2CALA

Crystal structure of his143met rusticyanin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
LDTTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGMAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RUSTICYANIN
publication title Atomic Resolution Crystal Structures, Exafs, and Quantum Chemical Studies of Rusticyanin and its Two Mutants Provide Insight Into its Unusual Properties.
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
molecule tags Electron transport
total genus 32
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2calA00
2Y1AA 3CDZA 2OCCB 1XB8A 4BWWA 1AG6A 4YSEA 1A65A 1ILSA 4A2GA 3D12B 1KCWA 1JZFA 1WA2X 2GBAA 2FT7A 2AZAA 4DP9X 4UANA 2YQBA 1HAWA 2YAQA 5I26A 1V55B 1L9RA 2IH8A 2J55A 2UX7A 2WSDA 3PLYA 3GDCA 5I6KA 2HZHA 1ASPA 1GY1A 3N2JA 5AKRA 3WNJA 1OE3A 2FT8A 1NPNA 2FQGA 1DZ0A 3S3BB 3IEAA 1WA0X 1SHXA 2BWDA 4DP5X 1AR1B 1SNRA 2EIKB 4YSPA 1PNDA 2XUWA 2NRDA 5I6MA 2VSMB 2CUAA 2UXVA 1JVLA 5B7EA 5B1BB 3NT0A 4MFHA 5LDUA 1ASOA 1TKWA 1J5CA 1R1CA 1KCBA 3QPKA 3FSVA 1J9QA 3OMIB 1ET5A 2XYBA 3ZIYA 1AZNA 3H56A 1GS7A 2JKWA 1BAWA 2PP9A 3AW5A 1NIFA 4EF3A 3EHBB 1NICA 2BZ7A 4YVNA 3ZBMA 5AFAA 3UACA 2XXFA 2FQDA 3FSZA 1NPJA 3MX0B 5E9NA 2PPCA 1M57B 4DP6X 3FS9A 5TK4A 4E9RA 2HX8A 5I6PA 4GXFA 4GY4A 1CUOA 2YAEA 2YAOA 3NSDA 2BW5A 1OCRB 1OF0A 3CVDA 4Q8BA 1ASQA 2VW7A 3SBPA 1ZDQA 3MBWB 1BQRA 1J9TA 3PAVA 3QQXA 4HAKA 3NJHA 3X1EA 1PLBA 2FTAA 4A67A 1IC0A 3NJGA 3FU8A 3TBBA 1PZBA 2UXTA 1ZIAA 4NB7A 1A4AA 1NWPA 3X1GA 3ZX1A 2CALA 4AX3A 3UGEA 3FSWA 3SQRA 1CYXA 3NJFA 2HX7A 1GSKA 2FT6A 4JKNA 4W1TA 3WIAA 4AI7A 3OQRA 1VLXA 4HALA 3UABA 3TBCA 3GYRA 1ET8A 2YAPA 1MG3C 3NJIA 1KBVA 1E5ZA 1AQ8A 2HXAA 4P5SA 1KGYE 4A2HA 2Y69B 3QJSB 4DP0X 2IWKA 1XB3A 2GSMB 3FQYA 2VMJA 2PPEA 5F7BA 1E65A 1W6LA 3PCYA 8PAZA 1N70A 1RZQA 3T6VA 3X2QB 3BVDB 3ERXA 1PLAA 1IUZA 3AG2B 1L9SA 2XV2A 2IDTA 2R7EB 4KO6A 4M4RB 2HX9A 2JFCA 2EIMB 4P5RA 2UXGA 1XMEB 4HHWA 5I5MA 4HZ1A 1PLCA 4YSAA 3FT0A 5ANHA 3HEIB 4JHUA 3T6ZA 1E5YA 1WAEA 1ZV2A 2MTAA 4G72B 4KNTA 3CZUB 3NP4A 2XLLA 4FA7B 1NIDA 1NIBA 3NSYA 4DP4X 4YSDA 3JTBA 4AKOA 1URIA 2AVFA 3ASOB 1JZEA 2ZWNA 5EHFA 3DTUB 3ABMB 1NIAA 4HCIA 6PCYA 1W8EA 1BXUA 1ZIBA 3N55A 2VW6A 4WTQA 4X4KA 1WS8A 1OCCB 5PCYA 1UATA 2VM3A 2YAFA 1AS6A 1IKOP 3EF4A 4G70B 1OOWA 2UX6A 4E9YA 3TASA 1OE1A 4W9ZA 4QKTA 4KO9A 1X9RA 1BXVA 2QPEB 2JXMA 4TXVB 3NJLA 2GI0A 5B1JA 1KBWA 2PP8A 4DP7X 1RKRA 2HRGA 1EHKB 1GYCA 1N68A 3T6XA 1CURA 2I85A 3SBQA 1JXGA 1EZLA 2BP8B 1BYOA 1JZHA 1ET7A 1NIEA 2R7EA 4DP2X 1BQKA 1GS8A 4E9WA 5D4JA 4NAJA 2PPDA 2PP7A 1KDIA 2GC7C 3OD3A 1A8ZA 1XB6A 4KNSA 4YSSA 4K9JA 4BWUA 1JERA 1PZAA 2J56A 2YAMA 3IE9A 2EIJB 3TU6A 1BYPA 2XWZA 2IAAC 3AG1B 3FPXA 3S8GB 1SF3A 5D4IA 3PAUA 4AKQA 3ASNB 2QT6A 1A4CA 2OJ1A 2X88A 4YSCA 4DPBX 4KOBA 5TK2A 3T6WA 1AZUA 1NWOA 3NSCA 2XXGA 4G7QB 5I6OA 4YSRA 4YSTA 1AAJA 3AY2A 1SF5A 3H4HA 4N8UA 2EINB 1SFDA 2XV3A 1PCSA 2E86A 2Q5BA 2BP0B 2H47C 1SFHA 1B3IA 1BEXA 2YXVA 3EH5B 3G5WA 4KNUA 3TA4D 6PAZA 1PAZA 1BQ5A 4ZK8A 5I28A 2GB2A 4HIPA 1T5KA 1KDJA 2DYSB 5I5IA 2AZUA 2VM4A 4PAZA 1JZIA 3V9EA 4AZUA 1IBZA 2BP8A 2IWFA 2VSKB 1M9WA 4FAAB 5B7MA 3EH3B 3PXLA 2FNWA 1AS7A 2YAHA 3ZDWA 3PPSA 1E30A 3UADA 4BXVA 4NERA 2YXWA 1L9TA 3ABLB 2FQEA 2MRYA 3OMAB 3KW7A 4E9VA 1RCYA 1HFUA 1V10A 1ADWA 1AIZA 4M3HA 1AZCA 3AG4B 2HRHA 1WA1X 2ZXWB 4BK5C 2IH9A 4E9TA 2ZONA 3L45A 1A4BA 3X1BA 4HCFA 2OV0A 4DP8X 2YARA 3ABGA 1TEGA 1CYWA 1DYZA 1FFTB 1NZRA 5I6NA 2W8CA 4GP8B 5I5JA 5IY5B 4BWTA 5B7FA 5F7AA 2DYRB 1HAUA 2I7SA 1GS6X 3CVBA 1KYAA 2QPDB 1AZRA 1JOIA 1PNCA 3X1FA 2LLNA 2XVBA 5PAZA 2BP0A 1OE2A 1L9PA 5B1JC 4A2EA 7PCYA 1PMYA 2Q9OA 3NJMA 4KO7A 2DY2A 1F56A 1QHQA 1GW0A 4N4YB 1AACA 3WG7B 3UAEA 4DP1X 4KOCA 1NTDA 2RACA 4UAHA 4CSPA 1ETJA 3T71A 1BXAA 1FWXA 2GIMA 2DWSA 3BQVA 3NJJA 1TEFA 1I53A 3CG8A 3FU9A 3X1NA 1E67A 3NJNA 4G7RB 3WI9A 2BO0A 2QDWA 2UXFA 3FU7A 3NYKA 1TU2A 3C75A 3U25A 1A3ZA 3S3CB 4BDVA 4F2FA 2XX0A 5AZUA 4YL4A 2IDQA 5B1KA 1QNIA 1ZDSA 2J57A 2WO3B 3NJKA 2B08A 3QJVB 4F2EA 3WKPA 2AFNA 4WKXA 2QDVA 4YVUA 1J5DA 2BHFA 3IBOA 2IDSA 1AZBA 2GC4C 1ILUA 2HLEB 2TSAA 3S3DB 7PAZA 3HB3B 1PY0A 4Q89A 4A2DA 5B3SB 4G71B 2DV6A 4YSUA 1SDDA 4AKPA 1OV8A 1J9SA 1GY2A 1JZJA 3FPYA 3QJTB 4HHGA 1OCZB 3WKQA 3DKHA 2IDFA 1RZPA 2FQFA 1SHWA 1ID2A 3FQ2A 2H3XC 3UAAA 4E9SA 1AANA 3EH4B 2PCYA 2ZOOA 4PCYA 2CCWA 4YSQA 1MZYA 3IN0A 2VN3A 1IBYA 4E9XA 2PPFA 3CVCA 2B3IA 3CDZB 2P80A 3IN2A 1CC3A 1QLEB 1NDTA 2BZCA 4A2FA 1AG0A 2N0MA 1X9UA 3FYIB 2XU9A 4UF7C 3FQ1A 5I6LA 3NP3A 4A68A 5A7EA 4L0PB 2FWLB 2A3TA 3RYMA 2PCFA 1MDAA 2GHZA 3JT2A 3QJUB 3FYEB 1SJMA 1KV7A 3NSFA 1AOZA 2EILB 4QLWA 2CJ3A 4A66A 2IDUA 4GP5B 1J9RA 4JHVA 3PAZA 3DIVA 3FU7B 1L9QA 3QJQB 4HCGA 2J5WA 1PF3A 2X87A 4ENZA 1OCOB 1L9OA 1AS8A 2CAKA 3H4FA 5B1AB 4BDVB 1WS7A 2XV0A 1PZCA 2TSBA 3FSAA 1GR7A 2PLTA 2AANA 2BW4A 5D4HA 3KW8A 2I7OA 1MZZA 4GYBA 4DPAX 4RH4A 3AZUA 4F7KA 2P80D 4KO5A 2DWTA 4G7SB 1JXDA 3V9CA 1NINA 5FC9A 2PPAA 3ABKB 3OM3B 3GXUB 3T9WA 2W88A 3WNIA 1YLBB 1JZGA 4DPCX 1JXFA 2H5UA 4YSOA 1FA4A 4GP4B 2BWIA 1SDDB 3QJRB 3AG3B 2WO2B 1W6WA 2VW4A 1V54B 2XX1A 1ZPUA 4CSZA 1MG2C 4BXSV 3S8FB 4E9QA 3SBRA 1JVOA 2FJSA 3OMNB 2CBPA 1M56B 9PCYA 2IWEA
