3NIGF

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nigF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nigF01
1QFWM 3EYOA 4QHKI 4YC2C 1N4XL 3C6LB 3ULVL 3RI5F 2JLLA 3EYVB 3WLBB 1I9IL 3TN0A 1A64A 4S11A 3VMNA 2D9CA 2EH7H 1U8NB 4WDIB 3BWAA 4IMKC 3AS2A 1NFIA 5DC4B 1MLCA 1F90H 1O7SA 3R0MA 4GLRI 3A6CH 2NR6C 4U3HA 4CN4A 2COQA 1ZT4B 2VZUA 5FOJA 1A14L 3FAWA 1FL5A 4NO3B 4UBDC 43CAA 4NIKB 4DAGH 5DRWB 4PJXA 3BPLB 4PY8J 3REWB 4PBWD 3L6FB 3TF7C 3IJSA 3GKZA 3GMOA 4H0IA 1ZLSH 1P7QB 2PTUA 1FGVH 3DUHA 3EHBC 4R3SA 5E2WH 3RUGE 1CGTA 3VU2A 5D2LF 1DUZB 4MXVF 3C60C 4QHUB 3HMXH 3S35L 3U0PA 1GAFH 3QWRD 3VD4A 3U30C 3NACH 4XWGH 1CBVL 5D7SL 1RZJH 5H37G 5F1SA 5HHNA 4JVPA 5E5UB 3ZKQD 5FKAB 4ZOEA 2B4CH 1MFAH 3VCLB 5EZLA 4P46B 4UDUB 1BX2A 4U1MB 1DVFA 1YYMH 3GSQA 1OD7A 1W8OA 4PJ8D 5E8PB 2BXZA 4FP8L 1VESA 3TNNB 3DUSB 5D7LB 3QULA 3WFCL 1XMWA 4D0BA 2IAMC 3GMQA 4JFXB 1U93B 4R0LB 5GGSY 1ERNA 5HI4D 3OR7A 1HEZB 1I7TB 3KPRB 4KI5F 2DQDL 1KIPB 4HLZH 3RI5K 1V3LA 3O4LE 4NQDD 3OPZL 1NKRA 2PYEB 3WKNA 1A1NA 2R2EB 5J1AB 5KVEL 4QHLA 1HIMH 3WFBH 1NEZA 1MI5B 4QLRA 4C55A 3BVNA 4JQXA 3DO3A 2DQHH 1G0DA 3P9LA 1AY1H 5JQ6L 3A6BL 1N2RB 1C5BL 3G08B 5ISZA 3T4AB 3W9EB 1N3NA 1T7YA 3BZDA 1H3WM 3C6SA 5FIEA 5CSGA 1WCBB 3HRPA 4I13B 5SX4H 5FA4A 1JPFA 4EN3C 2A74B 3AXLA 5CJQH 1V3MA 4X0KA 4QKXB 1H3XA 1SBSL 3SDDD 2V2XB 3DI2B 4E41D 1TCMA 1YNKL 3C08H 1NANH 3P9MB 3PDGA 1W0VA 2LU4A 4OKDA 3OGCB 1SEQH 3DX7A 3IU3B 1KXVC 2GJ6A 2DLFL 4Y4FB 5GGUA 1KJVA 3F6IA 2A9NL 1S7UA 5AUMB 3MO1B 3QUZD 5HBBA 2IPTL 1IC4L 4JPVH 3X12B 4YEFA 5I71C 3LN4B 4X5XA 5AG9A 1PLGH 5C3TA 2F19H 4JDVB 5HHVH 3V0WL 2P5WB 5FA3A 5IF0A 1MREL 2HT4C 4DGYL 3PDDA 3I75B 3PIQB 4EQ3A 4MD5A 3B2UD 1MCCA 1BJ1H 3R06A 4X5WA 3QEHA 4L3EE 1T1WB 4GG8A 3SCMD 5DQ9A 2SEBB 4ZFGH 1QOKA 1L4IA 2W60B 4LK4A 4PJAA 4XNXH 1MRFL 4ERSL 3S4SB 5HHPA 3PWJB 4AZ8A 1BIHA 1EHLH 3FRUB 4ODSH 4P3CL 2KQNA 4LVEA 1K4DA 4CMMB 5K9KB 3NCJH 4HUVA 4FXLA 2HTKC 2ZOLA 3VD5A 1OD9A 1V3KA 1T4KA 3NFPA 4KXZH 3D39D 2LVCA 3HZYA 4OGYL 1YEKL 1QG3A 5HHXL 2H6PB 3BGFB 3C5ZC 3KYKL 4N8CH 1JNLL 1MH5A 2JCCE 3AMLA 4DKFH 5KS9A 1NANI 1AQKL 3MRHB 4NZRL 5DHXB 2WBJA 4DZ8B 1FG9C 5EBWA 1QUNA 5DEZA 4MJIB 2ATPA 5GGVY 4BA8A 1GPOL 3CSYB 3EDEA 4NJ9H 4YHOH 1RIHH 2NYYD 3ARZA 4M93B 3CAFA 2DKMA 1B9ZA 3E6FB 4OZGA 2MFNA 5EWIH 4MNQD 1UJ3C 3ES6A 3V5KB 4WWKC 3HS0B 4IRZL 2CR6A 2Z35B 4OQTA 1WEJH 1JWMB 1YA5A 5I19L 1D5IL 3RAJH 1JZ4A 2BZDA 4L4JA 3ULSB 5T1LB 4JM2B 3LH2H 4NQCB 4FQHA 3BQUD 4EJ1C 3MBEA 3G5YB 1NLDL 4ZFZA 4WW2B 1RIUH 3MJ7B 3QNZB 1MFNA 2CLRB 3BJ91 4FTVB 4U1HB 4FMFA 1N6UA 4PJIB 3U4AA 1T6VN 4LVHC 4LLUB 2YZ1A 4NN5C 2OL3A 2UVFA 4DVBB 3WL9A 3R1GH 3IAPA 1F2QA 3QUXC 4LARL 4S1DD 4X9BA 3VWJD 2QEJA 4NWUL 1PSKH 3HC4H 3D48R 4KXZI 1J12A 3NABH 1BECA 4HGWB 4NBYB 4I0PB 3RBGA 5TH2A 4PV8B 1NCWL 2YXFA 1KLGB 3MRNA 4XCYB 3O3AA 1EEZB 5EU3B 1YJDH 1QBLL 3ESVF 2ZSVB 3NCYS 3MRKB 3BKML 4WGWB 2FBJH 2MPAL 1MFCL 5DF0A 2FZ3A 1IAMA 2NY1D 4PRIA 1T3FB 4L4VD 1I1AA 5IFAH 4PRBB 1AGFB 4P99A 3WUWA 4GXUN 4DCQB 3HNSH 3U36A 5HGAA 4JFDD 4MQSB 1RHHB 5JUEH 2IH3B 5TQ0H 1DR9A 3OJMB 4P9HC 5LXGL 2AXHA 2P5ED 4BQBA 1UB5A 3MLVH 2E6PA 2EE6A 1JPST 4LHUD 3UBXI 4FQ1H 3HMWL 2UZIH 3ELAT 4POYA 1Q9WA 5C0IA 2JB5H 1EX0A 2CIIA 1C12B 5GGTL 2O26U 5T5NF 2XKSA 1R3HB 1D6EB 3QG7L 4NP4H 2WSKA 1MF2H 3EJZD 1RUAL 3GIVB 4I2XB 1HHIA 3MRBB 2N4IA 1KT2B 4OI9A 4QRRE 1OAXH 4OGZA 5F7WC 3VFMB 5B3JF 4M48H 1LVEA 5GISL 3RU8L 3VXMB 3WNMA 1QRNE 3LKRA 3FT4B 2APTA 4JLRA 1WVZA 3WFDL 3VFTB 1ZHBB 3ARFB 3MRGA 1DUYB 3P4OA 3QUKA 5CP7A 3X11A 2VZOA 1XGUA 3LS4H 2P8PA 4PGBB 2UWEA 2XRAH 3NCYP 2AV7B 2Q1EA 4QXTA 3IJHA 3O4OC 1H15A 1T21B 5GS2H 3T0EE 2GW5A 2HFGH 2Z8WC 5DD0L 3EDJA 5IBLD 2JJWA 4Z7WE 5JNYB 3HUJE 3E2HB 1PX3A 4X98B 5CJOH 5C2BL 1T1YB 3OAYH 4HULB 5C0CA 4X9HA 4MS8C 3C5SA 2EO1A 1CTNA 1RUQH 3OKNA 4FQIH 4EUPA 1HYSC 4GUPB 1NBVH 1EO5A 3HNVH 1YEGH 3HR6A 1KEMH 2BY0A 3WFHB 5EO1B 3IFLL 2NTSP 2LU7A 5JW4N 1FNSH 4HIXH 1R3IH 1NKOA 2JF1A 2VXUL 5D7IF 3W0WE 3L3GA 3CMGA 1BM3L 1CGUA 1IC7H 2PYFA 2ITDA 3QXVA 4CN1A 1D9KD 4OKVB 3PHOA 5I1KL 5FAAA 1KJ2A 2QHLA 4P2OA 4Z77A 2NY2C 2V5SA 2JJTA 4PJFA 3ZYIA 5DUBB 1Q9OB 2IG2H 1A6ZB 1FORH 5EC1A 1RZ7L 1A4JB 5FF6A 4M7KL 5I15H 4HX1B 4JFFD 4YHYB 3OKMA 5C0BB 2I9TB 4HLZG 2R0LH 5GJSH 5FO8A 2VKXA 3MCKB 4YHNB 2F54E 4JHAL 3KR3H 2ZUWA 4QF1A 5HD8C 5C2UB 5DVOA 3UTOA 1XF2B 4RIRB 5BRZE 2IH1A 4DTGL 1FO0H 4LASL 3BP7A 3CZFA 4WFHD 4X8JA 2W0PA 5HHMB 2DJSA 1KCUH 4N0UA 3H2WA 5GZNC 3FT3B 4GG6B 1U91A 5CMAB 5I17B 3RWFA 4PP2A 5TJWK 4OLVH 4DWHA 1ZSDA 1DN0B 3F62A 5GS1C 1JF1B 3SE4C 5E9DB 3U2SA 2NY3D 3OR6A 4GS7C 3O9WA 3VA6A 1QSFE 1OTTC 1Z9LA 3PQYA 3JWNC 3GBNL 1NMBL 2R2HA 3AVEA 4JRYA 4ZPVB 3U1SL 1I7UA 2H8PA 1NDGB 1MCPL 4YHIA 2X4TA 5ECJE 4H20L 2P42B 3HLAA 4WUUE 1AP2B 3W11C 3LY6A 2E7MA 2NMSA 2CJUH 5E99H 1Q0YH 1QLRB 1UWEH 1MFBL 1YY8B 1WAAE 5IKCA 1H0DB 2Q3ZA 1J86A 5DJXB 1BIIA 5GRYA 2YC1B 3TPKA 1U8KB 4K94H 5SWSD 5JOPD 1CFVH 3DTXA 3LEXA 2YPLA 4WHTB 4BUHA 2VR5A 1QSED 1A3RH 3D5OF 3NFSH 3WHXA 5I1HH 4K23L 1CDUA 3QIBD 1DL7L 2J8UF 4P5KA 5L88H 3OB0H 4N1HB 3TVMA 2EZ0D 3F7YA 1Q1JH 