5DHXB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
249
structure length
231
Chain Sequence
ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEIIQEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, light
total genus 56
structure length 231
sequence length 249
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhxB00
1EV2E 5HYQB 5BVPH 3C8DA 1SYVA 3PWPD 3CNKA 4ZOCA 1MHEA 2AJUL 3KJ6H 5E2WL 3VA2C 3TT3L 2AEIT 5B3JF 2R8SL 2Q7YB 2XOTA 1BFOB 4NC1C 4F7EA 1MLBB 5I66A 3R8BB 1U36A 1A6VL 4GBXA 5L9DH 3QUML 3HZMB 5IVXF 2NCMA 4ZAKC 3UJJL 5I6XC 5D2LE 1YEJL 4QWWD 1KJ2B 1GPOH 3PJSB 4JG0L 1RIUL 4HIEB 2N56A 4NRYB 3O2WL 2BNQB 5FKPB 4JVPA 4D0BA 2VZSA 2HT4C 1ULVA 2YD4A 1PLGL 3C6LD 2EDKA 3FMGH 1W72B 3O11B 2GYSA 3UC0L 2X4SA 4TSCL 1T83A 5DLMH 5HY9A 2QQNH 5BV7B 4NZRH 4HUXA 3EJJX 5JW5A 3BPCB 2XA8H 4G9FA 5I1LA 3UBXG 4PGZA 1ITBB 4V1DE 4YPJA 1A7BA 3MRNA 2NQCA 5F3BB 4G5ZH 1RURH 1JI2A 4HPOL 4JEGB 2VH5L 2VLKA 4WWID 4G8FB 5SWQB 1BEYH 5DRNB 4M62L 1JMZA 1P7KA 1LO0L 3ISWA 4PY7B 4NC0B 3MREA 3MV8A 3VFRB 1EVTC 3FQUB 3LN4B 5SV4A 2YMXH 5DZNA 1T1YB 4R8WH 3MLWL 5J3HC 3TLRA 1LE9A 3F6IA 1OSPH 1VFAB 3ARSA 3VCLA 4U1SB 4PY8I 2ICES 1DP0A 1BZ9B 1R3KA 4FQXD 4AIZA 3AGVA 5J9PA 2P8LB 1DLHA 5ELIA 2PO6D 3ARGA 1U8IB 1RZKC 1FG2A 4WY7H 2ZSWB 4X7DC 3QEQB 5CBAA 2IEPA 1RHHA 4Z9KB 2YPLD 3G5XA 3GSNB 2HJKB 1UJ3C 3VJ6A 4UT6H 1QNZH 3D39E 3QIBA 4DAGL 1QQDB 1U2CA 1U8HB 4XMPL 4C83B 1UYWH 3QJFA 5E5MB 4MNQE 4ONFH 1MCRA 4K9EL 4LCIH 4NWTH 3C8HA 4I2XE 5CILH 1D5BB 5K9QG 4G6MH 3B4NA 5ESVB 1MFCH 4BQ8A 3IDIB 1XGPA 1KEMH 1I7ZA 4N0RA 2H9GB 2J8UF 3QNYB 2ERJB 1T1ZA 3MLPA 4YHKL 5EU7E 2UZYB 3VH8A 1ZA3B 1OM3H 1JGLL 2XACC 4HS8L 1NCAH 4XNUH 2Y1VA 2VAAB 4O2CA 5EU5A 