chains in the Genus database with same CATH superfamily
4E68A 2CU9A 3B2VL 3H3PL 4LASH 4MD4B 3P0VL 1YNTF 2XQ0A 1IJ9A 2OBGA 3GTVA 4XHJD 3MLZL 1A65A 3KXFE 4O4YH 4XAWH 3CSYB 1N59B 2NY4C 3DK0A 2GSGA 4K7PH 5DS1A 5SX5K 4DP9X 3K71B 2O5NA 4I0PA 1JGDB 1KG0B 2NNAB 1U3HD 1A8JH 3A4EA 4N3UA 1KOAA 5JQIB 1FFPA 3GDCA 3P3RA 4PI0A 2WXLA 2V2XA 3MCLH 4UWQB 5BOPA 2R8SH 4OQTA 3VMPA 2PCFB 3QBTB 4GAGH 5HGDB 2YMXH 4JY4A 4GEIA 1KN4L 3S3BB 4KHTL 5G55A 5T5FA 2EH7H 4R0LC 4A38A 1AIFA 4DK6A 3HZMA 5FYKU 4LOFA 4A7UA 2BWDA 4NQVA 4NIYE 1VFAA 1OIOA 3F7VB 4IBUA 1B6UA 4XR8C 4XX1G 1B2WH 2R23A 4KRPC 1OXYA 3LRSA 2P28B 5C0IA 3ILQD 1NCCL 1TJGL 4Z7VF 2PTTA 4Z7UE 1BP3B 4K7FA 5C0DB 1ACCA 2PR9A 1KCBA 1F4YL 3MQIA 3FSVA 1BG9A 3H56A 1MFAL 5C0GB 2Y2TA 3L3JB 3TBSB 1GS7A 1OD7A 4XC3L 1MWAA 2A6KA 4YHMH 3REVB 3QHZL 5JORA 4YVNA 5CKAA 5I8EB 3KPMA 4MHHI 3S98A 1Q8MA 2XXFA 1EBPA 2FGZA 3GJFK 1E8ZA 3HC4L 5E6RB 1FP5A 2F08A 3D08A 1TITA 4G7YL 4AEIH 3RZCB 4L3CB 2AQNA 3SZ6A 2A73B 4JM2C 1FVEB 3ECWA 4V1DA 4E9RA 4R2GB 1CDHA 1SLVA 3B2XA 2VB5A 3E6FB 3NOIA 3CHSA 3AU1B 3WHE0 2YXFA 2JKXA 3PWUB 4D9QD 1A3RH 4FFYH 3SBPA 2BNRB 2QSQA 3RJDA 1KCVL 1W9XA 4PU2A 1KTDA 4UQ3B 4OV5A 2GPZA 1PJ9A 1JDDA 2MFNA 5G5DB 1PLGL 4KKAC 3TO4C 4B7LA 2QQKL 3KMDA 2CDFB 1ED3A 2V9TA 3IKKA 4PJDB 2BOCA 3IGUA 4IBSA 4K8RH 1YYLH 4BJLA 3FSWA 1JNJA 1SJVA 3QZNA 4K3DL 3NSXA 4BGDA 1KXVA 1XQ4A 3L4XA 4AI7A 4LCUB 2AQTA 4XVOA 4Y2DC 3KXFD 3HJ0A 4O9HL 4XP5L 3V0HA 3U7WH 3WNMA 1NSNL 2QMJA 5C6TH 2Y3NA 2EO1A 1V3LA 2BSTB 5IIEA 1HKLH 2AABH 2VR9A 1T0MB 1BFOB 3HN3A 4FD0A 4H88H 4JFFE 4U2ZA 5D2NC 1TYJA 1UC6A 1FJ1B 4LLYA 1JYWA 3GTNA 2IDCA 3T2OA 4ABQA 3FQYA 3AM8A 2BX5A 4RMVA 3TESA 5F7BA 3P02A 4MNGB 5CMAB 2AEOA 3ERXA 1D5BA 3DX9B 3BH8B 4RMWA 3ZTEA 3AG2B 2WXNA 1MFBL 4NO0B 1G1OA 3VG0H 2AJUH 4YBQD 2ITCB 3OC8A 1UB6B 3TH4T 4GJTB 4HZ1A 1R4XA 3C87A 4MCMA 5H35B 4BFKA 1RK1B 2UZIL 4XB7A 1QYGH 3IK2A 3O4LE 1E5YA 4PR5A 2MTAA 4Q9BA 5G4MA 5DJ2B 4U0RC 1UA7A 1WC7A 3RWGB 1E4KA 3P30H 4AQOA 1OAKH 3VTAA 3P9LA 4OLUH 3FFCA 4EN3D 4K23H 4Z7WF 1QSFE 5DZLA 4OCRH 1MF2L 4IRZL 4M93B 2QV4A 3LPGA 2AHIA 4Y4FD 3CD4A 3BGAA 4WFED 4XAKD 3IJYA 2CLZA 3B1TA 1AGDB 1VZHA 5HPMA 4AQEB 4KXCA 4PV9B 4Y19A 1O7VA 5IMOA 5E99H 4ISVA 3BEVB 2OJZH 4Y1AA 5C0CE 3EYVB 3I50H 5FYJD 5IB2A 5HYSG 3FFDB 3UJIL 3KWUA 3MJ9L 2NYYD 4MNHB 1OE1A 5DD5L 5B39A 2XSKA 5IQMA 4UM9A 3WTVA 4P3DB 4DERA 3ULUE 2K9UA 1KBWA 2EXTA 2PP8A 2D03L 4IRSC 3K91A 1F4WH 2ATKA 1QKZL 3B6SB 3N85L 2WXMA 3D0AA 2CMRL 4ORZC 4FKHA 4FTVB 2W95A 1ZTXE 2CR3A 5ALBH 1ROWA 4QT5B 1LDSA 4AQ1A 4ONFH 4JRXE 2GSIA 2F7QA 1WBXB 3O81A 4KNSA 4FQQB 3ELAT 3A6CH 5E6ID 3OG6B 3SKOB 5AVQB 2DYPD 3CIQA 2E9WA 1IGML 1RURH 1CQYA 3K5RA 4RX4A 4UT6H 4DZ8A 5JXAH 3ABZA 1U8MA 2VXQL 3APDA 2DBLL 5CWSB 2X28A 3WNNA 1UH3A 5EIQA 1FG2A 2H4EA 4GRWB 2IANB 3NSCA 5E1QA 2VDML 4MQ7B 3II2A 4FLOA 2XT1B 3GIVB 1CU4H 1OTUC 3ML8A 3O4LD 1LEGA 1ZD6A 4M6MH 2Q5BA 4X4ME 1NEZB 5IEHA 1E0OB 4DVBB 4DF9A 4ZMWA 5C70A 1C16B 1G1KA 4PB9H 2AKRB 2KH2B 4PLJC 2GK0A 4U1JB 2OQJA 4ZFOB 3TVMB 1CDGA 3MV9A 4Z3EA 4JFPA 5L7XH 4IRJA 4Q14A 2MOQA 1KJMB 5C08B 4OLYH 2E7HA 5DK0A 4WUUE 3TTYA 5I1GL 4IYKA 5JOPD 1RZGA 1T1YB 2KUTA 3FT9A 2C9QA 4N2CA 1KB5H 3VWJC 4ATWA 1G84A 4KROB 4AIXA 2D7TL 5ETUA 4PYHA 4OLEA 3QPXH 4FXGB 2WBJD 1OAJA 4WGKA 5EC2B 5DMJB 3LPOA 1JVKA 4M62H 4ICWA 5CP7A 5I1IL 4WO0A 3MJ7B 5J57B 4ZT1A 1NMCC 1Q38A 4MWFA 4CJ0A 4R7VA 4YXKL 4JPVH 4AZ8A 1KIUA 4X6EB 2RMNA 2ZX5A 4N0FA 2ZXWB 2YK1L 1NCDH 1MREL 2N59A 2F5BH 3EYUH 4X6DA 4XNAA 1BW8A 1JJUA 1I7TA 3VWKD 1NZRA 1T2XA 5IBLC 4GP8B 4OZ4B 1JK8A 2BSBA 4D9LL 5IY5B 4K55A 1J0HA 1X5AA 1S78C 4NYLB 4JRXD 2OL3B 3MSPA 3S5ZA 3CFBA 1U58B 1HN1A 1NAML 3PS6A 2G4GA 5J1SC 3PFQA 1KEGL 4BCZA 4KITB 3GNML 5HDRA 3KWWA 1I4FA 1I1AC 1PMYA 3GSRB 2FO8A 4PJIF 4LQFL 4ZUTA 1RZ8A 2DY2A 3VXUD 3QEUB 3WUZA 5FM8A 4K5OA 1PEZA 2JLLA 2K45A 2CDGB 2R9HC 5C09A 5AVRB 4X98A 4ENED 1HESA 3GI9H 4RFEA 1KIRA 2Y7OA 2LOEA 3M17B 4ES9A 2BIPA 5I1CH 2XQYK 1JHTA 4N6RA 3FKUS 2BO0A 3O6LH 3K6DA 2VDKH 3T1FB 2WAQA 1N64H 2FEEL 5FGSA 5K9KB 4LPYA 1JPEA 4ZW6A 3DJZA 4RFOL 4YBLC 3VU1A 3P2TA 4ACTA 3P69A 2XX0A 1PYWB 3MNMA 2XN0A 3H0TB 4H25A 5C0RL 1QNIA 3VFWB 1JZ5A 2F5AL 2Y7QA 5DLLA 3SB3A 1UZ6E 5C86A 3WSQL 3GK8H 5AZEH 5DEJA 2YUVA 4ZODA 5ISZB 3U46A 1CR9L 3TA3D 3U0WH 4DGYL 4H7VA 5D7SH 3F12A 4YHKL 2VQUA 2Z35B 1JXKA 2H2SD 1S9VB 3O6FA 3E2HC 5B3SB 3TFKD 4IHOB 1JPSL 3QI9D 4WWNA 5GGRY 5HYQA 1UENA 1L7IH 3MRLB 5IHUH 2H45A 4IJTA 4WIQA 3OAUL 5GGTA 3WENA 3MOAH 3U0TB 3L3IB 2GAZA 2VISB 2J8UE 4N2EA 3EDDA 3RUGE 1QQDB 2M1KA 4E9SA 1IC5H 5AYTA 4BFOA 4M6NL 5I1KL 4UQDA 1E2VA 2BOBA 1A5FL 3ZYIA 2E76C 5EC1A 4J2XA 3SDCD 1KYOJ 2DKSA 1AFVL 4LEBA 2LE9A 1EPFA 1B9ZA 4ZYKA 3ESOA 2YWZA 1YNTA 2BVOB 4MNQE 4LAJH 4NQXB 2FATH 5E8NA 4W9FC 4X0KA 2PTVA 2B8OT 3RX5A 4A68A 4RBPK 4MMZC 1EIBA 1FL6B 2EEAA 5KYYB 1MCCA 3GSQA 3D0VB 4ELKA 4DUWA 2QR0A 2OTWA 2A0LD 1EZVX 3JV4B 3X13A 2E47A 1BQSA 1UFUA 4P2QB 4YHPB 1YEKL 4BFNA 2QPFA 1J05B 2PF6A 3EUUA 4ADIA 5HD8C 2CAKA 3WE6A 1K5NA 4RETB 1IC7H 1DHKA 1YPZB 5I8CA 1MCQA 3DYPA 5FKAB 2V7HA 2QGBA 4PHZA 1R3LB 3EJQA 4A2LA 1YJDL 1OP5H 2DLHA 4DPAX 5CEXA 3IFNL 3FQRA 2VDLB 