3NIGF

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 44
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nigF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nigF01
3FQNA 3VD4A 2XQYG 5E8EA 4GRWB 3H9ZA 4RMSA 2IAMA 2ESVA 1ED3A 1LILA 1S9YB 3RNKB 2X7LB 1HQRA 2EDXA 2KQNA 3WFHB 4BSWB 1E4XH 3JWOL 5DHVB 3QZWB 3SY0A 3EGSB 2B5IB 5D7LE 5DQ9B 3LKSA 1F4YH 3OHXA 3PWJB 1JUFB 2AQ2A 3L3OB 3W11D 5E7BA 3GI8H 1JN6A 3ARQA 3W9EA 1T5XB 1X4XA 3NFSH 5GRUL 3U0TB 3RKDC 4JFFB 3QDJB 3CVHL 2A6DA 5JW4Q 4XMKH 3K80A 3B3IB 5FUCC 4JRYD 4JHAH 4LEOB 4MSWA 1S9WB 4YIQA 3B5HA 1JGLH 2YEZB 3SO3C 3RZCA 5ESAA 4R96B 4NRZB 3PXHA 4PJEE 1RUAL 2H26A 5IQ9B 2XZQH 4G8GA 3DO7A 3IDYB 4YK4C 4RWYH 3WCYA 2LU4A 4JFYA 5SWQB 4BQ6A 1BIHA 4POZC 2Q8BH 1P4LB 3LPWA 5E2VH 1EDQA 1KELH 3BKJH 1OWWA 2Z8VC 1CF8L 1FJ1B 1HZHL 1ZK9A 2EE6A 3VE0B 1U3YA 4Z7WE 1B6UA 1D5ZA 2NNAB 3SGDH 2XKSA 1HH6A 3MLRH 1FNEA 3DUHA 3HAEA 1HCFX 4CMMB 4NN5B 2YRLA 2W65B 2JCCF 3PWPD 2VLLB 1YEFL 3F58L 3QIWA 3VXSB 2ADIB 4EI6A 5D7LA 4XCYB 2DIJA 5L8KB 3HRPA 1G7LA 4DKEL 4OD1L 4HIXL 2ID5A 3MOAL 5F3BB 4P4KA 4NQSA 5EZJB 3BQUB 3WHXB 2QJDA 4CMHC 3DGGB 1MWAH 1B2WL 3TO4A 4RAVA 3UTSE 2EKSB 1OAUL 1PYWA 4IIQA 4G6AC 1A5FH 5DJXA 4PJEA 2RJMA 3QI9B 5CP7B 4FOMA 1CFQA 1NLBH 4OCSH 1KEMH 2XKNA 3MGTA 4JPVL 3VGFA 4YWGH 4ZFGH 3TBSA 1MCCA 2X4SA 4MAYD 3GMLA 2R0ZL 1PSKH 5HJ3A 1PDKA 3V8OA 3AREB 1G0DA 1LK3H 3SDAD 2LTQB 3D87B 5C08E 3CZJA 3K81A 2UY7A 1QYGL 3QFDB 4HSQA 3RY6A 2NXYD 4WJ5A 3DVFA 5DD1L 3ARDB 3OKMB 4Z7WA 5BMFL 5I76A 2J8OA 5SX4H 5INCB 3BSZH 3FT2A 1FZOA 3MUJA 5ITBH 2DQCH 3I6LD 3QYCA 3RWFA 3WLBA 4G9FA 2HTKC 1FNAA 1NCTA 2VXSH 2JJUA 4HIJB 3VWKB 5GS0C 2LE9A 2WWMC 1I75A 3NTCL 3V6FA 2Z35A 1DQLL 3QUYD 2V2TB 3QJHB 1M4KA 1X5HA 2DQUL 4NKQB 3DX8B 5DDHB 4JGUA 1JTTA 4RGNC 2HKHH 3FO0H 4LU5L 3WNPA 4UT6H 1H3XA 5J1TC 3UC0L 4PLKD 1DQML 1SM3H 3RX7A 4M6AA 4PRDB 2NX5E 5F9WB 3TBTB 3RWEB 4N8PA 4HS6B 4Z8FL 3N1MC 2R0WH 3KPRE 3F6LA 1DLHA 4LVHC 4OV5A 2NY2D 3MUGB 1YN6B 3LV3A 5LVEA 4JEGB 4O02H 5DGRA 4Y16D 3HFMH 2I9TA 4XP6L 2GCYA 4J4PC 4LASL 3C8HA 4UILH 5C0DB 3DIFB 3ROLA 5C08A 4ZO9A 5FCUH 2I60L 5DJ2A 3F7VB 4PY8I 3CSBA 1ZVSB 5T5FH 5FXCH 5ALBL 4BFGA 3PABB 4ZO8A 4OD3L 5DRXA 4KTDL 1CDUA 4HBQA 3DVGB 4KQ3H 2B0SL 2UY6A 5EFIB 3T8XB 3ECBB 4PRPD 4TSBH 1AC0A 2DM3A 5J56B 2IG2L 5JDSB 3MLSH 1A4JA 4ZODA 1OL0A 2D7PA 4HMEA 4QGYA 2R1YA 4TRPH 5GS1C 4HV8B 3PF2A 3GMMB 3BGFC 2ZSVA 5EB9A 2HRLA 2VR5A 3OTTA 3LKPA 1A7PL 3O0RL 2YRZA 4Z77B 3IJSB 1S78D 5C0GA 2A77H 3P4NA 5KTEH 5IHLB 3GUTB 4R26H 1U8HA 4BQ8A 3UTQB 5HHPA 2NX5A 5FV2A 5F9AC 2VKXA 4MD5A 1T5WB 4CGTA 5F7HA 2BDNH 3KPRA 4Y5XA 1P4BL 1KCVL 2QSQA 3MTRA 3BPNB 3TV3L 4RWHA 4IMKC 2UUDK 3SDCD 1V7NH 2DI7A 3MGOA 3WFCH 1JWMB 3WIHH 3GZKA 5CEYA 1Z0MA 4M62L 4LSUH 2CO7B 1ZLWH 2PTTA 3O2DA 4KH2A 3RWIB 1AQKH 5AUMB 5FYJL 4G8IA 4Y5YB 4H8WH 2V5TA 3RTQC 3DSNA 1C08B 3HC3H 1AD9A 2YPLD 4PJCF 3HZVA 5CD5D 5CIPA 4Y4HC 2XTLA 3WXVL 4RMQA 3DXAB 3PIQB 1H3VA 5LG1A 1E4WH 4PV9A 4HH9B 1BFVH 1FNLA 3P4OA 3FMGH 1WWCA 2WWKT 3EOBA 1NBZB 4JRWA 1FG9C 1AP2A 3WUWA 4UDTB 1QFWM 4TTDC 3T0XA 1OP5H 5EUOE 5HPOA 4TTGA 1VFAB 2P8PB 3SOBH 1MQ8A 4CW1A 3MBXL 2VE6A 4DEPB 2CUMA 3QO0B 2JJTC 4K2UH 4WEUD 2P8LB 3T0WA 5KSVB 3QG7L 4OCWH 3VW3L 3Q0HA 1A6AB 4Y8AA 3T77A 5IQ7L 5I1JL 4DUXA 4Y1AE 4OKVA 1I85C 5DT1L 1U8NA 3GNMH 4YE4H 5B39A 4G6FD 1DVFA 1SEBB 4HX1B 3TCLA 4F3FA 1CZ8L 4TSAL 4F2MA 2OXGA 1IZKA 4N5EC 1DLFL 2ARJB 4E5XB 4JREB 3DV4B 1LE9A 1T0PB 5E8DH 4FXGB 4I0PD 2BXZA 3V0WL 4NN6B 1GZPA 2DOCA 2AEQL 3MQIA 5GGTA 4JCLA 3PQYD 3LB6C 3O81A 3MLTA 4K7PL 5TE4H 2D7QA 3FFCB 1RUQL 3I3BA 2G75B 4F8TA 1PBYA 4P59L 4OAWB 4OD2A 4MDJA 2O5XH 3CSGA 4K3JL 1R3HB 4G3YH 4ONFH 1HSBB 3L3JA 2NMSA 1WIUA 1TTFA 2J7LA 3KAAA 3MUY1 4M3JA 4QRSB 3HZKA 2QADD 4KQ4H 4X99A 2EH7L 3MJ9A 4Z76B 3V79C 1ZT4B 5I66A 4L8SC 5EUOA 1I7UB 4IRZH 1TZHB 4FXLA 1T89A 3MBEC 3HE7C 4LNVA 4ZPVB 1SJXA 3RNQA 2F53B 1AIFA 4LP4A 5TQ0H 5IESL 3IU4H 4JQXA 5D96B 1CG9A 4XBPB 1R5IB 5AD0B 1KLGB 2HKFL 4OIBA 1NCUA 5EZOL 4Y1AA 5E7FA 4MX7A 4LSRH 3LH2H 1ZXQA 1P4IH 1XGPB 5HHXL 3MLUL 4DKFL 1QFUH 3MV9B 4KKCC 5DRNA 1T80A 2N7AA 3S37H 3K4ZA 3ZE1F 3V4VH 1PG7L 5L88L 4NNYB 2DRUA 3FRPG 3RGVA 3CFDB 5DZLA 1EXUB 4YEFA 1AR2A 2X4QA 1C1EL 1MCOH 1XZ0B 3VFPA 3MLWL 3QDMD 1T2JA 1F3RB 4LPTA 3CSYB 2KPNA 5GRJL 4NNXA 1I1AA 4I5BB 1ZHLA 4Y19E 1TDQA 3TPKA 3UJTH 3W2DH 4UI2A 2VRAA 4OZGF 3T4YA 4YGAB 1MIEH 5T1LD 1HHGB 2R0LL 2DQEL 1T1WB 2JCCA 3VFRA 2J8HA 3QIBA 4OZFH 5IB3B 4YX2L 2BSED 4JVPA 4NO2A 4KTYA 1P6AB 2WZPD 1N6QL 3QUML 3TH3T 3QCTL 5C70A 3F7PC 3GSNA 2ZZUT 3DURB 4ZAKA 3RY5A 1F02I 3N85L 1WT5C 2A6IA 2P5WE 4HFUL 5CGYC 5MHSD 5HGDB 3LKQA 3UEZA 2D7MA 1S7QA 1YEGH 1UM6H 1WGOA 2VH5L 1NCWL 3UZEA 3IB4A 1NCAH 1FFPB 1LEGB 2NY6C 4JPKH 1HHKB 4P2OB 3DYMA 4OZ4B 1BQLL 3FQXB 5GS0H 4H1LB 3MLXH 2P5ED 5IHUH 3UTZA 2DICA 2BNUA 3VDBA 5J3HD 3V7AE 3INUL 2VWEE 5TFSL 5LBSH 3LEYH 4PP2B 4S2SB 1WBXB 3BRGC 2X44D 4KAQL 4EN3C 5J6HA 1KCUL 3O6FC 3VXRE 4XNUH 5HI4D 1ZHKB 1CXKA 4YDIH 3OL2A 2JIXD 5IMLA 1CGTA 3T1WA 4GW4A 1Q9OA 1SBSL 3DSFL 2BERA 4BFBD 1A7RH 4BM7A 3DUUA 4AM0B 2HJKB 2QSCL 5KVFL 4P46B 