2CALA

Crystal structure of his143met rusticyanin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
LDTTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGMAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic Resolution Crystal Structures, Exafs, and Quantum Chemical Studies of Rusticyanin and its Two Mutants Provide Insight Into its Unusual Properties.
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
molecule tags Electron transport
molecule keywords RUSTICYANIN
total genus 32
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2calA00
2J57A 3PAVA 2Y1AA 4ENZA 2PLTA 1CUOA 1A8ZA 2FQDA 1ZPUA 1A4BA 4PCYA 1HAWA 1NIAA 2FT6A 1BXUA 3T71A 3WG7B 4DP0X 2Y69B 1AS8A 2EIMB 4DP6X 2PCYA 3FSVA 1XB6A 1ASOA 1AG0A 1KV7A 1SDDB 2RACA 3UGEA 2H3XC 2IDFA 1X9UA 2E86A 3GDCA 1NICA 4KOCA 2CAKA 4ZK8A 4AKPA 1WA1X 2PPCA 3ASOB 1OE1A 4HHWA 1IC0A 1PY0A 1E67A 2IDTA 2YAMA 4A2HA 5I6KA 5ANHA 5B1KA 2GBAA 2IAAC 3SBQA 2ZXWB 1J5CA 1ZDQA 2VW4A 4P5SA 3UAEA 3FU8A 2XV2A 4DP7X 3PPSA 2VM3A 3T9WA 3FSWA 2DYSB 1E5YA 1RZQA 4NERA 5I6PA 2XLLA 4G72B 7PCYA 3QJTB 4G71B 1AZUA 3AG2B 1OOWA 4E9RA 3S3BB 3TA4D 3EH3B 2B3IA 3N2JA 3G5WA 2YXWA 1ID2A 4PAZA 3ABGA 1RKRA 1SFDA 1NIFA 4QLWA 1W8EA 4DP9X 3CVBA 2A3TA 2CCWA 3CVCA 1KYAA 1AIZA 4A2DA 2WSDA 2YXVA 1HFUA 1AR1B 4KNTA 1X9RA 2W8CA 1RZPA 2FT8A 2IWEA 4BWWA 4DP8X 1BQRA 1OE3A 1EHKB 3T6VA 1PLCA 4YSPA 5D4JA 1SHWA 3AG1B 2HX8A 3JT2A 4KO6A 3NJJA 4L0PB 1OF0A 5I5MA 1V55B 4KO9A 1KDIA 1AS6A 2H47C 1AZRA 1CYWA 5I6NA 3PXLA 1NWOA 3QJRB 2HX9A 4WTQA 2DWSA 1GS6X 5F7BA 2ZONA 4W9ZA 3NJIA 1I53A 5I6OA 4DPCX 5B3SB 4YSUA 1GW0A 1NPJA 2YAQA 3QJUB 3WKPA 1PLAA 1PNCA 1SF5A 2QDVA 4FAAB 2QDWA 2UX7A 4DPAX 4GP5B 2BP8A 4BDVB 3S3DB 1E65A 2FNWA 1YLBB 3S8GB 3V9CA 4AI7A 3WNJA 2CALA 1W6LA 3T6ZA 1F56A 2JFCA 1PAZA 5B1JA 4AX3A 1WA2X 2GC7C 3NJHA 2VN3A 1SHXA 3WNIA 1B3IA 8PAZA 3OD3A 4KO5A 9PCYA 4YSOA 1JERA 1MG2C 2CJ3A 2HX7A 2VSMB 1TEGA 3D12B 3X1EA 1AANA 1ASQA 1AZBA 1N68A 4P5RA 2HRHA 4BXSV 3ZBMA 4G7QB 2BZ7A 4YSQA 1ADWA 4AKQA 5TK4A 4YSCA 3N55A 2FJSA 1IKOP 4DP2X 3PCYA 1A4CA 1BQ5A 4BWUA 2BP8B 4BDVA 3QPKA 4KNSA 2OJ1A 1E5ZA 5I5IA 4YL4A 1JXGA 1PF3A 1PZCA 3FSAA 3PLYA 3WKQA 2VMJA 4HCGA 3X1NA 4HCFA 4A2FA 1J9TA 1SF3A 6PCYA 2GIMA 1E30A 1OV8A 3X1FA 3WI9A 1ILUA 5IY5B 1JZGA 3QJSB 1BXAA 2OV0A 3GXUB 2I7OA 4A67A 1OCCB 2AZUA 3AW5A 2HRGA 4GP8B 1BQKA 1CURA 4DP1X 1QLEB 2BO0A 2HZHA 4DP4X 2JXMA 1IBYA 4CSPA 6PAZA 1L9QA 1OCZB 1XB3A 2J5WA 1J9SA 1JZIA 3NJGA 3ERXA 2ZWNA 4CSZA 2BHFA 2N0MA 2P80A 3GYRA 3EHBB 1MDAA 2YAEA 2DYRB 4A2GA 4AKOA 4E9WA 2PPEA 2HLEB 4YSEA 4YVUA 1J9RA 4E9XA 1XMEB 2AZAA 2YARA 3ZX1A 4JHVA 4UANA 3SBPA 3NJNA 2I85A 1T5KA 2ZOOA 2WO3B 1L9SA 3ZIYA 2LLNA 2XYBA 4F2FA 4BXVA 4NB7A 2IH8A 4MFHA 3NSCA 2Q5BA 2UXTA 2PP9A 2QPDB 1GY2A 4E9SA 3IN0A 1R1CA 1GSKA 2H5UA 1L9TA 3X1GA 2VM4A 4RH4A 4JKNA 5B1AB 1NIEA 1KDJA 3V9EA 4N4YB 2MRYA 2YQBA 3AG4B 2YAOA 2J55A 1JVLA 3TU6A 3FYEB 1IBZA 1NPNA 2NRDA 1JZFA 2VSKB 1BXVA 3FYIB 3MBWB 1L9PA 2EIJB 2I7SA 4JHUA 5AFAA 3AZUA 2XXGA 1ILSA 3L45A 4E9TA 4FA7B 2IDSA 4KOBA 3DTUB 2XWZA 3MX0B 3CVDA 2GC4C 3NJLA 1GS8A 2XV0A 1XB8A 1M56B 1ZV2A 1QHQA 3UACA 3DIVA 1ET5A 2XUWA 3FT0A 3T6XA 4UF7C 1M9WA 1PZAA 3KW8A 3FQ2A 5B7EA 3RYMA 5TK2A 5FC9A 3PAZA 2VW7A 3FS9A 4F7KA 3QJQB 2FT7A 1JZEA 2GB2A 1V10A 2YAFA 2PCFA 3FPYA 4GYBA 3BVDB 3AY2A 4E9VA 5I28A 2IDQA 3C75A 4YSDA 2UXVA 1BYOA 1A3ZA 4KO7A 1NIDA 1FWXA 1OCOB 3ASNB 1QNIA 3TASA 1ZIAA 2X87A 1KBVA 1J9QA 1GR7A 2GI0A 2BW5A 1PLBA 5LDUA 2YAPA 3S3CB 1TKWA 3NP4A 1AQ8A 5PAZA 2UXFA 4HHGA 2BZCA 2EIKB 5I6LA 3FPXA 1KCWA 4N8UA 3IN2A 1OCRB 1OE2A 2XV3A 1DYZA 1PMYA 2IWFA 3EF4A 2JKWA 3PAUA 4HIPA 2XX0A 5AKRA 3ZDWA 4HALA 1GS7A 2PP8A 3BQVA 1WS7A 3FU7A 4GXFA 2QPEB 4M3HA 2XU9A 3OMNB 1ZIBA 3S8FB 3OMAB 1NINA 2EILB 2B08A 4UAHA 2BWDA 4G7SB 1TU2A 1JXDA 1WAEA 1W6WA 2PP7A 3H4HA 2TSAA 4KNUA 3NJFA 3SBRA 2R7EB 1TEFA 1BYPA 3AG3B 3NJKA 3NSYA 1WA0X 5D4HA 5I5JA 1A65A 5F7AA 1MZYA 3SQRA 1NWPA 3NJMA 2DWTA 3NSDA 2UX6A 3FQYA 2PPAA 4YSAA 3IBOA 5EHFA 3TBBA 1CC3A 3HB3B 3FU7B 3OM3B 2YAHA 1SJMA 4A66A 1NTDA 3T6WA 1AG6A 1M57B 4DP5X 1URIA 4HCIA 3NSFA 1JZHA 4YSTA 2Q9OA 3CDZB 4YSSA 1ET7A 2CBPA 1PCSA 2DV6A 2W88A 1AZCA 4Q89A 3WIAA 3ABMB 3IEAA 2DY2A 2QT6A 2R7EA 5I26A 1BAWA 2BP0A 3X2QB 1VLXA 1UATA 2CUAA 1FFTB 4WKXA 1NIBA 3H4FA 1NZRA 3IE9A 3OQRA 3UAAA 4GY4A 1V54B 2XVBA 3X1BA 4W1TA 2XXFA 1J5DA 2BWIA 1AOZA 1DZ0A 4TXVB 3OMIB 4E9YA 1PNDA 2IDUA 3ABKB 1JVOA 3CG8A 3NT0A 1IUZA 2FQFA 1GYCA 3UADA 1ZDSA 3U25A 2FQEA 1KGYE 3DKHA 3CDZA 4YSRA 1N70A 1L9OA 1EZLA 4A2EA 1JOIA 2VW6A 4F2EA 1JXFA 4NAJA 2OCCB 1CYXA 2BP0B 3FQ1A 2EINB 2FWLB 1FA4A 2XX1A 1SNRA 3QQXA 2P80D 1ET8A 2TSBA 4HZ1A 4DPBX 4EF3A 3EH5B 2FTAA 5B1BB 1BEXA 4YVNA 4A68A 1MG3C 2X88A 4QKTA 5B7MA 3FU9A 7PAZA 2J56A 3JTBA 3NP3A 2FQGA 4GP4B 1AACA 2IWKA 1GY1A 1MZZA 3NYKA 2PPFA 3TBCA 1AAJA 2AVFA 5B1JC 3FSZA 1HAUA 1A4AA 4Q8BA 2GHZA 2IH9A 1PZBA 2UXGA 1JZJA 2HXAA 1KBWA 2GSMB 4HAKA 1SFHA 5E9NA 4BWTA 3CZUB 5A7EA 3ABLB 4G7RB 1WS8A 3H56A 3HEIB 4BK5C 5AZUA 1RCYA 2AFNA 3UABA 5B7FA 1SDDA 2MTAA 2PPDA 3QJVB 4K9JA 4M4RB 5D4IA 5I6MA 1L9RA 1AS7A 4X4KA 1AZNA 4G70B 4E9QA 2WO2B 1KCBA 3EH4B 1NDTA 2AANA 4AZUA 5PCYA 3KW7A 1ASPA 2BW4A 1ETJA