5FOJA 2AJYL 2CA3A 2ZYIA 4Z7VA 1MOEA 2NTFA 4I1NB 1SVBA 1FNAA 2OSLA 1UVQA 4ODVH 5KSAC 3TEWA 3HPJB 3NEEA 4B6ZA 4NZFA 2WXOA 5LGKA 2BWIA 1M7XA 3RNKA 1XF4B 2VXTH 3GHEL 3QJRB 4HCRA 4JPSA 3R8QA 4JW3A 5L2KB 4TVPH 5IFHH 1YC7A 2BVQB 1H3WM 2NZ9C 3PIQB 5I18L 4AE1A 1MVYA 2AV1A 5HHPB 1JVOA 3OMNB 4XCEA 4MAUL 4YXLH 1RMFL 2CBPA 3F7QA 1FAIL 1CL7H 2IGFL 4PLKC 5HHOE 3WUWG 1XB8A 3Q3GA 1YEJL 1KY6A 4TUUA 4Y4HD 5DZJA 3UC0H 4YXHH 1UWXK 4H4NA 1NBZB 4GIPD 4GAYA 1FC2D 4WI4A 3ZPDA 4A2GA 4YC2B 5HDBE 3NIDE 4RZCB 3ZL2A 3KYNA 5A3ID 2C34A 5BW7C 3R7RA 3ALXA 4FFVC 4GSDH 1HL5A 3PXJA 5JIKA 3T09A 1T7ZA 5J1AA 4MMYB 4WEUD 4HEME 3D4CA 4OI7A 3MCYA 1NFDB 4U6VH 4JFFA 4F3FA 4YUEH 1BPLB 4LRIC 1RUMH 1Z5LA 1FVCA 1NPNA 3UBXB 3VQ1C 4D0CA 3KL3A 1R3HB 1JTPA 12E8H 2XICA 2Y5TB 3PY9A 4NUJA 3SDXB 4ZUWB 3VXPB 1WUZA 4MNQD 4KI1A 3O3EA 4ORGA 1I9JL 5EUOE 4MZ3A 5MI0B 3NZUA 1FL5A 5IROA 4K3JH 4Z7OF 3LXCA 1N6QH 3A67L 5DJDB 4Y8AA 2P3YA 1I9IH 1KC5L 1Q72H 2JIXB 3LZLA 4KX9A 4ZSOA 3QCUH 3VH8G 1R5VB 2OP4H 4ANWA 5LN8A 1U8PB 5DC4B 4LBEA 5DJZA 1XGPA 1PFCA 4KXBA 4FEIA 4G8IB 3AAZA 1DLFL 1TEYA 2HFEB 2JJTA 3FQTB 4LLDB 4UTAL 4HKXA 3PXHA 3S37L 1DUZA 3V4PL 3NEXA 4B5EA 3EDEA 5TDPA 1QSFA 1P4IH 5EU3A 2DWEB 1O6SB 5TD4A 3FB6A 1YRKA 2ZP8A 3LQZB 1WFUA 2ZX9A 3DX6A 1S9WA 5J89A 5EO0B 2P26A 4GUCA 2YQ2A 2ED9A 4KY1H 2O6EA 2W9DH 3SGJC 2QGDA 1RIHL 4S1DD 3TN0A 1UASA 4CSTA 1D9KD 4TNFA 3U6XA 5D7JC 1WZMA 3QORD 1EAOA 5A16A 1AR1C 2JCCF 3OHXA 4Z7WA 4X5WB 1FFOB 2X4UB 4AL8H 2ZUUA 4XBGA 1WLHA 5C0CA 1JRHH 1KPVB 2XY1A 3DURA 3F05A 3QQXA 3DBXB 5B8CA 2Z7WA 1BVNP 2KMWA 1EANA 2W60A 3C2SA 4TTDD 4U7KA 3G5ZB 2ITEA 4IGBC 1MFVA 4JFTA 5CU5A 2ZG1A 2BJMH 4XX1E 1I8IA 5DRNA 3OKOA 3U30B 5JIMA 3DX8B 3IB4A 4AX3A 1SVZA 1IGYA 1GYAA 3VGAC 1DLHA 2OMWA 3NG5A 2NDGA 2WN3A 4EZMA 2YLKA 4LU5H 4BSVA 3CFCL 1QFWI 1IGCH 1LQSR 4OAWA 3QA3A 1PZ5A 5EA0H 3U4BH 1ET8A 2ZJSL 3TV3L 3HJEA 3QDJE 4GQRA 5E95B 4I18B 4LDCA 1JAEA 5SX5H 2NY5L 5TDNB 1OW0A 4NNYB 5GRJH 1KEMH 2Y69B 4L4TB 4XN8A 5J56B 2E7CA 3ISYA 2AEQH 3GSNA 1Q94A 1QRNA 1RZFL 3PV6B 2Q6WA 3AGWA 3ULVC 1FI8C 4BRJA 1WWAX 1IUZA 2KDGA 2VXUH 3LAFA 3AS1A 4KK8D 3KPRB 4WWKA 1NFAA 4DTGL 4HUMB 3MLYH 2D7PA 1QUPA 2NY7H 3QXVA 1AO7D 4JHZA 1XAKA 4P4RB 1J8HE 4YSAA 6CGTA 3KNBA 4AGQA 2XCMC 3K46A 4F57H 3V2AR 2W0FA 3HZKA 2CIIA 5SWQB 1MAJA 1DVFC 3BGMB 1OD9A 3WV0A 4X4MA 2UY6B 2ZUQB 1AKJB 2NY6B 3E1ZA 5TE7L 1F3DJ 3TJEH 2A74C 1O0VA 3CXDH 3QUXD 5F9AC 4PBWD 2QKIA 3ASOB 2Q7YB 2ZWNA 4LSQH 5KVMC 4Z1PA 3TURA 4U1KA 2NT0A 4AIZA 4NO2A 5D1ZD 2XZAH 1L6ZA 2DDQL 4QTIH 5E6YA 3WXVL 1BIHA 3DGGB 1YEGH 3JV6B 2WANA 4XVJL 1T5WA 3LKQA 2Y25A 5DVMA 4WUUA 3DRQB 1OCCB 4ELMB 3ZKND 3JT0A 4LIQH 1UYWL 2Y06H 1XHHA 4AC4A 4WTXA 3MLWL 4O51B 3HG3A 4CKQA 1NC2D 3D3VD 2XWJB 5D7IF 1EO8L 1OEZW 2IV9A 5KTEH 2WBXA 3O2DH 3W9DA 4AJVA 1C9SA 4ZXBC 4TLUA 1WCBB 2BFVL 2NQDA 2QPEB 3GSUB 3VRIB 2R0LH 4Z78B 2BRQA 2ZG3A 3KBHE 1S7VB 2V8MA 2VL5B 4N68A 5JHDA 1G9MC 5FLUA 5LKNA 1SOKA 4DP2X 5D8JL 5D7IE 2GTQA 3IMTA 3ARRA 3QDJD 3U4AA 4EO5A 1PY9A 3MXVL 1ETZA 2NOYA 3HI5H 2WQUA 3MRDB 2GC7C 1L0QA 3QAZB 3LNEA 2NNFA 3MUUA 4KZEL 1AI1H 1GW6A 1TTRA 1G0YR 1ETB1 1U8CA 3SKUD 3ZTNL 5JYLA 1U42A 4DGIL 3QHTC 4GG8B 4NKMB 4PWHA 4G7VL 3G08A 3QS3A 3IGAA 1EAQA 1A9BB 4Z3FA 1XF3A 3S8GB 1I3UA 2P4AB 3LOWA 3TZVA 1A4CA 3BAYA 2LGNA 2J8HA 5D5MB 3VFUA 1G87A 1BQLL 1DVZA 1J8HD 4HLZH 4R4ND 1AAJA 1AHWC 1OAZL 5DHYB 1XBDA 2AXHA 3APNA 3HS0C 1L0XA 1NA8A 4B5ZA 3L1FA 2XV3A 4ZPTA 2WC7A 4YHLL 3KYMB 1IAOA 1U8LA 3OGCB 1T4KA 3O9WC 4XPFH 1M7IB 4CGUB 3VFNB 2CR0A 4PJIA 2WZPD 1CGSH 1M53A 1R6VA 2R2EB 1MQKH 3SDDD 1PJWA 2IAMA 4JKKA 3D18B 1NMBH 1P7QB 4GPVA 4ES8A 1DQMH 3OXSB 1UB5A 3NESA 4N8VB 2FJGB 4UNVA 3BAEL 4G43B 4UBDC 5I5IA 5MENE 2MCG1 2OR9L 3IF1B 1S5IH 4MRBA 4OUUA 2BP8A 2IWFA 4P05A 1ZLUK 2QSVA 4LCIL 3MHZA 1RQ5A 4PJXB 1UM6L 2VDQL 1Z9LA 1X7SA 3HG2A 1F1GA 4YMPA 2APWA 2BXZA 3APCA 2L7EA 3QXDB 1TU2B 2GIYA 4XXCC 4WNJA 1EJFA 5FGCE 4MJ5A 1UWEH 3RY6C 2WGNB 3OMAB 2BC4B 4RMUA 2ZCHH 3GSXB 4AEFA 5K59F 1HFUA 1SXZA 3FU6A 2VXVL 4MAYC 2O5XH 3DTXA 3FAXA 2RIKA 5EU4A 1TOXA 2FB4H 2HT2C 1PKQE 1B88A 3BOVA 5FFOA 1XR8B 5IHWA 4O2FB 1QFWM 5DLML 3ABGA 4NGHL 3RTQB 2QZQA 3KGSA 1U8NA 3O3DA 2AI0H 1RUAL 1A2YB 4OGAD 4ZFQA 5I73B 1XH1A 4R6UA 1UA3A 3IDXL 3BRGC 3OR7A 4FXTA 4LVOB 5B7FA 2I9TA 3QFGA 3S3PA 2V33A 1AZRA 1E4HA 3RHWF 1E8WA 4FLQA 1BA9A 4P5KB 1U91B 3BAIA 3LS5H 5L6YH 4P9MH 3SKNB 5DRXB 4FX5A 3CN1A 4GBXD 1OE2A 2Y72A 3TXAA 1L9PA 1J0ZA 4MVBD 2GTWA 5DQJB 1JFQL 1LO0L 4GI8A 1KYFA 3OKKB 3NJMA 4HUUA 3FRUB 4YAQA 4HGWB 3NZSA 1DANT 4FNPA 2PTUA 3UAEA 3H55A 4FMKA 4PS4L 3G9AB 1KT2B 1RXLA 5TH2A 2PW1A 1K85A 3MRHB 4YDKH 5DYOA 5T3XE 3OJVC 1PD6A 3AREC 1UQSA 4Y16A 1G7QA 4M6OL 3E9TA 5JPMC 2HVKB 1HT6A 3NZHH 1J7VR 5TQ2L 3FB5B 5DQDL 4UIKL 2EO7A 2PO6B 5I6XB 1XH0A 4OSUL 3CN2A 5MHSD 1BLNB 5AZUA 3N3EA 5K39A 3ARSA 3P0YH 1F86A 5E1AA 3BAWA 3T2PA 2WIIB 4NZJA 5LHDA 3T0DA 3KVPA 1NCWH 1NJ9A 1U8QB 5MEND 5I16A 1HWGB 5KJ7E 1X7QA 3M6DA 3ZKXB 4WHTB 4A04A 2AFNA 1IT9H 2I26N 2MHAB 1TNMA 3D34A 3S5LG 3QIWD 1QLEH 4UT7L 2A9NL 2BNQE 5GS1C 1YA5A 2AQRA 3LN5B 2WIMA 4IDLA 4ZS6C 3D7PA 4JGNA 1J0YA 5EZLA 4A2DA 5LAXA 1JWSA 4BQ8A 4C4UA 2WNKA 2ESVA 2GK2A 2WB1A 