2CALA

Crystal structure of his143met rusticyanin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
LDTTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGMAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic Resolution Crystal Structures, Exafs, and Quantum Chemical Studies of Rusticyanin and its Two Mutants Provide Insight Into its Unusual Properties.
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
molecule tags Electron transport
molecule keywords RUSTICYANIN
total genus 32
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2calA00
1V54B 1TEGA 3PAUA 1GR7A 1KDIA 2LLNA 3CVBA 2R7EA 4HIPA 1M57B 3V9CA 3U25A 4AX3A 1NWPA 1XB8A 1PZAA 2JXMA 4BXSV 2JKWA 3S3CB 3CDZB 4BXVA 4YSEA 2PPCA 4HAKA 5B1JC 2GI0A 4DP2X 2FQFA 5I6MA 2GHZA 2VMJA 4DPBX 1BQKA 2QT6A 3NJFA 4NB7A 4E9WA 5B1KA 2VW7A 1I53A 3ZBMA 2B3IA 2XLLA 2PCYA 3H4HA 4YSTA 4HALA 2BW5A 1NIDA 1J9TA 4CSPA 4YSDA 2XYBA 3IN2A 1JZGA 4JKNA 2UXVA 5PAZA 1OE2A 3PLYA 1L9TA 2Q5BA 3QPKA 3UABA 2EILB 1RKRA 1XB3A 2H5UA 2HX7A 1SJMA 3JTBA 2FQGA 1ILSA 5B3SB 2FQDA 4KO5A 3KW7A 1JZEA 1NWOA 4P5SA 4ZK8A 1W8EA 1L9QA 2B08A 1SDDA 5A7EA 1SFHA 4F7KA 1AG0A 2EIJB 2FWLB 2Y1AA 4G71B 2BP0A 2I7SA 4GYBA 3S3DB 3DTUB 1MG3C 1AZNA 1GS6X 1TEFA 2VSMB 3WKQA 2CCWA 4M3HA 4BWWA 3WNJA 2OCCB 2ZONA 1MZYA 3PPSA 3AG1B 2CAKA 5D4HA 3IBOA 3OMNB 1AAJA 4E9RA 5AKRA 3T6VA 3NJKA 3HB3B 4AKQA 3ZDWA 1A4AA 4W1TA 2EIMB 4N8UA 3SQRA 3X1NA 2H3XC 2NRDA 4NERA 3SBPA 1IBYA 1OCRB 1IKOP 5D4JA 4KO6A 1CC3A 1ET8A 1KV7A 2PPAA 2VSKB 2W8CA 4DP8X 4E9QA 1PMYA 4YSRA 1PLAA 1KCWA 3ASOB 1ZIAA 2QDWA 1ZV2A 2BWIA 1PZCA 1PY0A 2BW4A 4BWTA 1AOZA 3OQRA 3NJJA 2PP8A 4BK5C 4Q89A 2R7EB 2W88A 4MFHA 3NP3A 5B1BB 1ET5A 1V10A 2I85A 3FSWA 5E9NA 1NICA 3FYIB 1PCSA 4EF3A 3NSCA 1JZJA 1PAZA 1KCBA 1TU2A 3S3BB 2TSBA 1E30A 1L9SA 1WA2X 2ZXWB 4DPCX 2AFNA 3OM3B 1BXUA 4A2EA 1NPJA 1GYCA 4YVUA 8PAZA 4WKXA 4N4YB 2PP7A 1PLCA 2YAEA 1CYWA 4KNUA 3X1BA 1X9RA 4HZ1A 2DY2A 2XXFA 3NP4A 1AZRA 5B7FA 2TSAA 3EH4B 4Q8BA 1E67A 2UXTA 4GY4A 4E9TA 2HZHA 1GY2A 4G7SB 1BEXA 1MDAA 3ZX1A 4DP7X 4F2FA 3QJVB 2YARA 2IDTA 2PP9A 4WTQA 3FQYA 5LDUA 1L9PA 3T71A 3NJIA 7PCYA 3WKPA 4E9YA 1T5KA 3DIVA 3CVDA 3NSDA 3C75A 4YSQA 1ZPUA 1XMEB 4HCGA 3IEAA 2J56A 2MTAA 1OE1A 3FU7B 2XV3A 1BYPA 2XX0A 4DPAX 4FA7B 2FT7A 2WSDA 2FNWA 1NINA 3N2JA 4E9VA 4GP8B 2OV0A 3BVDB 5AZUA 2YAHA 2RACA 4M4RB 4DP6X 3PAVA 3QJTB 1RZPA 2J55A 3UADA 2IWFA 3GYRA 2FT6A 3S8GB 1FA4A 4P5RA 3X2QB 1RCYA 2GB2A 2VW4A 2N0MA 4BDVB 1CYXA 2YAPA 4A2HA 2WO3B 3NYKA 5I26A 2IDFA 2XV0A 3AG4B 1E65A 1ZDQA 5IY5B 4A2DA 1ZIBA 3OMIB 9PCYA 4KNTA 3IN0A 1M56B 4DP5X 3AW5A 3IE9A 2BZCA 2WO2B 3QJQB 2BHFA 2VM4A 3D12B 3AG2B 4KO9A 2DWTA 3EF4A 1MZZA 2EIKB 2UX6A 1JXGA 1CUOA 3AZUA 3CVCA 2HLEB 3X1EA 4JHVA 3UAAA 5FC9A 4FAAB 3NJHA 1FWXA 2IWEA 1A8ZA 3T6WA 1OCOB 2IWKA 1OOWA 1E5ZA 3NJMA 3TBBA 1UATA 2XX1A 1ILUA 2CBPA 3AY2A 4CSZA 3HEIB 2XWZA 2P80A 1HAWA 2A3TA 1QLEB 1JXFA 1NZRA 1JZFA 4BWUA 5B7MA 3BQVA 3NT0A 4AZUA 2YAOA 2PPEA 2YXVA 1W6WA 3T6ZA 4AKPA 1N68A 2GSMB 1L9RA 4KO7A 2BP8B 1KDJA 1XB6A 3RYMA 1ADWA 1URIA 5TK2A 5F7AA 3UAEA 4PAZA 1W6LA 3GDCA 3TBCA 4G7RB 1JOIA 1GW0A 2FTAA 2YXWA 3ERXA 3SBRA 1GSKA 1EZLA 5B1JA 2P80D 1BAWA 2GBAA 1WA1X 3X1FA 3X1GA 4GP4B 5B1AB 5TK4A 3TA4D 1AZUA 1X9UA 4TXVB 1L9OA 1A65A 3ABGA 3ZIYA 4KOCA 4NAJA 3CZUB 1NDTA 4BDVA 1BQ5A 3MBWB 5B7EA 1BYOA 1HAUA 3T9WA 2IH8A 1CURA 3EH5B 4GXFA 1SHXA 4QKTA 1AZCA 3WG7B 1AANA 1ZDSA 2DYRB 1M9WA 3KW8A 4DP0X 2BP0B 1SFDA 1IUZA 2GIMA 4A68A 1SF5A 2Q9OA 3DKHA 1ID2A 1R1CA 3PXLA 3PCYA 4YL4A 3WIAA 1WA0X 3UGEA 5I6KA 1SDDB 2YAMA 2VN3A 2IDUA 4PCYA 1KGYE 1JERA 3FSZA 3MX0B 1WS7A 1OE3A 4W9ZA 2DV6A 2AZAA 1J9QA 2UXFA 5I5JA 1NTDA 2HRHA 2X88A 4F2EA 2ZWNA 3ABMB 1JVOA 2VW6A 2DWSA 3QJUB 2BP8A 4K9JA 4L0PB 4YSSA 5I6LA 3FU7A 1J9SA 1RZQA 1AS7A 1KYAA 1OF0A 1AG6A 5I6OA 2PPDA 1J9RA 5PCYA 4RH4A 1GY1A 3WI9A 3WNIA 1AZBA 3PAZA 1B3IA 1HFUA 4DP4X 1AQ8A 3ASNB 4G70B 4YSPA 2FT8A 1WAEA 3CDZA 2IH9A 3GXUB 3JT2A 4E9SA 5I5MA 2XVBA 1KBWA 1OCZB 3UACA 1SF3A 2ZOOA 4JHUA 4A66A 4AKOA 4HCIA 4X4KA 2FQEA 1OCCB 1EHKB 1WS8A 2XU9A 3OMAB 3FQ1A 4ENZA 1ASPA 2CJ3A 3T6XA 2UXGA 1PNDA 1NIEA 2XV2A 2AVFA 1A4CA 1A3ZA 1QNIA 3FSVA 1JXDA 1PF3A 4YVNA 3FT0A 3FPYA 4G7QB 1N70A 2DYSB 3ABLB 1GS7A 1SNRA 7PAZA 2IDQA 5I6NA 4QLWA 2HX8A 3H56A 4GP5B 4KOBA 2QPEB 4YSUA 2QPDB 2PPFA 1KBVA 3NJNA 4KNSA 2IAAC 2OJ1A 3EH3B 5I5IA 2PCFA 4AI7A 3NJGA 3NSFA 1IBZA 1PZBA 2MRYA 1PLBA 1JZHA 2FJSA 5I28A 1VLXA 2BO0A 4DP1X 4YSCA 4HHGA 3QJRB 1AR1B 1ASQA 4HHWA 3QQXA 4YSOA 1JVLA 1NIFA 1MG2C 1TKWA 4E9XA 2VM3A 1E5YA 3G5WA 1AS8A 3ABKB 2Y69B 5D4IA 1ETJA 1BXVA 1AACA 2HRGA 4A2FA 1ET7A 3FSAA 5AFAA 2HXAA 5EHFA 5ANHA 4UANA 1AIZA 1JZIA 3N55A 1GS8A 6PCYA 3L45A 1ASOA 2CALA 3FU9A 2CUAA 3FQ2A 2YQBA 1NIAA 1IC0A 4UF7C 3FS9A 3NSYA 2QDVA 1SHWA 2XXGA 2AANA 2J5WA 4UAHA 1V55B 4HCFA 2YAFA 6PAZA 2PLTA 3TASA 3CG8A 2EINB 4A67A 2I7OA 1AS6A 1J5CA 2XUWA 1OV8A 2JFCA 3FPXA 3FYEB 2UX7A 1NPNA 4DP9X 2BZ7A 2GC7C 1F56A 2AZUA 1PNCA 3H4FA 3OD3A 4YSAA 2IDSA 2J57A 4A2GA 1J5DA 1A4BA 1DZ0A 2H47C 3QJSB 4G72B 1YLBB 1NIBA 1QHQA 2GC4C 3TU6A 2X87A 3NJLA 3AG3B 1FFTB 1DYZA 1BQRA 3EHBB 2BWDA 5I6PA 2HX9A 3V9EA 3S8FB 2E86A 1BXAA 2YAQA 5F7BA 3SBQA 3FU8A
