2CALA

Crystal structure of his143met rusticyanin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
LDTTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGMAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RUSTICYANIN
publication title Atomic Resolution Crystal Structures, Exafs, and Quantum Chemical Studies of Rusticyanin and its Two Mutants Provide Insight Into its Unusual Properties.
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
molecule tags Electron transport
total genus 32
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2calA00
1OV8A 3CZUB 2DY2A 4DPBX 2IDFA 1PLAA 4BXVA 3MBWB 2BWDA 2VM4A 2XV3A 1JZFA 2BW5A 4N4YB 3SBRA 3UAAA 2B08A 4NAJA 3EHBB 3ZDWA 4GXFA 3NSFA 4DP9X 1J9TA 5B3SB 2I7OA 2JXMA 3KW7A 2P80D 4E9VA 5I6MA 1GY1A 4JHVA 1KYAA 4DPAX 2HX9A 2I85A 3UACA 1ASQA 1BXAA 1SJMA 1SNRA 1W6LA 3PLYA 2IDQA 2PPCA 3DIVA 4HALA 4W9ZA 1JXGA 1PMYA 1W6WA 1XMEB 4M4RB 3S3BB 1TEGA 4BWUA 4HCGA 3X1FA 1A4AA 4YSSA 5B7MA 3BQVA 1E5YA 1GS6X 1HFUA 1RZQA 2PP7A 3HB3B 5ANHA 1IC0A 9PCYA 4HIPA 4F7KA 5F7AA 2XLLA 4Q8BA 5PAZA 1JZEA 2BP8A 4L0PB 2QPDB 1WAEA 1ZDQA 2GC4C 1A4CA 2YAFA 4A66A 1ILSA 5D4IA 5B1BB 1GW0A 2MRYA 1OCRB 4BDVA 1A4BA 2FT6A 2H5UA 2Q5BA 3NJMA 2PPEA 3FU8A 4N8UA 3NJGA 4F2FA 3QJRB 4WTQA 2VMJA 1A8ZA 1OCCB 1AS6A 2AANA 1PNCA 3KW8A 3HEIB 3FPXA 2IWKA 4CSPA 2PP9A 2BP8B 3NJFA 4GP8B 4YSQA 3FYIB 1CURA 2YAPA 5PCYA 4A2FA 3S8FB 1AS8A 1DYZA 1L9QA 1XB8A 3QJVB 4BDVB 2AZAA 4DP6X 2BP0A 4DP1X 1J9QA 4GP5B 3FQ1A 4M3HA 2VSKB 2AVFA 4F2EA 1TEFA 1NIDA 1BYOA 4G70B 1OE3A 1PAZA 1NICA 3PAUA 3UADA 1V55B 1PNDA 2HRGA 1JZIA 3IBOA 2BZCA 3FQYA 3QJUB 2H47C 1M9WA 3WNJA 6PCYA 4YVUA 1FWXA 2VW7A 1RCYA 2XXFA 2CUAA 2XWZA 2AFNA 4G7QB 2J57A 2BP0B 3OQRA 1JERA 5B1AB 2VSMB 3H4HA 3RYMA 1KV7A 1KDIA 1SF3A 1EHKB 3IEAA 3EH5B 5TK4A 4BWWA 2TSBA 1SHWA 2Y1AA 3ZIYA 2A3TA 1KBVA 2ZOOA 5E9NA 2GI0A 1NINA 2FTAA 1L9PA 2IAAC 4CSZA 1N68A 4GYBA 5B7EA 1BEXA 1B3IA 4MFHA 4DP8X 2EIJB 2FT7A 4G71B 3EH4B 5EHFA 5B1KA 2FWLB 4P5RA 2YAEA 1KGYE 2HLEB 4YSCA 2VW4A 2EIKB 1RZPA 3NP4A 3ZX1A 3ABKB 1MG2C 1KDJA 2PP8A 3OD3A 4E9RA 5A7EA 3FPYA 1OCOB 1CC3A 1PCSA 2EILB 3T6VA 1ET8A 2LLNA 1HAWA 4P5SA 4QKTA 3DTUB 1W8EA 2XVBA 2CBPA 1WS7A 4AI7A 3GXUB 2HX7A 2YAOA 1L9SA 2W8CA 4FAAB 2XU9A 3ZBMA 2YXVA 2VM3A 4KOBA 2ZXWB 7PCYA 3ABGA 3T71A 4YSEA 1AZRA 3AG3B 3OM3B 2VN3A 4G7RB 3ASNB 2J5WA 1YLBB 1IKOP 2W88A 5D4JA 5I6OA 2BWIA 2HXAA 1GR7A 4GY4A 5I6PA 1JXDA 1OF0A 2I7SA 2ZWNA 1JZGA 1J5DA 1SHXA 2FQGA 1OOWA 2WO2B 3FQ2A 3H56A 2B3IA 1JZJA 4AX3A 1L9TA 4HZ1A 1GSKA 4KO9A 2XX1A 2JFCA 4YSAA 1X9UA 1N70A 1EZLA 4YSRA 1MDAA 1XB3A 3TA4D 1NWOA 3WNIA 3C75A 4G7SB 1IUZA 3X1BA 1BXUA 1ID2A 4Q89A 4A2DA 1AZBA 2GSMB 1I53A 2HZHA 5F7BA 3T9WA 1AAJA 2VW6A 3NSYA 4ZK8A 3UABA 4A67A 1X9RA 4E9WA 4W1TA 4PCYA 4E9YA 1WA2X 1PLCA 2NRDA 3G5WA 1AG6A 2DV6A 3GDCA 3PAVA 1SF5A 4BXSV 5I6LA 2XX0A 4K9JA 3U25A 3QPKA 4YVNA 3QJSB 2PPFA 2DWTA 8PAZA 1WA0X 2N0MA 1L9OA 2HRHA 2UX7A 4PAZA 1PZAA 3NSDA 3PXLA 4NERA 5TK2A 1AIZA 3FS9A 1PY0A 2GHZA 4KO7A 1PZBA 4BWTA 1NDTA 1NTDA 2X88A 4AKQA 5I6KA 6PAZA 3T6XA 1NIEA 4A68A 1AANA 1ZIAA 2RACA 3AG1B 3TBBA 2CCWA 2QPEB 1MZYA 3FSZA 1AOZA 2UXVA 2DWSA 5AKRA 1SFHA 3T6WA 3AZUA 1JXFA 2XV2A 3WG7B 2JKWA 5IY5B 2FJSA 2DYSB 2QDWA 4G72B 2FQFA 1BYPA 2XYBA 2UXTA 3X1NA 1ZV2A 3EH3B 3FT0A 1CUOA 3MX0B 2FQEA 2IH9A 1ET5A 1AS7A 1XB6A 4YSTA 1OE2A 2J55A 1ADWA 1IBZA 2FNWA 2OJ1A 2P80A 3N2JA 1ILUA 3ABLB 3D12B 4EF3A 3QQXA 2IH8A 1HAUA 4AZUA 4E9TA 2BO0A 4HHWA 4DP7X 1GS8A 2IWFA 5I5MA 1ZIBA 2BW4A 3NYKA 3WKQA 5I5IA 2YAHA 2GIMA 2FQDA 3OMNB 1AZCA 1A3ZA 2R7EA 2YAQA 1E30A 4YSDA 1ASOA 1ETJA 3JTBA 4DPCX 2FT8A 3ERXA 1J5CA 4TXVB 1UATA 1JOIA 2IDSA 4JKNA 3SQRA 1F56A 1KBWA 2MTAA 1AG0A 1CYXA 1PZCA 4RH4A 3WKPA 2R7EB 1NIAA 1L9RA 3V9CA 1AZUA 4HAKA 4E9SA 2BZ7A 1GYCA 4HHGA 4YSOA 3NJHA 3CVBA 3EF4A 3FYEB 2YAMA 4KNUA 3AG2B 2OV0A 1BXVA 4UANA 1KCWA 2YQBA 1M56B 1J9SA 4DP5X 2X87A 3NJIA 4HCIA 5B1JC 3UGEA 3NJNA 2CJ3A 3SBPA 4KO5A 2QDVA 2AZUA 3WIAA 2EIMB 2PCFA 5B7FA 3SBQA 3CVCA 3AW5A 4DP4X 1VLXA 2CALA 4WKXA 3X2QB 3FU9A 2OCCB 1MZZA 4AKPA 4GP4B 1PLBA 3NSCA 1AQ8A 2TSAA 1AZNA 3GYRA 1T5KA 3N55A 4YSUA 4QLWA 1NPNA 1R1CA 1SFDA 1WA1X 2CAKA 2XXGA 5FC9A 2WSDA 3V9EA 1URIA 1BQ5A 3IN2A 1V54B 1V10A 2IDUA 2PCYA 4KOCA 1E65A 2XV0A 3NJKA 1FA4A 1SDDA 1GS7A 3FSWA 3IN0A 3PPSA 1DZ0A 1JVOA 4YL4A 1E5ZA 4FA7B 2YARA 3S3DB 2ZONA 1OCZB 4DP0X 3AY2A 4JHUA 1NIBA 3FSAA 2H3XC 1ASPA 3JT2A 2Q9OA 3L45A 1NWPA 3CDZA 3X1GA 3CG8A 2YXWA 5B1JA 4AKOA 1KCBA 1RKRA 3TBCA 1SDDB 3S3CB 1TU2A 2QT6A 1M57B 2UXFA 5I6NA 2DYRB 4DP2X 2EINB 1MG3C 2UXGA 3FU7A 5D4HA 3QJTB 3CDZB 4A2EA 3DKHA 5I28A 5I26A 3QJQB 1WS8A 2PLTA 3NT0A 4HCFA 2Y69B 2BHFA 2WO3B 3S8GB 1OE1A 3UAEA 3WI9A 1QHQA 3FU7B 1A65A 2GB2A 3NJLA 4NB7A 1JVLA 2E86A 2HX8A 3ABMB 3BVDB 3ASOB 2J56A 3T6ZA 3TASA 1CYWA 1NPJA 2GC7C 4KNTA 1AACA 4KO6A 2PPAA 1PF3A 3PAZA 3OMIB 3PCYA 1BQRA 4A2GA 5AFAA 1GY2A 5I5JA 2PPDA 3OMAB 4E9QA 1J9RA 4UF7C 1QNIA 4BK5C 1ZDSA 1TKWA 2UX6A 3TU6A 1ET7A 5AZUA 4KNSA 2IWEA 1NZRA 2IDTA 4YSPA 1NIFA 4E9XA 4A2HA 3IE9A 2XUWA 5LDUA 1FFTB 3AG4B 3H4FA 1E67A 1ZPUA 7PAZA 3FSVA 1AR1B 1BQKA 3NJJA 3NP3A 1QLEB 2GBAA 1BAWA 4UAHA 1JZHA 4X4KA 1IBYA 4ENZA 3CVDA 3X1EA