chains in the Genus database with same CATH superfamily
4JQIH 5J89A 3BAJA 5D1ZA 5T5FH 1F2XK 1JPSH 1V3MA 2IBZY 2BIIA 3SIKA 5FUOL 5J11C 3ZU8A 3UJTH 1K2DB 3F7RA 4KHXH 4S1RL 3QAZB 2CGRH 3GD1C 3T71A 4WO4C 2NCMA 4MLSA 4YEEA 2PCYA 3WDHA 4FNSA 3T2LA 1SDDB 1T7VA 1H9DA 1F90L 1FZKB 2ENQA 4RRPA 3H7BB 4H8WH 4P2QA 2VIRA 2F1AA 1J0KA 3ASOB 3FB7B 2X4OB 1OE1A 4HHAB 1M2VB 4QHNA 4UDUA 5EC2A 2P47B 2XIIA 2ATPB 3RLSA 5ACMA 3NAAL 4IHOA 4WUUE 5H94A 1QEXA 4WI0A 3IU4L 43C9A 2UZPA 3EDKA 4ZJ9A 2WBKA 2Y6TE 2BH0A 3KYAA 4HV8A 4UNUA 1C16A 5FGRA 2VM3A 1QEWB 4X8XA 4HKZA 5I6PA 2KQMA 5I76B 4YUEH 5DMYA 4L5FE 2CH8A 4XX1G 3LIZA 3S3BB 4PTUA 1E27B 3G5WA 2VLRB 5KWYC 1N2RB 1RI8A 4G8AC 4OCWL 3GS7A 5F3FA 3WIIL 4DN4H 2P5EA 3FULA 1QI3A 1CDUA 2YKLL 5BS0A 5G4NA 1NKOA 3FB7A 2PN5A 1CU4L 2FT8A 1VEOA 3DX7A 4TVUA 5E94B 5HVGB 1RK1B 4OGAC 1EHKB 1UKSA 4QYOB 4HIQA 2G5BB 2OR9L 2YGVA 3AG1B 4U3SA 5DGQA 2NXZB 1NUDA 4KO6A 4S1DD 1BV8A 5A2IH 1E5AA 1ORSA 2DD8H 3K6NA 4Z0XB 1UM4H 1NCTA 4N2HA 3GBNL 4HOMA 5DFWH 4XWOC 2Y7QB 3FTSA 3BUPA 5FYLE 1OPGL 1WAAE 3CXHJ 4IQHA 1IZJA 3BH4A 5ITBL 2ZCKH 1NMBH 3QXWA 5D2NB 2HFFA 2H3KA 3HUJB 5KANG 4DPCX 4KK5D 5EC1A 2WUCH 1GW0A 4ZMNA 2O6DA 4R2GB 2YAQA 1JGDA 3BAEL 4LLDB 1PLAA 4OJFH 1R46A 2XPGA 1G7JB 5T5FA 2VL5B 3C87A 1Z9SA 2EVGA 3BPCB 3P11H 5EU3B 2YOAA 4C56D 3S8GB 2Q7YB 3WNJA 4LLVB 4CDHA 1ORSB 2GG1A 2ADYA 1BG1A 4F9PC 5DHYB 2P28B 5HGGS 4IJ3B 5FECB 5L9DH 3GKWL 4KKLC 5GRUL 3UBXI 3EFDH 1J0YA 2BVPA 3PHOA 5DO8A 3DRQB 1TVHB 3BN3B 4LDCA 3MJ6A 5GRZA 2YXFA 4ZAKA 5DQDL 3P4NA 3ALPA 4LCYB 3TBVB 4BIKA 3S9DB 3CN0A 2CO6A 4NBYB 1TTGA 5DVNA 4JHWL 2MFNA 3WJJC 4LLAA 1EEQA 5IW3A 3S2AA 2DM3A 1MFMA 4XP1H 5CAYB 2XPGB 4JRWA 5EG6C 4MS6A 3VO0A 1WZKA 5KBLA 2EEXA 3QWOB 5G4OA 3QFJE 4HC1A 4ODSL 4OZGB 5I5IA 2NTFB 4XH2A 1EFXB 4ZI8A 4ZUSA 1CGVA 1KIRA 5SWZD 3VI3F 5SV3A 5IQ7H 2OI9B 2E9WA 5BOJA 1R3JA 1DQDH 4R26H 4LARL 2HJKA 4P4RB 5T1JA 1OV8A 4ZNEA 5AEAA 2C8NA 1ETZB 3C08H 2VLME 1E8YA 5TQ2L 3WFDL 3S4SA 4DCQB 2CA4A 3O45A 4R7DB 3MLXH 4KU1A 4JPSA 4UT9L 3D33A 4P2RD 3BD4A 3OHMB 4YHPA 2BIOA 2ZPKL 2FEJA 4PJHB 5JIMA 3T09A 2DLFH 4UNIA 3RL1B 3TT3L 1CI3M 1XHHA 5MENB 1K8IB 1FJ1B 1THAA 5IJDC 5K39B 1E3XA 4NS0A 5HDQH 3S5ZA 3N3EA 4FF9A 1EQWA 4B9CA 3LQZA 3KGRA 4BM7A 2PTUA 3CFEA 4AZ8B 2QQQA 3UZQA 1G9MH 3EJUA 5HSFA 4XT1C 3VXRD 3LS4L 1UWGL 4AIZA 5KJRL 1F4XH 4JHVA 2FZ3B 4DZBA 1I9IH 2EEAA 5I18L 3DI2B 4YHPB 4CGTA 1KJ2L 5BV7B 3X3FH 5T3ZL 5GSRB 1R5WA 4ERSH 4BK4A 2VZSA 3W57A 1MW1A 2IH8A 1ZT1A 3RL1A 3VVWA 2WXHA 1ZD6A 1XF4A 3P4MA 3W2DH 2FX7L 4HWZB 1GSKA 5DC2A 4RETB 1CDGA 4JKNA 1P2CA 4H1LH 3QCTL 3V0HA 4UQ2A 1U8OB 2WWNA 3LTVA 5E00B 1BCIA 4F8PA 2CCVA 4WU5B 5HJDA 4JN2B 4AIXA 5E6IB 5GGTH 3P0GB 4OF5A 1IBZA 3FQXA 5JIQA 1OWWA 3MYZA 3VI4F 2FZ3A 2ICEA 4DZBB 4DPRA 4HJEA 3MBWB 1N5YH 5AWNH 1XO8A 1QW8A 2AABL 4N0CC 1WD8A 2G9KA 5DEFA 1R5WB 3BEVB 3UTZB 1LP9F 2YR3A 2B0SH 2PMZA 4TUOA 3V4LA 3FFCD 3BMWA 4MCYA 5DTFB 3GRWH 2F74A 5L88L 1H3PH 4LSDA 4P57A 4CKQA 2YMOA 4WO4A 1QFWL 4PD4J 4PGDA 1HCYA 1U8OA 2CRZA 5E00A 4UTAH 4G8GE 3TN0B 4FXGB 1WC7B 1D5XA 3MV8B 3O2VH 3QAZC 1SJHB 3KLLA 1JWUA 1NANH 4XGZA 5DVPA 1JZEA 3DECA 3U79A 3ZE2E 1J0IA 4FQLH 5D1ZI 5DC0A 4X6DB 3B9VA 2ZTBA 3II1A 4L48A 1IFRA 43CAA 3NQKA 3P40A 4YSDA 5I8EA 4R4FL 4XWOD 3V2AR 1A14H 2EXTA 2IAND 3GEWB 1G87A 3UTZA 3CFJB 1FNFA 1NIDA 3L81A 5D7IB 5CCHE 3E6FB 3F12A 1CLZH 1T0NA 4HUMB 2PR9A 5F96L 2YD2A 4YDZA 1D5BB 4C4UA 4NNYB 1S9WB 4EI0A 4PWIA 3R1GH 2LLGA 2WQAA 2CM6A 5CHNB 1UT1A 5MEPB 1OAJA 3NP4A 4AV4A 3N0PB 3ZL2A 1ZY9A 2A74B 3ZLQC 3RFZB 3C2SA 1P5VB 1YJDC 3RDTB 3TEXA 5I1EL 4AMKH 2F15A 4UWQB 4WAFA 5D2LE 1WT5C 3DXAD 3GDBA 3MUZ1 5EF2A 3L3KA 3Q05A 4FLQA 3LMJL 4YE4H 5I8EB 4F8OA 1PAMA 5ICXA 3BQVA 3JWNE 5IHUL 5DJ6A 3JV6A 4OJDH 5B3JF 3OMAB 1GOHA 3KYMA 4UIKL 3OKDA 2K0RA 1FORH 1I85C 1PLGH 1T0NB 3QEQD 3VCLA 1XT5A 3U4AA 3FDWA 5IQ7L 5MP6L 2CZNA 3QQ4A 4OCRL 1U41A 1J8RA 1OEZW 3SPGA 1XL6A 4DFIA 2EDNA 4NKDA 1TEFA 4YDJA 2J8UA 4FP8L 2MMXA 3HS8A 3T0VA 5BRZA 3IGFA 4GT0A 4H2AA 3RL2A 1CGTA 1MCLA 4OFPA 5L2KD 1H19A 2V7HA 4KVCL 4NNXA 1CIUA 4GAGH 2FEEI 1NOLA 3Q9QA 3EGXA 1YMHB 1LO3H 3MOAH 2A4CA 2YPVH 5EU6E 1X9LA 5T3ZD 3EJPA 2A77L 3JV6B 2BOBB 2AK4E 5GXBB 5IF0B 4KKBC 4RMVA 3FMGL 3UTPE 1OTUD 1T20A 3NA4A 4U4BA 5BZZA 3ULUD 1FG2A 2BWQA 3HLKA 2LU5A 1H5BA 3WIAA 3VWJD 3FTXA 4JUTA 4KH9A 2KC0A 4WCYH 3HI1A 5B8CA 3DO7A 4GFTB 5D2LF 1NIBA 1P84K 3LDBB 5F3HA 4APQA 2W9EH 4K8RC 5F7EH 5F1KC 2CLVB 2VDQL 4DKFL 3LHAA 1P4IH 2AQQA 3D85D 3RL2B 3SQBB 2XXFA 3S5LA 1D7DA 2V7HB 4NNXB 2J6EL 2JNZA 3D0VA 1I8MA 3WUWB 5C0CD 1OM3H 4QHUA 3I2CH 4NUJB 4ZSOB 1KV3A 3IS1X 3CG8A 2IAMB 3L3DB 3DJTA 2JKTM 4NQCB 3KPRA 4HUWB 3U4EB 4GXUM 4XNMA 4XOAA 4YFLF 1FG2B 2A5UA 2FECI 1DLFL 1IEAB 4Y9GA 5DZNA 4JGUA 4ZBJA 3STZA 4WJKB 4LOEA 3HC3L 2FE0A 4OD3H 3QHTC 3SKJL 3FU5A 3IDNB 4JK0D 3DSNA 4G6KL 4MDJA 3ATBA 4QRPA 3WDIA 1HHIB 2ZT9C 3K4ZA 3NOIA 4GKZB 4DPBX 1XGPA 1HOCB 1UHVA 4ZG1A 2Z7ZA 4RRPM 5IOPA 3ARVA 3L4CA 3SQBA 2IPTL 5ID0A 5B7MA 1MXGA 2PR4L 2R39A 4JZNB 3CWGA 3FTYA 2UZXB 2V7NA 3UO1L 4AIOA 3OGCA 1E7UA 2HB0A 3BVXA 3D39B 1GYAA 1JV2A 3MKKA 5FYKL 4BH7B 4FG6C 2G3MA 2IV9A 4U2YA 1PZBA 4LOUC 