4FC3E

Crystal structure of human methaemoglobin complexed with the second neat domain of isdh from staphylococcus aureus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
144
structure length
144
Chain Sequence
b'QQYPPADESLQDAIKNPAIIDKEHTADNWRPIDFQMKNDKGERQFYHYASTVEPATVIFTKTGPIIELGLKTASTWKKFEVYEGDKKLPVELVSYDSDKDYAYIRFPVSNGTREVKIVSSIEYGENIHEDYDYTLMVFAQPITN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemoglobin subunit alpha
molecule tags Oxygen transport/protein binding
source organism Staphylococcus aureus
publication title Structure of the Hemoglobin-IsdH Complex Reveals the Molecular Basis of Iron Capture by Staphylococcus aureus
pubmed doi rcsb
total genus 30
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fc3E00
2Q7AA 3QZNA 3QZMA 2ITFA 4FC3E 2MOQA 3QUHA 4NLAA 3QZPA 3QZOA 3VTMA 3OVUB 4H8QA 2O1AA 3S48A 3SZ6A 3SZKC 4H8PA 2O6PA 5D1XE 5D1ZI 3RTLA 3QUGA 2E7DA 5D1QE 4WJG3 2ITEA 3VUAA 3QZLA 2Z6FA 2H3KA 4MYPA 3RURA 2K78A 3SIKA 4YMPA
chains in the Genus database with same CATH superfamily
1ZKAA 2IANA 4ZBJA 2LOEA 3RTQB 1HEHC 4HUNB 1WV7T 4M7LL 3KMDA 4KRNA 1FGVL 3LS4L 1K6QH 2AHIA 2ADFL 3EOAA 3AGVA 3T04D 3QEGL 3SZ6A 2KLRA 5GS1A 2P5PA 3V2AR 4RMVA 4X4YB 3UTSA 5FGSA 1TO4A 1SMAA 5AB2A 3RJOA 3EOYG 1X5XA 2P5EB 4HWBL 4BWUA 4G6KH 1OPGH 3FDWA 2CAKA 4KZDL 5I5IA 4PJDA 4OFVA 5EF0A 5IESH 2DBLH 2ICES 2F58H 4XVTH 3ROOA 4M43L 2E7LC 4WHYG 2F7PA 1KB9J 2DM2A 4I1NB 1ND0B 2SODB 4U31A 3HG1D 4XN2A 2C1PA 5T1JA 1DLHA 3D12B 3LPPA 5IQNA 3BEWA 3MBWA 4HHGA 5KYWB 4N1CA 2NR6C 2W60A 3DDFA 4NSKA 5BUPA 1NCIA 4MHHI 5IEHA 3GRWH 4P57A 1BDYA 4UUJB 4XO5A 3PAZA 1LEKB 2JJSA 1JGDA 4NZ8A 4XMPL 5DS2A 5BMFH 4ALAL 2BCKB 1KELL 1GW0A 2ZX8A 4BCXA 3WUWG 3IJSB 2AANA 1NEZG 4YVUA 3MRJA 5F0LB 3UG4A 3X17A 4QNPE 1SBSL 1BVNP 1PW3A 1PX8A 1OTTC 3HE6B 4GUOA 1R33A 2XA8L 1P4LB 1A47A 5DFWH 3NK4A 2XIDA 1N2RA 2DQDL 3X14B 4PUBL 1T1WB 4KI5D 1OCCB 4WO4D 3GXTA 3FO2A 1ZLSL 2ED8A 4L8CA 3WNKA 3PP4H 5C3LD 3SKNA 5ILTH 5GS0L 3KBFA 4HJEA 3DUUB 4D9RE 2IQAA 3HS0B 3N40P 4ISVB 4J27A 2H32B 4LCIH 4PGEB 4QXWA 5HI5D 5I1LA 1BFOA 2WKOA 1QQDB 5F9DC 3CC1A 1FZKB 3J7HA 3LKSB 3K4DA 5T1LD 5IBLC 1UM4H 3NGBC 1MEXH 2ROYA 3Q6GH 2YA1A 3UAJC 4PGCB 4XNAA 4L9LA 2G0LA 3MXVL 1ZY9A 2Z1KA 5AFAA 1T83C 1SJMA 5B39A 3EFDL 1ODAA 3QIUD 3MUJA 4CN4A 4DVRH 5B1CA 1IM9A 3TFBA 2QR0A 5L9DL 4H1LH 3VXRD 4AEHL 2X4PB 32C2B 2IADB 3NH7H 1E5UI 3B2DC 1N8OE 2VAJA 4JFDD 1S78D 1B2WL 4P2QA 3S35H 5C0GB 1IQWH 3OHXB 2J12B 4XP6H 4MSWA 1AKJD 1XZWA 3OQRA 1G7PA 5E6YA 2CCLA 5KSUA 3TZVA 1BWMA 4MNQB 3I9GH 4FQXB 5BXFA 3L9RB 4PV9A 5K1VA 1FZMB 4PBDA 4AJVA 5B21A 2C9QA 1VB9A 3DJTA 5JQ6L 1KY6A 5C0CE 2QTVA 1OAZL 4R4BA 3WNNA 4Z3IA 3LEXA 5E8DH 1HE7A 3ZDZB 1QG3A 1J9SA 4ZUVB 2FHBA 1I9IH 1JI1A 4KTGA 3VXSE 1ORSA 3ZDYB 1I1AB 1DJIA 4ZTPL 4AYID 3BKJL 4N20A 3TBTB 3O2WH 4WNQA 1HINH 5C09B 1CR9L 3V6OE 4BD4A 4XZUA 2EVIA 4F7CA 1OGTA 3S5LA 3U0WL 2NY1B 4FG6D 4LLDB 2FO1A 2XCMC 3BKYL 2VXQH 2ALWA 2OJZL 3WI9A 3OGCA 2X12A 3Q5TA 4DFIA 1GPOL 4QHKI 4DK3A 1ZGLM 1G94A 2KQMA 3T2OA 2OMUA 4KUZL 1OK8A 3CFDA 3OSKA 5DRWB 3RKDD 3ULVD 4A37A 1I8MA 2CGYA 1HVXA 1MREH 4JR9L 1WC7B 4I5BB 4K7PY 3RIFF 4ZQKB 3UO1H 5C92A 1FN4B 3UBXB 3HVNA 1K8IA 2NY3B 1AP2B 2VH5L 3CSYA 3QDJE 4G9DB 4JANB 3GSVB 2YSTA 3NSJA 3U0PA 2YGQA 1T0NB 1KN4L 3WE1A 2UX6A 2ZXDA 1EAPB 1I1AC 2UY7B 2FSDA 1NUGA 3QJHB 1FHNA 4K7FB 1R3KA 4OTXH 3T0EE 1NL0H 2DWEA 3HI1B 5FM5M 2WWOA 3CXHJ 3DGGB 3K72A 3FB8B 2ZOLB 4Z76A 4YK4B 4XNDA 4QKTA 4PS4L 1NANH 4I4WA 1KYFA 4GYBA 4YDJA 4LLQB 5FFLA 1VFBB 1U3HB 1E4WL 2A6IB 4QKXB 3QNFA 2CDFA 2VDLB 4HS8L 1OAUL 1JNLL 1IQDA 4FYRA 2VAAB 2OJEA 1TQSA 4MMZA 4AV4A 1CCZA 2FATL 2Q3XA 4LNRA 5H37A 1G7QB 4HULB 3L5XH 3VD0A 2Z34A 3PY9A 4CNIB 1JUFB 3CZLA 1FIGH 5ETUB 5A7BA 3DMMB 5EEUA 4B9YA 1H6TA 3ES6B 2IFFH 3RVUC 1YEEH 4PJGB 1IIKA 3C5ZA 1UKSA 2X28A 4UU9A 4FFYL 3IMBA 3VO0A 3QRLA 1O5PA 1VLXA 1YRKA 3GWJA 5T1KD 4QAMB 4PJAA 4ATWA 5FKPB 5LNGA 3QDJD 1OB1B 4CW1A 2VR9A 2GJJA 5CP3H 4ELKB 3ZGIA 3IWUA 5LN4A 5C9JA 5FO8A 2BW4A 3S8WA 1U3HC 3M8OL 4MNQE 4M56A 3UGEA 4TSBL 5FUCE 3GI8L 3WIHL 1USQA 4MDIB 4CVZA 5IJDC 1TTFA 4AJ0A 1QBLL 1YLBB 4AZUA 3O3BB 5LB1A 3BQUD 3GUTA 2X1WL 4O9HL 3ZMRA 1CXLA 5DFTA 3KPNB 3QQ3B 3WEAA 1QAWA 1AD9A 5FWQA 4GG8B 4JDVB 5DYFA 2AXGB 5EUOA 4U4IA 3H7LA 2FR4A 2WPGA 5F6HJ 3TWYA 1SNRA 3PIQB 4FYTA 1Z1WA 3N85L 4MYPA 1CF8H 4L05A 3LZFH 4FZ8L 3L2LA 2E6PA 1UWYA 5CILL 1BAWA 2WB1A 1BEXA 5EDXA 4ZMXA 1M7IA 5C07B 1P4UA 4U1JA 2EDQA 1T7VA 4H8WL 2XSKA 4XBGA 4XBMA 5IBUB 1HJBC 2YWYA 3BP5A 2TRHA 4JO3H 4PJHB 1PZUB 4PLKD 2Q8BH 5HHVH 1P4BH 3T4YA 2PTTB 1HHIB 3D52A 2WLIB 2CJSA 2LLGA 1RHHA 1U8MB 4L3FA 1B0RA 5MEOA 3FTSA 3GPSA 3BUIA 1OT1A 3DTDA 4IRZH 3WNIA 1IEBA 5M95B 4KQ0A 1RZFH 3L1OL 3HJ0A 3O3AA 4OVVA 1M53A 4ODUB 3MNZB 4QMEA 1O6TA 3GXMA 2CSPA 4FYQA 2XG4B 1ILSA 4JKPH 4XHQA 3Q2LA 3TT1H 1MI5A 4DF9A 4L3EA 5E5MA 3V52L 2ATKA 5KJRL 2C3VA 3FRPA 4LGPB 5CINL 3II2A 3P4NB 3CFCH 3GRGA 3TCLB 4OLXL 1WZMA 4PLOB 1LWJA 3QS3A 3VGBA 3U82B 5DJYB 3ZXAC 1MFDH 4CBZA 4TSCH 2CDEB 2FWOA 1T04B 4Y2OA 4I77H 4Y1TA 4D9QD 1F90L 5DA4A 4YVNA 2X3BA 4G9FA 1OCWH 2VDPH 4LOUD 5CZRA 3Q48A 3R18A 3QK0A 5T3ZL 2PWGA 1WHPA 3QJZA 