4FC3E

Crystal structure of human methaemoglobin complexed with the second neat domain of isdh from staphylococcus aureus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
144
structure length
144
Chain Sequence
QQYPPADESLQDAIKNPAIIDKEHTADNWRPIDFQMKNDKGERQFYHYASTVEPATVIFTKTGPIIELGLKTASTWKKFEVYEGDKKLPVELVSYDSDKDYAYIRFPVSNGTREVKIVSSIEYGENIHEDYDYTLMVFAQPITN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen transport/protein binding
molecule keywords Hemoglobin subunit alpha
publication title Structure of the Hemoglobin-IsdH Complex Reveals the Molecular Basis of Iron Capture by Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 30
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fc3E00
2O1AA 2Q7AA 3QZPA 5D1QE 4H8PA 2K78A 4MYPA 4NLAA 3QZMA 3VUAA 4WJG3 3QZOA 2E7DA 3RTLA 5D1ZI 3QZLA 3SIKA 3QUHA 3QZNA 2MOQA 3QUGA 3SZ6A 3OVUB 5D1XE 2H3KA 2ITEA 3RURA 3SZKC 2O6PA 4H8QA 3S48A 2ITFA 3VTMA 2Z6FA 4FC3E 4YMPA
chains in the Genus database with same CATH superfamily
5F1IB 4WI0B 2QQLL 3UBXA 2YAMA 4YSAA 4DP4X 2JCCF 3S7GA 5DHVB 4XNUH 4JZJC 3ZYIA 4HWBL 5BOPA 4Y5YB 2DIEA 3MUGA 3IAGC 4PV9A 3FFCA 3O0LA 4ANXA 5CSZA 1TZIA 2IO5A 2WKOA 3MRLA 3QRGL 1TMCB 3WIHH 1AO7E 5HHOB 3N43F 3AS1A 4CKQA 3CC5A 4LVNC 4XPAL 3NZHH 4K3EL 1RHFA 4ZTPH 4U0QB 3V0JA 2EXSA 2GITA 1H3UA 2JE8A 1DBBL 4RGMC 4WWKA 5FHBL 1DJGA 2ZTBA 3KWXA 4H5SB 2DM3A 3WY2A 3FSOA 1X9QA 2WVVA 2XV2A 4B97A 4HWBA 2DL9A 3WENA 3FQWB 4JKWA 4TTDC 4IBWA 1ORSB 2VO8A 3OTTA 3BIBX 2WLYA 1TU2A 3DO3A 3GPSA 4MZIA 4ORZC 4P4KA 4RZCA 5B7FA 3QYNA 5I5IA 4L18A 4HIXH 3UBXI 3KPQA 1OALA 4UTAL 2WLIB 3LIUA 3GRBA 4PJHB 4I9WD 1BVKB 1AQDA 4BQ9A 3L48A 5EHFA 3V8CA 2Z65C 4W70A 4AUYA 4E5XB 3Q8EA 1JF5A 1QRNE 4CVXB 4JRFA 2VLRE 3D39A 3OKOA 1QUPA 5GGTA 3MQIA 4P57B 5BZWA 2BW4A 1KJ2A 1YLBB 4P46B 5F8QC 1CLZL 3RGHA 3CH1A 2PYED 3E6HB 2NNRA 4J3XA 4TRPL 1A9VA 2UWEA 4X5XB 2E7LA 1QYGH 5DEFA 5JTWA 3U9PL 5IHZA 4PJGB 1Y6NR 3AQDA 3IJ8A 4HJSA 2DKSA 2PR4H 3SJVA 4AUJA 2ITFA 4G6AC 3RY6C 4F7PA 3WNIA 2ZWNA 4F57L 2EDTA 1PLGL 1NCDL 5EC1B 2JKIS 1NIBA 5B7EA 1JF1B 3PGDA 4IRZL 4OM1H 3GBDA 2BVPA 1A5FH 2DIJA 2WXQA 2X2UA 3LXBA 4GG8B 5DSCB 2WMPA 1A3LH 1TF4A 3U2SA 1R5WB 5F1KC 4M8UA 2LVCA 3BQUC 3MV7A 2HTKD 4UT6L 3MLRL 1WBXA 5C92A 1TENA 1SJEA 3ZKXB 5JA9A 3EJUA 4TNFA 5F7DA 3NFSL 4JM4L 1IT9H 1EVTC 2WKOF 3DVNA 3MROB 4IRZA 4Q9BA 5K59E 4FXKC 3RX9A 3H85A 2D7PA 4Z7OE 2NUPB 3ARBB 1EDHA 4LOFA 5IVXE 2F53A 2HPTA 2MKWA 4ZMLA 1T0PB 1QP1A 3BH9A 3QWNA 1AZNA 1CDGA 5L0QC 1HX0A 3IMUA 4HIEB 1MAMH 4UT6A 4X7TA 5IROA 1QSEA 4AOFA 5T5NG 1W2KT 3ARGC 3DSNB 2XU9A 3NRQA 3KPLA 5SX5H 4AGLA 4AYMC 3ZO0A 3L4YA 4YK4B 2Z35B 4TOYH 3AG4B 1XR9B 4BWTA 4Q97A 5F44A 5KVMC 2O5YH 2YZ8A 2ZCHL 4WHYG 3GSNH 3ULSB 5H35A 2Y7NA 4DP2X 2GY7B 2J4WH 2QHRL 1SY6A 4PJIA 3QAQA 3DLQR 3HZYB 4S1RH 3AROA 1UOLA 1KN2H 4KFZC 1TQWA 2CRYA 3QDMA 4RGNC 3MZTA 3ORJA 3MRBB 1XO8A 3LZFL 3UTSE 4G9DA 3D4GA 1P7HL 4RH4A 4LSUL 3BVXA 4NKOB 4CVZB 4KTYA 2JWYA 2HT3C 2FSEB 4M1GH 1PY9A 3WNKA 3ARYA 3B2DC 5FO9A 3VSTA 1WHPA 3HFML 2AVGA 1FFTB 4RNRA 2I9TA 4OVUA 2A5UA 1CD1B 4ICWA 1CLYH 1YNTA 3UO8B 1CK0L 3RDTB 5ERWB 4HKBB 2UWEF 5CCGE 3MR9A 5DD6A 4BKTC 3C6SA 4LPXA 4ZOBA 2F7IA 4ZODA 1I9IL 3BKJH 1OTUD 5E1IA 5HYIA 2J8UB 3TZVD 3QAZC 2MNWA 5H94A 1ODUA 3TYGH 1RZGA 3L2NA 1SJXA 3GO1H 3PWPB 1BQ5A 3S6CA 1M2OA 1D5IH 4FQ1H 1J1XL 4A2GA 4KVNH 4C54A 2QMJA 3RRQA 3UJTH 5JOFB 1INEH 2CK0H 4R7NA 4DETA 4ZQTA 3FH5A 3N41F 3L95A 4PJDA 3SYPA 3GUTB 5ES4B 2WWMC 3MBXL 5D5MA 1Y0LB 1KIPA 3KM1A 3LPOA 1I1AA 4ZQKB 3QSKB 4L05A 1TO5A 4HJJH 1HEZB 3NDZE 3VXMB 3WGUB 3BPCA 4UZGA 4Y89A 2ATKB 3GC3A 3HNTH 4PJXA 2XSKA 3QEGL 3V95A 1KCSH 5IUSA 2K6YA 4W9DC 3OGCA 5AG9A 3B9AA 3MBEA 3Q5OA 1CMOA 3DX4A 3AXHA 2H47C 3G9VA 4FLHA 4YHPA 4PR5A 3HJEA 4XMVA 2C3XA 3MXVL 5KSVB 3QUXD 4LARH 4NN5C 4N9GB 3O8XC 2EUWA 5EO1A 5MP6H 3UX9B 1IGTB 2IDTA 3TNMA 2D0HA 2NCEA 2WUBH 4X9FA 5GSVB 5HI5C 1F5WA 5I75B 1OCCB 1A9BA 4F7MA 3QEQB 1A7RH 2I32A 4X99B 4WI0A 1GY2A 1IFHL 1T04B 2W95A 1L7TH 1IC5H 4NZRL 2MOGA 4Y1AE 1RZJH 4GW5A 5DHVA 3EYSH 4F24A 4EUPA 3IJEB 3VD1A 1OP4A 1HCFX 5T3ZL 2WUCL 2C26A 3FT4A 3QHFH 3VVVA 1ZK5A 3NJKA 4JQIA 2F08A 4HGWA 4S1QH 1MPAL 1MNNA 3DHMA 1RLBA 2QVIA 3I6KB 5IHUL 2OAAA 3PL6B 2QMKA 3HC4L 4GSXA 3LKRB 3LSOA 3RVTD 2F8VA 3GSWB 1SJVA 3BXNA 4GAGL 2X10A 1DEEA 1ECYA 1GPOH 1PJWA 4UYPA 1VRSA 3ZDYB 1SXAA 1ORSA 2PYFB 3L5IA 2JJSA 1BVLB 1EEZB 3U1SL 1J0JA 1PZ3A 1Z0NA 3RWJA 1H0DB 3VFSA 1JCKA 1NBYB 2WLIA 3FO0H 4PJHA 3CXHJ 1BVKA 5FYLH 4LMQE 1M6OA 2WOYA 4L5FL 4I18C 3QIWB 1ZV2A 4JG1H 4R5XA 2OYKA 4NLAA 3S97C 4HC1A 1IBGH 3BP6B 5EZIL 4QRRE 3ZT6A 3CZJA 3FT9A 1XMWA 4NNXA 5D5MF 2FLRT 3LKPB 3MCKB 4P46A 2OSXA 4U4IA 1JV5B 1INQB 5CM1A 5BS0E 1SFDA 3E6HA 1OAQH 2BIQA 4FNUA 4NBYB 4PJXF 1O5DT 3BWAB 1U92A 2CJUL 2WGXA 3GXNA 3EXLA 3NZ8B 2V37A 3WD5L 4NZUL 1S7SA 1MY7A 1YECL 2UYLA 4NBZB 5EUKB 4LHUG 5INDB 3VGAC 1YY9D 1J8KA 1KIUB 3EYQD 4MLIA 3QJVB 4GXVL 1U3HD 4WO4A 1K85A 1S7TB 1UM5H 3K2UH 3QFDA 1V7ML 1IQDA 3VXUD 5KS9E 2P43B 2EDJA 3BSZA 1S3RA 2F5AL 3QUHA 1DQML 2XIDA 1FPTH 4FXGC 1U30A 1CR9L 1BGXL 1MLBA 2I27N 4FABL 4XHJC 4P9HC 3L9RA 2WQVA 4GG8A 2LU4A 5DSCA 4JO2H 1QACA 4XZUA 2G30A 