chains in the Genus database with same CATH superfamily
4JRYE 3CVHH 3LV3B 4JLRB 4YHPB 3UYPB 1MWOA 4FQXD 4X8XA 3RWIB 1QW8A 4MZRA 4GG6F 3T8VA 3K5RA 5TDOB 2VKWA 2R51A 3NH7L 5JYMA 4NRYA 1J05A 2RFXA 2V7NB 1Z3GH 4LSUL 1YMMA 2BNRD 5D1ZB 3U6RB 2DL2A 3EHBB 4OJEH 5DRZA 1BPLB 2KDGA 4UB0H 5AWNL 2HTLD 3GMNA 1U8OA 4NQSA 1KEGL 4DKFL 3N5AA 3DPDA 4B9CA 1JN6A 1HCFX 1GY1A 3NFSH 4BKLA 3H9SA 4NRYB 1BXAA 1J05B 2RFXB 1YMMB 5KS9F 3PL6C 2ZXQA 4P4KD 2XNAA 1KOAA 5AOMA 2RAMA 1EZSA 5DRZB 1QPXA 4UWQB 4P04A 4AJYV 4PRHA 4FABH 4LP5A 2NDFA 1KN4L 1U8OB 3GMNB 5ISZE 4NQSB 1G1KA 4YBHA 4KKBC 1IC0A 4BKLB 4N5EC 1OPGL 4XVTH 3ILPA 3H9SB 5AYUH 1XZ0B 3TO4A 1JZEA 2DQDL 5F1NA 2LW3A 2XNAB 4Q52A 4W93A 4QRPD 1URLA 3MBEC 4PRHB 3K8MA 4A66A 4D3CH 3NCMA 4PJDF 1MJJA 1I1FA 2QZQA 3PFUA 4GAJH 2F1EA 3ILPB 5FS5A 3TO4B 1LDPL 2H2PC 5F1NB 3EH2A 3P54A 4Z3FA 5F7LB 1H3UA 1MJJB 1I1FB 2VSCA 1ECYA 4UTBH 2BVOA 1HTYA 4M3HA 4UM8B 1LVEA 1XDTT 4G70B 5IFHL 3U36A 4Z7UE 4GG8A 1NBQA 3IMSA 1GGBL 3BSZH 2YUWA 1N4XL 2XWZA 5H2BB 3JV0A 2BVOB 3STZA 1BVNT 4J23A 2ED9A 2HFEA 3CHXA 3DA0A 3EYUH 4GRWF 4Y19A 2NCMA 4OF3A 5CEYA 2J6EL 4TNEA 3LSOA 1N6VA 2A3TA 2Y7MA 4G5AA 4GG8B 3KGTA 4W4OC 2ITDB 2ERJC 1TZAA 5KVGE 4XI5C 3BIAX 4K7PH 4P5TC 3STZB 1I1RA 2MOQA 3G6JE 2BINA 3GIVA 2HFEB 4Y19B 4Z7QF 5I15L 5CEYB 5DHEA 3VG0H 1MIEH 3LSOB 4UT6H 1KLGA 2WLLA 4CN1A 3LEYL 1TSHA 4O51A 2CRYA 5K9QI 3KM1A 5KVMC 5HHMB 1U92A 3AREA 3VSQA 3L4CA 4OF0A 3GIVB 1OCOB 3IWUA 5LGJA 1M42A 4YH6A 1A47A 4KRPD 4M93C 1IAMA 2AK1H 3NABH 5EOQL 4UQ3A 1A1NA 2Q3ZA 1KLGB 2WLLB 2YAOA 4O51B 1MNNA 1G1YA 5ECJE 2HYMA 4JR9L 2V5MA 1U92B 3AREB 3CX5J 4KOBA 4M1GL 4UQEA 3Q6GH 1YAZA 3O0LA 5E23A 1MFDL 4M4PA 3WD5H 4JRYA 3HS8A 5LGJB 4JDVA 4JQIA 1TZIA 4UQ3B 4WSGA 1JHLH 1A1NB 3CIQA 2FRGP 4EDWL 2V2WA 1KEMH 1ID5I 1MY7A 3FH5A 4GO6B 2MCG1 4NGHL 2QQLL 1X9LA 1LWRA 2CJSA 5EA0L 1EQWA 2YOCA 5DVOA 3ZVVA 4WKZA 3OLEA 1OF0A 3ARZA 3QDJD 3LXBA 3L2MA 3MUJA 4AGNA 1MHPH 3MGAA 3LVEA 3VXRD 4NCC2 1XGYH 2ZWNA 3BMVA 2B4CH 1AHWA 2CD0A 4JRYB 1D9KC 4JDVB 1FVDA 4YFLI 1QABA 1TZIB 4MB5A 4K94C 3H56A 2V2WB 4ZFFA 1YEKH 4J3OH 3IXTA 5HDWA 3PNRB 4HZ1A 1D6EA 5ICYA 5FOBA 4WKZB 3IS1X 1Q0XH 3EFDL 1U91A 3WDIA 1A9VA 4JPKL 4JQIH 3IFLL 5DTFA 1AHWB 5K9QG 2X05A 1MPAL 1FVDB 1QPPA 5ISZA 1ID2A 3FDWA 3EIFA 4ZFFB 3F04A 5FR3A 1CMOA 5IMLA 1YJDC 3IXTB 3US9A 1D6EB 5ICYB 3RGVD 5FOBB 1BW8A 3WFCL 1U91B 2WLYA 1CDUA 4PJHE 4A67A 1TJGH 1F00I 5DTFB 1HVXA 4P99A 1AG6A 2FHBA 1EERB 2OJZL 3DX4A 3KWXA 5ISZB 5IEKA 3U25A 3KPRD 1QAWA 1T6WA 2XTSA 5AOLA 5CINH 5DVNA 5IMLB 2FEJA 4U33A 1BM7A 4UNUA 3ZDYF 5I1JH 4LSPL 1F58H 1KXHA 5GRVL 4FDWA 4HUUA 1GC1C 4Q0XL 1NMCB 3CVIL 3GEFA 1Q1JL 2IAND 4KXBA 5TK2A 4TNWF 1M1XA 4APQA 3LDBB 5I6KA 3TEZA 5IEKB 2QQNL 2QFRA 3APCA 1F3DJ 3MBXL 3KVQA 3QUZD 4Y9FA 1EK3A 4HUUB 3MCYA 4JFPA 5EUOF 5CCJA 1AO7E 1JWSA 4Z7UA 4QOKD 4U4BA 5D2NE 4PJCE 3DDGA 1M1XB 4HUVA 3FFCD 1ML0A 4APQB 3COOA 5JW3L 3FCBA 4JHWH 4KKCD 4YIQA 3GNMH 1EUUA 5DF0A 2FH8A 5DGRA 2FJSA 4L5FL 2DLGA 3TPUA 5HVWA 2DTSA 3NCFB 2WB1A 3GRWL 3MRLA 5I19L 2IF7A 4P5KA 4JFPB 1ZA3A 3WIIL 2E47A 1JWSB 4Z7UB 3VO0A 4X5LA 4HUVB 1J88A 1Q1PA 3FF7A 3ULUD 1NUNB 32C2A 3TOPA 1JGUL 3GM8A 4YIQB 2FBJH 3L9EA 1AS7A 6FABL 1VEMA 4OGYL 3BVVA 4KZEH 2F7OA 1KTCA 3TPUB 3SDDA 3G6JA 4P59L 5KSAD 4KH9A 1BMWA 1ES0A 3MRLB 5JPMC 2NNCA 4H8WL 4K7PX 2DLIA 1J1OL 4IU2A 4P5KB 4YXKL 1ZA3B 3GBEA 3C5ZD 4P2RD 3BLKA 32C2B 5TD4A 5F21B 1L6PA 3KBHE 4NHCH 1DQQA 2K45A 2Y7QA 4NQTA 4ONFL 3N50A 3QXTA 3VGHA 3WTSA 4X7EC 2Q2LA 4DOHE 3F7VA 3SDDB 3FO0L 4DKAA 1HXYA 3G6JB 1ES0B 2A6KB 2VLLA 2VDMB 1J48A 4IU2B 2ATKA 2WIIA 4U4IA 1EJFA 3QISA 2EYRA 1NJ9A 5KVGH 1DQQB 2Y7QB 3LRSA 1TJIH 5JIKA 3F7VB 5HDBE 4FE9A 1HXYB 1HQ4A 4FQJL 3TBSB 4XMPL 1I3RA 5C0IA 2VLLB 2VDRB 1Y07A 5E5LA 2ATKB 3P2BA 5HJGA 2WIIB 4J3OF 1FZMA 3PWVA 2EYRB 1NJ9B 1PZ5A 3EF4A 1XTLA 3LRSB 1FNHA 4UANA 3OMZA 3ZHFA 2VRQA 5HI3D 4KI5D 5L2JA 3EJQA 1HQ4B 2HAZA 1I3RB 5C0IB 5SWZD 4GRMA 4PS8A 5EZIH 1RQ5A 1CGSH 1FZMB 3PWVB 4ZS7L 1GRWA 4YGVA 4X4YA 3FB8B 1PZ5B 1YAIA 1CDIA 4AK1A 3ESVF 1TZ8A 4QHPA 1BHGA 3VWJD 5AAMC 5L2JB 3GI9L 3L54A 3VD5A 3L95A 3CAFA 3LQZA 5T1DH 4GRMB 3TP4A 2NW2A 4KJWD 1NPNA 2L7UA 1G0XA 3G5XA 2R0KH 4JHAL 2AV7A 3MU3A 4JANB 4XNXH 4YGVB 4X4YB 1L7TL 5IWLA 5HVHB 1S3KH 2LHAA 2ROYA 1GGYA 3TJEL 4TL4A 1UOKA 4MHHI 1EGJL 3JYBA 1XEDA 3EJZD 4MYPA 3W82A 2IDUA 5T3ZH 3RAJH 4PJHA 3S9DB 5EU6E 3L95B 3LQZB 4FFYL 1HXMA 3Q2VA 2NW2B 4XNDA 2PR9A 5CJXA 2YR3A 4NNYA 3G5XB 1T2QL 3KH4A 2AV7B 3DSNB 2OR8A 1QATA 2GI7A 3JVGA 4UV4H 3X13A 1U8NA 4NN7C 4QWWD 1YEJH 4PJHB 1A6UL 4KGJA 4RFNC 3OV6A 1TLMA 4OD3L 3TWCL 3BN9D 1L0PA 2BSRA 3HVDA 4P4RA 1HXMB 3BPOC 2BVUA 3A67L 2UXFA 4NNYB 3GMLA 2DYRB 3TZVD 1RPKA 5DMGC 2EINB 1EUTA 1U42A 2EO7A 4YFLF 3X13B 2WYZA 3F7YA 1U8NB 4FNRA 1AO7A 3BP6A 3QK0A 4N25A 5D2NA 3MCKA 1MW3A 2BSRB 4P4RB 4PJCA 4Z7OE 2AJXL 1GYAA 4PJGE 2I27N 2QSCH 2V9UA 3O2WH 2W95A 4XN1A 3BVTA 3GMLB 3S8GB 3NCYP 2BMKA 4J8QA 4Z7UF 4KROC 2FB4L 5JQHC 5KANI 3CZEA 3F7YB 2Y06H 1QKZH 1AO7B 3BP6B 5D2NB 1I4FA 4PJCB 5CD3A 1E8XA 4MHHG 3TTSA 3H2WA 2WQSA 2J56A 3BN3B 3T6ZA 3H2PA 4BZ1L 1H15A 3L2NA 2VXSH 4LCWD 2BMKB 2AXJA 4EJ1C 1KB9K 