2CALA

Crystal structure of his143met rusticyanin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
LDTTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGMAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic Resolution Crystal Structures, Exafs, and Quantum Chemical Studies of Rusticyanin and its Two Mutants Provide Insight Into its Unusual Properties.
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
molecule tags Electron transport
molecule keywords RUSTICYANIN
total genus 32
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2calA00
1YLBB 4DP0X 1XB8A 4KO7A 3UADA 1WS7A 1L9OA 1ET8A 4E9VA 3V9CA 2HX7A 4M4RB 1JOIA 2DV6A 2IWKA 3T6WA 3IEAA 3S8GB 1HAWA 3ASOB 1JZIA 1NTDA 1V10A 2Q9OA 3NJKA 2HX8A 1GR7A 3FPYA 3NSCA 5B1BB 3TBBA 3UGEA 1IBYA 4E9WA 1JXFA 4YSCA 1BXVA 4FAAB 4E9RA 2VMJA 1AS6A 3FSZA 2XUWA 5I6KA 1A3ZA 2UX6A 2PPDA 2UXVA 4DP6X 3GDCA 4KO9A 2X87A 4A67A 3NJHA 2IDQA 2PPFA 2J55A 4HCFA 3NJMA 3ABGA 2HZHA 2YAOA 1GS7A 1OCOB 3IN0A 4CSZA 1ZIBA 2ZOOA 1KGYE 4YSQA 4YSPA 3NJNA 3WKQA 2FQFA 3C75A 1E30A 3NJGA 1L9RA 5I6MA 4BK5C 3NJFA 4E9QA 1FA4A 2HRHA 3NJIA 1AOZA 1OE3A 3H4FA 3KW8A 5B7MA 3NJLA 2EIKB 2QPEB 2OV0A 2A3TA 3N2JA 1ZPUA 2YAMA 2UXTA 5ANHA 1PZBA 1NPNA 1BAWA 4Q89A 3JTBA 1JZHA 1AZNA 3PLYA 3FSAA 3X1FA 1TU2A 8PAZA 1BXAA 2BP0A 5TK2A 1M57B 1VLXA 4KNTA 1GS8A 1GW0A 4KNSA 3FPXA 1W8EA 2J5WA 2HX9A 1SJMA 1JXDA 1CUOA 3CVBA 2QPDB 4G70B 4GP8B 5AKRA 2FQGA 4YSTA 5F7BA 2FTAA 1GY2A 1JVOA 3T9WA 4DP4X 2YQBA 3FSWA 2QT6A 2GC4C 2OCCB 1J9SA 3ABKB 4HCGA 2FT7A 4KO5A 2FQDA 2BP8B 1KCWA 4YSOA 1KBWA 2YAEA 4G7QB 3FQYA 4NERA 3RYMA 2IDTA 3X2QB 1KCBA 1WA2X 2HXAA 3OD3A 1ID2A 3UAEA 1A4BA 2QDVA 1L9TA 3FU7A 2PPEA 1W6LA 4L0PB 4HALA 4KOCA 1ZIAA 4GP5B 5PAZA 3UAAA 4QLWA 2B08A 4MFHA 3T6VA 1OCZB 2BP0B 2AFNA 4BXVA 2XV3A 4ENZA 5B1AB 1PAZA 7PCYA 3CDZA 4AZUA 2IWFA 1W6WA 3WNJA 1FWXA 4JHUA 4DPCX 2VSMB 3SBPA 2XU9A 5I5JA 3TBCA 3FS9A 1NIDA 4UF7C 2UX7A 2I85A 2B3IA 4YSAA 1M9WA 2FT8A 2BWIA 5B1KA 2GHZA 1E5ZA 3FQ2A 5B3SB 3WNIA 3AZUA 2PCFA 2MRYA 2AZAA 4AKPA 3G5WA 2UXGA 1NIFA 3TA4D 3AG2B 4UAHA 1ILUA 5I6PA 3QJUB 1GS6X 2WO2B 1ETJA 3FYEB 1RCYA 5A7EA 3NP4A 4DPAX 1BQKA 3PXLA 4HHGA 4E9XA 2YAHA 3CZUB 3OMAB 2IH9A 5D4IA 2BW5A 3BQVA 2GB2A 3AW5A 4A2DA 4PAZA 3DKHA 3QJSB 1AZCA 5I5MA 3EH4B 4DP5X 1JZFA 4G7RB 1IC0A 4EF3A 2R7EA 1MDAA 4F2EA 2VSKB 4YSSA 4AX3A 1JZGA 1SF3A 4M3HA 3SQRA 1JZJA 3SBRA 1AS8A 2J57A 1ET5A 4NB7A 1PF3A 4HAKA 3FYIB 5IY5B 2CCWA 2GI0A 3NSDA 4JKNA 2DWTA 2IAAC 2XLLA 1AG0A 1ASPA 3NT0A 3IE9A 2H3XC 2TSBA 4KOBA 3MX0B 3JT2A 3V9EA 4A2GA 1PMYA 3FU8A 1NIEA 3FQ1A 3WKPA 2ZWNA 2J56A 3WIAA 2EINB 1WA1X 4HIPA 5B1JC 4BWWA 2FQEA 1WS8A 2YAPA 1HAUA 4FA7B 1HFUA 3QJRB 2BHFA 3TASA 3QPKA 5B7FA 3H56A 2FWLB 3IBOA 4G71B 1AAJA 2HRGA 3SBQA 1SF5A 2FT6A 3ZBMA 2XWZA 3FU9A 5AZUA 1ZDSA 2P80A 1ILSA 4JHVA 2GIMA 2DWSA 4DP2X 1AZBA 2Y1AA 4BWTA 3CG8A 1M56B 1WA0X 4YSDA 4P5RA 1NZRA 2VW6A 3NSYA 4GY4A 5F7AA 4DP9X 1NWPA 1OOWA 2VM3A 1AZUA 4A2HA 2JKWA 3EH5B 4HCIA 4WTQA 2FNWA 5FC9A 4YVNA 1SNRA 6PAZA 3TU6A 2XX0A 2XYBA 2CAKA 3OMNB 1GY1A 1JVLA 4W9ZA 1OCCB 2VN3A 1J9RA 4AI7A 1RZPA 4GP4B 2DYSB 2BZ7A 1TEFA 1A4CA 2X88A 1L9PA 3S3DB 2ZONA 2IDSA 1J9QA 3QJTB 1IKOP 2NRDA 4K9JA 1A4AA 1MZYA 1X9RA 2Y69B 5I6OA 3X1BA 1ZV2A 3ZDWA 1JZEA 1OE1A 4TXVB 4E9YA 1ADWA 1J5DA 1KDIA 3AY2A 1UATA 2BZCA 2PPAA 5B1JA 4X4KA 3U25A 1BYOA 1ASOA 5AFAA 4ZK8A 4GXFA 4YSUA 4NAJA 1FFTB 2LLNA 2GBAA 3UACA 1N68A 3NSFA 1WAEA 4AKOA 4PCYA 3T6ZA 1PLCA 2H47C 2XV0A 3ZIYA 1PLBA 1AANA 3T71A 4YVUA 1NPJA 2EILB 1B3IA 3OMIB 2GSMB 6PCYA 1XMEB 1N70A 1PCSA 5TK4A 1JXGA 2W8CA 1E5YA 3ZX1A 4A66A 3KW7A 2WSDA 4A2EA 1MZZA 2IWEA 2EIJB 2HLEB 1QHQA 2CJ3A 2W88A 3ABMB 2Q5BA 3HB3B 1PZAA 3DIVA 1URIA 1AS7A 2BW4A 2YAFA 2H5UA 2UXFA 2XXGA 3ABLB 4RH4A 2CBPA 2VM4A 2VW7A 3X1NA 3S3BB 1ASQA 4QKTA 1SFDA 1L9SA 2AANA 3L45A 1A65A 4YSRA 2CUAA 1R1CA 1XB3A 4A2FA 1J5CA 3GXUB 3WI9A 1A8ZA 1AACA 2IDFA 2YAQA 5B7EA 4BWUA 1NIBA 2I7OA 3ERXA 3BVDB 1IUZA 3FU7B 1BXUA 2JXMA 4DP8X 3X1EA 2P80D 1AZRA 1SDDB 2DY2A 2PPCA 1XB6A 3EHBB 1TEGA 4UANA 1NINA 4WKXA 2XX1A 2PP7A 1CURA 3EH3B 1IBZA 1MG2C 1RKRA 1I53A 2QDWA 2MTAA 2OJ1A 4N8UA 2AVFA 3S3CB 9PCYA 1SHWA 2ZXWB 4CSPA 1RZQA 3FT0A 1OCRB 4A68A 1SHXA 5LDUA 1JERA 3AG3B 3NP3A 5EHFA 1DYZA 2BWDA 4YL4A 5D4HA 1BQ5A 3EF4A 1EHKB 2PP8A 5PCYA 3MBWB 1J9TA 2YXWA 3D12B 2YARA 2CALA 2TSAA 3IN2A 3NJJA 1AR1B 3X1GA 1NICA 2JFCA 1E67A 2N0MA 5D4JA 4W1TA 3CDZB 2BO0A 2VW4A 3WG7B 3NYKA 4DPBX 2RACA 4E9TA 7PAZA 1KBVA 4N4YB 5E9NA 4F2FA 1MG3C 1KYAA 1QLEB 1NIAA 2IDUA 1E65A 4Q8BA 3FSVA 3ASNB 1PNDA 1OE2A 3AG1B 1AQ8A 1CYWA 1GYCA 1KV7A 3S8FB 1ET7A 4G7SB 1QNIA 2XV2A 1L9QA 2XVBA 4HHWA 5I6LA 3PAZA 4KO6A 1EZLA 2BP8A 2EIMB 1DZ0A 2PP9A 4BXSV 1V54B 1V55B 3AG4B 3PPSA 4G72B 3OM3B 2AZUA 4KNUA 1NWOA 4AKQA 3UABA 2I7SA 3QQXA 3CVDA 5I28A 1OF0A 1PY0A 1SFHA 3QJVB 2GC7C 3CVCA 2DYRB 4GYBA 2FJSA 5I5IA 1CYXA 4YSEA 1X9UA 4HZ1A 1OV8A 1NDTA 1ZDQA 3PAUA 4BDVB 2IH8A 1GSKA 4E9SA 1BQRA 1TKWA 3PCYA 1PLAA 1BEXA 5I6NA 1PNCA 2XXFA 2PCYA 1SDDA 3OQRA 5I26A 4P5SA 1AIZA 4DP7X 1T5KA 1AG6A 2R7EB 2PLTA 3DTUB 3GYRA 3H4HA 3T6XA 3QJQB 3PAVA 1PZCA 2WO3B 4DP1X 1F56A 4F7KA 1BYPA 3N55A 1CC3A 1KDJA 3HEIB 2E86A 4BDVA 2YXVA