3LV3B 1DTUA 1E28A 4EDWH 1HHKA 4PRIA 2V2XB 4AIZB 1BZ9A 4AENA 1M05A 2XWJA 4ZFZB 3W9DB 4V2BA 4MXWH 2OYPA 3UXFA 1MFAH 3RGVB 3ZO0A 2KQMA 4MJ5B 1DEDA 3S35H 4KQ3H 2EO9A 4RMTA 1FO0L 2NTFA 2VITB 1J0JA 3KHOA 5DD5L 5GS0C 5J89A 4FP8H 5I1HL 3BYYA 1U9KA 1XGTA 5LGJB 1MI5A 2BSSB 4NNPH 3RP1A 3CFKA 4GRWE 2NXZB 2EIDA 1MHPH 3WSQL 3VXME 2YUXA 4Y5VC 2MWCA 2P5EA 2P7TB 1NH6A 5FCUH 5I1LB 3O8XB 2F8XC 4YJZL 5FHAH 5H94A 4B0MM 3CPLA 1JF5A 1P4LA 2A83A 5F7KC 3H0TB 3D3VB 1PJ9A 5E8NB 2JIXB 1QO3B 2J8UE 3G04A 5GS3A 2DM2A 5EU6D 2DOCA 4Y4HB 1HKLH 5T1KB 4Y4KB 2DJUA 3BN9D 3VMOA 3C87A 4OGYH 1KIPA 5HDBF 4LSDA 3C5ZA 4OZFA 2EDEA 3K0WA 2QQNL 1NDMB 5IFHL 3IS0X 1BOGB 1Q0YH 5IK3A 1I85A 2D31B 1SVCP 4ZXBB 5E99L 4WTXA 5IB2A 1J8HA 4JZJB 5JQ6L 3IJHB 5DJ6A 4U4BA 4L1HA 4QT5A 5TDNA 1SBSL 3ARWA 3EYVA 1OAKH 5B8CC 4PRPA 2GCYA 3AFLA 5TE7L 2G2RB 2DMKA 5AAMA 3WNNA 2OK0H 1Q94A 5BS0B 4W81A 1CFSA 1N5AA 1RZKH 4LRIA 4G8GD 1LDPH 3MXVH 3MYJA 4NQEA 4M8VA 4HWZA 3K8LA 3PXJA 1AQDA 1A6TB 4JFDB 4JRXB 1IC5L 4PJHE 4QNPE 2YOCA 1AFVH 4M7KH 3G5VB 4HV8B 3SDXE 3HI1A 3SGDI 1MVFA 5J12C 5IBTL 5E8DH 3TBWA 3QDGD 2Q86B 3LY6A 1N4XH 2X10A 1H0DB 4RWHA 1NBYB 3FAXA 3UDWC 3NAAH 4CU8A 5CJ8A 3GJFK 5I74C 4NQCB 3PABA 4BSJA 1FFNA 4RA0C 1G1CA 3T0EB 1VPOH 2Y23A 5HHOA 3U9UB 1E4XL 2P42B 4H1LH 1H5BC 3VXOA 3MV9A 3H7BA 4R2GB 4WW2C 2EECA 5D1ZA 4Y16C 3GMMA 5C0AB 4GRMB 4ZFGL 5IHZA 2DQCL 3FB8B 4MVBC 4UQ3A 1NUGA 4F37K 1T3FB 3I2CH 4E9LA 1MCWM 1G7IB 4GSDH 2AEPH 2IAMA 3FB5B 1CD9B 4W4OA 4C56B 3BD5A 1PSKH 3U7YL 5D7LA 4PB0L 1AXTL 1D3CA 4S0TD 4YUEH 5TDPB 5EC1B 1XCTB 3RWDB 2DQFA 4MS8D 1FRGH 3PDOA 1KPUA 5E8OA 4P4KD 1MRCL 3S6CA 2IBBA 3M1BA 2AEPL 4FQ1H 1N26A 3MBEA 3GI9L 1GJIA 2P5WA 3WXWL 4X4XA 4OAWA 4PJIB 4QEGA 