5E9NA 2YEZA 1JPSL 1WIPA 2CCLA 3MQIA 1NFKA 3O0RL 1BEYH 2M83A 3SPJA 4D0CB 3ZGIA 1JPTH 3OAUL 4KH2A 5FDWB 1IAOB 2MTAA 4CMHB 5A7BA 1QHOA 4PRDB 3OR7B 3SGJC 1FZJB 4H8VA 4NN7C 2NY1C 4JKPL 4QGYA 2NNRA 1DUYB 1TQBB 5IOPB 1I8AA 3VI4B 1FE8L 2N56A 2YWZA 3FUDA 4X0KB 2CBTA 1IEBA 3KXFA 4JJOA 3ZT6A 3MV11 1KSRA 4NQVA 2RCSL 1JIBA 2QVTA 3T3PE 3QRFM 4AZUA 2L7QA 2YFOA 3EUUA 2BMKB 3PDOB 4LCIL 3IFOA 1W72B 5EF0A 1ASPA 4H8WC 3FT4A 2E4TA 4MJ5A 4BH7A 1OK8A 3EBIA 4NWUL 4DETA 1OB1B 1CFNB 1R24B 5JIHA 4NFDA 1B0GB 2W07B 2GIXA 2F53E 1ZLVK 3GSQA 3LZQA 4D0CA 3WTUA 1N6QL 1BVOA 4DP0X 5JZ7C 1JI2A 3O9WD 1K5WA 5SWSE 4J12A 4GEJA 3D6GA 5CUSL 1XB6A 4JKWA 5LCVA 3HJ0A 1JWSA 4H8WL 4FZ8L 3CBJB 4XXWA 3JUYA 2NY6C 4IRSC 5IVNA 2E86A 2KZBA 1YEEH 4KOCA 2CAKA 2EADA 1ORQA 2WXIA 5DMJB 1EZVY 2DQIL 2YD9A 1B4LA 1IEBB 3KXFB 1RZJC 3KPMB 4A2HA 1U8JB 3NQIA 4NRZA 4DJMA 5I6XC 1AXSB 4P46C 3T2OA 4AGQA 2VKXA 3BLKA 3X13A 1BG9A 2GUYA 4YHKH 3OB8A 3BGFB 1FAIH 3W82A 1K5NA 1E5YA 3IAQA 4FQ1L 4G80A 2DWDB 1RPKA 5GHWL 4DN3H 2W07A 1B0GA 1KCLA 5DMGC 4GLRI 3WY4A 1PYWA 1Y18A 1UB5A 4FZ8H 3RPKA 3IKKA 2AAVA 1KTBA 4QLWA 3DHMA 1UD6A 1F5WA 5DQDH 1IU1A 5EULV 5LAXB 2QVFB 2NXZD 1X9RA 1X5LA 3ZT7A 1RLWA 3WUWG 5CEZH 5KYXA 3RPBA 4DW2L 3LNDA 1LM8V 3CDGB 1AXSA 4ETQB 2ZUVA 4G9FB 1C16B 5BQ7B 4PJBB 3LH2L 3MLVL 3UAJA 1MF2H 4L0PB 1V3LA 2W9DL 3QH3A 3IDYC 1YUHB 4FLSA 5D70H 5C86A 4JQXA 2VMFA 3U6XS 1I7UA 3WIHA 5HYJA 2QPSA 1FCGA 5IW1A 3GBEA 1E4WH 3LNFA 3QEQA 4OIAA 4OZIA 1NCAL 4O5LH 1DSWA 1RK0B 2J44A 4ORGB 1MELA 1S7WB 3V0FA 2JKIS 3R8BB 4K5LA 3FN9A 3WJJA 2GITA 4JFTA 5E94A 2G9HB 4LVEA 3ZKNC 1N0XL 5FKAA 3AJ7A 4JX0A 3KPSB 5A2FA 1SDAB 3HJEA 4GMTH 4HJ0C 4KMQA 1AKJB 1CTNA 3L5WB 2MOGA 3KVQA 3NCJH 3P4LA 5FYKD 1KWGA 1AD0B 2VDRB 4HJUA 4TULH 1YUHA 4FQQB 1OW0A 1KPRB 3THML 2DLGA 4L37B 8PAZA 5DRZB 1T83C 5DSCA 4G42A 5J9PA 1TEGA 1AANA 2V17L 1ASQA 4O4YL 3GZKA 4HJJL 2HRHA 3O0LA 4EI5A 4TOYL 5D2NA 3OX8B 3HFFA 2ZKMX 1S7WA 4GAFB 3RAJL 3HG1D 1J86A 3EH1A 2EIEA 1CJYA 2PUQT 1S9XA 2R0ZH 2BP8B 3L4YA 3GF8A 5F88A 4JY5H 2ZG2A 2H7WA 2K4AA 2OR9H 2CQVA 1M05B 2Z3FA 5HI3C 3B9KA 4APQD 2FHFA 3BH9B 1EO5A 2P7TB 3DMMA 1QO3A 4Y1AE 3QEQE 2J88L 3UBXG 1RK7A 2F8OA 1QSFE 3DK0A 3Q1EA 2DQUH 1OCCB 1ZA6A 3WO4C 1HSAB 2HRGA 1BBDL 1S6NA 1T7WA 2WXMA 5JORB 3LXUX 1IRAY 4BV1A 3B56A 1P9MC 1L9QA 5DD0H 3NIGF 4QRQB 2MJWA 4OIFA 4KRMB 4LHUD 5LUMA 1JK9A 4WTZG 4JG5A 3TEUA 4L8SA 3L2MA 4TRPH 4GKLA 3P69A 4UT6H 5ES4B 1IJ9A 4LO9A 1QLRB 5J1AA 5EO1A 1QO3B 2BX5A 5E5RB 1IAII 2JQMA 2PPEA 5IM7B 3IPBA 4DUWA 5I66B 1M6UA 5FW7A 3VD0A 4XN8A 1D7FA 4ISVB 3PXJA 4PRPB 5KOMC 4AC2A 3NRPA 4GRWB 2DBJA 3ZPDA 3QYNA 4NKQB 4NQDE 1NH6A 3MDJA 3QQDB 5KSAA 3O9WB 1OP9A 3UOAB 3B7UX 5ERWA 4NQXB 4YHKL 3F5WA 3R4DA 1D5MA 1G1KA 3V9FA 3LVTA 5IR1A 4OV5A 3S36X 2AJVL 1J0JA 2JK5B 4DGWC 4E9SA 3PG2A 2H5UA 2IXQB 5D8JH 5K39A 2DBLH 3T77B 4AQ8A 4IIQA 4UQ3B 5ECGA 1QLRA 5IOKA 5MERB 3S34H 2WQVA 1V7NL 2D7TL 3AT9A 4FGMA 4JRYD 5DZ9A 4NUGL 1BQSA 1G1YA 3QXUA 5D7KE 3QUZB 3EYUL 4JFYA 5J4MA 1EJ8A 1KXTB 5ID1A 2WIMA 5DA4A 5FKPB 4Y4FD 1ZGLB 4MBRA 4CC4C 1HC1A 4AIZB 3A0OA 4FS0A 3OKMA 5HDRA 5AKTA 1M7IA 1NC4D 1CE1L 3QQDA 5KSAB 2FYYB 2XTJB 4H88H 3O9WA 1QKZH 3N42B 4UV7L 3HS0B 5KVGL 3VSTA 4KKPA 2OTWB 3K4AA 1BZ7A 3BP6A 4NT6A 4XX5A 3VYNA 3RRQA 3CVDA 4Y16B 1KACB 1Q38A 1EVTC 2X70B 2OYLA 1NEZG 4LNRA 5F6IC 4Y4HA 4RCAA 3SE3A 5KG9A 3MCKA 3FT3A 3ISWA 2DM4A 1OSPH 4Z7OE 5DJZB 5MERA 4JZJB 1P2CB 1NA8A 3WHE1 2HKFL 1G1OA 1I1AA 4PJFF 2QGDA 2ZKYA 4TNEA 4GLRH 3SDDD 4F15C 4X4YA 5DHDA 3OQ3B 4JFPA 3HHRB 3FF8A 1F4WL 1ZHKA 4PRHD 1AKPA 4QLRA 5I28A 2WMPA 3OC5A 2R0LL 4MAYD 3VFSB 4J23A 3DDFA 5GGVH 3WFHA 2HLAA 3BQUA 3IFLH 3WENA 1GGCH 4W9LC 1NBCA 2Y3AA 4OCSL 2WBJC 1UQSB 3DBXB 4QAWA 2CXGA 3RGHA 1TZ8A 3GSOA 2F74B 2WNWA 2ZCZA 1CLYL 4FFZL 3ML8A 1M42A 4WK4B 4CBZA 5FLVA 4HETA 4KFZC 4J4PD 4WO4B 4KGLA 1GC1C 4NDMB 3RWGA 4AQOA 1U8PA 2XZAH 3MV8A 3STBA 4NUGH 4FQHB 4Y5YB 1OE2A 5DLMH 3EFOB 2EDYA 2IFGA 5KYYB 5C0CE 4F9LA 4EIUA 1R3IL 3PNRB 4ATWA 4LRNL 2AEIT 5C97A 4L4TD 3VWKD 5HI3D 2C3HA 3UYOD 5IGXH 3AUWB 4Z7QE 5BZDB 1MRCH 4AGMA 1UWXH 4PY7B 4RMTA 3UTSD 2HKHL 4TVPH 1S9WA 1S7XB 2EDFA 1HQ4B 3H4HA 4DVBA 2VDLH 3L54A 2R7EB 4AW7A 4K0OA 4Q56A 3H6AA 3PDGA 2ZKXA 3EOAB 1P5VA 1A22B 3HZVA 5I5JA 2V37A 4V11A 2PWEA 1G7IA 3MRGB 2VMEA 4ZFZA 4OIIH 1KIUA 1D5RA 3UROR 3LZNA 1F6AA 1HH9A 2B5IC 3VD9A 4LCUB 2CHNA 2OMTB 1FNEB 3FUJA 3ARDA 1FNAA 3LV3B 3BPNB 1IAIM 1MDTA 3PQYE 1U3ZA 1NTDA 2AEPH 4PRHB 2F6AA 2YPVL 4DP5X 5IKCB 4ELMB 4Q97A 5EU7E 3CDZB 4F7PB 4ODXA 2EJ1A 3SO5A 1DVYA 3GLAA 3NCCB 3PJSA 2JI1A 1NAMB 1BAWA 2RR3A 2J8UB 4MCNA 3SDCD 5AG9A 4P9HC 2IQ9H 2HPOA 4HF5H 3HAEG 1T1ZB 4OJEH 1L0YA 2FGZA 4I8DA 5BRZB 4OZFG 1TYJA 5IJVB 3FQUA 4LDEB 1FL3A 1RZ7L 4J3OD 3BKML 2A77H 3OXSB 5JOPD 2EO9A 3P0YL 3ZYZA 2O5YL 4K07A 1CLOL 5DD3L 2AQSA 1YMHA 3WLWC 3ZHKA 4E9YA 2K6ZA 3NT0A 3VM7A 1OK0A 1T0MB 2Q7AA 2Q7NA 2VN6A 4P59L 1ZDSA 4DKTA 5IKCA 3TYFA 5FR3A 4L3EE 2E9GA 4P5TC 5E03A 1E9OA 3LKNB 1L9OA 3CJJA 3FQNA 2CIKB 4N8CL 1QOKA 1WUZA 2AXFA 2OCCB 4IK6A 3I02B 4IRZA 1UM6L 2Z93A 1I3GL 1SNRA 4HGWA 5JHAA 4WUKH 1S9VB 5HHNA 4KK9D 3FTGB 2EE2A 3TJHD 2SEBA 5SX4H 3EYQC 1MG3C 2HLFC 3MR9A 4POZC 1W0WB 4W4OC 