1QLRB 4R90H 2J1WA 2EICA 3VD4A 5CGYD 5FKPB 5D7KD 4LNRA 2XBZA 4RLDA 4GBXA 4WGVB 4AGPA 5E4AA 1PJ9A 4W9GC 1IUZA 3MROA 4HQQH 4AENA 4FZEL 1JHLL 2X70A 3VXOB 4JRYE 2NUPA 4MD5B 2BCKA 1VSCA 3OKKB 2F54D 1CN4A 2NZIA 1I7ZB 4TNVK 3WV0A 2AEWA 5DMGD 5FYKE 2AF2A 3FU0A 3S2CA 4LLQB 1N67A 1TQUA 1RLWA 2FATL 5DD5L 5KYNA 1S9XB 4JLRB 1ZSHA 2Z35A 2XZQH 5GS1C 2AAVA 3FFCD 4AYSA 3LDBC 2X87A 1OTTD 3ULSA 2OMZA 1T2QL 3RJDA 2COVD 3OL2A 4ZO8A 3DC0A 4OM0H 4O5LL 1QW8A 4ZMAT 1CF1A 1Z5HA 1TZ8A 4PJHF 2WXFA 2FWUA 2VR3A 4WWKD 3SBWA 2KC0A 2WC7A 3WJJC 6CGTA 1IGYA 1QD0A 2H0JA 1KC5H 1L9MA 3TPKA 4JFOB 2XKNB 3VWJC 4OUUB 3JWNH 2OCFD 4N86A 5GGVH 4H25B 3O0RH 2XV3A 3QFJA 1CFVL 3GINA 4P4KD 1JPSL 4Q0XL 5D7LE 2F8IA 4GY4A 4IHBA 4JFPB 3BQVA 5FYJE 5HYJB 1XF2A 1CD1A 1KNOB 4L8SB 1FYTE 3C8KB 3L9BA 4ABQA 1ZT7A 1VB9A 2F58H 4PVNA 4QJ3B 5JNYB 1JXFA 1KXVC 1MXDA 3FB8A 5DJDA 4PJGF 1DVZA 2EDRA 4PCSA 5A2BA 3D39D 3GNML 2X40A 1HKLL 4KK8D 4MMXB 2GC7C 1Q0YL 5L9DL 3I85A 1WYJA 4KO5A 4QF1A 3VTMA 3PF2A 4JMNA 3DYOA 4BSJA 3RI5F 4KZ0A 3EIFA 3WEOA 2BH0A 3QZPA 4WNQB 5KVGE 1SEQL 1NC2A 1NMAH 1U93B 3JYCA 5E1QA 5D1QC 1HL4A 5IFHL 3GUTA 4M93B 4WJG3 1Y0LA 1I9EA 5DD1L 4QO1B 4B41A 4ZQKA 4YHZL 2NXYD 4ZUVA 3SJVD 1HEZA 3FHAA 2EIZB 2B1AL 2UX6A 2EDWA 2F18A 4JFSA 5J57B 1P5UB 2IDCA 1BEYH 3T09A 3X12A 1IRAY 4H1LH 4AQAA 1T5XA 4NT6B 4J28A 4L9LC 4R7LA 2FB4L 1RHHA 2DAVA 4BM7A 5HHVH 1AACA 4O4YH 2A77L 3TJHD 3H9ZA 1C12B 2BVEA 5I6PA 4ODTL 3SKNB 2GIMA 5AWNL 2E6PA 5KSVA 4K8RL 2W91A 3PHOA 4I48B 5I30H 3MV7D 3UG3A 3NCYS 3W2DH 2IBGA 4FL4C 3WLWD 4G1EB 1UWXK 4KKLC 3GFUA 5JXAH 5HXMA 3WDHA 5IW6A 3T2NL 4H13C 4AXWB 2D9CA 2FEJA 1U8PB 2O72A 3BRDA 2I85A 4OH2A 4NQCD 4UAOC 3ECBB 1W8EA 3SKUD 2AJ3B 3QHZL 2IPUK 4LHUB 4I9XA 2F53D 4GQPH 2H2PC 1XF4B 2Q7AA 4JKPL 2K78A 2YS4A 1OXYA 2VXUH 1FIGH 2CDFB 3HHMA 2JK5B 4MNQE 5BO0D 3BWUF 5HDBE 3MU3A 1UJ3A 5D6CB 3HG3A 3P4OA 4N26A 2VMDA 3QDAA 2QGEA 3PL6A 2PWGA 3D9AL 3DPBB 4J6RL 3QGVA 3GSWA 5IWLA 4BELD 1PG7X 2QSVA 4TSAL 5GZOC 3AMKA 4PJ7B 5HDLA 1EO5A 3QNXB 3HOGA 2QR0B 3LB6D 4NNPL 2EYTB 3E6FA 2GKIA 5ICUA 3TU6A 2J8UF 1EEZA 2E86A 3II1A 4S1DD 2OSWA 3TT1H 1QQDB 1T2JA 4OJEH 2Q7YA 4TL4A 1TJGL 2A73B 3GJFK 2HVBA 2HT2D 2Q2LA 3ETSA 3H9YA 4XPGL 5KYXB 4HT1L 5KZCD 1TTFA 3SE4C 1RERA 3QIWA 4WGWB 4Y4KB 4AYBA 3ULVH 3VFGH 4UBDD 5D8JL 2GEEA 4Y4FB 1DVSA 2Y5TB 3DXAA 1BZQK 1FYHB 2HT4D 4FTVE 3RU8L 4UMSA 3BP6A 4XAKD 4BFBD 3UTZB 4Y1AA 5KJ4A 5IJVA 4PRNB 5IEKB 4O9HH 3QDGE 4LSPH 3TCTA 3WXWL 5JQ6H 3QFGA 3E1F1 3TP4A 2ZAGA 2P1YA 4AJYV 1RY7B 2OJZL 5JPMC 2PTTB 2OMUB 1NLBH 3NZ8A 3A6OA 2N0MA 1P1VA 3GSXA 5CHNB 4OKVA 1DQLL 2EDMA 4BZ2L 4ALAL 5INDA 5ISZB 2AERT 4YEEA 3CMOL 4YHLL 3MOQA 5JPNC 5IB1B 5C0AE 4KHTH 1YN6B 2FJSA 2ROXA 4N0YL 4NEHB 1O6VA 4FYQA 4JQXA 2D0GA 1S7TA 4PJ6A 5DD0L 1I1AD 3IE4A 2BHFA 4L8BB 5D2LB 1KG0B 1HC1A 4TLSA 1BZEA 3MLTA 5SX4I 1HL8A 3LZRA 2HJKB 1CYXA 3UIYA 3MBED 4LP8A 3ZKSD 5AW3B 1WFMA 4ZUSA 1QLRA 1LO0L 4GMTH 5FKPA 1CE6A 4MWFB 3MRGB 3FQ1A 4X98A 1NCAH 3MLYH 4LF3B 1MCOH 4QRRA 3UO1H 4C4KO 1WCQA 3VXOA 2HUEA 4J1UB 4MD5A 3K91A 5D1ZC 4IOIB 3LHPH 4BH8B 3OKKA 1I7ZA 4RGNE 3TGXA 2NY6B 4AJVA 2DYPA 4EN3B 4BFNA 4M5YH 2Y0SA 1NPNA 3NP4A 3WUZA 2X9XA 1ZSDA 4XMLH 3U4BL 1QOKA 3WEBA 3V8OA 1S9XA 3WIIH 3P77B 3ZDYF 1UOVA 3BAXA 4PS3A 5F7BA 5AOJA 4NENA 2B0SH 1YN7A 3RX5A 4LMQI 5KS9A 3P2TA 4I77H 1G9NL 2XPZA 3Q1SH 4H26B 4PJ5E 4QRAA 2DQJL 4LPYA 1DJYA 3GXIA 4RVBA 5FUZH 3HNSH 2V5MA 3BH8B 3UZEA 2BSSA 1V55B 3AG2B 1FVEB 1UXWB 4PJCE 4YDLC 3RL1B 3ZE2E 5LLIC 3LIZA 4B0MB 1CFSB 2XKNA 2YUWA 4OUUA 3IWUA 4OGAD 3AJ7A 1MFDH 2A2QT 2YSSA 4H25A 1H8LA 3OXSA 5FYKL 5T5NF 1UM6H 1EAPB 3S3SA 4O51B 2FCBA 5L6YL 1KJ3H 3OSVA 4J3SA 5DFWH 3C8KA 3F7VA 4PBDA 3MDJA 3GMNA 2APWA 3OHXC 4PMEA 2JQAA 3RGVA 4HMEA 4OD2B 1EFQA 5FO8B 5KVEH 1FG2A 4F93B 2JFCA 1I8UA 4JFFB 2W0LA 4G6FB 4GKLA 4H8HA 5AW7B 2YOCA 4MMXA 2OL3B 3PG2A 3I3EA 4GAFB 3HN8A 5JLZB 2JKNA 2WP3O 1TJIH 4F9LC 4N2CA 4P4RA 3US0A 1VCBC 4P46D 3I6LE 2VXVL 2FQGA 4KDVA 1PGRB 5L88H 4E42B 4XPHL 3W11C 2LT9A 2D7QA 1WAEA 1NFDB 1EBPA 3BMVA 2VXTL 1U93A 2ZNWA 1XGQB 1ADWA 1RV6X 4E9XA 4NP4L 4F7CB 5FYJL 5HGGS 3Q05A 4I1PA 2WTRA 3ARFC 2WSPA 4KKAD 1FRGH 5FHAH 1X6LA 1D2PA 2X4NB 4U4BA 1E4XL 2LVEA 1IZKA 4WO4D 1QFWH 4E9QA 1A7NL 4AM0B 2ZD0A 4MJIB 1RSYA 2EILB 2XT1B 4KQ3L 4PI0A 1P5UA 1SOQA 4XP9L 2IBBA 4P2QE 2YARA 2Y5EA 4NT6A 2Z8VC 4G9FA 4HIQA 3WJMB 2C3WA 3WS6C 3MRFB 3S8GB 1C5DB 1P4IH 2C34A 5HYSG 5I24A 4X83A 4BFJA 4DQOL 1F3RB 1N7ML 2YUZA 3SDAC 4F2MB 1P2CA 1I1CA 3SKNA 1ZRUA 1KTDB 2EP6A 3Q6FA 5KVGL 1X5IA 2OMYA 4B9KC 4WTQA 3VAEA 3WE6B 2J56A 4ILDA 4LAQH 4UB0L 3ZKNC 4FA7B 5IQ9A 5J6HB 5SV3A 4TLTA 5EO0B 2AQQA 3QUZA 2NSXA 2G5RA 1E4WH 1Q9WB 1U8PA 1PLAA 3TYFB 2VH5H 4V11A 5CF3A 5EEVA 2VRQA 4QRPE 3ECBA 1FDLH 2AJ3A 3B7TA 4PWJA 3VRLF 4LHUA 3MYJB 1YJDH 2Q0ZX 1XF4A 4IGBB 4MDJA 3LKSA 2CIKB 3KPNA 2RACA 2JK5A 4B6ZA 2YN5A 3TH2T 4QR7A 1WF5A 3B43A 5D6CA 4WK4B 4ZYKA 4K7PH 1SM3H 1I8KB 4NJ9L 4GQQA 1URZA 2RHEA 4OJCA 1BVNT 2MOVA 3B3IA 3X1GA 2VN5A 1I7UB 1YEHL 3DPBA 4XN1A 1AYRA 4G43B 3IEAA 4EIUA 4RWYL 3V6OC 3G5ZB 4AJWA 2HXAA 2ICCA 1W16A 4WAFA 1VPOL 3QNXA 3GEWB 1FN4A 2QR0A 4PB0H 4KUZL 2E3VA 1GIGH 2H1XA 1X6NA 1RKRA 1VFUA 3U7AA 3RLSA 