1ZT4A 4DGIL 3VFWA 15C8H 3STLA 4MQ7A 3IFPA 4C4BA 1IVLA 5IREA 2DLFL 1QNIA 4GI6A 3HKZA 2E46A 3V8CA 3GHPA 3RB7A 1I4FB 5CD3B 1A7QH 5AVUB 3SN6N 4MAUH 4BCZA 4HDIA 3RWEA 1H15B 1RJCA 3U30B 3CC1A 4H2CA 1ZT4B 2QV2A 2CKNA 1E40A 3S36L 3VFWB 4FQIH 4JCMA 2GBAA 5FGBC 4RWHA 4MQ7B 3IFPB 1ONQA 4IIQA 4N87A 1H8LA 1EJ6A 3BDXA 4P2OA 2MKWA 3ZGIA 4E9LA 4Y5XA 3RZCA 5DFTA 1Z9SA 1HNFA 1LD9A 3FUMA 1OY3B 4HDIB 4RMTA 3RWEB 2G4EA 2XV3A 3LRMA 5I1KL 5K1JA 1P4LA 4G42A 2BW5A 4DOHB 3SBRA 5B38G 2C9UA 4IIQB 1EAPA 1ONQB 1CF1A 4P2OB 4WUUE 3RZCB 1CLOH 4Y5XB 1E7VA 3QFJB 3KVPA 4U1GB 1Z9SB 3V4PH 3CFQA 3KW7A 1LD9B 1T2JA 1TNMA 1DQVA 5DZPA 2CHWA 3V95A 5E7BA 1MCEA 2C9PA 2EUXA 1TQSA 1WICA 4F8PA 3O6FD 4R97C 5MI0C 2DMBA 2VDNB 4I0PA 1N12A 3H42L 4JPVH 5EO0A 1P4LB 2QHRH 4G42B 5HDBB 1SNRA 3V79C 3C6EA 2C1PA 4PB0H 1OTUD 1BG9A 5T1KD 1EAPB 1YEFL 4AMKH 3QCTL 1A7RH 3BAXA 5F9WC 3UJTH 1GS6X 2VDNH 1HINL 4ZNEE 3EBAA 3IBEA 4I0PB 5EO0B 4QJ3B 1FGNL 4M8RA 4WWKC 1THCA 2C1PB 3MRIA 1X3DA 4PVLA 1PY4A 4Y9BA 3FQTA 5IB4A 2NZ1A 3UAJC 1AR2A 1ZTXE 3RFRA 4E41D 3AGWA 4UBDC 1J8SA 5DD1H 3BYTA 4NM4L 4N8UA 3AABA 1ZHNA 1XSOA 2VMJA 4G5ZH 2AANA 1QLEL 4G6FB 3HEIB 4BUHA 3MRIB 5EU6A 2AK4D 3I84A 2XETA 2VDPB 1IRAY 1MREL 3FQTB 1CURA 1LYQA 2WPGA 2ZWYA 3GO1L 5IB4B 4JJ5A 3C87A 4XBPA 3VI3F 4PJHF 5E08L 4AW4A 5E56A 3MXWL 3MREA 1W91A 1ZHNB 3B9AA 4JFZH 3SDAD 5D1ZC 5EU6B 1PAZA 2NY6D 3B3IA 3H9YA 3MCLH 3TIDA 1JV5A 3PNWA 4PV8A 4HQQL 1A9BA 3QJUB 3WHXA 1IAIH 1M9WA 1TETL 4JJ5B 4R5XA 4HJGA 4XBPB 2N1KA 1N6UA 1RCYA 2EEBA 1M05A 4LSRH 3CK0H 1T04A 2CG9X 1SMOA 4HGKC 5IW6A 3MREB 1TNNA 3DGDA 4PRDA 1OSPH 2C8NA 4Y16A 4F8NA 1JPSL 3FZUC 1E2WA 1H3PH 1NMBL 3B3IB 4PJGA 4H8HA 3EH1A 1JV5B 3TIDB 4OLZH 3GBLA 3PNWB 1QWHA 4PV8B 1A9BB 3WHXB 3OZ9H 1AHKA 1PX4A 1YPZE 4I3RH 4N85A 2X9XA 4HJGB 35C8L 1M05B 4JN1L 1T04B 3RFZA 2AI0H 3LH2H 5IW6B 3P3UA 4PCTA 4PRDB 3PFQA 4IHBA 2DQEL 4UZSA 3IF1A 4Y16B 4MQTB 3FUNA 5C0JA 4FJZA 5KYUA 2UY6A 4Z7OB 4PJGB 1XF5A 4PI0A 4DPRA 4BZ2A 4CADA 4XP6L 1J8HE 4FI7A 4YDLC 3WKML 4KVNL 4R4FH 1BLNA 3RFZB 3TURA 1DQTA 4IU3B 4E9RA 4DIXA 1KIRA 3N43F 3IF1B 3QEUA 4ELDA 3MLUL 1XAKA 1ZHBA 2UY6B 3HE7A 3CSPA 5DJ8A 1XF5B 2WUCH 2YUZA 3E8UL 4CADB 1MW1A 3F8UB 3HFMH 4P2CG 1OW0A 3CFUA 4EDXA 3ARFC 4MA3A 3D2UD 4NJ9H 3ARDD 1BLNB 3BUIA 5GRJL 2K3HA 5IHLB 5C09A 4QJ4B 4U1JA 3ZO0A 4LRIC 4HLEA 1KIRB 1NM9A 3QEUB 1A6AA 3VFUA 4I3GA 2CBQA 4UYPA 1ZHBB 3AG3B 4K5NA 1QEXA 3HE7B 5TQ2H 4BZ2H 2NMSA 5DJ8B 1ACCA 2W88A 1UUSA 5F8RC 4EDXB 1MCWW 1CXLA 2J6WA 4OGXL 4MA3B 1XL6A 1R0AH 5IVXF 1NFKA 5C09B 4MMXA 2XJKA 4N22A 4WUUA 1A6AB 3VFUB 3UO1L 4TOYH 2PXYD 5LGYA 4HWBL 3BC9A 1QBLH 2N3JA 4UU9A 3V55A 2YD6A 3MUUA 1Z5YD 3CE1A 3SSGA 4ACTA 2ITCA 2MOGA 3AC0A 1X5KA 2PABA 4OUUA 4MMXB 3NQKA 4WUUB 1S7TA 1CLYH 4IBZA 3MV9D 2Q76B 3WNIA 3MRFB 1GTFA 1I8IA 5JZ7C 1X7SA 3BZFA 4ZNEA 4UU9B 2Y6SC 3ZZ1A 3BKJH 4N2IA 3O0RL 2V0AA 3KGRA 5C97A 2ITCB 4TVPD 3CZSA 4PJ5D 3T3PE 4B60A 2Z91A 2D7OA 3WIFA 1PKQE 1L0YA 3UABA 4LEOA 3S5YA 2YPLD 3KJ6H 3E9TA 1S7TB 4UM9D 1FRGL 2VDOL 2YGOA 4AW7A 5HPOA 2A9MH 2WQXA 3QPKA 3BZFB 3U1SH 4YVNA 4NSKA 2UZPA 4X5PA 3HNTL 4AE1A 1MCPL 3FK3A 3HC4H 4L1SA 1GC1L 4KJYA 2Z91B 1YYLH 3WIFB 4LEOB 4RRPA 1YHPA 2BNQD 1DBAL 1PY0A 5C0BD 5I0ZA 4Z3EA 5F1IA 4BWTA 1UXSA 4HYTB 4UZGA 3VXPA 3TEWA 4RRPG 5DD0L 3DTXA 1NC2D 3UPAA 3TESA 5AW4B 4BH7A 3AG1B 2YFNA 3ZQ9A 1P7BA 4J3OC 1PGRB 4KJYB 5C08D 1XFPA 1ZTXH 2OXHB 4M5YL 2LLLA 5F1IB 5ADPH 1UXSB 2APBA 2OA9A 4EZKA 2DMCA 4YHML 2IPUK 3VXPB 3T0DA 3CHQA 3DTXB 1NBCA 2XY2A 5DUBA 5BO1H 4X7SL 4X8GA 4BH7B 3WIHL 2EXTA 4XCCH 1P7HL 2NX5E 4W9GC 1EEYA 4P05A 5CCKH 1HZLA 5FCUL 2RMNA 3D09A 4JJOA 1YPZA 2B16A 4G6AC 3OJ2C 4DW2L 1RIVH 5MP6H 3WBDA 3O3UN 3X3GL 2QKIC 2Q7NA 5DUBB 2P80A 2KQMA 2DPKA 2YOAA 2ZCLL 4D2NA 3QQXA 4TLTA 1EEYB 1QI3A 4NO0A 5T5FH 4P2AA 2BO0A 4Y2DC 3WTYA 5MENB 1FZKA 4NS0A 1ZIBA 1J8HA 1YPZB 2GTQA 4FYRA 1MELA 4FXGA 1NEUA 3FQUA 4LFHD 4S0SD 1AZCA 1E30A 4JAMA 1ZVHA 2XPGA 3R18A 3P0VH 5C07D 1TJHH 1RPQA 5LQBL 5DMIH 4NO0B 3QQ9D 3NCYS 3CHPA 4L3AA 3CZLA 3VFRA 3U4BL 2H8PA 1J8HB 5I1IL 4N8CL 3Q2NA 2HRPH 4FXGB 4MA8L 1NFIA 3FQUB 5IB3A 1I31A 4J12A 1FH2A 4KK9D 1KCLA 3F12A 1L9RA 4JAMB 4K5PA 2C4XA 2XPGB 5J6SA 2LU7A 4BQ8A 1UYWH 4H5SA 1M2OA 4DEPB 4Z7NB 3DECA 1CICA 1T5XA 2XZAL 4N0YH 4YX2H 5A2BA 4OZHE 3VFRB 2H8PB 2CK0L 2X5PA 1NFIB 4AXWA 5E2TL 5IB3B 3U4EA 1KCWA 2UZYA 4IKKA 4AYMC 2PTTA 2JV6A 4H5SB 3VXMD 3MLRH 1KJ3H 5AB1A 1CICB 1S5HA 1T5XB 4OD2A 5A6IA 2PETA 3PWPD 5E5RB 4YHYC 2WAQA 4F7EA 2RQ8A 3Q7JA 3OXSA 4M8QA 1EJ8A 3FQ4A 4AXWB 3F83A 3U4EB 1I3GH 2UZYB 1ZA6A 1QFWI 3QZOA 2PTTB 3QI9D 4GXUN 2W80C 3HTLX 4ZBJA 4I3SH 1BBDL 1S5HB 4OF7A 4OD2B 4M03A 2ZXAA 4HZAA 4KX8A 2WANA 4AZ8A 2BSTA 3PUUA 1JZ5A 4ELKA 4F7EB 4K3EH 4IBTA 2W0LA 1RMFH 2XXGA 1RUKL 4NZTH 3OXSB 4OF8A 4X7FC 4MSWA 5KN5A 1XT5A 2XQYK 4M8QB 1MCRA 1GA2A 3IN2A 3LZFL 3UIYA 1ZA6B 2CH8A 3NRPA 1ZLUK 1PKQA 2VLKD 3HUJB 1VSCA 3NJKA 5JW4R 4AYFA 4PYHA 1BWMA 1UURA 3MACL 1A02N 2EE6A 4AZ8B 2BSTB 5ADOH 4ELKB 3NTCL 3MFFA 4R7DA 4ZJ9A 4MSWB 5CZVH 3AY4A 3TT1H 5KN5B 3IGKA 4G3YH 2Y0SA 5CN1A 2JJSA 3T3PB 2Q9OA 3GLDA 3KWWA 2Z35A 3ILDA 1PKQB 3VWKD 1IEHA 1PYWA 5HI3C 2VJ0A 5JPNA 2W65A 2ZSWA 5D7IE 4AYFB 