chains in the Genus database with same CATH superfamily
1CDUA 1X7TA 1F8TH 4ENEC 5EO0B 2RA1A 5DZLA 4FG2A 1TJXA 4K5NA 3UEZA 5FM8A 1MN4A 3FUIA 1IM3B 4UDUB 2EVFA 1KF9B 3OAZH 4F7EA 4BXVA 4D7BA 6FABL 3BDBA 2R4RH 3GXIA 3EDFA 3RIAF 4PVLA 1AKJA 1KJ3H 5T3XH 1PKQA 5ALBH 1HQ4A 5IB3A 1BVNT 4P9HL 4TVPL 4JZJA 1S9YA 5K59F 4LSQH 4XVTH 4OQ1A 4CSPA 3D4ZA 4KXCA 1S7QB 3CC5B 4JREC 5C3IA 2Q0ZX 1PZUB 2IBBA 3D6GA 2PTVA 3ARYA 5L8LB 1DVFB 5E5UB 4MCYA 2HX7A 3WNOA 2XHNA 2RB8A 1KPUB 4Z3TA 3AAZA 1BVLA 1RJZB 3O4LE 4LDLB 1HHIA 5B8CC 3PL6B 1EVUA 4Y2DC 2ZP8A 1SDDA 2VAAA 4OIBA 2PCPA 4GRLB 4MX7A 2HFGL 2JVUA 3HBGA 3MR9A 3W39A 2XG5B 5C0EA 2B1AH 1ZLVK 2PYEE 1BLNB 3BFWA 3JBG7 1EO8L 3GSNB 4BWWA 1BW8A 2HTKC 4PJ6A 1OF2B 1U41A 2FJFB 2GTZA 2VC2L 1FG2B 1XF1A 3ARXA 1IGCL 1GOGA 4GXVL 3W5NA 1QVOB 2WUBL 4HH8A 3CFBA 3G9VA 2C3HA 4IKIA 1C7TA 4N6QA 4I13B 1MJJB 4HEMA 2UZPA 1ZEAH 1DBJL 1QSVA 3FN0L 4W9JC 4KTEL 1WAPA 1KV7A 2IGLA 5K9QI 4Q0XH 4L5FH 4UOW1 4ABVA 4ONOA 3LKSA 1H6TA 5DTFA 5C0RH 1CR9L 1H3XA 3PFUA 5G55A 4TN9A 1WO2A 1DVFA 1PY0A 4U1JA 1A5FH 4CC4A 2DBLL 2L8AA 4URTB 4KKNA 2WIIB 1GYAA 3MJGX 4G1MB 1YNKL 1ZLSH 3N85L 3QBTB 4X5XA 3VFOA 4HSQA 4D7PA 2CGRH 2APVA 2X1XR 3JWDC 4QRAA 5JXEC 3OHXA 4EF3A 2AC0A 4X6DB 3SDYH 2C1OB 3DXAE 2QZQA 5DJ6A 5TE6H 3NCYP 1L9SA 1WA2X 3U9UA 4F7PA 3FO1A 1MOEA 4DPCX 1WC7B 1YJDL 1UASA 1GYCA 2NQCA 2CDEA 4N4YB 1F58L 4U1GC 4Z0BH 4ZW7A 3WFHA 4DQOL 3T3MF 1M7UA 2WLHA 3NP4A 3TPKA 3SPHA 1E67A 4PP1D 1KJMB 3IRZA 2H32A 1E2VA 5D7LE 4X7TA 4EI6B 4OZIA 2P48B 4J8RA 1GY2A 4PYGA 4UDTB 1LQSR 3V5KA 1HILA 3BKCH 1NGXB 1WCBB 2FSEA 2D0FA 1AGDA 1INEH 5DD5H 1TMQA 2IDTA 3K4AA 5AUMB 5HJBA 4L8CB 1B2WH 1MREL 2F8XC 1X5HA 3MSPA 3Q5OA 4YK4B 4K5OA 1T0MB 2X4PA 4NP4L 3UO1L 5TQ0L 4G8GB 2NY4C 4UZGA 5GRUL 1EEYA 4PJIA 1XMEB 4AIXA 1NFAA 2N7SA 4ZAKD 3FU7B 3LZPA 1DBAL 3ROLB 4DH2A 3QCUL 4ORGA 4HXBL 1MIML 4K7FA 3IGAA 4OCMC 4TUOA 5JHDA 3QFJA 2YXFA 2EUXA 5HDBE 3OWRA 4GKZA 2UY7A 1EX0A 2PYEB 1OAUH 3ULSA 1B0GA 2VDOH 3QJTB 3NCEB 4HOXA 3WN5C 2FT6A 5DJ6B 3VWKB 2JH2A 1YO4A 4UCFA 5D2NB 4LEBA 2H1LM 3RDTD 4OCYL 4UT6H 3V4PA 4YQXL 1L0QA 2GB2A 4OFPA 5MEND 5B39B 1INQA 4EOWL 2L7JA 1CLOH 3NCCB 2J43A 3THML 3T8XA 5GGQH 3D48R 1HYSC 3BWAA 1ES0A 1CE6B 4RVBA 2F53E 2BZCA 3F7PC 4UTBH 2I24N 3VFMB 4XMLL 3VA6A 2VM4A 2K9FB 3IJHB 4FFYL 5JORA 5G2NA 1A6PA 1YEJH 2F8VA 3P4LA 4OZGA 3APDA 2B4CH 4ZUWA 2G5RA 4PJBA 1OSPL 4JG5A 4HJJL 5E4OA 2JCWA 4NIKB 4BGLA 3HG1B 2FO4A 4CSSA 1L3NA 1WBXA 2K3HA 1AP2B 3WMPA 4KNQA 5CCGE 5FGSA 4YH6A 5GS2D 4ZMNA 2C1OA 1FWXA 1BVKA 3E9TA 1RJZA 3GGWA 4TVPD 4BQ8A 5G4OA 3UAFA 1CYGA 2WLYA 2YPLD 3S34H 5J5EA 2M8XA 1UATA 1ILUA 4CSZA 5I6XB 2VJXA 1LGVA 4V2CB 5CSBA 3Q48A 1WICA 4GSDL 2X70A 4QTIL 2W60B 2P9RA 1VF5C 2Q2EB 2YPVH 3AABA 3DSNA 5I0XA 3QQ3B 4NM8H 2XG4A 5DHVH 3O2DL 5C0CE 4U1SB 3ZVVA 4BE5A 3KEHA 2H8PA 3KDPB 4BSWB 1HL8A 1F6AB 4FZEH 3QUYD 3LRHA 4AQ8A 4KMTL 25C8H 3O8XA 1QFPA 3I3BA 4JHZA 5IJKA 2VXSL 1HOEA 5F97E 4ODVH 1ZRUA 3QR0A 4RFEA 4WW1A 1V3LA 4LU5H 3A6OA 1EDYA 3REVA 3HBQA 5DJ0A 4QOKE 3TWCL 4LRIA 3GS7A 2UV3A 4KJWC 3DUUB 3HAEA 1UFUA 4G9FD 2NW3A 2Q7YA 4YDVA 1NGQH 1J05B 1EZLA 4OD1L 4P59L 4UUJB 5GGTH 1A0QL 1GGCH 1QZNA 5BXFA 5DYOB 1J11A 3K8MA 1WA1X 4DZ8A 4MMXB 2P5WA 3K6SA 3QXUA 2BVOA 1NCBL 3TNNA 3ZIYA 3PAYA 3VRJA 3QUYA 1A3RH 1UGNA 3KXFB 1UJTA 4L0YA 3WY1A 4EPSA 2XWJB 1A9EA 3PL6A 5D1QD 1FYTE 3AS2A 4G11A 2P28B 3IDMB 4GH7B 5HGHA 3STLB 2J1YA 3I50H 4ZRGA 1RZJL 4YE0A 1N2RA 2QMJA 4XBEL 1LHZA 2YD6A 3VNYA 3UG5A 4C55A 3L4TA 3UBFA 4PS4L 1DQDH 1TVDA 5BUPA 4UT7L 5HYQA 4NUJB 4A6YB 1DQLL 1A5FL 3DV6A 1WFOA 2FWUA 5CNHA 3RKDC 3U1PA 2O6EA 1SY6H 3HC0B 2SEBA 5L2KE 3ESOA 1QBLH 2ICWA 4HUVB 3E6FB 2DV6A 4PJHF 2EIBA 1WFNA 2Z9TA 5E5MA 2HFFA 2HKHL 3FKUS 3LH2L 5DLMH 4OKDA 2ZWNA 4X6EA 2W9DL 2RQ8A 2JI2A 3D3VD 5EBLB 1BM3L 5H2BA 1GPOH 1VAHA 3QYNA 5D6DA 1JXJA 3AROA 3DTDA 3HPJA 5AAPA 4CMMB 4HSCX 2AXHA 4ZFZB 5E6IC 2J8UE 3JV5A 1GY1A 4ISVB 1CICA 2O93L 3WI9A 1E9PA 3HNSH 4GQ9L 1CGWA 5KSAD 3T08A 4YXLH 5TGBA 2L4OA 1DUZA 1F3RB 3ILPB 1T2QL 4YSPA 2VABB 4CILA 3QWRD 4LVOB 1E2WA 1YQVL 4Z7UE 2I9LA 2R39A 3K2IA 4X8JB 3QG7L 3SIKA 2EEDA 4KY1H 5E2TH 1CFSB 3T04D 3HS8A 1QSZA 1AYOA 2Z4QA 3C60D 4F57L 4X5WA 3EOAB 2PKDA 2IAMC 2E74C 1MY5A 1P0SE 3OMAB 4XN5A 1Y7VA 2GKIA 3SPVA 3VI3A 4J1UA 3ZL2A 5KG9A 4XE5B 3S98A 4QDGA 4X9IA 1HI6B 2E9IA 5I8OH 3FSVA 3IF1B 1OP4A 3CXHK 3REWA 4G7QB 5IMOA 5FYJL 2XNAB 3ULUD 4QOKB 4PREB 1AC0A 4X6DE 4XVTL 3SGEI 3VXUD 4NGHL 4D0DA 2V2WA 2G4EA 2IDQA 4JCMA 5AW3B 1D7CA 3GB7B 3TVMA 4QRPD 3NGBB 2J72A 2VXTL 2QEJA 2DKSA 3LSOA 4ZPTB 3GI9L 2OJ1A 1NGYA 2BSTA 3F6LA 4PJ7A 4HU2A 5FYKE 1XH3A 3C60A 1RUPH 4HJGB 5ES4B 2QL1A 5HI4C 5I19L 2HSIA 4L3AA 2BDNH 1JV5B 4H26B 3KWXA 4ODBD 4DKTA 2XTJE 4Y5VA 3QDGB 3WUWA 4HEME 3S34L 3VNZA 4DP1X 1ASQA 1L7TH 3QXAA 5E94B 1MCDA 4L23A 5DS2A 1EFXD 1AI1H 5E03A 1N0XH 5EBMA 4YXHH 4WI0B 3TVMD 4QRPA 2FUQA 1AS8A 2EXTA 2NXZB 3QUYC 3SCMB 3ABKB 4FKEA 3OB8A 3UXFA 1DSYA 2OSLB 3RGVA 3Q8EA 3DECA 4BZ1H 5AFAA 3QIUD 4BFJA 4LBEA 5DD3H 3FF8A 1QSFA 5ANHA 5D55A 3QXVA 2DYPD 5ID0A 5CF3A 4XN4A 1JJUA 1ZHNB 1I7UA 2QVIA 4HG4K 5E51A 2Q86B 3KLSA 5BQ7B 3BE1L 3IDMA 5CZXD 3DOSA 