5JHDE 4JFDB 5IHHA 5AVSB 3DA0A 5IK3A 3GRWL 3L9BA 5GGVL 4U1NA 1KLUA 2CO7A 2ETWA 3LRGA 1ACYH 1JFHA 1U36A 5E8OA 3PWNB 1OW0C 2PPFA 2AVFA 2K4WA 4U31A 4KWUA 5D1ZB 1KGUA 5AW8B 3UFIA 5EEXA 3A5VA 2VDPH 1JF1B 4U1GB 5BZWB 4YDKH 1UXWB 2IOOA 3IGAB 1IEAA 4Z7WE 5LXGL 5TDOB 2DIBA 4G3YH 4QXTA 5C1MB 2FJFB 3CFCL 1DN2A 3DURB 1LTXA 2VXSL 4QRPB 3MLYH 3QHFH 2WZPA 3BAKA 1C1EL 1I8IB 2SEBB 4WHTA 1KGXA 3CSBA 3UPRB 3SGDH 2XT1B 1DTUA 1LQBC 2B0SL 2FEDC 3ILQC 4JCWA 1QUPA 2WAQA 3RI5F 2ICWI 1ETJA 3ARGD 3E8VA 2CMRL 2F18A 5AZ2H 1JF1A 3K80A 3FU3A 2YEZB 3B4NA 3HRPA 5LNGA 4L1DA 1BAFH 1WEJH 1HYSD 3O3AA 2CDEA 4YXLH 2WKOF 1TETL 2NOYA 4ZPVB 1J8HD 4Q0XL 4Y1AA 2W65B 3CXHK 3CFUA 4QTIH 2EDOA 1MHHB 2PW2B 2APBA 3L95A 3MRPB 5D5MA 1IGJA 4NPYB 4HSCX 4HCRL 4F7TA 5JHDA 3F8UB 1A6PA 4JM2F 4R5XA 4AKPA 4OLUH 4Q2ZA 4X0KA 1I9RL 3NRQA 4FMKA 1W0YT 3QIBD 3TH4T 1KNOB 5ANHA 1YEIL 2CDGB 2ZXWB 3OAYK 3FUMA 1LWJA 1PG7X 4UDTB 3CX5J 2J5LC 3HS0C 3O2DL 4KUCF 4OF7A 1KTLA 4KGJA 1ED3A 2DYSB 3RHWF 2W1NA 5DEGB 3TPKA 1OB1A 4N26A 4IOSD 3VMNA 3NMEA 5I15H 4N2GA 1NANI 1OOWA 3BP4B 4E9RA 5ICZB 4MD0A 4AOFA 5JOFA 3NCEB 2EDKA 3IJHA 4M6AA 4HPHA 5HHXL 1YMMB 1IGJB 1GKOA 3Q1SH 4OZFB 4F15B 3CFMA 4WW1A 4MJ2A 4OFQA 5JO5A 1OAQL 3QIUA 3QWNA 4W9JC 1GYVA 1QMUA 1RZPA 3C6LC 1MCIA 5LNDA 1OSEA 2EUVA 1A1MA 4JREB 4NX0A 1FH5L 1KNOA 1KB5B 2OK0L 4YSPA 3NZHL 25C8H 1QYGH 2JE8A 2XPZA 3LYRA 2XOTA 3GHBL 1ZLUH 2CO2A 4DGVL 1K5NB 3IFNH 1H6EA 4U1LA 4U3CA 3B7YA 2HFTA 5CZKA 4KXCA 2K8MA 2JELH 2JJTA 3DRQA 4TLUA 5FO8B 4KMTH 2GY5A 1KBPA 2ZONA 3BPLC 4TSBH 3X17A 8FABA 5L8KB 3RPIA 4DGYH 2NYKA 3WEXA 1NM4A 1NGPH 3LD8C 3IWUA 3MKGA 3VD5A 4KXAA 2CGYA 1KPUB 1BZDA 2V2WA 5B39G 2X4QB 3BSHA 3ULVL 3V4VH 1A1MB 4BCYA 5KYXB 1DFBH 2XI9A 4O51B 1YPZB 4OZGA 2MPAL 4CL7A 4BUGA 3R7QA 2BCKA 3B2UC 4OD2B 4UUJA 2EZ0D 5F6IB 4PB0L 3GHEL 5I1GH 3NJHA 2IFFH 2V17H 4O4YH 5HYJB 1NSNH 4APXA 4F7CB 1AZBA 3QAQA 1N68A 5AB2A 3TJHC 5JPMA 4N0UE 3LZFH 3ARTA 4H1LG 5LCVH 1P6AB 3B43A 4JM2C 2K6WA 4YSQA 1OP5H 3EG9B 3T4AB 5KVEH 2NY7L 4GW1A 2X4QA 4K5OA 1WT5A 2GITB 5CMAB 1BQ5A 3ETTA 1JL8A 2VZ3A 3RIFF 4HJGA 3OKKB 1JMZA 3NESA 1I4FB 4OLYL 2BIMA 2E47A 3MNWB 3DRTB 4YFDB 5FFGA 2X4SA 5E8NA 4PJCE 1M6OB 1T0OA 2YUWA 2WNGA 5DSCB 1WE5A 2ZCKL 3LB6C 1WVZA 4QY8B 4UQEA 4X7DC 1JZGA 2F53A 3VXTB 1BPVA 3QUYD 1QBML 1Z1WA 4LPWA 1AQDA 2E27L 4FNPA 3FOLA 4ZFGL 4Y5YC 1OF2B 3L16A 4JPQA 4PBXA 2E9JA 4PJHF 3R06B 3K6IA 2BO0A 3TPUB 4DP4X 4Z3IA 2H1XA 3KM1A 3ISRA 4P23A 1A47A 4S2SA 3B3BA 1U8KB 2X3AA 2DQCH 3CN1A 1MFDL 2ZOLB 2BXZA 1HEZB 1RXLA 1VERA 4GXVL 3SBWC 3SKNB 2N0MA 4ZW7A 1ONQB 4G1MA 2E7CA 4XPGH 3ZRFC 3U7WL 1RUPH 2JJTC 3BH9A 2YAEA 4WJ5A 2B14A 2C5DC 1D9KA 2R23A 3FH5A 4OUOA 4QY8A 5E99H 3GSNB 1YEWA 5GRXG 5DJCA 4JFVA 3R0NA 3I84A 3K74B 1MUJB 2BIQA 4ODVH 4M7LL 4LP8A 3WXVH 4UB0L 1HQRA 5H37A 3SCMD 3ZIYA 1XR8B 2D31B 4Z9KB 5C2BH 4AV5A 2CE6A 3MX0A 2XRAH 2B1AH 3CLFH 3NEEA 2IGFH 5KSVB 1C12A 4YDIH 3D3VB 3Q13A 2HVJA 4PJCF 4P3WA 5I1GL 3QUZD 2CLRA 2MPVA 3GWJA 4MMYA 2NUPB 5M94B 1DSFH 2H0PA 1VPOL 3G6JF 4UZSA 4XCEB 3X1GA 4ECNA 4POZD 2IOMA 4RNRB 3LRHA 4AQZA 1F6FB 3RNKB 4J27A 3KLSA 4KK8C 3LNGA 1N6QH 1J12A 4JDZB 3IBEA 3NFNA 3GSNA 1SXAA 5HDLA 3ZKQD 4P2RE 5FGBC 3QRLA 4WW2F 5I66A 4XGZB 4YDNA 3ZHFA 3L3GB 3ESVF 3APDA 1U8CB 3MZGB 3F85A 3U2SB 1L6XA 1GA2A 3QO1B 4K3HA 4U1KB 3FRUA 1NGPL 3BWUC 1TJGL 3KR3L 2WO4A 2XVLA 2XXGA 2XN2A 3VFWB 3LHPH 2AEQH 4OCYL 2IWGA 2KLTA 3ULVD 2H45A 3G5XB 3PRZA 5CJOH 4QRRE 5I30L 3B7RL 3VXSB 1YMMD 2P49B 1F45A 4XB7A 4M8VA 1Y0LB 2C3GA 2XXMB 2DI8A 1QSZA 1T7ZA 5C09A 3S34L 2RH0A 4N2NA 4IOFC 3H1ZA 4XB3A 2AK4D 4UT7H 4PUBL 5B7EA 5GGSY 1WBZA 1C5CH 2XV6B 5TK2A 2A74A 4HIHB 2VW7A 3QUZA 4CMHC 1MY7A 3FS9A 3LOWA 4WNSA 4UTAL 4WI4A 1J18A 1QBLH 4YQXL 3Q6FA 2R0KH 2WLMA 3K5RA 3HS9A 3AY2A 1M53A 4W9GC 3P77B 2VXQA 4GO8A 4AQ1B 1KCUH 5DU7A 1FP5A 2ESVA 4FFTA 3U48A 1BZ7B 3BP6B 4YHOH 4KV5F 5D1ZD 5IB4B 3C60B 3BQUD 1Z5LA 4F7EA 4WWNA 5C09B 2A6DA 2EICA 2WBXA 4WWKC 3RVTD 1D3CA 1Z2KA 3FT3B 4PLKC 4LHUG 1FBIL 3VXPA 3NK4A 2XBTA 3V6OA 4RLDA 1TJHH 5E2UL 2PCXA 4NWUH 4HHGA 2HTLC 4KZCA 2HUEA 2EQDA 3GINA 1JF5A 3PHQB 3ZTDC 2ADJA 3IN2A 3UBHA 1KCWA 4RMRA 4N2BA 3X3GL 5KANI 2X28A 1P1ZA 2JKWA 4I0PC 3PYCA 5LGHL 1KLFB 2XX0A 1ZLDA 3P77A 1A4KB 3ZDWA 1X3DA 5C92A 1FC1A 5EZOL 2HLAB 3BQUB 4UV4L 3RVXC 3FCUB 4ZUVB 1G5AA 4H40A 4ZMTA 2Z35A 1T2QL 5MEOA 4LCWD 2W81C 5IQLA 1BF5A 5K33A 4GXVH 1T20B 2QELA 5CP7A 1FZOA 1E8XA 3PGDA 4ZUWB 3APNA 3RX7A 2ZXQA 5C07D 2F54D 2APTA 4AYMC 2BNQE 3D0LA 4G8GB 5IBUB 3NJKA 3ARUA 3PHQA 1GGBH 5F3HB 2XN9E 1JNNL 2DYPD 2Y2WA 1FAKT 4ANXA 2NY2D 3TTYA 3V5DB 3W37A 2UX6A 3DJ9A 1DVSA 3A6CL 3RAJH 1A4KA 1I8MB 3TBBA 4YAQA 4HJSA 4W9FC 1TSRA 4BKTC 4LVNB 4X5WA 1MW0A 4A66A 4RISL 4AYDC 3QNYA 4ZMPA 3QDGA 5K93A 3B2UD 1Q8MA 1DQQA 2OCJA 3IDYB 2EYTB 2BCMA 4A7GA 4P5TA 2K6YA 4IU3A 2E7BA 1A9BA 3ECWA 3D0LB 4G8GA 4IRSB 4WKXA 3BIKA 3BWZA 1RVFH 4FRWA 2FO8A 2FBRA 5C7ZA 5T1KB 3OKNA 4BYHA 4MB1A 4Z77A 3UYRL 1O9VA 5MEND 3TL5A 3G6AA 2AJYH 3L3OB 3P9MA 5AVYB 4UQAA 3NFPB 1XL4A 4BQCA 1DZ0A 1GGUA 2ADIA 2Z92B 5DD5H 2GQHA 1CFSB 3MXVL 4WUUB 3V52H 1JV2B 4NBXB 1CF8H 4CVZA 3OLGA 5KS9E 1P7KA 4XO4A 5CU5A 3PJSB 2CJUH 4L4TE 4NAJA 3EOYG 