJA 4KVCH 1J88A 3JBG7 4DZ8B 1MAJA 5CS7A 4CMHB 2YRLA 4PJFB 3P4NB 4ZAKA 4Q58C 4N8VG 5BRZB 3T0EB 2H41A 5D7IF 3MRIA 3DGGA 4Y4FD 2OL3B 1BQLH 1FZJA 5FHBH 5DEFB 2CXGA 4GXVH 5J11B 1BBDH 4NHUB 3HN3A 1J7VR 4RA3A 5CGYC 4NZRH 2CKBB 2XZCH 2I25N 1Q9OA 1K8DA 3WE6B 1NJ9B 2QSTA 3HMWL 4JG0L 3QIBB 4GAJH 1U8JA 1S9XA 2ZKHH 1I4FB 1N59B 2MQCA 1F02I 4M5ZH 1INEL 3VRIB 2NYYD 4OLZL 2NY6C 3QDMB 1CXHA 5GRVK 5J9PB 3MQIA 3FT4B 3VFGH 1VADB 5GSVA 5TGBB 3SKJH 1MVUB 2J8HA 3HS0A 3NCBB 4HIHB 4HUNB 4K9EL 1UJ3B 5DS8A 1MY5A 1VHPA 3W39A 3X3GH 3QDGE 2ILLA 5KSUA 1JZ3A 2G2RA 3RWIB 1T2QH 2F5BL 4YHMH 1MCCA 4LCIL 2Q8AL 5JDJA 1CFSA 2AEQL 2BVPB 4QOKA 4J3VA 4KQ3H 1DLHA 1FE8L 2Z31A 1U8NA 1J05A 2O26U 2DJ4A 5HVFB 4OZGF 1T7WA 3V8CA 1XGTB 4EJ1C 4NN5B 4O51A 5ENWA 5HHXH 4UIMA 5I17A 3B2UC 2OQJA 1MF2H 3HPJA 4J3OC 3T0BA 4PJFE 4HUVB 1G1YA 4Q7DA 5J1AA 2YUZA 1XF3B 1IAII 5GZNC 3E6FB 4FFVD 2X4UB 3VFTA 5BRZE 3T0EE 4KAQL 2A0LD 3ARZA 5ACMA 3SEPA 1D3CA 1VFAA 1NUFA 1KNOB 4B0MM 2YPKA 3GIVB 3WL9B 1QSFE 3BP6B 3ELAT 3L5WA 1UWXK 4NNPH 4OZHF 4DKFL 1XAUA 2NXZC 5T3ZE 4QHKI 3V5KB 4KHXL 5ECJE 3QZWG 3UYOD 1H8NA 4PGCA 3ILPB 1ADQH 5IEHB 3ISWA 3QG7H 5GRUL 3RUGA 4WFHE 2B0SL 2FJFB 3VXOA 3ARFC 4EIGB 1FYTB 2IPTL 3RJQB 1G7MB 2ZP0T 2V7HA 4IS6B 3AB0B 5FK9A 1ZOXA 3GKWL 4KTEL 5F93C 2DWDB 4M8VA 1S9YB 1Q1JL 4GAYB 1Z3GH 5CBEB 3NIDF 4C55A 1AQDB 4JRXD 4F15C 5IBTH 2CLVB 3LPGA 1NFDB 1JPFB 4QRRE 4NC2B 2AJSH 1RK1A 2AK1H 2JIXB 1EEZB 5C07B 3WKNA 3PWJB 1NLDH 4EDXB 3BYTA 5FM5O 3VD7A 3AUVA 3RPKA 5DJAB 4X7DC 3FAXA 1XGPA 2FIKB 5L9DL 2X1XR 3AREC 4ELMA 4G3YL 1JN6B 3O9WC 2R1WB 2YD3A 5CJQL 4ZO6A 2NY3B 1NC2A 3QPXH 4ISVA 3LS4H 2J5LC 3UO1H 3U2SA 4D9QE 3OB8A 2P5EB 4KK6C 1K5NB 2YBRA 3BGFB 4XPGH 1TZGH 1RUML 2P48B 3LRSB 1FYTE 1RZFL 2MPAH 4EI5C 2A74A 4ZS6D 4IHOB 2Y5TA 1G6RA 4MQ7A 3SDYH 