5AQ0A 5AVYB 3CH8A 2FR4A 3OXRA 1A66A 2FUTA 2BC4B 5EORH 4XNQA 4UAHA 2CO7A 2J8OA 4WENB 3P2BA 4O4YL 3EZ8A 2NQ3A 1FZOA 1TDQA 4QCIA 3WXVL 3K6SB 3N9GH 1JF1B 2EVGA 3O8XC 4F3FA 2BP3A 1J8HA 5DYOA 5C3LD 1UZ8A 4YDNA 1GCFA 1OV8A 1MUJA 3VGAC 1LD9B 1CFNA 2UX7A 4OCXH 4IEFB 3NCJH 1F56A 2AZUA 4YSAA 1RJLA 2XN9E 4HWNA 2DQDL 5TDPA 4G9FE 3FRUB 5IMLB 3WIFB 4PJ9B 4Z7IA 2VR4A 4FYQA 3T2QA 4XMKH 3KGUA 4G7YL 4PWHA 3QS2A 1WZKA 3PREA 3R8QA 1ND0B 5E2VH 3NA9L 4HK0A 5C0BB 1TZGH 4ZD3L 4G8FA 3GSQB 4K94H 1B0RA 2E86A 3ECBA 4GS7B 3MLTA 5HJ3B 2ZX9A 3ROOB 4JMNA 2BNRB 4ABWA 1BOGA 4W9EC 4YIQB 1FIGL 2CUHA 4BUGA 5HD8C 2L04A 4Q9CA 3G9AB 1AO7E 4AENA 1O6SB 3QNXB 2PETA 3RU8L 2FYYA 3CVBA 5TE4L 4IBZA 1M57B 4OVVA 5E99H 5K39B 2E27H 2MQ3A 5EOTB 5JLZA 5BQ7A 2WYTA 1OTSC 1JGEB 1CTOA 4O2CA 4V2BA 2Q76A 5I66B 5GRWA 4DP2X 3L17A 2FQFA 3NAAL 4EZMA 3U83A 2B39A 3I6LD 1HL4A 3QI9D 4XZUA 2QT6A 5IJVA 2ZSWB 5E1AB 5EZPA 4OJDH 4JFEE 2D7TH 2L3BA 1H19A 2OR7A 4GQQA 4JN1L 1FVCB 1NIDA 3S36H 1CLYL 5EDSA 2MHAB 5I1GH 4JEGB 3D0AA 4JLRB 1C8PA 2UXVA 2X4OB 4XAKD 1OE2A 4CAGA 3GSUB 1LP9B 3VXME 2DH3A 3X17A 3T4AC 1CGSH 5AEAA 1ILSA 5KYUA 3E0GA 1RZ8B 2VIRA 1RFDH 7TAAA 1QR1A 2OMWB 4ZK8A 1ZA6A 3VXSA 3FAWA 3QG7H 5I75B 2WZAA 2DMHA 4APQA 1KCUL 2R1WA 3AWFA 3FCSA 4PRIB 4U6VL 4OLXH 2C3XA 1DSFL 3MN8A 4IMKA 5GGQL 3IMVA 1IJNA 3QI9A 3UG3A 1GS6X 3BVXA 4WW2A 2OX5A 5EEVA 3IB4A 1S7WA 2K6YA 3WNJA 2BHZA 2H2SD 2D31B 2CAKA 5D4HA 4Y2NA 5DHMC 4LGSB 3KCPA 3VX0A 2JLPA 3IMSA 4PREA 3IGKA 3C6SB 2YPKB 3NJKA 5DJYB 1AQHA 3PQYB 3SY0A 4XNMB 2E5EA 2A73B 4NZJA 2O6PA 3LRMA 2G9HB 3SGKC 3EJZC 1D9KC 1DQQA 5F7WC 2KS0A 4PJCA 1RIVH 1S7VA 2WLMA 3EYUL 4WWKC 3ROLA 4GRWE 1GKOA 3L3JB 4BFNA 4UT9H 4C4KT 3KBPA 2QV2A 1Z9MA 2XC8A 2ZYIA 1PZCA 3QG6A 4UYQA 4PU2A 4LKCA 3ZE1B 4KROD 4RNRA 5JPNA 1AOZA 2ORBL 4UQ9A 1E9OB 3NJJA 1LILA 1EEQA 1DLFH 3M88A 1N59A 3RWHB 1JZDC 3RPIA 1RURL 4KZDH 5L8JB 3BP6A 3RWGA 1I3RB 4X5PA 4D94A 1JUFB 4YHIB 4F5CA 3WCYA 1HDMA 1CF8L 1MHHA 4DGVL 3DX4A 2JJSC 5AVTB 1E30A 4DVRH 4NT6A 5FUOH 2AS5M 2TRYA 2WWMC 2ZSVB 4U0RB 1NEPA 1PZ5A 4V1DE 4CBPA 2KERA 1K4DA 5KVEE 1AXIB 3I84A 2CJTA 2ED9A 4JZNA 2KPNA 4POUB 3RHWK 2NYKA 2VISA 2WCPA 5KSBB 1SJHB 2I9TB 4KTGA 3CPUA 4JFEB 1E50A 2IO5A 2MHAA 3NACH 1KYUA 1DVYA 4BGDA 5DRNA 3QJVB 2E7HA 2P49B 3C8HA 3AQDA 3QDJE 2K8QA 3NDZE 2PP9A 4XP4L 4EIZC 1NCBH 1Q1PA 4R4BB 2A6IA 3T71A 5IVXB 3NCFB 2K6ZA 3WKPA 2X4TA 3DGCR 2CBOA 4G42A 1O7DC 1NCAL 5TJWK 3GDBA 1TTCA 1WFIA 1A6AA 4NQTA 1H6EA 3HZMB 2XWCA 4I0PD 4DUWA 5EIIB 2WSDA 1K6QH 4IDLA 1D5IL 5AVSB 1BPVA 1MLBB 2ADIA 3SDDC 3MRIA 3QIBC 2O5ZH 3H8NA 2UWEF 2VSDA 1BZ9B 1KPVB 1QEWB 4AYFB 1YNLH 4EZLA 3BUQA 1ECYA 1SUJA 1EJ8A 2CBQA 4PRAA 4ETYA 3PP3H 3V6OC 3ZQ9A 2NZ1A 2N0MA 1BP3B 4A2HA 4X5LA 5KSVA 5I26A 3FH8A 5KBDA 4HWBH 4P9HC 5IOPB 2ZAGA 3BVVA 5H35B 3V7MA 4H20H 3LEYL 5D1QC 3FW6A 1KXTA 5CEZE 3C2SA 4A37A 4DP5X 4U3XA 4U2YA 5HVHC 3DX3A 4G6AC 1LK2A 3ULAB 4YFEA 3KLDA 4KQ4L 2AGJH 3TV3L 3D12B 2FEEL 3X12A 2C9VA 2DWTA 4JRYD 5C9KA 3U0PA 4GMSL 4PG9A 4MA7H 1RIUL 4AG4H 1XD1A 1H3PH 2X09A 4GKSB 4GW5A 4W9GC 3AB0C 3HN5A 3AZUA 4LEXL 3BT2L 4S0SD 3L7EB 1Q0XL 4JE4B 4JHVA 3FONB 1YY8B 1Z0MA 5GQBA 4Z3GA 1F2QA 3LNHA 2Y07L 4PHXA 1X5YA 5TH2A 3WJLC 3CSGA 3T4AB 3LTVA 3PL6C 2OSLA 3WHE1 1S9WB 3B8SA 4M62H 4WNSA 4WHTA 3S2AA 2X4RB 4P23A 2E6PA 2IAMD 3RDTB 4HUNB 4N25A 4ELME 2UUDK 4WEBL 1OSEA 1O75A 2F7PA 4JRYA 4MWFB 1JXFA 4OQTA 1RERA 2VLMD 3DOIA 1UVQA 3IETB 3KYNA 4NQDE 1OSZB 4WRLA 5DEFA 4BWUA 1E8ZA 1Z9LA 3BQVA 1QUNA 1CDBA 2DOCA 3DRTA 3F6JA 3FBQA 3E8VA 1YN6B 4Z23A 1VA9A 1G1KA 4KFMA 1A3LH 2C9SA 3QUHA 3EDKA 1N12A 2KLRA 3I6KB 1IAKB 2GSMB 3QRLA 5EU3A 5KVGL 2BP8B 1IAII 4ZMZA 2VDNH 2YA1A 5F9WC 5TK2A 5LQBL 4Z7NE 5D7JA 1EZVX 5KBKA 2QHRH 2WYIA 1S7SB 4QRSB 1U8OA 5GZNC 3SHSA 1RHHA 5T1LA 2XKNB 4ADJA 5MP6L 2FX8H 3VB9A 4JY6B 3MLSL 3OSKA 43CAB 1Q94B 2OCFD 1MQKL 3DUSA 3QFDB 4PJ9D 2DM2A 4NO2B 2X7LB 4Z7OE 3CZUB 1NDTA 3QCTH 4XCFL 5CJBA 5B7EA 2ZCKL 1XZ0A 4KTDL 2FL5B 3FHAA 2VLJE 1P4UA 5HYIA 4U31A 5D7LA 5GZNA 4FQPA 1LE5B 1U8QA 1WHPA 2GUOA 5AYTA 4MCZB 4Y9EA 1CFMA 5JPNC 2D7MA 3BJLA 5JIQA 2AQRA 2QBWA 1J7VR 3HRPA 2YN5A 4MAYD 3WDHA 1QA9A 4I3RH 4X8CA 1ZT4B 4FQCH 3WIAA 5KS9B 3V5KB 3PDOA 2FE0A 1NEZB 4GUPA 1LO4H 2WKLA 2N1TE 3BEWB 4L0ZA 5L0QB 4L5FE 3EYFA 2PYED 3T09A 2ZOWA 5EA0H 1MFNA 5TFSH 2OZ4H 3ARDC 1OIOA 4G6JH 3VH8B 1UM6H 4PJ9A 2CJUH 3TBTB 2EXSA 4JQXC 5F7DA 5I5JA 5JW3H 1KTRL 5F3HB 3L3OC 2VMDA 5KS9F 2NXYB 4YSSA 3LCYA 3DURB 4MJIE 4MMYA 1OCWL 1AS7A 1GOHA 4D2NA 1AG6A 5JOPE 2UY6A 3P30L 2IQAB 4HUVA 3FXIC 4HUUB 1EFXB 2V2XB 5IEKB 4NNPL 4WTWA 5E2VL 3WNIA 1WD8A 1CL7I 1K6QL 4K5LA 3F64A 3GSXA 2G5BB 4K5PA 3FUJA 5AKTA 5LBGA 1UWXK 2FT8A 3J8F7 5CGBA 5CR8A 4RWYH 4EAEA 5D1XC 1XWVA 1A7RL 1QW9A 4GAFB 4C59B 3G6AA 1OCCB 3ZE0E 4CA4A 3IWVA 3RG1C 2FEDD 2DQCH 5FHBH 5H8DA 1GHFH 3KE0A 2ZXAA 2EIZB 1YN7B 3CFDA 2R56H 3OZKA 3MUHL 5LAXA 1J0IA 2BK8A 2JB5L 3DO7A 4ACTA 2X6MA 4PJ8B 4Z18A 1G7PB 5I24A 2GK0B 3M46A 5DJ8A 4D3CL 1QVOA 2DMBA 3M07A 4Y4FD 5BXFB 1BMZA 4KZEH 2Y7QA 2EUVA 3DIDA 1NSNH 1TFHA 1MUJB 2N59A 3PHOA 4AMXA 2WB1A 5AWNH 2QPDB 1OP5K 4L37B 2DQTH 3PV6B 3ZDYF 3H2PA 2IAAC 1MCIA 2DWDB 3APNA 2R0LH 4NM4L 5K33A 1CDGA 3HCVB 