1AO7D 5KANG 5C0AA 1VCBC 4OCYL 4P2QD 3P3SA 2WW8A 3NCCB 3QQDB 4EAEA 5F3BB 1N9PA 2YC1A 3HNVH 3KL5A 2EH8L 2ALAA 4Z7OB 1CT8A 3N9GH 1HZHH 2ZG3A 2GSGB 4MMXB 4NHCH 5DS8B 2JIXA 3DOHA 5KVGL 1LMIA 1ZSDA 2VXUL 5K39A 1NICA 2JQZA 2VDNL 4L8SB 4G7VH 4JPSA 4OI9A 4PJCB 3JVGC 1NPJA 2FGWH 3CU1A 2OZ4A 3QJOA 2KPNA 3TZVD 4JGUA 1YQVL 4M02A 4X9IA 1AG6A 1AS6A 1LWHA 1DDTA 1ZT1A 1AGBB 4CAGA 4KJQD 5K9OB 3O6ML 5I2IB 1QABA 3CFBB 4E41B 5KVEE 1MF2H 1A2YA 1QFUH 2Q86A 3VFSB 2GTZA 2IPKB 3L3GB 4PWKA 4GRLB 4O2EA 5J5EA 1E7UA 4N0YL 4JFZL 1TDQA 3D0LA 3RGHA 1HHHB 3RL2B 3BZDA 4G8GA 3HMXA 3MJ9H 5JOPE 4JFFB 2AJYL 1J5CA 1PLAA 5IIEB 1ONQB 2OP4H 4LE8A 2MNJB 4NNYB 2A0LD 5IHWA 3OXSA 1ZWIA 4QYOA 5TPWH 3ZVVA 3X1FA 4IEFA 5KBDA 3DURB 3CFTA 3EF4A 4C4BA 1RJZA 1IVLA 4IRSB 2R59A 1FE8H 3L3JA 4P23D 1KCWA 4FN0A 4O4YL 1CXKA 2AQ3A 2Q3ZA 2JELL 3QIUB 3P30L 5D7SH 2ORBH 1OKEA 2R2HA 2CJUL 2V2WA 3U30B 4EIZC 4Y4FC 4EUPA 4J3SA 1NWPA 4KK8C 5CNHA 4MJ5A 4YHKH 3NYKA 2PYFB 2GSIA 4UQAA 1A6UH 5T3XE 1XH1A 4F7PB 1HIML 4KITB 2GW5A 1XVSA 4WWPA 4PJDF 4WCYL 2AXFB 4WO4A 1JPGA 3BO8B 4CMHC 2X4SA 3RDTA 2ETWA 4QRTB 5D1XC 4AGLA 1NMBL 3KPOA 3LNGA 3S36L 2MPAH 3STBA 1KJ2B 4GEJA 4ZAKC 4MS8D 2Y5TB 3M1CA 1G7MA 1NIBA 2BSBA 1LO5B 5HGAB 3QRBA 3BXNA 4XVOA 4ACPA 4RRPM 3OPZL 5DRZB 3T6QC 4LBEA 1F3JA 4BFIB 1UQSB 3JV4A 1WYJA 3R8QA 2TRYA 4LESA 3AS0A 3ARTA 2MCG1 2P8PB 4YNYA 1SXZA 3K4AA 3WTUA 4X7TA 1A3RL 5B3JE 2A4CA 3CUPB 5J1TC 3BAEH 4HG4K 2QKIB 3F7KA 1MIEH 2VLME 2A5UA 3NPSC 3UAJA 2BNRA 2CIIB 3CMOH 3H2QA 3KL0A 3PJLA 2CLZB 4OZIF 5D93B 4GKSB 3LKNB 2VITA 3ZTEA 2ICWI 5E4AA 2BZCA 1J5OH 4FXGC 2I5YH 2HX7A 4L5FL 2HRHA 4PJBF 1X5LA 4LEBA 2UWEF 3HUJE 4Q4EA 1I1FA 4GQPH 4FQHB 5MERA 4UT6L 1IKOP 2OCCB 2HFTA 5E2VL 5FHBL 2ZG1A 4XPBL 4NAMA 4UYPA 1ZTXL 3S9DB 1MH5B 1M7UA 3EAKA 4NKOB 1BIIA 3U46A 4NI6A 3QG6A 4KHXH 4TPRL 3WHE0 2KS0A 5LG6A 4JO1H 4JFPB 3ZL1A 4Q89A 5I16B 1T5WA 1VDGA 2DQHH 4YDLB 2X2YA 3IE4A 4YGVA 2GBAA 3ALXA 1QX1A 4ZTOL 3V0FA 3LRSA 3DARA 3D9AL 4P2YA 3QAQA 5GGVL 3GBNL 4YHMH 1S7WB 2DQEL 2NUPB 3ATEA 1E4XH 1GZHA 5EFIA 2WAQA 4XCNB 1E0OB 1IL1B 4Y19B 5D4JA 1N26A 2NR6A 2X70B 5HJ3B 3QEHA 1FNEB 1SLWA 5KZCB 1HQRB 2NZ1A 2IAND 4UILL 3LVEA 4U1IA 3H9SD 4P48A 1BVKA 3BSZL 3O8XC 4QTHA 5JTWA 3AXIA 2NY4D 5C71A 4FNLH 2WKLA 4IBLT 3WKMH 1BQLH 3SBWA 4XOAA 3V0WL 3ZZ1A 3GMOB 3T0AA 4JW3A 1J0ZA 1FBIH 3Q3GA 3SHSA 3GLZA 4GS7B 3STZB 1NCBH 1SHSA 3VYNA 4MD5B 2NW2B 3IFNH 4JQIL 3FO1A 4ZO6A 4LPVA 1PG7L 2R27A 1JZ3A 4U6XB 4MA1B 1AOZA 3AT8A 3NCFB 4MJIE 3ARGD 3GIVA 1CGXA 2ZUYA 4LCCA 4Y5XA 4FQQA 5IK3B 1GZHC 2BHYA 4KUCF 3QCVH 1M05B 3PJSA 4KH2A 1H8OA 2K6WA 3BAJA 4BGLA 1I8LC 5TDNA 2BIMA 1B3IA 2OZ4L 4U1MB 2EEBA 4CILA 2WBJB 3ILQC 4HMCA 3VFMB 4BH7B 4ZW5A 4EOWH 4RETB 4G59C 1LO2L 5D7LD 2AK4E 4KXDA 5DC4B 1Z6JT 2ATPB 3FSOA 3R0MA 4U4BA 3S2CA 1GJUA 1NGQL 2JB6B 3SKOA 2QFPA 3WY3A 5DQ9A 3P73A 4M62L 3KS0H 5BRZD 2IANE 1NLDH 3AQYA 1NQBA 2QVMA 2IGFH 1WJ3A 3FFDA 1URZA 3ECUA 5CGMA 4ABUA 2W65A 5CZVH 2AV1A 2X4NB 3K0YA 5AW3B 3V95A 1WE5A 3FBKA 2R0LL 2FE0A 1S5HB 1UWXK 2Q7AA 3B2UD 3P11L 1WRFA 1A4JB 4K8RH 3T6VA 1EAJA 3RWHB 3BI9X 1GY2A 3QZPA 1KCVL 3C9NA 3BYTA 5IUSA 1BQSA 3NRPA 4Y16D 1TVHB 3UTTA 5T33L 1XF4B 3QC6X 3MAWA 3S5YA 4FXKC 1JDDA 4RNRA 4B95C 2D3JA 5LCVL 1FNFA 5CUSL 3A47A 2FJFB 5ADOL 3TYGH 1H19A 5EZOH 1RIUL 3SOBL 2DV6A 2VXSH 4ZOBA 3MXWL 3U4KA 1TLKA 3F58L 3HMXL 3UADA 2ICWA 1KYOK 3WS3B 5IQ9A 1NOAA 1BLNB 4Z7AA 2WVUA 3ZRFC 4RVBA 3LHAA 1NGYA 2IWGA 3T65B 4YEFA 1G1CA 1UOVA 1ZLDA 4GO8A 3RA7H 4OZHF 1JK9A 4U6YA 1C5CH 2GT9B 4XPHH 1GCYA 3LH8A 2BVTA 2CDGB 4NZJA 3RVWD 2Z91A 3LKPB 2AQPA 4FI6A 4XE5B 3U7YH 5I1CH 3EJSA 5DMKA 3L2MA 4HOZA 1QLEH 3EUUA 1JV5B 4L1HA 5I6XC 2WIIA 5KJ7E 3ULVE 3LVTA 2R29H 4DN4L 2QMKA 2V9UA 5GGQL 1BZOA 3ATBA 2XX1A 4PRID 5HI4D 3EXLA 3F64A 3ABMB 5IW1A 5GZNC 1FWXA 4Z7QB 5FECA 2XKUA 2YPLA 5C1MB 3C2AH 1QKZL 4YZFE 1XAUA 5EN2B 1KIRA 1C16A 3QWOB 3V0JA 4LASH 2HJLA 1TU2B 3M17A 5TDOB 1NEZA 4M5SA 5FUZL 3ETSA 1HZKA 2AQTA 5L4JA 2ZUQB 1S2EA 5DVPA 4PJXA 5EOQH 3C5XA 2C4XA 4G3YH 1JL8A 3VUAA 4D9QE 4ODXB 1TQBB 3CDGB 2NXZC 2W9EH 5IMOA 1T1XB 3F7VA 3QBTB 2GITB 2IALA 3BKCH 3NCMA 4JM0A 3IDNA 1X5FA 4QYAA 2VDRL 5I18L 4PY7B 4UV4H 4PP1C 2HH0L 2O5XL 1DEEB 5HD8C 1CXIA 2JCCE 2FB4H 2E9IA 3FH7A 5K5YA 4W9KC 1DSFL 1X5IA 1VFUA 2J6EL 3IDJA 3KR3L 4QR7A 1U41A 5EZLA 5FYKH 2HT3C 4OZHA 1S46A 5IB4A 3BWAA 3HB3C 1UTDA 4YDVB 5I24A 1WBXB 3ZBMA 2HWZL 1QSEE 4ZFFB 4CMMA 4PJ5A 5FGCB 1GGTA 2ZUQC 5D1ZC 4R8WH 5ABDE 2FSEB 3MROB 5EH1A 3D18B 4BE6A 2H6PB 4ATTA 1GZQA 4P9MH 3OZKA 4QRPA 4BSVA 3DGDA 3GLEA 1JXKA 1MVFA 1IGFL 4PJFF 4IK6A 3RB7A 4KX7A 4N8VB 3UIZA 2X2UA 4BSWB 3IJSA 3OL2A 4AJYV 1MQKH 3KYKL 1HAWA 2FZ3A 2OSLA 4JCMA 4BUGA 4U7KA 4ENED 5MENE 4DOHE 3MR9A 5J3HD 5FGBA 4IRSD 4M48H 5F9OL 1AACA 3RQ3A 5KS9A 1QFOA 5F2FA 3FO2B 1Z0MA 3MYZA 4KK8D 1UB6B 1ZLSH 2VR8A 4HPYH 1CLZL 1DJZA 2AEOA 5E70A 1S4IA 1MFBL 1O7DE 4JVWA 2BVOA 3VXOA 5AW8B 3CCHB 4PJ6A 3SDCA 3WJLA 2BY2A 1QQDA 3BPNB 2G30A 5KVEH 1BLIA 5GPRA 3QNYA 2EYSA 4C56E 5KWYC 1IGTB 3RUGF 5EORH 2LR4A 2EDRA 5CJOL 4G43B 4UBDD 1WAAF 3BKMH 1CE1L 4DP5X 3QGVA 3MFFA 4K3HA 1FGVH 2DEYX 3WG7B 5EEVA 4K7PX 5IT2L 1QYGL 1UJ3A 2IDSA 4WJG3 1E42A 3RWIB 5F1IA 5B39B 1OARH 