3J8F7 4YBQC 3GMQA 3ARGC 4OGXL 4X4ME 3GDBA 2GJ6D 4U1JA 3MPCA 1H0DB 1G7PA 4MJID 1LE5A 1IQWL 1KPRB 1X5GA 1C5DB 2YC1B 4UAOC 1S5HB 4LCIL 1CR9L 4X4XA 5DJZB 1A8JH 1SYVB 1U93B 4LLQB 3MV7D 4AIOA 3PG2A 1CQYA 1RD6A 3HPLA 2P1YA 5FO8A 3D0LB 2P5WA 1N2RB 1H3PH 1NH6A 5TDNA 2Y7QA 5C0RH 1MHCA 3P0VL 3QXWA 4LLVA 1Q9WA 4X7DC 4C57C 4GS7C 5JO5B 1NC4D 1DUZB 5CINH 1ORSA 3PWUB 3O41B 5D1XD 2NR6D 4WV1A 1ZHNB 5TE6L 3ZSTA 3GMRB 3JV5A 4S1RL 5E4IA 1UM4H 1RJLA 3EJJX 3HI1B 4ZUWA 1HYRC 1INDH 3GSNL 1YJDL 5D5ME 1LD9A 3D0VA 2SEBA 3DI3B 2ZCKH 3OXSB 1QQDA 3VXRA 1FVCA 1ZTXH 4Z95L 2ADFL 5MERA 2IANA 1MHHB 1YYML 2OL3B 1K8DB 1SEQH 4PLJD 3PHQB 1F45A 3MXVL 1YEKL 3KPQB 3Q6FA 2XQYK 5EA0L 3FFDA 3RX8A 4DGYH 2CIKB 1T3FB 4NBZB 5I1AA 4I0KA 1I8MB 4EUPB 4X4MA 1TCMA 2OR9L 2BCKB 4LF3A 4F9LC 5B3JF 4NUGL 2BNRE 1PZUB 2FGZA 4NC1C 4XNMB 3KNBA 1UH2A 3V6OA 3TJHC 3MNWB 4NT6B 1ULVA 1KCKA 2IAMD 2ESVD 1RULH 5C09B 2ATKA 1ZLUK 4KKBD 3NAAH 5C6PB 5B8CA 3MFFA 1RUPL 3M1BA 1I1FB 1O7VA 1QLEL 4LP5A 4X5WA 4K94C 3JWDH 1JZ4A 4L5FH 1JRHH 1OB1A 1FDLL 4Y89A 4QXGL 2EXWD 4CKVX 2VLMD 2HMIC 2NY4D 2BVUA 5FFLA 3GMNA 1BOGA 3MRKB 5DMGC 1GVIA 4UQ3B 5CLTA 5F88A 5K9QG 1XF5A 3CZFA 3CU1A 5FYKH 2YOCA 2EECA 2FLRT 4EI5B 4FQIL 5LWYH 4PJHB 4U0RC 2VO5A 2AJXL 5DHYA 4YDJA 3OB0H 1G84A 4W68A 3GO1H 3QPXH 4PGCB 1NGZB 3GJFB 4LVEA 5D6CA 3ZL4L 3VD3A 1H9VA 3RZCD 3S36X 2NLJB 5TE7H 2QQQA 2DKSA 4R2GC 1LK2A 4OFKA 4G8GD 4KI1A 4RISH 5KVMC 5DJ8A 5KSBF 4PJCA 4UIKL 4X0KA 2WUCH 3L3KA 1HK6A 4Y4KC 3HR6A 4FQHB 3MC0A 1UEYA 3HUJB 4WO4B 2MHAA 1FVDA 4YGVA 3EBAA 5JTWA 3FCTA 3WDIA 2IPUG 2UV3A 1MJUH 2BNRA 1DBBH 5IM7A 4PGEB 3I6KA 1MAKA 5FM5O 1Q1JL 4KHTL 1T22B 4NZDA 1JHLH 3K2UL 3SE9L 3X17A 1C8PA 4QT5A 5FKPB 2WW8A 1PJ9A 3D85B 5F70A 5GSRA 1U8OB 1QLFB 4FFYH 2RCSH 3ULVC 4ELKA 3FOLB 3UJIL 3K0WA 4G42A 1DBJL 3TA3C 1RJYA 3QIWD 3O6KL 5D7LD 5H8DA 1AHWA 1FPTH 4GT7A 4NDMA 2EDNA 1AE6L 1A7NL 5A16A 4PJFB 2AJZB 2IMMA 1YNKL 4O00A 4OUOA 4U1SB 3C5JB 4P4KD 3ZE2E 5HHOB 3ZE1E 1B4RA 2A6JB 4A2MA 4GKZB 1ONQA 5I1LA 1NMBH 4I18C 1MFCL 4XCNA 3TO4D 4PJ5E 2RQ8A 4UU9A 3PDOA 1DBKL 1X5JA 4RGOL 3ILPB 1FBIH 3BMVA 1NAMH 4BFIA 3SKJH 1FL6A 3KXFA 1NJ9A 4Q6IB 2FX9L 3V4PL 5IR1A 3C6SB 2DQHH 3RWHB 3WHE1 1FO0H 1IAMA 2R29H 2MTPA 2B4CL 1B0RB 1TPXB 1TVHB 1NMCC 3N1FC 4JZOA 1YEJH 4P3WA 3VXTB 1XF3A 1WICA 5T1KA 4GSDL 1XF1A 5J06A 3G5YB 1G0YR 3VDCA 3BUYB 3KPLA 4HHAA 2FB4L 2V17L 1CLYH 3I85A 3RWJA 1BX2B 3FO1A 3TPUB 1XGTB 4O9HH 1ADQL 1E6JL 3PGCB 1EEUA 4PUBH 4X6BA 1ZGLA 2GK2A 1MJ8L 3QB7C 5TPWL 5GISH 1S8DB 4PRIB 1MFBH 5KAQG 3T65A 2NXZC 3NIDF 2ILLA 5JOFB 5JXAH 1MCKA 5D2NC 1RZKH 1RSFA 4L4JA 1JGEB 4FQ1H 1ZKAA 1MPAH 1U9KA 1MLCA 3BD3A 4JKPL 3PE9A 5EO1A 1XT5A 5KAQF 2PW1A 4ZFOB 1M7XA 4MHHG 1UQSA 5E56A 3CVIL 3L5HA 3FN3A 4GQPH 3VXNB 4JFXB 4P5TB 3UTSD 4PJ5A 1SJEA 5DUPL 5FV1L 3MSPA 3E6FB 2A9MH 3B9KA 1L0YA 5TH2A 3IFOA 1IL1B 4IOFC 1BFSA 3FRPA 4KK8D 5JPMA 1UZ6E 4MQXD 4X6DF 3BKMH 3NCYS 1CFNB 3QQ4B 4K3DL 1YYLH 1UM5L 3Q1SH 4OZGA 1RAMA 5GJTL 3VGAC 2OZ4H 1C5BL 5IB2B 3VXME 5EWIH 3RGHA 1WTGT 3C6LC 2OCFD 3MR9B 5C08D 2NY3B 3QXVA 1KPUA 2VXVL 2VL5B 3DMMB 2EDYA 3IGAA 4XXDA 2ZOLB 1U8PA 4O5LL 1A3LL 3MROB 5D1QA 1LO2L 2PXYA 5DZOA 2YD1A 4NKDB 4R7NA 5FF6B 2H32B 3Q3GA 3MRIA 4YHKL 4FQ2L 2EDQA 3QWOB 1IFHH 4AT6A 1BFOB 8FABB 2E27H 2DQGL 3T3PF 2X4TA 4PP1C 1IBGL 1QHOA 2GITB 4U1LB 1GGCH 5EPMB 4H5SB 5GIRB 4JY6B 3AROA 5GS2D 1AGBB 1NBYB 1R6VA 1YEDA 2P24A 2A6KB 5E99L 4ZOAA 1WEJH 3ARUA 2FSEB 2NX5D 2EZ0C 5JR1H 5F9JA 5FA4A 4NWUL 2BMKA 3CFCL 4S0TD 5D72H 5KVDL 3KPRD 1GAFH 4U7MA 1SMAA 4L8CB 3Q48A 5K9OB 3A6BH 2PO6A 1UJ3C 1OTTC 4YBLB 3IDGB 5KSAC 4UQ2A 4J2XA 5ID0A 3SDXF 2I9LB 4JQIH 1OAYL 5B3JE 2AXFB 3N50A 3STZB 3VXMA 3QCUL 1NANH 4XAWH 1EJOL 3E0GA 5A1AA 5CEXA 2RGSA 1PW3A 4OGYL 2BSRA 5IEHB 3JTTB 2LAAA 3DVIA 3F62A 3LS5H 1IE5A 1I3RA 4XRCB 3L6FA 4PJXB 1K3IA 1YQ2A 4PREA 1NCNA 3E3QE 3DLQR 3MZGB 3MJ8B 1CFTB 1II4E 1KBGH 1I7ZA 3K8MA 1I3VA 3Q5TA 3U0WL 2BVPA 1QEWA 1S5IL 2APFA 2IBZX 5A40E 5C3TA 1P7QA 4OLWL 1OLLA 1WQVT 2EDKA 3SGKA 1MI5E 1NBVL 3PWPB 4G5ZH 3WNKA 4QKXB 2X9XA 4OF5A 1X5XA 5BV7L 2J3SA 1OVZA 4FQXC 1VB9A 4QHNA 1U3ZA 1CU4H 5MP6L 3BPLC 3IDJB 4XCFH 5KS9B 2NY7L 5IJKC 1ZA3A 2JELH 4HWZB 1IGML 3OAZH 1DVFD 1KLUB 4YXHL 4M6NL 4OZFG 4RGMB 1M05A 4LSDA 5C0CE 5C0BE 4MA7L 4X6EB 4DZ8A 1JTPA 2AERT 3ILQD 4RAUA 1Q72L 3REVB 3BP5B 2HFEA 4KRMB 1U8IA 5ACLA 2Y72A 4NQVA 4PTUA 5DTFB 4NQDE 1I9RH 3F7YB 5J6GA 3CH1B 2C1PB 5DJCA 4LLDB 5DJAA 4Z9KB 3SDAB 1IILE 3DNKA 2NXYB 4H26A 4OM1H 3GMPA 1KLFA 2M2DA 1MWAA 3DETC 3QEHA 1QBMH 4WUUE 4B41A 5E8PA 5FA3B 1HILA 1S3KH 1HHHB 2AVGA 2D31B 4U1IB 4AJ0A 3PGFH 4KJYA 3U0PA 5C07A 4MAYC 2XZAH 5IVZA 2JB5H 1FG2A 3CUPB 3NZ8B 2G9HB 3MJGX 1MI5A 1X6NA 4ISVB 2WANA 3LHPH 3GI8L 4TVPH 5GGQH 1PEZA 3KYAA 4AQ1B 4R0LB 4MNQB 3OKNA 3DX9B 4AH2B 3QUYB 5F21B 5IJVA 2DM2A 4XMKL 4KMTH 3RJQB 3ULVH 1N6VA 3BP6A 4AENA 3C09C 1L7TL 4XCEB 1AQDA 4JHAL 4Y1AD 4MXWH 4Y2DA 1BF8A 1UGNA 3I3EA 2W0LA 1PQZA 3PGDA 3THMH 5T3ZH 5I73B 5C0CA 2XZQL 5C0BA 4EIGB 5CWSB 2NCMA 3RUGB 3OSKA 3I9GH 2VAAB 3A6OA 1I3UA 3TBVA 1EUUA 5AYUH 4YUEH 3O45B 4FFWD 4OCNC 3RGVD 1IEAA 3QQ9D 4OLXH 