3GMPA 4ZMYA 3CCHB 3DUHA 5I0ZA 4Y19B 3HW7A 4OGYH 1DO5A 3UROR 3ULVC 1LE5A 2ESVD 2PWGA 1U21A 2ZCHH 3WNPA 3OAUL 5CZVL 3OC8A 1LO2H 2J3SA 3NVQA 4XC1L 1KGCD 3BH9A 1MCOL 3QJFA 2Y07H 3V5DA 3C09B 3WV0A 2VO5A 1G7HA 3DSFH 3I2CH 4WUUE 4KGLA 4RAUA 2I69A 4PJXA 5H37A 5FR3A 4CJ0A 1XF3A 1BREA 4YSOA 1AD0A 1Y07A 3IDGA 4N90D 3TBSB 4MA7L 3ZGHA 1TKWA 4UQ2A 5KYXB 2ZXQA 3MRNB 4K3DL 3C08H 4XNBA 1MWAH 2ATPA 1N3NA 2NNCA 4H0HB 4ZG1A 5D4IA 4ATWA 3FSOA 4R7DB 3I3DA 1OWRM 4OH2A 4WHYG 5D93C 2FZ3B 2R4SH 5ILTL 5IGXL 1KJVA 4F2ME 3FFCE 4HAGA 3WUWB 4PRIA 4M56A 2R1WB 1ASOA 3FCSB 5F8QC 2Q8AH 3W11C 1L7IL 5L88L 5E2JA 3VGHA 2Y1YA 4M7LT 2QQLH 4AZ8B 1GRWA 2XTLA 1JPSL 4N5UA 3OKEB 4XPHL 1FFPB 4XP9L 2YAFA 1KXQA 4BA0A 2Z31C 1KLUB 2A99A 4FTVE 2K1MA 4M7JH 5HD8D 1TIUA 3LRGA 4HJ0C 4UINH 1XGRA 2LU3A 3RKPA 2EINB 2I7OA 1CD0A 3IU4L 5HDRA 5IVNA 4HV8A 2YMOA 3ZR6A 1PNCA 1TTFA 2V5SA 5K9JH 3EAKA 3RZCD 4KKRA 4MQXD 3W3BA 4UT9L 3E6FA 1DZ0A 1A4BA 5ESAA 4ZW6A 4NZTL 3N1PC 2NY6C 1MFDL 1M71B 3TU6A 2SODB 3L4UA 3S88L 2Y9RT 3JUZA 5AB2A 4NUJA 5GGRA 2HT2C 2BY3A 2XV6B 2CPCA 2YAQA 2WO4A 1LXMA 1TVHA 2MWCA 4LZKA 4PGCA 3CLWA 4XWGL 5FHAL 4GKZB 3ZDYE 1EAOA 2ENJA 4QRTB 5D2LA 2Z1KA 3U0WH 4HDIB 5LLIC 4TOYH 1A2YB 1AYRA 4PRHE 2BOLA 2HRLA 2G2PA 3H3PH 3N3EA 1PW3A 1X6NA 3C87A 1DN2A 3O3EA 4HKJB 4RDQF 3FB7A 4XN2A 3QDME 2Y7MA 5D7IA 4R8WH 2PNDA 1BZEA 3MV8B 3WS3A 4IGBD 1V05A 3AWEA 4QRSA 4N2OA 3CZLA 4YDMA 4LHUA 3L08A 3W0WA 4N8VB 1MH5A 2EDBA 1I9EA 3NFSH 5HYJE 2P26A 1NMBL 2Z34A 3O6LL 2BW5A 2Q7YB 3DRTB 3N0PB 3UYRH 3CFEB 4OZIB 1YAZA 4HOMA 2KZ1B 4P49A 4TLSA 1E6JH 1Q4NX 2VLJD 3ENEA 4PJ8A 4UV4H 2MQCA 3TPUA 3WEXA 4BSVA 3QB7C 1KG0B 4ZFOA 4RFEB 2FK9A 4JG1H 4KO5A 4NRXA 3SPIA 4KHTH 5EBWB 1HSAA 1IKNA 4HIHA 4P5SA 5A2BA 5F8RC 3TNMA 1L9QA 3EIFA 4X9YA 4BSWA 1XGYL 4LVNC 3VU2A 4XPGL 7FABL 4HWZA 1IL1B 3F8UB 1DZBA 3N1FC 4EEEA 1F5WA 2FLMA 4WJ5B 4O02B 3QDJA 1T1ZA 2VUYA 4FNSA 3DI2B 4M03A 2V3EA 1P5VB 5HYSA 4LCCA 2PR4L 2QQNH 3RRQA 4W9DC 3U30C 1U2YA 4HUXA 2EJ1A 1FHNA 4O2FA 1DSWA 3KXFA 3RY4A 1F4AA 1QNZH 5CBEA 1A6ZB 1GC1H 5JW5B 1CB4A 2LAAA 4FEMA 2AV7A 1SXAA 4S11A 3QXAB 4CVZB 5KVDH 2Y4SA 4UQDA 4M7KH 5ETUA 3OJDB 2ETWA 2AJUH 5D8JL 5D72L 4ZS6D 5CGYC 5JMOC 5BNXD 3O3DA 4HJ1A 4OF7A 1ZLUH 2ID5A 1FDLL 1FNSL 2GTWB 2JMRA 1N6UA 4YWGH 3S3SA 3TFKD 4M5YH 3FO9B 4PCKA 1B2YA 2BW4A 3V0GA 4DKEL 3EXLA 3T2LA 3K6FA 5E0QA 4LLMB 4N5EC 1ZMYA 5HYSG 1I8AA 1CCZA 1BM7A 2Q3XA 3BT2H 1RHFA 3OKOB 4FXGB 1T5WA 1GC1C 4NZRL 4AQOA 4TUKH 5E9NA 4NUMA 5LGHL 1PCSA 1E6OH 3KPQB 1TVHB 1RPQA 2Y7LA 3CQPA 3TYGL 3WDJA 2QSQA 1FFOB 3V5HA 1D5ZA 2QVTA 4PMEA 4J1UB 1MW2A 4WY7H 5T1JA 4OFQA 4QPEA 4N26A 3B43A 3OAUH 2QLVB 4WKXA 5ESQA 2NCEA 1CYWA 1IILE 3KLKA 4L4TB 1D9KA 4NZUL 1QSEA 4X98B 1DO6A 5E1GA 2AXFA 3TN0D 4HZ1A 5EC1A 3AXLB 1FQ9C 2R9HC 4R97B 1L0YA 1Q94A 5E23A 2O61A 1X9LA 3F7YB 3EJSA 2YWYA 1N18A 4TUOB 3N6YA 3FUKA 3DX0A 1XF2A 1OAXL 2XYCA 3PWUB 3NIDE 3HRZB 5LCVL 3O45A 3WUWG 4G8IB 5CSZB 2R27A 3FQYA 2OQJA 3VXUE 1SEBB 3NJIA 3ZTDC 5JNYB 1FH5L 2IADA 1U8JA 1KBGH 5K9JL 4X0NA 5IR1B 4AIZA 3IVKB 1PEWA 2EE3A 3F7KA 4X7FC 6TAAA 2DIJA 5DURB 4UT6A 3SYPA 3V0WL 4EDXB 4LDCA 1FF5A 4KXZH 4FQ2L 2RIKA 3B7SA 4YPGB 1HE8A 3QPXL 1PQZB 1N3NB 1B88A 3OX8A 3FJTA 1HX0A 3SDXA 4P5RA 3G6DH 1HCZA 2PW2B 4HEPG 5DSCA 4WWOA 4QKXB 1XGTB 2ZOLB 1CYXA 1E4XI 2KL6A 5J13B 4Y1AA 5IY5B 3L3JA 3K6DA 4FF9A 4BQBA 2NSQA 1ZIBA 1THAA 5GRJL 1I1AD 25C8L 2Q2LA 2DQGL 1A1NB 4IIQA 2P5WE 4PB0H 4PW3A 4NKMB 2WIMA 5DHVA 3QJHA 5DD3L 1ZVYA 5LGKA 2A6JB 4KK9D 2JK5A 2W9EL 4GSDH 1F90H 1C9SA 2BVOB 1SYSB 1DJWA 4S0HA 4F33A 2ARJB 3L54A 1QSEE 3NFPB 3VFWA 3UH8A 1CQYA 2FX7L 4JFYB 3UTSE 5CEXB 4N24A 3IT8D 4Z7VE 4TOYL 1PU0A 4K3EL 1ZAGA 1AHWA 2D3VA 3GBNL 3QZMA 2VN7A 3MC0A 3PWJA 1B4LA 1WISA 2Z8RA 5FOBA 3EXJA 2VXQL 3GPEA 5CZRA 5HYJD 1K8IB 2LQRA 1A8ZA 4JFZH 4S1RH 1IEAB 4HLZG 1Q0EA 2IWKA 4Y1AD 3IRCA 1UCBL 2FIKB 4DKFH 2YD4A 4WGVB 3AREC 4IW4C 3FUNA 1KACB 2C8NA 4OBSA 4Z7WF 1MSPA 2DLHA 4FQJL 4LAQH 1TJHH 2NXZD 2P3YA 2P80A 4WCYH 1J8HB 2ZUQC 4OD1H 1NZRA 3ZQWA 4IU3A 2CLZA 3F05A 3QUZA 1Y6MR 1CD1B 2LAGB 1KTKE 5ANMB 4GG6B 2NR6D 4BE6A 2YAOA 2QMKA 1AQKH 2R23A 2G60H 2AMUA 5C0JB 3ES6B 3QQ4B 4Y4FC 1L9RA 2Z6FA 1K8DB 2XQYA 3LZFH 1P9MA 1ZHNA 3HI6L 1N7MH 4KTYA 4YX2H 4Z76A 1MDTA 4JPIA 4MQ7A 3CFCH 3I50L 2R29H 4HUUA 2Q3ZA 4RRPG 2QGEA 2VT0A 4P2OB 2NY3B 1B3JA 4JQVA 4JM2B 4NPKA 2VMEA 5DMJB 3KVPA 4J3SA 5GSVB 3ZZQA 1BXXA 2QQNL 2FYYB 2XIBA 3UJTL 4OZFG 1C5BL 3P02A 3VRLF 4FXGA 2V9TA 4JZNB 5J3HD 1HINL 3G6JF 4TXVB 4F15B 3HR5B 4G8FB 1I8UA 4LLDA 1BAFH 4X4YB 4K8RD 1BYOA 1I7TA 3FOMA 5H37H 5AD0B 4H1LA 4F8QA 1T80A 4GXUM 4TPRL 3EH5B 3BWAB 1H5BA 1QO3B 2AXGA 3CZGA 3UBXG 1AANA 4M4PA 4PVNA 3MR9B 3O2WL 1CFTB 5FF6A 2GBTA 5CN1A 4FKKA 1D5XB 2CIKB 1S7RB 3H2QA 1RZKC 3JQOB 5EU6E 2FGZA 4AW7A 3CZNA 4LEOB 3I6LE 1P5UB 1XF4B 1DJXA 3K8KA 5F1KC 4N1HB 3I9IA 1DVZA 2P8PB 5HDQH 4JFDE 3EJJX 2R2EA 3FQUA 3OGCA 4PJAA 3Q01A 1E7VA 1YEIH 2NZ9C 1QSEB 4X98A 3HPLB 3UTSB 3UTZA 4AGPA 3C5ZC 3U2IA 4WWNA 1XGPB 2MCPH 4CU8A 4ONGH 2HLAA 2COQA 4PGZA 4X2UA 3ARRA 3BSHA 5IT2L 4YAQA 2Q6WA 3HMXL 1HXMB 2DMGA 4NZTH 5I8KL 1N5AB 2HLFD 2DLEA 2ESVE 2AF2A 3M7OA 4GRMB 2BHYA 5IHUH 4U7SA 5D96C 3R8BB 