5DFVD 4G8FB 1ZT4B 1J18A 3N0AA 4GFXA 4PEEA 3BDXA 3MCG1 3PWUA 3W3BA 4P2RE 3LQZB 4X7CC 4LLVA 3PHQA 4EUPG 1B4JH 4FQLH 4X42A 2Q76A 5CBEB 3L3KB 4PJDB 3TZVC 1IKNA 1I3RA 4PRPA 1A4KA 5E2UL 3HZMA 3FN9A 1NLBL 5FX3A 3WY4A 1G6RL 3BOVA 1RJCA 2GPZA 2E4FA 2XVBA 1KCUH 4KJYA 1FZMA 3WN5C 5CJXC 4FXKA 3SO3C 1W0WA 3GJEB 4ONGH 3TBYA 3EO9H 4ZUWB 2ZE0A 3O9WC 5GZOC 4ZUVA 2JWYA 4BGDA 3IDYB 4AQZA 5HYFA 1NCDH 1SOQA 2CIKB 3FUHA 2QZQA 2PWFA 4KXCA 2YWZA 2V5RA 4F7CB 2ENYA 3NIGF 4WEBL 4XNUL 2WZ6A 2A9ML 3DI2B 4M7LT 2V7HA 3MLWL 2FAUA 5T8IA 4RISL 3MRIB 3MLPA 5ILTL 3SKNB 2R2EA 4LLMA 3OKOA 2BINA 5DUML 5HI3D 1E3ZA 1MREL 2WUBH 4JPKH 1RLBA 4KO5A 3B83A 1R24A 4LCIL 1SXBA 1VA9A 2DI9A 1TQBC 2YRLA 4HKBA 5F3FA 4A7QA 3FB5A 1LJMA 4NC1C 4RCAA 5D4IA 4KKAD 1NGXB 4IDLA 2X4QB 4QWWD 2F2HA 3VE0A 2CALA 1OAJA 3IN0A 5D72L 1U95A 2ZWLT 1F6FB 4B9GA 5EU6B 2RB8A 2QADD 2D0FA 1EEZA 4LSRH 3DGGA 3GMPB 1O6SA 2GK0A 1IC7H 1XL4A 1DUYB 4KY1H 5KN5A 4K2UH 4H7VA 2QELA 4ANWA 5DSCA 4G1MA 1F58H 4H40A 3I84A 3FQXB 3HZKB 4JHWH 1CD9B 5HDLA 2Z3FA 3BN9C 4UV7H 1XR9B 1LP9F 1V55B 2F7IA 2OL3B 3FZUC 4NCC2 3M7FB 2BRRH 5DK3A 2D7TL 5KVFE 1IARB 4ZZKA 4IOIA 1MCOL 1VGEH 4QCIB 4QHLB 5GGTH 3LNHA 4WI4A 1KJMA 1KJ3H 5IVZB 1IQWL 3OHXA 2I07A 3LIZA 1GS6X 4U2YA 1U93B 4ZMAT 1UH4A 2YEVB 4OLVL 2K8MA 1BQHB 2EVJA 2NYYD 4MNQA 4LVNC 4Q9RL 2OTWB 2OS7A 1R46A 3QJQB 3RWCA 1TEYA 4CNIA 4HLJA 2XKNB 1PLGL 2YK1L 3IMWA 5CMAA 2YXMA 4JPWL 3SDAD 3FU3A 4PJ5E 2F8OA 1OAZH 2R2CA 3FW6A 4NQED 4ORZC 4NUPA 2IFFL 3LV3B 1FQ9C 3MRCB 3RVTC 1F45A 1AI1L 1JPFB 2B1AH 3Q6FA 4XXCC 1A6ZA 1HOCA 2B5IC 2VXVL 3DJZA 2WTPA 1U42A 3KLAA 1QO3A 4UOZA 6FABH 1ZA6A 5AAMA 2B2XL 2OMXB 2OBGA 5JQIB 5KW9H 3JWNC 1Q9KB 4TL4A 3T1FA 3V0VA 5KSAA 1UKQA 1YY8B 3S98A 3KPLA 3RNQB 1X9LA 1WWAX 4I3RH 3AABA 4Z7WA 1F4WL 1Z3GH 3UYOD 1QR1B 2IOMA 3QI9A 2WQSA 1D6EA 4X5LA 1KIUB 2C1OB 2XQYK 1WC7A 5E6IB 4J8QA 3KW8A 5ICZA 5AVQB 3SKMA 2NQ3A 4G2AA 4IBYA 5IFAH 4NQCB 5EUOB 4C56A 1K8IB 4TQEL 2Y07H 4AIOA 1IKFH 5BV7C 3ZGHA 3MLRH 5AW9B 1KENH 5I19L 2VJ0A 1NL0L 3A24A 2DWEB 3N41F 4GKZB 5JA8B 1INDL 2Y7MA 4JG5A 4AYFA 3HC3H 1DVFA 4LFHD 4P5TA 2BSDA 5GXBB 2ZWSA 1XGTB 4I4WB 2EILB 3WFHA 2DEWX 1M7IB 4RAUA 5C07A 4YDJB 3PUCA 1R75A 1P7KA 3LN9A 3JBG7 4P46D 2OW7A 5K93A 1WCBB 2EDXA 5JA9A 3ATAA 2A6IA 4NKMA 5SX4I 3RFZC 3E80A 2EEXA 1VEPA 2WLIA 3Q01A 4S11A 4H2AA 3S2AA 3PGCB 4WDIA 5HPOA 3MRRB 3TNMB 1EEYA 5MI0C 3AB0B 4N4YB 2LHAA 3VYOA 4EXPX 5MEQA 1R19A 5FV2A 1ACCA 4HWEL 2MFNA 3O3AB 4CVWA 3T2QA 2ZCKL 1DCLA 3OKYA 2OQJB 3QULB 3X3GL 3CN4A 3BZEB 3QHTC 2P42B 3OMIB 1YYMH 4GW1B 1CLVA 1VAHA 2HUHA 5GRUL 3U30C 4HWBA 4OLYH 2FIKB 1QI5A 4QO1B 2IWFA 3HRZB 3FT9A 3BCFA 2CDEA 3ASWA 4H13C 4NENB 1LGVA 3C6LA 4WI7A 4PRDB 4LKCA 5FKPA 3S48A 5I28A 1PAZA 2GJRA 3WFCH 4XMZA 4OF8A 4AMKL 1W15A 3L81A 3NOIA 4PRIB 3JWNH 2WSPA 2FUTA 4UBDC 1MHHA 5IB1B 2ZF8A 1BXAA 1GIGL 4LSTH 4MDIA 4CVZB 4HFUL 5D4HA 3DOSB 1F42A 1QBLH 4XH2A 5F7FA 15C8H 4K0OA 2OPCA 4PRIE 4NIKB 5MEPB 3VQ1C 4XMKH 4W68A 3WO3B 1FVEA 1M6OA 5FDYA 3TBWA 2PR4H 4NQQA 4AENB 2JKTM 1U8QB 5HYSB 4L8SA 1CF8L 2QGCA 4BM7A 4JGJA 3PWLA 2E7LA 3QIBB 3ZTJG 3MBXH 1E43A 1XL6A 2EDBA 5TE6H 3O6KL 3O6FA 4G8GD 1S7UB 3CFIC 3SGEH 1UB5B 5FF6A 5IKCA 4BH8A 1CDIA 2JQAA 3GINA 3ZKNC 1P7QB 4F33A 4N2GA 4N2AA 4Y7MA 3UTSE 4N0YH 2NQCA 3RNKB 3SPHA 3UJJH 4B96A 4OJDH 3LKRA 3GSNA 3QYCA 1TMCB 1XH3B 2K3HA 3V4LA 1EO8H 4FXGB 1E4KA 2BXYA 3RVVC 1S7RB 5ENWA 1ROCA 3HNTL 4LRIC 4HIIA 2HT3D 2OYLA 4XVSH 5F96L 1MNNA 3NSFA 5HHPA 3EHBB 3MNZA 1LO0L 4JN2A 4HSCX 2XWJB 2ADFH 1P53A 4NZTH 4N2BA 5HI5C 4K3JH 2O26U 3QNXA 1IC5H 1H8LA 2N0MA 1WHOA 4X4YA 4DKAA 1HL4A 1G0XA 1N7ML 1D5XA 4G6KL 4WO4C 2GSIB 4OFDA 1A6VH 2Y2WA 3MO1A 1INQB 4DZ8A 4Q6IB 4JY5H 3RZCB 1TSRA 4GPVA 4WGWB 1CE6B 3DK2A 2AJZA 5SX5K 2XWBA 3BP7A 4LDOB 2JVUA 4G9FB 5EBGA 1NC4A 2NSQA 2XTLA 3MCKA 2Y1AA 4XVUC 2APVA 4IMKA 5EU6E 3V6ZA 3ZHFA 2YMXH 1PD6A 2YOCA 1KJ2A 5KG9A 2NX5A 4L1LA 1BD2A 4YWGH 2Y5TA 4U6VH 3OMAB 2WBJD 5IEHB 3ULSB 4FP8H 4GAJL 1QACA 4NFCA 5LVEA 1OAKH 1MI5D 3HNVL 5GHWL 2B1HH 2GJ6B 1A4BA 1KEML 3H53A 5JHBA 1DBKH 1YEDA 2Y3AA 1WUZA 4X6CF 4A2GA 3MV8A 4YQXL 1ZSDB 2VXUH 1SBSH 4ZNEA 4FNPA 1PJWA 3MBEB 2AVGA 4UM9B 4KTDL 4OIAA 1CICB 3K6FA 1YQVH 2VLJE 1RU9H 3DIDA 4EN3D 1ZT1B 4RWYH 5K9OA 4A39A 4IM8A 4W1TA 4FFVD 4AVHA 1OW0C 4FX5A 1AKJB 2BMKA 1NOLA 4BJLA 2X1QA 3NCBB 2BNRB 1MN4A 5GS0H 4TLSA 3ECBB 2QMJA 2XN9E 1MAJA 1L5GB 3B9DA 3I85A 5BV7H 4MAUH 2P28B 1WFUA 2OP4L 2OK0H 1N6UA 3G9VA 2NY0C 4KRPB 3RLSA 4LK4A 3NBNA 4BFBD 3MLUH 3DMMD 2A77L 2N56A 3IM1A 5CJBA 5AB1A 3QEQB 4BWWA 1IC4L 1RJZB 1E6JH 4L2YA 5F72S 4XPBH 3AQZA 2GEQA 4NKOA 3EFDH 1MAKA 4AQ1C 2HA1A 4L9DA 5E08L 3NJIA 3P30H 5D7SL 3WTWA 3LXAA 4HIPA 5DF0A 1A64A 1BYOA 3V0AC 3HCVB 4DEWA 4F37F 3MJWA 3GD1C 1IC1A 2WNWA 1L7IH 3A23A 2J6EA 3DMMC 2UZXA 1REIA 1AGDB 4FJZA 4L4TE 2UXGA 4BWTA 4FLQA 2XG5B 5TF1H 1O5DT 3MRKB 3DTUB 2YD9A 4OFPA 4WCYH 4YHNA 4GW4B 1M1XA 1O6VA 1T21A 2ARJA 5C0GA 2ISDA 3F7LA 4PI2A 4MSWB 5BRQA 2QGDA 3LXUX 3P77A 1JWMB 5J4MA 2PWEA 4N0UB 1PZ2A 2ICEC 2GFBA 3EOBB 1SJHB 2PLTA 5HGAA 3TVMB 1BVKB 4QTHB 3TO2A 1ZPLA 5EIIB 3FT2A 1AZCA 3DX7A 1YJDH 4FNLL 1KTLA 3Q8EA 1K5WA 2ZX9A 1ERNA 1IFRA 4K3GA 1FNGA 2HSIA 5HJGA 3JV4B 