4U1JA 3REVA 3HAEA 3DETD 4L4VA 2ICEB 2QQNH 3C6LD 5IFHH 4J3UA 1DQTA 1WIUA 1A9BB 3QXAB 1U8IB 1AHWB 1TJHH 2B0SL 3I6GB 3K2UL 5F9DC 2VNCA 1U8LA 1UA6L 4LEOB 1JJUA 1ZGLP 2E7LA 2FO4A 1HHJA 3GMPB 4PGDB 5ILTH 3SBWA 1FBIL 4H8WC 3FB8A 1OP9A 2BNUB 2HTLC 1FVEB 3FB6B 4P2QA 1ZHKB 4MJ6B 4UU9A 5HYSA 4X6CF 2E8YA 3U7AA 4NKMB 4S10A 4XXDB 5FKPB 1YQVL 4M62H 3QEGH 1MFEH 1TZHB 1W72A 2CRYA 3QXWA 1VKXA 5H94A 4MAYA 2VC2L 5D71H 1IAIH 5LCVL 3HCVB 4M4RA 2CMRL 4O51A 2XZCH 3OWEA 4PJXE 4CVZB 4ETQA 5EG6C 4YFLI 3GSNH 2J8OA 3VD3A 4OGXH 2OTPA 5MEQB 1IGCH 2VQ1A 5JXAL 2HG5B 4OIIH 3MV9B 3MV7A 1BQHA 4JHWL 4GRWB 5ADPL 4O4YL 2B20A 4X7FC 4L8CA 2HKFH 2PXYC 3GRWA 3Q6FB 4XCCH 2IWGA 5IMKA 3B9KC 3T0AA 1ZLVK 2DIAA 5IB4B 4G6JL 1II4E 3U0WH 5IW3A 3P4NB 4P46D 4FN0A 5IVZB 5BMFL 1A7OL 3DVNB 3QO0B 1GVIA 4M7LL 5ITBH 3QB7C 3JWOH 5KVFL 35C8H 5D7LD 1P9MC 5GRWA 1WFNA 5EIQA 4XNMA 2PTTA 5B39G 5FOBB 4RWHA 5CKAA 5FYKL 4IJ3B 1CXLA 5CEZE 5EU4B 4ZPTA 1HH6B 3KPRD 5C09A 3K8KA 4WEBH 4NO5A 1MHPL 4YDIH 1NQBA 4M6OH 4AM0B 5EU6A 5FYJL 5IHUL 5FGBA 2PYED 4WO4A 3E8UL 4NYLB 3EZJB 3DUUA 4LKCB 1MI5D 4UIKL 1F2XK 3HI1B 5J3HD 1S7VA 4WI5A 1BJ1J 4NZTL 3B2VL 2XTJB 4PLKD 5CZXD 1UQSB 1S7RB 2DDQH 5AD0A 2Y72A 4JPWH 5DJDB 1JHKL 1XR8A 2XPGB 1KC5H 3MYZA 1CVSC 4MA1C 4PJ9A 2NX5A 5ISZE 3WIIL 3KPMA 3INUL 4XCNB 1J87A 4WWID 4EI5A 1T20B 2JTDA 1I3RA 4KAQL 3L1OH 3PHQA 3B5TA 4WEUD 4NBZB 2Q8BL 4M7JL 2CDGA 3K46A 2Z93B 4HQQH 2ZUQB 4UAOB 1UXSB 4LCWB 1I8IA 4RWYH 3IDGB 1EA9C 1GZPB 1U9KA 2IANA 3Q0HA 4Y4FD 2QQQA 4GQ9L 1FLRL 4EIZC 2GJ6E 5D7JD 3JXAA 4WTXA 4KVNL 4FFWC 1QACA 5E8DH 1HOCB 4NRYA 4Y88A 5T33L 1YDPB 2RB8A 3ARBA 3LMJH 3CC5A 5D4QA 1A4KB 2KDGA 4PRHB 3GFUA 5I76B 4PJHF 2VDLH 2P5WD 5GSVA 3ULVD 1UM5L 3CSBA 4YNYA 1PQZB 3F8UB 2MCPH 3HZKB 3QXUA 4AY0A 4RAHA 1TZIA 1MCEA 2MTPA 4YX2L 4GMSL 1H3PH 3JUZA 3JSSA 4YO0A 1K2DA 2JJSA 2F53B 3U7WH 5AZEL 3EYQD 4EDWL 4AENA 1URLA 3TFKD 4N0FB 1JTPA 3Q5OA 5B21A 2ARJQ 4LSTL 5INDB 4NQVB 3MACH 5FUZL 2EECA 3WIHA 5B38G 4HKBB 1J1XL 4PJAE 2VB5A 3ZYZA 2OZ4L 1Y18B 5J6HA 3BPNB 1GJIA 5DD1L 1X5ZA 1WIOA 4UV7L 5ICYA 1U8QB 3QJFB 4Z8FL 1P4BL 5BS0A 2X1XR 4F33A 4M61B 5MP6L 3C2SA 4XP6L 2GTWB 3V6ZA 1DQJA 4U1SA 1TZGH 5BQ7A 1A6UL 4XH2A 1FL3A 4GBXB 5LGKA 1F11B 3VXRB 4L4TB 2CXKA 4U1NB 2BSSA 3A67L 3DIFB 3ZKNC 5KS9E 4MJID 4Y16A 4R2GB 1T1ZB 1TQCC 5EBMA 4EOWL 2MHAA 1Z5LA 1J8HD 4ONFH 3RJQB 5JMRA 3P73A 5E0QA 3TYFA 2I9LA 4P4KC 2A6KA 3HC0B 3O6LL 1IT9H 1CFTB 5IROA 3UAJD 1Q9KA 3VGFA 5I1CL 2YRPA 4WI4A 3T8XA 1NGZA 2OS7A 5ADOH 1AQDA 2MQCA 4PYHA 4FA8A 2P44B 3BZ4B 2Q6WA 2ZNWA 1KB5L 5T1LD 4JM2D 4YDLB 1X4XA 2ICWB 1BVLB 4NQCD 2CIKA 5DK0B 3MLWH 2NW3A 4D9RE 3SKMA 3RPKA 3OTTA 2IQAA 4UT9L 4DKDC 1QQDA 3CXHK 1HZHL 4XMKH 1IGYB 4FTVD 3OKEB 2VAAB 2ESVA 2RFXA 2VDQL 4L29A 3Q6GL 2VQTA 1QEWB 4P5TA 3BRGC 4MZ3A 4ALAH 4HW6A 4Z7UB 3UPRB 4NC1E 4OLXL 4I0PD 4WUKL 4ZAKB 4XNYL 1QFWH 4U0RC 5LGJB 4OV5B 4G42B 3IYLW 1MAJA 4Y2DB 1RZ8B 1VADA 3QQ9C 4M1DL 1I8KA 5DYOB 4LLQB 3BEWA 2LTQB 3RX8A 3RWGB 2X89A 2R0KL 3F12B 5CHNA 1X5HA 2BDNH 1CFNA 3CIQA 3IDJA 4F7PA 4PRIE 4WIQA 3IRPX 1DQLL 4ONHA 1AFVH 4LSSH 1HNGA 3O11B 5GS0D 1E4KA 4F2MB 2DQUH 5JLZB 4F15B 4HIIB 5IBUB 5J9PB 3QWOA 3IVKA 1SYVA 3KJ6H 3EBAA 4MXQC 5CGYC 2C3HA 1FN4B 2W9DH 3SE8L 2YD7A 4I1NB 2YA2A 3M1BA 5T1MA 4E0RA 4M00A 4OUUA 1KCRL 3V0VB 1BFTA 1ZLWH 5DVKA 3T4YA 3TWCH 2QHRH 1T66D 2F5BL 4RCAA 2X4OA 1UACH 4XBPB 1TDQA 5F9AC 2FWOA 5LQBH 1ZVYA 5K9JL 3QJHB 3ECBB 2PCPB 3MNZA 2EDDA 1UM6H 2FB4L 3QUYC 4M5ZL 1JRHI 4HKJB 5JTWA 1I1FB 2CKBA 2AJVH 1N0XH 4X6EB 3ZZ1A 4JKLA 3QHZL 4PJEA 1ACYL 4H5SA 2X42A 3VXMD 3LD8C 1GGYA 1NC4B 4JPKL 3ARFD 4EEEA 1M7IB 5JR1L 1LEKB 1UEYA 2WIIB 4FQCH 3A0OA 3GBML 5DFTA 3WSQH 4PGCA 4EVNB 1OWWA 3SKOA 2CQVA 5D7JA 5BZWA 3ZDXE 4QTHB 4RQQB 2YD9A 2UWEE 1RZGA 4LOUC 5T1DH 1KCSL 2VN4A 4PG9A 5CIPB 1RURL 1JGEB 2HFFA 1AGDA 4UTAH 1E6JH 4S1SL 3BIKA 2Y1VA 2XA8L 4I3SL 4UQ3A 1GYAA 5HGBB 5L8KB 4JG1L 4PV9B 4MNHA 3L3DB 4OLZL 4DUVA 4ZXBC 1XF3B 3P77A 3NN8B 1J9CT 4HPOL 1INQA 1WBXA 1JGDB 5JW4R 4U1IB 3V0AC 4F7TB 1QLFB 4HFUH 4JM4L 4DN4L 1SJHB 3JWDC 5DHVB 1LO3H 3UYPA 1OM3H 1KB5B 4NM4H 3SY0B 3IFOA 3RGHA 1FZKA 2YD2A 3GB7A 4CJ0A 3UYRH 2UY6A 4TNWF 1AJ7L 5J56B 3CX5J 3BH8A 4K3DL 4PJFE 2HN7A 3HB3D 3O3BA 3BDYH 5DMGD 3HR5A 4RA3A 1TITA 3V8OA 1ONQA 1RZFH 4OZHB 3UP1A 1EAPA 5C0BD 3RWDB 1H3TA 1IM9B 1TJGL 3LZFH 1A7QL 1MNUL 3QDAA 3SDXB 5ESQB 1OCWL 1CXIA 1CGSL 1TLKA 3R0NA 4PTTA 3LEYH 1G7HA 4JZNB 5IK3A 5M94B 4X7TB 2Q76A 3RVUC 5HHMD 5D6CB 3FO2A 5DGRA 1BQSA 1AO7B 4KK9C 3GNML 4N0UE 3HRZA 3QDGA 4X9IA 5E9DD 1UWGL 2GITB 4NM8L 4BQ8A 2ORBL 2AERT 2VLRA 3MREA 3O2DH 3BAEH 4R7DB 4WU7A 3MA9L 1U8PB 3HNTL 5F89A 3UDWA 1RZIA 3GI9L 3MGOB 2W1NA 3UYOD 1LO5A 3PQYE 4K8RL 1KJ3H 3T1FB 4JRYE 4XVTH 2AEPH 4DUWA 1I7ZB 2FD6L 3T0WA 1MCKA 5TGBA 5H2BA 4PD4K 4M1GL 4V1DA 1CF8H 5JHDB 2P43B 3SKNB 3KPNA 3O2VL 1L7TL 4QHMA 1SY6L 2BOCA 1X3DA 4GRLA 1D6VH 5DMKA 3TV3H 4YFLF 1KN2L 3G9VA 4KTDH 1G6RL 1FLTX 4Z76B 2W91A 4MJ2A 4PTUB 5FYJU 4KRPC 1AR2A 4TOYL 2EE3A 4K9EC 1OQXA 3BN9C 2IPUK 4TNWK 1NJ9B 1RJLA 2YPLE 2X2YA 3M8OL 2DMBA 2OI9C 3U4BL 2Y5TB 3C2AL 2HWZL 4QT5A 