2B0SL 1NCIA 4ZMTA 5JIHA 3IJ8A 1DEEB 2VERA 2FH6A 1FI8C 3B2DC 4W6XB 4PG2C 3LHAA 2AJZB 4U3HA 2VE6A 4KKPA 1XGRB 3CBKB 1PS3A 5E6ZA 2IV8A 4J8RB 2VM9A 3RKDD 2PW1A 4TSBL 1NA8A 1F02I 1WUZA 1YEGL 5I6XC 1PYWA 4X6DF 1T3FA 2XU9A 2A9ML 2DQFB 1Q9OB 4TNFA 1MCNA 4U7KA 2DH2A 3FO1B 2V9RA 4JJ5B 5F0MB 1ZK9A 1UXLA 3ZDXE 5KTEL 1QFWH 1NAMB 2BIOA 5ETUB 1A3ZA 4Y1TA 5F3BA 4XE0A 3GSUA 2QFRA 3A24A 1HXKA 3NFSL 3SE4C 1WLHA 4Q56A 1R0AL 3DROA 3O6LH 3LB6D 3MRJB 2HJKA 2YKLH 1HL9A 2HX8A 4UM9D 4XT1C 4NZDA 1G43A 1F90L 3UTTE 5DRWA 5JUEH 5TF1L 2I60H 5EU6A 4QR7A 5DR5L 3AXLA 3B6SA 1R5WA 1J8KA 1X5ZA 4TL4A 1GZHA 3D08A 1S9VB 4OCXL 2FLRT 3OPUA 3L5XH 2JCCA 3PGFH 3ARED 4GLRH 1A21A 2DF3A 4QRQA 1RMFL 3BQUB 4OCWL 4ZTEA 4JPQA 5SV4A 3VAEA 2Y25A 5FK9B 2CKNA 3JWNH 2ZUXA 5MEQB 2D7NA 2VLRD 1INDH 2LTQB 3G5ZA 3VSQA 3V4LA 4YHYB 5T1MB 3WTVA 4ICXA 4LIQH 1B6DA 1XCTA 2NNAB 5TGBB 1DVQA 2W65A 1HN1A 5HHOE 3DV4B 2YSSA 3KGSA 1ET7A 3OAYH 3ZL4L 2TRHA 4UANA 2ICWJ 3L7FA 1AIZA 3RU8H 2W95A 4QHLB 4FLOA 3ZKXB 4XX5A 3N5AA 3TFBA 1JRHL 4GG8A 4M7LH 5JXED 2XPGB 2IPTL 5IJKC 4YLCA 4PJEE 3QAZB 1YUKB 1MF2L 3B9VA 1S3KH 3KYMA 5BZDB 4YHNB 3UBGA 3EFOA 1EEZB 3NA9H 1HKFA 1TNMA 1B0WA 2N7AA 2VRKA 4GNKB 1ZS8B 3QZWA 2NDGA 1I9JH 1REIA 1IMHC 4LVEA 4A67A 2GJPA 4PJGA 4L4VB 5GHWL 1LE9B 2R2BA 1HVXA 1Z7JA 4AEIL 4ZFOL 1EGJH 2Z8WC 3ATBA 3RWIA 3B2PA 3HBZA 4A2GA 5FYJE 2E9JA 4HIEA 2XY2A 2BS71 5CEZL 4MBOA 3MCKA 2D2OA 4D0BA 4MJJA 3TTYA 2E75C 3PRZA 3AUVA 3BT0A 3QFGA 4R2GD 1DYZA 2FBJL 5J11B 1P69B 1B9ZA 3EFDL 5I6PA 3U4AA 1HCYA 3BGMA 3EHBC 2XQ0A 3FB5B 4HBCL 5AAMC 4ETQB 3VW3H 1CGTA 3VXQB 2XN9B 3RVWD 1UJ3B 3O3AA 4WWID 4IU2B 4GRWB 2AP2A 3WAJA 3QEUA 5GISL 1AR1D 4YDJA 1DJGA 1UXMA 1QG3A 1HINH 3DHUA 2JWYA 4AX3A 3CHQA 3RFRA 4IRJD 1NJ9B 3H9HA 3TA3B 2X9YA 4HFUH 5L2KD 4JFED 4OJYA 4EN3A 4PLKC 4LLYB 3MNDA 1FZMB 3WEMA 3HBPA 3KPRA 1KCUH 3B2UD 4ANVA 4DPBX 1BQKA 3HS0C 1NMCB 2YUVA 4NI3A 5E08H 1M2VB 4LMQI 3TF4A 2EYSB 1E3XA 1JGLH 5JQHC 1I53A 3AQXA 4LCWD 3ZBMA 2XLLA 4P46B 3VFPA 4YSTA 4F5CE 4P57A 1S9VA 5DJDB 4L8DA 2XYBA 4G5ZL 4LLQB 3BIKA 4LQ1A 4R83A 1URLA 3CDYA 2BINA 5BZWA 4ADGA 1A7QH 5IK3B 4FMFA 1YEFH 3QIBB 3AWGA 2HPOA 5KJRH 4KROC 3MUZ1 4GSQA 1NWOA 4Y9GA 3CN0A 1W8EA 1ROCA 3BAWA 4YC2C 1M2VA 1EEYB 4MB5A 2E9WA 3CXDL 3EYUH 4L4VD 4PJIB 1FL5A 1UT2A 5DO2C 3KPRD 1LWHA 2J7LA 4CN6A 1AXSA 1DLHB 4ZFFB 5ACMA 1AZNA 3VDBA 3QJXA 4M3HA 3W2DL 2E46A 2NY2B 3GRWL 3DPDA 2EEBA 4TM9A 3NJVA 1NJ9A 3CLEL 1TZHB 4GW1A 3V8CA 1VACA 1QLEH 1CPUA 1PEZA 4K9EH 4MHHI 1Q90A 1AAJA 2V7NB 4ODTL 3T6VA 5AYQA 3PGCA 3FHEA 3EYFB 1HK6A 1YECL 4OT1H 5C71A 1JPTL 4S1SL 1N6QH 1FGVH 1IQDB 4OZHB 4TMPA 4DEPB 2CQVA 4X99A 4Z95H 2CNZA 4UMSA 5EU6B 3LXBA 3RP1A 3BW9B 2G5UA 4JUSA 5EA0L 4DP8X 1JF6A 4G8GD 1UM6L 2F8OA 1SYVB 3AB0B 4YSRA 3WJJC 2CK2A 2VL5B 3ZYIA 5IBTL 4YMPA 4J3VA 3AC0A 4JPKL 4PTUB 4CNIB 2BNQB 3MNZB 3SB3A 4R0LA 4NQQA 2A83B 3OKMB 3GSXB 2WBJA 3EO9L 3Q2LA 4O00A 1AD0B 2PXYD 2OTPA 1E4HA 1CG9B 1DBML 3NP3A 1BGXH 2EDYA 3PV7A 5AOLA 43CAA 5HPMB 3VH8G 1BBJA 4AQAB 4HK3J 1MHCB 3UBHA 2JJTC 3C5JB 3HR6A 3LKSB 5DTFB 5C08A 3S6CA 3GIZH 5EB9A 1WAAF 2C4FT 4MJHA 1WT5A 1HKLL 3EGXA 5AB9A 1G7LB 5F7UA 5I71C 4G8GA 3OLGA 1IM9D 2NY0B 4H8UA 1OTUC 4PJGE 3ME0A 3G08B 4H20L 5HHNA 3LEVL 4WHTB 3HHSB 3V0JA 1DVFD 1Y1UA 4HX1B 1E9QA 1IC4H 3ECWA 4I4WB 1PG7W 4YO0B 3MBWA 5EZIL 3PDOB 4UNVA 3FH7A 1M1XA 2PXYA 3QQDB 1BZ9A 1KPVA 3R19A 1NFDA 4D0CB 5LDUA 2WB7A 3L5HA 3RWCB 4QXUH 5L9DL 3D85B 4DOHB 4BZ2A 4ZUSA 2CDEB 1WK0A 4HGMA 5C08D 2I5YL 4AC2A 4M8VA 3IU3A 3IEAA 1OE1A 1MNUH 1GSMA 1TZAA 4K07A 5I74C 3WKMH 1WFUA 4ADIA 4MMZC 5EIQA 3UPCA 1NINA 1FNFA 3G6AB 3K71A 3GPSA 4L5FL 1Z66A 5FM5M 5ADOH 1OHQA 5EEYA 2AGJL 2KLSA 3QEGL 4JB9H 2XZAL 1C5BH 4FMVA 4WNJA 4TVUA 4PCSA 4HPYL 3V0IA 1YEHL 5JO5A 5ALCH 1UWXH 4MDIB 4NSKB 1I9JL 2R23B 4M5ZH 4WI0A 5CJQL 5KYYA 2B8OT 4GW4A 3O6FB 4X0KA 3VFVB 4AY0A 4LCUB 2WC7A 1EJFA 2QELA 2XN2A 1CFQA 4K3JL 1AD9B 4LOVA 1S7SA 3OXSB 4MBRA 4MXWH 5J1SC 1E65A 4LXFA 4ZJ9A 4ZSOB 5B21A 3IS0X 3WDIA 2N1KA 5J6HB 2IFFH 1QLRB 3DX6B 5MEQA 1U42A 4AWJC 3EF7A 4HJJH 1O6TA 4NFBA 3SODB 3TJHD 5JHDD 4KX7A 4HPOH 3PP3K 4J6RL 2WTRA 3UC0L 3BXNA 3MOBH 4XO5A 4PM1A 5CD5C 3VD1A 2XKUA 1BD2A 1SVBA 3MJ9A 1G0DA 5GS1C 4RIRA 4JRYB 4X4ZA 1CGXA 1ZV9A 1FG2A 4P48A 4AV4A 1UADC 4OD3L 3RDTA 3KAAA 5IV2A 4PV8A 4X6CA 3SDCC 4QYAA 4FAAB 4P04A 2CDFA 1R3KB 4UTAA 3VCLB 3V10A 3TJEL 5IUCA 1RUQL 2IWEA 3CGTA 1AY1H 4JQIA 4MX7B 2CO6B 1OSPH 1EXUB 2K8MA 3D25B 3I9GL 5L7XL 4EO5A 4FQIH 4OIIL 2Q6WB 3S37H 1BYNA 4YAQB 2IPKA 3A4EA 2CBPA 1IM3D 3AY2A 3VFUA 1DJSA 2Q7NA 1UXSA 3BN3B 5E8OA 5GRVK 3WO3B 5IBUG 2AEIT 3Q6FB 2FIRT 3KPNA 4UQ3A 1G7IA 1QLEB 4X80H 3WJMB 3IMWA 5DVOA 3KPSE 3BFQG 4Z3IA 2FIKA 2OBGA 1DR9A 3OJMB 3GSNH 2RD0A 1A8JH 3CPLA 3RAJH 1GIGL 3TCXA 1UYWH 3FHQA 3AMKA 4PJ8C 4WK4B 5FOBB 5EOQH 5GISH 3ETBF 1ZWIA 4YJZL 4ZXBC 1S7WB 1HHJA 2CBTA 5LBSA 5F3FA 4L4TE 4YQXH 5IB1B 4LT7A 3TEZA 3ARDB 3K2KA 3EKCA 3CFJA 4QRPE 3BFOA 4NIYE 3C9NB 5AKVA 3SDAC 4XAKE 4APQB 1Q0YL 2DD8L 1J5OH 1T04A 2WWMD 4JAMB 35C8H 5IFHL 4LDEB 3EYVA 1ZXKA 2VXVH 2ICES 2M83A 5IG7B 3IDIA 3V4VH 3X1FA 2J5LC 5AZ2H 3S0PA 2EP6A 2H6OA 5TK4A 1CMOA 1AZUA 2X4OA 4GFTB 4YNYB 3QQ9D 4B9CA 4M6OL 