chains in the Genus database with same CATH superfamily
2KH2B 4DP0X 1R19A 5FS5A 4A04A 3MRHA 4MCMA 1UEYA 2DJ4A 4OFVA 1E2ZA 3ARDC 5T5NF 3O6KH 2GK2A 2OMZB 4H1LB 3FMGH 2VO5A 4NM4L 4HWUA 2QKIC 4JE4B 3U2IA 4BUHA 1L0XA 4DAGL 1QUNB 1PAMA 2XZCH 3CSPA 4LCWD 4Q2ZB 1ZK5A 3S8GB 1CE1L 1RULH 1NUDA 1SGKA 3MMEB 4B0MM 1HAWA 3BP7A 4KMTH 4IHOA 1JZIA 2F19H 1BM3H 3KBHE 1PY9A 4JHWH 2CXGA 2X70B 3MACH 5CEZL 3TF4A 3D2UD 4HUXA 3MRNA 3CFJA 4Z7WF 1X9LA 1A2YA 5SWSA 3QXUA 5H94A 3LKQB 4LL1A 4BEIA 1RL1A 2ITEA 4KK8C 1KCVL 4KO9A 5L4JA 4UQBA 1FAKT 4FNLL 4OFYD 4FHKA 5J9PA 3ABGA 3DVFA 3OR7A 4LKXA 4PJ7F 2H6UA 1FLTX 2C7UB 4JZJC 3LOWA 2CCVA 1OARH 1OD9A 32C2B 2K3HA 4AGOA 1BVLA 3NJGA 3LMJL 4GQPH 2OTPA 3BH8A 1JJUA 3OTTA 4OLWL 2JJVA 4XCYA 2VTFA 1Y18A 1YEIL 3SJVE 3T2OA 5AZ2L 1M1XB 3NPSB 3LEVL 1DQLL 3AVEA 4MNGB 4GUQA 2PWGA 4HF5L 4CVZA 3DX4A 1DBMH 5IT2L 3GZPA 1SJHA 1M1XA 1S7VB 5F9DC 3EH2A 1AZNA 1BZQK 3X1FA 1DEEB 1TF4A 1OAYL 2J1WA 3PHAA 5I0XA 5TK2A 5IVXB 5D71H 4FQXC 2XPYA 4NHCH 3KYAA 3FPXA 3BD5A 5DJDA 5EU6D 2P5ED 1L7TH 1SJMA 3V6OA 3LN4A 3FCTA 4JR9H 4UI2A 4H8WH 3QORC 2EDMA 2P8LB 1KBGL 2BM3A 1P69B 2O61A 1RVFH 2WLYA 2NYYC 4GBXA 4L4TE 1JGVL 4CKQA 4XXWC 3ZOAA 5G5DB 4YHMH 2AF2A 1AXIB 3BMVA 1FYTA 3ETBJ 5TJWK 4DGYH 1EJ6A 1HL9A 4JY4A 4M8VA 4HCGA 4XCNA 4OZHE 1PKQA 4XNUH 4F93B 1LO0L 2BP8B 4N6RA 1B4JH 3FFDA 2B9AA 4WWKD 4HT1L 1WO2A 5SWQA 4K94H 1KCBA 2E56A 4N0CC 3MR9B 4POZD 5EFIA 2H3NA 3IU4L 3FU7A 3O8XD 4WV1A 5BRQA 2FIKA 5SWZE 3UAAA 1B0IA 4FXGA 4XOCA 3LRHA 2YMXH 5KBKA 1CVRA 4ENZA 3I75B 1LP9B 5KVFL 5KTEH 1NAMH 1QZ1A 2CLZA 4S11A 2WIMA 4MA3A 5IBTH 1PDKB 1T5WA 4D2NA 4EIUA 3C2SA 4IS6A 1BQLL 3LPOA 4N9OB 4PBXA 2F54D 4PJIA 2ZT9C 4U1GB 3SBPA 3O9WC 2OSLA 4HS3B 1WWAX 4JCMA 3DV4B 4HJGA 4EQ3A 4N0YL 3N1PC 2AXJA 4PIRF 1FNSH 2CPUA 3T3ME 3SPGA 3F7PC 4KKZA 3BRDA 4MMXB 5HHMD 3IM1A 4GAJH 4B27A 2WVSA 4NLHA 3QJZA 4MLIA 1V3MA 5I76B 5E6YA 4P3CH 2EDRA 1AP2A 3ULSB 4MCYA 1BD2A 4FABH 2A6IB 3UYRH 4AIOA 1P1ZB 2JKLA 1MHCA 3HC3L 1QI5A 1AZCA 2A6JB 3UOAB 4ZFFB 1JPSH 1BFOA 2JH2A 2F1BA 2GFBB 4HIEB 4JFEA 1WQVT 4G7RB 4HGWA 5EZIL 4DP5X 1P9MA 2R7EA 2HH0L 4Y7OC 1FUNA 3LSOB 1JGIA 3GSRA 1KPRA 4KWUA 1QBLL 2XA8H 3MV7B 4ZRGA 2Y36L 3RVVD 3ATBA 4MX7B 5JLZA 1BX2A 4ELMB 3JSSA 3I9IA 4J12A 3ARUA 1MHHA 4P2YA 1BZ7B 4U6TA 2HRPL 2IGTA 3IDJB 2JLPA 3QQ4B 2QSQA 2MCG1 1T7YA 5EOCL 1A3QA 2VDKH 3QR0A 4XVUC 5D7SH 1QO3B 2E46A 2CLVA 5ABZA 1AI1H 4PGBB 2W91A 2R56H 4QF1A 4MAUL 5JA8B 1DHKA 2YS4A 2DKUA 2GAZA 3U7WL 2CO6B 1SEQL 3MA7B 3HRZA 1ZAGA 3C60B 3W5NA 5AVXB 3D39B 3UZQA 3W1ZA 3L1EA 4BFRA 1VB9A 2KL6A 4OLYL 4GAYA 3BMWA 3GRWH 5F2FA 2CJSA 3FTSA 3GM8A 2VDLH 4HXAL 1EH9A 1PLGL 1CG9A 4O2FA 3BP4A 2WZ5A 4NQEE 3RJQB 4ZOCA 1XH3A 3L3OA 3R06A 4JDTL 3TXAA 1L3WA 3T3MF 1XTLA 3DI2B 1TQTA 4JW3A 3HE7D 1LDSA 3QYCA 2L4OA 2CA4A 1X4YA 1CGTA 3WOVA 1AZBA 4E41D 2FGZA 2Z6FA 4BWTA 5JQ6H 1X4ZA 3HG4A 1I4FA 1OTUC 3CXDH 3Q8AA 4GMTL 3CQPA 2NUPA 5LWYL 1WWBX 5CJQH 1S8DA 2W80C 1ADQL 2VW6A 1WP6A 2QELA 1N4XH 2Z4QB 3KPRA 1S8DB 4GY4A 3SE9H 4HWEH 2NUPB 4B6ZA 2NZ9D 5C0EB 2K78A 5EZOL 2FEDC 3RU8L 5CCHE 1YEFH 5ERWA 3BH4A 4UBDC 1IRAY 4ZOEA 5T1DH 3PWUA 3SZKC 2NUTB 2WXKA 4ETQA 1SUJA 5GGQL 2Y5TB 1H0DA 5T1LA 3ZKXC 5IM7A 2JB5L 3MV9B 4U3SB 1G7IB 2ZUWA 1AQDB 1SYVB 3F6LA 1MCQA 1UH2A 2F74A 4BQBA 2ZONA 5FR3A 3EGSA 2FECI 1IKOP 3IGAA 5ALBL 4X99B 4LVHB 5IQNA 1PLGH 4G1MB 5CU9A 1TO5A 4L48A 5I6OA 1T1ZA 2DD8H 1P84K 1MY5A 1GPOH 5KSVB 5BO1H 3S4SA 3MV7A 4YO0B 4OVUA 1YNKL 3RPIB 5K9KA 3T0AA 2IALB 2VQ4A 3WSQL 4GPVA 3HOGA 4JZOA 2ZX5A 1E4XL 3H2WA 2KDYA 4DZBA 4W9EC 1UURA 4UZGA 1WAEA 3WY4A 4XMPL 3PQYB 2ZPKL 3PGDB 1E7VA 1MREH 1FORH 2X3CA 1GGTA 3MV7D 5C0RH 1FC2D 1YEFL 4AQ1B 1IGMH 4AT6A 5DA0B 1OWRM 2RMNA 1H3PL 4H26A 4NCC1 3O9WD 4A7QA 4EUPB 2IGFH 1MHEA 2F58L 2G9HA 3BN3B 4TSBH 1S5HA 3TV3H 4NBZB 3RDTC 5FM5O 1PL3A 4X4YB 3MOBL 4JKPL 5LJYH 1IAII 5I1DB 2YAFA 1MHCB 4RESB 2GJ6E 1K2DA 2UXFA 4P2OC 5BRZE 3IKKA 1AMXA 2D73A 1QUPA 4MJJA 2X4SB 4PVMA 1P84J 2MQ3A 1EMTL 4LGRB 1F6AB 2D0GA 3VD3A 3WFZA 5DHXB 2AJYH 3UH8A 2PXYA 5L2KA 3KZ8A 3BP6A 3W56A 5CGYD 4QYOB 3F3HA 1KLGB 2O6PA 4G7YH 3FCGA 4OCSH 2DBLH 2UZYB 4YEFA 5C9JA 3BCFA 2JKNA 4IRJD 5GRJL 1KWGA 4QT5B 4RGMB 4MKTA 4XE5B 2FHBA 3HVDA 1CTOA 1J8SA 3HE7A 4F80A 2NSMA 3IRPX 3G5XA 3QIWB 4IOSD 4AMKL 1P6FA 3RVVC 4BKSC 2VYRE 1XB6A 1DVXA 3ZE1F 1TITA 2JI3A 2K8QA 1NAMB 3IFPB 4LSUL 5DK0A 2V0AA 4TQHA 4U6HB 5EMYA 5L0QC 2BY3A 2VT0A 4MHHI 1NEZB 2KZKA 4N8CH 4ZZKA 5A2FA 5K1NA 1ZA6B 3MRPB 4N2AA 1WK0A 1FGNH 1LDPH 2XN1A 3IJSB 5J6HB 1ZWIB 4MSWB 4O02B 2Y2YA 2IXQB 3BAKA 1F4WH 2IGLA 1BBDL 1ZV9A 1LVEA 4QO1A 1NANI 4XT1C 1BQ5A 1G7IA 3DTXA 1J1PL 3JUYA 3H54A 5EORH 3QQ9C 1KG0A 1IT9L 3H42H 3PWPD 4GQRA 1F3JA 4HT1H 3BZ4B 1I1AA 4GAGL 4IKKA 1S3KH 2AI0L 2P5WD 4MJIE 4Z3HA 2GJJA 4Z3GA 3F05A 3GI9H 5EIVA 2P47B 4X7SH 1OAYH 1V5JA 2RCSH 3CDZB 3FB5B 4G7VL 4WRLA 5DHDA 3WFCH 2QBWA 4FXTA 4XNDA 2Q7NA 1FL5B 1EJ8A 3W81A 4APQC 4ORZC 1MHPL 1QTPA 1D5ZB 3PQYE 4AYEC 2A83A 4F7TA 2QQLL 1WH0A 4D9QD 4U3SA 2C9AA 3GHEL 3FSVA 2NUTA 2QGCA 1PNDA 4X9IA 3SBWA 2BX5A 1KV7A 2D2CC 3SDYL 3DJRA 2ENPA 2P8MA 4PR5A 2ESVB 5CJ8A 4YDJA 4NIKB 1WFNA 5AL0A 4R7DA 5DC0A 