4HKJB 2VDRB 2WQSA 3DUUB 3GTTA 1J86A 3PWUA 2L7UA 1MQKL 1WAAE 4JZJA 2A73A 4UDUB 3PWNB 3SBPA 5KYXA 4M7LT 2R4RL 3QFJD 1NUDA 3GMLA 1C7SA 3FSVA 3QR2A 3F7LA 3LAFA 2OZ4A 3IT8D 4PJ9C 3U0WH 3B8YA 4Y4FA 2Y5TA 4NO3B 5EC2A 2P26A 2X89D 3RDTD 2VDQL 3SE9H 3QJFA 5BMFL 3K6SB 3EBHA 2YD4A 3FAXA 4P49A 5DYOB 1YNKH 1TCMA 2BK8A 4Y19A 1GOGA 4WSKA 5IEKA 1OW0C 1TZOA 1XT5A 3HHRB 5JW4M 3PWPD 1FGNL 2WB1A 1RUAL 1RJCA 1GC1H 2PTTA 2NQCA 2OMUA 2YRPA 3EKCA 3ZT7A 5CLWA 1BIHA 2P45B 2CLVB 5AL8A 4HUWB 4LKCA 5ISZA 1EZUA 2ZWZA 4ABUA 1T6BX 2V2XA 5IB1A 4BZ1L 2P7TA 4ZAKC 3SDCC 1MWAB 1KTBA 1XFPA 2MCG1 1EIBA 4G8EB 4JHWL 4P3CH 5EU6B 2CMRL 1RZJC 1C5BL 4L8BA 5D2LA 3VXMD 4GLRH 2BZDA 3DIFB 2GAZA 2CXKA 2HJKA 2LU7A 4M4RA 5HGAA 3AXLA 1GZQB 1QEWB 3OSKA 2IH3A 2AK1L 2NQDA 2PF6A 3NABL 3NFNB 3UEZA 2JCCE 2YGOA 4OBSA 4HD5A 3KR3L 1BQKA 3VFWB 5IQMA 4HXBL 5CIPB 2P49B 2FT8A 3MLZH 4FTVA 4MWFA 5K9KB 3TEXA 2VABA 2E6QA 4LL1A 1SUJA 1LP9B 1N70A 3IXTB 4XBPB 3B7YA 1HQRB 3TT3H 2VDLH 3QDGA 5JHBA 4J1UA 1YMMB 3IDJB 1ZEAL 1WDAA 4R9HA 3NJLA 3S34H 4BH8A 3BUDA 3QEQD 4HS8H 2IOIA 2Z1KA 2PW2B 1TFPA 4EN3A 3U6XA 4N5UA 4XVUD 1R24B 3L5JA 4M61A 4ZMXA 3VNZA 2VAAB 2AFNA 4G7RB 3BPLC 2WB7A 3BQUA 4GFTB 4LLDA 2YAQA 4PS7A 2E7BA 4XODA 1T1YB 3LRKA 4TUUA 5DMJB 3E2HC 4PW9A 3PL6D 3VCLA 1YYML 4TM9A 4XR8C 4F8TA 2LGNA 1UXWA 4JFUA 3VH8G 5ANMA 3LD8B 3OPUA 3SQRA 3VD5A 3VW3L 1MIMH 1KTLB 3VXUE 5C6PB 3GRWH 1ZTXL 1WSST 3MRMA 2WZPA 4ECNA 2DQFA 1O6TA 1VJSA 3ARGA 3K8LA 3G5YB 1EAPA 2WLJA 3QXDA 4O51A 4TVUA 5D7EA 1YVLA 5I19L 2CR3A 3OQ3B 1MREH 4AUUA 1CF8H 2GABA 1AR1C 3QIWD 1BXAA 1JXJA 3FSZA 5D1QE 4UNUA 4DFHA 2KLSA 2WO4A 4OD2A 3DXAD 3DHPA 4PTUB 5ESAA 1CO1A 3S2AA 2YUXA 3OKEB 3QZMA 4YDJB 2J2ZA 2B39A 1AXIB 4IMLA 3QBTB 5SWZA 3IETB 1KY7A 5AVTB 4D0CB 5I26A 5JLZA 3AY4C 2N4IA 5F0PB 5ICYB 5C0IB 1EMTL 1F4XH 2QLYA 3DJTA 5D2LF 3BKML 2H1PH 4TLKA 1HVXA 5E95B 3V7AE 1N4XH 2O6EA 3K2KA 3VFTB 1NFDA 2AQ2A 4XNYL 1GGTA 2ZPKL 3P1VA 4LCIL 4F7CA 4Z9KB 4PJ5A 3PLYA 2VC2B 1IC0A 1QLEB 1XXFC 5HPOA 5JHAA 1E0OB 4JZNA 1CI5A 2Q6WB 3JVFC 4MJIA 3ULAB 3BP7A 2IVFC 2CHDA 2HCZX 4PIBA 2HX7A 3ARUA 1AQHA 3LH9A 3HN5A 2ZF8A 3M17A 3WJMA 4G8FA 4HUKB 3MRFA 5LGKA 3F8UB 3RUGB 4AQ8C 2FX8L 2FUTA 2HWZH 3N0PB 5B38G 1P7QA 4L1SA 4R96B 4F2MA 2GBUA 1X4XA 2E6JA 1S4IA 4HWEL 1TJHL 3HZVB 4MASA 4NUQA 4NO5B 3ROLA 1TLKA 4PRDB 3VD3A 2OP4H 1EX0A 3LEYH 4YHML 5IESH 1M4KA 2GTWA 2APXA 4HHAA 1WEJH 2QPFA 2B15A 4FQPA 1AGCA 2CO4A 3CSGA 1N2RA 4R6UA 1MW0A 4M7KH 4UOQA 3TEYA 1Q8MA 4MKTA 2MNUA 3MYJA 5FM5O 4HIHB 1JPEA 4OIFA 4HS6B 1XD0A 1T03L 2PCPB 3IN2A 5KANG 3ARZA 2DKUA 2FT7A 4XVTL 3MA9H 1XV8A 5C07A 1I7UA 1AD9B 1OAUH 4NQSB 3G5ZA 2OXGA 4HV8B 4YWGL 5GGSY 2EINB 3C5XA 3LEXB 4JFZL 1A4AA 5HJDA 4E0RB 3GXDA 1LL1A 5IJKC 4NCC1 2O4EA 3DGDA 1NCBH 1OPGH 3QYCA 3IF1B 3N6YA 4ETYA 1FNAA 3VQ1C 1MFBL 3DUUA 1AXTL 1Q4NX 3ILEA 1S6NA 1NCJA 1NSNL 3FTSA 4H88L 2C4FT 2OFQA 3VXSB 5D7JC 4DGYL 3PWNA 5IZ7A 4Z3GA 4ZPVB 4CDGC 2ROYA 5HYJD 1RP8A 2RH0A 2OTUA 3DYMA 2PMZA 4XVOA 5AL0A 4B9PA 2VSKB 2DWEB 4PG9A 5BZZA 4PGEB 1NFDF 1DZBA 5JHDA 4Z7VB 3RGVD 1B0RA 3FHQA 1JTTA 1H5BB 1SLXA 1BD2A 1WBYB 3QCUL 3ZO9A 1UWGL 1BMGA 4E2OA 2FYYB 2OX5A 3DDFA 1RAMA 4PAZA 5I1JH 5KVDE 3S37H 3W5NA 4R0LB 2OYPA 1EK3A 1NH6A 3FTGB 2CLVA 2MCMA 4NQCE 4PTTA 2HFFB 1Y6MR 3MLVL 4DUVA 4I18A 1RZ7H 2J5WA 2BMKB 4ZO6A 3CBJB 1KEML 2EJ1A 3U0PA 4Z7WE 4G8EA 1SF5A 1QHOA 4K23L 1A6AA 1JWUB 4GSRA 4YHNB 2O6DA 4P23C 1KYOJ 4QMEA 1GZQA 4OV5A 3B56A 3WYRA 2AJVH 2VERA 3NFNA 5D96B 3RA7H 1OSZA 2VDPL 4WNJA 4W9HC 1N64L 2R29A 1EVUA 5IF0B 4IBYA 3GSQB 4UDTB 3OD3A 3VFWA 2R4SL 4A6YL 2IQ9L 4P9HL 4U1LB 4JPKL 4QT5B 4NQVB 3TWCL 2ALWA 2X4RB 3CZFA 4GUOA 4FI6A 4FP8L 1LP9A 4Z3IA 1IC1A 3HLAB 1BBDL 2RJMA 2Y1AA 4WV1B 1YMMA 2TSAA 4YPGB 1ZGLB 3MGTB 5I8OL 2XOTA 3QUZD 4L29B 4M00A 4FXGA 4MD0B 5DJCA 2DQHH 4DOHB 1F3JA 2PW2A 3LPFA 4B9ZA 4P5KA 1FH5H 3QUYC 5GZNC 4LHUD 3MBWA 3QNFA 1R24A 1URLA 1K4CB 5C09A 5B39B 3EGDA 4APQC 1LEIA 3JWDH 2ZUQB 3UYOD 3Q8BA 1A4JA 4JL1A 1NCIA 1GW0A 4ZZKA 1TZAA 2O5ZL 4LASL 5C2BH 5AB0A 5AVVB 4OGZA 5F6HI 5HHNB 3IN0A 2MHAB 1NANH 1X9LA 2PKDA 3BO8A 4F8LA 1U8IB 3AU0A 3PJSB 5B38B 5HYSA 3D69A 1FCGA 2ZCLL 1UACH 3B2VL 1TUPA 2EH7H 3QUML 1SQ2N 1FSKC 1KCWA 4HZ1A 1PDKB 1V10A 3WY1A 5C0JB 4PS4H 5A7BA 2YD7A 2BIMA 3HNVL 5KYYB 1AE6H 5DVOA 1FIEA 4F8NA 3S4SG 3ZR5A 1KBBA 3G5YA 4HPYH 2KPNA 3KPSE 1SZNA 1A47A 5GS1A 4L3CA 2J6EL 4X6FB 3O6ML 2OSYA 4Y4KD 3FB5A 1E9QB 3RPIB 4L3FA 1ZVSB 4PTUA 2NY0C 2XBDA 4Y4FD 1V54B 3MV9B 1FAKT 1NCHA 1QWHA 1R75A 2AJYH 3QUMA 2MOQA 2PLTA 3GSVB 3ILQC 4JB9L 5GRUH 3IETA 1KJMA 2WJ7A 4KX9A 4MJ5B 3QWRA 4D0CA 5AFAA 1QBLH 2BVQB 2Y72A 5C0IA 4LCCB 5DHMC 1XXDC 4EI0A 4TTDD 3V4VA 3U1QA 2D7MA 1SJHA 4WI7A 3TBVB 1RQ5A 4AJ0A 3TH4T 3KPOB 4MQTB 2JB5L 2Q1EA 1E3ZA 3KLHD 2QDVA 4GRLC 2CCLA 2RFXB 5ISZD 4DESA 4LDLB 4UCFA 3HG2A 3RIAK 3EO9H 2Q6WA 1KGYE 1KXVA 3K8KA 3QEHB 1H6FA 4G7YH 3CFTA 3CVIL 3EJYC 2DWDB 1QR4A 2BHZA 3LMJL 5HHOE 1LP9F 1CXIA 1GGUA 2V5YA 1L0QA 3TO2B 1JFHA 3VX0A 3RUGA 5MEPA 1PIGA 5CGMA 3SE8L 1U4FA 2YPLB 5CN2A 4JFVA 1B9KA 4LHQB 3B9KB 3DIVA 2EE0A 5E5LA 1ZVHA 1IFGA 4ONGL 4K5PA 3A67L 1PMYA 3ARFB 3QK0A 3M46A 4JN2B 7PAZA 1T0OA 4EI6B 12E8L 4UT9A 3QE5A 4YEFA 2W0KA 