1QOKA 1ZTXH 2UV3A 3VWJD 3EDDA 3SDXA 2AABL 3D85D 4MAUH 4J2XA 3CK0H 2VITA 2APBA 3MRKA 3SDAB 4D3CL 5ILTH 1R5WB 5EOTA 3QNYA 4MA3A 5DD0H 4Z7QE 4CVZA 2IH3A 3O6FA 2ATKB 1WZLA 2Y6SD 4PR5A 1NFDE 2YEZB 1U8MB 3SE9H 9CGTA 2ADFH 3ARBB 5I0ZA 4JFHD 2WBWB 4FQHB 3A67H 4ODSL 3SGEI 1MIML 5C07E 3D2UA 1YDPA 4JQXC 5CINH 3WNPA 3QNXB 3C09C 4HJ0C 4YHLL 1A7QH 4X9BA 5CSGA 3S4SA 3EYFB 2ERJB 1BJ1J 4BSVA 5CD5C 3SCMB 4N0UB 3RDTA 3OKKA 1ULVA 3A6BH 1PEZA 4Z7UA 5IHUH 3ABZA 3ULVF 2DMBA 4N0FA 2P5EE 4XBGA 1NCBL 3EYVA 4KVNH 2XPGB 3K4DA 4XNUL 2AEIT 4LNRB 5L6YH 3UXFA 3TYFA 4F7TB 3FO1B 4P46B 4XI5D 1RZKH 4UTAH 4FABL 3D18B 2XI9A 4LQFH 4Z95H 3FFCB 3QCUH 4OIIH 5KN5A 2K9UA 5CILL 1XGQB 2O5YH 4X4XB 7CGTA 4PJHA 4DVBB 1BVZA 3D0VA 4ESKA 4HKZB 2YA1A 5I15L 1BVLB 5CUSL 4H25B 1JF5A 2R4RH 5E8NB 1I75A 3GMLB 4JFEA 1YEFL 2C5DC 4EOWH 4P3CH 1X9QA 1DL7H 1XF4B 2AQ3A 1QFWM 1WBZA 1SEBA 2IQ9H 4KXZI 5AUMA 4PJBB 4IIQB 4UQ3A 4YHOH 2DQCH 4YXLL 3VJ6B 1I8KA 1UH3A 1WCBB 1FFNB 2BRRL 2MOVA 4KROD 4N0UE 1PX4A 4Y4HA 5FKPB 3BQUC 2IBBA 1I1RA 4UB0L 3GM0A 3RIAK 5IB1B 4U7MA 5JZ7D 1B4RA 4OZIF 5F70A 3P0YL 4LGPB 2VXUL 4RFNB 4LLWB 5C7XL 1ODAA 3P4MA 1FNSH 1HH6A 4PY8J 2XT1B 3FT2B 1CU4H 2QKIB 4DQOH 1BGXH 4Y19B 1QSED 3IETB 2NY5C 5GGRB 3I75B 3LEXB 3GSXB 4HWBH 5HGAA 4LMQI 4OBRA 1XIWA 3QQ9D 3N85H 2IAMC 5BVJB 4M8QA 4P5TD 1DVFC 3FFCE 4NJ9H 3T0DA 4GKSB 2VISB 4PJAA 1F58L 2DQHL 5J56B 1RZ7H 3PHOA 5DQJA 4HXAH 3RWDB 4NCC1 3OR6A 2A77L 1CFNA 1MI5D 4AEFA 1RK0B 4NQUA 4XPTL 5F8QC 1B6DA 1LO5A 3ORJA 3S35X 3ZT5A 4NZJA 1JPST 2XQBH 3KG5A 4ONFL 3MJ7B 1I9RH 3BDYH 4OV5B 5JPNB 2XA3A 1F97A 5K9KB 3T4YA 1UXSB 3PABB 4CJ0A 2NY1D 2UUDH 5MENB 1GPOH 5HY9A 4PJBE 2XZQH 1JF1B 1KN4H 3ZDZE 1MFCH 3IJYB 1XGRA 1YMMA 3V0WL 2IFFL 3CFJB 2YC1B 4YC2C 2EIZA 2OK0H 3T09A 4RFOH 4HWUA 2UYLB 4FP8L 2HH0L 3CJJA 