3RVTD 4PBWD 4Z7UB 4BA8A 4U6HB 1T1ZA 2Q8BL 2CDFB 1FV1B 1UVQB 4OF3A 1KELL 5I30L 4JDZA 2APVA 4JE4B 4NQDA 4C54A 5C0FB 3VFNB 1I1AD 4HAGA 5D6DC 2H45A 5ETUB 4E9LA 4ZFZA 4XMLH 4Z78A 3QA3A 5BZWA 2JB6B 3EYSH 4QTHB 1EHXA 3L3DA 5E8NA 2LVCA 4GH7B 2FR4B 3MLRL 4RBPK 2CRYA 3WFBH 3NIDE 5E6IC 3QIBD 1MHPL 2NY2C 4WUUA 2P45B 3P40A 4EDWH 5ICZA 1R0AH 4IMLB 2VN4A 1IQDA 3BZDA 4MGXA 4R97C 4L9LC 5F7LB 2C7UA 2OX5A 3RIFF 1C16B 4ZAKD 4TSCH 3DVNA 2MQCA 5JHDA 4FFVD 2BFVH 5I1EL 2XACC 5CGTA 2UZYB 4OGAD 4U7KA 1I8LA 1CDYA 3IAGC 4WVRA 3CFBB 4XI5D 5C0AE 3WE6B 5EBMB 1JF1B 3SPVB 4ZPTA 3QNZA 3SKOB 1RY7B 3QDHA 5EBLB 5MEPB 4ESKA 2OQJA 4OB5H 3SDDB 2HFFB 3S36L 1A02N 1L6ZA 3UTTE 4LLWA 5F1IB 1F11A 1OARH 1CD9B 4ETYA 1A1OB 4HIHB 1ACYH 3QJFA 1I9JH 1G9NH 3VXPA 4K23H 5ADOH 1Y6KR 5F7YC 4ZFGL 5MEOA 2VZTA 3EDDA 1CD1A 1FRGH 4LRNH 1PSKL 5E9DE 2PCPB 3EDEA 4QXTB 1RV6X 1FGVH 2C3HA 1A3RH 2GTWA 2WINB 2FZ3B 3TN0A 4Y19D 4MDIB 3GSQB 3TYFA 3REWB 3M8OH 1FAKT 2VUOA 5M94B 5ITBL 1J8HE 1DANT 1VGEH 3ARBC 2DQCL 3IXTA 1JWUB 2YPLB 5GGRB 3PP4H 4NKIH 4YLQT 4MJ5A 2GTZA 1XIWC 5DQDL 3K1DA 2VXSL 3SBWA 4Z7NE 2X4RA 4FZEL 3TFKD 2P5WD 2ZUSA 1MCEA 1X5KA 2HKHL 4UT9H 1DQQA 5FUCE 4PJAE 4PRNA 5C0AA 5JUEL 5KG9A 5CD5C 1JPST 1CE1L 5GPRA 5FB8B 1WK0A 5K93A 2VLRB 1D6EA 1AXTH 4C55A 1RI8A 2H6PB 2Q87A 4MNHA 3X11B 4DGVL 3UTTA 4X6DA 4M4PA 1JNJA 1EEYA 5DJYB 5K9JL 5KBNC 2K7PA 1KCSH 4MJ6B 3SDXE 4CVZB 1HYSC 1MCPH 1LO0L 4NZRH 4X6FB 1R24B 1KT2A 3VXRD 1CGSH 3RVUD 5ALCH 3HFML 4HJGB 3BKYH 5E9DA 3ESVF 4YDKL 1AH1A 2C3VA 1AO7E 5T1DL 3G5XB 5D70H 4L29A 1CGXA 5IVXB 4I0PB 4WFEE 1QSZA 3QI9C 2A73A 2PTUA 4P3CH 3VFVB 1CICA 4OI7A 5EO0A 1UB6A 1NKRA 5D9SA 1J8HA 5GGUA 1IAIM 4GAJH 5B38G 4MD0A 3U46B 1H3GA 1KJ2H 5TF1H 3MRQB 3SO5A 2D7TH 4F7CB 3VMPA 4Y5VC 3MLSL 1URLA 1FFNA 2Y5TA 3LEXA 4YFEA 5IB1A 4TRPL 1KJVB 1WC7A 4NP4L 2QADB 4WFGE 1BVKA 4LOUC 5GQBA 2FIKA 3KPMA 3TJEH 3MUHL 3U7AA 4XC3H 4PJAA 5C0EB 1R5WA 1U8KB 5HHQB 3O6LH 2VN7A 3NZHL 1IGIH 4R26L 4DFIA 2ED9A 4WFHE 3B8YA 1T0NB 5CHNA 3B2VH 1CL7I 2K1MA 5H2BA 2BDNL 5D7IE 1F4AA 2AJYL 1YUHA 2CRIA 3X3FH 3UROR 3SDXA 3EHBD 2BVEA 1D5BA 1M6OB 5BCAA 2OJZL 3D3VB 3GKWH 3U83A 2HJFA 3WIHL 2VYRE 3WFCL 1E4KA 3C2SA 1V3MA 4PB0H 4WI6A 2IPUK 3JUYA 1IGFH 2WK2A 4IBLT 1AO7A 5IW3A 3MV01 1B0WA 1AQKL 4O2FA 2G5BA 3ES6B 4M93C 3HC3L 4NO3A 3QDMB 1EK3A 4CL7A 5J89A 4AMKL 4HUMB 3KJ4C 3TNNB 1E4WL 4LNRB 2BNRD 1W0VA 1QR1A 4LSSL 1XF4B 2V5MA 3FMGL 1NGXB 3SN6N 4PFEA 1ZWIB 2VDRH 2VNCA 3FB5B 4AIZB 1K5NA 1NC2A 3FO2A 3FB6A 4J3OC 4NQUA 5CILH 4LSPL 5DK0A 2LQRA 5DQJB 4CVWA 3KPTA 4HKJA 5IROA 4RGNE 3FO9B 4HK0B 3LZFL 4D8PA 4EEEA 4LPYA 2P42B 3N9GH 4L4TE 4B0MM 4OCWL 3MLZH 3VU2A 2YZ8A 3E8UH 3MRFB 1E28B 4WI2A 1M7DA 2OXHA 3I2CH 4RMRA 1J11A 1PKOA 1H5BC 3GNML 2VQ1B 5FM8A 1UKSA 1ZS8A 2FWOB 5FUOH 5IG7A 2DLIA 4L4VE 2CJUH 5D7IA 1XR8B 5I1HL 4XH2B 5CJQH 3VH8B 3UDWA 3U30B 4TN9A 5J12B 3CXDH 3P11H 4OZFA 5FO9A 2P5EB 2O93L 2R2HA 3ZDXF 2DQTH 3C2AH 5SV3A 5AAMA 2A1WH 1W2KT 5MI0B 1QG3A 3KXFD 5DMYA 2A74A 2X4OB 5HI5C 5IVOA 2Z92B 2CUHA 1XMWA 2E7CA 2JIXB 5TE4L 3GSVB 2UWEB 4RA0C 4D0DB 2DD8H 5L2JB 4K71B 4LLAA 1T03H 2D7NA 5EOTA 4KY1H 4KUZH 2O5XL 4XXCC 5T1KD 4PV8B 1T66C 2XQBL 5J3HC 4G3YL 4ONFL 3RWCB 1CLOL 4QOKE 1F13A 1ND0B 3GB7B 4KQ4L 4P2YA 3D39E 2GJ6B 3BGMB 2VABA 4M61A 1ZLWK 3CNKA 5BOPA 1H8OA 3H7BB 1AXSA 1T6WA 4P99A 3BDYL 2HJLA 2O26U 1I4FA 4MXQC 4PGDB 3MV7B 4L4TA 1KB5B 2X4NA 1P5VA 2AK4E 3Q2CA 4V1DB 3JTSB 1SYSA 3AM8A 2AABH 5FYLE 3VG9B 1JYWA 1FAIH 5D93B 2WP3T 1NGYA 2ATPA 1Z9LA 5IBUB 1GPOH 1AGEA 4U1HA 4NFCA 1QP1A 3MRJA 1SVCP 4MQ7B 1QFUL 5D1XB 4PJ5D 1I7TB 3V4VL 4GRWH 1KNOB 4ZQKA 4EVNB 4IOSD 3B9KD 2IH1B 1OP5K 2DLTA 3EYFB 3BRDA 3TVMA 4JCMA 2VMFA 5DD0H 1U58B 5IFJA 4JM2C 5JW5B 3O2WH 2Z9TA 3BRFA 4G7YH 4M4RA 1W0WA 1UKQA 5JQHC 2OP4H 3JWNC 5IB5A 3VXQA 3WS6C 1U3HB 2BOBA 2ZUXA 3GIVB 3GHEH 5HYSG 5J11C 3UJTL 3S34H 5DMIH 4ONHB 4KU1A 1MIEL 3L7EA 4OTXH 3WN5B 4PJDF 1L6XA 4DN4H 2GSGB 4KKLD 2R4RH 4QOKA 3T2OA 1BJMA 5DUML 1JMXA 5FYKE 2XWJB 4FP8H 5GS1A 5D1QD 4ALAL 2PXYD 3NN8A 4CU7A 3JV0A 4POUB 3WD5H 4RSVA 4JO1H 5E8EB 1P2CA 1Q9LB 2IAMB 2ESVB 3OZ9H 1J0IA 1M71A 2XG4A 1YEGL 3OGOE 1UM6L 4LVOB 4MQTB 5FDYA 4AK1A 3QUZB 2VR9A 2X89A 4CU8A 1NCAL 3GSXA 3OJMB 4JPKL 4HCRL 2YWYA 1HH9B 3G08A 4I3GA 3GBLA 1VACA 5IB4A 3SKMA 2C4FU 3HC4L 3MLXL 2NY4B 5IHUL 1JN6B 5BRZE 5I8OL 3IF1A 4GKNA 2OTPA 4WI4A 2A6DB 2IH3B 3LEYL 4LBEB 5J13C 4ODUB 4M7ZC 4ODHL 1D9KA 4B7LA 4MSWB 1KV3A 1EJ6A 5CSBA 2G2RA 2AJ3A 4Q9RL 4M5YH 2PO6D 3VFOA 3NA4A 5ESAB 1NLDH 3U6RA 4DTGL 1CVRA 3DTXA 4LGPB 3RTQA 4N8VB 5DR5H 3CLFH 4M7KH 4G8GB 4YXLH 4Y4HA 1OHQA 3VXMD 4JFYB 43CAB 3MNVA 1YC8A 3O3DA 1EPFA 4EOWH 3IVKA 4DOHE 3EO9H 4OZHB 3IDIB 1DEEB 1P69B 2EEBA 2R2EA 2XV6B 3CDGA 4IRJC 4R90H 1VKXB 1NPUA 4N0UE 1MLBA 5D1ZA 4OF8A 3WKMH 3W5NA 5DSCB 2I26N 3PDGA 2JJTA 4HBCH 2B1HH 1JFQH 5DO2C 1BVLA 3ULVF 1EZVY 3VJ6A 4DW2L 1FNEB 1P7QD 3HAEB 1B90A 3VG0H 3CX2A 3UPRA 4F33A 1I85A 3QIWB 4DUVA 5EOCH 4N0YH 1NCBL 5D7LB 2I5YL 3MYJA 4J8RB 4M7JH 2QTEA 3SGEI 4MJ2A 2QKIA 5BRZA 3O4LE 2QQKH 5CBEA 5TGBB 5L0QC 4JB9L 5KVGH 1INDL 4P4KB 4KJQD 2W1NA 4OJFH 5CEZH 