2ZCKL 1D5ZA 5C7XL 4QYOA 2PW1B 1QFPA 4ODXA 3L95A 5JW3H 3HZMA 1MY5A 4KKNA 4PRPB 1F3JB 4L4VE 1FNEB 1AXSB 1DLFH 3QQ3A 3VFRA 2D03H 4Y2OA 4XPGH 4TVPD 4ORZC 1RJZA 3VWKC 2DBLL 3SKJH 1SMOA 5HY9A 2P5EE 5MI0B 1XGQA 4RGNC 5IWLA 1FJ1A 5JOFB 5F93C 3T77A 2OP4L 4ZTOH 3I50H 3TA3A 4Y5VC 5FGCB 4UUJB 3QG6A 3CDYA 5JZ7C 2AEWA 3P0VL 2UUDH 3LDBC 4HWNA 4H1LG 4XB8A 4HXAH 3RL2B 5DGQA 3H9YA 2E5EA 3CFKB 1ACZA 4S2SA 3JTSB 3EJYD 3O41A 2OQJB 4FXGB 4DOHE 4TPRL 5D8JL 4JDZB 3W9DB 4HWBH 1YEDB 3DSNA 3NCFB 1EHAA 3EDKA 3MV9D 3VFOA 3QDMB 1CI5A 3MV7E 5E2VL 4RMUA 3TH3T 1X5JA 1NFDB 1JFQL 1B88A 1VEPA 4I0CC 1QP1A 2HJFB 1LO2H 4FQXB 1AXTH 4GW5A 4KFZC 3VG0H 4RFEA 3FN0H 2ZCHL 1WUNT 5DFVD 4HJGB 2R4SL 5E2TH 3RVXD 1NMAH 1W2KT 4KKCD 5F1NB 2VITA 3AAZB 4MXWH 4UT7L 5FDWB 3O45A 3BT2L 5F72S 5TFSH 4M5YH 4IMLB 5I8OL 3GIZL 2OJZH 4FG6C 1J1OH 3O8XA 3N1MC 1YMHB 3X17A 3OHXB 1N4XH 2H2PC 3QCVL 1NGQL 4AIZB 2C4FT 3RTQA 3EO9L 1I9IH 2FIKA 2LQRA 5C09E 3T2PA 4MJ5B 4EI6A 5E6IC 2VN7A 4ZMAT 5EU6E 4NJAL 3AS3A 2XTJD 3WS6C 1MIML 1EUTA 1NCCL 3LVEA 4WRLA 5D9SA 1C16B 5EUOE 3PGCA 4QRQB 2PO6B 1A14H 3STLA 4YHML 3IGAA 4XPHL 4YPGB 3T0EC 4PRDB 4U1GC 3F5WB 1YEHL 2C7UB 2NX5E 3PP4L 2IADA 2XQBL 2ENYA 3N1GC 4MA7L 5F9WB 3CXDL 1BQLL 3WEXB 1AXIB 1R3JB 2Z91B 1PX4A 1XIWA 2EICA 2VABB 1G6RB 4LCWD 5D1ZA 4WFHE 2HVJA 4YBQD 2HLAB 4X80L 4NHUA 5C0GA 3K4AA 3S35H 2IANE 2X4PB 1OLZA 4U7KA 1CBVH 5D7SH 4F9PC 3U46B 1VGKA 3MUGA 7FABL 3X13A 4PRHD 3DX9A 2ADJB 2P8LA 4ZS6C 3ZL4L 4KJPD 3V7AE 3LN5B 4FP8H 3AREA 3BO8A 4Y4KC 1ZHNB 2G75B 5E7FA 3WFCH 1S9VA 2F53D 1OWRM 2AQ3A 4GAYB 2WWKO 1ZTXL 2YN3A 5MENB 3GJEA 2R1XB 2DQDH 4HG4J 3OPZH 3HHRB 5IVXB 4HS3B 1SMAA 2ADFL 2JJVA 1KB9J 2XWTB 5JPMA 3BESR 4NZJA 3RWCB 5KVEH 3S7GA 4G9DA 2GI7A 4XZUB 1ZS8B 5I8EA 5HVHC 1RZKL 1U3HC 5EC2A 1QSEE 5AAWA 2GCYA 4P5MA 5JQ6H 5BS0E 3A6BH 4JRXB 4HIJB 1IEAB 1C5BH 4S1RL 4G8GB 4GBXD 1CQKA 4LLYB 3STZB 3VXRD 4L4TD 1R5IB 1W0WB 3S35X 5DC9B 3DXAA 3LV3B 4H88L 4GAJL 3VGEA 5IB2B 3OV6A 2F74B 1NCAL 5DEGB 1HHGA 3PWPB 4R2GD 3SQBA 2ILLA 1OGTA 1SBSH 3V52L 5K59E 3FQTB 4W4NA 2Q20A 3QRFM 5TDPA 3HN3A 1YNKH 5KVGL 1JN6A 4URTB 5HYJB 4LPTA 4I3GA 1P2CA 1KBGL 4L8SC 4YXHL 4X4ME 3WN5B 2DLFH 4YAQA 4J8RB 2APVA 3LHPL 5EPMB 2A9NH 2NY5L 1WICA 5F6IC 3BOVA 3ME0A 2IPTH 1IC4H 1X5LA 5HJ3A 3WV0A 3FQUA 3JV5A 5L2KA 1MCQA 5F7YC 1TTGA 5JPNB 3ZMRA 4HF5L 3SEPA 1SEBB 4NQED 3V0WH 2PF6A 4N8VG 3FAXA 1MREH 4DGYH 1PZUB 5FYJD 5C0ND 1AC6A 2R9HD 2GFBB 4R26H 5C0DB 4CN6A 1H8NA 2I26N 1UZ6E 5IHZB 1M6OA 3HG1B 2E9BA 1VENA 1WFUA 1KYOK 1T7WA 1G1YA 1EEYA 4X4XB 1V3JA 2ESVE 2EXYD 4KJQD 5D96B 3VRIA 1MRFH 1VPOL 3L9RB 4ERSH 4ZAKD 2QQLL 4FMKA 1T7XA 2NCMA 3EKCA 2Y07L 5CUSL 3NTCL 4Y2DD 4P3CH 4YIQA 3EZ8A 3KJ4C 5I16A 6CGTA 1EGJL 5T5FL 5TE7L 5CCKH 2EDKA 1G7PA 4FQ2L 3S5LG 1ZA6A 2KBGA 4JANA 4QTIL 2DIJA 4OGYH 1YEKH 2VJXA 3D3VB 4JKWA 5SWZA 3RWHB 4DEPB 4J4PD 3KYKH 1IGIH 1JNLH 1UB6B 4JPIA 4QRPA 3ULUL 1J88A 1AQKH 4LIQE 2QTEA 2VUOA 4NZRH 1EHXA 3WDIA 1FFOB 2HKHL 3OKKA 1CCZA 1EXUA 4WI3A 4XTRD 1GPOH 5I75C 5FECB 1CICA 1AI1L 4KJWC 1DQQB 3TNMB 4C56B 2DOCA 5KTEL 3EJJX 4KKBD 1TVBB 3VFWA 4Q9BA 3JTTA 4MX7A 5DJ8A 1CT8B 4TULL 4QWWD 2Z31B 4IRZH 2W0FB 3QAZC 2NY4B 5EZJB 3ZHDA 1OF2A 4GKNB 5I19H 1D5IH 3ZKSD 4XX1E 2WANA 3E0GA 4ZUWB 4APQD 4W6XB 2EDNA 2EDRA 5MHSE 4PREB 3DGCR 1HYRC 5CBEA 3SO3C 3RNKA 3TBSA 1FSKB 1U36A 2GSGB 5KSVB 2G5BA 1NLDH 1DVFC 4NO2B 3FOLB 4PJEE 1KPRA 1HI6B 5ETUA 2KZWA 5FGSA 5LWYL 4MQ7A 1OGAA 4JCLA 4Z0XB 1ZVSB 4JO4L 4N0CD 3WLWD 1ZT1B 4CL7A 3OAUL 1AGEB 15C8L 1U95A 2Z8RA 4NWUH 1ITBB 1FFNA 3MGTB 5ESAB 1NAML 3FMGL 4C58B 1V5JA 2EE9A 3CJJA 4RRPA 1NCWH 5KW9L 2OXGA 3GSXB 5DT1L 5BVPL 3BX7C 2PKDA 2W38A 3RVTD 2WP3O 1MELA 1QBLH 3BKMH 2NXZC 2MPAH 4I4WA 4JQXC 2GQHA 1DBKL 1MFCH 2DWEB 1I75A 3CVIL 1CXFA 4RAVA 1E27B 1SVCP 2LU3A 5INCB 4GXUM 4XBGA 3ZTJH 3DX8B 2Y7QB 1TVDA 5DHYA 3U0TA 1AKJB 5T3XL 4M3KB 2BC4A 5FM5M 4HH8A 4KV5F 5JORB 3H3PL 5F7HA 2NY6B 3TLRA 5LXGH 2BCKA 4MWFA 1MLBB 5HHQB 2IPKB 1XH3A 3HMWH 3JV6A 5L2JB 1TCRA 2ERJB 4G8EA 4P3DA 4WHDA 1HKLL 4JFEB 1U8JB 1A7NL 5GGTH 5D1QA 3QG7H 4J1UA 4MD4B 4GOSA 2JE8A 1RUAH 4LLWA 4AL8L 5D1XB 4BFIA 5CD3B 5HI5C 4CGTA 2YSSB 4OSUL 3OKLB 1IQWL 4QCIA 3EW3B 3P0GB 4HWZB 3VJ6A 5JIHA 5KAQG 3VFVB 4MJ4A 4HKZA 3FN3A 5HHOA 4TUJB 5DFWH 3RU8H 1J8HE 3IAQA 1K5NA 3WFDH 1K4CB 4ZOCA 2EKSB 5EOTB 3S96A 1AO7D 2Z8VC 4QXUL 4XHQA 3VRJB 4X7CC 5ESVB 1ZA3A 4JFYB 5CEXB 3MUY1 4UOW0 5D72L 4Y7MA 3U6RB 2QQKL 2ZUXA 3QDGE 4CDHA 2DAVA 3BSZL 1MUJB 5ELIA 4IHOA 4Y5XA 4GKZA 5C08A 2VLRE 1BHGA 5DD0H 5F1IB 1B0RB 2FR4A 1IGJA 1W8NA 2OR9L 2W0KA 1PEZA 3NZ8A 2DIBA 5C2BH 4LGPB 5C0FB 4ZQKA 1HHHA 3BI9X 3NBNA 1A6PA 5EOCL 3TJHD 2DQJL 2J88L 2AXGB 3K1DA 4NC2B 4A6YL 5J0BA 1Z0NA 4Y1AA 5JHDD 1X6NA 3L3HB 1YY9D 4KKAD 1G7IA 5EUKB 5JW4M 1RK0A 5IFJA 2OTUA 1S9XB 3IFLH 3MNVB 4L8BA 4EQ2A 4V1DE 3GUTB 3FB5B 1IAKA 2AK1L 1XCQA 2VXUH 2WV3A 4LDOB 2BHUA 2Y6SD 1BM3H 4I18A 4QRUA 3F7PC 2QKIB 4GRWH 2CRZA 3ARDB 4YZFF 5DS8A 3EFFB 1RZ7H 1C1EL 4M7KH 2JK5A 1UZ8A 3TJEL 1I7RB 4CADA 4PRPD 2BMKA 4PJCA 4Q0XL 2EE2A 3MZGB 2DLEA 2LFGA 4N90E 2Q8AL 1JZ2A 2IGFL 5AYUL 3LQAL 3I85A 