1LNUA 3KDMB 1VESA 4RZCA 5DK2B 3BZ4A 5DYOB 4ZS6D 2R0KL 3DMMD 5F96L 4M5ZL 5LVEA 3VXNA 1KIRA 4MCYB 2WUBL 4MNQB 2FH6A 2VC2H 2FEEI 1GGIL 3IU4L 5I8CB 5ENWA 5EZJA 5GSVB 1J88A 3CC5B 4JO1H 4F7MA 2IH3B 3OJVC 1I1AA 3QUKB 2J8HA 5CJXC 5HHPB 3GSUB 4BFEA 4PRAA 3JV4B 2HJLB 4EIGB 2JCCA 4LP5A 4FFZL 3QI9A 4YXHL 2CLVA 2DQDL 4GW1A 5TH2B 4JLRA 1HDMB 1LHZA 2A9ML 5CZKA 4R2GD 5TQ2H 4PRIE 3SEPA 5DUMH 1GOFA 5IT2L 1OAYH 1M71B 1T04B 4OT1H 3NCEB 1R24B 4Q9RH 2R2EB 8FABA 4KRPC 4LU5H 1ZHLB 3GRWL 4CMHC 1EZVY 25C8H 4K8RH 3NH7L 4MMZC 4L3CB 4E5XA 3QDJD 3QXDA 4OM1L 4IIQC 1EDQA 1FPTH 5DRZA 2P43B 5ISZB 3VDCA 1U8KA 4K8RD 2O5ZL 1BX2B 1LQSR 2A73B 4QRUB 2JB5L 3KGRA 5JIPA 3MCKA 3BUTA 4N9GA 5IFHH 5B39G 2IALB 3BKML 3QZWB 5GRXG 5H37H 4XBEL 3HR6A 1LMKA 4G3YH 5ESAB 3RTQA 4WTZA 1R3JA 1B0GB 1BOYA 1JTTA 2MHAB 1JF1A 4OGAC 1T03L 1L0XA 3ZT6A 3I6KA 4P2RB 4JVUA 3AS1A 2OP4H 4AH2A 1QEWB 2K7PA 1CZ8L 3WEXB 2OZ4A 5J3HD 5I2IA 1NC4D 2BZDA 4FQ2L 1NCCL 2X40A 1XR8A 4KKBC 3LPWA 2QHLA 3BQUA 4X98B 2CGRH 1T1XB 2R4SH 4OLXH 4TQEL 4Q6YA 4U3HA 3MLZH 5D2LB 4RGNC 1U8PB 4OUUA 4PV9A 4ENEC 1WFUA 4JM2B 4KMTH 1EGJH 1J8HE 3DV6B 1YYMH 1KJ2L 4HKBA 1Z9LA 3BZ4B 4PJXE 1JPST 4UU9B 4L3ED 4U1MB 3UTOA 3JWDH 1ZSDB 5D7SL 1BQSA 4WIQA 3MBEB 2QQKH 3V52L 2VERN 3THML 2W65A 4X7TA 5MEQA 5LBSH 1SEBB 1DQTA 2R23A 4FRWA 1AGCA 4KV5E 1FZKB 4XP4L 4Z6AT 5D70H 5I9QC 4LCYB 5BRZD 3SDCD 1CXLA 2BVQB 5D7LD 5FCSH 4RNRB 1K5NB 3OSKA 5KSAB 1X44A 1ZAGA 1A6AA 1JPSL 2H6PB 2EKSB 3TBSA 4O2FA 4PJFB 1OTSD 1T6WA 4FS0A 3HAEH 3TV3L 4OZIB 2JIXD 4XNZC 2GHWB 3RWHB 5C0AA 4OZHA 3C08H 3IKCA 3TYFB 4EVNA 1OP3K 5J56B 2IQ9L 4CBPA 1T5XB 4QTIH 2DQIH 1DQQB 3RNKA 1OARL 2R29H 4YUEL 1NBQA 4QRRB 4P4KB 1A9BB 5HPOA 1FNLA 3VRIB 3K4ZA 1W0VA 