5L4IA 4C57C 4PRBB 1FFOB 2X41A 4N87A 1V7MH 4X9HA 2C3GA 2OXGA 3QA3B 4LSQL 3JT0A 1BOGB 3K5RA 3IU3A 1QEWA 1Y18B 1OEZW 3P0YL 3FQUA 3HFMH 3ZDZF 4EI5C 3K5SA 4JY4B 3F5WB 5BZWA 2FO4B 4W9JC 3N06B 1M05A 3PJSB 5D1XA 4ZQKA 4BK8A 3N50A 5KYUA 2PXYD 4BV1A 2X09A 4EI6A 3WFDL 1FN4A 5BO0D 1FAIH 3ULUD 4G8GE 1R6VA 4RMRA 1FAKT 1BREA 1HSBB 4FNTA 4TYUA 4AK2A 2FL5A 4GFTB 4D0BA 1I1FB 2IWEA 4OTXL 4ORGA 3VWJC 2L7QA 4TNWK 4PJHE 1TJIL 1MUJB 4C54A 1J8HE 4DW2L 3ALPA 4C55A 1M9WA 1XGUA 3U2JA 2NY6D 4HOWA 4UTCA 3GB7B 2WP3T 3HUJB 3JWOH 4DPRA 1UYWL 3TL5A 3Q0HA 3GKWH 1NLDL 2CO1A 4O5LL 4PGZA 1T89C 4LEXH 5GZNA 1EDYA 2CDFB 4NC0B 1T7ZA 3D85D 3D7PA 1TKWA 1S7WA 2DQEH 2EE9A 3HG1E 3SYPA 3K71B 4P23B 1CB4A 3UTQA 3RWFB 5ES4B 1QD0A 1MOEA 2FEJA 2QVFB 4K8RL 4JZJC 4WJ5A 1R5VB 3L5XL 4WFFE 3QEHB 1HFUA 5TF0A 4GUPA 2LVCA 1JPST 4RGNC 3VW3H 5DWUH 5EUKB 3UC0L 2IEPA 3ARQA 1TITA 4PIBA 1UXSB 1XCXA 3BPCB 4YDMA 4UU9B 1QNIA 1J05B 5HHQB 1NCNA 1QSFA 4JFEA 5FLVA 5D7IB 3IXTB 2Z31D 3EDKA 3Q2VA 4OM0L 3O2VL 1T22B 4LIQE 3NFNA 5JW3H 4MD5A 4JGMA 3UP6A 5LGHL 3IPBA 4ELKA 1KXVC 1DSYA 1FYHB 3S8GB 1CF1A 1NC4D 3F58H 5BOPA 1E5CA 1IBBA 1R5WB 4OR1A 5CN2A 5AZ2H 1J8SA 1O7SA 1GGBL 3GXDA 4GIOA 4MJHA 3BFWA 1MFVA 3FRPG 2JV6A 4A2MA 3DX8B 2AGJH 5EOCH 2DW5A 4P3WA 5DFAA 5FB8B 4Q7DA 2C9AA 2NX5E 1UACL 4YHIA 5TDNB 4V2BA 1ZDQA 4PJ8D 3SO5A 1UD6A 3TBSB 3U7YL 3Q44A 2DJMA 5TE4H 2EABA 4FLOA 3N85H 1QLEL 4V2CB 4E9RA 5IQLA 1XIWA 5IG7B 4E5XB 2E27H 3C5ZD 2X88A 1T80A 3BCDA 4HYTB 2Q7YA 5ID0B 1XBRA 3I6KA 1H5BC 5D1QE 5DJCB 5K9QG 2DQGH 3ELAT 4YSRA 2BSEA 2E47A 2X7LB 2FEDD 1YAIA 2OTUA 4Q0XL 2WWNA 3O45B 4MS8C 5EO0B 4AC4A 5EN2A 5D71H 4S1RH 4EZLA 1GYCA 5CSGA 2HG0A 2YSSB 5K9QI 2TSBA 3KDMA 4NQDD 4RAVA 5IB5B 3BVUA 2XY2A 5H4YA 1KTKE 2DB8A 1PF3A 5JOEA 5MEOB 2K70A 3FQ1A 1M2VB 5E1AA 4IHOA 3KH3A 3L1OH 2FVNA 3NACH 3K6SA 3C5JB 3REVA 1MCWW 2J1YA 1MSPA 3B3BA 1QBML 1TJMA 3M1BA 2JH2A 4KJPC 1JZ8A 3I9PA 1IAOB 1BBDL 4MDJA 1H6EA 1W80A 5F97E 1IJNA 3QUKB 4WW1B 4QY8B 2DJSA 2BY0A 3UTTB 3ECQA 5BVPH 3FO0L 5FC9A 2YUZA 3V5HB 4HXAL 2YA2A 3WJMA 4XNMA 3MA7B 5IB4B 3E9TA 4EIUA 1U8HA 4AGMA 2HPOA 2W0PA 4EKXA 4M03A 3W0WE 4OCXH 1M9SA 3WCYA 1IGIL 3DV4B 1FHGA 1RIUH 3WXVH 3QQ9C 4AQAB 2XIIA 1XSKA 3L48A 3GSOB 4H20L 1U8IB 4GT0A 1YDPA 4JZNA 5T5FH 3UTSD 1XIWD 1P84J 3C6LD 1TZOA 2FJGB 1BCIA 2NDFA 4OGXH 3CK0L 4X7FC 5FGBC 1T6BX 4PRNB 3R1GL 3SCMB 3FHQA 4KFZC 1BA9A 4K9EL 1SFDA 2R7EA 2ITFA 3EGXA 4OLWL 2D7OA 4IBTA 3KYNB 3NRQA 1AZNA 3F6JA 5L8JB 4FABH 1I1YB 3ULAB 5FOJA 2QT6A 4JO5A 5AW2B 4MVBD 3LNFA 3GF8A 3K2MC 2WKGA 3S35X 4TUKH 1A22B 3O41A 4F7MA 4OD3H 4QTIH 2B20A 4NUGH 4NO0D 5ICYB 5F9WC 3ZX1A 2TAAA 5JR1H 1QKZH 2O61A 3F8UB 2C9VA 1I3VA 3CZNA 3I50H 1MFEL 1UCBH 2ZICA 1CE1H 1BV8A 1I8UA 2XQBL 2WC7A 2AJYH 2VM4A 1FZJB 3RWIA 4J23A 3KWWB 4LLUA 3DI3B 5GRZA 5I82A 4DZBA 4U33A 4PJ8B 4WI9A 1EBAA 2W9EL 1EV2E 1GY1A 1TZGL 2J3SA 2WZ0A 3B34A 3HHRB 1BZEA 2GITA 1T7WA 3UO8B 2UXTA 1MXGA 1S7XB 5J11B 4ZQTA 3QUYD 5CJQH 3L3JB 2CUMA 3L3OB 2I27N 3QIUA 5EC1A 4ZUTA 3V5DA 1PCSA 5HDQL 4X6DE 2Q6WA 4FFZA 2VYRE 2GJZB 4MAYC 4HIEB 3RILA 2YPKA 4ABQA 2UZYA 3MN8A 4LCWA 4X5RA 3O3DB 2V3FA 4YHKL 2MOQA 4J12A 5D5MF 2AQQA 4WEEA 3DHUA 2AJVL 3II1A 5HDBE 3DXAB 4G5ZL 1KCUL 1A6TB 4KJYB 4F7PA 4LOEA 1UADC 2ENQA 1A3LH 1RFDL 2NOYA 5C0CA 5GZOA 1B3JA 2BNRE 1GGCL 2A3TA 3OBAA 1UD5A 3GI9H 3HE7B 3KDPB 5FLUA 4MZ2A 3T3PB 5GSVA 5AENA 7FABL 4K5LA 4QRPB 3QUXB 3VXQA 3RY6A 1CGYA 1Z5LB 3B3IA 3Q8AA 4RESB 1AYOA 1U33A 2BHZA 4DKDC 4EEEA 4X98B 2CKBA 5MI0B 5IB3A 2Y6TE 4HWNA 3S7GA 3BDYH 2CGRH 4XBPB 1UT1A 4W9ZA 3THMH 1WSST 2KT6A 4HAGA 5D1ZI 2WXPA 4BZ1A 3VMPA 4RDBA 4X4XA 3G6JA 4AEIH 4YX2L 2FD6H 5AUMB 5KSVB 1R34A 5EORL 4XCFL 3V4PH 3NABH 3F6IA 5KVDH 5C0JA 2HRGA 1PJ9A 5AVUB 1JCVA 3NJNA 4MQ7B 4W6WB 1DQQA 1U3HD 1EEZB 4LSRL 3V55A 5BPPA 5K59E 1J5OL 5BOJA 1UJ3B 2IGTA 1JZ4A 1DUYA 4J6IA 1EHNA 1F11A 4NWUL 5EF2A 3VGFA 1AD0A 1QUNB 1F58L 2J21A 3ECWA 3QQXA 2KLSA 3FQYA 4J3UA 3TJEL 5JHDB 1TXKA 2QGEA 3BGMB 4OFIA 2CR0A 4ECNA 1XIWC 2XT1B 4XXWC 4AXWA 5IWLC 3BRFA 1W72B 4RGNE 3MFGB 1DTUA 1O9VA 3BX7C 3L3KA 3GS0A 1AGFB 3VFUA 4JO1L 1OP3K 2XYBA 4N8PA 4X5WB 2I07B 1ACYL 1JGIA 5ADPH 1DBJL 1DQLL 1W2KT 3MV11 3O4LB 4ZZFA 1MFMA 3N0PB 3SYOA 3RWCB 4OSUL 5FWRA 4Q9CA 5C97A 1RMFL 2N1TE 2EIKB 5FCUL 1FRGL 3EDEA 3TPUA 4LP4A 2QHRH 3KPRA 4ZUUA 1LDSA 1YC7A 3KPPB 4EIGB 4F27A 4XC1H 5K59F 1RZKL 3FCGA 2QV4A 5JPMA 4MZ3A 2V7NA 2OMXA 2PPFA 1AAJA 4UILH 5I0VA 4O58H 4YDKH 1MQ8A 2X9XA 3BSZH 2NNFA 3RG1C 1R3HB 1TVBB 3WXWL 1G9NL 1CQKA 4I3RL 1RAMA 4AKPA 4BZ1L 1J8HB 5LNEA 3D0VB 4P5KB 2XQYA 3NJKA 4KMQA 1X5JA 2LT9A 5JZ7D 3CN0A 5F93C 3O3UN 4C59B 3BW9A 1F97A 3OKOB 1QLFB 4AG4L 2C1OA 3PNRB 3IMUA 4JPVL 4JPKL 4LL1A 3TTYA 4IQHA 1L0YA 4X0KB 2D3VA 3T1WA 1Y6KR 3CFEA 2Y7OA 3GXIA 3U48A 3A0OA 1JP5A 5IFAL 3QJUB 4JM2C 5DJ8B 5E2WH 3HKZA 2VN3A 2W59A 4PR5A 1JOIA 2D4DA 3Q43A 3HB3D 1L6XA 3MLRL 2IDQA 4RGND 2FK9A 2B08A 2Q3AA 3S97C 4N22A 3L7EA 3QEQD 1BEYL 2NSXA 4P4KB 3KXFA 4KHTL 4PJ8C 2WXQA 3FSZA 3SDXA 3MSPA 3P2BA 3QZOA 5SWZE 5B3SB 2QADB 3Q5YA 4K2UL 1I7TB 5FK9A 1AKPA 4R83A 2E8ZA 2WBJA 1F3DJ 3VJ6B 4GI8A 2FBJH 3UPRB 4FXLA 4QRRB 3K3QA 1A1MB 2WVSA 3CPLA 4NKMB 4AH2B 43C9A 1WUNT 1LE9A 5T1LB 1S9YB 