5F7MC 1NAMB 2X5PA 3VXSB 2CLVB 4DTGH 3D0VB 4LASH 5F9JB 4K94C 1R6VA 1Q9LA 3AMKA 4TSAL 1JF6A 1UFUA 3SJVB 1LNUA 4O00A 3QXDB 3BZEB 3K3QA 2EH7L 2AV1A 5EBGA 1B0GA 1AD0B 4ELMB 2J4WL 4CRPA 1EO8L 4MSWB 4APQA 4NC1C 3UTTB 1A1OA 4MDJA 3GBNH 1YQ2A 1NMBH 4JREC 3U1SH 4WW1B 2EDQA 5I1LB 4JZJC 5DJAB 4RAUB 4PGEB 4WENB 1C08B 3GGWB 3BD5A 4H20H 4HUXB 4GKSA 3QDMD 3PABB 2HT3D 3C9NB 5HI4C 3IETB 4MLIA 1MFBH 4W4OA 1T89C 4PJ7A 4PLJD 4FQXD 4LQ1A 4MHHI 1I1AC 1UJ3A 1VA9A 4I5BA 4KJYB 3RKPA 4XCEA 4K2UL 3VXOA 1U58A 1KTLB 1YMMB 1CZ8L 3AB0C 5DO2C 1A5FL 2YUZA 4Y19B 4OB5L 4K23H 4NQXB 1ZAGA 3RGVA 1DL7H 5IG7B 4BYHA 1A2YB 2B4CL 2RJMA 2P7TB 3RY5A 1S7SB 1XAUA 5L8LB 3CFEA 3QH3B 3V4PH 4Q6IC 1CFQB 3TESA 2H26B 1FZOA 1NDMA 4L9LB 1CN4A 1KCVL 1OAUL 3GHBL 3K2UH 4IIQB 3TO2A 1XR9A 4QRTB 3ULVF 4ONOA 1FBIH 4NRZB 3MPCA 3RA7L 2AS5M 1JF5A 4NHCL 4B5EA 1VEOA 1P1ZA 5BVJA 5KAQF 1CDBA 4G6FB 4IRJA 2PO6D 1YQVH 3NGBC 4LVNC 4AIXA 4WI6A 2H1PL 2DL2A 2VC2H 5C0BE 1I8MA 4A6YB 3ARGB 5LCVH 4Z7WF 1KFAL 3HUJF 2CMRH 4ZG1A 2W07A 5HDBE 3THML 5FHBL 4TNVK 2XFXB 3B2UC 3I9GL 3ZE0E 2XTLA 5JXAH 2DQEL 2X10A 2BHZA 5MEOA 5HHME 4WU5A 1K3IA 4JHWH 1H8SA 4ACPA 4O4YH 5ADPH 2X1OA 4G7VL 3SCMC 5EA0L 4U1KA 5F3BA 3AC0A 4RBPH 5TDNA 5I6XC 2C3VA 2F58L 3QUML 4MQXD 3CH8A 1IGTA 3FO9B 5IV2A 2R15A 4YC2B 5BMFH 5D2NB 4Z7VA 5KVFH 4M7LH 4KKLD 5F1KC 5K9QI 2JJTC 4XRCB 4YDVB 5F6HI 2NQCA 4XI5D 4ODUB 2XG5A 4GAGL 4HT1L 5FYKH 3MNWA 3PUCA 2PR4L 2Z4QA 4HDIA 2VR4A 2BY1A 2X7LA 5MEND 3CH1B 3LKPA 2DMKA 3GM0A 4H25B 1M4KA 4X83A 1MHPH 3X3GL 1NEZG 3K1KC 4X6CB 1JNJA 5FYJH 3WMSA 5IHUH 4CW1B 2CDFA 1A22B 2YOCA 4HCRA 3E8UH 5ITFA 1RMFL 4JM2F 3WE6B 5BV7C 1S7XB 2HH0H 2XN9D 4AEEA 2NYYC 3MRLA 4UIKH 1V7ML 3G5VB 3RX7A 4WFFE 4AT6B 2WM0A 4WW2F 5I73C 3B2VH 5I30L 4JRXD 4HIHB 4PJIF 3GSWB 1JHKH 3C8KA 1EHLL 4KWUA 3KPOB 4G8GD 1N59B 4NRXA 1G9NC 3WIIH 1NL0L 5K93A 1EFXB 4J12A 3C60B 2VE6B 3PWPD 3UJIL 4E5XB 3O9WC 1DEEA 3DXAE 4KAQH 4R4BB 4X6DB 4OCRL 5F97E 2PETA 4EDXB 1QVOA 3BQUC 2Q8BH 4M7JH 2WAHA 1BOGB 32C2A 4TVPE 5I2IB 2EYRA 2D7OA 4LLDA 5HYJD 1R5WA 4Z7QE 3BW9A 5DZNA 5BW7C 5IW1B 4JFPA 4GQ9H 5F7UA 1G0XA 3FQNB 1FLRH 4HEPG 1KNOB 3IS0X 1NCBL 1A1MB 2YUVA 3QIUD 1EJOL 4S1DC 2IAMB 2Y36H 4KVNH 2P4AB 4FFYL 1WZ1L 5B8CC 1BBJB 5JW5A 2IEPA 4Q2ZA 2XWJA 5DJ2A 5T33H 2FRGP 2VDML 4PR5A 1YEFL 2X4RB 4XAKD 2HRPL 1UM5H 5L2KE 3EOBA 2C1OA 2CH8A 3T2NL 1NUGA 1BLNB 4KI5D 5IEKB 2ICWI 4Q97A 4GXVL 2PN5A 4X99B 4YX2H 2OMNA 4GMSH 1V7NL 1HSBA 3E6HA 1A6TB 3D18A 2H45A 3MJ8A 5AZEH 3HG1D 4PJ5B 4EDWH 1G7QA 4YFEA 1YUHA 4N5ED 1E4WL 2BFVL 3DV4B 4TN9A 4LSTH 5FUZH 4XGZA 3ZHKA 5I66B 3KYMA 4M7ZC 3O0RH 1N5AA 4XP4L 1J1XH 4P2RB 1F4YL 1VFBA 3X14B 5C0AB 4F7CB 3MV11 1R3LB 5DD1H 3QEUB 2E7LC 3T3ME 2WQ8A 4EN3B 1P4BH 1T7ZA 4PJDA 4BSWB 4Z8FH 4PIRF 5MP6H 5E8NB 1G0YR 4XP6H 3FT2A 2NNAA 3D3VD 1A6UH 1WITA 1HCVA 3BXNA 4IOIB 1LE9B 3DROA 1D5XA 5KSUA 1M1SA 2NZ9D 4HZLA 5SWZE 1YJDL 4GAFB 1CFBA 4D8PA 3QA3A 4QRPE 3A67H 2OM5A 1GIGL 4JFQA 4X6BA 4S1QL 1G9MC 4EOWH 4WV1A 4MGXA 3QUMB 4C56D 4P9HL 1FL6B 3DWTA 3O3DA 3MRRA 4M9PA 3GRWH 2Z31D 5I1CH 2NY4D 1SJEB 1J8KA 2O61A 1B2WL 3OX8B 1NGYB 3MRPA 4KUCD 2Y23A 3EDFA 1KB5H 5DD3L 2GJZB 4GW4A 3ROOA 3WJJC 3SKUD 5IB3B 4U6VL 4UT9H 3UZVB 5HPMB 1P4LA 2XACC 1HZHH 2JELL 5BZDB 5DUML 2P48B 5IUSA 4TUOA 1IKNC 1JUFB 1KTKE 3S36L 2XQYG 5JA9A 1OAXL 5F88B 1OGAE 3TIEA 2V5YA 3Q6GH 4FHBD 3OXSB 3ZDZE 1I3VA 1FZJB 3ALPA 1QBML 3FCTB 2XOTA 5F7FA 3IXTB 4OLXH 2EDTA 2YHGA 4WUKH 1WWBX 5K9OB 4XNYH 2VMFA 2R23B 1TVHB 3C5ZB 5GGRA 3LS4L 1Y6KR 5FGBC 5J57B 4WO4C 1D9KC 2N7BA 5T1KD 3T65A 4M6NL 4M1DH 1X5YA 2BVPA 4OZFA 1IM3B 2YUWA 1A6WL 3WUWG 1KG0B 4GG6F 2R0KH 5AG8A 4M4PA 2OJEB 3TBWA 3KYOB 3PF2A 1JMZA 4LFHG 3MOAL 5E95B 1DQLH 4PJ9C 4U6XA 1LO0L 3NCBB 1TENA 1AKJD 4WWKB 1CE6A 1ZGLA 4FQIL 2VXSL 1S8DA 3SGEH 4FFZL 5I1AA 5IQ7L 2CKNA 1CD1A 2NY6D 1E4XI 2XN9A 4HUWB 5IW6B 4A2MA 4WTZA 5L9DL 3ALXA 1KCRH 2FJGA 4MLSA 3TBYA 3H42L 5ERWB 4JFED 4YDJA 2F5BH 5IBTL 1XF5A 1BPVA 1P9MA 5K9JH 2HFEA 5D1XD 3DMMA 4LVHB 2FB4H 4G8FA 4M5ZH 5D2LA 3FQRB 3IF1A 1BD2B 4JFZL 2AJZB 4NN5B 4QRSB 3GSOA 3TIDB 4ZUSB 3QUXB 1S7WB 1IQDA 3QHZH 2IMMA 3LSOB 1ACYH 1CLOH 5B39B 4JPKH 3SDCD 1ES0B 3PV7A 2A77L 4KROB 2XKUA 4TYUA 5HHOE 3P4MB 2DQTL 1QR1B 1BFVL 5JR1H 3LKQB 3GBMH 3FHQA 3MJ9A 2WBWB 3QIUA 2WINA 3BGAA 4M8VA 3TPUB 5H35B 1H3VA 3QEQA 4RZCA 43C9B 1KCSH 3ULUD 4UILL 1RURH 1ZWIA 4EUPG 2FX7L 4Z18A 4S1SH 5C08E 4RISL 4OD3L 4NQEE 2VDNL 2XA8H 1F58L 4I3SH 3K8MA 4HH9A 4JG1H 5EIIB 1FYTA 3UTPE 4LCIL 4OLZH 4M8QA 3QIBC 5DZLA 4HPOH 1AIFB 2P24B 4O2EA 3DETC 1TTFA 4OZ4B 5J11B 4P23B 2JIXA 3I6KA 4Y1AE 3VI4F 2AKRB 3B9EA 4JM4H 4DN4H 1G7JA 5FO9A 2C3XA 3MRFA 3FQXA 3NVQA 1YNTB 1IC5L 3IFNL 1PDKA 1BFOB 1KIRA 3ARDD 1AJ7H 3DVGA 1MHEA 4K3DH 4OZGF 5KN5A 2OYPA 2M8XA 1DBJL 4GRWF 5FXCH 5IROC 1OSZB 2MSPA 3VDBA 2FL5B 3ESUF 1GOGA 3ZE1F 3MA7B 1TJGH 1A7QH 1UVQB 4PJCE 1LP9B 5FM4A 1MNUH 1OCWH 1KSRA 2R1WB 1CGSH 4OCXL 1Y0LB 1J05B 3NMEA 4OCYL 4YFDB 2B39A 3VXSD 5JO5A 4J3VA 3JV0A 1F3DH 1LHZA 3SJVD 2C1PB 4H8WL 2F8OA 3BN3B 5HYEA 4X8XA 5BJTB 3GNMH 3UTZA 5IMLA 4P57B 4BH8A 1UWGH 1P84J 4NM8H 5B38B 2C4XA 