2AXGB 2J7LA 1MCIA 2DI9A 2C3HA 2VE6A 1F3RB 3CFJA 5HDBE 2R0LL 4GAFB 3TZVA 5IR1B 2OBGA 4QF1B 3FFCE 3LQZA 3QR2A 1JYVA 3HG1A 1OB1B 5B8CA 1BIHA 1OL0A 3O4OC 1NLDL 2ESVA 4DZBA 4ZYKB 2XZCL 4FZEH 4LEXH 3UYPA 4OGXH 4P3CH 1S9YB 3HC3L 4LCWD 4HZLB 1J1XH 4G8GA 2ATPB 4RGOH 4UOW0 2FJFA 4FNLH 4GAJH 4PJAA 4S0SD 2W9LA 3T0ED 1UJTA 4U0RB 4OFVA 2C1PA 3QO0A 5FA3B 3ZYOA 5ANMB 1V7NH 1OSPL 1IM9B 2WBJA 4R26L 2EDYA 5T5NG 2HT3D 4QHUA 1NGYB 3MOAH 3TBYB 4RDQF 5BVJB 5C3LD 2B1HH 2YN3A 1CFVH 4ZD3H 3KPSD 3TA3C 2YPKA 4FQHA 2D31A 5IB3A 1IAII 1IARB 4RGOL 2BVQA 1MHCB 4ZQKA 1BGXL 4LCCA 2R0WL 2CRIA 1I3GL 3JUZA 5FYLL 1DEEB 4NN6B 3EYFA 5SWZB 5ITFB 5E2TL 1SBSH 1U95A 4OD1H 1S7QB 3ARQA 4Z18A 1CN4A 1QFUH 5JZ7D 3SJVE 2Z92B 4Y4HA 1DQJB 1N64L 4M6NL 3K80A 1HH6B 4LDLB 5E6IA 4LSQH 3QUMA 1RUKH 4YWGH 4R7NA 1RMFH 4NDMB 1CVSC 4WWKD 2QQQA 1E6JL 1I4FB 2E27L 4P2YA 4YBLC 3STZB 4YDKL 3TN0B 1MCBA 1SY6A 5CEXA 1GAFH 4HT1L 3VXSD 2HAZA 1MFAL 2XXMB 1LILA 2FX9H 1D5ZA 2EDJA 3A6CH 4K7PY 5CMAA 1NAKH 4OD3H 3FB6B 4AMKH 4BM7A 2VLRA 2Z0BA 4WO4A 4HT1H 1CFTB 4WW2A 3MRCA 3H9HB 3TF7C 1YDPB 4OJFL 3W9DA 4XP4H 1NFKA 2C5DC 3QQ4B 4ZAKD 1ETZB 4LLQB 5C86A 3H9HA 3WDHA 1WC7B 4K3GA 5ERWA 5FO7A 3T04D 5DJCA 3IETA 2EDDA 4HEME 5DRXA 4YDLC 1QFUL 5EFIA 4BH7A 2LAGB 3OAZH 4ZUVA 3NA9H 4DKFL 3PHOA 1KB9J 2O61A 4XNXH 5T3XH 3CVHH 2V7HA 1II4E 1T1WB 2JJUA 5KJRH 2BNRA 1FL6A 5C0GA 1FVEA 3OKMA 4HX1A 3WUWA 2J8OA 1MIEH 3SE8H 4JRYD 4R0LB 5FM5M 2BNUB 2E7HA 4NJ9H 3ZKXC 2FH8A 2F19H 4TNWK 4K94L 4PUBH 5E6IB 1AI1H 4WNQB 2VXUH 4G6JH 3EUUA 4FABL 4OFKA 4XCCL 1TITA 3VXUB 2B39A 1NANI 3L5WA 3FQTA 3HNVL 4M1DL 2X42A 4JQXC 2DQHH 5IOPB 1TCMA 4F9PA 3MO1A 3DI2B 4LCCB 5I8CA 2DIAA 1FDLL 3C60C 1U8IA 2PO6A 2CK0H 3QDMA 1XGRB 