5HHOA 4ZO6A 3FPYA 3HG4A 3QJTB 1OCZB 1UD2A 4FZEH 4HHGA 1TPXC 3E8VA 3ZHKA 3HC3H 2DOCA 4XOEA 4LSPL 4NO3A 5F7KC 5FK9B 1ZK9A 2HN7B 3VYPA 4NHUB 1ZT4A 3PL6D 4WW2F 4PCYA 4S1RL 4HFUH 2QVTA 4P2AA 5EUKA 1TENA 3H1ZA 2B0SL 2N7AA 1NCUA 4DEWA 3QCVH 1NANI 4AENB 3T4AC 3O0RH 2PYEE 1FCCA 1B4RA 4LCCA 3EFOB 1CFVH 1IGIH 3PFUA 1EJOL 2KPNA 1JGEB 3FQ1A 2G5BA 1IM3B 2IOOA 5CJOL 2ADJB 1I9RL 2V9QA 2FWLB 4LB8A 2Y7MA 3RYMA 2ZWSA 2VJ0A 4KK5D 3T3PF 2P9RA 1RUQH 4YWGL 3VXNA 3W39B 1VZGA 4I9WE 3BT2L 1BVKB 2HLFD 1A4KA 5JOFB 4X9GA 3MJ9A 1F2QA 3FU7B 4PBVC 5BMFL 5FGRA 3QIUC 1N8ZA 1M2VB 4QD2E 2B9AA 3HE6D 4WCYL 2FNBA 4S11A 4AXWB 1ZGLB 1GOFA 3L9RA 4IOFD 2G2NA 2YN5A 4EI5C 5KS9E 3GMQB 2HVJA 1D5IH 4CADA 4FG6D 5JR1H 3GMOA 1MHHB 2X9WA 4CUCA 4KVNH 1XGZA 5TE4L 1WEJL 2BS71 3RZWA 2UVFA 2WLMA 4JLRA 5L4IA 4QHLB 1S7RB 2LHAA 4XMWA 1YLBB 4LGSB 4MTMA 1WBZB 1M7UA 5AUMA 3KLHC 2G0KA 3F8UB 1JUFB 5F9JB 1R34A 4U1HB 4F93B 1BAFL 4I0PC 3SE3A 3VI4F 2VW4A 5IB1A 1MG2C 1EZSA 5IJKA 1AQHA 1KXQE 1O5PA 2BNQD 1JGIA 3ZJAA 2UWEE 3QQ9C 3BGFC 4MQXC 3TCTA 3TIEB 2VXQA 3GIZH 3QO0A 4OGXL 3G9VA 3QO1A 3SDAB 4XMLL 5FW7A 3WTYA 3POHA 1TCRB 1B0RB 4FNLH 1ILSA 1RPQA 2HJKA 2J21A 1KCWA 2JCCA 2XNAB 2Z93A 4CNIB 1Q9LA 4MB4A 2J6EH 5J5EA 5D96B 3HCVA 1HAWA 2X09A 3MTRA 5CNHA 1CLOH 4IJ3C 5DFWH 43C9A 5AKRA 4A63A 3P9MA 4JKPH 1OE3A 2F58L 4YHZH 3VFSA 3LS4L 4OFPA 3JWDH 4GEJA 2P5WA 3DROB 4U1NB 1UKQA 4Y4KA 2CHZA 1C08B 2ZTBA 3IEAA 4R2GD 4M29A 1HHIA 1OY3B 3RG1C 1OARL 4NJ9L 4Q0XH 3P11L 2BNRD 3O3AB 5HDLA 5BRZB 3QXUA 5DDHB 3O8XB 1PSKL 4I9WD 1FN4A 4M8VA 4GQ9H 4F7CB 2DQMA 3KCPA 2AJSH 3L3KB 3PYCA 4IOSD 2CBQA 3HAEB 5FYJL 5CZVL 1E2WA 2F74B 3QQ4B 1DBJH 5J6GB 1BZEA 4F9LA 5T5NG 5GS3A 4AGNA 5I71B 1MJ8L 4KX7A 1L9MA 4GSRA 4F7EA 2Z34A 3NFSH 3V0WH 1HCVA 6TAAA 3CH1A 2JMRA 1CG9B 1BFVH 3STZA 5AFAA 1LK3H 4GG6E 1VFUA 4UDTA 3UAJD 3QULB 4HFWA 4PVLA 2XG4A 1YMMA 1G9NC 3SKJL 2AQ3A 3A4AA 1GIGH 1RZJL 1NEUA 2VIRB 3HMWH 3SYAA 4MJIA 4AJWA 2FJFA 1KXVC 1I8LA 2GJZB 3NSDA 1DQQB 3QISA 4LRNL 3ZE2E 4APQA 3W0WE 4XE0A 2J1WA 4PJ5E 2WCPA 3C6LB 5E1IA 3HNVL 4AMWA 4F33B 5E8OB 1JNLH 2AEWA 1IBDA 2X4QB 3Q8BA 1G6RB 1ND0A 1SJXA 3MRBA 1ZA6A 3QFJE 1MIML 4A67A 1N10A 1I8AA 2NZIA 1G5GA 3S35H 1BECA 4FNUA 4GINA 3Q6FA 4WHDA 4ZOEA 3AM8C 1ES0A 2ISDA 3CDYA 4UIMA 1J12A 4KBPA 1ECZA 2NSXA 1QVOB 4HPOL 3CFMA 3BSZH 3EBHA 2Q8BL 1T83A 1UWXH 3GYRA 3QRGH 3Q05A 3U1QA 5D7IA 4AVKA 5J9PA 3NJXA 3ARGA 5LCVH 3N41F 2KDYA 4A2HA 4UNUA 5ESQB 5FUCE 5GIRA 2HKAA 4TNVF 3SO5A 1HHGB 2R27A 5TDOB 2VMJA 4U0QB 4ODBD 4MKMA 4HK3N 4OB5H 1ZSDB 2OMYB 3RGVA 3T6VA 1VB9A 3ULAB 2DIAA 4LPWA 1FHGA 2XC8A 3VFTA 2XV2A 3WLWC 3GPEA 4XT1C 5F7DA 2APTA 3EGXA 3KM2A 1KFAL 1OSPL 4HHWA 2IALB 1PLCA 4AEHL 2FEEI 3WFBH 1ZVNA 1HQRA 1IRAY 3ETTA 1GA2A 2E3VA 2RQEA 5ANHA 3WKML 1GTNA 5ADOL 3W11C 1D5XB 1CLZL 1GC1L 2D2OA 3CZUB 2HPTA 1KY7A 1FH5L 5JPNA 3VXQB 3NSYA 4DP4X 3BVNA 1K2DA 1OB1A 1Q9OA 1JPTH 1DFBL 3TX4A 5F3FA 2X41A 4ODUA 1OSYA 2EC8A 2HKFH 2OZ4L 4FTVD 4PJEB 3BPLB 3UYRH 3SGDI 1PU0A 5FCUH 1HOCA 5DEFA 3T2NH 4L8CB 4V2BA 1WS8A 4F37F 2HTLC 3CAFA 3W0WD 1UATA 3MGOB 5C97A 2VM3A 4NQUA 2OSXA 3TYFA 2M26A 2ZCZA 3EF4A 2UX6A 4PY7B 2BHYA 4AQ1C 4RMSA 2XPGB 3NACH 5EOQL 1G1CA 4RDQF 4LASL 4KPHH 3SOBL 4WSKA 3GXNA 3W56A 4TXVB 4PRPE 2IPTH 2IAND 4O4YL 7TAAA 3WS3B 2YMTA 4XAWL 3MUJA 3TO4B 4W9EC 5DQ9A 3FOMA 1PKQA 4K7PL 2UYLA 1KENH 2AJZA 1DUYB 1BQKA 1CFTB 1RHHA 2EEDA 2ZX6A 2NW2A 2DLTA 3K6OA 3MNZA 2R8SL 1R24A 4YIQA 3MJ6A 3TVMD 1EV2E 4XNZB 4X6CB 3ROOA 1XB6A 5TF1L 1DJIA 1ZY9A 2DQHH 2OA9A 2Y6TE 1D2PA 2BS9A 2B39A 1EHNA 2QSTA 5C08D 5DRWA 2EH7L 3L3OB 3HUJF 3NUKA 5HHMB 2VZTA 2VZSA 4QRPA 1N0XH 3KDMB 5IMLB 3PAUA 4PJBE 4QNPF 3CSBA 5HI4D 5DURD 3VACA 4IRJC 4JRYB 2EDHA 3F2LA 4GW4B 3X12B 3F01A 2HFFB 4OF8A 5I0ZA 2Y1VA 1SF5A 3G5YA 5F8RC 4WAFA 4R90H 4LL9A 5CCGE 1NFIB 3CN0A 2CLRA 5KYXB 1FAKT 2NY2B 2FHBA 2OMZA 3H9SA 4E42A 1HSBB 1QPPA 2YXVA 2Y1ZA 5L4JA 1FBIH 1OLZA 2WWMC 3TH2T 5FO9B 6PAZA 3L13A 3CHRA 4BYHA 4AEIL 2KBGA 1A6UL 1AJ7H 2EEXA 3FBQA 2HTKD 2VLKA 2EO9A 3CLWA 1UZ8B 3OB8A 3VUAA 1IFGA 3VXME 4EI0A 1NLBL 3D39B 4EKJA 3H2WA 3FUEA 4U1SA 1GZPA 2VSKB 1A3RL 4JFQA 3O41B 4OKDA 3SQBA 5B7MA 4HLEA 1AS7A 5D70L 4ZNEA 2YAHA 4P9HH 3TJHC 3IBEA 5IWLA 4J3OC 4XCNA 2BSED 1IGJA 5EN2A 3ABLB 4PG9A 3S48A 4LCWA 2H32B 3BUDA 2CIKA 3OR6B 3KPQB 2J5LC 2C9RA 1II4E 4K8RL 1YYLL 1REIA 2AXJA 4KZCA 4BE5A 1ZLVK 4DN4H 3ARFD 4YHYB 5C9JA 1C12A 4J3TA 4PRPD 4ODSH 3D0LB 5BUPA 1RK0B 3QC5X 1CN4A 4UTAA 1N12A 4HKBB 2VC2H 2ZONA 3IJ7A 3U7WL 1ZHLB 1CDIA 5ELIA 5C6TL 1RP8A 4H88L 5I6NA 1WBYA 3NRPA 3L54A 1AD0B 1NDMA 4IRSB 2CRIA 1LP9F 4TVSa 4XO5A 3P54A 4MA1C 2PYEA 4BSJA 2FK9A 2JB6B 4HJEA 1LHZA 5DS2A 3DO7B 1KXHA 4A2EA 4ETQB 3U6RA 1WV7T 4JAMB 5F44A 2BVEA 4NZRL 1X3DA 3ZTJG 1BEYH 2YUWA 2B1AH 4XNYH 3N0PB 4WW2A 3QJFA 3FBKA 4X7CC 3HAEG 2F53E 2Z1KA 3ISRA 1AXSA 4X80H 4ZD3H 3JTTA 1SHMA 3T71A 4HULB 1QBLH 1FWXA 1HHKA 2DWDB 2YPKA 2DJ4A 3EJYD 4P2YA 3VGFA 1TUPA 2OK0H 2Z8SA 3HG5A 2NLJB 1OAKL 5FHAL 2P24B 4OLUL 3DSFH 3VGGA 1XGRA 4K23L 3ZDXE 5EPMA 1EGJH 1CS6A 1BVLB 3QUZC 4LP4A 5AYUH 1A3ZA 1AC6A 1XFPA 3GSWB 3MV7B 4GS7C 4R26L 4AH2A 3GUTB 1GPOH 3FTXA 1DEDA 2H3NA 3MRFB 3O6FC 5LG1A 1KYOK 1J5HA 