3AROA 2PP9A 1A2YB 1NCUA 2TRYA 5E8NB 3C8KA 5SWSB 1AGBB 4HHAA 2EO7A 2HKHH 4AUJA 4P46D 4NUMA 43CAA 1MJ7H 2XVLA 1AY1L 3HG1D 2APTA 4HMDA 3TN0A 3D06A 3MLXL 4OGYL 1RZIB 1CFQA 5E2UH 4UOW0 1AGFB 1BEYL 3QQXA 5E6SB 1FNGB 2UY7B 1OF0A 3OKDA 2NY4B 4YAQB 1SFHA 2VLRB 4OGYH 5J12C 1L5GA 4MAZA 2CO1A 2F19L 3X12A 3LXUX 5EF2A 1I85A 4NO0B 3C6LB 5DJCB 5A2AA 3SKNB 5C1MB 5E9DD 2IFFH 3F7LA 1BZ8A 4FFZH 4WI5A 2B4CC 2H6PB 2Z92A 1BEXA 2PTVA 5J6SA 1QX1A 2HP4A 3AUVA 5C09E 2Y3NA 1XX9C 2B7DT 3WO4B 3DX1A 5KVMC 1KBGH 2F54B 1I3UA 1FFOA 5C07D 1L6ZA 4JO3L 4M4RA 1Q94A 2YKLL 3DX7B 1CMOA 3FF8A 1PZCA 1QO3A 5AW4B 2J88L 4GKLA 3LD8B 1DVYA 3QYMA 3FU0A 3O6FA 3AQDA 2OSYA 4HS8H 3FRPG 3KPRD 3GQFA 5DMGD 1AD9B 4E36A 3M17A 4LLYB 4OZIB 4H8WC 4KXBA 4LDCA 2NY7H 3CLEH 3RX9A 3TCLB 3T6WA 4A7SA 3OKLA 2Z34A 3CFNA 1MW0A 1O9WA 1VDGA 1DVFD 3OKKA 2KLTA 4PLJC 3X11B 3B9KD 4MJIB 3SE3A 3X11A 4HU8A 4GO9A 4WI7A 3NSJA 5EO9A 1URLA 4J3UA 2EE0A 4PJGB 4W9KC 3IAQA 4XMZA 5K9JL 2UXVA 2PPDA 5IW1B 2VLMD 4EEEA 4ODVL 4PJCA 3P9WB 3JWOH 3U1PA 4HPHA 3MZGB 4YLBA 4F8QA 4CSZA 2XPZA 3L9RB 1NCJA 1P7BA 2Z0BA 4K3GA 3V0DA 2H2SC 4FG2A 5DVKA 3OR6B 3UROR 1KYFA 2BDNL 4E9QA 3LIZL 3L4ZA 4NENA 2NNAA 5IM7B 4KKBD 4YHOL 1BFVH 4JRLA 3MRLA 3TBWB 5AAWC 2QQQA 1FE8L 5I19H 5TD4A 5M7QA 3V0GA 2B4CL 1YPZF 3P4MA 5J1SC 5I74B 1BAWA 2X10A 4FI6A 1I9IL 4I87A 1NH6A 2Z4TA 5LNEA 3DRQA 2XWEA 3ILQD 1JXKA 4LNVA 1NKGA 4W4OA 3I50L 4X98A 1KJMB 1RU9H 1M57B 2CO2A 4QXGH 3T2LA 1LO3H 3S96B 3GLAA 12E8L 2FIKB 4QHPA 2L7EA 3QXTA 1QR1A 1JCKA 1YN6B 1HQ4A 1W8EA 4OFPA 4QHLB 1G94A 2AERT 1JXDA 2HN7A 5EA0H 4HZLA 3KCPB 3VDBA 3UBXA 4RNRB 2VIRA 3QRBA 3ROLA 3IPEA 3C5ZD 1WIOA 2R1YA 2BC4B 3RIAK 2BOLA 4M5YL 5J3HC 4Y0GA 1D5RA 4PRNB 4XAWL 1OLZA 3ILEA 3N0PB 3I6KA 4X4MA 5KYUB 5IB4B 2IPUG 5C3TA 5IHHA 3P2BA 3X2QB 1FV1A 3OKOA 3LKNA 5FCUL 3PABB 3VNYA 1SXBA 3NQIA 4ODSH 3ULUD 3GJFA 1P7QA 3LKOA 4PJEE 5JIHA 2QDVA 1IFHL 1IM9A 1IGIH 1VCBC 5K1JA 2QKIB 4JG0L 5A6IA 4OF6A 5IP4A 1HILA 2AFNA 2F7QA 3VFGL 2EXWC 5B1AB 3KPPA 2KT6A 4TF4A 4OM1H 5IJVB 4F8LA 3HVNA 3VD7A 3IS0X 2EYTB 5D1XA 3AWFA 3ARBC 3UDWC 3F00A 3VVWA 4DPCX 5IHZA 2WUCH 3BQUB 3GEWB 1ACZA 2DM3A 2EDTA 1KT2B 2ZXQA 1AZVA 1HI6A 5GGTL 1A7QH 1FLRH 1XIWA 4JUSA 3BZEA 2WYIA 3I2CH 3KM2A 1XSIA 1M7IB 4FYTA 4UQ9A 4KH2A 1DJHA 3SCMC 2A6IA 4EI5B 4DVRL 1QFWL 1BAFL 3BRFA 1MCWM 3IPBA 4X9GA 1P4IL 5DS8A 1MEXL 4FZEL 5T33H 5BXFA 2WO2B 4HJEA 1MI5D 4JFOB 1AGDA 1OQXA 4MX7A 1JPFA 2ICES 1MFDL 2CLRA 3HPLB 3GS0A 4XWOD 3IFPA 5JZ7C 1U3NA 1NUFA 4LSPH 3MRQA 1MFDH 3CVHB 1MCEA 3CFJB 3BQVA 3ZE2B 1JUFA 3QJSB 4J3OF 5DLML 5DA4A 2HKFH 4DK5A 1KJ2L 2HT3D 5I16B 1FGVH 1P4BH 3TZVA 3MRDB 1T66D 4HJJL 4EIBA 1Q9OA 2Y3AA 3BYTA 1T3FA 4P2CG 2ZAGA 4PJFB 4ICWA 4QRRD 2F53B 4DFHA 4P2QD 2WUCL 5EIIA 4M43L 1UOLA 1YEDB 5DF0A 5DHVA 3BJ91 3ILPB 2AEWA 3BGAA 1KCSH 1ASPA 1A7RL 1NSNL 2EE2A 2IADA 3CBJB 4FYSA 4JG1L 4AM0Q 5ISZA 4N3UA 3CLFH 5EZOH 5EEVA 3V4VH 4LRIC 5IHUH 5EU6A 1I9JL 3SZ6A 1HYSD 3E2HB 4PJAE 3AFLA 3MX0B 4PJFF 3UBXI 4ZMWA 3WIFB 3WTYA 3EYSL 25C8L 1N6QL 4J8RB 3BC9A 1H3TA 1EEZA 2AXGA 5AW3B 1ZT1B 3FU8A 3VGDA 4MA3B 5GGRA 2CDFB 3MUZ1 1A7PH 1DQJA 2F5BL 3RWEB 4HW6A 1DLFH 2F5AL 2BIQA 1UVQB 1RFDL 1G6RB 4UT6A 1N59A 2Y22A 4FNPA 3V55A 5CEZH 5CSGA 4KXDA 1UT2A 4G2AA 1SF5A 3C87A 4PRHA 3N41F 2P8LA 4RGND 3OF6D 1U91B 4AV0A 4BQCA 2A74C 4ZS7H 2J8UA 5JQHC 4GKSB 4OCXH 1QR4A 3JTTA 1PD0A 3UJJH 3IKCA 1FZMB 3N85L 3UDWA 1AGBA 3PJNA 4URTB 4QWWD 3MUJA 1E50A 2AMUA 3LPWA 2NW2A 2XN9A 3GM0A 3CU1A 4DGVH 5K39B 1K85A 4ISVA 4A2HA 5GSVA 2ZWSA 2FJFB 5IQ9A 4OCLC 3W11D 4GXVL 5AVTB 1HHHB 4X99A 3ZU8A 1N6QH 3O4LB 5I23A 4X6FB 1SNRA 3HI6H 4QXTB 3TYFA 5A40E 5SWZD 4I48A 4RGOL 4NP9A 4WU7B 1GYUA 4DOHE 1D5BA 2XV6B 1A4JA 1I7RB 4PLKD 3UXFA 1NGZB 1KPVB 3IMSA 3RVXD 3ZJAA 3U2SA 3I9PA 3P30H 1UXSB 3GF8A 3GMLA 4IBTA 2XN0A 3FZUD 4OGAC 5H37A 1DZBA 1UB5B 4RZCA 1LE9A 5D7LD 3KJ4C 4H25A 2IF7A 5EBWA 3E6HA 1N7MH 2PPAA 3CVHL 4BV1A 1BVNT 1GSMA 3VRLF 3DROB 1QSZA 3TEWA 2A9MH 3K2UH 7TAAA 2R2BA 5C3IA 4Y1AA 2GBAA 2WXQA 3KVPA 5KSUB 4J1UA 2C7FA 4ANWA 2XV0A 1CE6B 4R3SA 4PFEA 1L0QA 1S78D 5CZVH 1NPJA 3MRGB 4WEBH 5EN3A 4TS6A 2VXVH 5SV4A 2QL1A 1PCSA 2VGLM 3DC0A 4XN1A 2MOVA 4IQHA 4Z3TA 1JXGA 1VFUA 3SQOL 1FZKA 2Y07H 4LSTL 5CD5D 5J1TC 3FQWA 2J6EH 3GIZH 2J1ZA 3EGDB 2E7DA 4YDMA 1T1XA 3W9DB 4BH8B 1HE8A 5D6CB 1XGPA 3HB3B 3PHQA 2FR4B 2X70A 3MCLL 3T8VA 1KT2A 2VMCA 3A22A 2VXUH 3ECWA 1UFUA 3QFJB 4KK6D 3ZKMC 3DK2A 4F7PA 4M7ZC 1A7OH 2MPAL 4AL8C 3TPUB 2H26B 4PGEB 4U3XA 3CSBA 1B3JA 1RIVH 3DX2A 4LNRB 4NN6C 1NQBA 2OMWB 1XGRA 2VLRE 3QRGH 1ZLSH 4A2FA 2Q7AA 5CD3A 2AJVL 2EXYD 2JJTC 3SKMB 4AEEA 1A8ZA 3A5VA 2FX8L 3SY0B 3VXUA 1YMMA 5L4MA 4LVOB 1ZSHA 2YD2A 3W0WA 3GDBA 3HG3A 4GEJA 1LK3H 3FQNB 3K6FA 4NKQB 2R39A 2QQNL 3QDGB 3FQTA 2OXHB 5TE4L 2LFEA 2ZE0A 4OLYH 2ROYA 4EOWH 1U95A 4G9DB 2B1HL 4OTXL 4JNXA 4JR9L 1CLOH 2NY5L 1OAXL 1FH2A 2G2RB 1VADB 2VR4A 4Y1TA 1U8HA 3SGKC 2CJTA 5TFSL 4W4OC 4KMQA 2ZD0A 3AM8C 4OZIF 4TNGA 3MRRA 2FUQA 2F18A 5CJ5A 1IILE 1U91A 3M07A 3ZYJA 1T1WA 3O41B 4W9DC 3I2CL 3S98A 1XF1A 2YBGA 2B0SL 3O3DB 4QTIL 5AW8B 3QXAA 4HVBA 4EVNB 1DQJB 2IAND 3SDXB 5T5FH 1XF4B 4N2EA 3TEZA 3PXJA 1O5PA 2ATKB 2BFVL 4OCYL 2WXGA 1IKNC 