4U6XA 4IOIA 4OJDH 4G8IA 3MFFB 4UNVA 4R7DB 4XVOA 3EOTL 4FI8A 4ZX6A 3HNSL 3LQAH 3KWWB 5FAAA 2Z35B 1PYWB 5IBTL 3FSOA 3VWJC 1O75A 2W65B 2ZSWB 5JPNB 4PCSA 4IOIB 4U6XB 3OPZL 1P4IL 4G8IB 2IDCA 3N1PC 2JVUA 1T3FA 1OE1A 3QCVL 3EJYD 4OCWH 5T1LA 3AGVA 3AVEA 2NX5A 4YE4L 2BNUA 3OZKA 1TPXC 4JHZA 1U8PA 1LGVA 3SGKA 3ABMB 3MYZA 1RUPL 2JI3A 1JI1A 1KB5L 4M62L 2XIDA 1T3FB 4YFDB 2XPZA 4GO9A 5T1LB 3VFVA 1VEPA 1QFWH 4LHUG 2DYPA 5I1AA 2NX5B 4TNVF 2BNUB 2CDEA 1J9RA 2DQJL 1TKWA 2CCVA 4MVBD 2Q1EA 1Q9LA 3BAKA 5TQ0L 3LS4L 1U8PB 2NY4D 1BQUA 2C9VA 2QELA 1I85A 3GBNH 3GZOA 1JI2A 1FLRL 4XB7A 4EXKA 3ZIMA 1ND0A 4JKKA 1CCZA 2WXRA 4QXGL 1U6AH 3VFVB 4MWFA 2DYPB 4FFZA 4AVIA 4TQIA 4DHLA 5I1AB 1N5YL 2CDEB 1TKWB 2XBDA 4DPBX 1LJMA 1NQBA 1CQYA 1GGTA 1TYRA 2MQ3A 5F7WC 4HWNA 3VXSD 5CJXC 4XX5A 4BK8A 2BWDA 2ZPKH 1HDMA 1ND0B 4F91B 3IU3A 2IAMA 3MLTA 1P4BH 3VSVA 3GSRA 3DOSA 4MWFB 3B5TA 1A0QH 2J8UE 3ML8A 5C0AE 3JVGC 3D4YA 1BZEA 1IGCH 1TQTA 3WTUA 4GKNA 4M4RA 3SY0A 3O6KH 4OZHA 2ADFL 1RV6X 2ESVE 1MFCH 1UWGH 1IKFH 2CUIA 3L4ZA 1NLDH 4TUKH 3CZGA 4FI6A 1HDMB 5HBBA 2NNRA 1ICTA 3IU3B 2IAMB 2WLKA 3MLTB 5E2UL 4MBOA 5SX4I 4FFZH 3U1PA 3GSRB 5C1MB 1BPVA 1BFVH 1BFSA 1BZ8A 1P7QA 4U3HA 4PJ9D 1E6JH 4QHNA 2G5RA 4GKNB 4M4RB 5D2NC 1C5BH 2H0EA 3SY0B 2E59A 4OZHB 3RTQA 1BQHA 5B7MA 2K3TA 1RP9A 5F6HI 2VLRD 1J1XH 3ARPA 3WMSA 5FYJU 3BMWA 4MJHA 1A1MA 5F7AA 4FX5A 1P7QB 3KEDA 4TM9A 3EYVA 3E38A 3MXVH 4K8RD 4L1TA 2QPDB 2JKJA 2HN7B 4QHNB 1OARH 1NFAA 3O8XD 4HUXA 4MA7L 3GGWA 5K9JH 2BS71 1LDSA 2Z7ZA 3CQPA 3RTQB 1BQHB 4DGVH 3WY2A 3KE0A 4TSCL 2J8HA 3L1GA 3FTGA 1F90L 5GZOD 1A1MB 1RU9H 4FZ8H 3FPXA 4BUGA 2DQMA 3EYVB 2JJVA 4WVRA 2BC4A 2WZ6A 4HUXB 4MMZA 3GGWB 4FA6A 5JTWA 3QRGH 3IB4A 5E2VH 4UB0L 5I24A 3NRQA 1HCYA 4ICXA 5ETUA 1S6NA 2AV1A 1ZANH 3BP7A 2AJZA 3NFSL 3CNKA 3BWAA 4P3WA 3I50H 3GXFA 2NZ9D 1W2KT 2CR0A 5KUKA 5D7IA 2XCMC 4CBZA 1N8ZA 3FTWA 2BC4B 4P2OC 1B2YA 2AXGA 3RZCC 4MMZB 2Q2EB 1EA9C 4FABL 1JNNH 2C9XA 3IDUA 3T0EE 3TA3D 2P42B 4HJ0D 4LEXH 5ETUB 1XSJA 5I0WA 2AFNA 2EE2A 3V6OC 2AV1B 4W81A 4AEIH 1HYSC 3BP7B 1UD6A 2AJZB 4TN9A 2IFFH 1WCBA 3MJ6A 4XVTL 3BWAB 5FECA 1CI3M 5AYUL 4F9PC 3FTVA 4KUCF 5EN2A 5D7IB 5D2LF 1N8ZB 2AXGB 3ATAA 4LARH 4KAQH 2BNRE 3RGHA 2J3SA 4D3CL 4HWUA 3JWDH 5K5YA 4GAJL 3P4NA 5SX4H 2CU9A 1WCBB 1MUJA 5FECB 4P46C 3EAKA 3T3MF 5IHHA 5EN2B 3ELAT 4WTZG 2V9RA 2VABA 2X0WA 1HHHA 4MMYA 5DURD 2HLEB 3B1UA 5D9SA 4YBLB 4JDEA 5DZVA 1XBDA 3HIZA 4HFWA 2WTPA 3WFEH 5L6YH 3P4NB 4NKMA 3AS0A 4TMPA 1MUJB 1CC3A 2E27H 4DUVA 4YK4B 4CUCA 3IJ9A 1UD4A 2VABB 2NXYD 2NUTA 2F58L 1HHHB 4MMYB 4AI7A 3GS0A 5D9SB 1K5WA 3V7AE 5E4AA 5ID1A 4U05A 4JDEB 5G2NA 4AEHL 4K55A 4FAAB 1MRDL 3LPWA 4HFWB 5GISL 4NKMB 4XBMA 2PTUA 5IHUL 1DVFD 1DLHA 1VZIA 3EYUL 5DJDA 4G7RB 3ASNB 1UT9A 2NUTB 2KI6A 1YLBB 2JCCF 5CLWA 3T2PA 4L4TD 2H6UA 4RGMB 5ID1B 5A7BA 5AG9A 2CPUA 4KY2A 2J8UA 4GUPA 1QUNA 4L9LA 4Z7VE 1E3XA 5C0AA 1QLRA 4K7PL 1JZGA 1DLHB 1KUMA 1SHXA 3KBFA 3SDYH 3BDYH 2ESVA 2G2PA 2OKMA 1OGTA 3SCMD 3ZQWA 2EXWC 1LK3H 1I7RA 1JZJA 3RURA 3FJTA 1KPRB 1EDQA 4I85A 2D2OA 2ZCKL 2J5LB 2ZSVA 2J8UB 3QR0A 1QUNB 4GUPB 4L9LB 3L3IA 4OZHF 5C0AB 1GCYA 1QLRB 3LIZA 5KUMA 4O58H 4UCFA 5CJBA 3QC5X 2CLZA 1EFXA 2A9BA 2AK1L 3A6OA 3CLEH 4OFYA 3NABL 1TQBC 1OGTB 3CD4A 4S1QH 2PR4L 3KWTA 3BP5A 1I7RB 4ZUUA 3EO9L 5A2KH 2WQAA 1A7PH 1KPUA 1G7QA 4QRUA 2R9HD 4PBDA 1ZGLM 2ZSVB 1E5AA 3ARDC 2VW6A 3L3IB 5D7JA 3Q6GL 2HPTA 1WZ1H 3WD5L 1I7UA 3H7LA 5DLMH 2CLZB 1EFXB 4S1SH 3DGGA 1JHLL 3KR3H 3BP5B 2OMWA 2D9CA 3Q01A 4ZUUB 1CD8A 1KEML 1KPUB 1G7QB 1FUNA 1L9OA 2FR4A 4QRUB 5DEFA 1P6FA 5I0XA 3RPBA 1UM5H 4OSUH 3LIZH 5D7JB 4AMWA 1MHPL 1OP3K 1WD8A 5E9DD 4ENEC 1FO0B 1KXTA 1I7UB 2B4CL 1PZBA 5KSBE 3V6FA 1BSIA 1XX9C 3CDCA 1HT6A 4IMKA 3DGGB 2OMWB 4UAOB 5GIRA 4A68A 4OFVA 3KBEA 5D1XB 2XG5A 2FR4B 1UWXK 5DEFB 2VZUA 1MZYA 3IMRA 1Q0XL 3PHSA 4OD1L 1Y6KR 4XPBH 3AM8A 3K4AA 4JQIL 1KXTB 1VKXB 4I5BA 2CO2A 1DL7H 3V6FB 3T0EA 2G0LA 3KPNA 1S8DA 1NCBH 5D7IF 4BA8A 4Z3IA 3L4YA 5GIRB 5HSFA 4FQ1H 2QDWA 5DZNA 3UGXA 1GHFH 3ZTEA 2FQFA 4QCIA 2XYBA 4HLZG 1FFPA 3X1NA 1KN2H 2PUQT 1KLFA 2XRAL 3FT0A 2AEPH 1N9PA 2B15A 1IGTA 2JJWA 3HC2A 4I5BB 1FNEA 2BNRA 2XXMB 3QDJE 3SO3B 3T0EB 3KPNB 1S8DB 3GS4A 1GKOA 1IC1A 3VXRE 3BPLB 3RWGA 3SHSA 1ADWA 1C08A 3IDIA 5DFWH 4I9XA 4G7VH 5IBLC 4QCIB 2IGFH 1FFPB 1F58L 1KLFB 4QY8A 5C8JA 3KPLA 2UUDK 2FJUB 4WY7H 4ICWA 3L3KA 1IGTB 4GQPH 1D5BA 1MCOL 1DVYA 1FNEB 2BNRB 2RQEA 4P4KA 2FEEI 2F8XC 2IBZY 3RWGB 5C71A 5DEJA 1C08B 3IDIB 5E1IA 1J1PH 1JUFA 1MAJA 2Q86A 4S0TD 1PJWA 3ZR6A 1N7MH 2IPTL 4QY8B 4HKBA 4CC1A 3KPLB 5C8JB 1TZGH 3HN5A 3ECQA 2ICCA 3L3KB 2EO1A 3B2VH 1D5BB 2XFXA 1GJIA 2B9BA 4P23D 5HD8C 1L3WA 4P4KB 5C3IA 3AT0A 3LNGA 4JHWL 5CZXD 3GNML 3WKPA 4JUTA 1NIAA 5I30H 2AW2A 3V7AG 4LOUC 1JUFB 2Z6FA 2Q86B 3KPRE 1S7XA 4JY4A 1IB5A 4HKBB 3SGDI 4W9DC 3UBXI 4PRNA 5BZDA 2VZ3A 1E3FA 25C8L 2XFXB 3ESNA 4XT1C 5HI4C 3CLFH 3CMOH 1ECZA 3APNA 2IANE 3UTSD 4C4KT 2P5ED 2HLFD 2EIEA 3MUY1 4QRPB 4Z7VA 1KFGA 5GZNC 5TDPA 4WENB 5FYJD 5B1JC 1OB1A 1S7XB 4I0CC 3L3OC 1SOSA 4UTCA 4JY4B 3ARRA 1PW3A 3Q9QA 4NLHA 5ACZA 4PRNB 2D03L 5BZDB 2SODB 1LXMA 3SBQA 1R46A 1IU1A 4Q9QL 4PWKA 1MCKA 1VLXA 4NHCL 