3AGVA 3BP7A 3GJFB 3B2UC 2G60H 2NUTA 1QSZA 2WZ0A 1NFDE 1MUJB 5GJSH 5EEVA 3VNYA 4QAMB 5E99L 3U4EA 3QZWG 5JXED 4PIRF 3QJVB 2OJZL 4BKTC 5BZDB 1QLFA 2VLRE 4Z3TA 5JIPA 3PQYB 1V7NH 5IGXH 5CGYC 2F7OA 1FSKC 1S3KH 3DPDA 1V3KA 2B20A 4J4PA 1JHLH 2DQEH 4OJFL 1ILUA 2BY0A 4PGDB 1NOAA 1G7MA 2EDXA 3LIZH 2UWEA 4PV8A 5F9WB 3RVVC 4FN0A 4JO4L 3UTQB 3B7UX 3F58H 1YECL 2C9PA 2Y22A 3DX0A 3I6GB 2W5PA 1A1NA 5ID0A 2MCPH 5KVGL 1ORQB 3QR2A 1KACB 1JTOA 4U05A 5J7CC 3OKDB 3VI4A 3QNYB 1WWCA 2XJLA 1YEWA 4JDZB 4G8EA 3QCTL 1AC0A 4JZNB 2XWTB 1E4WH 3ECVA 5E94B 3IN2A 1CC3A 4FHBD 2XWCA 3JZYA 5GZND 2B1HH 2OMBA 4YDVB 1TETH 3SJVE 3IFOA 3NIGF 4JFEB 3T5WA 3VD5A 4UT6L 2K7PA 5JXAL 2H6PB 3PV7A 3FYEB 3MRIB 1I7ZA 5ID1A 2GFBA 1ODUA 1T04B 2VRAA 4LLWA 4A66A 4XTRD 2IDUA 2Z8VC 4F15C 3ZRSA 2MPAH 4TL4A 5CD5D 4XPHL 2X87A 4TSAL 1R3JB 3PWVB 3PABB 1E8XA 4MD0A 1Z1WA 4Z0BL 5KG9A 5EO9A 1JGLL 2HJFB 1DBAH 1S9KC 4FQXD 3KS0J 3QDMA 3FQXB 4N0CC 5D4HA 1RZKC 1QLRA 3D25A 1QPKA 4CILA 1N2RB 2I27N 5CD3B 1RHFA 2DWTA 1OTTD 4HC1H 5CSZB 5FA4B 4GUOA 1FNGA 4OLYL 4PWEA 4M8QA 1DDHA 1NUGA 1W72A 2G9HB 5EOCH 3WNIA 4MZ2A 1TQBB 1JZGA 4XMUA 3OZ9L 3U1SH 3CX2A 1NBYA 4Y8DC 4YBLB 1M3IA 4N2OA 4ETYA 2YC1B 4QXTA 5JHMA 4XGZA 4TSBH 2H8PA 2VLRD 3B2MA 1AQDB 4PJ5A 4PGCA 3T0AA 3A4FA 2QEJA 5FUOL 5IBTH 1PS3A 3R06B 2GJ6A 4F8LA 1LNUA 2Z31A 2R1YB 4M62L 4M7LT 5C6PB 3QFJA 9PCYA 1ONQA 5M95B 4FP8H 3CDZA 2KC0A 3H2QA 4FCAA 4FTDA 4A39A 2JIXD 3JUYA 3KPNB 4L29B 4OR1A 4HS8H 4PWJA 4XPTH 3G5VA 3UX9B 3QQ3B 4P57A 5IROC 2VAJA 4HWNA 3HB3D 3WHXB 3D2UB 5EBMA 2GYSA 5I1DA 1DTUA 3SPCA 2C4XA 1Q9WA 3QNXB 4MB5A 4UT9H 3NCJL 1QW9A 4Z7QB 3QIBA 4TNWF 4D9RE 1GY1A 2V4LA 4L1LA 4N0RA 1CFSA 3RWFB 5L4MA 3HKZA 3UZQA 1J9CT 2NY3C 2JJTC 4AYMC 3WLBA 2R39A 1YY9C 4HEPG 4E0RA 5I19L 5GGVH 4GW1B 1CXHA 1M1SA 4YS4A 4G5AA 1HZLA 1EAPB 2LAGB 1NGPH 3VRJA 3DHMA 1CD1A 3FH8A 2EKSA 4C4KO 1DANU 2NY1C 3FTGA 3SY0A 3NT0A 1DJXA 1KBGL 3GI9L 3CU7A 3TN0C 1TKWA 1TIUA 5T33H 4HSAC 5BUAA 5I1CL 4E41B 4FFWC 2JSFA 1JGVL 4HJ0D 3OHXC 5DVNA 2VDKL 5DJ6B 4WI3A 1MNUL 3VVVA 2DD8H 1WAAE 3QEGH 1R9FA 1NICA 5B8CC 3IXTB 4HAGA 5C07B 3M7OA 5C7ZA 4FHJA 4NJAL 3TBTA 4ZJ9A 5IMKB 3QWOA 1E6OL 1NAKH 4UTBH 1UKTA 2D3VA 2FEDC 1DE4B 2HLAA 2XN9E 2V3EA 2W38A 1NGWA 3MLUL 2YAOA 2CO2A 2OTUB 4LPUA 2CKBH 2KLTA 2GVYA 4L4TD 4QO1B 3FO0L 3F84A 5A2BA 1U8IA 3UTSA 1Z7JA 3B43A 1TJIH 3U0WL 2EDLA 3F5WA 1X44A 5D7SL 3P4NB 4JHWL 3O45B 3DECA 3QNZA 3VXRE 4YZWA 3L81A 3P40A 3JVGC 3D5OF 4ZOAA 1OW0C 4XNMB 5A6IA 4EUPA 3EYOA 3CJJA 5IHLB 5IHUL 5DK2A 5IM7B 3NJFA 1RAMA 2HX7A 2UZPA 3MOAL 3L9YA 4BCXA 1MAMH 3DX7A 1IX2A 1IL1A 1ORSA 3EHBC 4HWEH 1L3NA 1P84J 1NKRA 2XZZA 4NI3A 3GZOA 5I1HH 1DQDH 3SPHA 5BRQA 1SEQL 5T1LB 1EJ8A 5C8JB 3HR5A 4D9RD 3NABH 1R5WB 4HWZA 1I3VA 3QJSB 4HSQA 1IE5A 2OM5A 3KLSA 4UV4H 3FO9A 4GMSH 5F7LB 2W81C 4WVRA 4XBPB 3TBWA 4OZIB 4NRXB 1HWWA 1K4CA 5EO1A 1B0GB 3GD1C 4PJAF 4YHIB 1QRKA 5H2BA 2QKIC 4GAJH 4PJ8A 2WYZA 4PJFB 5BVPH 4MXVF 5EFIB 4KHXL 2K3TA 3TPUA 1JF6A 5KVFH 3ME0B 3DVNB 4I88A 4OZFB 3V4VL 1HILB 3KWVA 2B59A 4PBXA 1UXLA 3MN8A 4XX5A 4G72B 5F88A 2IQAA 4QHKJ 2WWOA 3HUJA 2W65A 4OCMC 3VI3B 1A1OA 4MJ6B 4Z0XA 1FVDA 1NOLA 2LFGA 5L0QC 1RERA 4PLNC 2W92A 1BQHG 3QS2A 4XWGL 5CILH 2DI9A 2PNDA 5ICYB 1RFDL 5G2NA 2R0KH 4J2QA 1WD9A 3S8WA 3VAEA 1MHEA 1UM5H 2EAEA 3IXAB 1CJYA 4NQSB 4HS6A 5DZ9A 1L6PA 4AG4H 4ODVL 2XN9D 4ZTPH 2VW6A 3VXMA 4D8PB 1IM9D 2EEFA 5JW4R 2YMOA 3WEOA 4S2SB 1OCWH 2XG5B 1E9QA 3EIFA 2ZUTA 1IKOP 4MB3A 2IC2A 2BWQA 1JNHB 5I8OL 5D7JB 4YXLL 3DOIA 1UWGH 2EVIA 3ZU8A 4PEEA 1BXVA 1W0VB 3CPUA 1QR4A 2ZXQA 4BFIB 4AM0B 4BINA 4HIHA 4J3OH 3HN5A 4QOKE 5CBAA 3BEWA 1A14H 4IGBB 4UV7L 5ICXA 2ODHA 4XCCL 1S7TA 1VFBB 2FWSA 2YRZA 2Z0UA 2GUOA 2WNXA 2VDRB 4GSDL 3TZVC 3ZE1F 5CJXA 4NAJA 3CLEH 4G11A 2YBRB 1LDPH 4H1LH 4PM1A 2V3FA 4YUEL 1KTLA 4HKJB 4LNRB 3IGLA 1S3RA 4XXWA 5B4MC 3PWLA 1A8ZA 2IPKA 12E8L 2D7NA 4K9JA 5E00B 1Q90A 4M5ZH 3ARQA 1CZ8H 3QYNA 2L7JA 3NA9L 4JDVB 1E5AA 2N1KA 3IPEA 4Y9CA 5D4IA 1CI3M 4G9DB 1T3FA 3CZLA 4NQCA 3ASNB 4P46D 3Q01A 4W9DC 2IAMC 1Q72L 1P4LA 4R7NA 2I60H 1Y6MR 3DX3A 2F53A 3QCUL 2WOYA 1FIGL 4I77H 3TLRA 1LP9A 4E36A 2E9GA 4Z7NE 1NWOA 5E08H 3MBEA 3C09C 5FYKH 4JPQA 2EDNA 2C1PB 3H9ZA 5DZAA 3ARXA 1I9EA 2J20A 5CFAA 1B0WA 2HAZA 4LHUG 1ACYH 5JUEL 1UCBH 3VSVA 4LLVB 1IIIA 1SOQA 5MEQB 5GS0D 3SE8H 3LKPB 1SFHA 4GSXA 2CQVA 4TUKL 3TA4D 4KNUA 3U9PH 4J3BA 2P8PB 4I0CC 4I9XA 4YFLF 1JFHA 4MA7H 3RTQD 4E5XA 5K9JL 2O72A 1ZA3B 2IQ9L 1DQJB 1SEBB 3VG9B 5ANME 3DPBA 4PJ9A 5FV1L 3KG5A 5ADPL 3SCMA 1SMDA 4DKAA 1P4UA 5BZWA 5GS2H 4HUWA 5EH1A 4HDIA 2ZF8A 4MDJA 3CDGA 3WEXB 4ABVA 4AL8L 4GRLA 5HGHA 5DI8A 1JRHL 5JQHC 1OGAE 1E30A 3SO3C 5GGTH 3K81A 1AGEA 4OZGE 4A6YB 1FZOB 1EMTL 4C83B 4UM8A 5DD0H 4O2EA 2BJML 1SM3L 4NQEE 1HQ4B 3ECQA 1DZBA 1OSZA 3T04D 2ROXA 2FJHB 2AAAA 3L5XL 4XRCA 2H1PH 1KLUB 4XH2A 3HI6H 1MJUH 4QOKD 1IGCL 4Q9QH 3L45A 3IWVA 3U4BL 5T8IA 3OLIA 1PTZA 1TZHA 1Q9KA 3PWNB 2E7BA 1IIKA 3UGUA 1I3GL 3ZHNA 4BWTA 4M61B 3FCUB 4JQIH 5IZ7A 3ZUCA 2WGXA 1KEML 2NW3A 1ZS8B 2YGQA 2PO6D 8CGTA 2MOGA 43CAB 2Y6SD 3VD0A 4AYFB 2ZWLT 4G9FE 3SJVA 4Y16C 2N0KA 1GVIA 1JPGA 2C9UA 4BK5A 3H53A 1M71B 4XVSL 2WLNA 2VXUL 2XTJC 2H26A 3DARA 