1LDPH 2Y9RT 3WENA 5EC2B 1ZIBA 4W93A 5CS7A 3CVIL 4JDTL 3D4ZA 3T0EC 2MTPA 2IGFL 4QRRD 2R23A 3RRQA 4J3XA 2QDWA 2MHAB 1KULA 3QULA 1MHCB 2BSED 5D93C 5INDA 5KYYB 5DJDB 4JPWH 2EEAA 1NM4A 4X5XB 1S5HA 4Q4IA 2NW3B 5HHNA 2VLKE 4LLWB 3LV3A 3MRCA 2W91A 4FXTA 4ZSOB 3RWHA 3TEXA 2CK2A 2P5WB 5ESQA 5IHUH 3X1EA 1ZA6B 2ZPKL 3QZLA 4NENA 1SOKA 3V6BR 5I9QC 5DXWA 3C60A 5J9PB 2O93L 4HPOL 3IB4A 1XR8B 1YY8A 2QTEA 3D4CA 2HTKD 3FXIC 4NNPL 2BSTB 3MGTB 1U36A 1YUKB 3MZTA 4D7BA 4JO4H 1M4KA 3ESOA 4J28A 3G3LA 4ZAKB 3ARGB 1J11A 1MCFA 5I1GH 4TNGA 4DO5A 2Y06H 3S3BB 3S4SG 4XMKL 5CR8A 3ZK0A 1B6UA 4PS8A 4XB7A 1GYWA 3AVEA 1MLCB 1CDHA 3GXNA 1M6OB 2E8YA 5DJ2B 1CU4H 4JO2H 3DVGA 3D34A 3HI5L 2VDMB 2VJ8A 4L5FE 4X8JA 4N6QA 3IFOA 3WKQA 4ZPVA 4DH2A 1INDH 1EWHA 3JQOB 3LB6D 4N2IA 5DD6A 2N1KA 5HVGB 5C0RL 4P5TB 2CDGA 3CAFA 3UMNA 3SYCA 2DJUA 5SWZA 1SN5A 4N9OB 4HBCL 2E5EA 1I8IB 2CO4A 1JPSL 2X2JA 4Z0BL 1FO0L 4DESA 1TQTA 1H3UA 3TEZA 4AE0A 2IH1A 4PRPD 2DQMA 1VESA 1A6WL 1PZ3A 2W92A 5FECB 4XP4H 3WLBB 1KTRL 3VH8A 3ZY7A 5KJ4A 2WO4A 2XN9B 3EYUH 2ZCKH 4NJ9L 4RWHA 3DBSA 3REWA 2H3NB 1HKLH 3B2VH 4D3CL 2XWJA 3DSNA 4Q6IC 3NIGE 1DVSA 2CMRL 3BZEA 3FAXA 5E9DD 3IKKA 4HGKC 3RFZB 1U6AL 2MNWA 3QC5X 5DD1H 1D5XB 2HKAA 2BNQB 2XFXB 3FHEA 1DFXA 4E41E 4GBXA 3HRZA 2VDQL 3LD8B 5FFGA 5IV2A 5CO1A 1J0HA 4HK3N 2HH0H 4ZMYA 3EOTL 4TVPD 1K9TA 2C5DC 4OJYA 5HY9A 2PCXA 3N40F 3QJVB 4N1HB 3FT3B 5DC0A 3F65A 2CWRA 2O5ZL 3KR3H 1XCTB 1U8PA 3QUZA 2BWQA 1MCCA 4F1ZA 1SFHA 3OQ3B 1WBXA 3QQ4B 5ACMA 3R4DA 1BFVL 1T03H 3E1ZA 4LSSL 3CXHK 2VZ3A 3D18A 3JXAA 3T08A 4P9ML 1JYNA 2VABA 1MVYA 1ETZA 1WWBX 2EE3A 2QLVB 5EEWA 1AR1B 1XF3B 3V5KB 2DOCA 2CBPA 2ZOKA 4G70B 4E9VA 3VSVA 2ODIA 2IXQB 2ZXWB 4TRPH 3O6KH 4P3CH 4AQ1B 1DQTA 2YAHA 4NPYB 1OALA 2KHAA 4P9HC 2ARWA 4DEPC 3RNKA 3OAZH 3VXOB 2BHUA 2WXOA 2D2OA 1A7BA 3NQKA 3KVDD 4KV5F 2Y7QB 1DZBA 2WVVA 4Y4HD 1YN6B 3FU7A 3L3DA 3HNTH 4OIIL 4RLDA 3C6SA 2MCPH 4X6DF 4Q8BA 4DNLA 3DX9B 2YZ1A 2FX7H 3BISA 4XVSL 2VZUA 5F96H 3HE6C 4NN6C 1WIUA 3MFFB 2GSMB 1LO0H 3FCSA 5AVTB 1N6QL 5IVXA 1ZVSA 4IIZA 2CLRB 3O2DH 4TXVB 3SSGA 4NO5B 3R8BB 1IC5L 4P2CG 3O9WA 4GUQA 1HNYA 1N0XH 1IAIH 3I75A 1I8KB 1FYTB 1THCA 3R06B 4PMEA 4PJ7F 5E2TL 2D7MA 2V5MA 4PGJA 3SPGA 2HVJA 4IHBA 3T3MF 4LU5L 4XVUD 1VGKA 3T0ED 4OCMC 5DRXB 4PCKA 3FRUB 2XWBB 1A8ZA 3BIAX 3MCKB 3UG3A 3DRQB 2CHDA 1U2HA 2VLKD 3C09C 1S8DB 2EYRA 5D2NA 3NIGB 2GFBB 3EOBA 2CQVA 1OAXH 3DIFA 5SWSA 1FL6A 4NYLB 1F4YH 5GHWH 4LVOC 4F2ME 1BVZA 2I25N 2V2TB 3CXFA 2XZAL 3RIKA 2ZNWA 1RK1A 4I7ZC 2B16A 1N67A 4D2NA 4JY6B 2DYPD 5HGBA 3FTUA 2Y2TA 5EU7C 4TVSa 1YN7B 2BC4A 5DK0A 3ZE2E 4HJJH 1QUPA 3ZDZE 3PCYA 4BFNA 1G4MA 2X4RA 2KLTA 5C0AD 1NC2D 3QPQD 5IY5B 3WMPA 4P05A 4MBRA 1UATA 2R8SL 1SQMA 1CDGA 3QUMH 3PWJA 3RL1A 1P7HL 2IPTL 4PB9L 4ZAKD 5JORB 5ECGA 1RUPL 4M4RA 3CX5J 4B50A 1T1ZB 2Y72A 5B1JA 2H0PA 3RTLA 8PAZA 1HWGB 1F6LL 2VIRA 2MEJB 4B9FA 3FB5B 4N25A 4WENB 5BV7L 4UIMB 3ZKSD 3L13A 2AJSH 1SF3A 5IJVB 1N59B 4OIBA 4Z3GA 2QQQA 4BKSC 2O4EA 2UVEA 2AEQH 2EQDA 1H3VA 4H25A 3W9EB 5AB0A 5KVFL 4HCGA 2EXWC 4FFYA 1MHPL 1IC4H 2OX5B 2ITCB 5F70A 1O6SB 2GK0B 2FQDA 5KN5B 5AYUL 5F0JB 4PRPE 1MI5E 4W9GC 4Z7VE 1FFRA 1J0IA 1MCHA 4P23C 5EZIH 3BE1H 4MHHG 1ZV2A 1AJ7H 3RPIB 5KTEL 4JFHD 4Y5YC 3GMMA 2EUWA 3QT2A 4X99A 2OL3A 4NGHL 1VFOA 2YJLA 2UUDH 4GW5A 3U25A 4Z78B 4IOIB 4QHLA 4QCIA 2ENJA 4Z7VB 3TIEB 1M1XB 3KPQA 3B2XA 3X12B 2G3XA 3UTQB 4L1TA 4Z7WE 4OLVH 2XOTA 3U36B 4ZNCD 2VISA 4IDJL 1TETH 3APCA 5I8KH 1E50A 2KH2B 3INOA 2WCSA 5BOZG 2NCMA 5KAQG 4AYEC 3QORC 4OV5B 4WTZG 4OCRH 4HK0A 4XZ4A 5EU3A 1UXSA 3POCA 5I1IH 3L4XA 4XAWL 4EJ1C 3PQYA 1PLCA 5CCHE 4XRCA 1KLFA 1WS8A 1CG9B 3O2VH 3NCYP 1QRNE 2WANA 4HF5H 5EBWB 4E42B 4ESKA 1HQ4A 3H54A 4LAQH 4C83B 2DWDB 2Y23A 4B41A 2BNRD 3IGAA 1TNNA 3BQUB 4XOCA 4MB4A 4YH6A 1ICTA 3MQIA 3TIDA 1CFVH 1H5BB 3P02A 4BK5A 1HCVA 5MENA 2K0RA 5BW7C 2MWCA 3QJSB 3ZTJH 5HYJB 2X53A 1NGWB 3AREA 4BELD 2E75C 4C4KT 2AEIT 4PN6A 1Y6MR 4H1LA 2IO5A 2PO6A 1QZ1A 1VENA 2VN6A 1QHOA 1IUZA 2YD8A 2ZWYA 4DCQA 5J1AB 1ADQH 2FL5B 4BFEA 1XIWB 3GSWB 2HFFA 1R1CA 4E5XA 1OIOA 1JDCA 5IG7A 4XGZA 2X40A 3G5ZA 4PVNA 4AQEB 1JZ6A 2YD0A 2UYLB 4KK5C 2IC2A 4ZFOA 3CLFL 4R4ND 5DJZA 3HUJA 3JWOL 5TJWK 1R9FA 3VI4B 4MAZA 4YXHL 4DSYA 1HHJA 1KPVA 1TZ8A 5IUCA 3O4LD 5E6SB 2Z92A 2NXZB 1CK0L 5FW6A 1XGYH 5HDRA 3NG5A 5JMRA 1IO4C 4X6FA 1BXVA 2OW6A 2VDMH 4X8CA 5C09D 2RTTA 5B7FA 1TKWB 1EEYB 3BHBB 4NO2A 5F71A 1CFMA 1ZE3H 2YBRA 5F88A 4JLRB 3SDAB 3K6SB 2XUWA 4BDVB 4L3CA 2OR8A 3LCYA 3OJVC 5FO2A 3EYSH 4JAMA 4WJ5B 4M61A 1QBMH 4ZS7H 1GXEA 5H37G 1AZVA 4MDJB 5ICXA 2HYMA 1J5HA 1KYOJ 5I1DA 1JE6A 4RRPA 1I7ZB 4FOMA 2FIKA 4KK5D 3QQ9D 3GDCA 3WJMB 4N90D 5G4NA 3MNWB 2RR3A 4JFDB 2FLBT 3CHPA 4OZFH 4PJIA 1A4CA 1OL0A 2APSA 4Q14A 3S37L 1OHZA 1Y0LB 5IQ7L 3GZPA 3DJSA 3AMKA 5EEXA 1SVCP 3DUSB 4RIRB 3FZUD 4UQIM 4GXVL 2QEJA 2PMZA 1JRHL 1RERA 3AU1B 4K7PH 2MTAA 1MW2A 1UOLA 2Q0ZX 3L3IA 5GRJH 4KX8A 4X7EC 5LWYH 4EVNA 5KYXB 3E38A 3GSQA 3MRGB 3MRMB 5C0AE 3U7WH 4LFHG 2PR4L 3NVQA 4NQEB 3OKKA 1T66C 2L7UA 4NP4H 1CLCA 2VB5A 3FONA 4TVPH 5SWQB 1G7IA 4TTDC 4QWWC 4LCYB 2HT2D 5ID0A 3GHEL 4JFED 1EQWA 2DTML 5FA3A 2EC9T 3U6XA 3O45A 1CN4A 2CA4A 3BLPX 4KOBA 