3D2TA 2G2NA 5FCUL 4RDBA 1I9IL 5HHMD 5EEWA 4JVWA 3BPCA 3I9PA 2PWFA 2YUZA 4BCXA 1F1AA 2Y7NA 4Z5RB 2B4CC 3SDAA 5TE7L 2DJMA 4JFSA 1G9HA 3IPBA 3WJMA 2IG2H 1Z9OA 2AXFB 3VXOB 4OLWH 2Z93A 1SY6L 3UTTA 2MKWA 2X6BA 3V4PH 3NCWA 1V7MH 2ADJB 2CGZA 4G9FA 2BFGA 2WTRB 3QUML 4JRXB 2O5NA 4MDRA 5DVPA 1EV2E 4EN2A 4O9HL 1F58H 3FN3A 5D7IF 1JIBA 1LO0L 1SN5A 2XWEA 2FJHB 4X4YA 2YPKA 2GSGA 1CL7H 3K1DA 3OF6A 4HMEA 4QRFA 5DJYA 3FTSA 3RUGB 3AADB 3MLYL 4OM0L 2NDFA 4F2EA 4X7DC 1OGAE 5I8EB 2C3VB 3FAXA 5FYLL 4GI9A 3FT1A 1XF2B 1J1XH 5FLUA 1MCPL 3KPMB 2JCCF 3LD8B 2PPDA 4JG0L 4BA8A 2OZNA 1I3RA 2WZPA 5BRZE 4P5TA 4HKBB 3MBXH 3W81A 2ROXA 5IJBC 4MNHB 3PQYD 3GMOA 2WXPA 3KPNB 4UQ3B 1AZBA 3MRPB 4PJEF 4WHDA 5DFWH 1T4KA 1I1FB 4RX4A 4Y1SA 1UD8A 2NY6B 1I31A 5INDA 3CMOL 2VLRE 2VR9A 4P59H 2H8PB 2XVBA 2BNQE 3FUFA 2VCOA 4LCUA 4AEIH 3F7RA 3KPQA 3GHPA 5GGVY 5C7XL 3IYLW 1KTDA 1TO5A 4O2FB 4WFHD 3FZUC 2O5YL 1C5CL 2ADJA 4G9FB 3NSXA 3UYPA 4PJBE 1NIEA 2X4TB 4JKKA 1M7DB 1J8HE 5CP3H 3L9YA 1IL1A 3AVEA 2R0KH 4MAZA 2NMSA 1YPZA 2ITFA 2O6CA 3C6SA 1U8LA 3LVTA 3NIGB 4P3CL 3ZKND 1YUHA 4Z7QF 2OLDA 4RX4D 4HPYH 4AGLA 2AQTA 5GPRA 4P2RE 4FFYH 3GNMH 2FYVA 1KB3A 4BFFA 1MCKA 4NGHH 1IGYB 4DZBB 3JZ7A 4JANA 5F89A 4YO0A 1JZ6A 1BQLH 3HIZA 1E9QB 2XPZA 1BM3H 1PZSA 4H7VA 5FXCH 3LQAH 1F3DJ 5IMLA 4CW1A 2BXZA 2RGSA 2Q86A 1CXLA 4MQTB 4NBZB 4HK3N 3MV8E 3EGXB 1N59B 4LSVL 4MQXC 5CSZA 3RWHA 1BFVL 2AQNA 3G5WA 4AYBA 4NQEE 5E8EB 3W0WE 2FWSA 1T0PB 5C3TA 3LKQA 5DSCB 4Z8FL 1U8CB 4NN5B 2PO6D 2GI7A 1JNLH 4XNQB 4B9JA 3QEQA 5HHVL 3BPLB 1BQHB 1YPZF 5CLWA 3IGAB 3L45A 4R3SA 2BNQA 4JKWA 4NQCB 1NIAA 2DL9A 3MRHA 2A6KB 3FS9A 4BK5A 1WITA 2EDDA 4ICWA 5DJZA 2CR6A 4P2OC 1OGPA 3KYKL 2NUTA 4XODA 4P3WA 5I8OL 3K80A 3VXSE 2KYIA 4G8GE 1JRHI 4I3GA 1P6FA 5FUCC 4PJBF 4C8XA 5IB1A 2AJYL 1MEXL 4KJQC 3GHBL 1A0QH 4E2OA 3U7AA 3KWWA 5L4JA 4EDXA 3B9AA 4OFDA 5HJDA 3DNKA 1KEMH 4LCIH 4OFKA 5FYKH 1JPST 1QSFD 2DYPA 1SQMA 2H47C 3O3DB 3NPZB 1YLBB 4MZIA 4KHTL 4NHUB 5SX5H 3LKNA 2X87A 1QR1B 2X44D 4L29B 3DJZA 3VYOA 1KMGA 2WQUA 5IQLA 3EUDA 2HA1A 1HZHH 3MNZA 4LVNB 3CZSA 3L4VA 4ZOBA 2OQJB 1X5LA 2AK4A 5JOFA 3ARFC 2PTTB 4HT1H 2WQWA 1R19A 3QYMA 5EZIH 4PRNA 1FGNH 3BRGC 4V11A 3WN5A 1CBVL 2P8LA 3BO8A 3MLZL 4CC4C 3R06A 3TIDA 3NN8A 1KWKA 2Z8VC 3DMMA 5B1JC 1C8QA 5IEHA 2N01B 3GRWA 5ABAA 2ZUVA 3RZCC 1OTSD 4EBQH 2Y7SA 1UWGH 2X2IA 4PRDB 3RTLA 3TO4D 3HC3L 4L8SB 4WI6A 3FO9A 2BSBA 3NJFA 1KPRB 2MNUA 3KWUA 1KTLA 2E27L 1CLVA 4CDGC 4NNXA 2DLFH 3O3AB 3FULA 1CD8A 4G43B 4AJVA 1XSOA 4JZOA 3VI4E 1KFGA 3FT2B 4Y1AE 3RIKA 3NMEA 5T5FA 3DRQB 4PMFA 1W9XA 4QOKD 2PN5A 5C86A 4R4ND 1RKRA 1A1OA 2PXYB 2B14A 3CFIC 3QQDA 4XNXL 1KZQA 4L3EB 4UIMB 1JPFA 3PDGA 4RGOH 5D6CB 5IROC 1OLZA 2AV7B 5LUMA 2NW3B 2YA2A 4K7PH 1HQRA 4ISVA 5KSAC 2XPYA 3ETSA 4FXTA 4NKOB 2YA0A 3KPLA 3JV6A 3WGVB 3QA3A 5HHNB 4QHNB 4W9CC 2BMKA 1FDLH 1FNSH 3BGFB 1RSFA 3LXUX 5DJ2B 2QHLA 4EN3C 5ADOL 4I0CC 2Z7UA 1I9RL 2E7DA 2WXHA 3ZSTA 2J6EL 1QHPA 1LK3L 3AG1B 4Q2ZB 3J07A 4FI8A 5C0CB 1TSRA 5HGHB 3RE0A 4XP5L 1U8PB 4K94L 4YE4H 1PZ3A 3CX5K 3KPOA 4ONHA 4P5MA 3BD4A 2AEPH 2F61A 2DM7A 2Y1ZA 4DT2A 1NLDH 5L4FA 3T5WA 2DQHL 2R2BB 1TLKA 2EDLA 2YPLA 3MLXH 1VB9A 2FHFA 4PJXE 4WFGE 5IVXE 2X1PA 1JGDB 4UV7H 4ODUA 4RDQG 3J7HA 1YZZA 4NQVA 3KYAA 3APFA 2HN7A 3L1OL 5AW7B 3P0VL 2HJFB 4F7CA 1KUMA 4Q97A 4XB8A 1YSOA 3TH2T 3G5ZB 5LXGL 4WO4A 3VXQA 3MREB 2QQKH 3ULUF 2MPAL 2KT6A 1UB5A 1TEYA 1YYMH 2EIZA 5KVGE 1CD9B 1OAJA 2G4GA 1O5PA 4M6NH 1J8SA 1FG9C 5B1BB 1WEJL 3P9MA 1PD1A 1XH1A 2HT2D 4Y19D 5T3XL 2KLTA 2GAZA 4BFOA 3HKZA 3CLFL 1S6NA 3HPJB 4KXBA 5C92A 4G83A 1JZJA 1FNGA 5DA4A 2HWZL 4XRCA 4XNZC 5T1MA 1JNLL 3WNLA 5IKCB 1SLUA 3BYYA 4QXVA 2EVIA 1MNNA 2GHWB 3ZHFA 2YD5A 3GS0A 1X5MA 4S1DC 1A9BB 2TSAA 3P3TA 5EH1A 1CF8H 2DQGH 4FFYA 4DGVH 1NC4A 1IBFA 3KR3H 2P7TA 5GGVL 1IARB 1LO5A 1IBGH 2Q7AA 3G5XA 4JFDD 1K85A 3PJSA 3CFUA 5LBSH 4MXQC 4JFFB 4KDWA 3OVUB 2YARA 2UZXB 5BZWB 4H13C 5AW6B 1TENA 3AT8A 4QY8B 3IDJB 4PRPE 4YSQA 4PJ5E 1Q1JL 1ZGLA 1ODAA 1T21B 3JWOC 3L2LA 4IRZA 3S9DB 3VACA 1AO7B 4OFVA 5HI5C 1NC4B 1RHHB 5T1LB 3TGXA 1U8HA 4DK3A 1G84A 2MSPA 2Z4QB 1FAKT 35C8L 5IFHH 1RQ5A 3LZOA 4JCLA 4G6FB 4QHKJ 1KCLA 1X4YA 2X6AA 2EXYC 4N9GB 3UADA 3RNQB 2GUOB 5JZ7C 4M6ML 3AS0A 1I3VA 1A3QA 4BCZA 1IBBA 3RFZB 4XO4A 3BLPX 2JCCB 3UZEA 4WEMB 1LDSA 4H8VA 1IBDA 1JGIA 1FFPA 2JIXA 2OCJA 2Q8BL 4NZFA 4HS8H 2FJGA 4N2EA 1MCCA 5JYMA 3OMIB 3EADA 3SBWC 4AL8H 3VWJB 4CC1A 1CICD 5FYLH 2W9LA 3LZRA 1P84J 3LKQB 5LWYH 4LOEA 3R7QA 4DGYL 4F7CB 3QUMH 5MHSE 1KN2H 1FYHB 1UWGL 2ZKHH 3TO2B 4P2QA 1YA5A 4MMZA 2XFXB 1IVLA 1M53A 3ARZA 4G1MA 4CUCA 3ZKSD 2FGWH 5GRUH 1RV6X 1FGNL 1CLYH 3MKKA 5DUBB 3LD8C 2PYFA 3H7BA 3MJ9H 3ZL1A 1OP3H 1IGCH 3ISRA 2Z92A 3AXIA 4ONHB 2OSYA 5JW4M 1LVEA 1ZT1B 2JKXA 5DS1A 3FQRB 4F15C 4KKLD 1XGUB 1XL6A 2E47A 2IGFH 1OSZA 2NX5B 5CAYB 4EBQL 4DGUA 3DO3A 2AMGA 1SN0A 1OAUL 1EGJL 1NC2A 3VXUA 3HEIB 1AGBB 3FT3A 2BMKB 5EEZA 4C4KO 3L16A 3ILEA 1A6TA 1D6VH 1DTUA 5DQ9A 3WUZA 5GSVA 2DWDA 2F0CA 2RJMA 1UURA 3T2NL 1XF5A 3D2UA 2HJFA 4U0RC 2C9XA 1NGXA 4F8OA 3U6XA 3RI5K 4L9LA 2VWEC 4UAOB 3G04B 4ZW3A 3UPRB 3GKWL 4Z7UF 1ZT4A 5BV7L 3K8LA 3U6RB 4X7TB 3N0AA 2DTSA 1IAIH 