4MNHA 1AXTH 4U1JB 4F2FA 1QKZH 3T0BA 2BVEA 1PBYA 3EHBD 3M46A 2PYEE 4FQ2L 4HPOH 5JPNC 2WYZA 3IFOB 4M29A 3HPJB 4QWWC 3BI9X 1Z5LA 3MV11 3NTCL 2RD0A 3RB5A 5F6IC 1IE5A 5EPMB 2VDLL 4NWUL 5AW5B 4ODWA 3AADB 4UNIA 1ET7A 4FXGC 1HHJB 1BIHA 5DI8A 2Q7YA 3EFFA 4HHWA 5GZOA 1LNUB 4NC1C 2NXZB 2HTLD 3I02B 1TFHA 1CFVH 5IJKC 2CRMA 3JVGC 1FDLH 1HINL 3G5ZA 3CK0L 4TUKH 4PW3A 3ZE1B 1NEZG 5I1CH 2EDEA 4H8UA 1DANT 1JDCA 2I07B 2EC9T 1JDAA 3DMMC 1OQOA 4LP8A 4NO3A 3ATFA 3BPCA 4OLEA 4PD4J 3CVHA 3FZUC 3K8KA 5FO7A 5IB1A 4FFTA 2LU7A 2I7SA 1RXLA 2NY7L 1BG9A 3BX7C 2ZQKA 1UYWL 2YK1H 4R0LC 4YFEA 1QLRA 3ETBF 1FNEB 3QHTC 4UTBH 4OZIA 1I7ZA 1EEUA 1NAML 1RERA 3OXRB 4L4VA 2WTOA 3Q8CA 4QAMB 4R4FL 3QUXD 4MXWL 4TPRH 1I85C 3I50H 3IK2A 4AZ8A 1VA9A 2HMID 1M05A 1IQDA 4CN1A 1N18A 3DK0A 3TO2A 1J1XL 5DRNB 5IMMB 1HH6B 5J5EA 1SDDA 1UB6A 2DQIH 2J20A 4Z3IA 1YMMD 1EMTH 5GRWA 3K71A 3VA6A 1ZCRA 3HCVB 1F4YL 1MPAL 4HMCA 5BV7L 4I0KA 1L0YA 1NFAA 2G3ZA 3PHQB 3EBAA 2X7LB 3SD5A 3U2JA 1NCCL 3BAJA 1TFPA 4E68A 4UTAL 4BDVA 1LJMA 2I5YL 1OTUD 3RKPA 3T4AB 1FDLL 3TOPA 1G4MA 4JO1H 5HGHA 5IB3A 3V5DB 2AQRA 1DSWA 5DVOA 4AW4A 2FHCA 5I1CL 4E9VA 4WSKA 1CXKA 5J11B 5IK3B 4PD4K 1KIQB 2C5DC 2PTTA 5SX4H 4ZD3H 4N22A 1FORL 2QJDA 2WBJB 1GCYA 3BN9D 5H2BB 4ES9A 5J0BA 1DSFL 4K5NA 1P53A 1JHTA 1UA3A 5LGHH 1V10A 4B3VA 3U36A 3NSCA 1DQDH 3FRPB 3TFKC 3BUYA 1X6LA 3VXMA 5IOPB 2LU4A 3FSZA 4LLMA 1CYGA 1UD2A 3EYVA 1TZHB 2JB6B 4D0CB 3NJHA 1NBCA 1PG7H 4WW1A 4BFIA 4PBDA 1OP5K 2Y24A 1DBKL 2CO7B 2A38A 1ZXQA 2ERJC 1NMAL 4ICXA 3HKZA 4IK6A 3LQAC 3NFSL 2H2PD 1BWWA 2NQ3A 4X4ME 5I6MA 3STBA 3TBSA 5A2IH 1ETZB 1MVUA 5CIPH 1AZZC 3H4FA 3U4BH 1W8NA 3OHMB 3KW8A 1Q0XH 1WITA 3NJLA 2CE6A 4ODSL 1RUMH 4GEIA 5C8JA 2OMVB 1ZPUA 1EO8L 1DVZA 4YNYB 1FVEB 3WJJA 2P8PA 5ACLA 4EVNA 4XPTL 3RGBA 1WHOA 4PIBA 1UB5A 4L05A 1JZHA 3FB8B 4J3TA 4V33A 3GUFA 1XGQB 3PV6A 3CXFA 4X42A 1UADC 1H3WM 4KV5F 3JVGA 4KBPA 4FXKC 5FUZH 3RHWF 3UX9B 4AGLA 1EGJH 4OJFL 4GI9A 4UQ3B 3VM7A 4XWGL 3EG9A 1OANA 4Y19E 4XVJH 3C08L 3ZO9A 2FUTA 4JRWA 4Y4KA 3T0EB 4FC3E 4ODTH 4AGMA 2AKRA 4P5TB 1J8HB 1LO4H 1H15B 3HBQA 2BNQE 1S7XB 4MDIA 4XB7A 2YGQA 4WWNA 4XX1E 5IUCA 2H9GA 5IFJA 4YSOA 1YMME 3MNDA 5CAYB 3QUMB 2A4ZA 2YD4A 3QQ3B 3VG9B 3EYFA 3V4VL 1IAKB 4YGAB 3PP3K 3TIEA 4Y5YC 3RB7A 3OKKB 5I73C 1UZGA 5KW9L 5FYLE 4HKBA 4OUUA 1SEQH 1X5IA 3B7SA 4Y4KD 3VI3B 3CH1A 5FYKH 2WPGA 3H0TB 1ZGLA 2WGNB 3D3VB 1EA9C 3DPBA 3Q43A 1T7WA 3FB8A 3DIFA 3L48A 4WO0A 5B39G 4ELMF 5CFAA 1RK7A 1U42A 2EIZB 2WKOA 1WBXA 1GYVA 3L95B 3GZOA 4W6WB 3VNZA 4NQVA 4QRRA 1DJZA 3EYVB 4ORGA 5HVWA 1TLMA 4TRPH 3S37L 4IOFC 2WKLA 3MRDA 5F9WC 4ADIA 1U9KA 2I85A 1ONQA 1M3IA 5F0PB 2HPTA 4YHPB 2GHZA 4P2OA 1E4KA 3SY0A 4YDLB 1EHXA 1IGJB 3GC3A 4ZI8A 1HEJC 3TEYA 4N8PA 3AZUA 4HKXA 4WU5B 1HZHL 1QPPA 5GGRY 2VAAB 3VXPB 3TA4D 2JJTA 2MOGA 5HTSA 3QJUB 1AFVL 3EKCA 2BCKB 2YPVH 1UYWH 4PJFA 2QKSA 1BF5A 1J11A 2NNXA 2QMKA 1AFVH 1E2WA 1OGAB 3VXNA 1T0OA 3T4AA 3MRJB 5CR8A 4FFZA 1CICB 2GJRA 3WTUA 4QCIB 3AXIA 4W9FC 1O7SA 5LAXA 3HCVA 2HFTA 3L4CA 3NEXA 4RFOH 4WY7H 3BLPX 5FOJA 5HYIA 2CDGB 4M3HA 5I0WA 5ITFA 1ORSA 4HIXL 4DERA 3D85B 3L16A 2V7NB 5KVFE 5GGUA 2JTYA 2WXRA 4UIKL 2NCEA 5EEUA 3RI5K 3FOMB 2A9CA 5CEZD 4K9EL 1FAIL 1AG0A 1QFUH 1E6OH 2H1PH 3IE9A 1NGQL 4N8VG 4BH7B 4YHPA 4XXDA 1VHPA 3IXAA 5K59E 1P7QB 5C0BB 1DEDA 2BJML 4CU8A 4UNVA 5KVDE 2WNXA 2VR5A 1KB5L 2EUVA 4A2GA 3HHSB 1MCHA 3M8OL 1NIEA 4JGUA 4XVOA 4B60A 5GPRA 3D05A 3UTSA 4BZ2H 1ZLUH 3QH3B 4I3RL 3SE6A 1IAMA 2BVQA 5EZJB 5DJ8A 1WAPA 2KERA 3QFJE 1HFUA 4M3KB 1OSZB 4JM4L 2BINA 4N20A 1FZMA 2NY1D 2XZAL 4PJ5A 3Q7JA 3WYRA 1MVYA 1EAQA 2ZXEB 1R9FA 1IGTA 4J23A 5EDXA 4QXTA 3TYFB 4JHVA 4XBEH 4YHML 1XV8A 3AGWA 4FQHA 1TQSA 2XPGB 4UIMA 1KXQE 3ALPA 1RY7B 3QNXB 5E99H 5KBLA 4XBMA 4PJAB 3L1GA 2OL3B 1HINH 3PS6A 3RWDB 3KLSA 3VGEA 2WY3B 4MDRA 5LNDA 3II2A 4UV7L 1LE5B 4ZFGL 3SDDB 2P7TA 1P0SE 4LKCA 1E4HA 4GW1A 4YVNA 2L7UA 1FFPB 1AR1D 4OT1H 1NL0L 1TNNA 3U9UB 4LAQL 5I30L 3NPZB 1RZPA 2KC0A 4AGPA 1XCXA 4FFYH 2CR6A 5BW7A 5SWSD 2ADFH 4QYOA 5LVEA 3S3PA 3TESA 4RA0C 3WUWA 4X4XA 4NCDA 4L29A 2AJZA 3S6CA 2AV7B 4KJQC 3V0AC 5AOZA 3GHEH 1R24A 3P0YL 5L2KB 4F57H 4QIRA 3CXHK 4R26L 1J5DA 4AGQA 2O6EA 4MS8D 2VABA 3E1ZA 3UCQA 5L8LB 5AFAA 2EO9A 4H40A 3PP3H 1BMGA 3QORB 4LBEA 4NENB 4PRAA 2RGSA 1YY9D 4FI7A 2LLNA 1PX4A 2FYYA 2OMUA 2YBRB 4WFFD 5L9DH 2L7QA 1T21A 3VWKC 3CFKA 4GAGH 5EC2A 4M7KH 1PSKL 1IEBB 4M5YH 3LEYL 1N10A 1L4IA 2W9EH 2YRBA 2D8KA 6PCYA 1L6PA 5T5FA 5DJXA 1MJUL 4JHWL 5CZVL 5DJXB 3DYOA 4KXZI 1E9PB 1T3FB 2YPLB 3NK4A 5IOPA 3O6LH 3B5GA 4YOKA 2B1HH 3QH3A 1J0KA 3H55A 4RMVA 3EBGA 3N40P 3HZKA 3DX9B 3QK0A 3CHSA 2J6EA 3REWB 5BVPL 3GB7B 1XF3B 4E5XG 1T2JA 1A7BA 1AHKA 1S7WA 5IWLA 3LVTA 2VMEA 2XBTA 4RH4A 4JKKA 4LDOB 5INDA 5FB8A 4TUJA 2XTJB 3HLAA 5IBTL 3QEHB 2WZAA 1BFTA 1J0JA 3WEAA 4Z7OF 2FATH 4HJ0C 4Z0BL 2VCOA 5B39A 1J88A 2AK4B 3EO1B 1J5CA 4FXGB 5I1KH 4P57B 1ZA3A 2F61A 3V6BR 1S9WA 4F2MB 4X6CB 4I2XA 4OGZA 1PD6A 2UV3A 3O2VL 9CGTA 1RHHA 1CDHA 1U8JA 5LG6A 3BZ5A 4MCZB 2FK9A 2P1YA 3GSUB 4YIQB 4KK9D 1F97A 5T3XD 3QISA 2GUYA 4RBPK 5D9SA 1JMZA 5IFHH 4N2IA 3LH2L 4IBYA 5E8NA 5E2TH 4ZFOL 5SX5K 3WGVB 1T6BX 3UYRL 2P5EA 