4S1RL 3QG7H 3ZQWA 2G0KA 2DPKA 1IM3D 3K6IA 4XMWA 4FQPA 3AM8C 5AD0B 2XY1A 5FAAA 5B22A 1HXYA 4DUVA 3QXTA 2Z8WC 2QPDB 3LZRA 4MMYB 4HS6A 2BFVL 3RJDA 4HIIB 1TZGH 4M8RA 2VM9A 3C5JA 3LRGA 2VLMD 3NSYA 4L8SC 1KTDA 4FQJH 3MACH 1AC6A 5IJKC 3PL6D 4ZO8A 3BFOA 1CGVA 4J7RA 4GAGH 4PJ5D 3V5DB 12E8L 3GK8H 3AQDA 3NJMA 5IROC 4UTAH 1BJ1H 1EZUA 2GUOB 3GSXB 3GO1L 3UTZB 1K85A 2AK4A 2WQXA 3QORA 2RIKA 3UCQA 1E8YA 2DQTH 3VDBA 9CGTA 4BFGA 2VRKA 2BCMA 3DV4A 4UM8B 2AJZB 4AQAA 5TH2B 2YPVH 5HYEA 1H15B 3ARBC 1QI4A 4PCYA 5ANME 3TBVB 4ZXBD 7FABH 1DVUA 4GKLA 4ZO9A 4TNVK 4X9FA 5JHLL 3QWRD 3VFRB 4M1CD 4JQXC 4JZNB 1NGPL 1YEGL 5TQ2L 4FP8L 3BQVA 1I7RB 3CK0H 1BAFH 4RAHA 1MELA 5FDWB 1DO6A 1MJUL 3QIBC 3R1GH 3SCMA 1ULVA 2ZD0A 4L1DA 4WW2F 3V9EA 5C8JB 4S1SL 5JOPD 2Z0UA 35C8L 3BIKB 2H3XC 5DFVC 3ZL2A 4TUJA 4UOQA 1HHKB 4FG6C 5TK4A 4Q9BA 5DZJA 5EIIG 2DLFL 2WLLB 2FT8A 3G5VA 4XNQA 4IS6B 3PGFH 4NHUA 1SDDA 4UM9A 4EMZA 2NTFB 3IYLW 2DD8H 2WXGA 2YAQA 4G9FD 4CU6A 1AHKA 3OMNB 4A6YH 3P3RA 4NWTH 4PAZA 4Y2DB 5J56B 5BVJA 4PGDB 2J5WA 2PPCA 4GRWF 3I2CL 3JWDC 4KKRA 1FG2A 1SBBA 3HE7C 6PCYA 1B9ZA 3ZE1E 3C60D 2CNYA 2IH9A 4KVCL 4ENZA 3INUH 3RIFK 1EK3A 5L7XL 1M71A 3ATFA 4PJGE 4U3SB 1KJVA 1G0YR 2UXFA 3HR5B 3P2DA 4MAUL 3CDZB 3VXME 4WW2C 4NWUH 5GS2H 5IQMA 4LL4A 1AD0B 1QUNA 3TJEH 1P5UC 2WM0A 4WWOA 1DE4A 1R0AL 3VX0A 2X6BA 4GRMB 3V4VH 3FN0H 5JXEC 1WCQA 1F0LA 4NOFA 4PV8A 4UQCA 4KZCA 4X5WA 1EERB 4HIEA 1J1OL 4L3AA 1LP9E 5EPMB 3O3DA 1L7IL 1QSFE 5F7BA 3NCXA 1OGAB 4CSPA 4QJ4B 4CVXB 1FIEA 4NSKB 5TF1L 3LN4B 5D7JC 1SM3H 3VWKA 4P57B 4K8RC 2BDNH 4E2OA 5DEGB 3VA6A 3WKPA 3PE9A 2HFEA 4XVJL 1BYPA 5TGBB 2PR9A 4XAKD 1CFNA 3ILDA 4JFQA 3W5MA 3HA0A 1DQDH 4YO0A 2DLHA 4IW4C 5SV3A 3OXRA 2CKBB 1NZRA 3H9YA 4PIRF 1KB9K 1V5JA 1SZNA 3SDXE 1FFOA 4B3VA 4ES8A 4U1SB 1I53A 3LHPH 3ZQXA 1WG3A 4FFZL 2QVTA 2VW7A 1U91A 5GQBA 4B60A 2QPEB 1TTUA 5LBSA 3RPBA 1S3RA 1MCPH 3LMJL 1HT6A 5IBTH 4UTBH 4X4XB 1MKFA 5D9SA 2H1PH 2P46B 2DKMA 3LZOA 5BZWB 1ASOA 2NTSP 3T0XA 5B8CB 1EA9C 2FX8H 2RQ8A 1WISA 1PX3A 8CGTA 1DQQB 5TK2A 1K4DA 3UZQA 1CTNA 1S7QA 3V4VB 2WXMA 2RAMA 4JK0D 3EOAB 4MZIA 2QQKL 3BVNB 2CO6B 2G2PA 4QRRA 2OMYB 1ZIAA 2OL3L 4X6BB 3UBXG 1X4ZA 2MKLC 3HOGA 32C2A 4KZDH 3BYYA 3L4TA 4NERA 2FWSA 3CVIH 4JDTH 1GS7A 4HQQH 3GZOA 4XP6L 2HLAB 3TH4T 2Z65C 4KKLC 3TU6A 1WBYA 5K1NA 1LTXA 3TV8A 2J4WH 1P0SE 2TSAA 3MBWB 3QNZA 4MXWH 3L9RA 5DVMA 2W60B 4PJCF 2ITEA 3GDBA 4LLAA 1G9EA 2NY1D 3QZWA 4UUJA 1T89A 1COBA 2HLEB 1P5VA 1JYWA 4IU2A 2VC2H 2NZ9D 1DSWA 1JGDB 1WGVA 3RWFA 1EXHA 2FRGP 2YMOA 1DZ0A 2BCKA 2V17L 2H0EA 3GXFA 3GBLA 4WTXA 4Y2LA 4LIQH 1NCJA 4I2XB 2I9TB 4OUUB 4HUCA 3HPJA 3ZL4L 1UHVA 2ZJSL 3WIIH 2A74C 4PLNC 1XT5A 4ZOCA 1JF1B 5CJXA 3ZZSA 2XETA 4XNXL 1ZXQA 3QDGE 3HG2A 3SOTA 2CE6A 3ECVA 1E7VA 3MRQA 5IGXL 1MVUA 1T22A 5JW3L 1SYSB 1N4XL 4U2ZA 4L29B 1BIHA 4FAAB 2IQAB 3HS0A 4ISVA 5DZPA 1A21A 1PY9A 3DKHA 3N91A 1R5WA 2VJXA 3UBXA 4JDEA 3OJDA 1ASPA 1T5XB 4EN3C 1PQZA 3NIFE 2P7TB 4PR5B 2UY7A 4FADA 3LRLA 4CSZA 1V27A 2O6DA 5C0RH 3BT2H 4LVEA 1XF1A 4IOSD 5TD4A 1G6RB 1S5IL 2X4UA 3P9LB 3NZUA 3PAUA 2QSCH 4KAQH 3WSQH 3TX4A 3UPRA 5L9DH 1BXUA 1TCRB 2WBJC 3VDCA 2F7RA 2K6YA 4AEHH 2AZAA 3ZDXE 3A67L 4JMXA 3SGKC 2BIHA 5DJAA 2IDCA 3EIFA 1A6WH 4J3OH 2AXHA 1IMHC 2J5LB 2WSDA 1NINA 5LBVA 4OCLC 4MMZB 2VOTA 1CVSC 2QBWA 5D7IF 3TZVB 3Q8FA 4D9LL 1NAMH 4ZX3A 5BRZA 3CN3A 4GT7A 3QDHA 4P06A 1X9QA 3GXUB 4XP1L 3VD4A 4PRHA 3APMA 4M6NH 5JQ6H 1TJGH 5HPMA 1SJEA 1EJ6A 1U6AH 4NS0A 5HHNB 4Y7OC 3CBKB 5T1DL 5DD1L 4PJGA 5CEXB 2XX0A 4BINA 4RX4A 1RCYA 3CH8A 2A6JA 3QUXC 5IFJB 2WZPD 2COQA 4XO4A 5GGSA 2J88H 1XR8A 3BKYH 3ARXA 1HWWA 3RVVD 3VI3E 1L6ZA 3OGCB 1U8PB 2VDOB 2BSTA 4XNMB 4NBYB 2CUAA 1U8HB 3MOBL 3O4OC 4XAKE 4OCXL 2BOCA 3BDBA 1EX0A 3GHPA 1DYZA 4OZFB 1SLVA 2OMWB 7TAAA 3NA4A 4G80A 2L7EA 1KXQE 5L2JA 3GSOA 2VABB 5DJ2A 3WE6B 2IQ9H 3RWDA 1CU4L 2VL5A 4QRQB 3PIQA 1T0NA 4OGXL 1JRHI 4H26B 1J0KA 1GSMA 4PTUA 3S3CB 2BVQA 3D5OF 3IPFA 1LEGB 3OR6B 4HKJB 3QI9D 3VXSB 1M7DB 2N3JA 3PAVA 4PS4H 2WGXA 2C3WA 4JFYB 3KYMA 4BFKA 4H8WH 1CD1A 3FOLB 3IK2A 3BP5B 1OT2A 1CMOA 1U8JB 2DQUL 4NPJA 1EJ8A 2BW5A 2MCAA 5HSFA 4XMVA 2EEFA 4NQSA 5DMIH 1RJLB 1JZ2A 2R4RL 4TUKL 4Y19E 1AQHA 3VTMA 1UURA 1FGNH 3T77B 5T1MA 3UPAA 1IQDB 1JNLH 2GC4C 5A2KH 3SEPA 5DJ6A 2BY3A 3C6SB 3SGDH 3TM6A 5C0DA 4ODWB 4K4KA 4F7EB 1WBZA 1IEBB 5DHVB 4PW9A 5IFHH 5E6IC 4B9JA 1KYAA 2D4FA 2JKJA 1QSED 1OE2A 4TM9A 1YZZA 1VEMA 2CKNA 2CMRH 1JUFA 3F3HA 5E5LA 5KJRH 1QWNA 4X9GA 3O9WB 3LX9A 4G5AA 5DDHB 1I75A 4JJHA 2VLLA 4YMPA 3TCLA 5F6IC 4IMLA 4P2OA 1JXDA 4PBXA 4W9HC 5CEZE 3SQRA 1OPGL 1A8JH 2GTWA 2DQCL 1UUNA 2HT2C 4BQCA 5CHNA 1CXEA 2JB5H 2WJ7A 2EUVA 2DBLL 3KG5A 1DQJA 4JRXE 4Y5YA 1TT6A 2GJZA 1T66D 1ND0A 3MDJA 3DRQA 4WFEE 5DHXB 4D0CA 3Q1EA 4G8EB 1RZJC 2M2DA 1KIQA 4WSGA 3NA9L 1E4KC 4PH8A 3MOAH 4FCHA 3O3BA 3QXVA 4H1LG 5GS2D 4JGNA 4AL8C 2Q2EB 5KVGE 1CT8B 3LS5L 5EIQA 2ZUXA 1KELH 2JTDA 3N9GL 5KYNA 4E9QA 5D1QA 4N2FA 3V5KA 1CLOL 1LK2B 2FYYB 2QFRA 2NYYC 4MNHB 4FGMA 2L8AA 4X98A 2W1NA 1J5IA 4PUBH 3TN0B 3K7UA 1AMXA 4NPYA 1QFUL 3ZN6A 4U1JB 1RUPH 3SE4C 1A9BA 5E8NB 4JO3L 3PHSA 3CHRA 4HCRL 4RQQA 2A6KB 3MV9B 2WWKT 1GOGA 3NJXA 3MJ9L 3PV6A 2AVFA 4LHQB 3PU7A 