4U6HB 2ORBH 2BNRA 3FFCD 3UTTD 5CD5C 1L0YA 3HFML 3HNTH 3LKOA 2AVGA 1C5CL 3GI9H 5DI8A 5DD6A 3CK0L 4K8RH 2E6JA 2Z8SA 2CRIA 2VO5A 2Y25A 4NUJB 2A2QT 3ARXA 2FD6H 4LIQH 4ODTL 5F3HA 2AJ3B 3UTSB 4LSVL 1WZKA 1VACA 4NQSB 5MERB 4R0LC 3RIAF 4X4YB 4BELD 1KCKA 4M1GH 4Z7OF 3KPSA 3I02B 3O2VH 1L7TH 2WIMA 3G6JB 2YZ8A 1SY6H 2B1AL 1ADQL 2NLJA 5HDQL 1RK1A 4PJ7E 2CLZB 4HK3J 1UENA 2J7LA 4OZIB 1KN2H 3D25B 1G6RH 2YKLL 5T1KA 3OB8A 3FONA 5GGSA 1YN7B 4F7EB 4TOYH 2GKIA 3HAEG 4XCCL 4PY7B 4Y19D 4C57C 2R1YB 3KXFB 4Y4HA 3M8OH 2V7NA 1MHHB 1KPVB 4IRSB 4HS6A 3U4BH 3H9SA 3QDJA 4PLKC 4XPFL 3C2AH 2HWZH 1JNHA 3S6CA 3HE7B 1ZHLB 2ZCKH 5L7XL 1HXMB 4KZDL 5C7XH 4MCYA 1RV6X 5DZOA 5KSBB 1IL1A 3VXUA 1HNFA 4X9FA 3GSVB 1QZ1A 3MLZH 1D5MA 1RUML 2O5YL 1FO0B 5GS1B 5HYSG 3MV8B 1HSAB 1U0QA 4GS7B 2DBLH 2YPKB 1EVUA 2YD1A 4LNRA 3MLXL 5CSZB 3OZ9H 3L5JA 3DRTA 3FTGA 4BSVB 5IQ9B 4JFOA 2CR3A 2OP4H 2BVUA 4G6FD 1AH1A 3CPLB 4LPUA 4MNGB 3RBSA 5DJCA 4CU6A 4HBCL 4JB9L 4GRMB 3PWUA 3BRDA 3M45A 2VLLB 3P0VH 4ZTPL 4JVUA 5D7JC 2V2WB 1UXWB 4BM7A 3ARGD 4N1CA 2A83A 2DDQL 1BQHG 1G7MB 2I07A 3S98A 4QOKB 5EFIA 2EDWA 1MPAL 1HILA 3GMLB 4TPRH 5D8JH 3ULVC 4WFGE 3PWLA 3T2QA 5E8EA 3SDCA 3QQ4B 1KIUA 1WIPA 3D2UB 2IBZX 3SE9L 1KENL 3G04A 3CLEL 1EH9A 5LAXA 2FJHA 4L3CA 5HVWA 3RIAK 4JZOA 1AO7E 1G7LB 3EYQC 4UDTA 5IMMA 5D5MB 2IBGA 1NUDA 1S7QA 1JFQH 5C9JB 3Q48A 3EOAA 3NIDE 2MQ0A 2V9QA 3BZFB 2ZCHH 3VFPA 1PKOA 1F97A 4WNQA 3R8BB 2R4SH 1YN6B 4R97C 2J6EL 3EO0B 2UV3A 1HQRB 1F6LL 4OCSL 3PWVA 4MAUL 1F4XL 1N26A 4U7SA 1C8PA 4PS4L 4UT7H 4Z7VE 4AEHL 1FVCA 1ZOXA 3BT2H 4AQ1B 5I8OH 1I9EA 3GIZH 1MCDA 1BF8A 2V7HA 1LEGA 1FVDB 3BGFC 5ACMA 3QCVH 3DX6B 2ZOKB 2DD8L 1NGQH 1CXHA 1ZLUK 3GO1L 3EO9H 3B6SB 1PKQB 4X9GA 1MVUA 5A3ID 3QFJB 4RNRA 1CD0A 3T65B 2CDEB 4NJAH 4OFPA 2H32A 3HKFA 4WI9A 2BVQB 3MBXL 5C07B 1MIMH 5IJVA 1NCCH 3WCYA 4HIEA 2ARJB 5HYQB 2H3NB 1FH5L 2AJYL 4D0CA 2LAAA 4XNQA 5F21B 4YHMH 3VGAB 3MCLL 5SX5H 3D6GA 1MHCB 1EFXD 5I9QC 1INEL 1BAFL 3C60D 1S9YB 1ORSB 4Z7UF 1YEHH 1MOEA 1JHLL 4FXKA 3PP4H 2XQBH 4MA7H 2PXYB 3CXDH 1FFQA 1I9JL 3QXTA 2DQGL 1BQLH 4O2CB 3B9KB 2R0ZL 4WW2C 1D5BA 1NUFA 4M6AA 2J3SA 4RFNB 4NDMA 1AGBB 3I6LE 3KDMA 4X80H 4R4ND 2XV6B 3V7AG 4HWUA 5DJZB 2IAMD 3FFCA 3ARYA 4NKDA 2FGZA 1R3KA 5CKGA 4G9FA 4YLQT 3CLFL 5F9OL 7FABH 3VFNB 2BNQA 2GAZB 4RBPK 4JN2A 2EDJA 3ZL4H 3VXQB 2R4RL 5D7IA 1KF9B 1O5DT 4MCZB 5DQJB 3PNWB 4JN1L 4PJ5D 3P30L 4KMLB 1K8IA 1ZTXH 2O5ZL 4MA8L 2AW2A 3ABZA 5FK9B 2YPVL 1CGYA 1CIUA 3E1F1 5DRNA 1QSZA 5EU5A 1MCWM 1Z9SA 3KYNA 4PY8I 3VGGA 4P2RD 4QNPE 3IFPB 5ID1A 5GS0C 2ADFH 4GFTB 5C0AD 4HFWB 5KANG 1SJVA 4LAQL 4R96B 1NFKA 2FSEB 3OF6D 4EN3D 3K74B 1N64L 1RZKH 5IIEB 5EN2B 3V5HA 2E9IA 2VL5A 4Y5YB 2A1WL 4PJDE 1C5DB 1QFWL 5IWLC 5B3NA 5MEPA 3IDIB 1T66C 3IXAB 3GI8L 4S1RH 4BZYA 1U92A 3TA3C 1XGRB 1WBYA 3OQ3B 4R90L 2GUOB 4H88H 4GAJH 1SM3L 4JE4B 3KNBB 4U31A 1NCAH 4JKPL 2Q7YB 4WGVB 5IT2L 3V52H 1IGML 1FIEA 3BH9A 3H9ZA 3W5MA 3IRZA 4OLYL 5JDSA 1UKSA 5C6TL 5C9KA 5KVGH 4JY6A 1A7RL 1UWXK 1N7ML 4FQQA 5FCUL 3T2OA 1KBGH 4CNIB 4YXHH 3VXNA 1ETZB 3KJ6L 3F7QA 5CZVL 4D2NA 1MWAL 3LHPH 3OAZH 2NY5H 1F6AA 1HINL 1NBZA 5EO0B 4B50A 2AXFA 1NGXB 5CBAB 3MTRA 4DK6A 1NGWB 3MLTA 2EKJA 1FHGA 4P59L 3KAAA 3MV01 5DA0B 1R24B 4J3TA 5DDHB 3NPZB 5ACZA 2AEQL 5H37H 2VLJB 1N0XL 4PJGB 5CEYB 1H5BA 3RJDA 3LKNA 4JAMA 1HHKB 1UYWL 2VXTL 3O3EA 4OLWL 4WJ5B 4LSQL 4NNYA 1GOFA 2ADIB 4OZHF 4ORGA 3QI9A 4OFYA 3L3IB 1U8OA 2KH2B 2J8UA 1VPOH 1LD9B 3QDHA 2DM7A 2QQLH 1KULA 2NZIA 3RTQC 3C5ZD 3SGDH 2Y07H 5CUSH 2FEEL 3KPPA 3SDXF 4KRNA 3NTCH 1EGJH 3DGGA 1CD9B 5T5FH 2BVYA 5TE7H 1ZGLM 4D0DB 4FQ2H 3ARTA 4NT6A 3TH2T 3JV4B 3DO7A 1TQCB 4G8IA 2IALB 1F13A 4QTIH 1VSCA 4U2YA 1TTUA 3BGMA 4ZUTB 1GRWA 2ATKB 5DMGC 1PZ5B 3CFCH 2X1WL 4HS8L 5I8CB 1LEIB 4H1LB 4P4KB 3D87B 1LK2B 3ULUH 4MMXC 1X7QA 4WWKD 2HKHH 3RNQA 2YMXH 4O2FB 3EIFA 5JW4Q 4RGOL 3TO4B 1IAOB 4NOFA 1N5YL 3JWDL 3CU7A 5CAYB 2FECL 1AI1H 5FUCE 4M9OA 1CFSA 3RY6C 4ZSOA 3MLYL 5FGRA 5KTEH 2XN9E 4PJBB 1CDCA 2VUYA 3MRIB 4MA3A 2NW2B 2WMPA 2DICA 2XKNB 4TULH 4YHPA 1LO3L 2BSTA 4XT1C 3SPVA 3LEVL 3IU4H 3BMVA 1K9TA 3D9AL 4AIOA 4YJZL 3TP4A 1S78D 3DVIA 1XZ0A 2VDOL 3VRLF 4AG4L 4LBEA 2QR0A 1BD2D 4MDIA 4XXCC 4FOMA 5D2LE 3QUXD 1X44A 3PWPE 4MXVE 1GZQA 4YUEL 1UKQA 4OD1L 3G6AA 2FCBA 3TBTA 3CU1A 1I4FB 4KROD 1ND0A 5CP3H 2VZ1A 4ZOAA 2KKQA 1U2CA 5DRZA 5E6IA 3S37H 4JO4H 1WC7B 3SGDI 3T0VA 1DP0A 1FFPB 2XWBB 1EV2E 1MJUL 3OAUH 3GMNB 4PPTA 15C8H 4XVSL 4AYFA 4YHKL 3WS6A 1DZBA 1NAMH 3MLRL 4LSPL 1J5OL 3MRMA 1WISA 3QEQE 3HPJA 3D85B 5KW9H 5DT1H 1GGTA 2IBZY 5BVPH 1PYWB 5DD5L 3HE6A 1HH9B 1K8DA 2E27L 2EIDA 2D31B 4KI5E 1E0OB 4P4RA 2MKWA 4X4ZA 4W81A 1DBKH 1FYTE 1SHMA 3CVIH 3G6DL 3CFDA 3LQMA 4UQ2A 2OTWA 4GT7A 4P23D 2B1HL 1HXYA 3RUGB 2A73B 1MWAB 2ZKHL 1MJJB 4R7NB 1BVKA 1RULL 5DK2B 3PGDA 5T3XH 2BVTA 2ZG1A 3KLAB 1U3JA 3H3PH 2AK4A 3QUYB 3K4ZA 1T22B 4Z6AT 2CPCA 9CGTA 1JL8A 1U2HA 5E94B 4K9EL 3RPIB 3BKJH 3FQWB 4LKXA 3FB7B 1F4WL 4D9QD 1HKLH 1A7NH 3LD8B 2BVOA 3H0TA 1XCTB 4JY4B 2M1KA 3S37X 4OD2B 1NFDF 3U9UB 4AL8H 1S5HA 3MRQB 1YNLL 4LCUA 5EOQL 4OSUH 4PLOB 1IQWH 