2XZCL 1M7IA 4QRUA 1NGQL 1OQXA 3ZSSA 4LVNB 4UNUA 3RVXD 1SEQL 1C5CL 5M95B 4PJEB 3KYNB 1PAMA 1I3GL 1T1XB 2XKNB 3MGTB 3WS3A 1A22B 4DGYL 2JK5A 4HUVA 2DQJL 3C5ZA 4B50A 1DUYB 3GMLB 5J9PB 1KC5L 2FHCA 3TO4C 3MCLH 2V9RA 2YA1A 5B38A 4AG4H 4N0UA 5GJSH 2J1KA 1RULL 1QOKA 1F3JB 2GJJA 1NEZG 3MBEA 2DIAA 1PY4A 5I76B 4HXBH 2J12B 3FHAA 5HDQL 2OLDA 1NAMA 3BT2L 4W4NA 3JWDL 5C07D 4L5FL 4OBSA 3WLBB 5F72S 1MI5D 1J18A 1IT9H 2VDNH 4UB0H 3SCMC 1N0XH 4DAGH 2YSSA 1FO0A 4KROC 1F6AB 4ODXA 5E1HB 4GXVL 5I8EB 5KOMC 3V6FB 2KZWA 4OSUH 1J8KA 3X14A 3TNMA 2R4SL 3O4LA 4LHUG 3B9AA 4Y2DD 3HI6H 3GO1L 3G04A 5C0IA 2YK1L 4NJAH 5KSUA 4KV5F 1CXEA 3UTSB 4BH7A 5C0CD 4RISL 4YPGA 5C0BD 4ETQA 4M03A 2ADGB 3LCYA 4MZ2A 1NFDF 4XAKE 1J05B 3ORJA 2JJWA 5FHBH 1NGPH 5E4EC 3IFLL 4OV5B 1IKFL 1MH5A 1FZMA 2VTFA 5DEGA 3LV3B 4LEXH 1CLZL 3L1OH 4X7TA 4HKZA 4N1HB 1WJ3A 3RIFK 4NQDD 4Z7OE 1MJUL 2I9TB 1DBBL 5HGAB 2GCYB 4K7PY 4NCC1 1CFSA 2LFGA 1RZ7H 1OSPH 5IMOA 1JHLL 2NY0C 4ODBD 3MV11 2QBWA 3BYTA 1L7IH 4XBEH 5KW9L 1WT5A 3FL7A 3PWNB 5E6ZA 4Y8DC 4KK8C 4WUUD 2P8MA 4MQXC 3IDUA 3CMOL 1RK1B 4Z0BH 2EDLA 4JDTL 7FABH 1ZLSL 5FDWA 3IETB 5DD5L 5HI3D 3NACH 1BBJB 4RZCB 3OG6B 4NRYA 1A4JB 5EULV 4BK4A 2OZ4A 1UJTA 4WU5B 5EBWB 1WUNT 4KFZC 2ZSVB 1NMBL 1FZJA 1EX0A 4EN3A 1WWAX 3LKPB 5KVEH 4HJ0C 4KHXH 3JWOH 1T04A 2VLKE 4NKOA 4Z0XA 4RNRB 2GQHA 3P4NB 3VWJD 1U8HB 3SKJL 5H35A 3BFOA 4OBRA 5HHPB 4NQXB 5BO1L 2DQHL 5ESQA 1FO0L 3PP3H 2R29L 4LKCB 2CDGA 4I48A 5IF0B 1YEJL 1B0GB 4PJIB 4NC1E 3KDMA 5CEYB 1S7RA 1JV5A 3TN0D 2XXCB 2VR4A 1FNGA 4MQSB 1UZ8A 2O5YL 2PTTB 3OB0K 4L3CB 1CLYL 2X2YA 4MXVE 2UVFA 4O9HL 4LIQE 4G8IB 3O9WB 4PUBL 4Y5XC 3CX5K 5GISL 1O0VA 5CIPB 4M1CD 4R8WL 3B8SA 1HXMB 1TJHL 3PHOA 1DBML 4ZD3H 3P4OB 4P9MH 1SHMA 4PJBF 1QRNA 1RZKL 4WWKA 3MRCA 3BZEB 3EOBB 5CZVL 4FQ1L 3AY4C 1HZHH 2ZJSL 1MPAL 4R4BA 4KJWD 4HZAA 3KPOB 4P2QE 2ZG3A 4ODSH 2X1PA 1XGQA 2MJWA 4HWEL 2Y36H 1MCNA 1TVBA 4JGJA 1D5XA 5C0AD 1MHEA 5AYQA 4K3HA 5E08H 2ED8A 2VDQH 5D2LE 2A9ML 2BNQE 3UTTD 3S7GA 4EQ2A 1YEFH 2IADA 1FL3A 4OKVB 3AU1B 5CCKL 1NEUA 1U8NB 4HLZH 4NO0A 5JORA 1I1YB 2EDEA 3BKML 5EIVA 1DVFB 2CDEA 3H9HA 1UADC 1YYLL 4DKEH 4OD1H 1TTGA 3SJVB 3TCLB 3S97C 4F7PA 3P9MA 5E9DD 1TCRA 5EWIL 4F9LA 3QNYA 4X5XB 5HYSA 2CIIB 4TVPE 1B2WH 3WNLA 4LCWB 4AL8L 2V7NA 1GZPB 4Z18A 4APQB 5HD8C 1PZ5A 1XGUB 3QG6A 1EBPA 3MLTB 3CXHJ 3ULVE 1J8HD 1BD2E 4JPVH 3WIIL 5BW7C 3KPSE 3S3PA 1P7KA 1IJ9A 2R2BA 4OD2B 2FBJL 4J23A 1OAKL 2B7DT 2Y6SC 5KANG 5T3ZE 2R0ZH 4GBXB 3L3JB 5GRYA 2E27L 5EC2B 4X99B 1ZVHA 1QYGH 3RP1A 4YZFE 4JFPA 4KXZI 5DD1H 4X6CE 1GGCL 4BKLA 4ZO7A 5EUOB 3WXWL 5BMFH 4QRPB 2BSSB 4WHYH 1JBJA 43C9A 3B43A 3OKLA 3BH9B 4IDLA 3B9DA 4WHTA 1AIFB 4NQEA 3RNQB 4P0DA 1EHAA 2YPKB 3AVEA 2W9DL 2CRZA 2DQFA 3GBNH 1CG9B 5D2LA 4QNPF 5JR1L 5EU4A 1WTLA 3QXUA 1KIQA 4Y1AB 4CVXA 4EIZC 4O58H 5IKCA 3A6BL 3TLRA 1DQLH 3FOMA 4Y4KA 1UCBL 4YNYB 2NZ9C 2IPTH 2DQUH 3WFDL 1T89C 5IHZA 3IDMA 5EUKA 2HTLD 3ME0A 5DRNB 2EYSA 5I1GL 2J4WH 4LU5H 1CN4A 2X09A 1BGXH 4JQXC 1ETZB 2IEPA 4G80A 1UXWA 1AO7D 3QIUA 3UC0H 4LFHG 3RGVB 4OLUH 4X8XA 4WFED 5H94A 2OI9C 2BVOB 3L3IB 3HR5B 2A38A 2ZCLL 3S96A 1LP9E 5F9OH 4HKBB 1FVEB 2ERJB 1GIGL 2P4AB 3KPSA 1PD6A 2GAZA 3TA3A 3T4YB 2VISB 5FIEA 1KULA 5D2NE 4N0CC 5F7MC 4LQFH 1NC2D 4CUCA 5FGRA 3VFRB 4NO2B 2D4FA 2XA8H 1R3LA 1EERB 2I60H 4Z7VB 4G5ZL 3MRRB 4WFGD 1INQA 4X6CA 3STBA 1S7VA 5F7UA 3U7YL 4GRWF 1KEGL 1I1AC 3QZWG 1A21A 2OSLA 4I18A 4OD3H 3BVNA 2A6IB 3S4SG 1EVUA 4KTDH 1MSPA 1Q94A 3LKQB 3TH2T 1S7QB 5I9QB 3PL6B 4WFHD 2A0LC 1UXSA 1A6UH 3AMKA 5EN2A 3QIBC 3NFNB 2X4UB 4QHUA 4R7DA 2Q1EA 3GHBH 5HDOA 1AGFA 1F90L 4B7IA 5F97E 2EDOA 1QO3A 2FJHB 1YJDC 3LSOA 5FK9A 4P5MA 2BNUB 2YA0A 4FFVC 1J9CT 2V6HA 1WIPA 2Q76B 3KVQA 1RUMH 1RZIA 3MA7A 4IRSB 4XVJL 4U6VL 2F74B 5IMMB 1I9RL 1T6VN 2Z4QB 3SQBA 4Q74A 4CDGC 5IMLB 4HC1L 2AK1H 4UTBL 3R06B 4JFDA 4GW4B 4OZIE 1GGTA 1LP9A 1V5JA 1BZ9A 5IK3B 3BKCH 4WI5A 1J10A 1YMME 4Y19B 4CN1A 5K9KA 1HCVA 3TV3H 2X70A 4PYGA 1QBML 1NEZA 3GMQB 5GS0D 2H3NB 5D2NA 1UYWL 2WWMD 4EXPX 3ARFB 4O51B 5DURD 2XZAL 3QUXC 2JB5L 3FONB 4PS4L 4P2RE 4PJ7F 3GSOB 4B53A 5GGQL 5FYJH 4RGND 3FQUB 4L9DA 2OL3H 3HZYB 2MKWA 4NZUH 4L4TD 2YRPA 1MNUH 4KMTL 1YEHH 4PRAA 1GL4B 7CGTA 3ULUH 3F7RA 4LLVB 3GBMH 3MNZA 5ENWA 2ICEA 4XX1E 4LHUA 3TO2B 4EUPH 3KLAA 4WWID 3MRBA 3T0EA 2WIIA 1IKNC 3THML 3MRGA 5T3ZL 5I2IA 4WV1B 5ACZA 3D18A 1VFUA 1KTRL 2R23A 3I9GL 3LRGA 3MBXH 3QNXA 1RJLB 2WBWB 4JN2A 3HCVA 4YUEL 1JIBA 3OKOA 4J4PD 3RKPA 3TVMD 3W82A 4OLXL 3QG7H 5INDB 1QKZL 4YC2C 3VW3H 3PUCA 2SEBB 1FFRA 1QQDB 4KJPC 5IQ7H 3OKEA 5I1JH 5MERB 4JRYE 3DX7A 2YN5A 3BWAA 3OKDA 1OAQH 1GGIL 3BISA 2EDFA 1BECA 4OZIA 1MIMH 3Q5YA 1RK0A 2HRPH 3OAZK 3GSRA 4TSAH 5K33A 3Q6FB 3QFJE 2W9LA 5EH1A 3U48A 3ZKND 2YBRB 4FRWA 4U1KB 3U2SB 1CCZA 5D7SL 4PJBE 4QOKD 5I1AB 5F9DC 1ZHBA 4F58H 5I0DA 2HT3D 3BE1H 4QRTA 4EDWL 2R69H 3O8XA 1CS6A 3V0WH 3BEWA 2AEQH 1A6ZA 4YAQB 4JRXB 4P2RA 2BFVL 4UOW1 1WZKA 1HI6A 4K7PH 3FB8B 1AR1C 1OQOA 1BWWA 2XWTA 1RUQH 2O61B 2GK0B 3CFEA 3O4OB 4D0BB 3GEWB 2R39A 3ULSB 2GUOA 2GIYA 4GRLA 5B8CB 2X89D 5FYLD 3WFEL 4YHYB 3M1BB 4Y4FC 4K3JH 