4KX9A 1YDPB 1JG9A 1AP2B 3QCVH 4GUPB 1AH1A 3ZTJH 1PX8A 1EH9A 1NMCB 4QOKE 4I77L 3SD5A 3DGDA 1ZSDB 2G60L 4OIBA 4MYWB 2AGJH 5C3LD 4XE5B 4G8GD 1YY8B 3C09C 4NC0B 3ROOB 3X14A 4IRJD 1MWAB 1BFOB 2E7LA 4JR9L 3H55A 2NY2B 4S1SH 3ZZLA 4G6ML 3IK2A 4DO4A 1JTOA 4XP6L 5E8DH 3GMLA 2VZOA 3G6DH 2GHZA 3O2DH 2HXAA 1FLTX 4Z78A 4YC2B 3CZUB 1CQYA 3MLUH 5JZ7D 1NC2A 1I8UA 2ITDB 4PI0A 4WIQA 3I02A 3SCMA 2BSBA 1GPOL 2VDOL 3BE1L 3QG7H 4JVPA 4OF0A 2HVKA 2PPDA 2V0AA 4GRWH 1H0DB 4CMMB 5I6MA 5IJCC 4QTIL 2RJMA 3HZMA 2WW8A 3LMJH 2GI7A 3QZBA 3RGVB 1DJSA 4B6ZA 3VG9B 5EDXA 3IJEA 4ZXBB 5JDSB 1DVQA 1SVZA 3MNVA 4Y5VC 1CLVA 5JQHC 3TBWB 3MOBL 3KW7A 4NM4H 4HPOH 1EO8H 4LKXB 2W91A 2ZXEB 4P5MB 3VWKB 1OM9A 3QZMA 4TS6A 4HUKB 2J57A 2VR4A 2Y1AA 1OTSD 3QQ9C 5AG8A 1Q9WA 1H5BC 1RD6A 5KEZA 1ZPUA 2WSPA 4D3CH 1KN2H 3K2UH 4OZHB 3ARGB 4OGYH 1LK3L 4PJ8C 2QJDA 2HJLB 4CMMA 1XTLA 3UGEA 4AW4A 2IDFA 5EMYA 4UQBA 4NQDB 5FUZL 4FG6D 4N1EA 1PZ3A 3QHFL 5HDBE 1W0VA 4P5KB 1F4WH 5AOJA 4JKPH 2RHEA 4HHWA 1HJBC 4PYGA 4X80L 3TONA 2QHRL 3UPRA 2Z31A 3QJXA 5T3ZH 2AC0A 3D2TA 4PIRF 4XN7A 3GJFH 3OSKA 3KLHD 3BXNA 3H9HA 4N2MA 4MB4A 1UT9A 3N1GC 2D73A 4P5SA 2P45B 3QEGH 4YBLC 4PJBA 3WHE0 2Y06L 3MMEA 1OSPL 3FOMB 3H9ZA 2EDJA 2A6KA 5DHMC 3FHEA 4U1SB 3WFEL 5F44A 5FAAA 1HWGB 1I7UB 5JTWA 3JWDL 1G9ML 5ACLA 4IJ3C 5ILTH 4YGVA 5FB8B 5HHQA 3ARGA 5I71B 4NI3A 4ZUTB 4YNYA 3IT8D 1H8OA 3VGEA 2JJWA 3FO2A 4DZ8A 3I6LE 3MRPA 4PI2A 3UMTA 1W16A 2UUDK 1W0VB 4Q52A 2YXVA 2X4OA 1NKGA 3QIBC 2G9HA 1RUQH 5FYLD 1GXEA 4NZJA 3DGGB 4K55A 1G84A 5DRNA 2V5MA 5D4JA 4KRPD 5AZEL 1E40A 4GKNA 5FX3A 4N8CH 4D8PA 1AKJA 1A6VL 5EEYA 4M8QA 4W9CC 5JQIB 3LVEA 1OY3B 2OP4H 3MMEB 4IIQC 5FIEA 4PJCA 1AS6A 4NZ8A 4HUUA 4WSJA 3VI3E 3WMSA 1SHMA 1HKLH 1S9YA 3HBGA 4N2CA 5IWLC 3VD1A 4MSWB 1A3RL 1WRFA 5DUBA 3I3EA 1OGSA 1HHGA 1BZ9A 1CDJA 2V3EA 1DVXA 1HIMH 3FKUS 2DOCA 5C6TH 1QR1A 3VXMD 5EZJB 2BNRA 1LILA 2GJRA 4K5MA 5BS0B 3BT2L 2GJ6D 4Q9QL 4CDGC 1UD2A 4IMKC 4ZNCD 4MA8H 1KIQA 2OMXA 4PBWD 1HSBB 3UP6A 2FCBA 3NG5A 5F88B 5FM5M 5AQ0A 4OGQC 1XXDC 4S1DC 1JP5A 1A6WL 4NJAH 5ACZB 3NCXA 4PJ5D 1RPQA 1DUZA 2Y72A 4MA7L 4UILH 4NKMA 1WA2X 4M5TA 4BFGA 4FXKC 1B3IA 1N64L 3QZNA 3QVAA 3SDAA 3MC0A 5HDQL 3S2CA 2OYKA 1MG2C 1W80A 5DUBB 4MDIA 1F02I 1XGQB 3BE1H 5L4IA 8FABB 3CQPA 5K5YA 1MCWM 5FFOA 3RE0A 2CO4A 2EYRB 3WXVL 5KSAC 3I50L 4GQPH 4XCNB 5AKVA 5EC1B 1H6UA 3SQOL 4DGUA 3LJ3A 3QA3B 1IKOP 4AG4L 2X4NA 1G7JA 2RTTA 3F05A 3PCYA 4KMLB 3MA9H 1HSBA 2ENPA 2KZKA 2CG9X 2ZF9A 4O51A 1S7TB 5KBPA 4QRQA 4I9XA 4WGVB 1N0LB 4XBEH 5BOZG 5E56A 2DF3A 2VQ1A 2Z9TA 4U1MB 3M7OA 4L3ED 4U2ZA 1KXHA 3CFTA 1L0PA 2WZ6A 2DQEL 2ZXGA 5F9OH 1ROCA 3FFDA 2N1TE 3FUEA 3PHOB 2IEPA 2NDGA 4U7MA 5LG1A 1H15B 2VDNH 1GW6A 2BM3A 2WVUA 4P9ML 4X7TA 4XCNA 1NCWL 3JVGA 3D4CA 4MQXC 3QIUC 1RUKL 1PDKB 4F58L 3T0ED 1C5BH 2WBJB 2AXHA 2Z8VC 3VU2A 2JXMA 5F0JB 3F5WB 1Y1UA 1ES0B 4JO2H 5IR1B 2VLJB 4LCCB 4FFYA 1EFXA 2F7RA 3SJVD 4QRFA 1KIRB 1T5WA 5D7IE 3AU1A 5EU5A 4EBQH 2P80A 4PJ6A 4BGDA 3T77A 2WLJA 5ESAA 3Q48A 5IWLA 2IGLA 4NC1C 5TFSH 2AF2A 5D1XC 5C9JB 4KI5F 1IL1B 3DHPA 5A1AA 4JQXC 5D70L 3CQFA 4XMPH 4HDIB 1HI6B 4OT1H 4JM0A 4MA3A 2VDNL 1IAKB 3HLAA 1OOAA 1ETZA 2F5AH 1AQDB 3NTCL 1JF6A 1BM3L 3OKMB 2ZXDA 4PRAA 4G43B 1AHWB 2I85A 2OAAA 3ROLB 2WLLB 1E2VA 1X5HA 2LLNA 1MJUL 4YK4C 2DLIA 2YJQA 3HC0B 2GEEA 3T2PA 4AJYV 1CYGA 2X70A 3W3BA 1TZGL 3FQTA 4IS6A 1F97A 1A7RL 1R1CA 1KJMA 2C4FT 4PS4H 1ZA3A 3RA7H 4C83A 3P2DA 1H3PL 4A1RA 4E42A 3NCBB 4WJ5B 3WTSA 4D9QD 2R23B 4Z1PA 3V9EA 2CR6A 1A7BA 3QNZA 1PPIA 2ILLA 2A99A 2W95A 4IKNA 4BFJA 3L1GA 1S7QB 3UJTL 3HLAB 3FYEB 2A0LC 3QXTA 1MFBL 2C7UB 3H9SD 1SN5A 1EJOH 2H32H 2R8SH 3F00A 4B9IA 3RDTC 1AHWA 5AW3B 3OAZK 1CD1B 3OGOE 1Q72H 4GI8A 4J4PC 3SEPA 3AZUA 3VFRA 2VDRL 1OGTA 1MRFL 1G5GA 3ATFA 3SYCA 3E6HA 1SBSL 3ZDYF 4JY6B 5EF1A 2YD5A 1G7HA 2CKBA 3GPEA 5D7IF 1BZEA 1ZKAA 3PL6B 1HH6A 4I85A 5D1ZC 1XB8A 5HVHB 4HWZA 2OJEA 1UB6B 4MTMA 4M48L 4FZEL 4WFED 2NY4D 3ZT5A 4GW4B 3QXVA 5B38A 3OB0H 1L5GB 3IFPB 1AQHA 1I1YA 4N9OB 3JTTA 4OBRA 4YQXH 3VTAA 4F7KA 2ZX8A 1TJHL 1IQWL 3VTTA 1XFPA 2K3TA 2F19L 4MJID 1QFOA 3LPFA 3DTXB 3NGBC 1KN4H 4IRJB 3HE7D 4JL1A 2TRHA 5CIPA 5HVFB 2QQNH 1JZDC 5E2TH 3RFRA 1OTUC 2CO1A 3GB7B 3PL6D 4MAYA 4BQBA 1Q1JL 2H2SD 2OXGA 3BVNB 3TWYA 1Y0LA 1VA9A 5D8JL 4YDIL 2B1HH 3ZYIA 4PJAF 1UB6A 3CSFA 4EIGB 4FEIA 1SPDA 1CXLA 3KCWA 4DVBB 2A73A 1CG9B 2ZOKB 4FI6A 1TT6A 5B38B 2YLKA 3OF6A 2BFGA 3QIWA 4RWYL 1I1YB 2HWZL 5FYJU 2BDNH 3WO3B 1MPAL 3WXWH 3GSRB 2DWXA 4ZTOH 2FD6H 2H26A 1SMDA 2V5TA 4YLQT 4ICWA 2COQA 4NHUA 3GIVA 3LDBC 4KUZL 4UT9H 4WEBH 2ZICA 2ZQKA 5GS0D 2XTJE 3DJZA 1RUMH 4LAJH 3WSQL 5LQBL 4OCMC 1BA9A 2UV3A 4XWGL 4JPIB 5CJOL 1UADC 3OBAA 3VMPA 2C9RA 2J71A 3VRJB 3MODH 3ATAA 3O4LB 1UJTA 3KL5A 1AC6A 4M6OH 3SO3C 4L0ZA 1DQDL 4R26L 2BNRD 4L3EA 2OR8A 4KRNA 4QRRD 1CG9A 2X1QA 2WTOA 3QDMB 1IMHC 4LCWB 4UOQA 4M7LH 4ZFGH 1UEYA 3L2NA 5ESVA 5DC4B 1AJ7H 4UT6A 3GSRA 1F3DH 1QBMH 2WQ8A 3F62A 1P1ZB 1MJJA 1PVHA 4PP1D 3N43F 3FQUB 5CEZE 4XPHH 4KV5E 1QLEH 5D1QA 4BK8A 3OJ2C 3PWJB 5IP4A 4XXCA 1E6JH 1Y6MR 1FV1A 2HH0L 4X9BA 3WGUB 3LKNA 3O6ML 1SGKA 4TNVF 3UTTA 4NAMA 4Q89A 3V0IA 4PJEE 1CXIA 4TNWK 3N85L 3REVB 3BVTA 