2JH2A 1BEYH 3S35H 4QOKE 4Z7VB 1JYNA 1YY9D 5TDPB 5GRUH 3GLEA 1OB1B 3IDMA 1KIUA 3CN2A 3GYRA 1E5UI 1DCLA 4U1NA 4AENA 4B7LA 1FVEA 5ACZB 1N19A 1LO2L 3QQ9C 1DN2A 5FW8A 2Q3XA 4FNUA 5KVGL 1SM3H 2FIKA 2CCLA 1TJIL 4BKSC 3ULUE 2ODIA 1FA4A 3IDMB 1KIUB 2VDML 5KYYA 1GXEA 4R7NA 3FSWA 4L9DA 4U1NB 2BOCA 4AENB 1FVEB 4N90E 4ZDHA 3UBXA 4HWEH 5H35A 4XOAA 2WBWB 2TRHA 4S1DC 4QUOA 3AY2A 5IOKA 3Q44A 1KGJA 3P77A 3PYCA 2X7LA 3HBZA 3MMEA 4JQVA 2FIKB 3IFNH 3F5WA 4AKOA 2VDRL 2VDKH 1RKRA 4DEPC 5KYYB 3LXUX 4JGUA 4R7NB 5KSBA 4R4BA 4R90H 4OZFA 2QT6A 5FA4A 4ZDHB 3UBXB 2E7HA 4TRPH 5H35B 1S7WB 2CMRH 3GTTA 3MNWA 4JHBA 4Y5VA 4ALAL 3P77B 2VKXA 3MMEB 4OZFG 3F5WB 4AYDC 1UZGA 3O3EA 3EJCA 3BUBA 1PDKA 2XN9E 3BAJA 5DQJA 5F3BA 5J13C 1IGJA 3FTXA 5KSBB 5T1DL 2Y6TE 1F42A 4R4BB 4OZFB 3NACH 3H3PH 5FA4B 3EOAA 1BVLA 4G59C 2TAAA 3UO8B 4WW2C 2R0KL 3VRJA 5HHXH 3MNWB 1RY7B 4KRPB 4XAWH 4Y5VB 3P2TA 4J3WA 1S3KL 2G5BA 4JL1A 3A22A 4EUPH 5F6HJ 2E9IA 3O3EB 1JVLA 2VZ1A 1PDKB 2DN7A 3RAJL 2KZBA 2OMTA 3B6SB 5DQJB 5F3BB 3LKOA 1IGJB 4JFYA 3GKWL 2X3CA 2B1HH 3QDJA 3HB3C 3EOAB 2QQKH 1BVLB 1CYWA 1DQKA 4WIQA 3T2NL 1LP9E 4ODHH 3VXRA 1D7CA 3VRJB 1AACA 3VGAB 5SWZE 1UB5A 2ZG3A 2G5BB 3MOBH 1H8NA 2AQ2A 2K9UA 4EAEA 4E9QA 3LAFA 3ZUCA 1NCJA 4JO1H 5KAQG 5AZUA 1YEJL 2OMTB 3FBQA 3ATEA 3P4LA 3LKOB 3VWKC 4AV5A 4IRSD 4JFYB 3OR6A 2YQGA 3RWHA 2V33A 3QDJB 3P02A 5C0JB 4ZPVA 1IKNC 5FUZH 3VXRB 1AR1B 12E8H 2IMMA 1X5FA 2VUOA 2FO8A 1UB5B 3T4AC 1ZLDA 4L1LA 3KPMA 1EAJA 5CEXA 1ROCA 1J0ZA 2R23A 2QL1A 2OX5A 3OR6B 3RGVA 3RWHB 5ITBL 2QSCL 4ZPVB 3L08A 3O2WL 4NFCA 4ZMNA 5JQ6L 1Q90A 3EG9A 5TE6H 4Q9RL 2W0KA 5F7UA 3UAAA 3QXUA 4X6BB 1J0KA 4ZAKD 5I0DA 3KPRA 3GSUA 2X2HA 3U79A 1U3HD 1X4XA 3KPMB 3GSXA 2CXGA 2FHFA 2Y06L 5CEXB 1QKZL 4JGJA 2R23B 3TM6A 2OX5B 3RGVB 3NCJH 4Q6IA 2UY7A 1A6TA 3ATFA 4XE0A 5F0LB 2IANA 3NK4A 3EG9B 3A4DA 2Z8VC 4GAAA 4Y8DC 2VXSL 1A7BA 4DO4A 2WXGA 2IDQA 3KPRB 3GSUB 5HPMA 3GSXB 4DGWC 5JUEL 2DQGH 5TE7H 1DUZA 3QUZA 1L5GA 1PSKH 2UY7B 1A6TB 5TPWL 3UJJL 1A7QL 2EUVA 3WNOA 2IANB 4MAUL 2YXMA 5GS0L 5EU4A 4KGLA 5GS2H 4QOKA 5J3HC 3UZEA 2E9GA 5D7LE 4MAYD 1ZRUA 2YD1A 1YEDA 4DKEL 2AQSA 2YWYA 3OBAA 4FQIL 4F15C 5HPMB 3NUKA 3IDGA 4FFWD 1DUZB 3S3SA 2Z1KA 4LKXA 2X44D 3QUZB 2BY3A 2G60H 2O5XL 1L5GB 4E36A 1CBVH 1GW0A 2MRYA 1XCXA 3HA0A 3FU8A 5EU4B 1PZ3A 1CLVA 4QOKB 1IC5H 4Y89A 2F6AA 1WUZA 1M3IA 2Z8RA 5F9AC 3SB3A 3QPXH 1YEDB 4XNYL 4CSPA 4PN6A 1FH5H 2NT0A 3IDGB 4O9HH 4XC1H 4Y4FD 4LCWE 3FYIB 4UMSA 1CLOL 3S8FB 4LKXB 4XHQA 5KSAA 1HL5A 3FXIC 2AMGA 4JRXD 2AZAA 2QMKA 2EDWA 1R75A 3KCWA 3C5ZA 1EHAA 4WI8A 3FRUA 3IMWA 3SKOA 5C6WH 1MNUH 1WO2A 3OKLA 3PAUA 4AG4H 3RIKA 2BZCA 5JLZA 3V0DA 5KSAB 4YVUA 1T83C 4BA0A 4ZW5A 1A7RL 4WFFD 3UJTL 5KYNA 2VDNL 3ULUH 5KSBF 3C5ZB 4MXVE 1BOGA 4EEEA 1JZ4A 3FRUB 2LU3A 3DO3A 3SKOB 3IEAA 2XN9A 3OKLB 1E0OB 3V6BR 4AL8H 5BRZD 1A6ZA 1JPEA 4YEEA 3ZIYA 3D48R 1IAKA 1VAHA 3B37A 3MLXH 5JLZB 1GYVA 2VUYA 2ZF8A 4TTDD 4MCYA 1SN5A 5BMFH 2IAAC 4K5MA 1BOGB 4ADJA 1WITA 4OBRA 1FLTX 5I23A 3FU6A 4L1DA 2XN9B 4HK3J 4PP1C 1NGZA 1D5IH 1MVUA 1A6ZB 1F41A 2WZAA 1IAKB 1T7ZA 1B4JH 1LP9A 1IGFH 1XGPA 2AQRA 4MCYB 5F44A 5SWZA 4LSQH 4HKXA 5LNGA 3OD3A 4X6EA 4JFZL 5ESAA 3TIEA 1LO4H 1UENA 2MEJB 1N59B 2VDPL 4NAQA 1NGZB 4UOQA 1MVUB 4P5SA 5KAQF 1ETA1 3VTMA 1W8EA 4L23A 1G6RA 1XGPB 4L1HA 3DI3B 5SWZB 2J1XA 4XN2A 2RJMA 3CK0L 2JSFA 4GI9A 4HKXB 1BVOA 5BNXD 1RIUL 5J7CC 1OSPL 4X6EB 5ESAB 3TIEB 2EYSA 5E24E 1AZRA 1IGYA 5CO1A 3O6LL 4QEGA 2OW6A 1H3PL 4MXWH 4KX9A 2WVSA 2Z9TA 5AB9A 3VMPA 2KYIA 3OZ9L 3QUMH 1G6RB 4OV5A 4XAKD 3ZKXB 4JX0A 4KVCH 2JJTA 5HHVH 2WAHA 4Y7OC 3WO4C 4XVUD 2AI0L 3WY4A 3JWDC 3I02A 2EYSB 4Y5YA 3O6MH 1IGYB 3II1A 2VXTH 4PM1A 3IRCA 1NEZA 1V7MH 3WUZA 1VPOH 4NC1E 4HLJA 4OV5B 3EDKA 1SUHA 5AKSA 1GSKA 5LAPA 2IOOA 2ZCHL 1NEZG 1SN0A 2E8ZA 1G9NH 3I02B 4N2NA 3TZVA 1J0HA 3GZQA 4Y5YB 5FDWA 4RISH 3VD9A 3DARA 3QW9A 1IC4H 1NEZB 1A3RL 4A2DA 2NXYC 3ASWA 1KCUH 1XGQA 3O4LD 4N2FA 2HZHA 5D7LA 4NJ9L 4FULA 1FAIH 2ZOLA 2N01B 5IK3A 5J5EA 1E4WL 3WJJC 4Y1AD 1SMDA 3TZVB 1I9IH 4QTIL 1KGUA 3PAVA 2NRDA 4EN3D 5GXBB 1DVFC 5FDWB 5TQ2L 1GVIA 1WK0A 4BZ2L 5E8DH 1RL1A 3CX5K 3H9HA 2PPFA 1XGQB 2VM9A 5GGSA 5KYXA 5D7LB 3VA2C 4MTMA 2ZOLB 1KMGA 5JIPA 3N85H 4LCWA 3MKKA 4FMKA 4BIKA 2A4ZA 2X88A 3ULUF 1UOWA 3H9HB 4NO5A 4Y7MA 4PP2A 2FUQA 3IDXH 5GGSB 1F1GA 3LD8C 5KYXB 3C8KA 3T08A 3BH8A 4LK4A 1I9RL 1DJIA 3EDJA 3L16A 1AOZA 3AACA 5DK3A 3IS0X 3CTTA 3N3EA 3P11H 4LCWB 1CBJA 3MX0A 5AG8A 1IO4C 3TVMD 5GSVA 3NK3A 4NO5B 1WTGT 4PP2B 5IY5B 4U6TA 4OLWH 1B9ZA 1V3MA 4G72B 3DX7A 1GZQA 3C8KB 3S7GA 3BH8B 5TGBA 4L9LC 3MV7D 4EKJA 2OP4L 1OTTD 2C4FU 1EXHA 4JG0H 5J6HA 2GQHA 3MX0B 1IEBA 4WFEE 2QADD 3M1CA 3B9VA 2D3JA 4GNKB 5DJ6A 1UB6A 2A9ML 5GSVB 1QFUH 3U1SL 1X5ZA 2X70A 4E68A 3DX7B 4R4NC 1GZQB 3DI2B 3HC4L 5TGBB 4Z0BH 2YRZA 3EDDA 4LCCC 4PCKA 2HTKD 1MEXH 3S5LG 2L4OA 5J6HB 2NYYC 3KJ4B 1IEBB 2BW4A 3QDMD 2QGEA 4NRZA 5T1KA 1ZSHA 2XJLA 3NRFA 5DJ6B 1CK0H 1PEWA 1UB6B 4B9KC 2X70B 5EOCH 3MV9E 4LLVA 5T33L 4WFHE 1ASOA 4ZQTA 3WO3B 1WT5C 1LP9F 3DX8A 2QVFB 5D7JC 5F0MB 2AABH 3WU1A 4JKNA 5DUML 4NDMA 1CFVH 1ZTXL 3VGGA 4NRZB 4JRWA 4PJ5E 3WFHA 5ADPL 5T1KB 5J1AA 2YPLE 3TF4A 2CXKA 3V4VA 