3I85A 4Y19E 3G9VA 4K7FA 4LPCA 3G6JA 3T8XA 2CDGB 3S37L 1HI6A 2EXYC 3BRFA 3BZDA 2ZNXA 1FV1A 4ZUVA 3LKRA 5EZLB 3IU3B 3OXRB 1OSZA 3MOBL 2DQEH 3SE8H 3M07A 1SBSH 3LQAH 3RI5F 4KDTA 5F72S 3B6SB 2VC2H 5E8EB 1D9KC 1KPVB 4HGWA 4KRPD 3X12B 3BEWB 3LHPL 4MS8C 4Z7OF 2OS7A 5LGHL 4Q2ZA 4DW2L 1RVFH 3DRTA 4RWYL 3WV0A 5C3TA 3E2HC 3PGFH 3CFBB 2Z8RA 2Q20A 5DJ0B 5MENE 3VFNA 4WU7B 3LEVH 1I9EA 4XVUD 1KJ2B 5FYKD 3B2VL 1HKLL 4KV5E 3V4UH 1IGTA 4EBQL 4QWWD 1CXIA 4U6HA 1JNHB 5IV2A 2LTQC 3DSFH 5F88A 1JHKH 1FP5A 1MLCB 2GTWA 4ONGH 4U0RB 5KSBB 3WLWD 5FO9B 4QEGA 2YPLA 4OZ4A 2D4FA 4W6YB 4OKDA 2QQLH 4RGMB 2P8MA 3QHFH 3PG2A 4X8JB 3QT2A 5CSBA 4MJ2A 4AT6A 1FL5B 4PRID 1N5YH 4GUPA 1BFVL 4ZFFB 1EA9C 1MY7A 5F7MC 3WJJA 3OR7B 1U8PB 1HILA 2ZCKL 5DD3H 2DD8H 1CXFA 3O41A 1L6XA 3KXFA 3BHBB 3FOMA 4PJ7B 4YFEA 3LB6D 3HNTL 3HC4L 1MFEH 3STLA 4FFYH 4KU1A 4WJ5A 3GSNH 2YA2A 1P6AB 4DK3A 1WT5A 4WWKD 2E6JA 3QUYD 1BREA 3FMGL 1FVEB 2AXFA 2AJUH 2GJ6A 2KPNA 1X6NA 2BY3A 1TJHH 5C0IB 1CXEA 4Z7WA 4JKWA 3HE6C 5GRZA 5I1DB 4LARH 2D03L 1KCVH 2PO6B 3TVMD 5F7YC 2ARJQ 2R8SH 1WITA 4KUCF 4CMMB 4DN4L 3FB7B 5KSBE 4U1LB 3HRZB 3VXRB 4HT1H 4NZUH 4HJGA 4I3SL 3TBVB 3VXQB 2JJVA 3SQOH 4WW2F 4LQ1A 3ES6B 4D0CB 5EU4A 1WIUA 5CCKH 1W72A 2WWMC 1GGUA 1T04B 3PP3H 4QXGL 2DLTA 1AP2A 2NY0B 2XRAH 3KNBB 5EO0B 3CLFL 5CP7B 1ACYH 5EO1B 5I0DA 3BP4A 2F5AL 2VDNL 2R0ZH 1HH9A 5F9JB 3WNLA 5TQ0H 1Q0YL 3GSVB 1IAKB 4OQ1A 5IKCA 1T1WA 3IGAA 4HQQH 2IQAA 4PJ7E 4EIZC 1RUPL 2X7LA 4U4BA 2JK5A 4GXUN 4NQXA 3BISA 4Y5XB 2X9WA 2FZ3A 4IBLT 1CR9L 5LBSL 2O5XL 3INUH 4LHUG 1KC5L 4HK0B 2HN7A 1FZMA 1T5XB 2YKLH 4XWOD 2ADJB 5CJXA 3UMTA 2XACC 2ADGB 3WDJA 3CVHA 4Y4KB 5IROC 4JANA 1IAIM 1MHPL 4G8GD 4XPHH 2HJKB 1MFAL 5INDB 5D1QD 1A7PL 3RWCA 4YHIA 3VXRE 1MCHA 3JUYA 5IG7B 3VH8A 1UH4A 5D7JB 3KR3L 3DO7B 5HPMB 