3ORJA 5I74B 3PWVA 3LZFL 2IQAA 5IMOB 5EO9B 3FUFA 1RH8A 1CZ8H 1U8QA 4U0QB 3CFBA 2H1PL 3KJ4B 5HYSG 2MWCA 1V54B 1L3WA 1C5DB 3K3QA 4HS6B 1AD9B 2XVBA 4JM4L 4QHMA 2VC2B 2YA1A 4YAQB 1EZVX 4GQRA 4M29A 1PZUB 1N19A 2JQAA 4G6MH 5BRQA 1TJMA 2OMUA 4ONHA 3I6KA 1J1XH 1J8HE 2W9DH 2XQYK 3BI9X 2EH7L 4PHZA 4O00A 3V79C 3OAWA 3UTTB 3NIFE 3DETD 5D9SA 2VW6A 4K5PA 5E6ZA 4MS8D 5DUMH 2ZX7A 2H6PA 2ARJQ 4OCRH 1GCFA 1AO7D 5KVEE 3LZPA 3TO4A 4LPTA 2IQAB 1XSIA 3MGTB 5GISL 3CLEL 3OSVA 3VG0H 1HXYB 1JNLH 4B9JA 1G0DA 3BDBA 4KMTL 5JIKA 3HTLX 1AD9A 3JSSA 2YLHA 3L3OA 3E8UL 3P9MB 1WTLA 3MXWL 2I60H 4FTVE 1MW2A 4F1ZA 1QHPA 3D4YA 1CF8L 4AMWA 2ZJSL 2O6FA 3DC0A 1MZZA 1CFSA 4J28A 1W2KT 2R29A 4XXDA 3AMKA 1BF2A 2JH2A 3IGKA 4F20A 2DN7A 3P9LB 1MCJA 4JFFA 1H3WM 1I1CA 4HWBL 2BSDA 1LGVA 2VDQB 3G5VB 4NLAA 1D2PA 5EUOA 5JXAL 4RGNC 3WIHH 3MRBA 4LL4A 4S1QH 4XPAH 2OX5B 4YO0A 3UIYA 1PBYA 1MHHA 5D4IA 4JBSA 4OQTL 1XGPB 5GGRB 5FA4A 4HXAL 2XTLA 1F1AA 4QWWD 1YY8A 3VMOA 2D3LA 2L8AA 1IGYA 4RZCB 2B59B 4HWBA 4ELKA 4WSGA 1E0OB 1HKFA 2YHGA 1MJ8L 4GSDH 4ZX5A 3O6FB 5I8KL 3ZZSA 2ZAHA 1YJDL 4MJIB 3VFUA 2V9UA 3KPSE 3HE7B 1PIFA 4DOHE 3TH2T 4KZ0A 3CAFA 1DQKA 3C6LD 5T5FL 2HP4A 1CUOA 3BKCH 2EXWC 4XCFH 5H4YA 5KN5B 2IC2A 1QWUA 2NY4B 4UILL 1H6FA 5KSBF 2X05A 3T4AC 4YHZL 1TCMA 3GSVA 5K9KB 4FN0A 5EU6D 4MAZA 1NC2D 3V0WL 2B20A 4NFBA 2I9LA 3GBLA 2B59A 4ELKB 5JUEL 2MCG1 2E3VA 2ITEA 3FFCB 3GZQA 4ZXBA 1KG0A 3DWTA 2AW2A 2VN4A 1ZDQA 2H3NB 3B9DA 3TBWA 2QADB 3MLSL 1XH3A 1N10A 3PPSA 4JDVA 4I1NB 3HE7A 5A3IC 1RURH 1XIWD 4IBZA 3TVMA 1O7VA 2X3BA 4XVUD 7PCYA 4PRBA 2BNUA 2K1MA 2Y6SD 3ARBC 1AZUA 3QRGH 2Y7NA 4XVOA 4KTDH 4PJDE 4GSRA 3RKDD 3NBNA 2Q2EB 3VD3A 4M61B 4DP9X 3CFCH 4OGXH 4NQDA 3FTVA 4U6YA 3BZEA 1NCNA 5ETUA 3GMQB 1KFAH 4MJ6A 3RWEA 5E5LA 4DP8X 2W8CA 3EYSH 3L1OL 1FFPB 4X7SH 3A21A 2D03H 1OE3A 2QHRH 5D6CA 1YPZA 4MRCA 4IMKA 1QNZH 3KGSA 3MGOA 4N2FA 4V1DE 2AERT 3CHOA 5FCSH 4XMXA 1AXTH 2WZ0A 4G6JH 4NO0A 2PKDA 1K4DA 1QRNA 2M8XA 4U1HB 4ZQKA 2DWDA 1QFHA 4BFKA 1VCBC 4L4VA 4KJWD 5CLXA 1U8IB 5I6NA 2DEXX 3DX3A 1D9KC 1KIPB 3ARFC 3QJRB 4GQZA 5FK9A 2AV1B 3F6LA 1O5PA 5C7XH 2GSGA 4XHQA 1FYTD 2VDQH 4DKFH 3IYLW 3PGCB 2JLLA 2BVEA 1IGML 3D7PA 3L1OH 4LRIA 4O02B 2G0LA 4PRPE 2CIIB 1HS6A 3C6SA 1GZPA 3RWEB 4AEHH 4ADGA 2XZQH 4GINA 4YDVA 1LEIB 2ADGB 3MAWA 4TQEL 4FQCH 1LO4H 1RJZA 2X7LA 1BSIA 1KOAA 4Z0BL 4BSWA 2NLJA 1LDPL 1E65A 2L7UA 3WTXA 1ACYL 3MGOB 1BPLB 1YLBB 1I4FA 4LGSB 2VB5A 1NGQL 2CALA 3RX9A 3WKYA 4R7NB 2JFCA 2X09A 2LHAA 4ELDA 3VXOB 5E6YA 2VN3A 4KO5A 2LAGB 4HIIB 3KPTA 1KMGA 2QADD 4E0RA 2QEJA 2VSMB 3X1EA 5INDA 4E41E 3LN9A 2E0PA 2V4LA 2WXQA 4BZ1A 4OZIB 2P5EE 1QR1B 3T3MB 5EZJA 1UACH 2P9RA 4LT7A 1Q9KA 2IPUK 2HAZA 4NZFA 2X89A 4L9DA 3VXMB 1UFUA 2ICCA 3BESR 3KWWA 4IRJC 1C5BL 5GS0C 5KYUB 3ETBF 1J1PH 5F9WB 4U6VL 1EWHA 2NY7H 3EOBB 1BVNP 1O6VA 4LHJB 4XBPB 3TXAA 3ZE1B 2NLJB 3ES6A 1KZQA 4GW5A 4PG2A 4C4BA 4R5VA 2ZOLA 3SKNA 2WUBH 2FDBP 1RV6X 1IE5A 4CUCA 4HCFA 2V2TA 2N7AA 1YRKA 3QG7L 1QVOA 4NKMB 4RFOL 4EVNA 2BNQB 3MRIA 3WUZA 2VDKB 2VQ4A 1IGFH 4JPWH 1E30A 2NZIA 5E2VL 4G42B 4JFHE 3MUJA 3RY6A 5D5MF 5EIIA 1DP0A 4FKKA 4PJDF 4RIRB 3V6ZA 5DDHA 5ISZD 1MUJA 2A6IA 2NSXA 5E99L 2VLKE 4BZYA 4V33A 2ZG1A 1D5IH 5FM8A 4M8UA 5E1AA 1OZUA 5CN2A 2K8QA 12E8H 1NCCL 2C9PA 1U8LA 3JQOB 4BE5A 2LLLA 2LQRA 4AEFA 3EOBA 3GGWB 2MNWA 4KK5C 4EN3D 5EEZA 3MI6A 5KSVA 4HKJA 1XB3A 4K3GA 4RBPH 3LXAA 3FU0A 4PJAE 3NJGA 3PGFL 1M05A 4DAGH 3B5GA 2Y7MA 3B9KB 4QRPD 4Z5RB 2L7EA 2OSXA 3EHBB 1E28B 3CHRA 4WDIB 3LQMA 1XDTT 2H41A 3IDXH 3QCVL 3H42L 1TO5A 3HC4H 1IGTA 5HXMA 5DLML 4MNHB 4H2CA 4DESA 4X4XA 2CXKA 2OA9A 2D8KA 3O3DA 5D7LE 2Z31C 1PDKA 5T1LD 2GJZB 2PYFA 2ZOOA 3ARSA 1B9ZA 3GNML 3G5YA 4Z7VA 3QXAB 4NP4L 2ZCLL 5I23A 2HSIA 1TTRA 4YMPA 5K59F 2VXUL 4OFYD 3G6JB 3GZPA 2WQSA 1YEJH 3LH8A 3IE4A 5F96H 4D0BB 4GB9A 1EV2E 1UJ3A 5EU5B 1WISA 2MCAA 2ZSWA 4RWHA 5D55A 2KDGA 5H2BB 1O7DE 4HEPA 3UCQA 3DX8B 2ZUTA 2EE9A 3QP3A 5IJKA 1UUSA 4NM8L 5EV7A 5GGSB 5I74C 2J55A 1CFVL 2BOCB 1WIUA 3HN8A 4IM8A 1WBXB 1HL5A 4I9WD 1RULL 1N5AB 4PRAB 5HY9B 3EGSB 2I7SA 3ESPA 3FN0H 1PFCA 3M07A 3C8HA 5DFTA 1WG3A 3D2UB 4FC3E 2GJ6B 3AXLA 4KY1H 2JIXD 3RY5A 3IDJB 2YOCA 3IXAB 4WY7H 2EECA 3QGVA 5JHMA 1GS8A 4HFWA 4PVBA 2V5YA 3MRCA 5I1IL 1UYWL 4RFNB 3A4FA 2I9TB 3TCXA 5CFHA 4Q0XH 3UG3A 3HE7C 1S46A 1KCVH 2DTSA 4QWWC 4CRPA 4ZX6A 1M9WA 4M6NL 3RYMA 3S35L 5INCB 5DZPA 1T2JA 4MD5A 1ODAA 5AAMA 4P48A 3SE6A 1HL4A 4CADA 1KXTA 5ID1B 1M2OA 1N5YL 4M56A 4P07A 1ZGLA 2HFEA 4M7LT 1GC1L 5KJRH 3L7FB 3GRWA 4LNVA 1M7IB 2DMBA 3CMOH 4XPHL 4F57H 2FYYA 2HT2D 1OGTB 4OR1A 1MIEH 4KJWC 1MVFA 4JY6A 4EUPG 1BYOA 3F7PC 4QXUH 1ZHBB 2DTMH 1SEBB 1FPTH 5GRJH 5DD6A 1FWXA 2BHUA 4Y16A 3PL6A 1AZVA 4B9YA 3CZKA 5KTEH 3B1TA 5FUOH 1MCEA 5I24A 4PREA 4ZOCA 2R2HB 2X53A 4XE0A 1P7QB 3H3PH 4PQXA 5I16A 2XKSA 3K72B 4JQIL 3IMWA 3MRRA 4NWTL 4S10A 4M6OL 1EJ6A 2X4PB 1B0RA 2EDBA 2X6AA 3Q06A 1T66D 3FPXA 4RGNB 3HN3A 5ANMA 1OCRB 3MROB 1PFOA 5IVZB 3AU0A 3TO2A 1PU0A 4XVSH 1PMYA 4IKJA 1RUML 2XJLA 2ZKHH 4NZUH 2NDFA 2WMPB 4R90L 4WGKA 5ALBH 3OG6B 5EEVA 1PD1A 5HHME 3UBFA 2NT1A 4YIQA 1KCUL 2VR7A 2X12A 3BDYL 5HYJD 2ATKB 2ZWSA 1ADQA 3L5XL 2AJVH 4YC2C 