1AKJA 2R2CA 5FGCB 4ACPA 3KPPA 1OB1B 3QWQB 2XXMB 5F7NC 5JA9A 3W81A 1QFHA 3P0GB 3V6OC 3GJEA 5TQ2H 3BP7A 1I9JL 1UJ3A 1G9NL 2NY1D 5KSAA 3ESUF 3QRGH 4K23L 4IEFB 5ADOL 1KJ2A 3FQWA 5K59E 1D9KD 1FRGL 4X98A 5D5MB 4YDJB 2CUIA 5D6CB 2HKFH 3VD7A 1JZ3A 3DV6A 5IV2B 4RIRB 5EZOH 1A3RL 3ROOB 3RTQD 1LK2B 4M8QB 2FECL 1T83C 4Y4HD 5LKNA 2VSCA 3CXHK 5HHXH 5SWSE 4DKFH 5BS0A 1CBVH 2B4CC 1XCQA 2MQ3A 1JGUH 3AC0A 3L3KB 3M8OL 1G7MA 2X4PB 1ZGLM 3DYPA 3QFJA 5I74C 4MS8D 2EKJA 1FVDB 1VGEL 4TUOA 5BQ7A 5ILTH 3MODH 3EHBC 4PJBA 1K8IA 1OOAA 1IEBB 3PP4L 2V2XB 1BMGA 5FYKD 1LVEA 3O3BB 5D1ZD 4M1GH 2BNRB 2BVQA 4HD9A 4R4ND 5IM7B 1N6UA 4XGZA 3V95A 1HIML 4QT5B 4WTXA 4PR5B 3L9RB 3FB7A 4FQXA 2Y1VA 4ELKB 1DFBH 2VUYA 3RHWK 2CKBA 2DQIH 1FYTE 3CSPA 3WNMA 4H0HB 2AI0H 4HPOH 2R0LH 2DQEH 2PYFB 1OGAE 3I6LE 1TLKA 3C8KA 1AHWB 3VCLA 3TM6A 1N6QH 1YPZE 3QUMH 1KJMA 5BRZD 3QCTH 3O2VL 1MJ7H 1LO5B 2HVKA 4J12A 4U1MB 5E70A 2V5YA 1N8ZA 4YBHA 1G9MH 3K2MC 4M48H 5I1LB 3L5WA 4XCNB 4HFUH 5ALCL 3C60A 5ERWA 1XCTA 3AAZB 3PDOB 4RFEA 4WEMB 1NCWH 3LB6D 1CFBA 4I0CC 1D5MA 4ZG1A 2ICWJ 4OIAA 4JZJA 1FL6B 3P4MB 1BQLH 4P3CL 5SWSA 3S9DB 4Z6AT 4NHUA 3LRSA 3LQMA 3INUH 4EJ1C 4OUUA 4GAJL 2AV1B 4BK5A 1NDGA 4KAQH 1JGDA 5IVNA 1KCUH 1XF3B 2D7TL 5T1KB 1A1NA 3QULB 1U3JA 3RWGA 2D9CA 4QHLA 3MBED 3HE7D 1P1ZA 4XPGL 5IEKA 4GW1A 3VFWA 5IMKB 3FO1B 4XP9H 3TJEL 1ZGLB 1S7XA 4XC3L 1FYTA 1DQDH 4DCQA 2BY3A 2ZUVA 1JPGA 3O6LL 1IGIL 1OGAA 3MLYH 2IGFH 4Z7QE 4PRPE 1YPZA 1A7QH 1D6VH 5J7CC 2F5BH 3O4LD 1MLCB 1IC5L 2FEDD 2HN7A 1CR9H 2DJ4A 1BZ7A 4C59B 3WL9A 2CMRH 2PW1B 5JHLH 1QVOA 1UQSB 1NFIB 4EQ3A 3AXLA 4PJ5B 2H32H 1SJEB 4PB0L 3P0VH 5ESVA 1NCDL 2W0FA 2VLJB 4JY4A 3B9KB 4GJTB 1IGFL 5TH2B 1WAAF 1UFUA 15C8L 2N7BA 5JLZA 4CJ1A 4ORGA 3IFOB 4XNZB 4WI3A 2ZOKA 4JFQB 1MCJA 2GT9A 2X42A 4H25A 4NHCH 5C0NC 4OCXH 5DUBB 5E6IA 2NTFA 4OI9A 1CLCA 4HUKB 2V7HB 5JQ6L 3LQZA 1Z5LB 4L9LA 4Z95H 2ADFH 4PJ7E 1YYMH 5DJ6A 4O2CA 4JO3L 3U9PH 1U8PB 5CGYD 5DYOB 3BIAX 4HLZG 1GOFA 1S9YA 3RNKA 4HEPG 1EHLH 4R7NB 4BSWA 3BP4A 3Q3GB 2OR9H 3L7FB 3QZWA 4ZNCD 2DWEA 2A83A 1BFTA 4JO2H 4OCRL 2KL6A 3S4SA 1JUFA 1A9EA 3L3OA 4YDLC 5BV7C 4PB9H 4X9HA 4G6KH 2AKRA 1T5XA 3BEVA 3MXWH 4JFFA 5CJQL 4EN3D 3BESR 3O6FD 5D1QC 3CXDL 5KJRH 4G8FA 1YEDB 5LAXA 2P24B 4NKMB 1T0MA 2DQTL 4LEOA 3C2AL 1L9NA 1S9WA 2J6EL 2A1WL 3HB3C 1FDLH 1T7YA 3V4UH 2ITDA 3QAZC 4QXGH 2BMKB 1AFVH 5IQ9A 3PWVA 1ODAA 4U31A 3AB0B 3ARGD 5SWQA 2FNBA 3ZDYE 1T2QH 2IALB 2Z8WC 5TJWK 1VPOH 1X5AA 3ARBA 4ZYKA 4KY1L 4KUZL 2AJXH 4WTZG 3D1MC 1P4LA 3H3KA 4RRPG 4TOYL 4WHYG 3ZKSD 1XIWA 3GIZH 4OV6F 3F8UB 5EU3A 2EIDA 2DLFH 5CEXB 5CP3H 1JWSA 4S1DC 5CJXC 2EIZB 3AGVA 4PJ7A 3VE0A 1JMZA 3FRUA 2VZUA 1I3RB 5I1DB 3TZVB 5CEZE 2D4DA 3MCG1 4NYLB 4EBQH 3PQYE 2CLVB 5HVHC 1T7VA 5I71B 2CLZB 4E0RA 3ARPA 4U1NB 2B1AH 2BVPB 4PG2A 1L0XA 2V5RA 1FAIL 1P7QB 3H3PH 4WU7B 3AS1A 4KHTH 1GPOL 4Q7DA 1Q38A 2AJVL 2ZUQC 4ZNEA 3JV6B 5D7JB 1U95B 2HVJB 5EZJA 3WHXA 2VLKD 2YHGA 4G9DB 2FHFA 4I3SH 2EKSA 2VITB 1Z2KA 4ZUSA 4NO0D 5KZCD 3O2WL 4NBYB 5GRVK 1DQTA 1AE6H 2CK0L 3SGKC 4P23B 3QI9A 5HPMB 3MRNB 1YNKH 5EC1A 2JTDA 4DQOH 1BEYL 4RMTA 1ES0B 3FKUS 4DZ8B 3EYQC 4U1GC 1BF2A 1MRFL 4HIEB 2HFEB 4LSTL 4PPTA 4DN4L 3TJHD 2FL5B 5F1SA 3AREA 1U8IB 4ZUVB 3LN9A 1DBKH 4KJQC 3WO4C 2FLBT 3QFDA 1OGTA 4A2LA 5J6GB 1Q0XH 1ZA6A 3OKMA 5DJAB 2FX9H 5INCA 3OZ9L 4H26B 3RVXC 1X5IA 3RY4A 1MWAB 1YQVH 2YUZA 1N64L 2FECI 1OAXH 4HMCA 4IOIA 4TUKH 3QEHB 2HMID 5E8PB 3EJYC 3P2TA 1J7VR 1QBBA 4HIJA 3RJDA 5DMGD 3VWKA 2C1OB 4HFWB 4KJYB 4GOSA 3EZ8A 4U6YA 4XPFH 1EEZB 2FB4H 1EO8H 2DYPA 1MCIA 2V2TA 4ORZC 1WBYA 3DX8A 4NQED 2OJEB 2ZWLT 1Q8MA 4XHQA 2EDDA 1QPPA 2Y5EA 3OKNB 4JN1H 1U2CA 1WSST 1F42A 1AGDB 3QH3A 4AENB 2FO4A 4PRDA 5DD3L 3CMGA 2B20A 1PQZB 3PGDB 2MOVA 4M5YL 4Y4KD 4HS6A 2AW2A 5EZLB 1NLDL 3GGWB 4FQQA 2FCBA 3CLFL 4M7KL 5C0BB 1HN1A 4YXLL 4YHNB 4ELMF 1BOYA 3VA6A 1CDHA 3TBVB 3QIUD 5H37H 2ORBH 2ZG1A 1J0JA 4EOWL 2EDRA 4TVPD 1V3LA 1JPSH 3O11A 1T1ZB 3KS0H 3EO9L 5C0DA 1X7QA 3DIFA 4Y2DC 4R90L 4NQDB 3PNWA 4Q58C 3FT3B 3CK0H 3ULVD 1YDPB 1ZVSA 3FZUD 3NH7L 5IGXL 3IS0X 2Z31B 4Z78B 3QA3B 3PABA 3KPSD 4HBCL 2DMBA 3TA3D 1JFQL 3DXAE 3E2HB 3VXOB 1NAKL 3DVGA 3BXNB 3ULUF 1TZGH 1AGCB 5EFIA 2YD5A 1X5ZA 5D8JL 4AIXA 5T3ZD 1C5BH 3VG0L 3T8XA 2IFFL 3ECBA 5LJYH 2ZKHH 4WUUB 1JF6A 1UACH 3B2UC 1CDJA 3VMNA 5EOCL 4HV8A 4KRPD 3GMMA 4M7JL 1CI5A 3T4AA 4L1HA 2QQKL 1A2YA 1A3LH 4YQXL 5AWNH 4OJFL 4NRXB 4LCCC 4Z77A 3IJSA 4MLSA 1SY6H 5FGSA 3LN5A 4I2XE 3UTQA 3QNZB 2P44B 3EIFA 4XTRC 1T5WA 2UYLA 3VWJB 1F11B 1IBGH 3QT2A 4NM8H 5CLWA 1GYAA 5HI3C 5GGSY 3QJFB 1T21B 5DEFB 1I8LC 4XXCA 5MEOB 1JWMA 3WV0A 2BY0A 5DC0A 3G9VA 3QHTC 4F37K 4M8VA 4RAHA 1YY9C 1AJ7H 3JXAA 3L5IA 4JFDD 1DJSA 4NWUH 2E6QA 3CFCH 1FSKC 4F57H 4AG4L 3IDNA 5KVDH 4N90E 5GJSL 4MNGB 3TN0B 1FN4A 2CR3A 1TJGH 1C08A 3MJ7B 3EJZD 1S9KC 2NTSP 2NXZD 1G1YA 3DXAA 3EOAB 3PIQA 3HUJF 4HXBL 3MV8E 4MA1C 1OAYH 1UCTA 1E27A 1MCWW 5DLML 3X3GH 3QCUH 2XN9E 3UPAA 4WW2B 1NBZA 2MSPA 4HIIB 4UOJA 4MJ5B 2GTZB 2VDNL 1WISA 1IT9L 2AEWA 2CGRH 4OGYH 4UB0L 4UDTA 3SDYL 4C4KT 5IP4A 4XB8A 1KB9K 3HZMA 1MEXH 4NJ9L 4DAGL 