1PGRB 3I02B 4IIQA 4LSRL 5T5FH 1LK2B 3FB8B 4R5VA 3L3GB 1EEQA 4P2RA 2HWZH 1XTLA 3BHBB 4W81A 4MDIA 1Z2KA 4F57L 1XAUA 1P5VA 2YD8A 5A43C 4YPJA 3WO4C 2D7QA 2ZKXA 4OKVB 4QHKI 3QSKB 1OL0A 2A9BA 3ROLA 1KTJA 3WFHA 4WGWB 1CD9B 4JDTH 3TC9A 2XETA 4RAHA 2Z91B 3TJEL 3NYKA 2Y0SA 1LO3H 3C75A 3CMOH 3CXDL 3IAPA 2F54E 3CC5A 2A1WH 3CFQA 4CL7A 4U1IB 4LSQL 1BMZA 3TCXA 2BINA 2NY0B 4L8DB 1EEZB 2XZAL 4L4VA 4QTIL 2ZSVA 1AR2A 2YIHA 3VSUA 3QAQA 4M5YH 1IB5A 5TJWK 1YEGL 2IH1A 2ODIA 1CLVA 3F6IA 1QZ1A 4BUQA 3KJ4C 4ODHL 2Y06L 1N7ML 1S9YB 2VAAA 3REWA 1GAFL 1F90H 3DI2B 3IETB 3AMKA 1XCXA 1MPAL 3HIZA 1IM3D 4ZFZB 4HBCL 3U7AA 2EE6A 2TRHA 5T3ZE 3WFEL 2H6UA 5EDSA 4AC2A 2W91A 1QFUH 3OJDA 5BPPA 3VFGH 5F3HB 1K72A 4YDLC 3S34L 4NQED 5DWUH 1UM4L 4Y89A 3HI1A 4F2MA 4NO5B 3LN9A 5LWYL 4XVTH 1ZLVH 3LRLA 2Y36H 5J11C 1J5IA 1JWMB 3ES6B 3N9GH 5MEOB 2PCYA 2H32H 5LLIC 3IN0A 4GI9A 1QI3A 2YFOA 3OX8A 3ZW3A 1XCTA 1A6TA 4WI7A 5M7QA 1AY1L 5KSVB 2XA8H 3NEOA 2EYTB 2WLIA 2P7TB 3HE7A 2WB7A 2AP2A 1QEWB 2XU9A 1T89A 3FQNA 3B5HA 4G9FD 4DCQA 2OX5A 1LILA 2NNXA 1GMIA 3R8BB 1H3TA 5CAYB 2WKGA 3MRJA 1SJMA 3ZT5A 2WXGA 2WCSA 1EDQA 3ZO9A 4Z3IA 4I3RL 1FFRA 4QLWA 2BXYA 4N1HB 5IBUB 3OAYK 5FOBA 4YR6B 1O7SA 1BX2B 2W1NA 4HZAA 4OH2A 2XFGB 1TTAA 1LEKA 4X8XA 1L5GB 4X6FB 1L9OA 2XQYG 3T08A 3OWRA 3DA0A 3W1ZA 4RNRB 2OPCA 4AUYA 5E5MB 4X5XA 3OAZK 4PJGE 2WWKO 2YGPA 4FYRA 5CEYA 1RULH 2DM2A 3SE3C 2ITDA 2VLLA 3ATEA 4M7JL 1CTMA 2PXYD 2WLJA 2B3RA 1I8MA 1YYML 3V0IA 1MZZA 1WAAA 5EDXA 5C3TA 5IJKC 1JV2A 1XIWA 2F54D 1QFWH 2IADA 4NI6A 1BOGA 1MQKL 3Q1SL 4PWKA 4WO4D 4HK0B 1HHJA 4AT6B 3MRMB 4QHNB 4CA4A 4JFYA 3AREB 1JXDA 1ML0A 3W38A 3RWIB 4WHYH 3U1PA 2QQQA 5JPMB 1FLTX 1HXMA 1OP3K 4IOIB 4D0BB 4EI6A 3MREB 5KN5A 1LE9A 4W4OA 2E8YA 5H37G 5IFAH 1S5IL 5B3JF 4JJ5A 2Q3AA 1Q0YH 2JQZA 3HHMA 4DAGL 1W0WA 3S8FB 4E9QA 2RALA 2AEIT 5T3ZD 4OCSH 1GGIL 3VXRA 3VFMB 1UWEL 2IWEA 1IEBB 3QXAB 3D4GA 2NXZB 2ZCHL 3OKEA 3EFFB 1EFXB 2VABA 3MC0A 4O5LL 5DHEA 5BRZD 1IARB 2R1WA 4O2CA 3VO0A 1IQDB 4WK0B 1QZNA 4GKOA 2V3DA 1RZIB 2O5XL 1QSEA 4Y4KC 2FB4L 3B2DC 1ZLWH 1PQZB 5IVZB 4QRFA 2CO1A 3QQNA 3HNTL 2GBUA 4KRNA 2YQBA 2WXPA 4KK6C 5KYUA 2AI0L 4N2KA 2K0RA 4RRPM 5MERA 2X4OB 1C1EH 4FQLH 2BIHA 2UX7A 3Q13A 5DF0A 1S7WB 1ZHNB 4RESB 5AWNL 5DD3H 3V0JA 4G6FB 3SE9H 5IP4A 4YLCA 3V8CA 2X1OA 3CZNA 2NX5A 3DV4A 5AW3B 32C2A 4F9LC 5L6YL 3VXSA 3NZ8A 5J12C 4KUCD 3RHWK 3C60A 2VCOA 3N42F 4U6HA 4GRMA 4PJCE 3EJZD 3O3BA 4S1SL 2JJUA 3IJHB 4TVPE 5BV7H 4OM0H 5DVPA 2X4NB 5DFVC 1XGQA 4QJ3B 5B22A 3C6LD 3KLAA 4UQIM 5CINH 3RIFF 1T6BX 4JE4B 4HXBH 2AVGA 3T65A 1DN0A 2RFXB 3VX1A 2VLJB 3QR1A 4JM4L 4Z8FH 3BO8A 3RWHA 2Q2LA 1FL3A 1I8LC 2Z0BA 2C3XA 1U8OB 4APQC 5A7BA 2FX8L 1OWRM 2CGZA 4PJAA 2PR4L 1OO2A 4UUJB 4GNKB 1J87A 5EF1A 3I3DA 3I85A 3LXUX 3EJPA 4QCIB 3RNQB 4ALAH 4UINH 1GH7A 1K8DB 2CUIA 1O75A 2YN3A 3K72A 5E9NA 3VVWA 1SHSA 3GBLA 5JIIA 5INDB 3FS9A 3BQUA 4Q2ZB 3I9AA 4FQCH 3P0YL 2NY4D 3NN8B 5D2LB 4MCZA 3N1QC 4I2XE 1MH5B 1A7RL 3ZE0B 3LYRA 1T83C 3QDGA 5K1NA 2X1PA 4ZFOL 1IT9L 5D2NE 2QVFB 1WDAA 2C7FA 4OFYD 5IG7B 4KV5F 3RGBA 3CFTA 5A40E 4G80B 3ULSA 4GUPA 2FTAA 1IC0A 1GJIA 3O11A 5D71H 5J13C 3NRQA 2GSGB 2YQGA 1RJZA 4GW5A 1KPUA 1WJ3A 2QGCA 4I0PB 4NB7A 4R96B 1M05B 1JGUL 2EZ0C 2ZOUA 3TBVA 5IOKA 3LPFA 4FZEL 3STLA 4Y2NA 5K9OA 3QNFA 1FFPB 1GSKA 3TFBA 4JKNA 3RGVC 5IR1A 1P6FA 3N43B 4KRPD 4ODXB 5ABAA 3TNNA 4EDXB 2LLLA 3Q9PA 1HNYA 3MGTA 2R2CA 2DM4A 5BS0E 2A9MH 3QYCA 4JZOA 1MCEA 4FNSA 1WT5C 1AIFB 4WU7B 3HZMB 4QTHB 5AD0A 1H15B 1FNEA 3ETBF 2FBJH 4P5SA 1KGYE 3L08A 1J1PH 3O0RL 3IDMA 1CQKA 1VHPA 3EYFB 1Z9OA 5GRWA 4NQTA 1IGIL 3LRSB 4RA3A 4PJHE 1XB3A 2X6AA 3WMPA 5JPNC 5F89A 1ZXKA 4RA0C 2CO4A 4IJ3B 3RI5F 4LXFA 2VZOA 3X2QB 5AKVA 4K7FB 4CVXB 3D07A 5D7LE 2ZX7A 4P8QA 4Z77A 4HV8A 1RUQL 2D4DA 2H0JA 3MNVB 3B2VH 1U3JA 3H3PH 2OL3L 3P0VH 4TL5A 1XX9C 4JM2D 5AW7B 1MWAB 5ENWB 1U8JA 1GMEA 2JFCA 4LKCA 3JYCA 3S3SA 3WS6A 4R83A 3FMGL 4JHAH 4KMTH 4AUUA 1ZV2A 5KSBB 1N26A 3GJEA 1OGTA 4J8QA 4BA0A 1X5LA 2X2IA 2R2HA 3UAFA 1FZKA 3JTBA 2Q76A 1EH9A 4KKAD 3TO4D 2WQAA 4A7SA 1OAUH 3FTZA 1UD3A 2Y2WA 1KN4H 1XD0A 4KHTH 2R0WL 3N40P 1XT5A 5ANMA 4Y2DD 5AAMA 4WTQA 4F80A 1ZS2A 4XC1L 4AK1A 2MQ0A 2CDEB 2JQAA 4WWOA 1PW3A 1NCCH 5E9DB 1TJGH 4PTUA 3EYSH 2CR6A 4UT6A 3QG7H 3PRZA 1YJDC 1OGAA 2W80C 4E9YA 4PRHE 3VU2A 4KO9A 5CFHA 3MPCA 2APBA 4PJ7F 4XC3H 1BIIB 1MRFL 4JRYD 1V27A 4HPHA 3NIFE 5IK3A 2OR7A 1SLUA 1VGKA 3GXDA 3AS2A 4L1BA 3LDBB 2IGTA 1CO1A 1GYCA 2QZ5A 1CURA 3HC4H 5EBGA 3UTPE 2PN5A 3B9KA 3MLPA 2J6EL 5AL8A 1YEDB 4F5CA 2AQSA 2CHDA 4BZ1H 1F3DH 1X9LA 2AF2A 1JF1A 4JFDA 4K7PX 1A7QL 4YFEA 2YZ8A 4JKPL 5I1JL 1ZKAA 4YFLI 3JWDL 4ZFFA 5FDWB 4CC0A 2K3HA 3IGFA 4W6YB 1KCVH 3KYOB 1JERA 3NCEB 3W81A 3ESPA 1TTGA 4LIQE 1D5ZA 3J27A 4PVBA 1MI5E 1PLGH 3NSJA 4POZC 3BH4A 5H94A 4AKQA 3OKMB 4ILDA 3P9LB 4JO8A 5CJ5A 2YPVH 2DEXX 4GQ9L 5CP3H 4K3DH 3QUYA 3AABA 1M1XA 2EDMA 4PJDF 3N44B 1XF2A 3MODH 3CFDA 5FHBL 3OKLB 4UB0H 2YA2A 4BFGA 4BZ2L 4O9HH 4Y88A 3IJYB 2VOTA 4XP5H 2CLZB 2D0HA 3L3DA 2L0DA 2AGJL 1RUKL 2J2ZA 4JG5A 3DO4A 3NFSL 3V0WL 4HUNB 2XJKA 5IWLC 5IMOB 4ISVB 1LK3L 1IILE 5A6MA 1NBVH 5LG6A 2A4CA 3KVQA 4FYTA 4ODTL 2JKNA 1XSJA 3NQIA 