2O5YH 3GSNA 3KDMA 4R5TA 4PV9A 5J6GA 4IRJB 5IFAH 2CXKA 2BFVL 3GMLA 4LSQL 2YPLB 4DVBB 1FAIL 2X1OA 3GDCA 4KKAC 1YN7A 1KXVC 1RZGB 2J88L 3CFDB 4ATTA 5D5MA 5ITBH 3HRZC 1H8OA 2XN9D 3BDYH 5JOFB 5TF0A 2DQ6A 4E41A 1U58B 1GSKA 4JFQB 3DDFA 3ZZSA 4U3SB 1JBJA 3MV11 3O4LD 4Z0BL 1G94A 4PD4K 3LKNB 4X5XB 3TA4D 3CFKB 4PJEA 2WZ6A 5GJSH 3IJSA 3L3KA 4XBPB 5LB1A 1YC7A 3ABGA 1UEMA 2DDQH 4NAJA 3GMLB 2LFEA 3SOBH 4Z8FH 4IDJH 1E3ZA 4G5ZH 1XQ4A 3RWDB 1PKQB 1RURH 3BKCL 4Y19E 4PJFE 5D7JD 1G9MH 2CZNA 2KDGA 2YLKA 4DP0X 1AE6H 5IT2H 3KW8A 4GXVH 4MB3A 2XACC 3DX2A 4IJ3C 1SFDA 2V37A 3T77A 4MMYB 4FXKC 3KGTA 3ZXAC 1SF5A 4PJHB 4F7EB 3DGDA 5T1KA 4F7TB 4H4NA 5SWSD 4N5ED 2NY6D 2OMZB 5EIIA 4KMLB 3OMZA 1MHHB 3VD7A 1SDDB 2KI6A 2IDUA 4PCYA 5A2CA 4ZZKA 3QAZC 4NDMB 5DJXB 1R0AH 3FDWA 5DFVD 2BLFA 1IC7H 2FJUB 4HA1A 3I85A 4WNQA 2QVFB 1Z5LA 2GJZA 2NSXA 3QEQB 4CDHA 1SJVA 3GXFA 5DC9B 4B9FA 5KZCD 1S7QA 1VFUA 3QJUB 4K9JA 3SO3B 5IWLA 2ZXEB 4FGMA 1J9SA 1HHKB 4OZGF 1QEXA 3ZY7A 1DQIA 2EDTA 4Q9QH 1S9YB 2BH0A 2UUDH 5HHOB 5EPMA 1J9RA 1T1XB 4HGWA 1LP9E 3PGFL 1QLFA 2VLRB 1A7RH 5AL8A 4J3BA 1MFCL 3UZVB 1DQMH 5T1KD 3ABZA 1T7VA 4BHUI 2GG1A 1DJZA 4OFIA 5IB5B 2NY5C 4AVKA 4AEEA 4F9PC 4OJFH 4Q52A 4E9SA 4FYSA 1CFVL 4XMLH 4BKLA 3LXAA 4AKOA 4TQHA 3QWNA 4WFEE 4L1LA 5TF1H 3DVIA 1CVRA 3CC1A 2FJGB 3ZT6A 3RX5A 3FUDA 4DF9A 3OKLA 3MLZH 3LKPB 1WS8A 5ENWA 3RY6A 3O6FC 2VZOA 3FQ1A 3JUYA 1R24A 3RTQD 3T6XA 2UXGA 3I6GB 1U8OB 1PNDA 5C8JA 2FEDC 2ADYA 4A63A 1A4CA 4I3SH 4J27A 5JDSB 3T6QC 2VLKE 1D2OA 3PJNA 1N6VA 5DD5L 4M7LL 4BUHA 2HFGH 2DLFL 3IVKA 4JKPL 4JVPA 4XO9A 3VXRA 4XCNA 1NCHA 3UO8B 5F7NC 1QTPA 1SVCP 3HS0B 1EA9C 4GAGL 3TV3H 1BZ7A 4FQCL 4QNPF 1YMME 4Y88A 1VGEH 5E9DE 4NYLA 3VXSD 4PLNC 4ZX3A 3QI9C 3QCUH 4GIPD 4E36A 4HWEL 1QFUL 2PTUA 1YG9A 4MSWB 1FL6B 3LPFA 4XXWA 5EOCL 2EE0A 1YUHB 2CDFB 4PG9B 2BIPA 3DDGA 3VCLA 3MCLH 2FVNA 2OI9B 4UB0L 4P4KC 2EDRA 1Y0LB 3C6LB 3BP7A 3JYCA 2IGFL 4AJYV 4YHLL 4YSCA 2A6IB 3K72A 5IVXA 1S2EA 1FO0L 1R5IB 1TFPA 2ZG1A 3UYOD 4AVIA 2DBJA 2VM3A 2DEYX 4OGXH 5LCVA 3ATAA 1X5IA 1O7DE 4KJQD 3TN0C 1CDHA 2X4UB 4XP6L 2FDBP 4JFOA 2WNXA 3ULVF 3O41B 4R26L 2WVVA 1HNYA 3QZBA 5EU7E 2X40A 3OZ9L 3MU3A 3TJPA 2CALA 3ZE2B 2FEJA 4FE9A 1LYQA 1A6ZA 5JW5A 1IC0A 1NMAL 1OD7A 4F7MB 2BOCA 1FAIH 2OZ4A 3QYCA 4HKXA 4IRJC 2XXGA 1BVNP 4MD0B 3NIFB 5DHXB 2WHVA 5KW9L 2X6CA 1T22B 3F7YA 4JRXE 1IAOA 4GAYB 1JPGB 4EI5B 1QATA 1XXDC 3DHMA 4TVPE 3LS5H 1T1WA 4RFNC 3JWNG 2WUCH 3K71B 2Z7YA 4A04A 4JFYA 4PBXA 1NBYA 1TQUA 3QPQC 1MRFH 3H4FA 5LNGA 32C2B 4Z5RA 4PIBA 3IU3B 3WTYA 3QULB 2FJHA 4UV7L 4FYRA 4LEEA 2XIIA 1J5DA 3UTPE 1OZUA 3OXRB 4F24A 1JHTB 4LSDA 1JN6B 2GC4C 1J1OL 1A6VH 3JWNC 2BS9A 2OL3H 5K93A 3D33A 2BWDA 2HT4D 4WUKH 2XWXA 2Z93B 3OKYA 1YMHA 2QSCH 1FVEA 4XC1H 2BRRL 2FWOA 4G80A 3U4BH 3NFNA 4FA8A 3SN6N 5KYWB 4BFBD 5C0AD 3WMQA 4YBLB 1D2PA 1HHHA 4PR5B 5DFVC 1WQVT 3K1KC 3OX8B 5BOPA 5K59E 1NWPA 4UZUA 1PZAA 5BW7A 3KLLA 2W81C 4DN4H 1TZIB 4QRRE 3SPGA 5FGBC 5EO9B 1VENA 3OXSA 2R69A 4U6XB 1R3LA 3AQZA 2ZSVA 5DD1H 1FZOB 4NRYB 4Y5VB 3KBHE 4LRIC 5K9OA 5B1KA 1ML0A 1ZTXE 1V7NH 2W1NA 4N2GA 1HT6A 4PJ5D 2A9CA 4X6CF 4LSUH 2WSPA 1WHOA 2QKSA 4PRDA 1CGVA 3QO0B 4JPKH 1QWNA 3Q13A 3O45B 3BSZA 4GSXA 4V1DA 2BPBA 2ZJSL 1EHLL 4TNGA 4I0PC 5B8CB 3QQ9C 4KVCH 5MEPB 2IH1B 2B08A 4Z95L 2HPTA 5D1ZD 1SFHA 4LP4A 3HC4L 5FW8A 2ATAA 1BF5A 2GUYA 2Z4TA 4WHCA 5C70A 1IFRA 4NQED 1R46A 4U1HB 3TBVA 2H6PA 2IV9A 5KG9B 2X2UA 5ISZD 2J8UF 3G5VB 1L6XA 1VADA 2ZONA 5HI3D 1LDPH 1RIHH 1NCWH 2F5AL 2O5XL 4PJ5A 3JV0A 2JB5H 4M6MH 2MCAA 4PJIE 3BUIA 3HB3B 4AKQA 3N1QC 1A4AA 3ZDWA 4NJAH 4AQEA 5FHAH 1ZANL 4OD2A 2X4NB 1S8DA 1Z5HA 4LHUB 3W0WB 4HV8B 4V1DD 4MHHG 1W0YT 5J12B 5J9PB 3NGBC 3BSGA 2WQ8A 1SGKA 2IAMA 3Q6GL 5D1ZA 3C5JA 1PMYA 1G9EA 3MUGA 3N06B 3ASOB 2V5YA 4UYPA 1H8SA 1KCWA 2QDWA 3RVUD 4AQAA 5TE4H 3O9WD 1ZHLB 3LEVH 2FO1A 5GZOD 4PGCB 3QEQE 4JFPA 4P4KB 4QT5B 2A6KA 5E2UH 4LNVA 3D4GA 3KXFD 3NTCH 4LPVA 3Q8FA 1TNNA 2GABA 3UP1A 4XNYH 5K39A 5DVNA 4DKEH 3FSWA 3MJ9L 4E41E 2V17H 3NIDF 2A6DA 1WDAA 4WKZB 3A23A 1T0OA 5BVJA 1U3YA 3KJ6L 1E4WL 1TJIL 1FZMA 2EO1A 1JFHA 4CBZA 3SKNA 1WF5A 2EACA 5E9AA 3UFIA 5CM1A 2XWTA 3N91A 2WV3A 4N0UE 3I9AA 4H40A 2JSFA 2VXTH 5C6WH 1FYTA 3EFFB 5I66A 2X2YA 4OLZL 3PGDA 3L95B 5EN3A 2D7PA 2DLTA 4WY7L 5GZOA 5IVOA 3CSTA 3DA0A 1TZHA 4PS4H 1BX2B 4FQHB 4QXTB 5K9OB 1KG0A 3QUGA 4GPVA 1NMCC 1RU9L 1M7IB 5GJSL 4YK4C 4YIQA 5GZND 1IAIL 5AG8A 1UZ8B 4MASA 1AXTH 1L9PA 4WTXA 4WGKA 1T5KA 3CFEA 1CIUA 3VUAA 4I2XB 3GLZA 5JOEA 4UILL 3LY6A 1OK0A 1CF1A 2CGYA 2FT7A 3QHZL 1D9KD 2JNZA 2IQ9L 5GGUB 3TN0A 3WN6A 4IOFC 4LCCB 4PJ9C 2B9AA 4HYTB 1XSKA 3I75B 5GGSA 2DIEA 3FTYA 4MQSB 1DANT 5FWRA 4DP6X 3T0AA 4L1DA 1FVEB 2G3NA 2YD3A 3RVTD 2HLFC 3V9FA 5MI0B 3MRDA 3N50A 3PWPD 4OB5L 2AW2A 5DD6A 4B53A 3EGDA 3KYMB 5F7FA 3DBXA 2BCMA 3CSYB 3DURA 3SGJA 5I1JL 3WEBA 1AR2A 4AV5A 4O02L 4XBMA 3S36L 5I1GL 4IBUA 1XHHA 3OHMB 4AL8C 3WMSA 1F97A 4E0RA 5JIIA 2Q1EA 5ALBL 4LFHD 1JYVA 5E4EB 2ZKXA 4N0RA 3HZYA 4I48B 4YUEH 4FXLA 4L18A 3IN0A 1I7UB 1RZFL 3VD4A 1J1PH 4WTZA 1DJHA 4OZ4B 2NY5H 3QJQB 5E7FA 3MYZA 3FTGA 4L8SC 4XVJL 3S35X 3RNQA 2CKBL 5FB8A 1BVKB 3AT0A 3EF4A 5DZVA 4KMQA 5KN5A 