3BZ4B 5C2BL 5HYFA 2P8PA 2X4RB 1VESA 2P8LA 5KSVA 1YECH 3S35X 3V5HB 3GI9L 3HI6L 1A6AA 4LHUD 1CK0H 1CL7H 4U0QB 5IT2L 2HLFC 4JM2A 1IGCL 5F7DA 4IOFD 2HH0L 3MRDA 4I2XA 5FM4A 4JKKA 5JZ7C 4JQVC 4OFDA 4PJFF 3UTTB 5I8KH 1SEBA 4HX1A 2VLME 5I19L 1EEYB 3WS6A 5FHBL 3RIAK 2F54B 3RA7H 5BV7H 4X9BA 3C6LD 3WKNA 3QDGE 5F6IC 2D0FA 3L1OL 5DWUH 4K7FA 5MP6H 3LS4H 3DV4A 4FXGA 4XC1L 5E9DB 4FMKA 3GFUA 1VFBB 1XH3A 3JV4B 1V8HA 4LSQL 4M6NH 2F15A 5D4QA 1VA9A 4NQCE 1L7IL 5BZDA 4XBEL 2GJZB 4MA7H 5DA0B 5D9SB 3X13A 3MV8A 3O8XD 3NFPB 1J8HB 2OTWB 4Z0BL 5GGUB 7FABL 2XN9A 4PP1D 4P2RD 3D2UA 3DUSB 1KYOJ 4Z76A 3LKOB 1ZT4A 4RQQB 1QPXA 1FFNB 1I7UA 5IB1B 2QR0A 4OLVL 2QSVA 4YHMH 4ZPVA 4D0CB 4MZ3A 4GRLD 1K4CA 4YPJA 2F53A 4LKXB 4XWGH 3BIBX 1CICC 3G5VB 2QQNH 3KPMB 2EZ0D 1JE6A 4XCCL 1R5IA 5KVEL 1KLGA 3K74B 4PJAB 4KHXL 4KTEL 1JF5A 3VXUE 3H8NA 3P77A 4TULL 5C6TH 1XF2B 2W0PA 2D03L 4M9PA 2Y06H 3KYMB 2F9BT 3SO3B 4E42B 1XGPA 2ICWI 3TH4T 1OTTD 5KSAD 1BQSA 3MRLB 1QUNA 4DZBA 5H2BB 3MLVL 4YK4B 2I24N 4KC3B 3UYPA 2LAGB 3QDGA 1CFVH 4HWBL 4NNYA 1NL0H 3WJJA 3CFDA 1DR9A 1EXUA 1L7TH 3Q5OA 4IRJA 1XZ0A 4U2YA 3G6AB 4WTZA 1AO7B 5BS0D 2W0KA 4RRPA 3CSYA 2XRAL 1QSVA 3M17B 4I5BA 3QFJD 4NQCA 2EIBA 2G5BB 4O2FB 3QSKB 3BN3B 4CU6A 4ZXBC 3TWCL 2XWBB 4ZD3L 1S7UB 1QR1B 5IB3A 2HTLC 4P9ML 1E4KC 1HOCB 2H9GA 5I30H 1KF9B 2FX7L 5ISZE 2RB8A 1K9TA 1U8JA 4LAQH 5I6XC 4FQXD 1K5NB 3FO2B 3FB6B 4ODSL 3A67L 1X4ZA 2F8VA 5DK0B 3DWTA 3U7WL 2Y36L 4QCIB 4HKJB 3GK8L 5E08L 4CMHB 4D2NA 2VDQL 1MHPH 3NCJL 3ALXA 4V2BA 3VXUA 4G9FE 1FFPA 3BGAA 1M7DB 3DROA 1X44A 2C9AA 3VI4F 4OZ4A 4PGBB 1ZVYA 4ELME 5IG7B 2YD6A 5I1EH 1G6RB 3BAEH 5D7IB 3C60D 5IROC 3EYUL 5DJ0B 4HZLA 5C9JA 1WBXA 4OZFB 3V5KB 4EKXA 1KN4L 4ONGL 2R2HB 1ZHKA 4MWFA 1QBLH 2P46B 5FYJE 2EYRA 1KB5H 2AJUH 2B39A 3S36H 5SWSD 3KR3L 3B9VA 2OS7A 3DETD 1J0KA 1RZJL 4QY8B 2IQ9H 1NCCH 3O3EA 1A6WL 3MOBH 2HJKA 4P46A 3UDWC 2HP4A 3HRZB 4P57B 4X9FA 5EOTB 1H0DA 1KFAL 4KGJA 3SCMA 3PP3K 3UXFA 5CFHA 5ISZA 2YC1A 4FZ8H 1S5HA 4LGRB 3IXAA 2AEPH 2HA1A 4PJXF 5DJZA 1SYVA 1U93A 5DURB 4LLQA 1AD0A 4BH8A 2VIRB 5SWZE 1HHIA 2IC2A 3HC0B 1Y18B 2QV2A 1N7MH 5DMKB 1FYTD 2YD3A 3D0LA 3U4EB 1N2RA 1CQKA 4W4OC 2FHBA 4RGNB 1RJZA 2KQMA 1OGAD 3GBNL 3I02B 2W07A 3D25B 5DQDH 1SYSB 1JK8A 3PWUA 3O41A 1YY8B 4O58L 5EORL 1ZHNA 4FZEH 3AS0A 4ELMA 4LVHB 1Q0YH 3HI1A 4L4VB 2IPTL 5F1NB 2XNAA 2FJGA 2J4WL 2UVEA 1BGXL 2DI8A 3RWDB 5JUEH 5KS9F 4X80H 3CC5B 1CE1H 1R3KA 1HINH 4OLUL 1ORQB 4DK3A 3AM8C 2OL3A 4LFHD 4F7TA 1K8DA 4DGVH 3P9WB 3PHQA 5F9OL 5K9JH 2BXYA 2W91A 5E6ID 3QISA 1YEIH 5TDPA 2BOBB 1DP0A 5C7XH 1LO0H 2CIKA 1FLTX 4OT1H 1RIHH 4PRBB 5FYKU 2BCKA 1JVKA 4XNMA 3TVMC 4LQFL 4ZUTA 3UBXB 4YDKH 3MNWA 1G1CA 3DJ9A 4NT6A 4QOKB 5HHNB 2XA8L 5T1DH 3ARTA 3D39B 3OGCB 2XTJC 25C8L 1HNGA 3EKCA 3NN8B 1S9VA 5HYJE 5SWZA 2ZPKL 5J4MA 2LABA 3BGFB 1P2CB 3ARWA 2C3WA 4KRNA 4YHLL 1I1FA 5JW4M 1NGWA 2R8SH 4U4BA 3OXRB 2X40A 3ZKNC 5JOPE 3SGEH 1A6UL 5I75C 2AK4B 4LGSB 4UIMA 3GHBL 3GSXB 2CXGA 2HT3C 4JFFD 4ZSOB 4JFEE 2GSIA 3EDFA 4OM0L 4NP4H 5CJOL 2WAHA 4EI5A 5DMJB 3ZDZF 3IF1B 4GKNB 1TNMA 4U6XB 3UBXI 3B5GA 4PGCA 1NGZA 4U7SA 1RUML 3NA9L 5T33H 4M7LL 1N5YL 2VZSA 2P43B 3NZHH 1MVFA 4UBDC 4HEME 2AJ3B 5TDOA 5I1IH 2AK1L 1WLHA 3VFOB 3WIFA 5CBAA 4FQHA 2AJYH 3ARBD 3RTQB 1S9XB 3HUJA 3RUGF 3BKCL 1QSFE 3DARA 4KK9D 4Y4HB 5IIEB 1WITA 1XIWD 4YXKL 4XNQA 5J1AA 2OJZH 3EZJB 2NY1C 3MNVB 3V8CA 4Z7UF 2Y07L 3EYOB 5DS8A 3IVKB 5F6HI 4JAMA 5FUZH 1D9KC 1T4KB 3AY4A 3CDGB 3BMWA 1LNUB 5FKPA 2VXQL 5JNYB 3D85A 1MLBB 1U8OA 1H15B 3SE3A 4KK6C 1VADA 2OL3L 5HYJA 3FOLA 1I9IH 2FJFB 4NZUL 4PRIE 4AMKH 3JWDC 5DXWA 1MNUL 2ZNWA 2P7TB 2CRMA 1YEHL 1PX4A 1VERA 3AUVA 4H0IA 4LSSH 5LGHH 3FN0H 3ULUL 1FP5A 3GBML 5DVLA 4ODWB 1WCBB 4MS8C 5H37G 3U82B 2F58H 1HYSD 4U1SA 4JFEA 5D1ZC 5HHOA 4LSPH 4QEGA 3WJLC 4QXUH 4R4NC 4MB5A 4Q9QH 4GKZA 2QKIB 5BRZB 4JJ5A 3MRMB 5F93C 3LZFH 4C58B 1M7IB 4QRUB 3QI9D 4HH8A 5JMRA 2BRRL 1ZT7B 1V3KA 2D7OA 1OAQL 4NO5B 3NGBC 2DS4A 3C6SA 5I8CB 3RWHA 4OFYA 1MIML 4GG8A 2HRPL 4NC2B 3QEQE 5I1HH 5BW7A 1QSFA 1TQBC 2JK5B 4UV4H 3VXTA 1H3WM 3T08A 3CFIC 5E00B 3QUMA 4F58L 5JW3H 3BE1L 2R69L 3IAPA 3BUYA 4DOHB 3OMZA 4YHPB 4GKOA 5CEZD 2QHRL 4JPIB 3RI5K 1XGTA 3TPUA 5B38B 4N0UB 4LOUD 1G7JA 1N3NB 4L8SB 4WNQA 8CGTA 3MBEB 3HE7B 1JNLH 1JZ7A 1S8DA 4PRIA 4LDLB 5JOFA 2XQBH 1NAMB 2JCCE 3C5ZC 3VI4E 1CLOH 3ARFC 3RL2A 4XPTH 1JGEA 3ETBF 2DYPD 3GKZA 1JNNH 3LDBC 1GC1H 1N0LA 2YSSB 1B3JA 5TQ2L 3Q6GL 2WNGA 1LEKA 2WLZA 3QRGL 5A43C 1CIUA 3X14B 5HYIA 3TNMB 3O4LB 3FN9A 4N9GA 4JFXA 3FQRB 4P5TA 3BDYH 1CGYA 5HHME 1GOGA 5CSGA 2ZP0T 4NIKB 3G04B 5C0IB 5F3HA 5CUSL 4PY7B 1ZMYA 3NIGF 3TP4A 1IL1A 4P5KA 4YPGB 1TJIH 2DIBA 4G6JH 4ZOEA 1CBVL 5HXMA 2KKQA 1JGUL 4LLYA 5IOPA 3QEQA 4GXUM 1P84J 2FEDC 5DEGB 5ILTL 3DX6A 4X7TB 3MODL 4HKZB 3NVQA 5EBGA 4PD4J 5IBTH 2FD6H 3WNNA 2VL5A 3DMMA 3U1SL 4M1GL 5GS2H 3E6HA 5F7EL 5HGHB 1CFSB 4PJXE 1INEH 2ZOLA 5IVXF 1OTUC 4HS8H 3MROA 4E41E 4PLOB 2H32A 4F15C 3JSSA 3QWOA 4I4WB 4Z5RB 1DFBL 2DQIL 1JZ5A 4Q6YA 2V2WB 1RZKC 1BFOA 5HVWA 1DN0A 2AI0L 2AXJA 2AXGA 1OLZA 4HPOL 5CZXD 8FABA 3CPLB 3IFPA 4Y7MA 1QFWI 