4FFWD 3ZL4L 4X7CC 3OB8A 3VXRB 3T6XA 1YEDB 3VU1A 1H3GA 2VDMH 1MCQA 2NNXA 1VENA 1YC7A 3M6DA 3V6OE 5F7KC 1TVBA 4LCWB 4L9LA 5AAMC 1G7JA 4KKCD 4XN8A 4BKLA 2JTYA 2NY6D 1KLUB 1UJTA 4HS6A 3QG6A 4EN3D 1KIRB 1KCRH 3GSNB 1R3HA 5D4HA 1YHPA 2ICES 2V5TA 5ECGA 2MMXA 3UPAA 1AMYA 2J12B 3SDDC 2UY6A 2YGVA 5CCKH 3KYMA 3GD1C 1RIHL 1DVXA 2XV0A 4GSQA 1BOYA 1DVTA 3SPGA 4EIZC 2AXWA 4NQSA 1G9MH 2A6IB 4TVPH 1GGYA 5DCCA 2O5XH 3OAZK 4HV8A 3FRUA 2ETWA 4JFQB 4E0RA 4PJGE 1RL1A 1ZHBB 3F85A 2FLMA 1FHGA 3T6VA 4Z3FA 1KEGL 1UXSA 3IF1A 4FFZA 3MODL 2H2SC 3ES6A 4OIIH 4OKDA 4PV1C 1E4KC 1GY1A 2B20A 2DBLL 1F2QA 3OLEA 4H8VA 5L7XH 5EOCH 4FLRA 1XTMA 3GGWB 3ARGD 3ZTJH 4U1GB 3T77B 4NOBA 5GGRY 1N0XH 4UV7H 2R0LL 3EHBC 1O75A 2DWEA 5LAXB 5HJBA 2X4UB 5HVHC 3WTVA 3PGFL 1CXFA 1GKOA 4L4VB 2FH8A 1H5BA 3HI5L 3MRJB 4X4MA 4JFFD 4IDJH 1LO4L 4G6FD 1GGIL 1OLLA 2FYYA 2GSIB 4HFWB 4R2GC 4UIMB 5B22A 4D3CH 5SWZD 4OZHA 3SDXA 4AWJC 2EKSB 4D9RD 4R0LA 1PKQB 4GAAA 3UDWA 5B3JF 3GMOB 3KWVA 3BIKA 4XC1L 3FTGA 5JHLA 3H3PL 4J3OH 4EDXB 2F61A 4ZFQA 3E7JA 3RUGF 3HG1B 2HG0A 3P9LA 3DRTB 4QXVA 1BG9A 1VF5C 2BMKA 3WIAA 1QRKA 4G7VL 2R2HB 5BV7H 3VH8A 1RMFL 4DGWC 2H3NA 4DSYA 3FZUC 1YJDC 4MQ7B 1JWUA 5C6WH 3V6ZB 1FA4A 4MJID 1NL0H 4YHNA 2GBAA 1O6SB 1UD4A 3Q43A 4O02H 3SOBL 5JUEH 2PXYC 4YSCA 1P84K 5DHYA 5IKCB 1U91B 2X6CA 3J07A 3PQYB 5F1OB 3RZCB 4Q9RH 5KVDL 3PJNA 3JWNG 4AM0Q 5IF0A 4UDTA 3V52H 4ZFGH 5JPMA 2WNGA 1EJFA 3UBHA 2DWXA 5I0DA 1VGKA 2NXZC 2NRDA 3FC8A 1GSKA 3OQRA 4NAMA 4U1IB 3NZHL 5F21B 5JPNA 1ANUA 2ZXBA 5BZXA 3DDGA 4K3DL 4ZTPL 2CHXA 3HLAA 3CN1A 2O6PA 3ASWA 2ZXEB 4IRJB 3ZE1E 2D3LA 4YPGA 3VD0A 5C0DB 4Z77A 3SPVB 4NDMA 3WAJA 4I0PC 1SLUA 3K7UA 3IS0X 1UFUA 4WFED 3WIHA 2FWOB 2J8UE 3QC6X 4HBQA 3TS8A 1K4CA 1NGQL 4IGBD 4OD3H 1RZFL 2J55A 3G6JB 4G59C 2YK1L 2XIBA 3PP4H 4MNGB 2DQTH 3IDUA 3PWPE 4Z7WA 4AC4A 2UVEA 3KE0A 2PP7A 5DT1H 3L16A 1BQUA 1ZT1B 4BRJA 5HHNA 2FJGB 3KLLA 3GTNA 4DPRA 2X05A 2DMBA 3PJSA 4PPTA 2H0EA 5B38A 2HLFC 5D1ZA 1GC1C 2CLRB 2BW5A 1UQSA 4H1LG 3T3MF 2ZUWA 3PFUA 4ZMZA 1PDKA 5C0JA 2EXWD 3JWOH 3ZPDA 5KYYA 1QYGL 4MA7H 4V33A 5FUOH 4JNXA 2WLLB 4OZHF 4F8QA 1T4WA 4AQOA 5DJXB 2ZWSA 3KYAA 4X6FA 3VO0A 1PZ2A 3QRFM 3F12A 1ZLVH 1ZVSA 2CWRA 3AG3B 3FU5A 2EQDA 1ML0A 2BS8A 2PCFB 2QV4A 2ZUSA 1GS8A 5C0CE 3GSVA 1WAPA 5GIRB 7CGTA 5JHDD 5LAPA 1BECA 2XX0A 1JGEB 2BSTA 4JY5H 2VZUA 4HKXA 2APVA 3SO3B 4FHKA 2BVQA 1GYVA 2ITCB 3K0YA 4LCCA 3EH5B 1A5FL 1Q9KA 4AIXA 1FWXA 2QADC 5D1ZI 1M1XA 2YD6A 4D7PA 3TBVA 4WJKB 1XSOA 1J05A 3CN4A 1G7HA 3ARPA 3LZNA 3ZMEA 1KLGA 1PYWA 3ZIMA 1PFOA 2HMIC 1TTBA 4WKZB 3ABGA 4PY8J 4Z8FL 2DQCH 3BUTA 4H0LC 4P2CG 1Z9OA 3H3KA 4MGXA 2OR9H 3POHA 5DRNA 5EU6D 4F3FB 1FFOB 4HP5A 5TE7H 2DWDA 2PWHA 3IDNB 1FP5A 3B2PA 4IBUA 1JWMB 5SWQB 4F58H 4IRSB 3RGBA 3OB0K 4F9LA 1XH2A 1ZA6A 1S7XB 2YPLA 4PCKA 3UTTE 1EEUA 3HN3A 4YSOA 3BGFB 4G6JL 2F5BL 2AMGA 3EZJB 3FXIC 1E5UI 2F9BT 3OMZA 5HHXL 5KANI 1DSFL 2HLAB 2DY2A 3JTSA 3FQTA 2GFBB 1LD9B 1KPVA 3ARFA 2J4WL 2K3HA 4FX5A 4KY2A 1OP5K 2B2XL 3AS2A 5DA0B 5FLUA 1KN2L 2ZONA 4XO5A 5K9OB 3P9MA 1YEDA 4MYPA 5CEYB 2A6JA 1YMMD 4N2IA 2Z8RA 2B9BA 3VFVA 3TXAA 1L3WA 2JI2A 1ES0A 3CC1A 4LCWA 5GHWH 2WXNA 3MUJA 2P8LB 4YIQB 3WS6A 5FV1L 4S0HA 4QRSB 5F9OH 1NFIA 2XIIA 4WEUD 4DFIA 1J5OL 2OCJA 1B0WA 4XHJD 3GSNA 3PHSA 3SDAA 1RD6A 4PU2A 4B95C 5C09D 3W39A 9PCYA 3CFMA 3CFCH 4YBLC 5J12C 2A6DB 1MOEA 5K9JH 4WI4A 4OLZH 4XMXA 2FX9H 5DQJB 2DMHA 4HJTA 5AVYB 4JFQA 3TYGL 4Z6AT 4JKNA 4KPHH 3CLFL 3L2MA 1DVYA 3RX7A 1PZ5B 3GS4A 3VB8A 2BWDA 3VDAA 3ZHDA 4KVPA 2A1WH 2GJ6B 1NBZB 3WO4C 4KVNL 4JRLA 1PNCA 1CDHA 4PWIA 2CNYA 1U4EA 3DKHA 5E24E 4ZUWB 1INEL 1KJVB 4J3VA 1ZK9A 1ASQA 3GGWA 4XX5A 3T77A 1X9RA 1Q0XH 2C3HA 4HS3B 3T65B 1NCCH 4D9QD 1SN2A 2BNRB 2C1PB 4RIRA 2QZQA 1RIUH 2IANB 3BCFA 3IDMB 1H3XA 3HNTL 4L4VA 3UADA 3B6SB 2COQA 3MRJA 1H8OA 4NM4L 3L3DB 1KCSL 1G7IB 2NZ1A 2GSIA 4GSUA 4UIMA 5TPWL 1QX1A 3BAKA 1PW3A 1I3VA 4XVJL 1SXNA 2F7QA 4HISA 3GMOA 3LXCA 1UB6A 2DS4A 4Z0XA 1RJYB 1LMKA 3DYPA 3V0GA 5F8RC 2KT6A 2WO3B 2YRLA 5ESVB 5AYUL 4NHCH 1JHTB 4LARL 5CJBA 2J8OA 2VOTA 3O3BA 4LVOC 2R2HA 4Z7AA 1M7UA 2WUBL 5LG6A 4XMWA 1I1YA 5AKTA 5I74C 3L08A 1DP0A 1RH8A 3MV8B 3V6ZA 1A7RL 3ILPA 2XX1A 5GS2H 3S4SA 3JV4B 2IMNA 3ZX1A 1OW0A 4KI5F 4IDLA 1RZJL 1UENA 5IKCA 2IWGA 3OJDB 3RZCA 1TSHA 1OAJA 3VRLE 1RJZA 3GXPA 2H32H 2FO8A 3FUFA 4IKKA 5DJ2B 1N6QH 2L4OA 4FD0A 4M02A 3QHFL 1ETB1 3LH2H 4ZDHA 4S1QL 3MXWH 4U1IA 4TPRL 4N2LA 2IGLA 1HSBB 5ENWB 3RWEA 1M6UA 4ZAKA 3KPMB 4OCWH 2ZSVA 3VXNB 5HGBA 1FBIH 4Q4EA 4JREC 3HAEG 1RUMH 4TULL 5FFOA 3PDGA 3O2WH 2VXQL 4FQHA 3ZHLA 5C0DA 5HYJE 1GPOL 5E8OB 4Z0BL 4YVNA 5GGUB 3SPVA 3G5VA 2KERA 3KYOB 2FL5B 4AGOA 1LO2H 5GJSL 4U1KA 2VRAA 1FNSH 4PCTA 2JNZA 3CDGB 5DVLA 3MCG1 1IE5A 3F00A 3FO0L 4YXKH 3G6JA 2NZ9C 2XLLA 4MNGA 5FYLL 1PSKL 1QO3B 5DFVD 5F88B 4D0DA 2XWTA 1FNEB 4YHOH 4TSBH 1ZT1A 2OSLA 1XCQB 2XWBA 3SKOB 2FJGA 3RE0A 5KSUA 3WN6A 1KGWA 32C2A 4B53A 2A9DA 1WGOA 3C6LB 1WV7T 4FQQB 1I8IB 3PUCA 2OMVA 1Z32X 2CLRA 4GKNA 4NRZB 1H9DA 5HI3C 3ZTNL 1JFQH 4WGKA 1HOCB 4H7VA 1FLTX 3EYUH 2LTQB 1OAQL 3L54A 4PY8I 2OMNA 4LSVL 3PU7A 3VXPA 1VADA 5DXWA 4WHTA 3VXSD 4BH7B 3C08L 2WTPA 5DJXA 4E68A 4I88A 3WNMA 5AENA 