4Y1AB 5IB2B 3QG6A 4OIAA 4OQ1A 4IRSD 2HRPL 5E2TH 4DW2H 2GY7B 5CGBA 4HXAL 2AZUA 5B39B 4BKLA 1MFBH 3LH9A 4NLHA 3PNWB 2DQIL 2VDLL 3KPOA 1XH3B 1JNLL 4JFXB 3DSNA 3T0XA 3VE0A 4FABL 3VTTA 3JYBA 4F7TA 2YXWA 3QHFH 2VR7A 2H0FA 3ZDYB 2FQEA 1LJMA 2CRZA 1CXLA 1RCYA 3GEFA 1TR7A 2N3JA 1ADQH 4HUKB 4WEEA 1XGYL 1MF2H 2V0AA 4IRZH 5L8LB 4N85A 4JO3H 1WF5A 4OCWH 3E38A 3UTZB 3QRGL 3WTUA 1VESA 3UTPD 1TEGA 4JFHD 4WW2C 1OANA 1A25A 4OIIL 4IM8A 3F3HA 2HRLA 2V17L 3O4OC 4AITA 1DO5A 1OTUD 3DUUA 5EBWA 2RHEA 1T7XA 5I76B 4M00A 3TEXA 4HX1A 3EG9A 4LVNB 4LE8A 4OB5L 4PLJD 1FG2B 4TNVK 4NZTH 1MFMA 2XWXA 3F00A 5AOJA 3COOA 3VQLA 2RAMA 1OVZA 5IMMB 1HWHB 5ACZA 1YN6A 2VDPB 4Z9KB 4YZFE 3PJLA 5J8OA 3PQYD 2P5EE 3SKMA 3D85A 1H0DB 5IEHB 4YLQT 2FLBT 2WXHA 3CSTA 4K3EH 3FU0A 2NY5C 3WFBL 4CC1A 2GK0B 2ICCA 3IDYC 3VWJD 1FO0B 3P4OA 3CSGA 2OQJB 4EIBA 3FC8A 3RBGA 4QY8A 5FX3A 1QKZH 1SJHB 4JFPB 3X1NA 2C7UA 3MKGA 3WGUB 2COVD 1JPTL 1HDMA 1ZTMA 2QDWA 5DK0B 4Y5YC 4U6YB 2PWDA 3K6FA 4J4PC 2D31B 2N4IA 3IMWA 1OHZA 5ETUB 4GO9A 2HKFL 3UYRL 3RQ3A 4DN3H 1HEZA 2EQDA 4O02H 2IDQA 4N2DA 3SGEH 3ETBJ 2VERA 3HBGA 3QQDA 1QR1A 5G4OA 3ISWA 1U0QA 3WKPA 3C12A 5IBLD 3FQUB 5DZNA 4BUGA 1KIUB 4F37K 3BPCA 4XWOC 2HJLB 4JFED 2VDMH 1S78D 2HLEB 3UZVA 4GRWF 3MJ8A 4I87A 3UMNA 1SDDA 4KPHL 2LU7A 2WVUA 1G7LB 1I7TB 3KPSE 1U3HB 3BMVA 4NEHB 4X6DB 5CZXC 3MLTA 3V4VA 4QRRE 4ZAKA 1JK8B 2IDFA 3C8KA 5DO8A 4HIIA 3D4YA 4LEEA 1CK0L 1I1AD 4X5QA 4FGMA 1Q1PA 1YVLA 3CSFA 1BBDH 4MAZA 4LF3B 2BPBA 2R9HD 4MHHG 5HI5C 1QX1A 4LHUD 4KVPA 4PD4K 1VACA 2CM5A 5HHXH 1MCSA 1CTNA 5T1KD 4N20A 5I1GH 1VADA 3KWWB 3N50A 3ARDA 3I2CL 4LSTL 5I2IA 2XTLA 2DQHL 2P80A 2CO7B 2D7TH 4OBRA 4ZUTB 2ENSA 2BSSB 5DSCB 5I6LA 2EIZA 1P7HL 5F0PB 3LRHA 4M1DL 1G0DA 1LD9A 1N0XL 1XZWA 4F7PA 1KIRB 1JE6A 2ED8A 4I48A 4MA1B 5FA3A 4I5BB 1XZ0B 3N1FC 3QJXA 4BD4A 2HB0A 1A7NL 2ADIB 5JNYA 4YDNA 1WGOA 3FB7B 1OKEA 3P77B 3P9WB 4KMQA 3B9VA 3HR6A 3W2DH 5C92A 2YK1H 2VZ1A 3P4MB 1AS8A 1MREH 3U2JA 3ZT7A 3T3MB 3KAAA 1WS7A 4UZSA 1FNSH 3LKOA 3L5WB 4MS8C 3AWFA 1N9PA 1MCBA 2AAVA 3V0GA 3DDFA 4JB9H 5FKPA 2BW4A 2H1LM 1WIUA 3I75A 4H25B 2I7OA 3K1DA 2IO5A 4EZLA 1QA9A 1FBIL 1G7PB 3FCSB 3UG3A 3L95B 3DXAE 2XVLA 1AJ7L 1NAMH 3U46B 5IJDC 4RMBA 5F3BB 1KEGH 4JN2A 3VXTA 3EUDA 2W88A 4NOFA 3FULA 3UJJL 5FB8A 5F7HA 3IRPX 3NAAL 1OLLA 5CBEB 1FA4A 2ALAA 5IW6A 5F7FA 2WO2B 1G5AA 4LQFH 1S8DA 1IAMA 4C4BA 4P9HL 2XQBL 4OCXH 2FJSA 3KXFB 3QIBC 3EZ8A 3EOBA 1WD8A 4GXVH 3DOSB 3QC6X 1U3YA 4YQXH 5FUCC 1FSKB 3KPSD 2OI9C 2UZXB 1ZVSB 4YGVA 1RLWA 5DC9B 3R4RA 1EXUA 4ODSL 5EC1B 4QRRD 4AGLA 3D12B 2EDEA 1CDYA 1CPUA 1P2CA 1U30A 1YNTB 4IQHA 5E8NB 4X0KB 5BS0A 3U36B 4X5LA 5HYJA 4U1MB 5C0RH 5HD8D 2F5AH 3WNJA 3GSQB 2YD5A 4XOCA 4KZ0A 2VUKA 3WSQH 4EEEA 4PFEA 2VITA 2QR0B 4LKXB 15C8H 2DQTL 3G6JE 4HP5A 4XZUA 2FQGA 4NQDA 1DZ0A 1CR9H 4NDMA 4JKWA 3DETC 1ZK5A 3SGDH 1D3CA 2CJSA 1SHXA 2CCLA 2FLMA 3TCLA 3HZ3A 2XFXA 3LZPA 2HA1A 5D7LA 1BEYL 1HSAA 1TMCB 2B1AL 4FZ8H 3UC2A 2ZNXA 1RIVL 2WCGA 1UJ3A 5I8CB 1CGXA 3POCA 5KSAD 1KGIA 4ZD3L 1UXWB 4CN6A 5JDSB 3RL1A 3C2AL 3DV6A 4Y4FB 2WUBH 3OAYH 1LO5A 1FZJA 4RDBA 4DQOH 1S9XA 4K5NA 2NZ9D 3EJSA 4L5FE 4QYAA 1SGKA 3DSFL 4KI5F 4Z7VB 1P84K 4JN1H 4ZUSA 1A5FH 3PUCA 5LB1A 1V05A 5AYUL 5IKCB 2GIXA 1Z5HA 1UVQB 3AUVA 1FIEA 1EO7A 4JREC 3HS8A 4PLKD 3ET9F 1H8LA 5GJSL 1NCOA 2YD1A 1JRHI 5TK4A 5T1LD 5JW5A 1JWUB 2FO4B 1BM3H 2HUEA 2AV1B 4PH8A 2ZWYA 1K9TA 3S7GA 2IEPA 4XCEB 2C4FT 1N59A 1OF0A 3CSYA 1NM9A 3PDDA 4FFVD 3UTTE 5IJVA 1KIPB 1OP3H 3T0EE 1V7NL 1KG0A 2NNAA 3Q3GB 4YK4C 5FIEA 2F0CA 3MV01 4OGQC 5I0XA 5IGXL 1J9TA 1S3KL 4GAYB 5CGTA 5LVEA 4JVPA 1ZLEA 2DQEL 1P1ZB 3X1EA 1XDTT 3FHEA 3LIZL 4NN6B 4G6KL 1UOKA 4MA3A 5CLWA 4PRHA 5HGDA 2XOTA 1MCFA 3QGVA 3F58L 3ULVE 1NWPA 2XWBA 2P8LB 3ARYA 5J1AB 1YPZF 3EOTL 1DVQA 4UMGA 2JKLA 3EOYG 3S36H 4JFFB 4F3FB 1PD0A 1RPKA 1BZ9B 3DIDA 4Y9GA 1FVCB 3IFNH 4D0CB 2AJYH 2Y07L 2YPLE 2J44A 1F6FB 3AS3A 4NUJB 4PJ8C 2Q86B 1ZJAA 2EJ1A 5I74C 3O3EB 5ESAA 3VFRB 1LO4L 4CMMA 1XVSA 3QH3A 5L9DL 3IJ8A 4LOEA 4DH2A 5GS0L 4NQQA 4PHXA 5TQ0H 4PJ7A 1BF5A 4JDEB 3FT2B 5C0GA 3L3JA 2B1HL 3NMEA 2ZP0T 2B9BA 4ZUUB 1G7JB 4JPWL 5I18H 3ZKMD 5FYLL 5DJZB 4IS6B 4LBEB 3REVA 1XGPB 4ERSL 2I69A 3L4TA 2NY3B 3AAZB 4L8SA 1FAIH 3BI9X 1MI5A 4KO6A 5BRPA 1E5CA 4XVUC 3RILA 1INDH 3RZCA 3LB6C 5LJYH 2A73A 3O2DA 1FVEA 1QSFB 3OHMB 5D7JD 5EU3B 3OLEA 1AR1D 3AU1A 4XN5A 1SVCP 3ZN6A 4KNTA 1JI1A 1T1ZB 3PWPE 3PWUA 4U31A 5F93C 1ESOA 2NY1B 3W9EB 4AM0Q 3IVKA 1DP0A 4MJJA 4XCFL 3TN0B 1LGVA 4HT1L 3V6OA 4IGBD 3KH3A 2ATAA 4HQQL 1FDLL 3Q2VA 1NIAA 4HC1L 1I82A 1MEXL 4YFDB 3SQOL 4PJDA 5T1JA 3CVHB 5C0CB 1I9JH 2FAUA 3SDXF 1CMOA 5B8CB 5EOCL 4WQOA 5EIIB 4O58L 4LCUA 5LNGA 1SJEB 2W60B 1DVSA 4GXUM 2WYTA 3OLDA 5F8QC 2X44D 4TSBL 4IDJH 1IEHA 1I8IB 1E3XA 1KC5H 1WQVT 4GSQA 5IBTL 1XMWA 1KTRL 4S0HA 1FGVL 2BSTA 4HUCA 4TQPA 1M6OB 3JVFC 2OMWB 3HZYB 4KUZL 3FOLB 2WTPA 4LPVA 1FJ1A 5A2JH 1QTYT 4XXWC 3QA3B 1PZ5B 1XF5B 4J3OG 3EO9L 4Q56A 1X9RA 3VWKB 1IVLA 3ULVD 3S37H 4HS8L 4Y1TA 3V4PH 5C71A 2FGWL 4P23A 4XPTL 1CIDA 4XNXH 4AIOA 3B3IA 4X9IA 1Z3RA 4PCSA 3T6XA 5HGGS 3DX9A 3BH8A 4DUXA 1F2XK 3FUFA 4JRXB 1P6AB 4MCYA 1BYOA 4NO0A 1CGWA 2J12B 3GSNB 