2CIKA 1OCWH 3EYOB 3QH3A 2NLJB 5J9PB 1PX4A 2OR7A 1LGVA 1LNUB 3KDMA 3QDGB 1MH5A 4QHUB 1FSKB 3HFMH 5DR5H 4X4XB 1AE6H 2BVUA 2VDRL 5CP7B 3MGOA 1XIWD 4DGVL 1IAOB 4HH8A 1ZHKB 3N1MC 3K2MC 5DRWA 3MV7D 3F12A 4QOKD 1KJVB 1XCTA 1ACYL 4P9MH 1RJYA 5FOBA 3W82A 2XRAL 5B38G 5DQDL 5HTSA 4KPHH 1EEYB 1RIUH 2E9JA 2VIRA 1WWAX 3S96B 1A2YA 1X5LA 1KIUA 4TSCH 4ZS7H 5AYUL 2CDEA 5MENA 3NOIA 5F88B 3V0WL 4QHNA 4JKPL 5DO2C 3HNTH 5HPMA 1NGZB 4HUWB 5DUBB 3KYOB 1OQXA 1VERA 4XB7A 2VLKE 1I9IH 5DEFB 3OKYA 5HGAA 3U7WL 1RZJL 1VB9A 3HC3H 4OBSA 2VLJD 2VDLL 3AROA 5GJSL 5BZDB 2FD6H 5KTEL 1QLRA 1W0VB 3EDJA 4Q58C 5DK0A 2QHRL 5I8OL 4MZ2A 2XQYK 3MLRL 1BVLA 2QQKL 4IRSB 4JY5L 2EDQA 3T3PF 3IDMA 4K94C 1MAJA 5HD8D 4ODTL 5DD3L 2GSGA 1M7IA 1UM5L 4J3OC 1OP5H 1RULH 4JDVA 3ARUA 1GHFL 4OM0L 2OZ4H 2C26A 1KB5H 1RZIA 2OR9L 3JVGC 4JY6A 3VXUE 3IDUA 2G60H 5LAXA 4KJWC 2MQ3A 5IW1B 1ZVSB 1I75A 2VO5A 4H26A 2Y4SA 1OF2A 2V2WA 3BKYH 3QQ3B 1A47A 4P3DA 4FXKA 5GIRB 5DQJA 5KAQG 5BV7C 4XI5D 5F70A 1HEZA 4PR5A 4ODUB 4C4KT 1IL1A 1LO4H 3IU3A 2HTKD 1EHNA 1RI8A 4RFOL 5EORH 1U8OB 4APQA 2XQBH 5C0BD 1ZGLM 2FL5A 2FHCA 4OZFG 4U1MA 2X1WL 5IROA 3IJSA 3EYVB 1NUDA 4LSUH 4HG4K 1UZ8B 5I73C 2DQGH 5J13C 3A6BH 2M26A 3LKQA 25C8L 4OKVB 1Z5LB 2EYSA 1F11B 4C59B 2X9YA 2XZQL 3O4LA 5AAWA 5LKNA 4DKDC 2N4IA 4CU7A 1N4XL 4UAOB 1A0QL 2W07A 5EUKB 1CS6A 4CN6A 1PQZA 4RWYH 4JHZA 5K59E 2CKBH 2AK1L 1MCLA 3RIAK 1KFAL 2Y06H 1YC8A 3GK8L 1IT9L 2RJMA 5IEKB 3FZUC 2JIXA 3B5TA 3NFPA 3KPLA 5I1GL 5KOVC 4HAGA 4LFHG 4YXLL 4Y4FC 2W9DL 2A74B 4UB0H 3O8XC 3QNXB 4ELKB 5LGHL 3CZJA 2ID5A 4MD5B 2QTEA 3PP3H 3W0WB 4JN2A 2BVTA 4I3SH 1NCDH 5JXAL 1U8QB 4QKXB 5HI4C 2XV6B 4U6VL 2VLME 3PL6B 4PJAB 5DMGC 3SKMB 4EI5A 3MRJA 4FN0A 