3V6OA 3EYFA 2IFFL 4FQJL 3O4LB 3OG6B 3CDGB 1B4JL 2EIBA 1QA9A 3UPCA 3KPLB 4PJHA 2ITCB 3CFJB 1DFBL 1B90A 3ZKXC 5HXMA 4QXUH 5T3ZE 3UZEA 2DTML 2V2TA 1U8MB 3MSPA 3FHAA 4C4KO 1U3HA 4ZXBB 5D72H 4HUNB 2QQKH 2A6IB 2ZG3A 3BSZH 4F3FA 3CDFA 1HYSD 5IR1B 2BNRE 5DFVC 4U6YA 3V5DA 4O5LL 4KRLB 2OR9H 2X4UB 5C6PB 5DC0A 4OTXL 4KKCC 4ONGL 3GM8A 4HXAL 3NZHL 5EOCH 3CFBB 2DQJH 2J88H 5E56A 3IDXL 3VXTB 2I60L 4YH6A 4EBQL 1VFAB 4A6YH 1QLEL 4ISVB 5GRZA 3RDTB 5GSRB 5GIRB 4HWBL 1QD0A 4L8SA 3FO0L 3KPSE 5A16A 2AK1H 3O6ML 3Q3GB 4FFVD 3L7FA 5JDJA 5DJ0B 5E8OA 5FUOL 1I1YB 4YDKL 3BRFA 4FZEL 3T09A 4FZ8L 1CICC 3KXFD 3VGDA 1F4HA 4IRSD 2XTJC 3BWUC 1U8HA 3L7EA 2H41A 4RMVA 3HE7D 4ZUVA 1C1EH 3PWNA 3K4DA 4E42B 3EGSA 4L3EB 2AP2A 3H9SE 3QDJE 3TJEH 5GZND 5IGXL 2B5IC 4Q0XH 2NTFB 4Z95L 3I3DA 4JQVC 3P9WB 4N8VB 2X4QA 2YD5A 2Q8AH 3VXUE 2IGFH 1A9EB 5AYUH 1ITCA 3LQAH 5E6ZA 5F7DA 5CWSB 4QY8B 5LKNA 3P40A 1A6AA 3RVWC 1OTTD 3P3YA 1MCHA 4NPYA 4TSAH 4C54A 2ZUQC 4N9GA 2WQRA 2YWYA 3DECA 2OSLB 1QO3A 4YBQC 3UBXA 1DDHB 3NFNA 4ZFOL 3QHTC 1NMCB 3OJDB 3WO4B 1MCOL 5FHAL 1FYHB 5ID0B 3FO1B 3W11D 2J4WH 1FNGA 1EO8H 4BZ1L 4JKMA 1KTDA 3IDNA 4S0TD 3DOSA 3QPXL 5IVXF 2HAZA 2JCCB 4LLMB 4QOKD 4K7FA 4NO0A 1NC2A 3S5LB 1T1XA 5C8JA 4KJPC 1BZ9A 1IGFL 2EDOA 1KCLA 2Z92B 3VFSB 2GT9B 4CU8A 5BO1L 4DN3L 3V6FB 1KLUB 2KPNA 3HPLB 1FG2B 1OW0A 1A6VL 3DHJA 4P48A 2GK0A 4UIMB 3M17A 3UXFA 4K2UH 2H9GB 1UADC 1CZ8H 3QP3A 5DMIH 1A5FH 3B3IA 1JWUA 2DQFB 4OB5H 5FYLE 4MD0A 1M7DB 4RX4A 2N7AA 4GW1A 3PJSB 3VWKB 3L3OA 2VLKA 2ZJSL 4PRNB 5IOPB 3C8HA 3RVVC 3PDOB 1RAMA 3I3BA 4HV8A 5D1QC 3H9HA 5CJBA 2LVEA 1KCVH 4Y5VB 5AWNH 1OAUH 2F15A 5I74B 3GHBH 3DBXA 3W82A 4L8DB 3QFJD 1ZANL 3RWEA 2A6DB 4F8TA 4PB0L 1WBZB 1GC1C 3RA7H 4NHCH 5C07D 5DTFA 5I1DA 5E5MB 3P4LA 1ORQA 3BD3A 1JK8A 4Y8DC 2IJ0C 5B3JE 3CVHL 5DWUL 2AQ2A 3DV6B 3RP1A 2H1PH 3KWWB 1T0MB 1QNZH 1KFAH 3KS0H 3GSUB 4YDLC 4LF3A 3VFUB 4Y5XC 5LVEA 3TZVB 3MRDA 4FNLL 1R5VB 3THMH 5FHBH 3B5GA 3TCXA 5IB5A 3B9KD 2R9HC 1MRDL 3PV6B 3I9GH 2MKLC 2DQEH 3DNKA 5H8DA 1S9WB 1TNNA 5ICZA 1AD9B 1KJMB 1X6LA 4G7VH 1FDLL 5EA0H 3QO1B 4ODWB 3ILPA 3NA4A 3H7BB 1DLHB 4OV6F 3MROA 3L3JA 2ZSWA 4KJQC 3GMRA 3MFFB 2QADB 3VGBA 2F58H 3QUMH 3EAKA 2ADGB 3FFCE 4ZAKC 5DRXA 3OKOA 1JBJA 5FB8B 2GSIB 2IMNA 2Y4SA 4G9FE 2DYPB 4OBRA 3F7VB 3O6KL 4Y2DC 4I18C 5E6YA 2BNQE 4NNXB 3QIWA 1BMGA 4QRRB 2LTQC 4QHNB 1F42A 4GAGH 4HT1H 5IESL 1S3KL 5D7IE 3BPCA 2PR4H 1QRNB 4RDQF 1CG9B 4HKXA 1B4RA 4I48B 2X70B 4J4PC 1KEGL 2XI9A 4R26L 4ZFOB 3X3GH 3BUYA 4KUCF 4HHAA 4DZBB 5A43C 1Q94A 2EIZA 4NKIL 2CGRL 1RMFH 4LCCA 1E28B 4U33A 3T0EB 2D7QA 1FAIL 2IF7A 3MYJA 1J0YA 2ZUVA 1V7MH 2GK2A 1MCJA 5DVMA 5GZOD 3MLUL 4I9WE 2X05A 4Z7WB 4KKBC 1SYSA 2AJSL 3HUJB 3PL6B 5I30H 2G2RB 3SDAA 3JVGC 4AEFA 2XNAA 5ICXB 3VE0B 1YEEL 1FZMA 1BP3B 5F96L 1NL0H 4G43A 3O81A 4U2ZA 5ENWA 5CCKL 3OXRB 3CCHB 5SX4I 4APQC 2FHCA 4BFBD 3UJIH 3SQOL 1I8LA 1KIQB 3GSRB 4OCRH 3U7YL 1YECL 5J12C 2NXYC 5J1SC 2WUBL 5J6GB 1IGIL 4EZMA 1M05A 3W0WB 2HVKA 1CGXA 2YA1A 3N0PB 3EO1A 1PW3A 5BXFB 3BEVB 2B2XL 2CUHA 4ELKB 2OR7A 4Y4KB 3ZSSA 4N0CC 4NKOA 1ZT7B 1BQUA 1NCBH 3K81A 3RWJA 1CXKA 1EJOH 4FFYH 1WZ1H 1IZKA 3GZKA 4W4OC 5EBLA 3QNYB 2JB6B 1GH7A 2VDMH 5FO7A 1YEFH 2VAJA 1H8OA 3G5XA 2HRPH 3ARVA 5E00A 3RKDD 4MHHG 3T2NH 3IS1X 2F54B 4AQOA 1I85C 1CTOA 1DJSA 1KPUA 4GXVH 3RRQA 3RVTC 4X6FA 4XPTL 1V7NH 2PW2B 2VLJD 1ED3A 1S7TA 2NY0B 2UYLA 5BRZB 3QZWA 3RGVC 2YRLA 5L6YL 1E4WH 2BFVH 4BFEA 5CEZL 2ID5A 5L8JB 3S9DB 1LDPL 8FABB 5IB1B 1DCLA 4OF7A 4RGNE 4XP4H 1F4YH 3CVHB 4DGVL 5DEFA 2J8UE 1BZ7A 1JGLL 1T2XA 3O6FB 1BWWA 3QWRA 2BY2A 1OAQL 1M71B 1QSFB 1T5XA 2VIRB 3GBLA 4HUUB 1IC1A 4PRAB 3ZKND 3GJFB 5SWQA 4F7MA 5IM7A 1OP3K 4F58L 4UOW1 5HGHB 3D69A 2X4SA 4OCLC 1HDMB 4GJTB 4JZJA 4AH2B 2FYYB 1OB1A 3MFGB 1IEBA 2X4NB 5ABDE 3R8QA 3GMMA 4P4KD 4PJ8A 5J89A 4IRJC 4WUUB 3L3KB 4OAWA 2BOBB 3IDMB 3WIFA 1GIGH 3S88L 3TO4D 4S1QH 1Q72L 3ULUF 4XVJL 1JHTB 1T89A 4P9HH 4LL9A 4CVXB 1T0NA 3IKCA 5FV2A 1NBYA 4NQDA 2VZSA 4ZSOE 2KZ1B 1WT5A 2OX5A 5ANMA 5KSAB 4BKLA 1B2WH 2ZG2A 2VH5L 3KPQA 1ZV5A 2FBOJ 2WWKT 3GSNA 3LS5L 2EEDA 5DD3H 4RFOL 1T5WB 1D3CA 3FFDA 1HQ4B 4Q6IA 5F1OB 3EYOB 4KDVA 4WFEE 3TT3L 4U6VH 3OKDA 2EXWD 3IJYA 3V2AR 2JELH 4L1DA 3TN0B 5DUMH 3RL1A 2HMIC 4YBLC 1INDL 3S36H 3KJ4B 3FOMA 3TJHC 1J18A 3D0LA 3SDDA 5SV3A 3BWAB 3M07A 5KG9A 2DWDA 1NFIB 4RRPG 2MOVA 3UTQA 4E41A 1MLCB 1YY9C 3FN9A 1U41A 1QBMH 3BHBA 4CAGA 3W2DL 4B53A 4NC0B 2GY7B 2Y6SC 3D85D 4AEIL 5E4EB 3QUZA 4LP4A 4YGVA 4M6NH 1FL5B 4YXKL 1OP5H 4HLJA 1L0QA 4KRMB 43CAB 1T04A 3W5NA 3MRCA 2EIEA 4PJXB 1A6WH 3DRQA 1PGRB 1TJIL 4K3HA 3IJSB 2F9BT 3GMOB 3CUPA 3T08A 3MOAH 4ELMF 4R3SB 1LO0H 1IJ9A 3WKML 4DQOL 3QAZB 2VXSH 3U0PB 3SCMA 4FFZH 5IQ7H 3MRJA 4TRPL 3F7RA 2G9HA 3QISA 4ZDHA 3KLHC 4R9HA 2J5LB 5HHNB 5L9DH 2AK4E 1QFUL 1RVFL 3H42H 3ILQD 5EOCJ 1B3JA 1XGPA 5EZLB 1BX2B 1DVFB 3GSQB 2OK0L 5IBTH 3S36X 3QULB 1JPGA 4D0BB 1EBAA 4JFZH 3D39A 3GMQB 4OQTL 5DSCA 2P47B 5GRXG 3OR7B 1Z9OA 4EIGB 5GHWL 3O4LD 4LOUD 4RMTA 3V6OE 4YHLL 2A77H 3SO5A 3DYPA 3DARA 2DQTH 4O58L 1BFVH 2W65A 1A1NB 4G5ZL 2HT3C 4PJHE 4QHLB 