2BLFA 4JKLA 3CSFA 5EBWB 4N8UA 5HDQL 5BVPH 2E27L 4IIQA 3QB7C 1SHWA 1RVFL 4Q9QH 2BSTB 4DOHB 2R0KL 3PDOB 1F13A 1LO5A 3BSZA 1FNGA 1CL7I 5L6YH 5EBMB 1I82A 3MC0A 5HGGS 1WWWX 3ZTJH 3Q2WA 3QDJB 2O5NA 4S1QH 3TH3T 2PWFA 1JNLL 1OP9A 4PJ5B 1LYQA 5JW4N 3BFQG 3KNBB 15C8L 3X17A 5EULV 5EU5B 3DRQB 3G04A 4QRSA 3SO3B 4PSRA 1GJWA 2YXWA 4JL1A 4RRPM 3ZHFA 2TSAA 3C12A 3KPRE 3OAWA 4ZSOA 3V7AG 3UP1A 1NICA 1NOLA 1W0VA 1HHJA 1FHGA 5DQ9A 1TJIL 2ZUSA 3CMGA 3G6JB 1M2VB 1KCLA 3QDMA 3OWEA 2F7PA 5KTEL 2AABL 4AW7A 2JV6A 5JZ7D 1UWXH 1CDCA 3ELAT 3SQBB 2FBJH 1MFCL 4NQEA 3DXAD 4JFFE 3B2MA 1DLFL 5FHBH 2NR6D 2APXA 3ES6B 3IDJA 3QQ4A 4XCCL 3LIUA 1DLHA 2XNAA 3NOIA 4P23A 3AMLA 1E90A 1K8DA 2YWYA 3B9DA 5HGAB 1W16A 3QXDB 2UWEB 2YC1B 3WFBL 4H13C 1L9QA 4F8TA 1X5JA 4XPBH 1FZOB 3GJFK 3H6AA 4OLZH 4GIAA 4MB4A 4XC1H 4ZAKA 5AVSB 3RJOA 1PIFA 3LKQA 4TKWA 5ACMA 5C7XL 1QFWI 3DV6A 2ZTBA 3LB6D 1CVSC 1MXGA 1U30A 4KVNL 3L5XH 1BXXA 4X5RA 2DEXX 1YEKL 4YXLL 4C4UA 4WNQB 3GXMA 3SE9L 4RIRB 1E2VA 3SDCA 5I28A 5JW4Q 3K80A 3JZ7A 2VSCA 4AYSA 3QJVB 5HI4D 4ZQTA 1F58H 3G6AA 1XBDA 4MNQE 4ZYKB 2YD9A 1DVUA 5D6DC 2EDFA 1NDTA 5HYQA 1YY9C 2LV4A 4GMSH 3U1QA 5B3NA 3DBSA 3QIUB 3L4UA 3T4AC 1GSKA 3B3IB 3QPQD 3RWIB 5FUZL 5AAPA 1GJIA 4U2ZA 4GBXC 3MLTB 2E4TA 3OQRA 4W9LC 3TBVA 2J6WA 1WBZA 5HJ3A 4GH7B 3WHE1 4B9ZA 3WIFA 4UU9A 2DW5A 4G8GE 3TZVB 1OP3K 4R5VA 3T77A 1WG3A 2LQRA 2W0FB 1R0AH 2BWQA 1BZ9A 1HSBB 5AEAA 1DL7L 3O0RH 4K3EH 2WANA 1RZ8A 5BRZD 4QY8B 3MRQB 1FAIH 1VAHA 1YLBB 2ICCA 2XVKA 3ARRA 3U6XS 5HHOA 1JD7A 4MKMA 4YDNA 1TZ8A 3IMWA 1RZ8B 3C6LA 1JCVA 1JRHH 4YBQD 5LBSL 5ID1A 3QUHA 3V9CA 1G9NC 2DWEB 1YAIA 4NZUH 4QRAA 3RA7H 5KVEE 4LOVA 3BAEL 1NFDA 2E7BA 2Z3FA 1Q9LA 2DYPA 4O2EB 4YDIL 1IE4A 3ARGA 4TLKA 5EOQH 3QWQB 3QQ3A 3MLSH 2CWRA 2YFNA 1Z0MA 5ADPH 3OKMB 2DQGL 4O2CB 3BWUF 3NG5A 3THMH 3IDNA 4E9RA 1V7NH 3FU3A 2ED6A 2OMYA 1JNHA 1K4DA 4ZUSA 2VZUA 3W5MA 3BSZL 4PV8A 2P43B 1KGCD 2P8MB 4FEMA 2VLKA 4ZMLA 1K8DB 1HWWA 3BGFC 1TMCB 4JPIA 5SWZA 6FABH 5E6RB 1X44A 5GRYA 3Q5YA 3MO1A 1J0ZA 4IRZL 7FABL 2EP6A 4ALAC 3JZYA 2XETA 1H3GA 4UTAA 1D5MB 3DXAA 4HWBH 1AOZA 5LCVA 3FO9B 4ZS6C 3HI6L 2VDQH 3MFFB 1E40A 5CHNB 4IDLA 1XCQB 4BHUI 1A6VL 3P9LB 3N06B 1S78C 4YDJB 3TO2B 4GSDH 2EKJA 1RUAH 2BSRB 2UZIL 4G83A 3W38A 2NY5C 4KTEH 4BQ8A 3LH2H 5DZNA 4BRJA 4IBLT 4KNTA 1GW6A 3K5SA 3ZMNA 1GS8A 4ELME 4EZMA 3L13A 3NABL 3RPBA 3B3BA 2C3VB 3CFIC 5HHQB 1XSJA 2NY0D 5FW7A 43C9A 1YEGH 3NCWA 1K3ZA 2C3VA 3POHA 2I07A 4OKVB 1XD0A 1ZHKA 2A9ML 3IAPA 1ZTXE 1TTGA 4PV8B 3G5ZB 5L2KD 4PVNA 2R83A 2O6CA 4NQDD 4DGIH 4G7YL 4QRPB 5HDBF 4MNGE 3VSQA 2FATL 3JUZA 1JVKA 5CU5A 4Z0BH 1MREL 5GRJH 2YGNA 1Z3GL 4J3VA 4OCWL 3RVWC 4N2GA 1WRFA 1KENL 2WBJA 4ZJ9A 5J6HA 2R8SL 3UTPE 4HAGA 5D7LB 1FSKC 1XH3B 3R06B 4L3EB 2XWCA 3CBKB 4X6EA 4JKPH 1OCZB 4NS0A 3ZO0A 4P2RB 2NW3B 4TVUA 4K7FA 1UM4H 2DQFB 7PCYA 1KLFA 4GLRI 3OAYH 1HCYA 1BVOA 5CZKA 4FQ1H 2IQ9H 1T2XA 4KK5C 1L9MA 2OMYB 3S2CA 1RUQL 2EAEA 2FJUB 2NXYC 3QARA 5BRPA 3P11H 4LCCB 4ANVA 3FS9A 4UF7C 4MQ7A 5EU6B 2B3IA 3O3AB 4XPGH 3P11L 4O2EA 1U6AL 1KYDA 4HS8L 4IM8A 4JREB 3QI9B 4K8RL 5I17B 3QCVL 2DQDH 2WYHA 3HMXA 5DJ6A 2MWCA 3F83A 2W65B 5A16A 3B34A 2JVUA 4FZ8H 1GAFL 3VTAA 1FYHB 4OLVH 3US1A 4G6KH 3MLXH 1CXFA 4RGNB 1PG7W 2XFXB 2YAHA 3CIAA 3CQFA 3NSXA 3PDGA 4IRSD 5BS0D 3L1OL 4LCVA 5D4IA 4JFHE 1PZ3A 4RMQA 4LPXA 1UZ6E 2EDJA 1MIEL 2K1MA 2XRAH 2YSSA 3HZKB 3L2LA 5C0AD 5TFSH 4OD1L 4PYHA 4WQOA 1HXMA 5HGDA 1BD2B 2K4WA 3ZDZF 1FN4B 1J9CT 4LHJB 1VJSA 1E6JL 3LVEA 5DD5H 1RIVL 3BGFB 3MOAH 1N64H 4Y7MA 3ZXAC 2DL9A 3N43F 3PIQB 2DEWX 4L8SC 3STLA 5B8CC 4ATWA 4N90D 3DO7B 3SYQA 3SKNA 1A7OL 1F5WA 1X5KA 3MOAL 2PN5A 1P7HL 4UAOC 3RWHB 1F86A 4JMXA 5IOKA 5L8KB 4X9FA 3RNQB 1SJEB 1BIIA 1A1MB 3FUNA 3ARVA 5BZDB 1QFUL 2NY2D 2X4NB 2F54A 4NNYA 3WFCL 2R2HA 2VABB 4BFEA 1C8PA 2PWEA 4W9CC 4Y4HB 1A1OB 3LZQA 4L2LA 3F58H 5I1AA 5KYYA 1P7KA 1F58L 2NX5E 3FUIA 5F6IB 2IFFL 2ZOUA 2GUOB 2EDHA 1J8RA 5I8EB 2D31B 3KPSB 3QJRB 4JRXE 3QXVA 4JDTH 4NAQA 4DIXA 4FD0A 5E6IB 5B7FA 1NDGB 2Z93B 2HMIC 5HI5C 1A6ZA 4JO5A 4NHUA 5FWQA 3W0WD 4XNYL 3NRPA 2RFXB 3GS7A 4OF7A 4J1UB 5CN2A 3WS3A 3A6CL 1ZHNB 5DJ2B 3CC1A 2H8PB 1Z1WA 1NLBL 3PUCA 3KEHA 4N6QA 1U8OA 5AW2B 4Q4IA 4AIZB 4NKIL 5I8OH 1S7VA 2YPKA 4OLWH 3KGTA 3MRKA 1HXKA 5FDYA 3MYZA 2J44A 4QR7A 1ZANH 4Z7UB 4TVPL 1UHVA 2BVYA 1WHPA 5FA3B 5LN8A 4P5TC 2E7CA 1P5UB 1YUKB 2KMWA 3E2HC 3UTTD 1P5UA 5IFHL 1ZA3B 1RP8A 4NWUH 1L9PA 4R4BB 5D6DA 2CCLA 3BT0A 3RE0A 4LDEB 4HEMA 1R3IL 1CGXA 2BRRH 3D5OF 5BV7H 4MD0B 4Q6IB 3ZHNA 4APXB 3P4MB 2FJGA 2OSXA 2R9HC 3QZMA 5FEBA 1QPXA 3V0JA 3O4OC 3VJ6A 3ARED 3MREB 3T5WA 4EXPX 3NCMA 1IEAA 1NKRA 2WAQA 4G8GA 5FYKU 3WXWH 3HJEA 3F65A 4OBSA 4J3WA 4GI8A 3V0FA 1N68A 2EIDA 4NKDA 5C0NC 4F92B 4N0UA 4X6DE 3WMQA 4ZX4A 5HBBA 3N1FC 4O00A 4NGHL 4QTIH 2BVUA 3SPVB 1ZWIA 4MSWA 4QEGA 3ENEA 3VXRD 5TTRA 1JXJA 5JUEL 1S7QB 2GSMB 3H7BA 3UPAA 2APSA 4LIQL 1JI1A 1C1EL 3L4YA 1N70A 4NLAA 3TV8A 2GY7B 1ZVSA 2IH1B 3BPLC 1G7MB 4I77H 3QIBD 5TK4A 2NXYD 3HBPA 2ARJQ 1E5YA 1RUAL 4L4TD 4NYLA 2Y4SA 4G43B 4GSRA 1NGYB 4K3JL 1UWYA 3RWGB 2MNUA 5E23A 3OKMA 4APQD 5JIIA 4AWJC 1CBVL 1WE5A 3O6LL 2VISB 1U21A 3VXRA 3C5SA 2PTUA 3HRPA 1HL8A 