2VITA 1OT1A 3U0TA 2VUOA 2IPKB 1IMHC 4OKVA 3GJFB 5I1GH 3QA3A 3NABL 3VFVA 1UZ8A 4D0CA 5BW7A 1OP3H 5IIEA 5KVFH 3NCCB 4GXUN 5JOPE 4OLUH 4P9HC 2OQJA 3OWEA 4KAQL 1S7TB 4HLZH 1DBJL 1NQBA 4OF3A 5FDWB 3TZVB 2P5EE 4OQTL 1FFOB 4ODUA 3SDAD 5LXGH 3NPZB 1TIUA 3ZMRA 4RGMB 3ARVA 2AQ2A 1KFAH 2Y06L 4YQXL 4HCRL 1CTNA 3PUCA 4P4KA 1U3HB 43CAA 4Z7VB 4E42B 5FHAL 3FN0H 2HT4D 3WLBA 5BRZB 3S8WA 4CJ1A 4YDJB 3QO1B 3T0EC 1RIHL 2R2BA 4U6XB 1KJMA 5GSVA 5KTEH 1D5BA 2Y7QA 4IDJH 3UX9B 2YC1B 3IDMB 4DKEL 1IEBB 4O2FB 3UCRA 3WIHL 1KN2L 4POZC 3QDME 4Z78A 4RRPA 1RUAL 3PWNB 5DFVC 2ZCLH 4NUJA 2PKDA 4NQTA 3CJJA 3V5DB 5FYKE 1ZHKA 5E95B 4F8QA 1NCWH 3VWKC 3VXRB 3ARFA 3UBXB 2OSLB 2X1QA 4YFEA 1U92A 4Z8FH 3AY4A 3AMKA 5JPNA 2IANB 4R7DA 1S9WB 2P8PB 4IOFD 3B3IA 4X4YA 3GRWA 1ACYH 3FFCB 1SJVA 3M07A 4UU9A 3JWOL 5EH1A 3UPAA 3EJYC 3MRMA 5I8KL 3TO4D 4Z7QE 5I19L 4ONOA 4W68A 4PJHA 2VQ1B 3TBYA 1R3KB 1PFCA 3DX9B 4UTBL 2HKHH 5DD0H 4PJCA 1KIQB 3X3FL 2YD9A 3FB8A 4Z7WB 1I8LA 3M45A 4EDXB 4D9LL 1OAXH 4LF3A 3VFMB 3QO1A 3C6LC 4P5MA 3X11A 3WJLC 4R97C 1DVFC 43CAB 3WFHA 3TWCL 5HSFA 4U1NB 2FD6L 4X7FC 4AJ0A 4PY7A 5FYJH 1U3ZA 4JO2L 3BT2H 4HZLA 3MRFB 5JO5A 1E4XI 3PXHA 1F2QA 3MV9E 1C5CL 1ZLVH 3T3MF 1I8MB 5DD3H 3VW3H 1B0GA 4N1CA 3PNWB 5CJQH 1I7UB 4R0LA 4WDIB 4PJ5A 4PRNA 2BNRB 4GAYB 2IBGA 4P2OB 2AJSL 4BUHA 4XC3L 3ZYJA 4PYHA 3WV0A 1M7DA 3VXUA 2BSRB 3EOBB 5KS9A 1ZLUH 3HUJB 3BJ91 3BD3A 2VKWA 4PJXB 4F57L 1RPQA 5DRZB 5AZ2L 3VXUD 2Q87A 1FDLH 3ARFD 5T3ZH 1EJOL 2DN7A 5ERWB 5FO7B 2YXMA 1NGWA 3I50H 1TNNA 4IRJD 1RZJH 1E27A 1KNOB 5DR5L 3EFFA 4PG9A 4I8DA 4YPGB 3VI3F 4JFEA 4XCCH 1CG9A 2XRAH 4MQ7A 5E94B 4YX2L 5HYIA 4WW2B 3RGVD 2XNAA 4GH7B 5F9WB 2CSPA 2B4CH 4CVZB 4TTGA 3MACH 5J1TC 5FYLD 