4F5CA 1DR9A 1UM5L 2C9UA 3QZWG 1WISA 2BPBA 2X4OB 2PCFA 4U3XA 2W59A 2A9NH 2QPSA 5FS5A 1D5ZB 1Z5LA 3O3AB 4AMXA 5DS2A 3MJ9L 1JGEA 1JMZA 1UH2A 5TDOB 5FV2A 2KS0A 1FPTL 4UM9B 3R7QA 1VFAB 3R8QA 1IIIA 4PS8A 3DK2A 2H1LM 2ITCA 3O4LB 1SDYA 2XQBH 1W0VB 5EMYA 3MUUA 2VSMB 1A65A 5FFGA 4BFIB 2CNZA 3VJ6A 2W9DH 4XVSH 4JO2L 5IT2H 1HYSD 4M7ZC 4HAKA 2BOBA 1AZZC 3QUKB 3BEWB 4TNGA 4XB3A 3T4AB 1LEGA 3EGXA 1JTOA 3W9EB 5IHWA 4JFHE 4IJ3C 4JE0A 3RNQB 1FFOA 2WW8A 1N3NB 3IDNA 3T6WA 3KL3A 4QWWD 4TQIA 4RAVB 1JWMA 4WENB 5SWQA 4IRSA 4HG4J 1AY1H 5DJZB 3N5AA 4ZUTB 3JWDC 3RY4A 5CP7A 3RI5K 3I50L 1S9YB 2AXFB 2XPGB 3ZYOA 3MOAL 2BWQA 3GMQA 1DUZB 2OULB 3LPWA 4PJ7E 2D2CC 2XZQL 3U7YH 2HLAA 1CD8A 1R3LB 2DQIH 1SUHA 4E41E 1JNHB 1IBBA 2E74C 4ZFZB 1OD9A 4OM0L 5C0CA 3NCYP 4OF6A 3ME0B 3G6JF 3V2AR 1GS6X 1L9SA 2HJLB 1ERNA 1NEZG 4QHNB 4A2LA 4R4FH 4DVRL 3FRPG 3WMSA 3EJTA 5CEYA 4NUMA 1OE1A 4OLXH 1ZPUA 1KC5L 1OKEA 3PAZA 3EUDA 2CDEB 2EC9U 3EJPA 1SVCP 4NQEB 1HINH 1A3RH 3NCBB 4AQ8A 5KSAB 5GGVL 3MSPA 3ZE0F 1ZDQA 4NQDB 2XJLA 4OQTH 3ULUH 2DQUH 1BAGA 5KUMA 2YWYA 1T22B 2VM3A 2EVIA 1OK8A 1LK3H 2A6DA 4JJOA 3HMWH 4HWZB 3I9GL 3MNVB 2EDLA 4OJDH 4RBPK 4R5TA 1NDTA 4GIAA 5D2NC 5FYKU 3SIKA 3QQ3A 2OMXA 3DO7B 5EBWB 4U1JB 3S8WA 4PJBB 3MI6A 4O2CB 3MLSL 4W9ZA 4GAJH 5D1ZD 5HYQB 3ZDWA 1U33A 5I23A 5FGBC 5TH2B 3SSGA 4UTBL 1KBPA 4OJFH 2KLRA 5GGRB 1YEGH 1NMAL 5K33A 4WFGE 3HAEB 1B2WH 4UQ2A 4A2FA 2J7LA 1JD9A 2VMEA 4AK2A 2E7CA 3T65A 2BNRA 2C1PA 1G0XA 1HCZA 5E56A 5JIKA 1VESA 2IANA 1EO8H 3ZDXE 4AYDC 3DTDA 4ELKB 3B6SA 5IW3A 1BEYL 2IH9A 1WE5A 3L3DA 1D7BA 3I02B 5FYJU 1F8TH 3B2MA 1V5JA 3UTPE 5IJKA 3ESUF 2AMUA 1SXBA 3G08A 3U6RB 3UAJC 4O4YL 2XCMC 5CD5C 2X6VA 3VU2A 4LBEB 1N8ZA 5ESVA 1JVOA 2G3XA 4L8CA 1FFQA 3FPYA 2GUYA 1JHTA 2C9AA 1KPRA 3FCTB 3UZQA 4KAQL 4PV8A 3L3KB 5HI4D 4LSQH 3W2DL 3WHE0 4I3GA 5ESQB 4H1LA 5JXAL 1DANU 2BY3A 1QBMH 2R1WA 2YN3A 3FN0H 3IBOA 3EDDA 4XBEH 4A39A 3G6AB 1OOWA 3EYOA 1G7MB 4NI3A 4Q14A 3RBSA 1QHQA 3OJDA 5GRXG 3HPLA 4RA0C 3ZXAC 2W80C 5DO2C 3K5SA 5DJ2A 2VXUL 2YPLD 5I1CL 2QQLH 4PYHA 4MJHA 3B9KD 3QZWB 3F84A 1XB6A 1W8NA 2KZKA 2WXKA 2MPVA 3EDFA 1HSBA 2X4SA 3EOBA 4O2EA 3JXAA 2UZXB 5F9JA 3ARFD 4W9KC 3L7FB 5GS0H 3Q9PA 3LKNA 4KI5D 1GR7A 1NOFA 2H26A 4R4NC 4PI2A 4GUPA 4K3JL 5E8OA 3CUPA 5GGUA 4ZS7H 4XPAH 4NGHL 4NYLB 4K3EH 4P23A 3KYOA 2FL5A 3N55A 2BSRB 1PZBA 3P4MB 1U8OB 1SOKA 2YD8A 3CTTA 1CLOH 2YIHA 3VMNA 1NCUA 4LCWD 1GVIA 5FHBH 1FL6B 4J3UA 1W15A 4OCLC 3QQDB 1LDSA 4IKIA 4L3EB 5IJBC 4JRXB 3CVHL 1F0LA 4NN7C 1XWVA 4J2QA 2FRGP 3SDAD 4I0CC 4YXHH 4D9RE 4L8DA 1MHCA 4HBCL 1FNEA 3BZEB 5IMKB 4YZFE 5C9KA 3CDCA 4XB8A 4UTAH 3VI3B 5J06A 4KHXH 2EXYC 1I8IA 3TCXA 4PP1C 1KXTB 1LE9B 4FQXC 3QCVH 5JQ6L 2EIBA 4D8PA 4J3OC 4JFDB 3VWKB 3BEVA 3QUYA 4KI1A 5GZNA 3VMOA 3IWVA 1MNUH 4A55A 4DO5A 3OJ2C 1AHMA 3FN9A 4KKBD 4C83B 3HMXL 3B7SA 5CEXA 2ZXCA 1NEZB 4TRPH 3R8BB 2BRQA 3FRPB 5D4IA 3CZUB 3AG1B 2I5YH 4QTHA 4W9EC 1EFXA 2ED8A 4JDZA 2X4OA 4GRMA 5I1IL 35C8H 4PHZA 3WEXB 2A74B 1D5ZA 3O3AA 4OZFH 3RAJH 4XB7A 5TDOA 1TMQA 4L4VD 3NSFA 1VFAA 4AQZA 2R0ZL 3T0XA 5HPMB 5FOJA 4PJ8C 4R7VA 1S5HA 3C09B 3HI6H 4WU7A 3D05A 1AAJA 1AGFB 1XZ0B 4AV4A 3C5ZC 1NCDH 5CUSL 3FT1A 1HK6A 1W8OA 2VWEE 3EGSA 3EBAA 3B5GA 2NLJA 1YEFH 2WIIB 5EOQH 3TBSB 5J11B 3GK8L 3ESVF 3F62A 1NCAL 3HG1D 5F6IB 4YDVA 2Q86B 1NBVL 2F7OA 1I7TA 4Q58C 1TNNA 1GYAA 2A7BA 3UO1L 3OVUB 2I25N 2VJ8A 2YBRB 4RSYA 5D1XC 1N3NA 3MLRH 4LAJH 3PWVA 2HUHA 1Z7JA 3QR0A 5DJZA 4A66A 4ZUTA 4M62L 4P2RB 3HB3B 2VQ1B 5DEJA 3QULA 1JV2A 3PXLA 3FNKA 1JUFB 3RZCD 4LU5H 4WW2C 5JIDA 3CDZB 3RL2A 4KMTL 3UZVB 1F6FB 1MWOA 1AVAA 2JJVA 3AAZB 1R3LA 2PABA 1UD3A 4FI7A 5E9DB 1E9PB 1JNHA 1SNRA 2ZYSA 2B8OT 4G11A 4N2EA 4QAMB 2YJQA 4K9EC 5JDSB 2P9RA 4GAYB 5DJ8A 3P3SA 4B7IA 1JPFB 3D2UB 1ZJAA 4PGBA 4ZNEE 4JY6B 3BUBA 4HDIB 3JWOC 5ECJE 2ZCHH 2XJKA 3LQAC 5E2JA 1XF3A 1IU1A 1QZ1A 2IF7A 4NQEA 2WXIA 2CKNA 1LWRA 2JKRM 2EC8A 4NQDA 1UM6L 1ZHKB 1T22A 1FNGA 1KJ3L 3FUKA 3KW8A 4FOMA 4HWZA 3MNVA 4P07A 5CJ8A 3ULVF 1KDJA 4G8IA 3OAYK 1MRFH 3JUYA 3D50A 3OMNB 4QNPF 1ZTMA 3DO7A 5EBWA 5JHMA 1SDAB 3RWHB 1Q72L 4EJ1C 4HUVB 4O2CA 4HIJB 2E9GA 3FUIA 1J8RA 1I9IH 2HVJB 1TJIL 4N90D 5AAMA 3TIDB 4LVHC 2WWOA 2ESVB 3CFJB 1EHKB 3D4CA 3EDJA 3FH8A 3B1TA 1B4JH 3ARSA 3L9YA 4BQ6A 4E41A 4KK9C 3X11B 1PQZB 4OF8A 3HAEA 3U4KA 2IXQA 3ZUNC 3KG5A 2W88A 4BXSV 1O7DC 1FRGL 3H53A 3L5HA 4N0UB 5FHAL 4YHKL 2EUZA 1GCFA 4GXUM 5F9AC 4FE9A 4ZMNA 1ZGLP 4ZMWA 4U3SB 3BFWA 1WUNT 1BZ7B 1QFWL 2E7HA 4FNPA 4ELKA 4QI3A 4LEOB 3QQXA 1Z9LA 3TEWA 2OXHB 1S7VB 1SOXA 3O3EB 1PX4A 1M3IA 3NCEB 1J1PL 4C56E 1N68A 5TE4H 1FUNA 1SBSL 1P4IL 2FGZA 1E8ZA 1G7LB 1YUKB 4R83A 2X1QA 3A47A 2OQJB 3SEPA 2FE0A 1E4KA 4LBEA 2JSFA 4U05A 4Y1TA 1QTPA 3TF7C 1ZOXA 4NQTA 1D5RA 4TNEA 4CL7A 2VLJB 4MX7B 5IR1B 1JNLL 2L7QA 5ESQA 1IC7L 3US9A 2FSDA 4LIQE 4FNSA 2D2OA 2B4CH 1QI4A 1FO0L 1TQBB 3MXVH 3W0WB 1E4WL 2JKLA 3ZSSA 4PVLA 2VH5L 5KOVC 4A2HA 4DCQA 2FJUB 3ZGHA 3CLEH 3G6AA 5CBEB 1G7MA 1FDLL 1WVZA 43CAB 1ZHNA 1W80A 3CSYA 4AIZB 1YJDL 4IRSD 4PLKD 4Y2NA 3HRZC 2C3GA 3WFDH 4ZS6D 4F7TB 2UXVA 2YKLH 1AQ8A 1L9TA 2DZEA 2WLKA 3QEUB 3QZWA 4NZRH 4V1DE 4K7PL 1SM3L 3ASNB 5CO1A 4ZNCD 1A14L 5BPPA 3D0VB 4J4PC 