2RB8A 3D0VB 3BFOA 4NNYB 4O02H 4Z7QE 2VR8A 3GXTA 1XXDC 5AB1A 2FEEL 1YG9A 3SGJA 4X4YA 4JCLA 4M43H 4DO6A 2VJXA 3EJZC 4XC1L 4H4NA 1LE9B 2LFGA 2C4XA 1C08B 3DUSB 1QBML 1M7DA 2ATPB 5HHXL 1MHEB 4B5ZA 3RWCA 1G1KA 2NMSA 2VUOA 3LHAA 3DUSA 2IANE 2ARJA 1I9JH 4P46C 5AOMA 4XMPH 3B5HA 2E7LC 1E27B 1BXUA 2UY6B 4IK7A 1A7RH 3ZE0F 3QDME 1RPQA 3O4LA 3KJ4B 2HFEB 3CX2A 2YSSB 3ME0B 1PCXA 3QZWA 5MERA 3QUMA 2CPCA 2YZ8A 1NINA 3NZHL 3T3PB 3K4ZA 5L88L 2J8OA 2NR6A 4RDQG 3GT6A 5DEZA 3VQ1C 3ZE2F 3DPBB 3ML8A 4FQLH 5F1OB 3U30C 2QDWA 3B9KB 4IBWA 4FE9A 3WNKA 3UPRB 1BQHA 2NLJA 1NC4D 4LEBA 5HI3C 3VRJB 1D5IL 3QNYA 2SEBA 3DVGB 1SHXA 4P2QE 3MRCB 4V1DE 1A7QL 1FLRL 2HCZX 4M48H 3RPKA 1JN6B 2W0LA 1EAOA 3AB0C 3K8MA 1NFKA 3NGBB 1K6QH 4GSXA 1TEYA 2MEJB 3GSXB 1D7BA 1J8HA 3KBEA 5E0FA 2X6VA 5K69A 2K9FB 1C5DA 2RCSL 2WLLA 3US9A 3HC0A 3X1GA 1LWJA 5E9DE 5HI5D 3T3PE 5C0GB 1PFCA 3ASWA 3ZE0B 4Z7AA 4NFDA 1JZDC 1U3ZA 1Q9KA 3RWJB 4ESKA 1AYRA 1RPUA 2ZWLT 1JPST 5AZEH 1C8QA 1HIML 5E9NA 2XWBA 1KXVC 3GSWB 3P30L 2OZNA 3CFCH 4MZRA 5EU3B 4D3CL 4TVPE 4XCEB 4I3RH 1NCDH 1RPKA 4XVSL 2YD1A 1YYML 2RFXA 1F6LL 2ZCLH 5FYKD 1DEEA 2DLGA 1VFBB 1VEPA 3QDJE 4U7SA 5DD6B 3AG1B 2CR3A 1IIIA 4OF5A 3D85A 4FFVD 2C1OA 2YN3A 2HRLA 4L8SB 4FLSA 3QUZB 3QCUL 2YD7A 3K46A 4FQJH 3BDXA 1KELL 3B2UC 5AL8A 4XBEL 4P5TD 3TWYA 5IFAL 1RQ5A 5EOCH 2GTWB 4EN3C 3QQDB 2C3WA 4B3EA 1X4XA 4XP6L 5D1QC 5CBEA 2ZP8A 1SHSA 1YJDL 2P44B 1VESA 5KOMC 3RY4A 2V2TA 5DUPH 5C0AE 3WY1A 4JFFA 1R5IA 3RZCB 2Q87A 4BFIB 5AVWB 2BCKA 4B9IA 2J8UE 2PW1A 4TL4A 4LLMB 3GRWL 1RURL 3TVMD 4POYA 3OJMB 4DKAA 3Q8BA 4KC3B 3QUYC 2L0DA 1L6XA 1RZKH 3B4NA 3PV7A 3W39B 5B38A 1BQRA 1QABA 1YNTF 5DO8A 3VWKA 1JE6A 3CAFA 3DA0A 5LNGA 2R7EB 1E8ZA 1B4TA 3GYRA 4JFEB 1CD0A 4WAFA 1SMOA 4PTUA 4LCCC 1SJEA 4JO2L 1BBDH 5KWYC 2ZKHH 3ZUCA 4ZFZA 3S2AA 1UENA 1MHHB 4YBHA 1S7RA 3WD5L 3VFOA 3CFDA 1WS7A 1UZ8A 3QEQE 3UYPA 1B2WL 4X9YA 5C0JB 1FG2A 3NCEB 1YEHH 3QDGD 3TT3H 1G7PA 4KRMB 1U8MB 2EZ0D 2IWKA 1SOQA 4UT9A 3U6RB 1D6EB 4XRCA 4NZRL 1UKQA 1VZGA 1CK0L 2ZYHA 3KPLA 4G42A 4FFYA 4Z3JA 4ZX5A 3SKJH 3ZTJG 3ELQA 5H35A 4Y2DA 4PVLA 2WOYA 4NQDB 3T0EA 3S36X 1F90H 4XBPA 1FO0A 2J55A 2X3AA 2WN2A 2HZHA 5F6HI 1EX0A 4AH2A 4RIRA 2FO8A 2AJYL 2G4GA 4HGKC 1HJCA 2BVOA 5DD0L 4UOZA 1AKJB 1F0LA 1OGTB 4LT7A 2BY0A 3FUHA 4LEOB 2G30A 5D7IF 3C75A 5LWYH 1KC5L 2DM7A 2R15A 3CZKA 2TRHA 3NJFA 1J5HA 3HAEH 2BVPA 3SCMD 2AJVH 4LARL 5CXPA 5I18L 2DIBA 3VAEA 1XEDA 2YUXA 3MLTA 5DI8B 2VKWA 3EYSH 5ANHA 2H3KA 3UTSE 4I88A 1WFOA 1PX3A 1PKQB 3NIFE 2CBMA 4YZFF 4NHCL 1U36A 4FL4C 1WJ3A 4K3JH 1QSVA 3DBXA 4JEGB 5D7LE 5K59F 5E6IC 3BUBA 2ZICA 1WD9A 2MH4A 3SPCA 4AYID 4YDLC 4EKXA 3N43B 1OO2A 4U0RC 3RL1B 3X13B 1BJ1H 5AWNH 1K4CA 3FFCA 3E8UL 4MRBA 5C08D 4X9BA 2JB6A 1YDPB 3MV8B 3U1SH 2EEFA 4IRZA 1JNNH 4I8DA 1HK6A 3FT4A 4UV4L 1RIUH 4LE8A 5AVUB 4KKRA 1MRFH 4TM9A 4OGQC 2ZYSA 3GPSA 3WKML 3IJEB 4LSRH 2VERA 2CUMA 2YAEA 1DDHB 4GRMB 2ICEC 1I9EA 2B20A 4NERA 1BMWA 4R90L 1PZ5B 3EUDA 5IQLA 3MRRB 2ZCKH 4F7MA 3DRTB 1ID2A 1BQUA 5LBGA 2W60A 2PTTB 4ZTPL 4I13B 3IDYB 4XCEA 2HVJB 4NKOB 1M6UA 2D3JA 2Z7UA 3BE1L 1FPTL 5PAZA 4IRSA 1VFAA 2EH8L 5T3ZL 3Q01A 4BXVA 2XV3A 1B88A 3HR5A 4GW5A 4N2NA 3PPEA 2PO6C 1PAZA 2YD0A 2DTMH 1B4RA 3TO4D 2H26A 3QR2A 2XWTA 2BP5M 3MV9D 2M8XA 2BOCB 2YQ2A 1T1YA 1HHKB 4O02L 5CEYA 1U8NB 4PGJA 2V9RA 4DKDC 2IVFC 5I5JA 5LCVL 3M7FB 4XNXH 1YNTB 1NCCH 2UX7A 3KNBA 5L6YL 2JELL 3IXAB 4AYFA 5I8KH 1ORQA 5I71B 3EJYC 3MBEB 4FXKB 1A22B 4Q6YA 1T22A 3F7YB 2PCFA 1Q9LB 5GGSY 2VZOA 1DQVA 1N26A 1EAJA 4YHOH 2Y6SD 3FOLB 3N1MC 4BZ1A 2EE9A 3IMUA 1KPRB 4H0HB 1DVTA 4J3OH 1Z9NA 5KBNC 1CFQB 3OMAB 4O2CA 3EGXA 2UUDH 2OZ4A 2UYLB 3MLZH 5FKPA 4PAZA 4FQQB 3GSUA 1G6RL 2V3EA 2DRUA 3FH7A 4BH8A 3KYKH 3D39D 3CFBA 2J73A 1QSFE 1QFPA 4A63A 1QQDB 2XBDA 4XVSH 4M6OL 3B9VA 3CC5B 3SDDC 5JXEA 3GHBL 2NR6C 4E0RA 3W9EB 2WP3O 4JRXB 1RJCA 1SF3A 4MB1A 4ODUA 2EIZA 3SBRA 4LPYA 2EZ0C 4Y19A 3S48A 1SXNA 5IY5B 3NCJH 5K9OB 1BJMA 1IBHA 3CK0H 3NSDA 3K4DA 4GUPA 4WENB 2X41A 2DWTA 1OAZL 4KQ3H 1OD7A 3DV4A 2PYFA 3K2IA 4EBQL 4Z77B 2VDLB 2ZWYA 2TSBA 4PMEA 5JOPD 2RHEA 4M8QA 1AYOA 4TLSA 4I4WA 5FLUA 4MGXA 3BKCL 1CFSB 4HIJB 3U0TB 5JNYB 1QKZL 2N1KA 4P9HL 4R4FH 1VENA 4I1PA 2EINB 5DFTA 1U3HA 1IBDA 3CZFA 1IM3A 5D70H 1PIGA 4F7EA 2E59A 4M7JH 5I2IA 1TQVA 1EUTA 1MFEL 1KEGH 1G1YA 4KI5C 1SBSH 2C9RA 1WT5C 3C2AL 1FFNB 1YEJH 1H5BA 3MCYA 4DNLA 5A43C 3DGGA 4QOKB 3SDCD 2CGYA 3UGXA 4DQAA 3ULVH 3UO8B 2R0LH 1XF5B 3E3QE 5J06A 3IDUA 5HY9B 3LXAA 2DWSA 2VN4A 1YEEH 4WHYG 2Z7WA 3WL9B 1KLUA 3CDYA 4U31A 5IQ7L 1NGWB 4TULL 3AWGA 2XZQH 1M2VA 4LRNH 4WNSA 2E7MA 4ACTA 3VJ6B 2J25A 4HKJB 3FO1A 5F1IB 2ZPKH 4DVRH 2Y1VA 2BH0A 1M42A 5G5DA 1V8HA 2NDFA 3FQRB 3IKCB 3PJSB 5E6UB 2CGRH 5HHVH 5F88A 1MOEA 3QDGA 3LQZA 3LEVH 4G1MA 4N2FA 4P23D 5IF0B 1YC8A 1U93B 4GKSA 1R75A 5KUKA 2ADJB 4P2AA 1DSFH 5CNHA 2F74B 1C7SA 1LMKA 4W9ZA 5JYMA 1RSFA 3P69A 4OB5H 4M8UA 4DUXA 3SE8H 4AQAA 2F0CA 4KRPB 4BUQA 2E9WA 2Y1YA 1A4KB 1GKOA 4RX4A 4U33A 2OZ4H 2AK4D 1NMBH 3BJLA 3GSNH 4K9JA 1ZSDA 1E9QA 2GEQA 2R1WB 1JZEA 5ENWB 1FVEA 4QLRA 4TNEA 5C0EA 3W9EA 3VVVA 5MEQB 1MRCH 4Z6AT 2YR3A 3LTVA 5D1ZD 1J5OL 2JJWA 4LSVH 4ZOBA 4CSSA 3FTGA 