1DQQB 1MI5B 3ZQWA 2VLJD 3AABA 3HNSH 5J0BA 3GIZL 5JYLA 3UTTE 4G7SB 2R2HA 4NZRL 4GSXA 5D7HA 3FB6A 1HT6A 2A9AA 4NYLB 2Q76A 2W0PA 3ARFA 4HJTA 2J25A 5AB1A 4D2NA 4JS7A 3MBXH 4G5ZH 4NDMA 2YIHA 4UT7L 3ULUL 3COOA 4JFWA 4XR8C 4KC3B 4GRMB 4JQVC 1AOHA 4BZ2L 3P73A 4YHMH 5TQ2H 3NSDA 1RQ5A 2WGXA 3G6AB 1FH2A 1MIMH 4QXVA 5I30H 1NLBL 1XZWA 1N59A 3D25A 5I82A 3GT6A 3KEHA 5D7JD 1FRGL 4YIQB 1GOGA 1EEZB 2QSCH 3FU7B 2O5YH 3HZKB 4JJHA 4NKOA 5T1DL 4J39A 3CGTA 3MNDA 4IGBA 5CZXD 2F1BA 2D2OA 1FN4A 2YZ8A 1M4KA 3GUTB 4PY7A 2Q9OA 3N41B 3BKJH 3IU3B 1T1XB 2DV6A 2O72A 1EX0A 4IRZL 3HHSA 4FYQA 1P4LB 2BP0A 5HTSA 4KITB 5ESVB 1OGAB 1J87A 4LSUH 1M3IA 2J4WL 4AC4A 2WUCL 1RHHB 4WTWA 1TITA 1FYHB 4ZS7H 1MLCA 1RAMA 4OY9A 3UYRH 4I13B 1BMZA 3ULUF 1XX9C 2RA1A 1MCRA 4YDLC 1JVOA 5FV2A 5KBDA 5GRVL 3NJVA 3SODB 2CDFB 5FCUL 5CU9A 5C6WH 3D39D 4G8EA 3DKHA 3M88A 2DJMA 1UOWA 1GHFH 1QG3A 1SBBA 1EZLA 1SQMA 4NHCH 2EE3A 2WZPD 5TFSL 3WAJA 2GUOA 4XNYH 5EORH 4F7MB 5D1XE 1F1GA 3FQ1A 4P4KC 4PJ9C 5DK0A 4I7ZC 5LBSL 2Q8BH 1T1ZA 1ET8A 3UJIH 2J1WA 4IOIA 3VWJA 1YNTB 3VG0L 1NMBL 4X9GA 2KDYA 1AO7B 5TDPA 3K6SB 1DBAL 3CXDL 3FU9A 4LEEA 2LFGA 4G2AA 2FR4A 4N85A 3QQ3B 3MNVB 1BVZA 1O9ZA 4HPYH 2WVTA 4G9FE 4JFOA 5DWPA 5JPNA 4ZDHA 2CDFA 2DD8L 1X5YA 1NGXB 4PJEF 3ZY7A 4QXGL 2R1WA 2VZTA 1TJXA 4OFYA 4PWJA 3LRMA 4U1GC 3QS2A 3AS3A 2H6PB 3HEIB 5C0JB 2XTSA 1Q9OA 1RCYA 4P2OD 4YXKH 4QT5A 5F9JB 1MHEA 3Q6GH 3ETSA 5I19L 4HGWB 3QJVB 4C8XA 2YKLH 2FX8H 3RZWA 2WN3A 3FQRA 2JI2A 1QZNA 1K4CA 5AYQA 4L8BA 2E6JA 1AO7A 3PIQA 4P0DA 5K9QI 2WKLA 1DFBL 3RVUC 4LL1A 2Z31B 4AGPA 4F92B 3RB7A 1DQML 4EZJA 4IHOB 1IKFH 2VERA 3CH8A 5F9WC 2WTRB 2EKSA 3GIZH 3PY9A 3HRZB 1QEWA 4RDQF 5CLYA 1OAXL 3K91A 1A0QH 2XXCB 3WLBA 3VXUE 1UXWA 3P3TA 4G7VL 4ENZA 1R3KB 3LIZH 3QDHA 2P24A 1HAWA 4F33B 3SPVB 3WY3A 3GHEH 3QORC 4NN7B 2O26U 5G4MA 3EKCA 4KFMA 3S4SG 2ZKHL 2Y5TB 2YGPA 3M7FB 2ZUQC 5IG7B 5DQ9B 5AW5B 3SKMA 3EO1A 4PJ8A 4AMKL 5I71C 4WFFD 2DQJL 1F3JB 2IBBA 1XGTA 2NW2A 4R7LA 1NCIA 4RZCA 3WNMA 2MSPA 5KVGH 5E8PA 1KB3A 2CJTA 2N01B 1MRCL 1TVDA 2MTPA 5B1KA 5KOVC 3Q8FA 2WTRA 3MLPA 1II4E 5IGXL 1GAFL 3S8WA 2QKIB 4N8VG 3KMDA 3O3BA 4FZEH 2H0EA 5GRYA 2XCMC 4OV6F 3QJTB 4O9HL 2IANA 2RALA 2NZ9D 4OLXL 1S9YB 2OP4L 1TJIL 3O3AB 2CDEB 3GUFA 4AM0B 4KDTA 1I1RA 5DFAA 4HH8A 2FAUA 2Y7LA 3FZUC 5T1LB 5T5NF 2BC4A 4MZRA 5BUGA 3ABGA 4JZOA 2CKNA 4XAWH 3T3ME 1J0ZA 5KUMA 4ZTOL 2NX5E 4X5XB 3UJJH 4WW2B 5IQ9A 3ABZA 3B8SA 1JGDB 2UWEF 1UA6L 3EDJA 5AALA 2YPLE 5CZRA 3WGVB 4P46A 4PPTA 3ZIMA 1TYEB 4UYPA 3UTQB 4LL9A 5ACZA 1U4FA 4GFXA 3BWAA 2UUDH 2C4FU 1ED3B 3GO1H 3H2QA 3TVMB 1ROWA 2HT2C 4NUPA 3MRHA 5FECA 1WBYB 1TZGH 2FO4A 3QBTB 1OP4A 1PGRB 4TPRL 4RVBA 2A9MH 5KZCD 4WV1B 3BP4A 1WGOA 1RY7B 2F9BT 3DPBA 4ZAKB 5C08A 4W9ZA 4EO5A 1W9XA 3P30L 3RI5K 4ZO6A 1RJLB 2DQHL 5CZVH 2FO1A 3U7WH 4U6YB 3OKLB 4CU8A 4YSUA 1QUNB 4RMQA 5HDBB 3BZEB 1BVLB 3GMQA 1BIIA 4I48B 4MJ6B 3WKPA 1DFXA 3AS2A 3X11A 1VKXB 4N3TA 3QCUH 3N9GL 3QWOA 1S7TA 3M1CA 1DL7L 3T0EC 1MHPL 1CDCA 2AI0H 3BIBX 1I82A 5T33H 3FRPG 3UAJC 4PG2C 3TWCL 1PAZA 3GRGA 4LLYA 2V8LA 2VSCA 3QPQD 5T1KD 4K4KA 9PCYA 1SHXA 1WWWX 2YD3A 5FO7B 3MV8D 5I0XA 3FCGA 4KVPA 5LXGH 1HEJC 4XX1E 3B1UA 1UM6H 3O4LD 1CICA 4JEGB 5E4AA 1U3HB 2DWEB 2ZAGA 3FN3A 3HG4A 4J8RA 4OJAA 4G7QB 3O45B 5DMGD 4P3DB 4LQ1A 4Z7UA 4OLWL 3GLZA 1LD9B 1XGRB 2JJUA 1ES0A 1NBVL 3UO1H 5MHSE 5LGKA 4YL4A 2CJSA 3O11B 5AB9A 4N25A 4GRLC 2XWJA 3LQAH 4OCXH 5EBGA 3V95A 3VI3A 2HCZX 3WE6B 35C8H 3HZYA 2FB4H 2FL5B 4DWHA 3MRFA 4RAVA 2EDMA 4MNGB 5EU4A 2PTVA 5FO7A 4Q4IA 2E59A 2GIMA 3F2LA 1QX1A 5C0BB 1BYNA 1NC4B 1JN6A 1LMIA 3E80A 5F7EL 1ILUA 1ZHLB 2DYPA 3QJSB 4NENB 4AVHA 2BP3A 2DWEA 1G7PA 2HJFB 4ETYA 2JV6A 3ZTEA 4O2CB 1UG9A 2JTYA 2XG4B 3ZE2F 3QZPA 3CZFB 1G6VK 1F4YH 1CXHA 2I07A 4QJ4B 5KAQG 5D71H 4DP1X 2OMWB 3LRSA 3NCMA 1XGRA 1ZVYA 5EU6B 1FO0L 4PB9H 3ZL4L 4GH7B 4CJ0A 3MUUA 5KYUA 2FSDA 4QPEA 1E9QA 3LN4B 4R96A 4YOKA 1FNGA 1J5IA 4OZGF 2R29L 4KJQD 4UTBL 2VXUH 1T2XA 3TCLA 1U8MB 2CR0A 2DQEH 1K3IA 2WQUA 4WZ9A 3MRKB 2EAEA 4IBLT 4LP4A 4LSVH 4L29B 4ONGH 4LSRL 2BNQA 5ABDE 1QI4A 5IESH 4P2CG 4YSEA 1A9EA 4YVUA 2C1OA 1J9RA 3QARA 3V6ZB 4FLHA 5IEHA 3KE0A 3FQXB 1IBDA 1UWXK 3WTYA 4UOJA 3SBPA 2E74C 3NJNA 4ACPA 3R06A 4FFWD 1E4XH 2XYBA 1TVBA 3E6HB 4YHNB 3PGFH 4HZLA 1HWWA 3D0AA 3T6QC 3JZ7A 2ENYA 2YO3A 2IG2L 2UXTA 5HHPB 5I0ZA 2Z1PA 1NBVH 3QYMA 3QC5X 3PP4H 4GJTB 5IBLC 1L9TA 3BRFA 2DIJA 4QGTA 1AHMA 1ZVNA 1NGZA 3KPNB 3Q8AA 3W0WB 1FNSH 2O93L 4OLVL 3ZHNA 1M7DB 3FUKA 1G9NH 3RTQC 3U9WA 4ABVA 3AGVA 1TZIA 1JVLA 2V33A 3DO3A 4RMSA 4QUOA 3VXRB 1C7TA 3G04B 1YYML 1JZFA 4AUJA 3RTLA 2GJZA 2PYFB 2AJYL 5DVOA 1CBJA 4IRJA 1JWMB 3L3HA 5FGSA 4Z7VB 5B39B 3L45A 4E9TA 1MFNA 2D31A 4NQCD 4PCSA 4M62L 4HZLB 4YZFE 3BVNA 2OXGB 4NN5B 1KXQA 3E6FA 5JHDD 3BQUC 3WL9A 5JQ6H 4NJAL 3S5YA 5FYJH 3SYAA 2DMKA 3PUUA 3P4OB 3CFNA 3KS0J 1ET5A 5DVMA 3L4WA 3MRMA 1FIEA 2D9QB 3NDYE 4HSAC 4EDWH 2J2ZA 3UEQA 1E5UI 3QJHA 3PAZA 1JPFB 1I3UA 3RFZA 3VDBA 1ECZA 4P4KB 3WE1A 2UVEA 5E2WL 1JHKH 3RP1A 2YPKB 3ZRSA 2C9AA 2X6UA 3L3GA 4X80H 4OVUA 1H3VA 1MJ7H 2YAFA 2C3WA 3G04A 4U1KA 4WFGD 5B4MC 1Z5YD 5KAQF 4N0UA 5I73B 1MW3A 5GIRA 1E7VA 1HHHB 3L1FA 4LRNH 