2CSPA 2FD6H 3IU3A 2DPKA 4ELMB 4Q8BA 1RK7A 5T3ZH 1U0QA 2UZXA 2DIBA 4FRWA 4W9IC 5IOPB 1P0SE 1QFWI 4F33B 1MPAH 5IMOA 3O9WB 4NPYB 1DQDL 4PB0L 4EO5A 5IHUH 3J2PA 2NOYA 4X6DB 3P4MA 2JKWA 4CJ0A 1FL6A 2NR6C 5CINH 3SD5A 3Q0HA 3BAJA 4JRXA 4LLAA 1IEAB 2XC8A 4HPHA 3QZNA 3PHQA 1AGEA 4PM1A 3SKMA 2F0CA 4AQ1C 1CD0A 3PYCA 2IDQA 2FO4B 3IXAB 4XCCL 3U30B 4JDEB 1JIBA 3ENEA 4IU3B 4MMZC 3FFDA 1SHXA 4Z7UE 5BW7C 1KXTA 4NNYA 3GIVB 1GCYA 4MDIA 5AG8A 3K71B 3DOIA 4ANKA 1FZKB 4EEEA 3VWKA 3BSGA 2IWFA 4PRAB 2GJ6D 3MTXA 4MJJA 1JZ7A 1GC1L 2GCYA 5FECB 5C0BE 1GZHC 2NPLX 5B3JE 4U6VH 2LFEA 1E65A 1JXKA 1I31A 4UZSA 1XBRA 2NY2C 4OUOA 1NEZA 1UVQA 3QDJE 3FRPA 4KROC 5AYTA 2RA1A 2CJUH 2Q3XA 1JGIA 1QWUA 1M7IB 3KPRA 4HUCA 4P3CL 1LM8V 1LTXA 2BNRD 4N0CC 4NZUH 5IMMB 4GUQA 1IKFH 4I4WB 2ZWKA 2IAND 3GKZA 3GSRA 3KBPA 1L0XA 3MV11 4WU5B 4F8OA 2YQGA 1XBDA 5AOLA 3VFNA 2CJSA 3FW6A 5LXVA 1SMDA 1XZ0A 2F5AH 3VQLA 3FTZA 1ZA3A 2A4CA 1AP2B 3N1MC 5E94B 1F41A 3CQPA 3DMMB 1UWXH 3SY0B 3OX8B 3QQ4B 4YDIL 4FABH 4ZT1A 2XWXA 2CR6A 3BT0A 1PBYA 2BOCB 2YBRA 4OV6F 3ABZA 3TT3L 1F02I 2VDLL 4PUBH 3U4AA 3CNKA 3LZQA 4FKHA 1TQCB 5T33H 4QKXB 3IU4L 5IIEB 4HS8L 1CXLA 2HFGH 2FJHB 2X9YA 1MJ8L 4P2RA 1DVFC 1WZMA 2W9EL 1XSKA 4JM0A 2IFFH 1LK2B 5AUMB 1FE8L 2Z4QB 2DTSA 3O41A 4WI3A 3QRBA 1N5YH 5E9DA 3ZTJG 5I6OA 1UG9A 5I6XC 4GAYA 4EXKA 5EN3A 5A16B 2FATH 3VXSE 1JPFA 1RUKL 3D2UA 2ID5A 2NW3A 1XGUA 2DQGH 4QY8A 3OZKA 4JY6A 5AZEH 5A40E 3DA0A 4YNYB 1MCSA 2DQMA 2UXTA 5D2NE 3JTBA 3CZLA 2ICWB 4P23D 3CFEB 5DRXA 3VI3F 3GRWL 1XH3B 2WWKO 2G9KA 4MQXD 5E2UH 2J1ZA 4TLUA 4J7RA 1PG7W 4Z7VE 3S0PA 2PR9A 4OFQA 2JQZA 3OKMA 2JQMA 2ARJA 3BN9D 5K93A 1MREL 5A43C 2CJ3A 1KGJA 3D48R 1JGUL 1Y07A 1Z9PA 3MMEB 4FC3E 4AGMA 3REWB 5BCAA 4ZW5A 1CFVH 2FR4B 4Q0XH 4I3RH 1U8MA 5DVKA 1LWHA 5I18L 2AK4E 3GRWA 5CS7A 4HUVA 5KBKA 1C7TA 3C6LD 5FGRA 4JQVC 3H9SA 4YHYB 2HVJA 2PP9A 1G5GA 3KAAA 8FABB 1F4XL 3CFJA 2M83A 4WWID 1QKZL 4TSCL 1MVUA 2RCSH 1N4XL 1FVCA 2IDFA 3FQNB 3NJXA 5C0GA 5ACZB 5GZND 3ULVD 4F91B 1L9NA 1Q0YH 3TESA 2DH2A 3NH7L 4MCMA 3RPBA 3FN3A 4FA8A 1HHJB 4N0UA 5E6IB 4EQ3A 2WOBA 1XGTA 4O2FB 4U3SA 1BZ7A 3Q2VA 4Y5XB 3IGFA 2ZNXA 4M1CC 3D3VA 2E27H 3ARRA 1M7XA 1LGVA 3K6NA 2B59A 4K3GA 1UA7A 2OXHA 1S7VA 3MJWA 4YHZH 2B9AA 3O3EA 4UM9D 4M29A 1MWAL 2UVFA 2R39A 3O4LD 5JYLA 1A7OH 1M42A 4CA4A 4A67A 1K6QL 1R1CA 2M1KA 3QIUC 3BESR 2FB4H 3VQ2C 3ZY7A 1HWGB 2VLJA 4MX7A 2VIRA 1DJSA 5IR1A 2ZCKH 1RZKH 4DOHE 2OP4L 5IESL 2BZCA 2VL5B 2VLME 3CZEA 2G3ZA 2QT6A 4P2OC 3T3PE 3VRIA 1AIFB 1XAKA 3NIGB 4ZMYA 1WEJL 5KBPA 2R9HC 5EBLB 4DP0X 5C0EB 2B1OA 5AWNH 4X80L 3W0WA 1T66D 2EEBA 4K8RH 4M7LL 3WTTA 3C5JB 2ICWJ 3ILQD 3ULUC 2YMOA 3GEFA 1E8YA 3FYEB 3T2NH 3NVQA 5TQ0L 2QPEB 3T04D 1IEHA 4N28A 4F7TA 1DO5A 3ZRSA 3X1NA 4JGUA 3WY3A 4O00A 2AQ3A 5HDOA 2O30A 4IBLT 1KPUA 1CTNA 1OZTG 1MI5A 3MA9L 1A3QA 4PHXA 2A0LD 4JKPH 3ZZLA 1OAUL 2QTVA 4LEXL 5D7IE 4AQEB 4YLBA 2E47A 4F7KA 5IK3A 4LIQL 4KZDL 1U2CA 3RYMA 1OGSA 4L37A 5AVUB 3IRCA 3MO1B 5J7CC 1A6TB 4Q56A 3IAPA 4RCAA 4X6DA 1NCBL 4OCYL 3D9AH 4J6RH 4DEPC 1DQJB 1FGVH 3MV9E 4NQED 2BNQE 4E9SA 5F0MB 5LBSL 3TVMB 2DW5A 4PH8A 3W38A 4NQDD 4NNPH 5FA3A 3C60C 3ZDZE 1H3PL 1FHNA 1ASOA 4LLVB 5G4NA 4XPGH 1G6RB 3LNHA 4JDEA 1IE4A 5SWSE 3GMPA 1HQ4B 2P5EB 2HPOA 2GIXA 4IU3A 2XWJB 5EN2B 5DQDH 3FB7A 3OV6A 2L0DA 2Y2TA 1U8JB 2H9GB 3F7KA 5C0NC 1SN0A 4U6XA 3K71A 5D70H 1FZKA 2E8ZA 3S37L 1T5KA 2P8PB 4PRAA 3TBTB 1EQWA 2AV7A 4HCGA 3GS0A 1YY8A 1B4LA 5FIEA 3ISWA 2I07B 1SBBA 4BQCA 3LH8A 3IFPB 4BK5C 3WXWH 3PNRB 2CHWA 1CCZA 5AW8B 3ZMNA 2KZBA 3VI4A 5EG6C 2OJZH 4BKSC 1LHZA 4X8CA 2Z34A 2FWSA 3VXTA 1EZVY 3ZL1A 4BZ2H 3CMOH 4YHLH 5T3XD 4G83A 1ET7A 3U0TB 2QVFB 3MUHL 2R23B 5D1XE 1A7QH 3MZGB 3FCSB 5DD0H 2AJVL 4WKXA 5TDNB 3RA7L 4W1TA 4YSTA 2QELA 2ZOOA 4NFDA 3VXRE 2HKAA 3FT0A 5BV7B 1AP2A 5GS0C 5E94A 4EMZA 1ZLSH 4P04A 3QQ4A 1K5NA 2OTPA 4NQXA 4OCRL 3P4NA 1CTOA 4M3HA 3PWJB 2BOCA 3HS0C 2WBWB 4O02B 1KY6A 1RJLB 3IK2A 1JXDA 4LRIA 3X14B 3QZLA 1MHPL 5E8PA 1YNLL 2OLDA 4ELMF 5IIEA 4JAMB 2DQHL 4NOFA 5EIIG 2FJHA 5C0BA 1A6ZA 3NCJH 3LNFA 2AP2A 4CU8A 5B3NA 1FH5L 4EI5C 2ZAHA 5AUMA 3ELAT 3WNPA 5BOJA 2AQNA 4TTGA 3C5ZB 1U2HA 2Z4QA 3I75B 1DBML 3QDJA 4QJ5B 1AHWC 4X6DF 2JI3A 3JWDL 3ARDC 1GMIA 5LKNA 5A2AA 1XTLA 3RZWA 5FO7B 3CWGA 2X09A 5C2BL 3KS0H 5T8IA 3U4BH 4CJ1A 4HEME 1KSRA 1ET5A 4POZC 4BHUA 1BXVA 1HH9B 2R2CA 3NCXA 4GMSH 3V0FA 3O11B 5EOCJ 1L6XA 1UACL 3TA3C 1G9NH 1UD2A 4GRWE 2DQJH 2ICWA 3CFEA 3KLKA 1XH3A 1CJYA 4UOW0 4PS4L 2ZYIA 1AE6L 5F9WB 4J3BA 4X7SL 4B0MM 1WWWX 4HPYL 1RZ8B 4JRXD 1ECZA 3G5XB 2Y07H 2YC1B 3KH3A 3W56A 1BF5A 5T1KB 4U1MB 3T4YB 3REWA 5CKAA 1PKQE 3BHBA 2WVUA 2XPYA 3DWTA 1HYRC 2I24N 2AJYL 4PBVC 1E27B 2KI6A 2LFGA 5L6YH 1KTRL 3N40F 1WFOA 4M6OL 1ORQA 2J21A 4WCYL 3HG1E 1MDAA 3KPTA 3VI4F 2X1PA 4JBSA 4NHUB 3BKCL 4NRYA 1QBLL 2AV1B 3GZOA 4FMKA 3Q13A 1FL5B 4BHUI 3HUJA 3E38A 4UUJB 3L4ZA 5E4EC 3STZB 8FABA 3TN0B 4JO3L 3VWKD 4KV5F 4J3WA 3FQNA 3AITA 2P44B 3L1GA 4N0FA 4ONHB 3IFOB 2ADYA 3AREC 3GYRA 1R19A 3KXFA 2BVYA 2E75C 4QOKB 3NEEA 2A9AA 4Y16B 4AW4A 5MEQB 4IIZA 4WI5A 1D9KB 3PQYE 4O2FA 5D71L 2Q9OA 3EO9L 5EUOE 2JKXA 2FEEL 1PTZA 2VXTH 4FNLH 4Y5XA 3KPRD 2WKGA 1NANI 4JPIA 