2EIKB 3MLVH 2CMRL 4NPYA 5F2FA 4UM8A 3ZDZF 3MUGB 2ZD0A 1KOAA 4FXKA 2XWDA 3DRQA 3N41F 3US0A 1UCBH 1ACCA 4Z78A 5KAQG 3VXPB 3HLAB 4I5BB 4LCWB 4PW4A 5F93C 3X1EA 2CHXA 4D9LH 5IB2A 3IXTA 5E94A 3PPEA 4YLBA 4NNXB 5C0GB 3A6CL 1XXFC 1P84K 3BPOC 4UV4L 4ZD3H 4P07A 3T6WA 3UDWA 3PXJA 1AIFA 1BFOB 3QIWB 3VYNA 1O9VA 2OXGA 2XNAA 4W81A 2X4UA 1QA9B 5I19H 1AQDA 1H3WM 3GJFK 1RZ7L 2BVQB 2Y2YA 4L2LA 4LVHC 5FA3A 3KBFA 4IRZL 1NGYB 4XMXA 1U30A 2IIJA 1JZFA 3NT0A 1GZQB 5FO9B 4N2HA 2NSMA 4IGBB 4G6AD 1W6WA 2NY0C 4JM2F 4P4KA 2ESVA 3UJIH 3RJDA 5CILH 3Q2WA 5EBGA 4NHUA 5LKNA 3IDNA 4YPJA 3WTXA 4YDLB 3L7FB 4XC3L 5A16A 3ZKMC 3ARWA 5CEYA 5C0AB 4I2XE 1A6WL 3IS1X 1U3ZA 3LZFL 1CTNA 3U0TB 1U6AL 2EYSA 2F58L 2QTVA 2WGXA 3VXPA 1XTMA 2P80D 3BCDA 3MMEB 2V3DA 1I3GH 4ZTOL 3VXRB 5I1KH 2V8MA 4OLUH 1JHLL 2BX5A 3MREA 15C8L 4A55A 1K4CB 3IM1A 2AQSA 4GBXA 4JREB 4U6XA 3RZWA 2QADD 1EXGA 3PV6A 5IJDC 1ZPLA 3T4AA 4IBWA 2XTJD 4NO5A 5AYUH 2Y06L 3EH2A 4XVUD 4XMPL 1BJ1H 5ICXB 3V4VA 4HJEA 4HP5A 2WPGA 1C1EL 5FDWA 1HNGA 3MCLL 1CURA 1H3GA 3UTQA 4LLWA 3UTZB 4MWFA 2OW6A 3TBVB 4HMDA 2AEWA 2BP0B 2OMVB 3QZWB 1IC5H 1D5RA 4IK6A 1IGIH 1VEOA 2BHUA 3EBGA 4RAVA 5IBLC 3U46A 3QW9A 1RSYA 4PLKD 3I74A 3PF2A 3P3YA 1NCGA 4FLQA 4Q2ZA 4WFHE 3TIEA 2XA8H 1VDGA 2HT3C 3GK8L 1RIVL 1KGYE 1EBAA 2JCCE 4N8VG 1PIFA 3F04A 4Z7OB 1PJ9A 2R4RL 3CCHA 2WINB 4OCLC 4YOKA 5F9AC 1WRFA 4UOW0 4OTXH 3JV6B 2CNYA 2J1WA 4BSJA 3BKJH 4ZUVA 5SWZE 4XP5H 3D05A 3SSGA 1H3TA 3BWZA 4KKAD 3WJLA 3CFNA 4NQEB 3O2DA 4ONFL 4X5QA 5C0DB 5E6IB 5K9KB 1WZAA 2DQEH 3OLDA 1M7IA 1FLRH 1NGPL 4PGDB 3H54A 1UB5B 3WS6A 5A2JH 2C4XA 1DBBL 4MD4B 1QRNA 1A7PH 4X42A 3MLUH 3JT2A 3HG0A 2G3XA 1QX1A 3UACA 4CRPA 4W9IC 4GINA 4X4KA 5F88A 4C56B 3HNVH 5D2NC 3P3RA 1ZTXH 5IHLB 4ENZA 3M17A 1C7SA 5DWUH 2J21A 1JN6A 3VDCA 1A6UH 1PZDA 4B27A 1QNIA 2EC9T 2VRQA 2H0FA 2BVTA 3GTVA 4G9DA 4P2RD 4PIRF 4UOZA 1KJ2A 1KCVH 5B39A 2A9MH 4XB3A 5DMIL 3WXWL 2DYSB 2Y24A 1MJ7H 1MAML 3X12B 3AQYA 1LO3H 2JB6A 2EDXA 4KOBA 4LO9A 1PFCA 1G6VK 1I82A 3Q2NA 1MRDL 1E4KC 2AKRA 1CWVA 3IJYA 2H2PC 1TZ8A 4KK8D 2YSTA 5D71L 2PWEA 4XI5D 4A38A 4AI7A 4QHNA 1D5IH 1HJCA 3RWCA 3FT9A 4KJWD 2EE9A 2V2TB 1RJYA 2YEZA 4NNPH 3LAFA 4K3EH 2WN2A 4GG6E 2J5LB 2PXYC 1FBIL 2W65B 2AJVL 3GI8L 5FFOA 2EIEA 4K9EC 4FP8L 4LOUC 3VMPA 2N3JA 4NC0B 5CEXA 3QZWG 2JELH 2EH7H 5BQDA 5C09E 1ZLSL 4LSUL 3BJ91 5FOJA 2B59B 1JVLA 5JW3L 2VXQA 5D7HA 4B9PA 5G4MA 3HN3A 2HCZX 2IMNA 3HZMA 4WEUD 2NXYD 4P3DA 3BD5A 5EU6D 3L1GA 2ZAHA 3ARFB 3PWVB 2IH3B 4FERA 3Q44A 5A16B 3CFQA 4JO1L 3QZOA 3FU9A 1YNTF 4UF7C 3M86A 2B9BA 4HS8L 4FG6C 4IS6A 4PUBH 1AHWC 4B9ZA 1FC1A 3LV3B 3SKJL 5MERA 1G0XA 1Z0NA 2F9BT 1PG7X 4P2QB 4P46C 2WLLA 3PNWB 2DJUA 1U8KA 5D7JB 1U92B 2VDPB 3VGAB 3K5SA 4U7MA 2I07B 3FPXA 1EO8H 5CWSB 4GKSA 4GW5B 3SZ6A 1GTNA 1T7YA 2BWQA 1SEQL 3HUJF 1G7QA 2P1YA 2BY0A 1K3ZA 4X99B 3TO4B 1T3FB 1NKGA 2PCXA 2ZX8A 4CN4A 4ZMPA 4G72B 2PW1B 5LHDA 4P5KA 3OC5A 4Y5XA 3FU0A 4N2MA 1BQRA 3HLAA 4GS7C 3MZTA 4TPRH 3HRZA 4J23A 5FECA 1X5XA 2ARJA 4FXKB 1BXAA 1BZDA 3AU0A 4Z7QE 4RNRB 4ALAL 1NFIA 5JPNB 1PKOA 3V79C 2AI0H 3FU8A 2VDQB 2VDNL 1EZVY 3VSVA 2ZCLH 2IALA 3M7FB 1DDHA 2R7EA 1EO7A 3FTGB 4LKXA 4LSPL 5T5NG 3U25A 1E2ZA 4BD4A 1XGPA 3CDZB 1KJMA 4F92B 3EW3B 4F37F 1D5ZB 3II3A 1MLBA 2ADIB 4RWYL 5C2BL 5HHOA 1NCCL 4HWBL 3SDYL 4KJPC 4OLVL 4OCYH 3BUBA 4KRLB 1J9TA 3L3IB 2GJZB 1EAPA 2DQEL 3G5XB 5I0VA 5I8KH 2UYLA 5F0PB 3TTSA 1L9TA 2NX5D 2G2RA 2Q5BA 3TBWB 4RISL 3L6FA 3F62A 3CHSA 2VDPH 3GZPA 3B9KD 1JXKA 3FTWA 4DVBA 1EAJA 1QMUA 4AE0A 2C9PA 4DK5A 4N0UA 1T20A 5EUOB 4RBPK 5ANMA 4R7NA 4QIRA 1KBKA 4N2AA 1YEJL 2CLVB 3PWPE 2DQTL 3BMVA 5HHOD 5C0BE 2D3NA 1JS4A 3S7GA 5DQ9B 5T3XE 2DIBA 2WVUA 1I8IB 4PVMA 3AS1A 4MKMA 3QARA 3DTXB 5EG6C 2AITA 3L6FB 2QGBA 2Y0SA 4PWIA 4ZMWA 4JM2A 1P4LA 2HRPL 4FTDA 1WE5A 1JNNH 2NRDA 3MV9E 3OR7B 1MFDH 5JOPD 1GZHC 1T6VN 3B9KA 3RWIB 1OPGH 4FI7A 2B5IB 1KENL 1GZPB 1ZT7A 2YOCA 4ZUUA 3SQOL 3BYTA 4F93B 3GSWA 3C08L 1CLZL 4L4VA 1JMXA 1UWEH 1EAQA 3TX4A 4WJKB 1ZIAA 1OAZL 5BJTB 1BJMA 2VDLL 1NLBL 1CD1A 5IGXH 4G8EA 4I0KA 2R8SL 4BWTA 4KZCA 5ESVB 4KK5C 4TQ8A 2NR6A 5EZLB 3ZKNC 3RA7H 2CR3A 5IM7A 3PHQB 1I8MB 4FCAA 3DHJA 5DUJA 1GJWA 4OKVB 3GKZA 4I4WA 5D1QE 4FNTA 3RUGE 2KHAA 5HVFB 4U2ZA 2ZOLA 2GEQA 1OZTG 4B9IA 1YCSA 3VSTA 3VWKC 2C34A 2EXYD 2W91A 4F1ZA 3WFZA 2WXOA 2ZNXA 5FW7A 1GGCL 5FGBA 3LKOB 4HUWB 4TQPA 5TDOA 3PWLA 1IV8A 3RVVD 1TTGA 4XOBA 1E5UI 3QDGE 1L9MA 1X9RA 2LV4A 1XCQA 5IHWA 3ESNA 3NZSA 1IGJB 4JO3L 4F9PA 5L9DH 2MFNA 3MA9H 4TTDD 3PDDA 1J0HA 3KLAA 2ZX6A 2WBJD 2I07A 5D9SA 3S88H 1B4TA 2HTLD 5ESQB 3DBSA 1AJ7H 4ZQKB 4AQ8C 4LLUA 4EI5C 4AH2B 1Z32X 2UZYB 4G1EB 3BUTA 2NOYA 2RTTA 4ODTH 4G7YH 2X9XA 1ICTA 4OQTH 4M5SA 4HCGA 3SGDH 3WAKA 4HG4J 4QXGL 2I9LB 4EVNB 4W9KC 4FLRA 1ZVSA 4HIJB 1IM9A 4OBRA 1QFUH 2HVBA 2HJKB 4NEHB 1OB1B 4KROB 4GP8B 3HG4A 1IEHA 4JKLA 3M1CA 4XN8A 5AZUA 3RHWF 2RACA 5EU4B 4FFZH 4ERSH 3L13A 3VI3B 4ALAC 3LH8A 4ZQKA 4PB9H 1SDYA 2OMTB 1NAMA 3E6HB 4AMKH 3GYRA 5AOZA 1FFOA 3V5HB 4IBTA 3WKML 3S8GB 2VDMH 4KVNH 4D9QE 1KIRB 3VGFA 3X3FL 5AOJA 3B7UX 3SGJC 2EYTB 2F74A 2YAPA 1WH0A 3W9DB 2KDYA 3EJPA 2RQEA 3MLTB 1IT9H 3ECBB 4KUCF 1RZJC 3GKWH 5C9JA 2YBRB 1T7ZA