3S34L 3EGSB 3CX5K 1KTKE 4G5ZL 4GQ9L 4H20H 4RQQA 3NCYP 1XR9A 4LSDA 2MKLC 4FQXC 1GGIL 4LKXB 5DR5H 1MUJA 2LABA 2N4IA 4NQED 4RX4D 3S9DB 3NN8A 4O2FB 1ZV5A 4IRJD 5I8EA 3ULVL 1AJ7L 3MR9A 2YN3A 4OSUL 3U0TB 1B88A 3A0OA 3HR5A 5D72L 1G9NC 3H3KA 4WEMB 1B3JA 5E8PB 3QUXC 1X7QB 1WISA 5F71A 5GRWA 3W9EA 1T89A 1CTNA 3LV3B 1L0XA 3DX9A 5EULV 3MCKA 2DI9A 4OD2A 3TZVA 3C8HA 4OFKA 3VXMD 3NA9L 3VFWB 1KLUA 5E7BA 4X6CF 5E6ID 2IJ0C 4WFGD 1EXUB 5I1LB 1K85A 1B0GA 3QXVA 4XP1L 3WIFB 2I9LA 2BOCA 2XKUA 3HZKB 2B1AL 5IR1A 4D9LL 4L3CA 5KW9L 1CG9B 3O3BB 3HMWH 4KKAC 1CDYA 4JG0H 2G5RA 3PDDA 4QHUB 4E5XA 4JVPA 3CMOL 3ARRA 2NNAB 1INEH 4NOBA 2VLRD 4OLZH 3ME0A 3P73A 4HUUA 3QJFB 3VFVB 3MRHA 1NLBL 3FQRB 1WVZA 4BQCA 3F7YB 4RNRA 3S4SG 4K9EH 4XNQA 1WCQA 1RZKC 2CQVA 4Q9CA 1RI8A 4XXCA 1NL0L 3GI8L 4QNPE 4PGJA 2F5BH 4LCIH 4XZUA 2Q8AH 4U1GB 3LKSB 2YSSA 2AEQH 2XG5A 1FE8H 5LAXA 5H94A 3QAZC 4I5BB 4M61A 5DUPL 4NYLB 1HSBA 2P5WB 2Y36L 5HYJB 1ZT4A 2HJLA 2G5BB 2Y4SA 1XZ0A 3IDYC 4KAQH 3L9RA 2UVFA 2BNRD 4AZ8A 1PAMA 4F7MB 4JHAL 3MLSL 5IQ7L 3VXPB 2LE9A 5CHNB 3F7PC 4C4KO 4BH8B 4HIIB 1F90H 4DKFH 4Y2DA 1I1AC 2QTEA 3CCHA 3JV4B 4TOYL 5IB3B 3T4AA 4J3UA 2GEEA 4LVNB 4P5KB 4HS3B 3P0VL 4GBXB 1WBXA 4KHXH 4S2SA 4P2QA 3V6BR 2WIIA 3V8OA 1U91B 2EDWA 5GRUH 2SEBB 2B0SH 3BDXA 4XCYA 4PLNC 3WBDA 4L8CB 3TO4C 4KMTL 4ODVL 3MNWA 1JMXA 2IPTH 4JB9L 5DUML 4ZUSB 4GLRI 3U46A 2V2WA 5CGYD 3GKWH 4KTEH 5DFTA 4ZOBA 5D7KD 2QQKL 1J86A 1PBYA 1S3KL 2P5WE 5FXCH 1Q1JH 3MBEB 4KK5C 5FGSA 3EFFA 4G6ML 2VXQL 2WIMA 4JM2B 5HYJE 4AMKL 4AQOA 4HUMB 4U1MB 2NY6D 2GUOA 2X70A 2ZUTA 1S7WA 1H0DA 3MO1B 1T1ZA 4E0RA 2BVTA 5GSRB 5GGTA 3FRUA 1JE6A 3DGCR 2R2EA 3MFFB 4OCYL 3VXUB 5JORB 1OGTA 2CDEA 3QNZA 3G5ZB 5LXGL 1GGYA 2J8UF 3BXNB 5DSCA 3C6LB 1CFQB 1S7SA 5L9DH 2HT4C 3MUGB 4G8FB 2DWEA 2EYRB 4P4KC 