5D2NA 3CVDA 5IW1B 4G7YL 4ZXBC 3HI1A 5F7HA 5I6LA 4NP4H 2BIOA 4P9MH 4GQ9L 4QRBA 3U36B 2FK9A 3V6FA 3VYNA 5I2IB 3D09A 1X5GA 4LCVA 2QHLA 1JS4A 4ORGB 1NM9A 1MLCB 2HLFD 4UQEA 1CYWA 1E4XH 3DX9A 4M6ML 5JXEC 1A7NH 5FGBA 1UZ8A 3T1WA 5IJDC 3QO1A 2EDNA 3U2IA 4ANWA 3FYIB 3TPUB 1FFPB 4HIIB 5JW3L 2XTJC 2NT1A 3EOTH 4EPSA 5ILTH 2VR8A 2YFNA 2QKIB 1AANA 4DQOH 1N7MH 3GLZA 1AIFA 5D93B 3DRQB 5C0EA 5JIIA 1OWRM 2PPFA 1NKGA 5KVGH 2ZKWA 2VDML 4F20A 1HSAA 1F6AB 2GPZA 1V7NL 3S48A 4UB0H 1QNIA 1VACB 2GG1A 3NSCA 1XVSA 3UAJA 4P2RD 3HB3D 2B7DT 1KCRL 3OXRB 1MCBA 5F7YC 4YUEH 3F83A 2WXJA 3JT2A 4IOFD 4S1SL 5DZPA 2DL2A 1UUNA 3L4VA 2GQHA 4BK4A 1BAFL 5E9DD 2O61B 3KVDD 4AQEA 4TVPL 1DJZA 5ITFB 2FEEI 2O5XL 1Z9NA 3EZ8A 4NJ9H 3D2UD 1YA5A 3WTXA 2ZX8A 5IHBA 2W38A 3MO1A 1J48A 1A6TA 1PG7H 2NNAB 3EF4A 3VDCA 5BNXD 5ICZB 1YEHH 1KCVH 4Y9BA 2BXYA 3SOTA 4ISVB 5TF0A 1DQJA 1NAKL 5DI8B 1DJXA 3TVMA 3BX7C 1VPOH 2DI7A 5L2KA 1KYOK 4PRPA 5L7XL 1XQ4A 3SYAA 4HOZA 1C5CL 4I2XA 3VVWA 4DUWA 4QHUB 2OMBA 4UV7L 4MTMA 1MQKH 4R8WH 1JPGA 2VW7A 3KHQA 2XFXA 2K45A 3PNWA 4FQCL 4GOSA 2VE6A 3LZOA 5EIIB 4OF3A 1SYVB 2Y1YA 4ZFOB 3QQNA 1I8AA 2WQWA 5JZ7C 4FMFA 3EJSA 2C7UA 3KYNA 4D3CL 5I82A 1E2WA 3FS9A 5BMFH 1E9OB 1D6EA 1AXSA 1AZCA 4JDVB 4ZMOA 2OJEB 4JN1H 3H9SD 3TBTA 4E9RA 1KCUH 1JVLA 3IFPA 4Y7MA 2I9LB 1H6EA 5CP3H 4DPAX 2B4CC 2OI9C 2D0FA 5I6KA 4IIQB 3G5WA 4UQ9A 1RUAH 1DTUA 4GS7B 5H4ZA 2WJ5A 1A8ZA 1NAMB 5F7LB 3GM0A 3HZ3A 5EORH 3UJIL 5HHQA 4ONFL 3IJHB 3U0TA 4BZ1H 2RQEA 4Y2DC 4FQXA 1VEMA 2R23A 4NB7A 3NIGF 5JUEL 4AEIL 5HY9B 5I76A 4Y9FA 1S9VB 2CMRH 5AD0A 1NEUA 4MA1B 3CHQA 2WTOA 4PRIB 1MCWM 3V52L 5MI0B 1TYEB 3ETTA 2PO6B 4X6CB 4AYFB 1RZIA 3NCMA 1X3DA 2BP8A 4ZD3L 3L5WA 1FCCA 2KZ1B 2AK1H 3LXAA 5JW5B 4MHHI 5SWSA 2VLJD 3SB3A 5FK9B 4DZ8B 5F7FA 3A4AA 3LCYA 2YR3A 5E8DL 4O02A 3X14A 4HXBH 3AGVA 3TJEH 4JDTH 3W0WD 2IH1A 2Q5BA 2X0UA 2XY2A 3PJLA 4W9CC 5TF1H 4JAMA 4BSWA 5KVFH 1K8IA 4LP5A 3QCTH 3TBYB 4D0BB 1J9RA 1UC6A 2P52A 2ZSWB 1CU4H 2G4EA 3A4FA 3PV6B 4FQJL 4IYKA 2A4EA 1OEZW 3AT9A 3A4EA 3C5ZA 3I75A 5F9DC 1PL3A 4CVWA 2XXGA 2DQTL 1AZUA 5ABAA 4YR6B 1CTMA 4JVPA 5IMLA 4HUUB 2GJ6E 3WJLA 1A3ZA 1MI5D 2YD0A 6FABL 1MCDA 4KK5D 1HH9A 4WUKH 4NKDA 3WLBB 5D1XA 4YSEA 1BFOB 2K0RA 3QPQC 4K9EL 3NA4A 5DO8A 5TDPB 3KJ4B 2W07B 1SLWA 4NFBA 4WW1B 1AI1H 3L4UA 3LQAL 2EDQA 4WW2A 4F7EB 2P5PA 5D4JA 1RZ8A 4HMDA 4KGLA 1VAHA 2NSQA 4PJFE 5LGJA 5JOPD 1ZANH 3V5KB 4H8WL 3VW3H 5DZVA 3T4YA 2BM3A 4FG2A 4X4XB 2GUOB 5I19H 1IGML 1SVBA 4OLUH 4QAWA 5CCHE 4YX2H 3IMTA 4NHUA 3SKJH 4N8UA 4MFHA 2IPKA 2PPEA 2AV1A 5DVMA 1BBJA 2G4GA 1FL5A 2HRPL 3IJSA 2QGDA 4M3KB 4KKPA 4ZTOH 4JVUA 3RFRA 5FW6A 3MV8E 3KWWB 2VDNH 4QOKA 4FFTA 2QBWA 3ALPA 4D2NA 4MXVE 4XMKH 2BFGA 1EMTH 3BC9A 2CXGA 5EPMA 3EUUA 1FLRL 2CUHA 5JW4Q 4OZIA 4XNYH 5EZLB 5IW1A 5T1MA 1ADQH 3GMMA 5HGDB 3SE3A 5I2IA 1CQYA 2QEJA 1CICC 2PCXA 4XNXL 5DURD 4YSDA 5LG1A 5C08B 4F58L 3S35X 5CBAB 5HI3D 1CLCA 2Z92A 3WNLA 3AM8C 1W72B 3LNGA 5LGYA 1OANA 4NCDA 1LEKA 4W6XB 1RP9A 4HIIA 2FX8H 4MCYB 4NJAL 3DMMD 2Z7UA 2IG2H 5C7XH 3P0YH 1QSFE 3DRQA 1G1YA 4CSTA 4HWEH 1TJHH 2Z31C 5BQ7B 3ZKMC 1CBVH 5KAQG 1QVOB 3EXJA 2WPGA 1M71A 1F6AA 1Z0MA 1L6ZA 3LN5B 4RSVA 4YHMH 2KBGA 1TNMA 2X9WA 1P53A 3IB4A 5GHWL 1QR1A 1EA9C 1VACA 1IBHA 4X4ZA 5F9OL 2KZWA 4DERA 2DEXX 4KJQC 1E43A 2A9BA 2JCWA 2W60B 3RBGA 4UNVA 4EBQH 4AT6A 4QRUA 2OMWB 5GRVL 4D9LL 3EFOA 3SCMC 1MQ8A 2DWTA 4BA8A 2G75B 2M2DA 3HE6C 1TO4A 3BWZA 3INUH 3CN3A 5K9JL 4OLZL 4LCUB 2FX9L 2EYSB 2Q20A 1I8MB 2CDGB 4BCXA 3KHOA 4KPHL 3DX3A 5DA4A 4XVTH 3BRFA 5DJYA 4ABWA 3Q5TA 4L4TB 1GJUA 3MC0A 4ISVA 3WE1A 5E5UB 5FF6B 5B1AB 5F93C 4RMTA 4HOMA 1I3GH 4X6BA 2EKJA 4NUGH 4ZRGA 1K4DA 5SX5K 2IWEA 3VG9B 1S7UA 5KYUB 4ODUA 4FS0A 4OGQC 2APSA 5DRWB 4G6MH 3E0GA 3VFPB 4KDTC 4LLUB 1MFBH 4J4PA 1NCCL 4LQFH 1NSNH 3WHXB 3WHE1 5IBLD 3Q06A 2NTFB 4Q6IC 5EIIA 1RIUL 3M8OH 2JJTA 3SQBA 3WAKA 4QRQB 5LCVH 2VUOA 2JXMB 1WTLA 4N2OA 1KF9B 2APFA 1E9OA 3V0HA 2G60H 4JDVA 5KW9L 2OJEA 3DX7A 1RZKC 1R5IA 5DK2B 1RUQL 1GKEA 2FIKA 2LV4A 1UWGH 5CJXA 3R06B 5H2BA 4CVUA 4PWKA 1S7RB 4IU2B 4P5RA 4GG6B 4HA1A 3KXFD 2NYZA 3L7EA 1KB5L 3D1MC 1IAMA 5E6ID 1VFBB 3NQKA 1NUNB 1WC7A 4FFVD 3ZHNA 3MLVH 4EXPX 4MMZA 4CMMB 3B5HA 1SMAA 2YQ2A 4G6KH 5DWUH 3JV6A 4HGMA 4YC2B 4BQ8A 4JY4A 4DK5A 2QQQA 2P5WB 1M9WA 2A9ML 3CXFA 3R1GH 2F54B 1JDAA 3Q6GH 4PRIA 4XTRC 2PO6A 1GZHA 4AYFA 3UBXB 2APBA 4KJWC 1BQHA 5IB2B 5CSGA 1ZAGA 1QFUL 3U46B 3FT3A 3F7RA 2FBOJ 1N64H 4DZ8A 2AQSA 1FBIL 1T80A 4PV9B 1GYCA 1RUML 2R4SH 3RWIB 4A6YH 2DMCA 2IQ9H 3MRLB 4P9HH 1KENH 3BOVA 4JPKH 1G6VK 3L4XA 3CC5B 4WRLA 3TWCH 5CWSA 3B1UA 5E51A 2H32A 5HSFA 1CGSL 4N3TA 4U31A 5LUMA 2B5IC 3TBYA 2IQAB 1FNSL 4WWKB 3FCUB 4IEFB 3PV6A 2ZSWA 4XNMA 1QTYT 3TCLA 1MRDH 4HK3N 5I8OH 3UAJD 4M43H 5FB8B 1KYDA 4PJBE 3QI9C 4ZZFA 5HJGA 4NZFA 4YR6A 1HE7A 1X4ZA 3OAZH 4RZCB 5EEWA 2R1YA 4TSBL 1F3DH 2JKJA 3SGJC 3TNNA 2QSQA 3ZTDC 5CZXD 4A2EA 3DX1A 5HHME 5B21A 1KELH 4FJYA 4P3DB 2GYSA 3WLBA 1QSZA 1AQDB 4Z7QE 1NIDA 3S9DB 1MJUL 2H0FA 1NZRA 2W07A 1JFQL 3THMH 4YOKA 4TVSa 43C9B 3EYUL 2XN9E 3D39B 2DD8L 4XBGB 4XO8A 3RVXD 2ZCLH 1NWPA 4F7EA 1P5VA 3VGBA 3TVMD 5DO2D 3D06A 3HS8A 5F96L 5L2KD 4G5AA 4PRPD 3CH1B 3FO9B 