5FV1L 2XZQL 4ZXBD 4LSUH 3WBDA 2APBA 1NEZB 2HP4A 5C6WH 2DLTA 4KZEL 3BVNB 4PLJC 2OL3L 3P9LB 4MNQA 4UILH 4Z78A 5ISZB 4Q6YA 2FX7H 3VXPA 4RISH 4OD3H 1N3NB 5GXBB 2VDNH 1F58H 3C6SB 1J1PL 1DANU 1XGTA 4H26A 4LCIH 1NPUA 2DLHA 5FA4B 1JPFB 3C87A 3U4EA 3AXLB 4X0KB 4OF8A 1AGCA 3BQUA 4HC1A 2R2BA 5FCSH 3RDTD 3QFDA 2A6JA 3EFDL 3ROLA 5C92A 5BW7A 1W0VB 4YWGL 1XF4A 3DX7B 1ZE3C 3RZCD 2GJ6B 1JV5A 5GGUB 3MMEA 5EO9A 1KJVB 1BREA 3QYCA 1S7UB 2X9XA 4BH7A 3VWJA 4WV1C 1IC5H 5F70A 4TUKL 5B8CA 3IFNH 3I2CL 1EEQA 4X5XB 3BP5A 5GRJL 4ZOBA 4ZFFA 4HK0A 1DBJH 5FA3B 5IF0B 3MR9A 4JJ5A 3ARQA 3RVUD 4L3ED 3UJTL 4IS6A 2PO6C 2FX9L 3FL7A 5A40E 3EDDA 4MD5B 3LQZA 4RGMB 3R06B 4X5WB 3QEHB 5C0JA 2CK0H 4BZ2L 5IEHA 3TCLA 4GG8B 4KH2A 4KPHL 5DQ9B 4OCXH 3HA0A 4U1LA 3V4PL 3OJ2C 4OCYH 4B0MM 4PJAB 4G80A 1VEMA 4H8WH 5DJ6A 4JFDA 5HHPB 3TBVA 3BE1L 2WP3T 4UNTA 1K4DB 1HK6A 4HUVB 2P5EA 3ARSA 4JO1L 4LHUA 2ZOLB 4XMPL 4V2BA 1T4KB 3NFPB 3HFMH 3HZYB 3RWIA 1BD2E 1C5CH 3CK0H 2MMXA 5F44A 4CDGC 3BYYA 1MH5B 5KS9B 4KKLC 3LRSA 3AU1A 4ODTH 5JHLL 2WBJB 4HJ0C 5EBWB 4LSVH 2YR3A 2ATPB 1RJYA 3HI6L 1MFDL 3BN9D 4ZYKA 3QNXA 2HYMA 1T03L 1P7QD 2XYCA 4WI8A 2FGWL 1O7VA 3K0WA 3ZE2F 4OZGB 2B1AH 1ADQH 3LB6D 5HDQH 3ES6B 1CIDA 3KS0J 4YR6A 1GHFL 2EYTA 3LKSA 1F00I 3F65A 2YKLH 5JIIA 4X6DF 5FUCC 3SHSA 3KPTA 5HGDA 1LE5A 2LV4A 4F9LA 1DBBL 1KJ2L 1XEDA 3WJJA 2YBRA 3WYRA 4XPFH 3VWKD 3B8YA 4FQHB 5L7XH 5IMOA 4KZDH 3MBEB 4UNUA 2K1MA 2DF3A 5AAMA 3Q1SH 2P8MA 4ZFZB 4HAGA 2VLKE 1J0IA 1Z9MA 1IKNA 3DMMC 2MWCA 1P7KA 1RUMH 2EYSA 1NCDL 3HZVA 2O5YH 1QKZL 1WWAX 2OL3B 4LP5A 4OT1L 3WL9B 3V79C 1IFHL 4NN6C 2VISA 4LCYA 5BV7L 2F5AL 3MLXH 4JREB 1FPTL 2FH6A 5TH2B 3VH8A 3WN5C 5E4IA 2HJKA 2EH8L 1D9KA 2Q86A 4HMEA 2HJLA 4D9QE 4ZUUA 3MRNB 4HBCH 4JB9H 3O3AB 2HH0L 4NN7B 2D2OA 2YEZA 3QIUC 4ZTPH 4Z5RA 1G9NL 1IAII 1FV1A 2X40A 5EUOA 4CUCA 2FJFA 2FZ3B 4MVBD 3TYGL 3TZVD 1HE7A 4PRIB 4JFFA 1T7VA 1MPAH 4NFBA 2VYRE 3FZUD 3DURA 5L0QB 1I1AB 2DBJA 1EPFA 2UZXB 2QBWA 4HC1L 4KI5C 1K6QL 3WUWB 4YXLL 4R6UA 4PGJA 3SE9H 3U36B 1KENH 1UCBL 5HGAB 3TH4T 3CLEH 3BP6A 3G5ZA 2VLME 5DR5L 2BSRA 4N5EC 1UB5B 2AQ1A 4FG6D 1JWSA 5TDOA 5D96C 2QADD 1JGUL 4JHBA 1Q9WB 4XC1L 4UOJA 5E1AA 5C0IB 1OAYL 3BP4A 3DYMA 2CIIB 3H3BC 4MMZC 2J6EH 3V4VL 4LLVA 4OCSH 2GTZA 4MAUH 2D9QB 3DHMA 1EAJA 1F4XH 1OTUD 3W39A 3DI3B 3WS3A 1HHIB 4QRRD 2Y36L 4PS4H 4AEHH 2DKUA 1DE4A 4HJJL 1QRND 4NSKA 5C0EA 4X7EC 1L7IL 1RUKL 1TFHA 4IBLT 5CILL 3NPSB 4OJFL 4TQEL 3LKRB 5I1EL 2DD8H 2P45B 3C5JA 4JLRB 2NZ9C 5DJYA 1FNAA 3MRGB 1RY7B 3GO1H 2BRRL 3P4OB 2C3WA 3RZCA 3QUKB 5DXWA 5CP7B 3X11B 3NGBB 3UZQA 1XGUB 2J8HA 2P8PB 3T0ED 2UWEB 4LDEB 4QXTB 4C83A 3IJHB 4ODVL 1H15B 3WXWL 5EDXA 1YPZA 3MBXH 3O0RL 3PL6D 3C8DA 1CR9L 5SWSA 3AY4C 4G6MH 1KXTB 4JDTL 1FH5H 1IBGL 2AJYH 5AEAA 2NY4C 1OSPL 2V5RA 1QSEA 5C0CB 3MCLH 5KVDL 1JRHL 3UEZA 1N8ZA 4AJ0A 3C5SB 1CU4L 3QWQB 1INEH 1BAFH 3OKNB 3QIBA 4EUPB 1W72L 1JHLH 5I0ZA 3NOIA 2XIDA 2X6MA 1I9JH 1G9ML 2DQGH 4ZO7A 5I6XB 3C6LA 3W0WD 2R0ZH 2HLFC 3EYVA 3WLBA 1Z3GL 4H1LH 3L3GB 2DJUA 1UGNA 2PYFB 2ITDB 3K7UA 1U8NA 3O2DA 4WDIA 3VD9A 3PHOB 1NH6A 1KJ2B 1QHOA 4P2OB 4Z77B 4PJFB 5TE6L 2DKSA 4X4MA 3GRWL 1EERB 5EC1B 3CLFH 5F9OH 5FF6B 1ZT4A 3MCG1 2GY5A 5DQDL 2RQ8A 3OKMB 2F54D 4NO3A 5FO8B 2R4RH 5A2FA 5DRWA 3QHFL 4QF1B 3REWA 2NY0D 4Y4HC 5BRZD 1Q38A 3L6FA 4JN1H 5BV7B 4XAWH 1YC8A 3KYAA 2V6HA 3P30H 3EYSL 2O5ZH 4MA8H 3IKKA 1BJMA 2IH1B 1P7QA 3BP7B 3CZFB 2YPVH 4X8JB 3EYUH 1QR4A 4N0UB 1U91B 1DUZA 3RWFB 4PP2B 4CKVX 4QHUA 3O6FD 1ZSDB 4LAQH 2R2CA 4HBQA 1QSFD 2NY6C 3U2SB 3OR6B 2EDHA 5EIVA 1N64H 3NH7L 3O9WB 4JR9L 3UX9B 2A1WH 5FKAA 3H6JA 3PQYB 2ERJC 2R2HB 4JRYB 5JXED 3EOTL 3VCLA 4P46A 4UDUA 1I7UB 4U1MA 3GI8H 1X9QA 1M7XA 2H8PB 3UC0L 4YHIB 4WUUD 3KHQA 5E8PA 2X4TB 4O9HL 3TNNA 3DUSA 4R90H 5D7LA 4FQPA 3HLAB 2HRLA 1JZ8A 1SM3H 3T3PF 4JFXA 1IAIM 1U93A 4R0LA 4JKPH 1A0QL 1MCFA 4HK3N 4Q74A 1HEZA 5DVLA 1I7TA 5IT2H 1IGMH 1X5KA 1CE1L 3KPRA 5IKCB 4OLYH 5E2JA 3WNPA 1KIPA 1WF5A 5C6TH 3SDCC 1A7RH 1BIIB 1N7MH 4QGTA 5FCUH 5BOZG 3H7LA 2PYEA 1RUPL 2R2EA 5CSBA 2EO9A 4NQDE 1VFOA 3DTXB 4X5LA 5J1AA 3LEXB 5KSAD 5CZVH 2YPLB 1MWAH 3NIDF 1MI5A 2K3TA 1HINH 1NSNL 1X4YA 5ANME 3WHXB 2DQIL 4P5KB 1N2RA 1X4ZA 3TVMB 3G08A 3T4AA 3ULUC 3F7YB 4U1JB 2D0GA 3REVB 3HAEB 4TSCL 4P59H 4L4VB 3W9EA 1JPSL 4M7ZB 1WCBA 1AR1D 4G6KL 3TN0D 2E7BA 2A74A 2FLBT 2AEQH 3UMTA 4XPBL 1E6OL 2WNGA 1U8LB 1UYWH 2V2XA 2VXTH 4OLWH 5DA4A 2FO4B 1HHJB 4LSQH 5DMYA 1CLOL 3P9MA 3FB8B 3L5HA 4P2QB 3OGCA 4E41E 3IU3A 4UU9B 5HYSB 4Y4FA 1QFWI 4OZFG 1LP9F 3WIHL 4LPYA 5AUMA 3MO1A 2R29L 1W72B 1T6WA 1VKXB 1WTLA 5LJYH 3X12A 5H94B 4MAYB 3LN4A 1F4AA 4DOHB 4EKXA 4JDVA 2YWZA 2P5WA 4O51B 4KJWD 3I75A 2CUMA 4HS8H 4ETQB 3PIQA 4KK5D 2VQ1B 1D7FA 3MV7B 1BQHB 1T1WA 4WTZG 1DBAL 3K2MC 4RGOH 2SEBA 1N5YH 3JWDH 4L8CB 3STBA 2W60A 3S34L 3MLYH 1YEJL 1P5UA 4OCNC 5IMKB 2E3VA 3S4SA 2QSCL 3PWJA 2P1YA 3FRUA 1PFCA 1EK3A 4CMMA 5K9KA 3PXJA 1MAMH 3LEVH 3D9AH 2VDOH 3BUTA 4AG4H 4XNMB 2PTTB 3G6JF 3GHEL 5CEZD 1CK0L 3T0XA 2H6PA 3QCTL 3D39E 4IOFD 4OZIF 4YUEH 4ZPTB 4NQTA 4OD1H 3VMPA 3PHSA 1J0JA 5C09B 3VW3L 3MRHA 4XCFL 