5CJQH 1TVHB 4K94L 5EU6B 3P30L 1BAFL 2VZOA 5I6XB 4CNIA 3JVGC 2YD9A 3B2UD 3MXWL 3KLSA 3CC5B 5GQBA 3KYOA 5GZND 1RUMH 4YNYA 4GKNA 5EUOF 2VR5A 5EOQL 4JRYD 1ZGLB 1RZFH 3G6DL 4NQDD 5DMIL 3VXSA 1BZ7A 3TO2A 1QVOA 1HXYB 4MA7H 2BRQA 3Q5OA 2AABH 5D4QA 5BCAA 4NBZB 4XAKE 4LCWA 4F37K 4D3CH 1HK6A 3CPLB 5DD1L 2Q6WB 3BO8A 1S7VB 3OJVC 3OKNA 2NW3A 5IJKA 4LDLB 3V2AR 2NXZD 1AKJA 4XHJC 4F37F 4DCQB 5JHDD 5H2BA 1S7QB 5K9QI 4ODSH 4NO5B 3VXUE 1MIMH 1IQWL 1NBYB 2QADC 5C0NC 2LU4A 4YHLH 1FFQA 4I9WD 3ULUC 3BWUC 3ARFD 4XWGL 4Y8DC 4KJYA 5EU6E 5J13B 4PJ5B 4G9DA 5ESVB 3TBSA 4HIJA 1FLTX 4RMRA 3H6JA 4PV8A 2Z91A 4TUOB 3REWA 1KFAL 3L7EB 1FVCA 5FM4A 4Z18A 1A6WL 3PE9A 5HDLA 3UPAA 4LCUB 4QYOA 1KSRA 4ORZC 5T33L 2AJZB 1OB1A 4FABH 4ONHA 4V1DA 4I8DA 4UTBL 3OL2A 4NNYB 3ARDC 3PQYD 1EK3A 5CILH 1FN4B 5HYQB 5IFAL 5F1NA 1N8ZA 1P9MA 1X4ZA 3F6IA 4LF3A 4WHDA 3ARED 3D0LA 5I15H 3O9WD 4R8WL 5I66A 4PRAA 5CUSH 5DRXB 5IVNA 5EBMA 4DUXA 1YEFH 4MXVE 5T3XL 4MMZC 2F54A 1KB5A 4O00A 3RPIB 4KK6D 3L5HA 2EIBA 5F7NC 4U6VL 5ADOL 3IFOA 4OI7A 3CU1A 4ZFOB 1XF2A 4ORGA 4M5YL 3K8KA 3RNKA 4EI5D 4YXLH 2BRRH 2VABB 1FFPB 2XN9D 5DMYA 4RAVA 3ARGB 4HFWB 5IBUB 3GRWA 4UB0H 4PJ5E 2ZG3A 3FQXA 3P0YH 1CCZA 2VXUH 3NZ8B 5C7XH 3SDDA 1BWWA 2D0GA 3DVGB 2ZUYA 3P4OA 5GS2D 5FYJD 1HN1A 4NZTL 2ZSWA 2Z92B 3RX8A 1UZ6F 5A2FA 4BFIA 3CXHJ 1X5LA 1NGYA 4MGXA 2GK0B 4FG6C 1NGXA 1BVKA 1WF5A 2LAAA 1LK2B 4Y1AB 4WGWB 1U8QB 3WS3B 4HJ0D 2DTSA 3TLRA 1F58H 2DQHH 2B7DT 3C9NB 2FIRT 1YEDB 2DIBA 5I2IB 5BW7C 4JPKL 2A77H 1G84A 1JUFA 5CD5D 4XPTH 1AIFA 5T1KB 2IPKB 5D5MA 1RZGB 3D25A 3O2DL 2XOTA 5D7SL 4ONFH 1A6TB 2ESVD 2KBGA 5E2TL 4QTIL 2I24N 3O8XC 1XCQB 3QUKB 5FUCC 1H15A 4MNQD 3VWKC 3MV8D 4MVBC 1VEOA 2ZUVA 3V0WH 1BX2B 4B41A 4MA1B 3BZEB 2Y25A 2IFFH 5DYOA 3W0WB 4U1HA 4P99A 3ZKNC 5DD6B 3L3GA 4FXKA 