4UIMA 3WNJA 4U1HA 2F5AH 3VFWA 1BZ9B 2WQUA 1NSNH 1IFGA 1YUHA 3EG9B 3MLVH 4DOHB 4OI7A 3L3DB 2GBTA 2MQGA 4QYOB 5TPWL 3AAZB 3S37X 3T6WA 4BRVA 1AANA 4IRSA 4P07A 3BEVB 1JN6B 4FG0A 1KPRA 4OGYH 3MVSA 5D2NC 3FRPB 3CFCL 1C5BL 2WXHA 4NOBA 3TTSA 2XPGA 1I8KA 3KXFE 2X4PA 3R06A 4HSAC 1GMEA 2PYFA 5E2TH 3DPBB 4NGHH 5CP3A 1OGAD 1TLMA 4N9GA 5EZJB 3QUYC 4Y5VB 1UJ3C 5I8OH 3H0TB 3IAPA 1MLBB 3SE3A 1AZRA 3FRUA 4TQIA 1ZV9A 2KQNA 1OCWL 2VDPL 5C86A 2EUZA 3FQRB 4M1GL 5T3ZH 1TETL 1RZIA 5D2NB 4ZODA 4AK1A 2FUQA 5E1QA 4JFOB 4U49A 1KCRH 1F18A 1FRGH 2P45B 2QQLL 1GOHA 3GFUA 3COOA 1XF2A 4WZ9A 2VGLM 5AG8A 4XC1L 1JD7A 3UFIA 3HPLA 1AQKH 5I0ZA 4IKLA 1F3JB 4UOW1 4KZEH 5TTRA 2Z93B 2QADC 3NJFA 3ML8A 5JQHC 2B5IB 1WS7A 4LLDA 3C09B 1DVFC 4PJCA 2G60H 2VDLL 3CVCA 1I9JL 4LQFL 4QXUL 4CRPA 5ITFB 2X4TB 2X4RB 3WO4C 1NJ9B 2D7NA 5I75B 1J8HA 3ARRA 5ISZE 4A7UA 2GVYA 1MF2L 1NDTA 4E9LA 3ARUA 2GTZB 1Z7JA 1P6WA 2IPTH 1CC3A 4PB9H 5DRWA 2WQ8A 4WI6A 3P2TA 1IGJA 4AG4H 2YOAA 2H7WA 4LF3B 1ZHNA 2VIRB 5CWSB 4ZUSB 2J72A 5T3XD 4HW6A 1FO0A 2I5YL 5IIEA 2NRDA 2V9TA 3LPWA 4K7FA 1PNCA 3HG4A 4XCEB 4D0DA 4OZGB 5JHLA 5IMKB 1NEUA 5KSAC 3N5AA 3IVKA 2GY5A 3C6EA 4LRIA 5B1BB 5BNXD 4NLHA 5E9DA 4ZW8A 3MZGB 4I9WE 4F2EA 4ZFOB 2Z8RA 5GZOD 2ID5A 5FK9B 3CDYA 4QXTA 1RUAH 3AWFA 3TEYA 3H4FA 2Q8AH 3CZEA 4YXHH 3CFMA 3CXDH 4XPAL 2Y7SA 3IJYA 4GW5B 3CG8A 1HIMH 3IJ9A 4Z7VA 3ULVH 3ESVF 3TIEA 4WO4B 2DQ6A 4JLRA 4H88H 4LNRB 5B1JC 5K9KA 3AGWA 4IDJH 4AKQA 2R1YB 3CFJA 5I6MA 2BJMH 4JFFE 1FNEA 1UZ6F 1MHCA 2VSKB 3IJHA 3ZO0A 2YD5A 3M07A 3TH2T 2M1KA 2WY3B 4POZC 2ATAA 3D69A 3SIKA 3BXNB 4NN5C 1T2QH 2NW3A 4P9HH 4BUHA 2ZAGA 4TOYL 4LSUH 1JG9A 4FFYH 3H42L 1LE5B 4BFIA 1NAKH 1KLFB 1S7SA 1YMMA 1GJIA 3ABKB 4DVBA 4M9OA 3LH2L 1HQ4B 5HJDA 3UERA 3M86A 2Y7LA 4GG6F 2XYCA 1RJYB 3BD3A 3M8OH 4U1LB 1RL1A 3V6FA 4GSDL 3K1DA 4JRFA 1L9QA 1XFPA 5HD8D 3WIFA 3B9KC 1G1YA 4LCCB 4Y5XB 2CIIA 3SDDC 5JW5A 1HEZA 5GRJL 4X0NA 5I76A 2XVGA 5JIDA 1YAZA 4JDVA 3PWVA 4K3DL 4PGBA 4L5FH 4DCQB 4PI0A 2X6AA 5DTFB 4XP9L 1MY7A 1ADQL 4ZMPA 1L9PA 2XKSA 3KEHA 5KSBF 2F08A 3TCTA 4QRRE 5SWQA 3D2UB 2G75B 5BJTB 1T6VN 4EDXA 3QVAA 4ZPVB 2NY0B 2XNAB 2YUXA 2AJXH 3KGTA 4X8GA 1G1OA 4N0FA 1YY9C 3GM0A 1X5HA 1TJHH 2JB6A 2IH3A 3SKOB 2R1WB 4LEOA 4BXVA 3SQBA 3CC5A 1QA9B 5IM7A 1J12A 4W70A 1OF0A 4L9LC 2KDGA 2BSSA 5HI4C 4F91B 3VWJA 4B7IA 3VI4A 5B1AB 4FE9A 1MWOA 4CMHB 4APQD 1HHJB 2DQHL 3AZUA 5A16B 1P4BL 1Y1DA 2AW2A 5BUGA 3EBHA 2H2PD 3OB8A 5HGHB 3QIUC 3K8MA 3MLZH 3SJVD 2OA9A 2ADIB 4GRWH 5F88B 3BMVA 3MJ8B 1UH3A 1HAUA 5IF0B 4BDVA 1CD8A 4PP1D 4ODUA 3MACL 2J8HA 1U9KA 1XCQB 2XG4A 4JKPL 5D2LE 1EFQA 1WO2A 4Q97A 5E1GA 5ICXB 3UDWA 3ASNB 4GSRA 1LXMA 4UQ2B 3RYMA 3SE6A 1DO5A 3O2DA 5EDSA 4ELDA 1RZQA 2Y5QA 3ZIYA 5KEZA 1PIGA 4XI5C 1LWRA 5DJ0B 4DEUA 5DO8A 2YGOA 4K94C 1LK3L 5D7LA 3J27A 3I3DA 1BX2B 2YN3A 4JZJA 4KMTH 1TTGA 3FO1B 2ZXQA 1RZ8A 3TEWA 2ICWB 1LP9B 3WS3A 3E0GA 1AR2A 5B3JF 1WFMA 3QQDA 2WCGA 1F3RB 4JQIA 4KNUA 3QWQB 1CI5A 1RUQL 2XZCL 3P54A 4A04A 1A1OB 1P1VA 2GT9A 4JCWA 2CJTA 2ZP9A 3MRGA 4TQ8A 5I1CL 5C6TH 2ZXAA 3G5VB 2LU5A 4UAHA 1P7BA 4G7VL 4N2NA 2ZOKB 1SDDB 1C7SA 1GC1H 4RA0C 3EJUA 3EJJX 2JJTA 1CWVA 2ZCLH 4N5EC 2HFGH 4LCUA 2L7JA 4AQ1A 1SYVB 3T2PA 1RXLA 1A2YB 4Y2DA 3T4AB 3V4PB 4DK6A 4GRLA 4O2EB 2R4SH 3U83A 2Z31A 3BP4A 3OB0H 4KVCH 1KBGL 3KBPA 3U0TA 1ZEAH 3QUZD 3VFTA 1ZLWH 4HA1A 1XX9C 2B4CC 3L3HA 4ANXA 2CGZA 3HR5A 2FQGA 2CCWA 3L5WB 1EZLA 2WVVB 4ZMTA 1KCSL 4EDWL 3H55A 4A2EA 4GG6B 4E9SA 3FAWA 2KBGA 4YXKL 3UYRH 2MCPL 4KVNH 2WTRB 5HHOD 2W88A 5CN1A 1OTTD 1KIPA 2Q1EA 3H2PA 3PNWA 4JPIA 4H5SA 4Z7WF 1CFTB 5CSBA 5IVXB 3JV5A 2Z1PA 3O2DL 3B2UC 2R2BA 2O5XH 4BEIA 1R5IA 2NMSA 4RH4A 5JHDE 3UTPD 1N0XL 2DQJH 2LVEA 3B2MA 1GMIA 4KK6C 4KWUA 1ETA1 4A2LA 5LCVH 4OB5H 2P4AB 3UIYA 2ZXGA 2PCPB 2XTJC 3L08A 3VXPA 4UQDA 4XP5L 2HWZH 2ZX7A 4HGWB 3BUPA 2BDNL 2LU3A 3P9WB 4QRTA 1GZQB 5CLWA 1A7PL 3UBXI 5I1HL 5H35A 4KQ4H 1ZVHA 3LYRA 4RFNC 4BSVB 4ZMVA 3OAUL 2IV8A 2KPWA 4S1QL 5IQ9B 3L1GA 2NZIA 2F7OA 2PABA 3HS8A 3KLQA 3ZTCC 3KAAA 4PJXE 1YECH 3NN8A 2YPLE 5D1QC 3AY4A 2XN9D 2JJUA 3KPRD 5M94B 1NGYB 2YD2A 5FDWA 3U9WA 1A3QA 3MR9B 4PWGA 1I8AA 1MHEB 1V3KA 35C8H 4BQ8A 3OPZH 2DWYA 4N2LA 3J8F7 1OSPH 2A9NH 3KJ6H 4HHAA 4PLJC 5FO9A 1UQSA 3MLYL 1E28A 1EUUA 4IS6A 3B7YA 4N1EA 1Q0YH 3PGFL 2BC4B 4B3EA 2H0JA 3RZCD 2NTFA 1FVCA 3D85B 2P43B 3QCTH 3VFPB 2CHZA 2R29L 3LMJH 3FOMA 3L16A 4HGMA 4HT1H 3WGVB 5MHSE 4AEFA 2BSCA 4K3EH 1AMYA 1YEJH 1I8LA 3OJMB 4QLRA 1RI8A 1BQ5A 1IBYA 2V4LA 3WHXB 3C2AL 4AGQA 3Q06A 3D05A 5D1ZB 5CJOH 1R4XA 1NEZB 1KFAH 3BKML 2VITB 5HDBB 3UZQB 4L18A 4WEUD 3HHMA 1X9RA 3AITA 4OGQC 3F01A 3MYJB 3AWGA 4TQHA 3QHFL 2PW2A 4R26L 1PMYA 5CGYD 4POYA 3TFKD 3AG2B 2VSCA 2A74A 2GBVA 3MCYA 2ADJB 4F7TA 3ZDYF 3LQZA 5E2VH 4GRMA 3U1PA 3ARED 2UV3A 1ZVYA 2P8LB 5IVOA 4I3SH 2BSRB 5DZVA 2CU9A 2HT4C 4PV8B 5DWPA 1KLUB 5I71B 2FB4L 4PVLA 5EZIL 1NLBH 3FYIB 1UWGH 3SE3C 1SLUA 3FUDA 4ZX5A 2PYEB 1IZKA 3QNZB 4GJTB 1JWSA 3BWAB 1NFKA 1P6AB 1RIVL 1CL7I 3BVTA 2EJ1A 2HAZA 4OFQA 4DPCX 5KAQF 4L0PB 2CR3A 4P5MA 1NOFA 5JPNC 4FEIA 2HFEB 1MCLA 2O5YL 1BVOA 1CDYA 2V17H 1NBYB 2V5SA 3AUVA 3EJZC 3VI4F 3P69A 3RGVA 4P4KC 4U1IB 5IB2A 1KEGL 3GJFK 5FGRA 