4UT9L 4N0UE 2Q6WB 1YY8B 2PYFA 4OY9A 3T77A 1DVFD 3MBEC 4QDGA 3O2VL 2OS7A 3LRMA 2BCMA 2IVFC 1NDGA 3BKCL 3D2TA 3H7LA 4I8DA 4TNWK 3NCCB 4WWKB 5DJYA 3RWGA 3U2SB 4W9IC 3WIHL 2NXYC 5DC0A 2VR3A 1MCJA 3BLBA 3KNBB 3ZKQD 1LL1A 3MUGB 1NGPL 5FWRA 4ODWB 4Y2OA 5LQBH 3CBJB 4LDOB 3RWDB 2JKRM 2P5EA 5TK2A 4AQEA 4PJ9C 4PV9A 5LBSL 2FSEB 5T33L 3SCMC 4IKLA 5EZJA 2VR5A 2DIJA 1H5BB 3BEVA 4EKXA 3PWPD 4GRLC 4PWFA 4ANVA 4FADA 1T20B 3FFDA 2DD8L 4U3XA 3QEGL 4FA8A 3LKQB 4WUUB 4TQ8A 2DQGL 4MGXA 4KKBC 1E40A 2RJMA 1D5RA 5D93C 2QQLL 4GO8A 1NAKL 4UTBL 5L0QB 2GB2A 4ZX6A 4HIPA 2X2JA 5HVHC 2ZOLA 1F8TH 3IJEB 4UQBA 5HHQB 5KBLA 2NYYC 3QI9B 2Z8RA 4NM8L 4WTZA 1LXMA 4MDRA 1IO4C 2FNWA 4AYDC 4PPTA 5KYWA 1KLGB 5AB0A 1L9TA 2DQFA 2F8IA 3SEPA 4FQQA 3D05A 3D8MA 4P49A 4F91B 5HVGB 2Z8WC 3SKOA 5SWZE 5TE7H 1RZJC 2FL5A 3SDCB 1MAML 4N22A 3MLVL 4K71C 4BK5C 3DI3B 5E70A 2Y3AA 5I1HL 1DQDL 4DP8X 1EQWA 1U8CB 1G7HA 1YEIL 1WFMA 2P43B 4IIQC 5C0NC 2DDQH 5CWSA 4NKOB 3IAQA 2W8CA 5LBVA 3G08B 3M07A 2D8KA 4JO1L 4ANUA 1HAUA 1FYTE 1XF3B 3NABL 4MQ7A 3GIVA 1KYAA 4G3YH 4G8FA 4L0YA 5KVEE 4WUKH 5DEGA 2XVBA 2V7NA 3SN6N 3MLWH 4H0LC 4PS8A 4ELMF 3PHOB 2DLFL 1NEZA 2W0KA 3O9WD 4DVBA 3VFUB 3WNPA 2AKRA 2IPUG 1GZQB 2ILLA 4U1JA 2FX9L 2NDFA 3ZGIA 4ZFOA 4I1RA 4OGZA 4GAJL 1XGTA 3MRQB 1ZV5A 1IAOB 5AG8A 1KJMA 1T4KB 4TMPA 4UBDD 4RGNC 4HH9B 5AOMA 2ZKYA 1WTLA 1T1YA 2ZXEB 4JGUA 3AY4A 5D8JH 3ZTCC 4HIEB 4NZUH 4OT1L 3LIUA 4LDLB 2D9QB 4H8WL 4LMQI 2Y9RT 1UB5B 1ZEAH 1DVUA 3BP5A 3C09B 4FXGA 1F4HA 5IQ9B 3MCKB 3VMNA 4H5SB 4KZEH 1R3KB 4BDVA 3DXAA 5AVYB 3DMMA 1PVHA 1SMOA 3HNSL 4MAYD 2HT2D 2YRPA 3M88A 3MRKA 4X6EA 4QRUB 3G7TA 3SPIA 3N06B 1TLKA 3ALWA 4JEGB 1GC1C 5AVWB 4DKTA 3NJVA 1OCWL 4OZHF 1BD2E 2QMKA 3DTXB 1UOLA 2F7RA 4A7VA 5D5MF 1UWGL 4OLWL 2G3NA 2EE0A 3GBML 4NYLA 2OL3A 3RUGB 4BFJA 3O3DB 3HE7C 4YHLH 4CC4A 3LVTA 1T89C 1CICA 3OR7B 5IV2A 3GSVA 1SHWA 3OSVA 2I9TB 4KDVA 3LKNA 1G6RL 2CGYA 3KR3H 4OZHE 4TS6A 2GJJA 3GSRA 4NCDA 4NM4L 4PJ6A 1LDPL 2CDGA 3LRKA 1HHHA 4CJ1A 3KHQA 4FYSA 2MH4A 1MW1A 1YDPB 3BAEH 4IU3A 3M17A 1FYTD 2VYRE 4RAVA 3ARED 1MQ8A 4HUUB 2WLKA 4LCIH 3WHE1 3FYIB 2Q1EA 3I74A 4JPIA 3AWEA 4RWYL 3T4YB 5BXFA 4PJXF 4GFXA 5EORL 3T1FA 3KE0A 3MRNA 5K9KA 5ERWB 2GHZA 1MELA 1XIWC 2PW1B 1KV7A 5DYOB 4KTDH 4IIZA 5F2FA 2I60L 1UQSB 4UAOB 4Y16B 5E08L 1G7QB 4L9LA 2VXVH 3F62A 3BD3A 4OCLC 5FYKL 5TFSH 3E6HA 3H0TA 3W37A 3VFWA 4ENZA 1E3ZA 4F8NA 3AS0A 1F4AA 2NXZD 2DB8A 4W4OC 1ACYL 2OFQA 2ED6A 4UOW0 1RUAH 5ISZA 4ZX5A 4AVJA 1RPUA 3SE8L 2HT3C 4Z23A 4PWIA 4ZS6D 2WUCH 1KBBA 1XXDC 1D9KB 1LMIA 2MNUA 4QRSB 3AZUA 2Z35A 2J6EA 2AMGA 1NJ9B 2R69H 2DH3A 5I16B 4MA7L 2KS0A 1FO0H 1X7QB 4IHOA 4Y9BA 1HI6A 4G7SB 3V9CA 3MRLA 3QWRA 1NINA 3GKWL 1MKFA 1U92B 3L3IA 3U0TA 1YZZA 2VISA 1JFQH 2X6CA 2X0VA 5TTRA 1JWSB 2LR4A 1QQDA 4ZMXA 2H2SC 3UTTA 3TFKC 5HHOB 5DXWA 1CF8H 3T0EA 1CWVA 1ZPUA 1XL4A 4Z76B 3AC0A 2IOIA 4PS4H 3WN5B 3LNIA 3WAKA 2FJUB 4DK5A 4U49A 4NFDA 5HDBB 3FONB 4TUJA 2DTSA 1EHLL 4NO3B 1FORL 3KPPA 4NENA 4BFFA 3UZEA 2BVOA 1ZT4B 3FF7A 4NQXA 4M6OH 3IKCA 3BDXA 2NCEA 4JY5L 4BZ2A 1MXGA 2DAVA 2H1PL 3CPLA 4U1LA 1FL6A 5TQ2H 5KYYA 5DQDH 3D0VA 4LCCB 4UIKH 4YDLB 4UANA 1U8HA 2ARWA 2YPLA 3P3SA 4XNQB 4OSUH 5DJ0B 3AFLA 3JV4A 4OF5A 4V1DE 5I26A 1H8OA 4P2QA 3QIUD 1ICTA 3DRTB 5EUOB 1E6JH 1QWNA 2VZ3A 3ZDZE 4JQIL 1J05A 5J11B 1N0LB 3VXNB 1YPZA 4K8RC 4P0DA 4EI5D 2D2CC 2C5DC 4ANXA 1A4KB 4UT7H 3ZMNA 4OJEH 2A9NH 5FKAA 1R3LA 4DKDC 1SNRA 5AKSA 3BE1H 1AZVA 2DQJH 2OSWA 3GSOA 2XUWA 4HOZA 3L9RB 4HSCX 1JVLA 4Z3JA 3US0A 1NCBL 4AQAB 4TLSA 1OT2A 3KLHD 4NXSA 3WDJA 3BQUC 2AK4E 1J5CA 2HVJB 2QGEA 3QUXB 4YO0B 4CADB 3HZVB 1ET5A 3GMOB 3TWYA 4I0PD 1IGTA 4DGWC 5L2KA 2EXSA 2Z64C 1PDKB 3BW9A 2BVQA 4G6AC 4JDTL 4S1RH 2PP9A 2X9XA 5ECJE 4EF3A 3CMOL 3QQ9D 4MQXD 5HHPA 4A7QA 1U6AH 4WJ5A 5AUMB 4ZXBA 3CVIH 2AJ3B 2UUDH 3Q44A 1INQB 2R29H 4ABWA 2PPCA 1I1CA 1GOHA 1EJOH 1M57B 4XMKH 1H3PL 1NC2B 4OLVL 4HD5A 5CJOH 3ZL1A 4M5YL 1NBZA 2EDTA 2HX8A 3ASWA 1I9RH 4GY4A 4N28A 3X3GH 2O61A 3ZL4H 3WIIH 2MNJB 1F90L 1YCSA 1WP6A 5AYQA 2D0GA 3H3KA 1H3VA 5DA0B 1H3UA 2A5UA 7CGTA 3AU0A 5E24E 2AS5M 4WCYH 1Q9LB 1QFUL 5AAWC 4X2UA 3UBXA 3VFGL 1R3HA 2UXTA 3FFCE 2YGNA 3ZX1A 3SDXA 3VXPA 5DCCA 4A2MA 3HCVB 3QDJB 2D3JA 2C9AA 4NN5B 2EUWA 2FT6A 4W1TA 4NP4H 1T03H 3V95A 4OF6A 4EPSA 4JGMA 2Y36L 2ZF9A 5DJDA 2OMVA 2ED7A 3G5XA 4NNPH 4XZ4A 3LZRA 4Y19E 1I1RA 1XV8A 4B27A 2JQMA 4V1DD 3WS6C 1R5VA 5L88L 4QXVA 3JV0A 1HCFX 1CLYH 2WBWB 2VLME 5EEXA 2E4TA 2HFEA 3R19A 4LLDA 3VGDA 3UBXI 5JLZA 2X12A 1BAFH 3LN4B 1HXYB 3DBSA 5FO7A 1E65A 1FN4B 3L6FB 3KCPB 5C9KA 2A4EA 1OTSC 1J8HB 5SV3A 2DWEA 3MLXL 2CXKA 4OGXH 3RFZA 4XMLH 5HHVH 5J12B 3AXLB 3TT1H 5E8EB 4F7EB 2UXGA 1XMEB 5AAMC 3NCFB 4YN3A 3ZDYE 4BIKA 4UDTB 3E9UA 3FT4A 3IFLL 3BX7C 3FSOA 4HFWB 4JMXA 2XG4B 1YMMB 4RGMC 2X4UA 4X5WA 3P2DA 2BDNL 3F7YB 2PW2A 1KPVA 5DJAA 2HP4A 3DBXA 2AVFA 5HDWA 2CRMA 2ZUVA 3LS4H 2XN1A 4OF3A 5GGSY 4AEEA 3DX8A 2E9BA 2X7LA 1J1OL 4DK3A 1ZA6B 3I84A 2CJUH 1SXCA 4KTEH 3GUFA 4J3UA 4NJ9H 5PCYA 3AUWB 3P11H 3B9KC 4LOUC 3Q6FB 1PSKH 4GSUA 1RSYA 1ES0B 2BIOA 3MXWL 3MUZ1 4I18A 1JS4A 5FYJH 1X4YA 5CZVH 3CFEB 4QHMB 1I1YB 5KVFE 1MJ8H 2KI6A 1NGXB 3C5XA 4QKTA 2F9BT