3FAWA 2ITDB 1KG0B 4FP8H 2C7UB 1C5BL 2HH0H 5ETUA 1PZ5A 3ZDYE 3WFHB 3JTSB 2GFBB 1FZKB 1F5WA 3GIZL 2EYTB 1IAMA 3L3DA 3S37H 5GGUA 1DQQB 1QLRA 3GMMB 4U1KA 5HDBF 4MQSB 1LNUA 4I2XA 4PRHA 4Y1AE 3HZVA 4PGEA 2CRYA 3DV4B 3MOBH 1AXTL 2VAAB 4BKLB 2DLEA 2E3VA 3DX6A 3QG6A 3TNNA 1D5BB 2COQA 4PLOB 3LQZB 1MCBA 5AG9A 3BQUD 3PWUA 2FATL 4ODHL 3LHPH 1X5FA 4OGAC 5LGHH 1NMAL 4DW2H 4RWYH 1BHGA 4L8SC 4KRMB 5MERB 4OZFB 2VL4A 4JKLA 2BNUB 4G42B 1I8MB 3PGDB 5DDHB 4YEFA 1ONQA 3VXME 4L3EB 5E5MA 4G9FD 4NQVB 3TPKA 4LSTL 3QXUA 3B2VH 1HKLH 5GJTL 4H1LH 3UPCA 5HHOA 2IAMD 4P23B 3ZE2E 4YQXL 4EBQH 1DVFD 3BMVA 4FTVA 1C1EL 2VTFA 3W0WE 1J1XL 4LKCA 1M6OA 4PJ8B 1JZ6A 1W0YT 5I71C 4LVEA 1P5UA 3MRRB 3OJDB 3M45A 1ACZA 1DUZA 1PSKL 5L88L 3AXLA 4F7EA 1BFVH 4Q9BA 2ARJA 4IEFB 4DUWA 5CEZE 4OTXL 2R2BB 3NBNA 2ZCKH 2KUTA 4JFFB 3OF6D 3U30B 3KPSA 3DXAD 3SE3C 1U3HB 5IMOA 4OIBA 3HNTH 3HC4H 1UYWL 2X42A 1WFTA 3HC3L 2GCYA 4XVSL 3RWHB 3WSQL 1JHTB 4WFEE 3SOBL 3NZHL 3U7AA 3HA0A 4NO2A 2AV7B 3DHMA 4DKAA 2XWJB 2QSCL 3GSUB 3MLUL 4HIEB 3FMGH 4YK4C 5C09A 4L3EE 2OI9C 5CSZB 3UCRA 3DV6A 4FFWC 1JTPA 4PTUA 4LPVA 1TZHA 5E99L 5HHMD 2GYSA 2EXYD 4MX7B 2D03H 1RIUL 1P4BL 3AROA 4J23A 3ET9F 1KTLA 1DDHB 4DN4H 3DO3A 1KELL 4YXKL 1Q9WB 3UTZA 3S35L 2QHRL 4I3SH 2NR6C 4XHQA 1D9KD 4R7NA 5SWZD 1G7QA 3IDNB 4Y16A 4MS8D 4X8XA 1CQYA 4IRSB 4QXGH 2BSSB 5C0BB 1W72L 5HHNA 3VI4F 5KJRL 2F5AH 3LDBC 5D2NC 2DYPD 3LCYA 2VDNH 3RNQB 5HVHC 3VG0L 4GG6B 2J3SA 1Q0YH 5JA9A 1KTRL 4OKVA 3GUTB 1RUPH 1UH2A 3HPLB 1OGAD 5MEOA 5FECB 3TM6A 1CR9H 5LBSH 5AYUL 2O5XH 3MUY1 3DOSA 1KC5H 4I48A 5FOJA 1RQ5A 3MLWL 5C08A 1RY7B 4JAMA 1MJJB 2NY4B 4MJIA 2E7LC 1LWRA 1WFOA 4C83B 3EZJB 5C8JA 3ALPA 2Q8BL 3MRDB 3JTTB 43C9B 1A6AB 4IDJL 4GW5A 3QI9D 1EEYB 1KPRA 1MHPH 4XPBL 5KZCD 1ZHLA 5F9OL 1MFAH 4R2GB 3CVHL 1A7PH 