5JXEC 4UDUB 2FHFA 1F4XH 1X3DA 3QJXA 4HUKB 3MLVH 4DEUA 1PZUB 4NAJA 4RISL 3DGDA 3TVMB 3NZ8B 3O6FC 4FQHB 4XTRC 5JPNB 5H2BA 1S5HB 1RHHB 1GAFH 1U8JB 2PO6D 1D6EA 5EBGA 3L5XL 5AVRB 2ZUTA 1IKNA 1NDGA 2Z93A 4G9FA 2F68X 4LPVA 2XN2A 1AC0A 4C56B 5HHMB 2JWYA 2P5EB 5HYEA 2VRKA 4HIHA 1MZZA 2FSEB 2BVQB 3LQMA 1CE6A 4QXGL 1HEZA 1MCOL 2VDMH 1S9KC 3BT2L 1TZIA 4Y5VC 4K2UH 3QJFB 5KSBA 3X3FH 1HI6B 3R7RA 4XNAA 4X7TA 3RGVB 4XH2A 5B8CA 5EV7A 2W0KA 2B77A 3GJEB 4OCMC 1TTBA 3RTQD 1A1MA 2WINA 1M7UA 3D51A 4MNQD 2FR4A 1ASQA 1FZJA 4NPYA 4I3SL 5IJVA 2AANA 5BXFB 1N7ML 2D9QB 3FOLA 4OCSL 4U1LA 2CG9X 4MMYA 3FB6B 4HUCA 1KBPA 2I24N 3BPNC 5KYWA 1BPVA 4U1LB 3WKYA 1BX2B 4R7XA 1XGZA 4JFVA 1NGZA 2WZ0A 5I24A 5JLZB 3ZUNC 2CNZA 4U1MA 3ULVC 3QPXL 1KJVB 4I1NB 4K15A 4IOIA 3IDIB 2DF3A 3AT0A 4TSCL 3PL6B 1SDDB 5IBLC 3THML 1AXSA 2DJMA 2DQEH 2UUDK 5E8PB 2WBXA 5DEFA 4LF3B 5CCGE 5IREA 4YPJA 4WKXA 2XX1A 4HIHB 3QWOB 1CURA 1GC1H 4X8XA 5GS0L 3ILDA 1TQUA 3GFUA 3MOBH 3LKSA 1NCNA 2JKJA 1Z9MA 1XH0A 2MOQA 3UO1H 3HG1E 1RZQA 3GMMA 1S5IH 3VFPB 4TNWF 4S0HA 3ZL2A 4S2SB 1XR8B 5FYJD 1JGLL 3Q6GH 4M7LH 4KK5D 5LDUA 2TAAA 1DDTA 4A7TA 1J86A 5J13C 1WZ1L 5AW7B 4PHXA 5KN5A 3RBGA 3U9PH 2R69A 4HOZA 5LQBH 5D4HA 1A3RH 2IBGA 2EABA 3O3AA 4O2FB 2WMPA 5IBUB 4QHNA 3O4OB 2F1AA 5J56B 1GGCL 1J9TA 5F7MC 4LCIL 2B1AH 4GSDL 4DCQA 2BC4A 3KD4A 3TH2T 1MCLA 2UWEF 4FLQA 4BINA 1S3RA 4A6YA 2WXLA 3FO0H 3ALWA 2XIIA 3OAUL 3RVUC 2NY4D 3HZMB 1BJ8A 1FCGA 5AVYB 4UQ3A 1F3DJ 1T7XA 3UZEC 4DESA 1BV8A 3BPNB 2ENJA 2K8MA 1Q90A 4XOEA 4KQ4H 1V27A 3DO4A 4KJPD 4G82A 3HG5A 3BIAX 3DBXB 2WD0A 1XD1A 2MCAA 3IXTA 1MLCA 2GI7A 3AU0A 3E8UH 3WHE0 4GW1B 4WO4A 5D2NE 1X7TA 1EXUB 5T3XE 2I9TA 2FEJA 1D3CA 1NBVH 3UJJL 3SKOB 3SJVB 1SMDA 4LCWA 3WKMH 5BS0E 3GMPB 1DZ0A 1KCSL 1GA2A 4UDTA 3UTSB 1I8LA 2DZEA 3KHQA 3AG4B 4MXVE 2CKBH 4U1IB 5DJYB 4OZGB 2BOBA 4BBWA 2ZUYA 1GGCH 4KNUA 2FRGP 3KPOB 3APDA 1JF6A 3UABA 2K0RA 1QRND 3VD5A 1PY0A 2ID5A 5DFVD 5F9AC 4PJ9D 4HCRA 4UYQA 5C6TH 2I9LB 2W07A 1AGDB 3TS8A 4NRXB 4FFZL 3FTYA 4M00A 2BIPA 1KWKA 5KYWB 1TIUA 35C8L 5K9QI 2FZ3B 4PP2B 4YE4H 3HUJA 4Y4HD 4AY0A 1QYGH 3VA2C 4C83B 4L8DB 1U6AH 2PLTA 4NX0A 3P0YH 3KS0J 5F0JB 4G6AD 2EYRA 3GBMH 1YMHA 3JV4A 1W0WA 5LBSA 5IW6B 2OLDA 1KC5H 2OXGA 3P4OB 5CP3A 2K6YA 2R29H 3KVDD 3B9KC 4LHUA 2CKBL 3LNGA 2APFA 1D6VL 3GIVB 4W9JC 1OTSD 3M8OH 3VYNA 5FO2A 1TENA 1R5WA 1JOIA 3H3BC 3RL2B 3RU8H 3IGFA 4KY1H 4CMMB 5H37H 4Y2OB 2MCMA 4ZBJA 1E5UI 3TBYA 1OGPA 2JNZA 2J2ZB 5DQDL 5BW7C 3UGEA 5HDBB 1HX0A 3WTXA 3SDXE 4FTVD 2MKWA 4JFEE 3EFDH 3C2AH 1Q72L 1KF9B 1UOWA 3LEXA 3HUJE 2G5BA 4ZX6A 3LKPA 5FUOH 3FT2B 3KLAB 4GBXB 4MD0A 2HRPH 3ARGC 4NO5A 3ULVD 4HCFA 3IFNH 3NJMA 2YD3A 3QIUC 5CZXD 1RD6A 3IN0A 2R9HD 3WEBA 1YA5A 3FCTB 2EDLA 4YSQA 5DURD 2WM0A 5KAQG 3K6NA 5C07E 2JK5B 1E30A 2B5IB 4GIOA 1L9RA 4ODBD 4TSAH 1KJMA 2XWBB 2ICWJ 2ADJA 3E0GA 4HH9B 1IFGA 3RWJA 4D8PA 1UB6B 2EICA 2A3TA 2RQEA 3LQZB 4AENB 2YAMA 5IMMA 2V7HA 3GLEA 3MRKB 2CZNA 2N4IA 5E6ZA 5FFLA 2FGWL 5FYJH 1DBBH 1EDHA 4LCWE 5HJDA 3EJQA 4HUWB 3PYCA 4N68A 4NRXA 4N1EA 4P2RD 3GRWA 2Q6WA 4RMUA 4TSBL 1QTYT 2VZ1A 4EZJA 3PWJB 4NQUA 4X0KB 4PJ7B 1MFVA 4KNSA 4LVOC 4PM1A 2J5WA 2COVD 2DQJL 2ZXCA 3KPOA 2Z8RA 2E9IA 5C0CB 4LCYB 2Y36H 1A1NB 4Y8AA 3IJYB 5AB2A 1N59B 4WI0A 1A0QL 4Q6IC 4KDVA 5HHVL 4F5CA 5BZWA 4DGYL 3MRNB 4UTCA 5I66B 1XMWA 3GSNB 4LLWA 5K33A 1A7NL 3O2VH 4TV3A 1KFAL 3G9AB 3ZKND 2CIIB 2IG2H 5C0FA 2V8MA 3IDMA 4XCFL 3UAEA 3U9WA 1OPGH 1L9TA 5TE4H 4L0PB 1RZKC 1Z32X 5C0IB 5KVDH 4LSDA 2OMZA 3ZDYE 4UB0H 1M9SA 4U1JA 3HHMA 1JMXA 2VDML 1S9VA 4R8WL 2GTZA 3FUEA 4YPGA 3AABA 5DK3A 3V7AE 3IJ9A 4C56D 2FAUA 1COBA 1FRGH 1W0VB 2OW6A 3B43A 1DJYA 2LAAA 1QNZH 5CEZE 4PY7A 4DPRA 4JHUA 2B16A 3L5WB 3RURA 3O2WL 4NZTL 2XWDA 5CN3A 1NIDA 2ADIB 2MPAH 4YSAA 3MGTB 1PU0A 4Y9EA 3H53A 4O4YH 5KVEH 2VXSL 5B3SB 2CMRL 1FP5A 1ZEAL 3RWIA 5JO5B 3WUWG 4XP4H 5AD0A 3B7TA 5LB1A 1JD9A 4NEHB 4UAHA 5CD3B 5K9OA 3DUUB 3V6OC 5BPPA 2YLHA 2CLRB 3C60D 3HPLA 3K6DA 5HYSA 2QPFA 1GVIA 1BM7A 2HT3C 4KV5E 1O0VA 1RCYA 4LLYA 1AO7E 4UQIM 4YQXH 5JTWA 4UOJA 5GSRB 3NP4A 5F9WB 4LMQE 4DPAX 2X4SA 2IV9A 4HHGA 1TVHB 3AREA 4CADA 4NJ9L 4V1DD 1GMIA 5GIRA 4PJEA 4PP1D 2ZXGA 3D3VD 1HU8A 5H35B 1VKXB 4HFWB 4PWFA 5I16A 2OXHA 4KQ4L 1JUFB 1ZS2A 3NCBB 4GUCA 5F1SA 2WLZA 5F7LB 4RLDA 5BOZG 4CMMA 1JFHA 4UNUA 3D39E 3O3EA 3FO2A 3RTQB 2VSKB 4ZNCD 1LK2B 4QXUH 4YHYC 5IMOB 1JZJA 5MENE 1HCVA 4JANA 3MLWL 4LHUB 1PF3A 3L9EA 3WELA 4FL4B 1OT4A 1DCEA 1DQKA 2IMMA 3P02A 2YRPA 1GRWA 2D4FA 4BSVA 1TTCA 1VGKB 3U46A 4ZXBC 3RY5A 2ATAA 4DW2L 4JM2B 1YPZA 1G9NL 2EEDA 3PWUB 4HF5H 3EZJB 5EEWA 1IO4C 1K72A 5TQ0H 4NN7B 2AEQH 2J56A 3VXSA 4OJEH 4HIPA 3BP5A 4D0BB 2ODHA 1CFNB 3EGSB 3F01A 4KDWA 3INUL 1S9XA 1E42A 5GGTA 4ANKA 2C4FU 4G71B 2HRGA 3POCA 1K4CB 2VLKD 3FFCB 4UMGA 1X7QA 4G8FA 4WWKC 1G7JB 1JTPA 3PQYD 1G7JA 4RZKA 2XOTA 1X7QB 2FWSA 4CVUA 1TZGH 1QR1B 3JWNG 4U1IA 3IMTA 3S96A 3IE4A 3GD1C 4B9PA 1XF2A 5GXBB 1TZOA 4ISVB 4BA0A 3UL4A 4KTDL 4GG6E 2D7NA 3QDGE 1Z9OA 2R1YB 1F4AA 5D9SB 2GQHA 2JKWA 5A6MA 1E9QB 1KJ3L 2GBVA 4HCIA 4IMKC 3IVKA 3VRIB 4MCZA 4NIYE 2ERJB 5ICYA 3H9SB 1HSAB 3O3DA 1BAGA 3S5LB 2PWHA 1C5BL 3KGSA 4GXVH 4JM2A 3LX9A 