3GJFA 4LLVB 4KXCA 1HQRA 2DD8H 2X3AA 2ZUQB 4TQPA 2F74A 3DX8B 4XCCL 1OANA 4OKVA 4Y4HD 1H3WM 1IM3D 4NDMB 5CCKL 4OUOA 1V8HA 3TJPA 3WFHB 1JAEA 3ARBA 2AK4A 3HJEA 4IMKC 5J1AB 5KW9L 5CXPA 3ETTA 2BNQE 1RIVL 5MP6L 3V4VB 5I0YA 1OAQL 2YEZA 5C0BE 2F1BA 1HQRB 5CUSL 2DM7A 4WW1A 4G1MA 5IROA 4OKVB 2EIMB 3GRGA 1WZKA 5LKNA 5SWSE 4MS8C 4X6CE 4DEUA 3SDAA 4I9WD 3ARBB 2AK4B 3V4VH 3D2TA 3GJFH 3X2QB 4WKXA 2YEZB 5ESQA 1MZZA 3MJ7A 4QNPE 3H2QA 3WN6A 4WJ5A 4WW1B 1G4MA 4LVHC 3P0VL 3N55A 1BF5A 4G1MB 2IG2L 5DMIL 3VSTA 1R47A 3SDAB 3S4SA 2Y22A 1S3RA 3V9EA 4HUKB 2ADJA 5CEZH 2NY6B 1V54B 2W81C 4MRCA 1SJVA 3S3JA 4FYTA 5ESQB 3MJ7B 3N06B 4WJ5B 1UYWL 2ARWA 4ZD3H 1L4IA 1DZ0A 5FYLH 1G7JA 2JB5H 4N0YL 3NIGF 1PZDA 2QMJA 3S4SB 2F7PA 5AYTA 1FL3A 2ADJB 4RVBA 1CGXA 1QSED 4PY7A 2NY3D 1LTXA 5I1CH 1XH3A 3CSYA 3QIBD 5IJKA 3P73A 2CHNA 1UGKA 3EJRA 4W9CC 1AH1A 3RDJA 1V3LA 4Y0GA 3DK2A 1JE6A 1G7JB 1ZY9A 2H2SC 3DJSA 4NYLA 3VRIA 2AJSH 4DP2X 5C07E 3RX7A 5JMOC 1OAJA 1MJ7L 1ZLVH 2YUVA 1FL3B 3KPSE 3NESA 2FIRT 2WTOA 3B3BA 1XH3B 3CSYB 5I28A 3P73B 1YY9C 3D2UA 3MLVH 1J18A 1H3VA 4I3SL 4IRZA 3HI1A 4NYLB 3HZMA 1SN2A 3VRIB 4PRPD 3AMKA 2FNBA 2G75A 4K3EL 4R2GC 4ZUSA 4Q74A 1RMFL 5J11C 4NZTL 3FBKA 3B56A 2HPOA 4LBAA 1V7NH 3U0PA 4ZFZA 5DVLA 2B8OT 3NJLA 1MDTA 3W2DH 3VD0A 4JY5H 2MCMA 3MUGB 1BD2D 2YA2A 1SVBA 3D2UB 4MXVF 3BVDB 2DH3A 3FOMB 2JKTM 3HI1B 3HZMB 4KNTA 2G75B 3VXME 5AQ0A 4ZUSB 4PD4J 2PXYA 3QDGE 1SXZA 5CZVL 2HFFA 3TT1L 1UT1A 3U0PB 4PMFA 4G3YL 4ZFZB 3J2PA 2BP5M 2HWZH 1UZ6E 5F9OH 4IRZH 4YDMA 3DHPA 4NI6A 3ZYZA 2EICA 4DT2A 1NIFA 1UWYA 3KDMA 2OMYA 3B9KD 3SYCA 3UTTD 2OYMA 3OTTA 4E0RA 4XBGA 4TNWK 4F9LC 2PXYB 3MV9A 4FERA 3HE6C 1IM9D 2YGQA 2HFFB 3INUH 3U9WA 1AY1L 3LQAL 4RAVA 5DHVH 1JPST 5JHBA 1JF6A 3LB6D 1Y0LA 4NQVA 3EUDA 3BCDA 3LRKA 4PJ5A 5D7SL 4BXVA 4F2MB 2XTJE 3KDMB 2OMYB 3K0YA 4M7ZC 5LXGL 3FN9A 3GXNA 2YPLA 4E0RB 4UM9A 5BRPA 3MV9B 5EZPA 4WNJA 5FWQA 4N4YB 4NBYB 4OCWL 3QWRA 5C6PB 2I5YL 2FE0A 4A1RA 2WD0A 4OQTA 4RAVB 2LVEA 4URKA 3A6CH 4F7PA 4GH7B 1Y0LB 4NQVB 2D7PA 1GYUA 4PJ5B 3U0TA 4UZUA 3WY3A 2OZ4H 4HHAA 2VQTA 4M6AA 1I8AA 2YPLB 1Q94A 2BNQA 3MLSH 4NWUH 4WK2B 5DQ9B 3WNMA 5C0BA 4Y5VC 5DFAA 4UM9B 1N6QH 1I8MA 4H40A 1SJMA 3QJOA 1W0YT 1QFWL 2GIXA 1PMYA 3QSKB 1F3RB 3S3BB 1LMKA 1K85A 1GOHA 5SWSA 4X6CA 3P0YL 1A4AA 2DS4A 1IFGA 3U0TB 1OXYA 3MI6A 3TFKC 1MJUH 3H85A 4HHAB 2COQA 2K8QA 1Q94B 2BNQB 5TFSL 5C0BB 1I8MB 3MA7A 1Y7VA 1BIHA 1U6AL 2FX9L 4OV6F 4OCXH 5PAZA 4XVSH 3Q1SL 1NCUA 1JNLH 3TN0A 1SMAA 4A55A 3DO4A 1JDCA 5SWSB 4X6CB 3U6XA 5I6XC 5LG1A 1OM3L 4LP4A 5D4IA 4FL4B 4L4VE 3IGUA 5H8DA 2BERA 2EDMA 3NPZB 3WKNA 2PPEA 3LZLA 4F2FA 1SYVA 1AR1C 3PGDA 4KWUA 1AI1H 1CE1H 1FQ9C 1DQLH 3MA7B 1P4BL 4GSDH 1DSFH 3C60D 3FTUA 3V52H 1A0QL 3TN0B 3I2CH 2D7MA 1FGVH 2PN5A 5LDSA 4K4KA 5C0FA 4UOW0 5AKTA 3NZUA 2E8YA 3O6KL 5I82A 2IV8A 4JM2A 1UWGL 1IKFL 3RLSA 3O81A 3WS6A 2NY1C 4TUKL 2CO7A 4Z23A 2CWRA 1SYVB 4UDUA 2VH5H 3PGDB 4U7MA 4HIXH 1MFNA 1ZTMA 4FFZL 1BYOA 4ODTH 1BFVL 3PWUA 1EAQA 5C0FB 3OLDA 1SY6A 1C5BL 5C07A 4KUZL 2JF1A 2XXFA 4JM2B 4LFHG 3KPSA 1NM4A 4FEIA 5AW8B 1O9WA 5JMRA 2CO7B 4UDUB 5FM8A 3RYMA 3W9EA 1KDIA 3VXSE 4BFJA 3WAJA 4MB3A 4OAWA 3PWUB 4H4NA 4X8JA 5FUCC 3MXVL 5K69A 1JK8A 1EEQA 3NGBC 3BXNA 3TJHC 2YA0A 4YDKH 5TE4L 5K9JL 5F7EH 4FFWC 4DGVL 4Q6IC 5C07B 1YC7A 1NCGA 5HYSA 3OKKA 1JYVA 2WBJC 5EF0A 5LHDA 3PJSA 3SKJH 3W9EB 1A6VL 1RU9L 2V3FA 5HYSG 1BZ7A 5E6YA 1F6FB 4OAWB 5EOCJ 5JIMA 4P3DA 4X8JB 1JK8B 3BXNB 3MA9H 4YHZL 3IJ8A 3CXDL 5DO2D 4XMVA 3DUUA 1FFNA 3U83A 4PBXA 3VXMA 4IYKA 3NP4A 3OKKB 3QDGA 5DJ2A 5HYSB 3I74A 3PJSB 5CJQH 1ZANL 4OB5H 2NR6D 5I75B 3S96A 2H9GA 5T1MA 5J06A 1BZ7B 3I50L 4QR7A 2H6PB 1G9MH 4P3DB 3PG2A 1MRFH 2CBTA 3RU8L 3P69A 2EDHA 3D34A 4P8QA 3QI9A 1M71A 2XQBH 1TEYA 2DMGA 1FFNB 3BI9X 3DUUB 5AL8A 3VXMB 1G94A 5AD0A 5JXEC 3QDGB 5DJ2B 4LEXL 2Z31D 4YBQC 3QJFA 3C2SA 1PBYA 4ZZFA 3S96B 3ZYIA 2H9GB 2IFFL 4X6DE 4N8VA 5T1MB 2CGRH 3UH8A 2NY0C 5KTEH 3QNZA 4PQXA 5HGAA 2W9EH 4JBSA 1F8TH 4R0LA 4N24A 3UROR 3FQRB 2ZTBA 2X1PA 4MA1C 1SOXA 3QUXD 3QI9B 4LARL 1M71B 4KAQL 3N04A 4WUKL 5AD0B 1UH4A 2Z0UA 1J0IA 2PYEE 3QJFB 4PJXE 4YXLH 3EJJX 4N8VB 3V0IA 3QNZB 2BSSA 2ARJQ 5HGAB 4N9OB 4R0LB 1CU4H 3RVWD 2XTJB 3W1ZA 2KKQA 2LR4A 2ED8A 5E4IA 2FYYA 3DMMD 3OB0H 2MTPA 3ARGD 1DQIA 4WTXA 3SIKA 5BVJA 3U82B 3WFEL 3LIUA 5B8CC 4L29A 3VB9A 4HUNB 1REIA 4LESA 5TJWK 2LU4A 3B1TA 4FKKA 4WDIA 1C8PA 3ZTCC 1NMAH 1AZBA 3UXFA 2FYYB 3VSUA 2KZKA 3DV4A 4ATTA 4DAGH 3D85A 5TDNA 1YNKH 3VTTA 4F7MA 5BVJB 4HC1A 1ULVA 4L29B 4BFEA 1BX2A 2W59A 4M6MH 2B77A 3AWFA 3GPSA 4O5LL 1J87A 5I6LA 1TQCB 4L4VA 1OIOA 4QNPF 4WDIB 2XWDA 3MV8E 5FO7A 4CU7A 3UDWA 3HG1D 3HHMA 5D72H 8CGTA 3A47A 1JK9A 4HF5H 3CFJA 3DV4B 1U8LA 2UX7A 1G7MA 3D85B 5TDNB 4F7MB 1ESOA 2VR5A 1II4E 4HJ1A 5I8KH 2OI9C 1BX2B 1I9JL 5AW5B 3OAYH 3SDYL 1EJOH 4L4VB 1S9YA 2YN3A 5FO7B 3U7WL 1LK3L 3WMQA 3HW7A 4BV1A 1JK9B 3CFJB 1U8LB 1G7MB 4HC1H 1TLKA 4XO3A 4PTUA 4HJEA 3RIAF 4JM2F 3T2QA 1PG7H 1ZOXA 2AJVL 5DD5L 1G9NC 3AQXA 4O58L 1RUAH 2WYTA 1NCIA 3K2UH 1S9YB 1XSIA 1RPUA 1OL0A 2JKWA 4S1QL 4HULB 1NAMH 4UMGA 2NY4B 3WEBA 3VXSA 2UXTA 3Q43A 3L9RA 1UASA 4N68A 4PTUB 5CGBA 1YQVH 3FU5A 4L4TE 