1DL7H 4IOSA 5DJ6B 3AT8A 2AV7B 2FRGP 2K9UA 1DO5A 2ZE0A 1DN0A 4HS8H 2IH3A 2P1YA 2P44B 3ASNB 3FB8A 4U1JA 3MRCB 2R1XB 4JVWA 1OP3K 3RY4A 1BQHB 4Y4HC 4M93B 2R69L 2VXQH 3PP3K 4ZNEE 1Z9PA 4DIXA 2NY4C 1B4JL 3IDGA 3BZ4A 3NN8A 4YXHL 1EXHA 4CC4A 5INCA 1VSCA 4YDJB 1F4XL 2UZIL 4YLCA 3EGDA 1AYOA 4HMCA 3FTWA 1CIDA 3IGLA 1MJJB 1TQBC 3CK0H 4K9EL 4PJ5B 2NZ9C 4XVTH 4OCSH 3SSGA 6CGTA 1RZFH 5E4IA 1M1XA 5C0RH 3IJ9A 1WS7A 4UV7H 4NPKA 5AYUH 3W2DL 4TUUA 4MRBA 1KGCD 4JRXE 5IB4A 3BFOA 3DXAB 1RPUA 2F7OA 1YC7A 2E46A 2APSA 2B08A 1S5HB 1NFIB 5DK2A 2BWDA 5C07A 4N0YL 1TMQA 2K7PA 4H0GA 1YJDH 5D7SH 2EACA 3SY0A 1TU2A 4X7FC 4XVJL 1TZHA 4Z7WF 5E8DL 5GGTL 5TH2A 3TVMC 1NBZB 2X4PA 2WXGA 3OZ9H 3BKYH 3PWVB 2Q86B 1MCBA 1B4TA 1A64A 1Q0EA 3ZTNH 2ADJB 3C08L 3JV5A 1H8LA 3GSNH 3MROA 3RUGF 2CK2A 5F7AA 2XWRA 4M7KH 1RSYA 1U2YA 2G75A 3NPSB 4PGBB 3ME0A 5D2LA 3HPJA 3SKOB 4R83A 5DK3A 2E8ZA 3O6FC 4M5ZL 2OMBA 1JD9A 5I1JL 1E4XL 4NUJA 1EAOA 3P02A 4ZRGA 2NY0B 5IFAH 5HHVH 2Z35B 5MEOB 3DXAA 4MAUH 1I7TA 1XEDA 1E6OH 1URIA 1MI5A 5L2KB 5EZLA 4HUWA 1YQ2A 4R3SB 2PYEB 5J1TC 3MOBH 3LH9A 4NM4L 4G8IA 5E1GA 2P8LA 4XP6H 4NYLA 3ABMB 3F7YA 3IEAA 5D93C 2QT6A 3ARFB 4G8FA 4AQ8C 1FFTB 1VB9A 4AMXA 1BF8A 5I19H 1EAPA 4L0YA 3CZGA 3MJ8B 1QA9A 2B5IB 3MV01 3LHPL 3HPJB 3HR5A 1A1OB 3X1BA 5L4JA 4WW2C 2G60H 3WJLA 5ID0B 4MWFB 4KRPC 1LQSR 2VRKA 3UGUA 4JZNA 4UINH 2F53D 3ARXA 1OGAD 4O2EB 1DJYA 1PNDA 1VJSA 3Q44A 2NR6A 1JPST 1F42A 4G6FD 4IGBB 3NEXA 4Y5VB 2EYTA 2PYEA 2F8XC 4G8IB 5DUPL 1T1XA 2WCPA 3U6XA 5IUSA 4JFFB 3F84A 3MUHL 4F8NA 4FP8H 1U8HA 3IMRA 1CXEA 1FGNH 4N86A 2EINB 3UJIL 3MV9A 3S96B 4NO2A 3SGEH 1EA9C 2WQRA 5F7NC 3QUZC 5FDWA 5I1AA 1HILA 2EO1A 4K71C 5ENWA 4OM1H 2P48B 2PWDA 1R47A 1QFUH 3HR5B 2YS4A 2VXVL 2DW5A 4Y4FA 5GGRY 5ABZA 3AUVA 5DD0L 4B50A 1BLIA 5CSGA 1TUPA 1IFGA 3IETB 3PUCA 4CW1A 4UB0H 3QDJE 1EMTL 3L48A 1JHLH 3V0AC 1KYUA 4GSUA 4HUVA 1GY1A 4NO3A 2YN5A 1EERB 4HUXA 2HH0H 1A4AA 4Q8BA 2IH9A 4AYBA 2ZAIA 1LNUB 1IBHA 4H44C 1OP5K 3ZZQA 3KH4A 3EJJX 1U3HD 1WS8A 4PV8B 3ZR6A 1U8HB 1IJNA 5CN3A 4TTDD 4E41A 2H0FA 3TBSB 1JNLL 4BCZA 4AYSA 4C58B 1I8KB 2OMZB 4FNTA 4L1SA 1E9PB 3AT0A 4M4RB 5D7LA 3MOQA 4X6DF 1QPPA 4QKXB 1T5XA 3E9UA 3CLWA 4E68A 5EZIH 2LR4A 3HN5A 1VACA 4MXWH 1EMTH 4XZ4A 4GBXC 4CW1B 1KCBA 1KTDB 3RGVC 1YEHH 3V5KB 2H3NA 1BW8A 3QIBB 2APFA 2OXHB 5I17A 1ZE3C 4A63A 5BMFH 3ZVVA 5D7EA 1MQKL 4GRLB 5EOCH 1CF1A 1BJ1J 1NCGA 5A6LA 2A4EA 1RMFH 3VFGH 4H25A 2V3FA 1VCAA 1Q9OB 2GY7B 2HYMA 4TPRH 2VLMD 2Y69B 1AY1H 4QT5B 4WI2A 1F90H 4OCWH 4FFZA 4FJYA 1LO5B 1S2EA 1E9PA 1G94A 3HA0A 3FZUD 4P3CL 3BLBA 1CR9L 1H0DA 1A6UH 5IT2H 3FQRB 4PSPA 4TUKL 2JWYA 4ZD3L 2AJXL 1A21A 3ILPA 1QZ1A 3W39B 1DQJA 3LEYH 1R19A 2FYVA 5D1QE 3RGVA 2ED9A 3A3YB 4GS7C 1P7BA 5D6CB 1KYOJ 3PQYA 4N2IA 4F1SA 5DYOA 3BDYH 3CFDA 3NACL 4YBLB 3KXFD 1K4DB 1RZQA 4NERA 1FGNL 3TFKC 1IGCL 1QWNA 4FOMA 4HQQL 4BZ2H 1R3KA 4ZW6A 2P24B 3KPPB 5D96C 2DZEA 3B6SA 4OLXH 4RDBA 1XVSA 3TURA 4LASH 1XCTA 3QRGL 4NI6A 4ZPTA 1HL9A 4L2LA 4X9YA 4ORGA 5DS2A 3Q8BA 4JB9H 3OJMB 4P2QB 3VNYA 1QSEE 1LK2A 2KI6A 4UDUB 3ULAB 1DQJB 1PD0A 2IWEA 2VAJA 4Y1AD 3D85B 2J5LB 5E8PB 3V55A 2L3BA 1FRGH 1A6AB 2O5ZL 4PM1A 1RUAL 2R9HC 5EA0H 3ZDYB 4Y19B 4WWKA 2ADFL 4LLWA 2VLJE 1JPGB 2OCFD 3L5WA 3U36A 4BEIA 5B3NA 4IBUA 1B6UA 1X5IA 3CCHB 3FT1A 1XEUA 2Y24A 3ZN6A 4HQQH 2FGWL 3MJ9L 2AQ1A 2B1OA 3S37X 2DBLL 4MNQD 5KYWA 3KL3A 3MBXL 4G5ZL 2HX9A 1DQLH 1XCWA 2UY7B 4ZUTA 3O2VL 2E76C 1MRDH 3OKYA 1EBPA 1ZOXA 2WYZA 3E38A 5KVFE 5ABAA 1BZ8A 2F54A 3MRNA 4FKEA 2EYSA 1EJFA 4HEME 3CV5A 1GGTA 1N67A 3B7SA 1A5FH 1RK1A 4GP5B 4QYOA 2GTWB 4I2XE 5HYQA 2WYHA 4GG6B 3ES6B 1XZ0B 3LEVH 4GW5B 4M1GL 1ODUA 4WY7L 4AI7A 4FXKA 1KEGL 2WGNB 3CVHL 4LSSH 2Z91A 2Z65C 3H9SE 4XPTH 3Q3GA 3WNIA 2FO4B 4MXVF 4PJXB 2P7TA 3M45A 4PW4A 3QC6X 4OZIF 3EH2A 3T3MF 6FABL 2CJ3A 2HX7A 2V9QA 4G6FB 3NABH 5EUOE 2ARWA 2VR3A 4AV0A 1KELH 2IPUG 3PWUA 3IVKB 3ZBMA 5F93C 4NKIH 4P2OB 4Y9EA 3HUJA 5DEZA 5DO2C 3K8MA 4ZAKD 1X7TA 3MYJB 1U91B 5GZND 4AKQA 5TK4A 1IC4H 3MRNB 3OL2A 1G0YR 5AL8A 4Z3HA 3MRLA 4A6YB 5KBKA 2AJSL 2X4RA 4KZDH 2FECL 1AHWC 3FQWA 1MFEL 2LU4A 5DJXA 1UZ8A 1TIUA 3CN2A 1YSOA 1G6RL 4WWID 2DIEA 4URTB 1E5ZA 1ND0B 5LWYH 4HBQA 1G7LA 3VDAA 3VFVA 1I7RB 2LVEA 3FSAA 4Y2DC 1DUZB 2XWEA 2Z91B 3V4PH 1J9TA 1SF3A 4YXKL 1U58A 3HE6C 2GFBA 2BSRA 3J07A 4J3WA 3V6OE 3SDAB 3O0RH 4Z3FA 6PCYA 3X1FA 1OAKL 3ZRCC 4TNGA 5K1NA 1U3HA 5IM7A 4ZFFA 1CE6A 2AJXH 4P2OA 3GSXA 3ZL1A 3HC4L 3MPCA 5KVEL 2ERJB 3DHJA 4XP4L 4MMXB 4JQVA 4GP8B 4QHKI 2EP6A 1KWKA 1QLEB 2ITCB 2FH6A 2G2NA 3EAKA 3EO9L 1TO4A 3N43B 4OF3A 1UCTA 5DJXB 3L8QA 4LEXL 5EIQA 1JGEA 3G6JA 5FHBH 4OV5B 2LVCA 2WYTA 1I7RA 3BD5A 3ERXA 2ZWNA 1NEUA 1OB0A 4PWGA 1SXSA 2BHFA 5JW3H 3BGFC 1NL0L 2IALA 2BINA 2KLSA 2V5RA 3VVVA 4BQ8A 1S8DB 3U46B 2VDPL 4YDKL 2R4SH 3GXDA 4JFSA 5HGHA 3OLEA 1OAYH 3QI9C 5EO0A 2NQCA 3MLWL 4LPCA 1TQVA 4NQEE 1QSED 5FOJA 1XH2A 1KCSH 5E9AA 1DJGA 4E9XA 1FSKB 2AZAA 1ZAGA 1O5DT 4UMGA 1O6TA 1FFNA 3EJRA 2NT0A 1DVFB 4M7JH 5EN3A 2Y1YA 4UANA 4B9GA 2HT3C 2LOEA 1T5KA 3EGSA 1HCVA 3BWUF 2VE6A 2Y3NA 4LRIC 2WBJA 3BKMH 1P4BH 1MWOA 3N04A 1LE5B 4GG8A 4YDLB 1C8PA 1SEQH 2WXNA 5GJTH 4B60A 1NLBH 3IDJA 3IXAA 3QFJB