1FGNL 1KTDA 5DUMH 4PTTA 4F8QA 2NY6B 1MCSA 1LEIB 2UZIL 3CFJA 4NRYB 4U1LA 3VRIA 1MJ7L 1IC7H 4ALAH 4JY6A 1AGBA 1NBYA 3G5ZA 4NPYA 3S3JA 4OCLC 4GAGL 3FHQA 3B6SA 4K9EH 1G9ML 4M48L 4WCYH 2A6KA 2BVYA 1FZJB 4LLUB 3P73B 4EN3B 3O6FB 5HI5D 4Z0XB 3F7QA 2DBLL 3TBWB 4L8CA 3LD8C 4HCRH 4MVBC 1NUNB 5GSVB 3HC4H 1MCDA 1KXVC 4BQ9A 3BHBA 1T66D 2D2OA 5I8OH 2I9LA 4ZFOL 1G9EA 1T7ZA 2GYSA 4QHMA 2CDGB 1C7TA 4I48B 3ARGB 5IUSA 4HK3N 3UO1L 4RDQF 4ODHH 5IEHA 2X1XR 1I8KB 1CXFA 3JTTA 3QUXA 1EFQA 2IANE 1S7RB 4LLMB 1RQ5A 4HGWA 4PJXA 4XVUC 4XRCA 4Q9RH 1FNGB 1QFPA 4UAOB 1GGUA 1JJUA 2YKLL 3A0OA 4DTGH 2CKNA 1K6QH 3DXAD 3D6GA 1CFTA 4MXQD 4E41A 3PJSB 4XP9L 2ED7A 2CH8A 4UT7L 4FQLH 1DQDL 4DK6A 5GS3A 3PHOB 4QRRE 2EH8H 4KXZH 3RDTC 5JXEC 4GS7B 4HS3B 3QO1B 3MLYL 2IGFL 3MRCB 3V6OE 1IKNA 2AV7B 1A7QL 1D6VL 2F5BL 5JHLL 4WHCA 3ZDZE 2CMRL 5ID1A 3C5SA 4MNQE 1TVBB 5DJDA 1D5XB 2CLRA 3L3GB 4TQEH 5CP3A 4JM2D 1L0QA 4DW2H 4F7EB 4HGMA 4HWZA 1J0ZA 2RAMA 3V5DB 4ZFFB 1KG0B 2VLKB 3VH8G 4BJLA 3O6ML 2VKWA 4WWKC 1FL3B 4JFZL 2GFBB 1XGRB 3LPGA 4PJ9C 3TF7C 1NCBH 3DOSA 2I5YH 1ZLVH 3DRTA 4GAYA 6CGTA 4X6EA 4C4KO 5T5NG 1CT8B 1VGKB 1KTKE 4NHCL 3REVA 3RVWC 4OCXL 4JB9H 2P49B 1EGJL 4Z7UE 1MY7A 3SKNA 2XZCH 5DTFA 3QNYB 2ZCHL 1F5WA 3F7YA 5T5NF 1NGQH 4UZGA 3P3YA 2C1PA 4OGZA 2COQA 1IAOA 4N90D 4LLDA 1CDCA 1UT9A 5KN5B 2V7NB 1EO7A 1JGVL 1PEWA 3BPCB 3SDAA 4C83B 1QLRA 4PJCE 1C5CH 3U9PL 1PZ5B 2UWEF 3KPNB 3MV8D 1RZGA 1I3GH 3M07A 1EHLL 3TIDA 1FZKB 4I77L 2XN9D 2FIRT 5FA3A 2R2BB 4Y4FA 4QRRA 3D2UD 1HHHA 2DQJH 2D31A 1KC5H 4JO2L 3NZ8A 4IHOB 4EDXB 4PB9L 2FATH 2F53D 4G6KL 2Q3ZA 4P2QB 1OT2A 3MXWL 3KS0J 4JZNB 4MNQA 3DX9A 1DE4B 3QUKB 4AH2A 5AG8A 3X12B 5KJRL 1X5FA 4BZ2L 4JG1L 3MOQA 4WHTB 5IBUG 3BW9A 3GM0A 5HDQH 5GRZA 2DQFB 3BT2H 5DK2A 1U36A 3TEUA 5D2LB 4M7LT 3ZTNH 1U2HA 3BD5A 3V4UL 2BNQB 5EU4B 3MO1B 4R2GB 1AFVL 2PTVA 1T83A 4CVXB 5A3IC 1GHFH 4FG6C 5IKCB 4MMXC 4GXVH 2VAAA 4NM4L 3QDGD 3FOMB 1CWVA 1T2QL 3CDFA 1R3JB 3O45A 2R4SH 5E94B 3IDMB 3FAWA 1VPOL 5EUKB 3VFMB 4Z7UA 2EYSB 3DRQB 4U6HA 4UDUA 4IRJD 1UH3A 4ENEC 1UVQA 2YK1H 3GIZL 2MKLC 1UXWB 5C0FA 2BHZA 2DLFL 3NPSB 3N0PB 1HWGB 3CCHB 1KJ3H 3L3HA 3VFNA 1ADQA 2YUVA 5H94B 4NQCD 1ITBB 5DO2D 2JB6A 1HQ4A 3KXFE 4QTHA 3MLPA 4R4FL 4XZUA 1ZSDA 4EBQL 2FR4A 4GMTL 3IFLH 1IKFH 1A7OH 1BD2B 5C86A 5FOBA 5DF0A 2B1AL 3KPSB 1CLZH 2GAZB 2AQ1A 2BSTA 2Q7YB 3TA3B 4LSVL 4IMLA 3QIUC 1C16A 1JZ2A 3H3PL 2Q86B 4J3TA 2ADJB 1R3LB 4OIIL 4J7RA 1JYVA 3RU8L 1FNSH 5C8JA 1INQB 3HE6C 4TYUA 4X6CB 1CE6A 5KW9H 4I18B 3FZUC 3D9AH 3VXUD 3CMOH 3SPVA 5HY9B 5DVOA 4JDTH 4I3SL 5EBLA 1ZLSH 3SDDA 5DD5H 4XPBH 5I16B 5EN2B 5F1IA 4K3GA 1A1OA 4HIHA 4R7DB 3G6JF 1AGFB 1F4HA 4DQOL 4LCYB 3RBSA 5FK9B 4KRPC 4P5MB 3HLAB 5I15H 2PCPA 5JMOC 1FQ9C 1RZIB 4N8VG 2GY5A 2NY5L 2VDKH 1HEZB 2XY1A 2FZ3A 1Q0XL 1E0OB 4MDIA 4ZUUB 3REWA 1OSZB 1RVFH 5BO1H 1SQ2N 1SY6A 4P46D 4RMVA 1LP9B 3ARSA 2VDPH 4OZGE 1QA9A 1KN2H 4DGIH 5K9KB 1YQVL 2YPLA 1OAXL 4TUKL 4ZMAT 5GGRA 4WFFD 3SCMD 1NEZB 2EE3A 3LQAL 1MRDH 2NXZB 5ISZD 4KROD 4KI5C 5D2NB 5HBBA 4OZHF 1JHTA 4I13B 1TQCB 4XPFL 2AGJH 1EO8L 2O5YH 1FORL 2JE8A 1MUJB 1MVUB 1TETH 2DLEA 2J5LC 4Q0XL 1IM3B 4JN1L 1GGYA 4R8WH 3GMOB 1WBZB 4G9FD 1TJHH 1DBMH 3EJZC 2EYTB 1CXHA 4JO4L 5FB8A 2VLRA 2H6PA 5ENWB 3S6CA 4LHUB 4AEHL 4Q9CA 5CZVH 5IW1A 5DJYA 3MRBB 2ZJSH 1G9NC 2C3XA 4MJ6A 1G6VK 5ACZB 3D18B 4CADA 1A6VL 4X6FA 4HWEH 2R23B 1R24A 2JJSC 1CGVA 3D3VE 1PKQB 3RL1A 3VGAB 4DWHA 2ORBL 4HJGA 1NDMB 2JF1A 5FYJD 3EUUA 3C6LB 3V7MA 1JPSL 2NY0D 4IM8A 5EO9B 3EFFA 2HAZA 4XB7A 3G5XA 5MENB 2JJVA 5IVXA 3TC9A 5CCKH 3CK0L 3BZFB 3OKDB 3E1F1 1RHHB 4JFHE 3T0EC 4OFPA 3W0WE 5AZ2H 4PJEF 4OZIB 1O5DT 2G5RA 4YR6B 3MMEB 4LMQI 3JZ7A 3GSRB 3UZVB 1YMMB 1TZGL 4X7CC 1CDGA 4IDJL 3DHJA 3W9DB 2ZKHL 1ZHBB 2PYEE 3EAKA 1OTSD 4QRTB 5DRZA 1UACL 1U91B 2HT4C 4AL8H 1LGVA 4F7MB 1ZANH 3BEWB 5SWZD 5CJBA 3EYVA 4J3SA 1A6ZB 1HKLH 2PKDA 4P2RB 3C08H 3BI9X 1HI6B 1BAFL 3T2NH 4HJ0D 2P47B 3CFEB 5AWNL 3WIIH 1SY6L 5C0EA 1EZVX 2YXMA 1Y0LB 2FBJH 1OAKH 4XVTH 4J1UA 1VCAA 5DI8A 1G7QB 3F12B 3O8XC 4NN7C 2CO6B 4JKWA 3GSUA 4NM8L 2EDHA 5E5UB 4GQ9L 1UJ3B 1M6OA 3WXWH 3I75B 5KSAB 3D3VA 1TVDA 3HPJB 1KJ2B 4QYOA 3FQWB 3L95A 3V0AC 2DDQL 4GRLC 2W9DH 2DB8A 2ZUUA 5DFVC 3H2WA 3EOYG 3ALWA 5CJXA 3TESA 1AJ7L 4RFNC 1YMHB 4XVSH 4D94A 4JFOB 3UTPE 4F57L 4JRYB 3ES6A 3W0WA 5JW4R 4WGWB 1TJGL 3S98A 1UCBH 4ZDHA 1DQJB 4ODVH 3WFDH 1G7MB 4LNRA 3C9NB 3QFJB 1NGXA 5I1GH 2Q8AL 5BQ7B 4TUOB 3X3GL 1U92B 4PJBB 5ICYB 2PYEA 4JY5H 2CGRL 3D85D 2BVQB 1R3IL 1MEXL 4MA3A 5HYJD 1DZBA 2ZCLH 5GHWL 1QZ1A 1T7XA 2R15A 2PN5A 4HJJL 3FO9A 5FM5M 4HK0A 4FQXB 5JPNA 5C9KA 3NABH 1YECL 5E2UL 1GIGH 3BPLB 2CKBB 1KSRA 5JOPD 3MRFA 5E24E 1CK0L 1CL7L 2EO9A 4V1DE 4N68A 2E7LC 3ZKXC 1B4JH 2LVEA 4RA3A 2PW2A 2VQ1A 4JFED 5HHOD 5C07E 5LGJA 1KPVB 4MA8L 5I8KL 4U49A 4WENB 4XP1L 4XH2A 3T0DA 3VH8A 3RA7L 3NOIA 4AYFA 3U7YH 5DHXB 1KEGH 1HSAB 3EDKA 4A6YB 1N8ZB 3CFKB 2FX8H 3QEUB 5DWUL 3LS4L 1UB5A 2APBA 5IW6A 3PV6B 1XCTB 5C0JA 1EBAA 2VXTL 4RFEB 5HD8D 5J57B 3NIFF 2R1XB 2X4OA 1SBBA 4W70A 2RR3A 5KSBE 4OFYD 1F90H 2UWEA 2WWKO 3GSVA 4D0DA 5L2JA 2LU7A 