2P4AB 3APNA 1M7DB 1A0QL 2NY1B 1BEXA 3HZKB 1XH0A 3K2MC 4MBOA 4X4XA 1JZJA 2GUOA 3MTRA 4A68A 5IHZB 1FAIH 2ZUTA 3LS5H 4HOXA 2VZTA 1U21A 2P5ED 2J6EH 2Y6SD 5AVZB 4F7PB 4R4ND 4OBRA 3EO0B 5F3BA 2XQBL 1F4AA 3OM3B 2W9DL 4JB9H 1IJNA 1X5KA 3T0EC 3P40A 4CUCA 2H3XC 4CC0A 2E9BA 3PGDB 4LLMB 1UKQA 3NK3A 1U3NA 1QNZL 4X6CF 2O93L 2J57A 4G42A 5C70A 3U2SB 5EZLA 2JB5H 3FK3A 5HGDA 4N5EC 3S35L 3ZVVA 1E30A 1ETA1 1WBXB 2ENYA 1VZHA 3HVNA 1SJEB 2NX5B 1TIUA 5CBAA 4XMZA 1AY1L 5F7DB 4MCNA 3DVNB 3BD4A 3L81A 4PJEE 1WQVT 4WQOA 1ZKAA 4JEGB 3ATFA 1NC4A 2KDYA 2CK2A 4ADIA 3IMBA 4MXWL 4UU9A 2EE2A 1R3IH 1QSEB 3KLAA 4S0TD 4HCIA 4D8OA 5G55A 3H2WA 3RKDD 3NZSA 4L3EE 3KPLB 2AXHA 4QHPA 5BQ7A 1A2YB 1GJWA 2VSCA 1ACXA 4E9WA 1QVOA 4K94C 5I66B 1X4YA 1SDDB 1OGAB 3LN5A 1RCYA 4MAYC 4ZG1A 4GXFA 4PJIB 3VXQA 4BSVA 12E8H 5DS8B 1WK0A 1HINL 1XAUA 4E9LA 3BD5A 2DJSA 3QDMB 3VI3E 3F05A 3N40P 2Z8SA 4OQTL 1HXMB 3ULUL 3HBQA 4G8GB 5DTFA 2OMWA 3C5ZD 1WCBA 2GSGA 4P05A 5IBUG 1WA2X 3WELA 2IOMA 3ESNA 4XMPH 2ZOUA 4JFDE 5KZCB 4JJHA 4P2OA 5FO9B 1L0YA 1D5XB 1OTSD 1T7WA 2EYSA 4RNRB 2Z0UA 1DVQA 3LVTA 4KTDH 4Y5VC 1YNTB 3WDIA 1CFMA 2E9WA 1RIHH 2FVNA 2NDGA 25C8H 3MR9B 5DD6B 2WN3A 4OQTA 5AOKA 3C6SB 1U6AH 4GAJL 3F58H 1BDYA 1F58H 4L9DA 2ERJC 1NIFA 3PDOB 5FF6A 2MPAL 1JYXA 4OJFL 5H94B 1RZGB 4Z3TA 4M8QA 1B2WL 2HTLD 4LLUA 5F1SA 2CRMA 2UXGA 1DBAH 3KH4A 4FI8A 1O9VA 1BHGA 3FO1A 5DHXB 3WHXA 5JQIB 2QVMA 4UI2A 2GJZB 1K8DB 2CJTA 3DTUB 3D30A 1K3ZA 1GL4B 2NTFA 3QORB 1KXQE 4Q74A 4R7NB 4GT7A 4IJTA 2FQDA 4QRQA 3L95B 3SBQA 4PJDB 2WYTA 2IPUG 1YMHA 4GJTB 2BC4A 2WXMA 1ILSA 1KJ2H 1F8TL 1KIPB 5D5MB 3CG8A 3WI9A 1G9EA 3DETD 1ZWIA 2ZZUT 4KTGA 3LX9A 5DK2A 2DIAA 4QCIA 3TN0D 1PY4A 2DQDH 2H41A 3I9IA 1LO4H 1GGIH 4U7SA 3OGCB 3VG0L 3C60A 1S7RA 4IU2A 1ZJBA 4QOKD 4AVHA 3FTVA 1EUTA 1E3FA 2FEDD 3MKKA 3F5WA 4XC1H 1VFBA 4YHPB 4Z3JA 3H3PH 3HG5A 2VISB 2DICA 4CMMA 2ZAIA 3OB0H 5B8CC 5I5RA 1BG1A 1S78D 3FN0L 3WFCH 4G7VH 5EO1B 3LQZB 4YS4A 4FKKA 1IV8A 4EZLA 2P5WA 5I8KL 4KRPC 1A9BB 5F1NA 4NAQA 3AQXA 3SOBH 1OP5H 3NPSB 5E2VH 5IB2A 1K72A 4GW5B 4H4NA 3QWOB 4Y88A 2OI9B 4PRHB 3DNKA 3L3HA 5F0JB 3U46A 1NUGA 4DH2A 4EUPB 2N7BA 5KVDH 1R3JA 5I73B 3GHPA 2NY7H 4FF9A 3FT4B 5GPRA 4PWHA 5GS0L 5JIQA 2CALA 1BM7A 1IMHC 3RWIA 1CVSC 1W6WA 5E1GA 5BVJA 4XRCB 1CS6A 3PIQA 4HGWB 3VMPA 2IADA 4ZS7L 4RRPG 1VZGA 5AW9B 3WFZA 2ZOTA 4K3DH 1H6UA 4MS8C 1CLOL 2IQAA 3LSOB 2DQ6A 3QWQB 3MKGA 3BXNB 1E6JH 4IEFA 4X7DC 1DEEB 3B7RL 3MRKB 1UUSA 3UBFA 5FB8A 5C3IA 4JFEA 1HT6A 2CPUA 4YXHL 2FYVA 1MY5A 5HYEA 5AVSB 1SXSA 1F00I 3RWJB 4K7FB 3VFSB 5I0YA 1NGQH 2ESVE 3HS0A 4NX0A 1RZFH 5CEZE 2YK1H 3TC9A 4KHXL 1M6OB 2OR7A 4P3DA 5T1LB 1DJHA 3X1FA 2XZCH 1TJMA 3QCVL 1OZUA 4PMFA 43C9A 4XBGA 2P24B 4B7LA 2JJWA 4EI5A 1MNUL 4NNXB 1CWVA 3UPRA 3O6FC 1OM9A 4HG4K 1AHWA 4MMYB 4UTAA 4W68A 1RK1A 4LEBA 2CG9X 2IFGA 3ARDA 5DR5L 5GISH 3FOMB 3VE0B 1XL6A 2YXVA 3FO9A 1M7DA 4NC0B 3HZKA 1U92B 4J4PD 4KXBA 2ADFL 2I5YL 1AO7B 1OO2A 5C2UB 3MGAA 5HGHB 3T0DA 35C8L 1S7SB 2UYLB 3KDPB 2P46B 3RAJL 2BVOB 4GG6F 3D0LA 5BRQA 3FUNA 1VKXA 2EADA 3BGAA 3N1QC 4WO4B 3QA3B 3DX8A 3EO0A 3TA3A 4J5VA 3T8MA 3QFDB 1IQDB 1X5JA 5IBUB 2YGPA 1NGYA 1CIUA 3HI6L 4AI7A 2CBQA 1N10A 2IAMC 4POYA 2VMJA 4UQCA 5DJAB 3OJVC 5B4MC 3ZW3A 1HKFA 4LLMA 4XI5C 1YEFL 5EOQL 1MLBB 1H19A 3DV6B 3L9RB 4OZFA 2XHNA 3NACL 1I7RA 4CAGA 3EBGA 1PS3A 4XZUB 3K6DA 4ODWB 4XNQA 2XVBA 3X2QB 3GXUB 5KSBA 2DQEL 4QYOA 5CXPA 1XGRA 4J12A 2VLRB 4LNRB 4GBXB 2NX5A 2DLEA 1QSVA 4Z8FH 4AENB 4JHAH 2JH2A 3A5VA 5AAWC 4ATWA 2X70B 3OR7A 1OCOB 4LU5L 3QR1A 1H8SA 2BCKB 4PRID 3AREA 3KCPA 1EERB 4XMTA 2PO6D 4LSRL 3BGMB 1JPST 1KGCE 2W65B 2Q8BH 3AS0A 2NY2D 3BYYA 4L1LA 2VW6A 4G6JH 2F5BH 1LJMA 5AYQA 4ZX4A 1A2YA 2KLTA 3FB6B 5HHXH 5JOPE 1DSFH 2QL1A 5I66A 4UOJA 1O7VA 1SDDA 1OGAA 2OMZB 4OLVL 2VKXA 3LN9A 2B2XH 5DS8A 3ARWA 4ABVA 3DBSA 3UC0H 3NTCH 5K1JA 3HJ0A 4LB8A 4DP9X 5JXEA 1AG6A 4X5RA 1BPVA 4Y2OA 1HXMA 1NMCB 3GLDA 1MCKA 4G8GA 4ODSL 4ZMTA 1IGYB 1PIFA 4K73A 5J0BA 3D52A 2AW2A 3NMEA 3U7WL 1J5OH 4RDQG 5I1LA 2XQYG 3QFJB 1C1EL 4F2EA 1PCXA 1MRFL 4WUUE 1GH7A 4KXZI 1D5XA 4LPVA 3QXWA 4XCFH 4N9OB 2EDYA 3I9AA 4X5LA 1XF2B 2HH0L 3DGCR 5IVZA 7FABH 5KAQF 4CKVX 3MLUL 4JO1L 4X0KB 3SDYL 5E2TL 1ZT7B 4W6WB 4IOSA 1JYNA 1NCGA 4Z7OB 3PDOA 2IJ0C 3FB8B 5DJDB 3V7MA 3V10A 3CHOA 4N4YB 3CLFH 2CM5A 1B4JL 3PGCB 5KBMA 2ZXGA 3H2PA 4X2UA 2WP3T 4QF1B 5FLVA 4I3SL 3FMGH 3FONB 2GJZA 1K8DA 3QORA 2OM5A 1G43A 4OCSH 3JZ7A 2H4EA 1NC2B 1IX2A 3BFOA 4Z78A 5BJTB 5IFJB 1UZ6E 4Z3EA 2XQ0A 2GW5A 2EVGA 2MQCA 2HTKC 4ES8A 1AZVA 4ZUVB 2ZOWA 4UV4L 4X6EB 3AXIA 3RWGB 5TE4L 1KMGA 2VDKB 3MVSA 5I1EH 3UTSB 2VM4A 1YDPB 1T6WA 3CHXA 2W0PA 1JZIA 4NM4H 1K9TA 3X12B 3LS4L 4AQAB 1T5XB 5TPWH 2N7AA 1J9SA 2UXFA 4L0PB 4XVJH 3KL0A 1RHHB 5A6MA 2IDUA 4UNIA 4CW1B 1Y18A 2B1HL 4N2MA 2VN7A 3ZQXA 5AYUH 2B4CL 2NCMA 1CDBA 2VISA 2ADIA 4Y8AA 3SGEH 6PAZA 3PHOB 4X9YA 3AC0A 3CLEL 3LQZA 3DX6B 2WNXA 5FXCH 5C08D 4Y4HB 5IW6B 2GK0B 1DDHB 4PRBA 4BA0A 1M53A 1TEFA 3WFDL 5DVPA 5IQLA 2YKLL 3NIDE 3O4OC 4PJIF 1J12A 4BQBA 2C9RA 2A3TA 3C87A 1NC4D 1TPXC 3MJ7A 5BRZA 1SGKA 2WVSA 4X9HA 3NGBC 3QWOA 2FD6L 4PRHA 2FBJL 2WQXA 3HKFA 3QUGA 5ADOH 3CQFA 4MJ4A 1EHAA 4WI9A 3B4NA