3OKOA 4WTWA 2R2BA 1UG9A 1CDYA 4XXCC 5EFIA 2IH9A 2H32H 4K3HA 4EN3C 2CHXA 3F3HA 1DEDA 3ZKND 2YWZA 4GRLD 4F57H 5AWNH 3VXSB 2MFNA 3L9RB 1JXKA 3ZMRA 2P3YA 3LIZL 3Q2CA 5DC0A 4AZUA 3OKOB 1CXHA 5F70A 2R2BB 4P9MH 4XH2A 5GS1C 2D3VA 1E6OH 3DX6A 1KSRA 4JREB 4XCFH 5A40E 4PJ9A 5L8LB 4PI2A 4S1RL 5DHMC 4FQQA 1KN4H 2VDQB 3M88A 1RUMH 2VE6A 2VGLM 1OAXL 3U0WH 3DHMA 4XH2B 4XPBL 3DX6B 2DJSA 1UZ6F 4PJ9B 2DQDH 4EI5D 1ACYH 3RJDA 1NCBL 2VERA 3O8XA 4FQQB 4M8UA 2X40A 3V9CA 4P48A 1FIGH 2DOCA 1AZUA 4HAKA 2E74C 4X6DA 2VE6B 3ILEA 1FE8L 1KN2L 3P9WB 2J1KA 1P84J 2AEPL 1HK6A 1QBML 2AP2A 2DTML 5FIEA 3HJ0A 4I1PA 4EN2A 1LDPH 2A83A 1JDDA 5I1LA 3O8XB 5E9DE 4KKQA 2PYEA 4PJXA 1XGRA 4X6DB 1VESA 4FD0A 4G7VL 4MS6A 3SGEH 3OF6D 5D6DC 5EZOH 1G7PA 5F7DA 3ZHNA 1A6PA 2IH3A 2HTKC 3EFOA 2DQUL 4WY7L 1IBDA 4Y1TA 3CDFA 4LHQB 5I1LB 3QHZL 2OFQA 2PYEB 4PJXB 1XGRB 1GGBH 3TA3A 1J1PL 1N4XH 1E27A 1G7PB 5F7DB 5I1EH 1N7ML 1WV7T 2IH3B 2VJXA 2HT3D 1TZGL 2XHNA 1YSOA 3EFOB 3B2VL 2NPLX 1JWUA 1UJTA 4FG6D 3UOAB 1BQ5A 1UD5A 4ECNA 3JV6A 1RHFA 2EZ0D 6CGTA 5I30L 3TA3B 2O61A 1E27B 4WWID 4L8SA 3MV8A 3U4AA 2YARA 4XPTL 3QR1A 3B7YA 3ZZSA 4JN2A 4JHUA 1JWUB 1NIBA 3CHRA 3LZNA 1AGBA 1RH8A 3CLFL 1OQXA 2R0WH 4IRJC 3CMOL 1DJXA 3JV6B 1LWHA 3WGUB 5DK0A 5IUSA 3NA9L 3X1GA 5D71H 2O61B 3LEYH 3EOYG 4O02A 5IESH 5GGVY 1TU2A 1BQLL 4LRNL 1QW9A 4RMSA 4L8SB 3MV8B 3V0AC 3ZL1A 1DO6A 4AQ1C 5I6NA 1OAYL 4JN2B 3UG5A 2M8XA 1AGBB 3MSPA 1CS6A 4OIBA 3EYQD 3BH9A 5HGBA 3R0MA 5EOQH 5D4HA 5DURB 1BEYL 5DK0B 1YYCA 3VQMA 5EN3A 5GRUL 4O02B 1JDAA 4JR9H 2X1QA 5ES4B 1WFOA 3HLAA 3ARBC 2OTWA 5HGBB 3BH9B 3H6JA 4NENA 3SE4A 4CKVX 1A65A 1M53A 1SM3L 2EDYA 4Q6YA 4V33A 5D1QD 3NA4A 4R26H 4L4TA 3WE1A 5L2KD 4NGHH 2QQLH 3MRBA 3UMNA 5IROC 4PIRF 3BFQG 4U49A 5FW6A 4OZIE 4HT1L 3M46A 4HWEL 3HLAB 4BINA 3FUEA 2F8OA 3DETD 2OTWB 2FEEL 2YSTA 4NENB 1RJYA 3EJUA 3SCMA 1VADA 4TPRH 5A3ID 3IFNL 2GIYA 3CBKB 1O9ZA 4L4TB 2HLAA 1XMWA 4APXA 4XO8A 3MRBB 2NNXA 4POUB 3ME0A 4U2YA 5I74B 5I5RA 1H5BC 3IE9A 2J25A 2YO3A 4GT7A 1E67A 1IEAA 4J5VA 3WLWC 4JPKH 4GBXD 4S0HA 4LGRB 2CMRL 4K15A 2B5IB 3DROA 4HS3A 4OTXL 4ETYA 4MRBA 1RJYB 3SCMB 1VADB 1DQMH 4AUYA 4GEJA 1YEHH 4ODBD 3QORD 4OI8A 2HLAB 3V4UL 3ME0B 4P49A 1KZYA 2V6HA 2HUEA 1IEAB 2AXHA 5F2FA 5HHXL 1QEWA 1YY8A 4XAWL 5CSGA 3UPCA 3DROB 4HS3B 4F7TA 3B9DA 2FDBP 2HMID 4H0HB 4W9EC 3OJVC 4KZ0A 1WIPA 4X6DF 2ZG2A 4PG2C 2B1HL 3K6NA 1ZMYA 5IJCC 4H44C 1ZS2A 2QQKL 3CVIH 5E9DA 2I85A 1S7VA 1ASQA 1QEWB 1YY8B 4F7TB 2VSDA 4WI7A 1W6LA 3QE5A 3VJ6A 2E7LA 2PPCA 5E4OA 3MOBL 3T8XA 1O6SA 1F6AA 3ULVD 2DQHL 5J4MA 1TEGA 3MBXH 4JO1L 1TENA 4NT6A 3X1FA 2EP6A 3DX0A 3N6YA 4PJXF 3R4DA 2PP7A 1CXEA 4N6QA 3KZ8A 3B9KC 5E9DB 5FUZL 1S7VB 4GS7B 3W81A 4XNUL 12E8L 1GGIH 4JG1H 4KTGA 2BFVL 3AU0A 3NZHH 3RE0A 3VJ6B 4BSWA 1LO0H 3T8XB 1O6SB 1UVQA 1F6AB 1ZDQA 4XB3A 1JFQL 4I8DA 2EEFA 4NT6B 4ZO7A 5A6MA 4UOZA 4E42A 2FX8L 3TYGL 5D55A 3FT3A 4RWYH 2EQDA 3WIIH 1E4KA 3K6OA 1OCCB 3I6LD 4OFIA 2OSXA 3MJGX 5TE6L 1T66C 3WN5C 4BSWB 4OR1A 1JGUH 4V1DD 1UUNA 1GOFA 1UVQB 5A1AA 4WSJA 2BHUA 1UT2A 5F7HA 4PGJA 1MFUA 4JZJA 4E42B 3NCJL 2IEPA 3KPQA 3MCG1 2ENPA 1CTNA 3FT3B 4LMQE 5DS8A 4EKXA 1J1OH 4IS6A 3PWLA 4YXKH 3AXIA 3OG4B 4Q14A 2EACA 2VXVL 3RY6A 4RGND 2R0ZL 4OT1L 3UADA 3PHAA 4WO4D 2DQGL 4RMBA 4X5WA 1Z7JA 1JGVH 5TE7L 4DF9A 6PCYA 4JZJB 3HMXA 2CUAA 3JV4A 3KPQB 5DS8B 5ERWB 1DVSA 4OJYA 4IS6B 3PWLB 5IQ7H 4N0FB 2BH0A 3D39E 4BM7A 3LNHA 2F68X 5DC4B 2EIDA 1TZHA 2EYTA 4FP8H 2D31A 4IJ3B 3SE3C 4HXBL 2ADIA 5INCA 4TUOA 3SDCA 3ZE0E 4PWHA 4X5WB 4FOMA 1E9OA 4AUUA 2YLHA 2EDNA 4IGBC 2G60L 3JV4B 4FTVE 4MJ6A 2HFGH 1HYRC 1N68A 3MGTA 3MLYH 1BECA 4DQOH 1IC5L 1WBXA 2XBTA 2EYTB 3M7OA 2D31B 1G0YR 4FN0A 2ADIB 3GMOA 5INCB 5T5NG 1EHNA 4XC1L 1KGYE 4TUOB 2CRIA 2H1PH 3HMXH 3SDCB 4B96A 5L0QB 4TF4A 4OZIA 1E9OB 4NZFA 2PO6A 2EIKB 1E90A 2KUTA 4MJ6B 1MG2C 2A0LC 1MKFA 1ZKAA 3QB7C 5IW1A 3US0A 3MGTB 3F65A 1DJHA 3TLRA 1WBXB 4PJ8A 2PF6A 1KWKA 1MNUL 2LLNA 3AQDA 4OGQC 5D5MF 3GMOB 3DTUB 4AG4L 3BRGC 3FUKA 4P9HH 3VACA 4OZIB 2D0HA 2R29A 4PJIE 3KMDA 4JQXA 2PO6B 3D06A 5IW1B 5J1TC 4KJPC 1X7QA 3ULUL 2EE9A 4YS4A 4BHUI 1F0LA 1ZV9A 2H3NA 4JHAH 3GLAA 4PJ8B 4Y2OA 1L7TH 2UZXA 3BWUC 4AL8L 3A4FA 1X6LA 2R4SH 1ZSDA 3F05A 3MLXL 2VIRA 4XMUA 3ZL4H 1TSRA 2YMTA 4R5VA 1A64A 4JM2C 1NGQH 1JXDA 1RSFA 3QXWA 2WQRA 1X7QB 1J5HA 3O4OB 2H3NB 1BJ1H 1RURH 4JRXE 4Y2OB 2UZXB 3DX2A 2DMKA 3H1ZA 1D5IL 1ZSDB 4LMQI 4M1CD 2VIRB 4UQAA 4HMCA 3KLDA 2Y25A 4XB8A 3TWCH 1IGFL 3KD4A 5K59E 2O5YH 4LSQL 1Z1WA 4YO0A 3RL2A 4HIEA 4G2AA 3D0VA 1W8OA 5D93C 4ODSL 4TNVK 1G9MC 4HIJA 4GMSH 2FUTA 5CCHE 4KK6C 3V0GA 3WFZA 3KL3A 3RDTD 3LKQA 4JFXA 1QQDA 2BVPA 3PF2A 4LPTA 4YO0B 4HIEB 5DSCA 5C3TA 3RL2B 3D0VB 2E6QA 4BHUA 1X9RA 2O5ZL 2BY1A 3GXIA 4KKAD 5B4MD 4HIJB 4MXWL 5BS0D 3DRQA 3ZTJG 3LKQB 3C6LC 1CZ8H 4JFXB 1QQDB 1U4FA 2BVPB 1T7XA 5DSCB 2ICWI 3PXLA 5C0CD 3QDAA 4O2EA 1I1CA 4KO7A 4OCYH 3WNKA 4DN3H 3WTWA 4DGIH 2VXTL 1NBYA 1QR4A 2OMNA 3RVWC 1G6RL 1GZHC 2DLFH 3RVUD 1VPOL 3DRQB 1G43A 2LE9A 4IRSA 2QPEB 1NCWH 4FXKA 2CGYA 3RZWA 1G9NL 3R19A 4O2EB 2GJ6E 3AZUA 2XI9A 1JXFA 1NBYB 2XTJC 2XV2A 3S36H 1IC4L 1CPUA 2QLVB 2BHYA 3L8QA 4IRSB 3D39A 4G9FD 1XL4A 1QRND 