1QSFD 3LEVL 4GLRI 4QGTA 2Z93B 2FRGP 4NNPH 3EO0B 3QXAA 2Y6SD 4QWWC 4KUCF 5DRWA 1NFKA 3LRSB 1GGBH 3STLB 3RWCA 3EO1A 2L4OA 1SVZA 4PJIF 4RX4A 3C60C 4XVJH 2MCPL 1ND0A 4U6VH 3GB7A 5E1AB 4MAYB 3RWGB 4QHLB 1TNNA 3BPOC 4BSVA 4IJ3C 4HC1H 3IDXL 4FQPA 4UTBH 4PRID 1N59A 4YHML 3H7BA 4JZJC 5AZEL 4XWGL 2PR4H 2YUWA 4PGDA 4LPWA 2QQNL 2VZ1A 4NUJB 1S7XB 4XWOD 2WBJC 1FYTB 2XA3A 3C09B 4V1DA 3JTSA 4DCQB 4OLYL 5C6TL 1UYWH 3QHZH 3MRHB 1EEQA 2Y06L 1OGAB 3G6JE 1UA6H 2NZ9D 4PS4H 4AZ8A 4N1EA 3RPIB 5JHDE 1YPZB 3U36B 4MQ7A 5D1XA 2HN7B 4P5TD 1HXYB 1U8LA 1LO4H 3WL9B 1I7TA 3VFGL 1ZEAH 1KNOA 1L9MA 1CFVL 3EYFA 5F7FA 1NL0L 1U58A 1TZIA 5JW5A 2FEEL 1WFOA 1AC6A 1IAIL 4JY4B 5C71A 4HKXB 5JLZB 5KSBA 5SX5H 3BN9D 3QEQD 4ORGB 5T3XH 1U3HA 3GIVA 5AG9A 5HYQB 1T2XA 1PG7X 4N0CD 3DMMD 5E6IB 1HDMA 2K7QA 1CXLA 2GSGA 2NY2B 2H2PD 4ODTH 1QKZH 2AS5M 1W8NA 4L9LB 2XWJA 4Y16B 5FKAB 4LAQL 5L7XL 1J87A 4WGVB 1GGIH 5DJ6B 4O2CB 1S7WA 1Q9LA 1WFNA 1AI1H 2VXUL 4LCCA 2A0LD 1V7ML 3LN4A 3BP4B 5LGKA 3CU7A 3QUZA 5D7SH 2OTUB 1DTUA 4PJ8C 3FT4B 4PJGB 4AY0A 5CD3A 2DWEB 2A83B 2Z8RA 3KWWB 1JNHA 3G6JA 2ZSWA 1HH9A 3S4SB 4M6MH 1A9EB 4PRPB 2AKRB 4QRQA 3BEVB 3BAEL 4LCUA 4HUXB 5EUOF 3IT8D 5HHMD 3WMSA 4D3CH 2IH3A 4BELD 4LBEA 4G8FB 1DSFH 5EU5A 4ODUA 5LAXB 4CDHA 4BYHA 1T0MB 3OAYH 3WFEH 3IFNH 1QBLL 4XBGA 1XAUA 1KB5L 2AJUL 3MYZA 5TF0A 1V3JA 2WUBH 2B5IC 2ITDB 4UTAL 3IJHB 3KG5A 4X6DE 3PWVB 3LKRB 4N8VA 2IQ9L 4NZTL 1NCCL 2D9QB 1IAKB 4J3XA 3MOBL 1KTLB 2ARJQ 43CAA 3BD4A 1A9BB 1KIPB 3NCYP 2ICES 3ARBB 4ZYKB 3HN3A 3P30H 3QUXD 4OZHA 1XIWB 3IDIA 1DEEA 1VKXA 4HDIA 5EU3B 4NSKB 1JWSB 3SDCB 2HWZL 4FZ8L 5J8OA 4PJ7B 5DSCA 4E41D 2HG5A 2AEPL 2KZ1B 5HVFB 2H1PL 3FRUB 2YZ1A 1GZQB 3DBXB 1N7ML 3IDYC 2NW2A 4YFLI 1K2DB 4H88H 2DWDB 1W72B 3OB8A 4E0RB 2D0HA 5IFHH 5GGVL 4KK9C 4U3XA 2RHEA 3GRWL 3T3PE 3H9SE 4TUJA 3ZT5A 1NUDA 3P0YL 4JQVA 2YMXL 3VMOA 4J8RA 4I9WD 9CGTA 1U0QA 4Z7VF 5I0ZA 1HIMH 1XGYL 4G7VH 1SJHB 5GGSA 1Q0YL 2O5ZL 5TGBA 4RMWA 4JLRB 3WIHA 5EZIH 4U33A 4ZS6C 4JDVB 3ZHLA 3HNVL 3ZYZA 1FLRL 2DM7A 4KJPD 1BJ8A 4X80L 4NN5C 1HINL 4K8RH 4PG2C 4ZUSB 1IGJB 1J0YA 2R56H 3KLDA 3O2VH 3KYNA 1A47A 3R8QA 1T1XA 2DF3A 5EC1B 4LL9A 1YEIL 5C7XL 4G6FB 4GUPB 1I7RA 4OT1L 1RIHL 4X9IA 3SQOL 3K8LA 3BQUC 1DUYA 5J9PA 2DI9A 2IAND 1WZLA 4Y5VB 1AR1D 1OGTB 1KENL 1F3JA 2IPKB 1J1OH 1ZA6B 1DEDA 4UUJA 4LPUA 1JHKH 3PQYB 4QRRD 3ABZA 4Y4FD 1XR9B 1JZ8A 1C12B 2R8SL 3FTGA 1MFDH 4IOIB 3ISWA 4GG6F 2FO1A 1Z6JT 5IBLC 2NYYC 3AREC 1FNFA 3H9SA 2LTQC 3KYOB 1F6AA 1P9MA 3IJYB 3V52L 4U6YB 5I8EA 4MNQD 3MRPB 3QR2A 2DYPB 3ARDC 4XPGH 4CNIB 1WBYB 4NCDA 4YHIB 1EAPA 1JPTH 2K3TA 4XPAH 3QXTA 1EFXA 3NIFE 5T33L 4D9LL 3QH3B 3UTSA 2FO4B 4OF6A 4QLRA 2J8UB 3VWKC 4UNTA 2ADGA 3V7AG 3TT1H 5I1IL 3BO8B 1J05A 1HKFA 4M93B 4FQQB 1IC5H 2J2ZA 3ELAT 4ZXBA 3KJ4B 4PJIE 3WEXA 4DJMA 1A1MA 5HGAA 3EFDL 5DVMA 5FUZL 3O11B 5HHVL 2E9JA 1NCDH 1RFDL 1X7QB 15C8H 2Q20A 3TBYB 5F9WC 3PNWB 4YO0A 5DGQA 5FOJA 4JANB 3PWNA 1I9IL 4J3VA 3VD5A 4HQQH 5EIIB 3D69B 4Q2ZB 1RK1A 4D9QE 3QWRA 5LGHL 3FN0L 3IETA 3BX7C 4N0FA 3UTOA 2Z91A 5JQ6H 5E2JA 1BBJA 4RZCA 5F71A 5T1LB 5T1MB 2F58L 2ITCA 1H5BB 3IU3A 3OPZL 4HULB 3MREB 4WU5A 5EBWA 1HNFA 4QXUL 4GAFB 2XPGB 4Q9QL 4JO3H 2VJXA 3VRLF 3T4AB 4NGHH 4R3SB 4HF5L 3QQ3B 1A2YB 3ZKMC 1NMAL 1FL5B 1A6TA 4KMLB 3R0MA 3SDDD 1G7IB 4M1DH 3LN5B 4RNRA 5L2KE 1FFOA 3A6CH 4X8JB 4OCRH 4K3EH 4NQXA 1J1PL 5CZXC 2UYLB 3NCMA 1IGTB 4HUUB 3SJVE 3O3AA 4F9PC 4LKCA 3EDJA 5IF0A 2D3VA 4UV4L 4P3DA 1B0GA 5ITFA 4PJIA 5D5MF 5JW3L 3FQTB 4LCWE 2J6EH 5BJTB 4L3CA 2XTJE 1DL7L 2RFXB 3IDNB 5DD6B 5DA4A 3O9WA 1FN4B 1FFQA 1G7HA 2FEEI 1JNLL 3V0VB 1IAII 4GO6B 1OF2B 4W4OA 1HXMA 3BPNC 3B5TA 4MB3A 3OJ2C 4TOYH 4HCRA 1E27B 2EIEA 4YJZL 3BZEA 1IC4L 4XPTL 4P4RB 5GZNC 2FYYA 4OLEA 3U9UA 4IS6B 4S1QL 3RQ3A 1JNNL 3KPOA 1GC1L 3HZMB 1A4KA 4KVNL 3RBGA 1J1XH 5IWLA 2FDBP 4MJIB 4QRPE 4HG4J 3CVHB 4Y5YC 5BVJB 1K4DB 2ZG2A 1EV2E 4KVCH 1RZ8B 4MCYB 5BXFB 3JWOC 3MGAA 5MEQB 2VLRD 3R0NA 1DDHB 1RU9L 1UWGH 3QCVL 1KIRA 4JM2B 5F7DB 5L2KA 3MRDB 3ZKQD 3AU1A 4I2XB 2HFGL 3RFZC 2FH6A 1I1YA 3WHE0 2BC4A 1TJIL 4L8DB 5C0ND 4G6JL 1NC4B 1S7TA 5FHAL 2AJVH 3SJVA 2Q6WB 1GOHA 5J11B 1DBAH 1Q9KA 1ZOXA 4DEPC 4KDWA 5FECB 4J3WA 4OCMC 2VDOL 4JG0H 2BK8A 4X5XA 1YNLL 5IBTL 2FD6L 1EUTA 2CIIA 4K7FB 4KKAD 4LCWA 5F89A 1CVSC 1E6OH 4WDIB 3WDJA 1INEL 2H8PB 3C87A 4APQA 5DHVH 1XH3B 2CK0H 1XGUA 4H20H 2AQ3A 4HS8L 3BH8A 3QEGL 5BZDB 1BEYH 3RVVC 2NW3A 3QPQC 4GRMA 3OX8A 5BVPH 1MRFH 3X13B 3MV8B 1FH5L 3P9LB 4LSTH 4GBXA 3V6ZA 4JREC 3H42L 2BOCB 2XFXA 2XN9B 5EC2A 3U4BH 4NN6C 4HUWB 4Z7VE 3D2UB 3MJ6A 1HWHB 1IC7L 2EEDA 3FQNB 3F6IA 2QR0B 4QRPA 2BSSA 3UAJD 4FQCL 3O2DL 1K4CB 3BH9A 4N5UA 4K9EL 2YPKA 4WCYL 1ED3B 3HB3D 4N8CL 3RAJH 4AEFA 1HQRB 1N64H 5J13B 4M7ZB 4PRHE 3MCKA 1N26A 5ACMA 1IZJA 1I1RA 1OPGH 3P77B 3VFTA 3SEPA 3SY0B 3ALPA 5HGBA 4XNXL 3LKSB 3OHXB 4YNYA 3D3VD 4DZBB 1RHFA 3ZE2F 3SE8H 3W9EB 3T1FA 3QDGB 4YDVA 1KACB 4S1DD 5D96C 1ETZA 4Y88A 3KLHC 1BQUA 2BVOA 3HR5A 3L3IA 1RZJC 4IRJB 4JFHD 4YIQB 5DD3H 5E0QA 3W0WD 5I1KL 4S1SL 3RZCB 1K6QL 4FQJH 4KRLB 2H26B 4HKBA 1WZ1H 4NQCB 4NFDA 3DO7B 1CIDA 1FVEA