3FU0A 1I9RL 1WVZA 3ZL4H 2H0FA 2DIJA 1T4KB 3BSGA 4BHUA 2NYKA 4XODA 5EHFA 5F9OH 1CVRA 2ZYSA 3QO1A 4HLZG 4MJ6B 3V0WH 3GIZL 2BRQA 3H9HA 4FG4A 2GI0A 4RISH 2VXQA 1JD9A 2Y2YA 4D7PA 4XNBA 1DVQA 4NRYA 5L4MA 4IKJA 1TZIA 4M8QA 4G6AC 4OBSA 1JPEA 4HISA 2RCSL 3MLTA 3SDDD 3TIDB 1NGXA 3GPEA 3P4MB 1TEGA 3EJCA 3WL9B 4XMXA 5E9NA 4LCWE 5GJTH 1XD1A 4M7JH 2H26A 4NKDA 4PB0H 2HN7B 1JVKA 4PJ9A 1Y1UA 4QHMB 5DRNA 3RHWF 2NY2C 4Y0GA 3BZ4B 4EO5A 5F1IB 1SVBA 2PO6B 2XZQH 4NZFA 1V10A 4J8RB 1NBVL 3PP3H 5B8CC 5J6HA 1TENA 5I73C 3E3QE 1Z9LA 1BHGA 1KPUA 3DA0A 4KUCD 5C08A 1RUKL 1Z9OA 2ED7A 2Q76B 4J3OG 4LP5A 1KSRA 4NO0B 4XC3H 3PV7A 3V0DA 2F7QA 4DO6A 2WQVA 4A7VA 1MWAH 3LOWA 4TN9A 3KGRA 1KV3A 4YSAA 1F8TL 4J6RL 3D51A 3VX1A 1JTPA 2NT0A 5B4MD 4Y4FD 3OVUB 5CMAB 4Z7VF 1SPDA 4BUQA 4HC1L 2XBDA 4GO9A 2Y3NA 5ANMA 3KLSA 5T1DH 3T8XB 4YHOL 1A4JA 4BZ2H 4BIKA 2J73A 3IFLH 3QCUH 1NMAH 1QPKA 1G0DA 3GEFA 3VGHA 1A4AA 3WN5B 3U6RB 1JNHB 4QJ3B 3DWTA 5DZLA 1TVHA 5T33H 1JGVH 5DURD 3F00A 4LOUC 2CBMA 1T20B 4KBPA 4FNSA 1ETJA 3TNNA 3WFBH 4J1UA 4KROC 3UOAB 1IBFA 3PXLA 2JCCF 5IHHA 3OX8A 2J2ZB 1N4XH 4WTZA 4M9PA 5L4FA 3KLHD 4LP8A 1QPXA 2VXSL 4Y8DC 4HKBB 5EF1A 5MP6L 3AQXA 1DANT 2VDOL 5A2LH 3LZNA 5D5MA 2E7CA 3AY2A 4LHUD 3ZDWA 5L2JB 4M6OH 1T5XA 1YMMD 2NCEA 3VE0B 5D72H 1QMUA 4FQ1H 5C6PB 4KO9A 2J1WA 4PBWD 1LEGA 3OR6A 4AYFB 3NJHA 3GSQB 5D7IE 2WLZA 2WXIA 2UZIH 2YJQA 5ISZD 3SKUD 4APQA 2O6FA 4ALAC 2DMCA 1E67A 3D3VA 2E76C 4JRLA 2P44B 5EO9A 1O7VA 1H3TA 3TYFA 1L3NA 2RJMA 4HG4J 4NBXB 4DN3L 2FT6A 4ODHH 4BSJA 2B0SL 5TDPA 1PSKL 5F89A 2J8UF 4HWZA 1MCOH 1VGEL 3FTXA 4KDTA 2YPLB 4NN6B 4PJIF 1D5BB 4B0MM 4Z6AT 4B7LA 1KJMB 1KJ3L 1VFMA 5HTSA 5IFHL 1G7JB 1VFAB 4NZRH 4ES9A 3ZSTA 2BP5M 3ME0B 4ZS6C 3RHWK 5GS0C 4QOKB 2DDQH 1KBWA 3QFGA 3GT6A 5AD0A 3IAGC 2G9HB 4N86A 4G3YL 1Q0XL 1MIML 1CURA 4ODXA 3MLSL 5HHOB 2BZDA 1SJEB 4NNXB 4MWFB 5HDWA 4FFWC 2X6MA 3VGGA 3KLAB 2GTWB 1FLRL 1NIAA 3ZLQC 3QRGL 5K69A 4XPFL 4L8BA 1ROWA 5INCB 1Q9KA 3A6CH 1JXJA 3K2IA 4HZLB 2PXYA 3UTZA 1DVTA 1F4WH 1Z3GL 1BVLB 4GKNA 1ZK9A 2EVFA 3D3VE 2A1WL 3MOAL 4PLKC 2YAEA 3IFPA 4NAJA 4XH2B 3SBWC 4R8WL 2YPVL 1NCGA 2ZOWA 4UIKH 4IOSA 1GYVA 2H6PA 3LS5H 1QWHA 4R5TA 4NQCA 4C56B 1FVEB 1NGPH 1U8NB 3GMQA 3FFCB 2FYYA 2AI0H 2X89D 4IBSA 3NCYS 5LJYH 2WXFA 3CX2A 3AXLA 4Q2ZB 4FJ6A 3AFLA 4JRYB 1KGCE 2WXKA 3GBDA 3TN0A 2NY5L 5JLZB 1QI3A 1P7QA 4IRZA 3SPVB 3UBHA 1EFXB 3OKEB 4DP7X 1ZLVH 2DYRB 3LKRB 3M6DA 2EIBA 5IHBA 4JQVA 4OKVA 4QRUB 5HVWA 1E9QA 3MODH 4OQTA 5DLML 3T77A 5FOBA 5FIEA 1YUHB 3EG9A 3MLVL 2XICA 3V0EA 4WDIB 3I2CH 3O9WD 4E36A 3IJEA 1HC1A 1B9KA 4QUOA 1DDHA 1OAYH 4MX7B 4NIYE 1GZPA 5LXGL 1L7TL 5D7KD 3KPSE 3PGDA 5DYOA 3X3GH 3C8HA 4NPKA 2NLJB 1G9NC 2XV2A 1OARL 4PTTB 2YIHA 4K3JL 4Y4FB 4QIRA 3CTTA 4NT6B 4GW1A 4YSDA 2Y5EA 2AFNA 3PWUB 5IQOA 2D31B 4QHKJ 3FQNA 5F7UA 2G4GA 5C0IB 5D96C 5F7NC 2DIBA 4QO1A 1KB5H 4G7YH 2VC2B 4ZOEA 2CHNA 1BF8A 1HL5A 3QORD 4MCZB 1INQA 4DZ8B 3US1A 3C6LB 3C5ZC 1S7VA 1XGQA 5GIRB 1I3RB 4PRPB 4DUXA 5AVZB 3H0TA 3CE1A 4UDUA 3SB3A 1W72H 2DQIL 1UXLA 4JJ5A 4KO7A 1PNDA 3NPZB 1RK7A 1XWVA 4XX1G 4DWHA 1CJYA 1AE6L 3L5JA 5LNDA 5EU7E 3VI3F 4Y89A 4O00A 3GMLB 5GJSL 3S96A 2BP8A 1SM3L 4KXZH 3A4EA 4QF1B 3GJEA 3D2UD 15C8L 2X4OB 2DM7A 3LDBB 1U58A 3M45A 1IILE 4IRJC 1PYWB 4XVJH 5E8EB 4YOKA 4ELMF 1AVAA 4HXBH 4F20A 4W6XB 1NCDL 2VT0A 3I3BA 4LCVA 1HYSD 2Z93A 2YXWA 4X6DA 2M83A 5HYSA 2ESVB 3MBEA 3PJNA 1CICA 3QJXA 1ZOXA 5EZPA 1OWRM 5EU4B 1HXMA 3FSAA 3V0HA 1G7HA 2B15A 2DKUA 5L2KA 3WTXA 1OPOA 4Z3HA 3QZWG 4PRAA 1DJSA 4K71C 1A9BB 5E8NA 1JHTA 1KDIA 2WUBL 3TF4A 3DVFA 3VAEA 1S3KH 2ED9A 2KERA 4R5VA 5CWSA 2XFGB 3PHOA 4ENEC 1VSCA 3FO9A 3TV3L 2WJ5A 2UY6B 1D7DA 2E7BA 3NSCA 3VG0H 3LDBC 3WEMA 4UQBA 1XB3A 3OKMB 1P2CB 1JVLA 1KXQA 1S7QB 2IMNA 3V4VA 1OXYA 1UA6L 2AKRB 1QRNA 2Y24A 2HTLD 3MUZ1 3QNXB 1QSEA 4HV8A 3W0WB 2W81C 3HMWL 2CM6A 4KRMB 2Q8AL 3A4AA 4UI2A 1CO1A 3D4GA 3DX6A 4AUYA 2XPGB 4BA0A 2NY6C 4X6BA 2LQRA 3MV9D 2RGSA 3DO3A 2KKQA 5DMYA 1J1PL 2ARJB 3HFFA 3S6CA 2EACA 4Y9GA 3FKUS 2YD7A 3MU3A 4WKZB 3SQOH 3UJIH 1SJVA 3O8XB 4NUJA 2V37A 5E23A 2OTWA 2YMXL 4MQTB 1C12A 3EBAA 3MBED 4N0UA 5DCCA 1KV7A 1F02I 2C3XA 2XKNA 4LDCA 3GS4A 3OKDB 5BO1H 1UZ8B 5SWSE 1N5AB 4ZDHB 2B1HL 2GJ6A 4IU2B 3U4AA 1WGOA 4Z1PA 3KM2A 5BRZE 4MD0A 1AI1H 1JPFA 1DBKL 2B1AL 2XTSA 3H42H 4MJID 3EJZD 5D2NE 4XPTH 3ARFC 5DD0H 4Z23A 4O51B 5HVFB 5KW9L 1U3ZA 2QLYA 1JGEA 4P2QE 3FQWA 2WWMD 2WO3B 4OAWB 2VLKA 3CH1B 3B56A 4YHZL 4YDLC 1E40A 1AXSA 3B9EA 3IU3B 3RDTD 2P5WE 4XNXH 2WBKA 1E9PA 4KDVA 3IRPX 2E56A 2X44D 2GYSA 3HFML 5EOTB 5CF3A 4KXZI 4MQSB 2RH0A 4N2HA 4IYKA 1D6EB 3ARZA 4IIQA 5F8QC 4YPJA 4LF3A 1A02N 3PDDA 1AXIB 4E0RB 2GQHA 5C7XL 5BCAA 4EI6B 3GSNL 4GI9A 3PWVB 4K3DH 4JHBA 4OIFA 4JS7A 3ZT5A 1EO5A 2Y07L 4JFVA 1E2ZA 5DTFA 4OLZH 5LQBH 1DBML 4MQXD 3PXJA 1CYWA 1KY7A 1GYAA 3H1ZA 5IMKA 5IMMB 4K94H 1DFBL 2AJXL 3BZFA 1WZAA 4F58L 4LEOB 4JMNA 5H94A 4XN9A 5KBNC 3G9AB 2F61A 2WLHA 3BUQA 4KAQL 3WSQL 1QFWH 5H2BA 5CSZA 2WP3O 2WIMA 2ENPA 1ZANL 2B4CL 3RTQD 2D3LA 4FF9A 2Z35B 3W39B 2VO8A 1VPOH 1LD9A 3F12B 3GBEA 4MBOA 4WUKL 4PSRA 2IIJA 3VSTA 2BNUB 4AQOA 4UQEA 1L0QA 3LN5A 2IPUK 1TZHA 4GW4A 3CFNA 3IRCA 4YHLH 3K71A 3E6HA 1J88A