4NO5B 4DZ8A 1PY4A 4RMRA 5EU6B 2Y5EA 4MB5A 4MJIA 3CSYA 4WO4B 4OLUL 1J8HA 3DUUB 1MJUH 1HN1A 3ARUA 1BVZA 4XVSH 4YHZL 1S7VB 3S8WA 3E6FA 5KSBF 4YHKH 4F57L 5AD0B 2XT1B 3MLRH 4LSPH 4NWTL 1J5OH 3V5KA 3HS0A 5ISZD 1TIUA 1XR8B 2Z35A 4MNQE 1JWMA 1OAKH 2NX5B 4PJ9B 5DD5H 3KPMB 4Q9QL 2E27H 5HI3D 3ULSA 4EI5B 5T1LA 4JM2A 1I3RB 4NQCA 3PHQB 3G6DH 4KTYA 1TQBC 3G5YA 2CDGB 4KQ3L 3NCEB 4WW2A 2B1HH 3MJ7A 3QNZA 2CLRA 1JZ7A 4Z9KB 1I8IB 4FTVA 4U1HA 4LIQL 4PJIA 2ZKHH 2IANB 4LLUA 2GJ6D 1RULH 3OAYK 4DVBA 2BJML 5FYKU 2WLZA 1RFDL 1VDGA 4HGWA 4GLRH 4NRYB 4K9EH 3ARBB 4I0PA 3ALWA 3CC5B 1MCIA 1F4WH 4PV8A 5GSVB 1KLGA 4YNYB 4XCYA 5D5MF 1EEZA 1TZIB 5EU3A 3C09C 1WFOA 2ZSVA 3MRKA 1JE6A 1YNLH 4YO0B 1K2DB 5EOQH 3ARGC 4H0GA 4AENB 1CVRA 2QJDA 1T3FA 5A2JH 2IFFH 3U48A 4FQJH 2CKBL 2AJXL 1B4JH 4PRBA 1AGFA 3B83A 4DCQA 3MLZL 1RHHA 1DFBH 2IH3A 4NQUA 5J6HB 2DTMH 4JFDE 4MZ2A 1H5BC 5ICYB 1CGWA 1TXKA 3AGVA 5BS0B 4F33B 3QI9C 3OZ9L 5JIKA 4H0HB 3V6ZB 1DQJB 4U1SB 1C12A 5BQ7B 4XH2B 4X7DC 4O5LH 1R3HA 1FL3B 1D6EA 4M02A 5D2NC 3GIVA 4I2XA 4OTXH 4I0KA 4ONGH 5GQBA 3MRBA 2G60L 3VGHA 1KT2A 2BSSB 3LQAC 2WBJD 3NZHH 1VCAA 4Y16B 4B41A 3VFMA 3IDXH 5EBMB 2I60H 1KN4L 4EBQH 1NCTA 3MXWL 4UTBL 2MHAB 1Z5LB 1TMCB 4L1HA 8CGTA 1QLEH 3IDYB 3VXMA 4OIAA 3P73B 3FT4A 3TYFB 3VFTA 1ZHBA 2I9LB 3ARFA 2A6KB 1DUYA 3FO0H 2X41A 3NIGF 2ZNXA 3O6MH 3U79A 1Q9KB 4JFHD 4PGBA 2QV2A 5FUOH 3CX5K 1NGZB 3T8XB 2AV7A 2XXCB 1U3YA 2AABL 2VDRL 1AQDB 5AZ2L 5A3IC 4YDKH 4FZEH 2Q6WB 4FZ8H 1T21A 4M6ML 3ZDYF 1YEIL 4D9RD 4M43L 3WNLA 1T0PB 5JNYA 2CIKB 2NW3B 4X98A 2G5RA 3MBED 4TTDC 1T1YA 3SKMB 4W68A 2IQAB 5HDLA 5IGXH 1QQDB 4Z95H 4XHJD 2AGJL 2ESVB 2RFXB 4KGJA 1IVLA 4GUPA 4L29B 1WWCA 4M7LT 2IQ9L 4P5TB 3WFHA 5EO1A 4M1CC 3ETBF 4XWOC 4QEGA 2DQCH 1UM4L 2D4FA 3OB0K 5K33A 4HAFA 3MUZ1 4XVUD 5A2LH 4LVOC 3L5IA 4OKVA 1RZJC 25C8L 1VADB 4R4NC 5DUBA 1MCOH 5FHAH 1I8KB 1Q9OA 4K71B 2B4CC 4BZ1H 1A6ZA 3BEWB 1FCCA 4OM0L 3AM8A 1A4JA 4V2CB 3QPXH 4HX1A 5CHNB 4PRID 1JZ5A 1CFNB 1U3ZA 3IDJB 4F7PB 5C0BA 2I9TA 1I1AD 4JFFE 3MCKA 4ONHB 4YHNA 3N1PC 3HE6C 5E08L 1IGFH 2K7QA 2CXGA 2EDLA 3QWOB 3IVKB 1SYVB 1XF2A 4LFHD 5DO2D 4RIRA 5BO1H 3RY6A 4DN3H 3M1BB 1KTRL 5T1MB 4E0RB 4OUUB 3FT3A 4GG6A 5CMAA 5I17A 1A6VH 3T4YB 3N85L 2Z0BA 2X4OB 1JNNL 1DN0A 1JF1A 2FWOB 5E9DA 1J0ZA 1QYGL 1A47A 3MNZB 2W59A 4XXCA 3W81A 4P9ML 1NEUA 2CKBB 4ZPVA 3WD5L 4Z7NF 1TETL 2V17L 4PJEB 5T5NG 4PFEA 1NDGA 2EDYA 4H5SB 4KV5E 5HYFA 2ZJSH 3BPOC 4G7YL 1KOAA 4NCDA 4G3YL 5GRVK 1AP2A 5D6DA 1QLRA 5GS0L 1ZANH 1CYGA 1YY8A 4PGCB 3SKOB 5D7JB 4PB0H 5BZWB 3V6OC 3VFGL 5GGTA 1H0DA 1RZGB 1T83C 5I8KL 5DJXA 1C7SA 1LK3L 2YC1A 1U8KA 4PG9B 2FATL 2YK1L 2HFFB 1GGCL 1AGDB 1YPZE 4PJGF 3BJLA 3QPQD 5SWSE 4WHTA 3BIKB 5JOPE 5C0CD 4UQ3B 3CVHH 4YK4B 5DWUH 1A21A 4MNHB 1MJ7L 3P77B 3GJFH 4J3SA 5C86A 4OGAC 2YD8A 5EZIL 1INQB 1WBXB 2ICEA 4FNLH 5HGGS 3NAAL 1A9BA 1MRDH 3QXAA 1U8IA 1AHWA 2DTSA 3PP3H 4R97B 3I6GA 1CDJA 4G6AD 3AS0A 4LEOA 1YZZA 4J6RL 3GMPA 4PGDA 3IFOB 4P2OD 1FDLH 2EDFA 1FZKB 3GB7B 4KTEL 2WLYA 4JGUA 2DS4A 2BNUA 1FVEA 1KGCD 3BH8B 3FB6A 1ZHKA 2HN7B 4MJ6A 3O3BB 3HR5B 4NKMA 1ONQB 4XXDA 5FKPA 3V4UL 6FABL 1EAPB 3O6KH 1TZHA 3NIFE 5FYKD 3FRPA 3H8NA 2YS4A 3HCVA 4PJBF 4AMKL 1NCNA 5IESH 1UH3A 1I9RL 1S3KH 4PTTB 2R56L 1J8HB 4CVZA 1G7HB 5IK3B 2Q76B 5MEQA 1KEGH 2HG5A 1P6AB 3BKCL 3FO2B 3MV9A 4YZFE 5J13C 3GK8L 1MIEL 2AAVA 5C3LD 4NKIH 2CGRH 3HRZB 4LDLB 1OOAA 3QDGB 3Q6FA 5I9QB 4NCC2 1FAIH 2VLRB 3EOYG 3MREB 3O9WD 3MLUH 4WU7B 3PQYD 5IB4A 5F89B 2AJSH 4JRYD 5ALBL 1RZIB 3P4NA 1LO5B 3BKYL 5IVZA 2L4OA 3DVNA 3QO0A 1YEEH 2ZP0T 5F96H 1S78C 1RU9L 5FOBA 5CFHA 5D7LE 5TGBB 3SQOH 5H2BB 5EORL 2BP3A 5EU4A 3U7YH 1HH6A 1YECH 3CFCL 4V1DB 2WUBH 3KPNB 4QHMB 5I1JL 2X44D 5AYQA 2BOCB 3KPRE 1PG7L 4KROC 3U9PH 4GRLB 4AM0A 1X5XA 5DMKB 2YMXL 1Q0XL 4NYLA 2ZUTA 2B2XH 2YPLD 4LKCA 2PYEE 1FNHA 3HI1A 2X9YA 1MQKL 3RUGF 1RJLB 1UQSA 1S7RA 1MI5E 2WWMC 2FEDD 5DJDA 1OW0C 3TVMD 4NFDA 2I5YL 4QT5B 2ZCLL 2XPGA 2W9EL 1D5ZB 3WFEH 1YJDC 4QYOB 4ODXB 3L95B 3IU4L 3HZMB 4XCNA 4JQVA 4PB9L 1HWGB 1TPXC 4XPTH 1T20A 5D70L 1Z6JT 4N0RA 3N50A 4KVCL 3QQ3B 3VFRB 1N6QL 4F37F 1RJZB 4HG4K 2ARWA 5L6YH 2Z93A 5CEZH 5C1MB 1NC4D 5J11C 1KB9K 1UXSA 4P23C 5HY9B 4LCWA 1XGQB 4P2QD 1LDPH 3IDGA 1GZPA 1FJ1B 3T77B 4DGVH 3S37L 3TA3B 1JGLH 2BK8A 3QG6B 1OAQH 2CO6B 4MAYD 4KQ4L 3KVQA 4F58H 1HOCA 1QBAA 1YDPA 1A4KA 4PRHA 5I76A 4S2SB 4N0YL 3O41B 5EU7C 2GEEA 3MX0A 1PQZA 3HZKA 1PBYA 2P5WE 3ULVE 4ZS7L 3K80A 3MV7D 1VB9A 3VFOB 1JIBA 2F53A 4BFGA 3S88H 1Q72H 2VSCA 4N0FA 4XVJH 1QSVA 5E70A 5INDA 4OF6A 4NQVA 1UT9A 1NLBL 4LHJB 4TVPL 2RCSL 4PGZA 2QSVA 4GW5B 4HKBA 4RFEB 3U82B 3O2WL 1Y18A 4D9LL 5DVNA 1FGNL 2C5DC 5CS7A 4QHKJ 2VITB 5DLML 1U8QA 1PY9A 3QJFA 1AC0A 4MYWB 1MCWW 2VH5H 4M61A 3O45B 4IDJL 2GTWA 2KUTA 3LS5H 4PBXA 1X5GA 4RFOH 4HD9A 3BKJL 3O8XB 1FIGL 4LRNL 4POZD 1WV7T 2F8XC 4GBXA 2R69L 3TT3H 5C09D 1F11A 1ZLWK 4L4TA 3RHWF 3VXRA 1IM9D 4BK5A 4U1NA 3RTQB 3DIFA 3QIWC 5EU6D 2FIKB 1ZEAL 2BY3A 1INDH 1T1ZA 4WO4D 1WZMA 4EI6B 3L5XL 4F37K 1RJCA 1EMTH 5EZOL 2X09A 5TQ2L 4MJIE 4KK6C 2I24N 1KELL 3WFZA 3HC0A 1CFTA 3W2DH