4YUEL 2X4NA 3C8DA 3DXAB 1IAIL 1AHWC 4WFHD 3BT2H 1D5BB 3JWNH 4WJKB 3MU3A 1OW0C 5JHDB 1DQTA 4KK9C 4Q7DA 4K71C 4YK4C 5DC4B 5JPMC 3MO1B 4Q9BA 3RUGB 5JORB 2EDOA 1J9QA 2AJSH 1SYSA 2B2XL 3OB8A 1A4AA 4Q74A 4U1HB 4D9LL 1FI8C 4QNPF 2MSPA 1XF4A 2D7TL 3QUML 4TUUA 2WV3A 1AMYA 3NBNA 1OPOA 3SO3C 1AKPA 3ZKNC 1RZJC 4ECNA 3UJIH 4GG6B 3O3UN 2VC2B 1F4WL 4UILH 2H1XA 4Y2DB 2X6CA 2APVA 1F1AA 5F89B 2QQKH 3GBLA 4XZ4A 1MCSA 1M2OA 2P28B 3T1FA 2VJ8A 3IF1A 2YZ1A 5E03A 2DYPB 4PJFE 4PJAF 3NPSC 3BEVB 2H47C 3LS5H 1F02I 1BZ7A 1B4JL 1QOKA 1XR8A 4YVUA 3GWJA 3OMIB 1U8CB 2DI7A 4S0SD 3BUPA 1UWEH 1A9BB 1XMEB 5HDOA 4M9PA 1QEWA 1UZ8B 2YQGA 5F3FA 1H6EA 1NCBL 4FZ8L 4C57C 3GSRB 1C5BH 3MJ9A 1RUPH 2AJ3A 3P9MA 4OUOA 2WSDA 5E2WL 1O7VA 2IWEA 5FYLL 2W65A 3CFKB 4HGWB 4XPAL 3KWWB 3TPUA 3F5WB 3ZY7A 1MJJA 1HSBA 4KZCA 1DBAH 2EUXA 1MW1A 2AMGA 1PZAA 5GS2H 2XYCA 4LBAA 3TN0C 3WJJC 1FF5A 2X4PA 4Y5VA 2EXYC 2AQQA 1IU1A 1E6JH 5DD5L 3C60C 2XRAL 3UBGA 4WI9A 1WBZB 4Z77A 2DMBA 3I6LE 1WCQA 1I8IA 4HUVA 2EVFA 3I74A 5DZ9A 1Y6MR 2Y72A 4FA8A 2JJSC 2VSDA 4EI6A 2NXZD 3L3HB 4GFXA 5ISZD 3DMMB 4AVHA 1G7MA 2F53A 2IDFA 3M1CA 3BH9A 4UV7H 5DMKB 4PYGA 1K8IB 3FU7B 4NUJB 4ELKB 5IHBA 2R8SH 1EJOH 3PQYA 4R3SB 2IC2A 3E9UA 4JPVH 3MR9A 3EOBA 4O5LL 3UAJD 4NN5B 1MHPH 3C5SB 2XY2A 4OZFB 4WSGA 5KSAC 1G0DA 4ZDHA 1Y1UA 3EHBB 2OJEB 1MFBH 3UC2A 2ZNXA 1VERA 3CN3A 3AB0B 1KCVH 3FSOA 3V6ZB 5ICZA 5C2BH 2EH8H 1IC1A 4H20H 4LIQE 4N1HB 5DURB 4F58L 4L8SA 4OGXL 4HOMA 2ZXWB 4PR5B 2DM4A 1CLOL 2NY5H 4H0IA 2B15A 4GBXD 3TNMB 3PY9A 3FDWA 2X6AA 4R7VA 4JFFB 3GMRB 3H9HA 1D9KA 4G8FB 5JW4R 4OZGF 4J4PC 2VJ0A 4JFYB 1MRFL 4YE0A 5CJQL 2ZX9A 4V2BA 1BZOA 3GBDA 2AITA 5E1HB 3QSKB 5FO9B 4X6DA 5IROA 3QWRD 4R7DB 4XCNB 2O4EA 4PB9L 1GJUA 4HCRH 1DE4B 3NJJA 4HJSA 3VMPA 1CI3M 1FNLA 2ED8A 3L6FA 2HT4D 1E4KC 1OT1A 1DE4A 3KPPB 3BZ4A 2Y7SA 2JB5H 4DPBX 5KVDL 3ORJA 2L8AA 4GFTB 5HXMA 1KYAA 1SLWA 3PL6C 3WNLA 2P42B 1A4JB 3H7LA 2CH8A 3MLZL 2HTLC 1UASA 4HEME 4WU7A 4Z7NF 3O8XB 4RFOL 4WY7L 5CS7A 1G7HA 3ASNB 1UFGA 5E4EB 2OMTB 2DB8A 4WO4D 5E7FA 5EZLA 4YXHH 2EEBA 3EO9L 1DDHA 1OSPH 1H8NA 4GRMA 3GHBH 2DQMA 2X6UA 1Q9WB 3PAZA 1UWGL 3GLDA 5D72L 3DOSB 3G6DL 3IDNB 4NZJA 1XZ0B 3VWJC 2WXFA 1EBAA 5IKCA 2GJ6A 1CD9B 5CP7B 2NYZA 3WO4C 4HFWA 1FIEA 1NWOA 4AE0A 4WFFE 2B4CH 4NUJA 5TE7H 4ELKA 2ZXBA 3V0WH 2UZYA 4WJ5A 2WNKA 3GPEA 4JVWA 4PJHA 5IROC 1QAWA 3U7WH 4OCRL 1ZLWH 3AQYA 3ZZ1A 2OL3L 1CYXA 3QVAA 4X7CC 2O1AA 1IM3B 1SPDA 2VDRH 4E9LA 5D70L 3MJ7B 4MD5A 3DO7A 2VN5A 2Q20A 1EFXB 3CFMA 4JRFA 3WFDH 4I9WD 3LPGA 3T0EE 4MJIA 3U0TA 4XNXL 3HMWH 4L9LC 4N2HA 3GBNH 2ODIA 3GXIA 4G8IB 4WI2A 4W81A 3VXTB 1F6FB 2XQBL 5F9OH 4PRIA 4Z78B 1IC7L 3BQUC 1CDIA 1F56A 4GRLD 4HSQA 3B3IA 2V17L 2ZJSL 1ZTXH 4UV4H 3DX6A 4Y2LA 3C6EA 4HKZB 2WBJC 3Q5OA 5C3LD 3M1BB 4OD2B 1E9PA 2BFGA 3VI3F 4OBRA 3RX7A 3GSOB 5FOBA 1G7QA 4YL9A 4XXCC 4F1SA 4PH8A 2X44D 2X9ZA 2ZCKL 3K81A 4FJYA 4LEXL 2ZAIA 1LEGA 2CUIA 4JRYE 4Y9GA 3RVWD 5E95B 4W4NA 3WLWD 4KRPC 3RLSA 4W6YB 4GRWB 3MLYL 4YDKL 4HUUA 3KYKL 3CLEL 4WK4B 4GKNA 4MA8L 1BZDA 4LQFH 5TDNA 5DO2D 3WHXA 5F7HA 1GR7A 5FXCH 2XSKA 2H41A 4D3CH 3FHEA 3DV6B 1JXFA 4L3CA 4UDTB 4C4KT 1MRDL 3GMPA 4HQQL 2PCPA 2WQ8A 1ZLUK 1GGIL 2VMJA 3RPIA 3BW9A 4WDIA 2O5ZH 3NIFB 3S3JA 4ETYA 3V6FB 4KHTH 3T65B 4A67A 1FHNA 1SZNA 4MAYC 2DEYX 4XC3H 4F37K 3H7BB 3RJDA 4ALAL 4Q14A 4K7FB 4IU2B 2AK1L 1I9RH 3H9YA 1JHKH 4ALAH 2X4QA 3WJLC 3MLVL 4K3EL 5I1EH 5GZND 1I9RL 4RGNE 1ZLEA 4WV1B 2ESVE 4Z7VB 3S4SG 3M88A 4W9HC 1Z0NA 4MZIA 3ZRFC 3ZE2E 2AEQL 3LKNB 1KNOA 3TC9A 5DEJA 3ATAA 4HUMB 5DMJB 2CR0A 3UP6A 4PRNA 5D1QE 4G6FB 3SE8L 2BNRE 3BUDA 1FIGH 2YGOA 2XWTB 3QG7L 4LPWA 3A67L 2GITA 2OZ4L 4WUUD 1O9ZA 3NN8A 3GSVA 3S35X 2JIXB 1CN4A 4LQFL 1EHLL 1IAIM 3L1FA 1NFIA 3K0WA 3QUZD 4EE2A 3QDJA 1U8IA 1P6WA 2GY5A 1WIUA 2UY7A 2CK2A 3MLUL 3MSPA 4JFXA 5KJ4A 4CRPA 5GZOC 5JDSA 4MNQB 1HH9B 4G6JL 3WDHA 1U8IB 2Q3AA 4JFXB 4DWHA 4MJ2A 4X2UA 2X0UA 2VLJB 2FQGA 2WJ7A 4YBLB 1O75A 1UD6A 4XCCH 4Z7VE 3T0VA 1UD3A 4NRYB 5IEKA 3QC5X 3SDAA 3GRGA 2IQAA 1LNUA 3W0WE 1A0QH 1UA7A 2BVTA 4XHQA 2YMOA 3VUAA 1RV6X 4D9QE 3MXWH 3L5HA 5AUMB 3ESMA 2BERA 1OHQA 3TT3L 43C9B 3P0VL 4R7NA 2VUYA 1NCIA 3KE0A 1KIQA 3F7QA 1QATA 3GI9L 3RDTB 2DTSA 1MWAA 4NSKB 4YGVB 3SQOH 1TUPA 3RNQA 3AC0A 3LD8C 3LH8A 3MVSA 1KV3A 4MFHA 3OKNB 4PV9A 4V1DA 3TBTA 4NRZA 3VGGA 3D0LA 4XPAH 1TU2B 1Q0YH 3P0GB 4ELMA 4JDZB 4PSPA 5F3BA 1MNNA 3HRZB 4QHKI 4CC0A 4D7PA 2NT0A 3CZLA 4PWIA 2BS9A 5BCAA 2AV1B 2FSDA 3MBEC 3TBCA 3DTXB 1M9WA 4PJGE 5ICUA 2XC8A 3S37H 4GKNB 5TDNB 3MPCA 4QO1B 4X5WA 3O4LE 1TJHL 5CWSA 2X4QB 1R3HA 2DN7A 2HLAB 2P26A 1T89A 3ZK0A 1X5LA 2BP3A 4DKTA 5KYXB 2UXGA 2MKLC 3BVUA 4PS4L 3DXAE 4JFFD 5HSFA 3U0PA 1VIWA 5DLLA 3WBDA 4ZPVA 1KB5H 4L37B 4LVHC 4JPQA 1BQKA 1Z6JT 1KACB 2QFPA 4HKZA 5EC2B 1PEWA 3VH8B 4AJYV 5KSAB 2Y23A 2XZCL 3FT3A 4MVBD 2FYYB 1GMEA 1FYTD 2OMUB 2X28A 2VDNH 3TT1H 2ITDB 3VTMA 4M7ZB 1FVCA 2WBJD 3OL2A 1IC0A 3SGEH 3TJPA 2RAMA 3O3BB 4Y8DC 1KGWA 4NQXA 4KKBC 4GG8A 4Z5RA 1I8UA 5JHLL 2R23B 1E3FA 1H3VA 1V7NL 4YHIA 1AS8A 3WJMA 1MFMA 2NNFA 3FFCE 3WLWC 2CJUH 4K7PH 4L5FE 3L17A 3RUGA 4JN1H 5AYQA 2H3XC 4GI6A 2W0FA 4U0RB 2X40A 4WWOA 1JRHL 3OKDB 4YAQA 2X2JA 4IMKA