3LS5L 2MIZA 2F5BL 4FXKB 5JA9A 3IJYA 3EH3B 3BRDA 1ODAA 1KCKA 2XWCA 2VB5A 3Q2WA 2FO1A 4XAKE 3H7BA 1I9IL 3O3DA 4ZAKA 1ETB1 4HA1A 2L0DA 1DUYA 1U3HA 5E8DL 5JORA 1GJUA 1NC4D 2XY1A 3QAQA 2JKSA 5CKGA 1IZJA 4OIAA 3D39B 4LIQE 3IJYB 1HAUA 2ICWA 1CF8H 3NCCB 1F97A 1YO4A 4YLCA 3ZR5A 5KJ7E 3H7BB 3ZE0B 2IWFA 3H42H 5GRXG 3OHXC 1AGCA 2KMWA 3O3DB 4ZAKB 5I5IA 3PL6D 1DUYB 1U3HB 4AQ8A 2EH8H 4NAMA 5JORB 1FSKB 2FQDA 1BA9A 1YEFH 4WSKA 4KKBD 3L3JA 3SPGA 2QPFA 4KMQA 2ICWB 3UJIL 3O4LE 3P11L 3UCQA 1T20A 1KBWA 1JCKA 4MAYA 4PJIA 1AGCB 2XWTA 3SOBH 3WCYA 5A2FA 1EO7A 4Y1AE 4NUGL 1PZCA 4C59B 3WJMA 1X4YA 4HETA 2DKSA 3BLPX 3LTVA 1WLHA 3MBED 2HJFB 5B3JE 1X7TA 3L3JB 3LZOA 5DD3H 3HBGA 2BZ7A 2FEDD 1R3KA 4NM4H 4EZLA 5DD6A 2E4FA 4XN4A 1ZK5A 4JG0L 1T20B 4MQSB 3A4EA 4MAYB 4PJIB 2XWTB 5LGHH 4BCXA 1TDQA 1IGML 2WW8A 4GPVA 2C3HA 3TPKA 5KVDE 1QFUL 1CGWA 4X7CC 1T7VA 4LSSH 1JXJA 3GO1H 4PYGA 4AIOA 5FF6A 3SPHA 1TR7A 3KBPA 4JRXA 2AXWA 5E08H 1NCCH 1X5GA 4KO5A 4OLYL 4KKNA 4ZMAT 1R3KB 4NP4L 5DD6B 1R17A 1MEXL 4IHOA 4XX1G 1ZT1A 2ZZUT 4GW5A 4L1BA 4W9FC 5DVMA 5BQ7A 2FL5A 4YFEA 2XOTA 1KXVC 5CF3A 1CK0L 1IZKA 3L7EA 4GXUM 3DBSA 5EOCL 3CN3A 4GP4B 4HQQH 5FF6B 2EVIA 1TETH 3DX9A 2TSAA 2W5PA 3P2DA 4JRXB 1T5KA 3NDYE 4H1LA 3MNZA 1R1CA 4IHOB 1WWAX 2FWOA 1WBZA 1CFVL 1ZT1B 2E4TA 2GCYA 2Z7WA 4GW5B 1GPOH 4U0RB 4CN4A 2FL5B 5FO8A 3MV7E 1BVKA 5CWSA 4EI5C 3L7EB 2DWYA 2Q6WA 2CNZA 2FJGA 2DD8L 2M2DA 4KZDL 5CLXA 3SE9L 3N41B 4LKCA 4H1LB 3MNZB 4XI5D 3ULSA 5I17A 4WQOA 1E5ZA 1SLWA 2FWOB 1WBZB 2DQEH 2BK8A 2GCYB 2ROXA 2Y3NA 2ZONA 3CGTA 3WNLA 4AC4A 4DP0X 5FO8B 3HMWL 1BVKB 5CWSB 1NWPA 3CDZA 2Q6WB 1YMHA 4XP6H 2FJGB 3MRGA 1MWAA 3VFGL 1NEPA 4H1LH 2ZT9C 4KQ3H 4LKCB 4FKHA 1DFXA 3ULSB 3ZMNA 5I17B 1MFBL 1E43A 3ET9F 3PV7A 4LCYA 1KBBA 5IFAH 1JBJA 1DTUA 4F3FA 2M83A 3LXCA 3V4VL 2VDLB 3CDZB 4JO3L 3E8UH 3BDBA 1YMHB 4A2EA 1Z5HA 3MRGB 1MWAB 5JIDA 1UEYA 4HSQA 4RAUA 5GRJH 3UAEA 1TITA 4LOVA 1UJ3C 4LCYB 1X5LA 4ZUVB 2VDLH 4F3FB 5C7XL 4PV1C 3RVVC 1JD9A 1SBBA 2DL9A 4EZJA 3RWDA 3QJZA 4RAUB 1MXGA 1HL9A 2JB5L 1IFHL 1FNLA 3TH3T 1D9KD 2PPAA 3ZE0F 4LT7A 1R5WA 2PPDA 3NG5A 5I1CL 2DF3A 4I9WE 4KFZC 4YHIA 3RWJA 2IDTA 4PY8I 3RWDB 4ETQA 4FNPA 5EU7E 4N2KA 2Z7YA 3UP6A 2AJSL 2B1OA 3IJ7A 3D18A 4YR6A 4LVNB 4BD4A 4B9FA 1H9VA 1R5WB 3BPCA 3EYQC 4N5UA 4L3FA 4UAHA 3O4LA 4YHIB 3RWJB 2ZAIA 1MFMA 3O0RH 1PLAA 3IDNA 3UG4A 3MLVL 4ETQB 3D25A 5HYIA 4JFQA 4L8SC 4KFMA 4Y1AA 2YHGA 4HK0A 3K72A 1JZFA 2P46B 4O00A 3D18B 4YR6B 4HBCH 5AVSB 1V7NL 4XWOD 2O6EA 4OF6A 4PJIF 3BPCB 2VYRE 1IIIA 3B7TA 3T5WA 5D1QC 4MASA 4DP9X 2VUKA 3O4LB 2BIQA 1QPKA 3V8OA 3W2DL 3IDNB 1QSEE 3D25B 4JFQB 2DJ4A 2X6AA 3L5XL 4Y1AB 2QSVA 4HK0B 3K72B 4L05A 5DC2A 5EG6C 3UACA 4QTFA 3LMJH 3FKUS 1HHKA 4TTGA 2NY2C 2D7TL 1NLBH 1W6WA 2WQVA 1CTOA 5DD0H 5A3IC 2HWZL 5F9OL 4IRZL 4YSSA 1FNSH 1NPUA 2LTQB 4OFKA 3BQVA 2HT2C 4OZ4A 4J4PD 4F8LA 4ANXA 1RAMA 1KGCE 2O72A 4HIPA 4XXWA 1WWBX 5HYJE 3NCBB 1Z9LA 1HHKB 3MAWA 5JHLA 1CD1B 3ULAB 3INUL 4BQBA 2GABA 1OSYA 4ZT1A 3IETA 4YHMH 3MVSA 4PRPE 4KMLB 2NXZB 4ZUWA 2DQCL 2YAFA 5K59F 4PG9A 5EO1A 4LGSB 4OZ4B 1U8MA 2EXSA 3MV7A 3RUGE 1LO5A 3MFGB 1OP5H 3N41F 4WU5A 1YEEL 1BD2E 2P49B 1AS6A 3FTSA 3VE0A 5J12B 1PU0A 1UOVA 1A2YA 5FYKD 3S37H 4GP8B 3IETB 1ITBB 3SE6A 3GI8L 3QRBA 4ZUWB 3HNVH 3ZHDA 2RD0A 5PCYA 3A6CL 3FHAA 1L9QA 4PREA 5EO1B 1RLWA 1U8MB 4ODXA 3IM1A 3MV7B 4JMNA 2NQCA 1LO5B 5DVPA 3ALPA 3WDJA 5JHLH 4WU5B 1KF9B 3FN0H 4NWUL 3VE0B 3IAQA 2QTVA 5DZ9A 5FB8A 4XRCB 1A2YB 2OR9L 1MHEB 4FMVA 4HH8A 3BAWA 4LEBA 1W72A 3AROA 4Z3HA 3IE4A 5LBSA 4HH9A 2P8LA 4Z8FL 2EJ1A 2Y7NA 4FMFA 4S11A 1CDGA 4PREB 4EPSA 2GK2A 1F4WH 3ELQA 4ODXB 3SKNB 1FNAA 1V5JA 1MJUL 1E28A 1TMCB 2IV9A 1NSNH 2ZP8A 3DJTA 5HYEA 4Z1PA 1KV7A 4QT5A 3N40F 4CGUB 2NYKA 3K6SA 3D1MC 5I1IH 2E9WA 4OQTL 4OCXL 4XVSL 3GINA 1W72B 1JNLL 2I26N 2P8LB 3F6JA 1WE5A 1NUDA 3AMLA 4LLMA 4B3EA 1E28B 1ROWA 2Q7AA 4BGLA 2X6BA 1JGLH 4QT5B 2CRZA 3K6SB 3GB7A 3MV01 5LBSH 1DSFL 2WB7A 1CTMA 2YLKA 3I2CL 1FGVL 5E2TH 2X6MA 3D33A 1INDH 2XZQL 4G6MH 1MCLA 4NPKA 3VQLA 1NCAL 2ZKYA 4LLMB 5EC1A 1PEZA 3UFIA 2VO5A 3PQYE 2KQNA 3LH8A 4H8WC 2VH5L 5I8EA 4HIXL 1NDMA 3BEWA 4TUJA 2R8SH 3GB7B 3SZ6A 3BD5A 3QZMA 2YXFA 2N0KA 1QASA 2QGCA 2ICWJ 4M6NH 5AVZB 2JTDA 1L9SA 4JFEE 1PD6A 3MTXA 5E6IC 1BBDH 4U1LA 5EC1B 3OAZH 3KLLA 4UQDA 5AAPA 4PS4H 5DGQA 4TULH 1UXWA 3D3VD 3N42B 1NCNA 2ITEA 4LU5L 1NDMB 3BEWB 1XCTA 4TUJB 1T89A 4U31A 5CJ8A 4MJID 2QZ5A 4CMHB 3X14A 1MRCH 1F86A 4G9DA 3E2HC 1UOLA 4LSTL 4DTGH 2O30A 4YDKL 3IJSA 5F7EL 2D0GA 4JZJC 1C12A 4U3SA 4U1LB 3G3LA 3QS3A 1JPGA 1UXWB 3RY6C 1XCTB 4N2AA 4IJ3C 2IC2A 1QSEA 3ZXAC 2ZWKA 3X14B 1SY6L 2QVMA 5B3JF 4G9DB 3FQ2A 1GIGH 3PREA 5E1GA 3W37A 3IJSB 3QIBA 4IKJA 3QDHA 3E7JA 1C12B 1KNOA 4U3SB 1O5PA 3HS0A 1DP0A 4PEEA 4B6ZA 1I8LA 1PPIA 3DPBA 3BUPA 1JPGB 5CJQL 1HESA 5AW2B 4PWJA 1E7UA 2O6DA 4OB5L 5G5DA 5CHNA 4ZMWA 1MDAA 3BQUC 5KBPA 1WAAE 5DMGD 3S0PA 1NWOA 1KXQE 5BRQA 1L0XA 3C75A 3EOTH 4ZXBC 1M6UA 1QSEB 2NY3B 4BSJA 4ZMOA 5F7MC 4YDIH 3SDCC 3QIBB 5L0QC 2GSMB 1Y18A 5GJSH 5HYJA 1TJXA 5DJ0A 5IBTH 3HS0B 3VYOA 4JKMA 5I71C 1AAJA 3DPBB 4O2FA 1P4IH 4PRPA 5G5DB 3S5ZA 1TO5A 5CHNB 5KTEL 5DR5L 5E4EB 4KRLB 3G5WA 4DFIA