5JUEL 1R24B 4ZFZA 2XA8L 1MFBL 5FFLA 3KR3H 4PP2A 3BIKB 4XNMA 3MRBB 3KPQA 2CR3A 4R0LC 5HHPB 3GSWA 3S34H 2PYED 4M02A 5IEKB 1U8IA 4X99B 4G5ZH 4GQ9H 4NUJA 5C0BE 3V4VL 3K81A 1AQKL 1GGIH 1HKFA 3BP7A 1YQ2A 3HZYB 5ISZB 5K9OB 3H3BC 2NTSP 4GG6E 1T3FB 2C26A 3OAYH 4XCEB 1AJ7H 3ULVH 3BP5B 3RFZC 3PDOA 4PJGB 1S7TB 4FMKA 4OSUH 5D72H 3HE6D 3U7YL 1YC8A 3C8KB 1NEUA 2Q86B 2H8PB 5E4EC 3TH3T 1FL3B 1KLFA 4LIQE 3CH1A 4LLMA 2GT9A 1DN2A 3QDGA 2EE6A 3NA9H 2UWEB 4MJ5B 4WNQA 5KVFL 4AYFA 5IIEA 2J5LB 3MLRL 5EBWB 2AK4D 5B38G 1A6PA 1KB9J 4XP1H 1FFOA 2IC2A 2B1AH 4D9LH 5EU5B 5KW9H 4I0PB 3KLAB 4P2OA 4Y89A 4DZ8A 2X09A 1CD1A 5GS1B 4PJFA 2D7NA 4GQPH 5KVMC 3P4NA 2XTJB 1OSPL 1DQLL 4Z0XB 3H9SD 1NLBH 5BRZA 3T0EA 3B9KC 1LE9B 2OL3A 4M4PA 5DEFA 4OCMC 2BMKB 1OL0A 3ILQD 1NL0H 3GI8H 4LCCB 4FMFA 4U1NB 2CKBA 3RVUC 5ACLA 1QSFA 3WE6A 1NJ9A 5ISZE 1JYVA 3QIBA 2FH8A 1I4FA 1N59A 2HLFC 3FHAA 3VRIA 1LP9F 4LL9A 4PJGE 4YPGB 3QDMA 1WWCA 5DUPH 5IBLC 2Z8VC 3F7VB 5J9PA 3FT4A 1VADA 5TGBA 1MVUA 2F53B 4HIHA 4NPYB 4WO4C 1UJ3A 2Y36H 3NCJL 2N7BA 2NTFB 5C0AB 1MJ7L 4K55A 2UWEE 3RWIA 3W9DB 4K2UL 2BVPA 4MZ2A 4KTYA 4FQXD 4I0KA 4JHAH 4XRCB 3MLSH 4URTB 1EBPA 1R5IB 5IQ7H 3O2VL 1XGTA 4RA0C 1MCRA 1GZPB 3OG4B 2MTPA 3T0WA 4PB9L 5IB4B 3U4BL 4HUVA 1T7YA 4TOYH 4J3WA 2XTJE 5EORL 3E6FA 2X4UA 1E4XI 3W2DL 4GS7C 3P0VH 1EHNA 4PFEA 4OF7A 2UZXB 3WO4C 4KH2A 1FORL 5D7IB 1KNOA 3GIVA 3WL9A 4S10A 3BP6A 3MUHL 4KMTH 4ODVH 3OG6B 1UVQB 4XBEL 4JB9H 4GRWF 4U31A 1BF2A 5DUMH 5K9QG 1IM9D 1KCRL 1NGWB 2LVEA 3V5KA 3ZDXE 2QQKH 2F53E 5FGBA 4KKAD 4JY5L 1S3KH 4V2BA 1TPXB 4G6MH 2VSCA 2VXQH 3ILPA 5IEHA 3DIFB 5C0AE 1F3JB 4AMKH 1CICB 3VGFA 3VI3F 2FJFA 5D71L 5D1XB 1FZOB 1FYTA 3VGHA 4OCYH 1G7MA 3PV6B 3UPRB 5GGTL 4IS6A 1AHWC 4P59L 4Z77B 5LXGH 3KYMB 2DWDA 3VGGA 2RCSL 4PJCF 1S9YA 1YMHB 2A73B