4P9HH 2FIKB 5SWZD 3QIUD 1Z9MA 2GK2A 4LCYA 4O5LL 2J8UA 4L4VA 4TUKH 3T77A 4XP6H 2ADGB 5K93A 5CSZB 3LHPL 3VFGL 4LSSH 2R9HD 5F44A 2CDGA 2DLEA 1P6FA 3CSGA 35C8H 3QUKA 4NKIH 4Y4FA 2D7MA 3B9KD 3C5JA 4K8RC 1Q9LB 1RZ8B 5EWIL 5DMGD 1WBZA 4E41A 1Q0YL 1UWGH 1KULA 3D3VA 4Y5VA 4KDTA 5D2NB 2EC9U 4XP1H 3VXSB 4JM2C 1IC7L 3D25B 3OR7A 1C12A 3ILQD 3SDAB 3KLHC 4MDIA 5ICZB 4LIQL 5I76A 2X4OA 1A3LH 2ED8A 4EN3C 3VRLF 1MI5D 4NWTL 4U33A 2IG2H 4MWFB 5EZOL 1G1YA 4ZUWA 1PKQE 2XT1B 3IXTB 4NC2B 1YEJH 3SOBL 3TN0A 5EZLA 3RZCB 3FO0L 3OXSA 1MFNA 1KEML 3CDYA 1I7TA 1U41A 5IFAL 5IQ9A 2F19L 3H7LA 1CG9B 5IMMA 4NJ9L 4UILL 4S2SA 3CUPA 4WWKA 2CK2A 1WZLA 2JJSC 3FO0H 4LHUG 1MIMH 4PIRF 3A0OA 2MCG1 1FBIL 1F90H 4QCIA 2E27H 5HHXL 4MAUH 1L7IH 3Q1SH 5KOMC 3RL1A 4DKFH 2V5RA 3RPIA 3S36L 1KCVH 1U8NB 3V95A 3ZKND 2YMXL 5HGAB 2PUQT 3JV5A 3QCUH 4PJGB 3PWJA 4AEEA 2Q86A 1ZWIB 4GAJL 4A6YL 1R24A 4GS7C 2DYPB 4Q6IA 5BMFH 5ETUB 4D3CL 4N5UA 3K74B 3JV0A 4JFDA 3SKUD 5E56A 3T4YB 2AXFB 4M7JH 2F15A 3BGFC 5EBLA 2EXYD 1CQYA 3STLB 4KKAD 1BQUA 3GM0A 5DRWB 3SOBH 3EW3B 4YFLI 2I9TA 4X9IA 1DQQA 1JVKA 4YHIA 4GAYA 3VXRE 4LHUB 2YKLL 3MLWH 1BGXH 3CX5K 5TE6L 3CZFA 1U93B 4XWGL 5J06A 1RSFA 2P5WE 3EO1B 3PQYA 2W91A 4WUUE 4BA8A 1GAFL 2Z35B 3KPMB 3DVGA 2A77L 5CAYB 2C1OA 5CKAA 1OSZA 4Y2OA 4RZCB 5DK2A 4JAMA 5EB9A 3KPNA 5INCA 1T7WA 5H2BA 3T1FB 3P9LB 3CCHA 1CL7L 1L4IA 4XTRD 5CKGA 2F5BH 3LD8B 4EXPX 1T5XA 4HKZB 5LG1A 4PYGA 4BQBA 4K3JL 1QFPA 4X6DF 1ZLVK 3MRKA 2VZTA 3CUPB 4IRSD 5DWUH 2JJTC 3LRHA 1P7KB 2CO6B 3NTCL 3WYRA 3QG7H 1R3HB 4GW5B 5GGRB 2E6JA 4LVNB 1BQLL 3B2UD 3DV6A 1G9MH 5LWYH 1AP2A 2NY5H 4XCEB 4YH6A 1MRDH 2B2XH 1QA9B 4YGVB 5KSAC 3UMTA 4OKDA 4FNLL 3GFUA 3KJ6L 1ZHNB 1TJHL 4I9WD 4X7TB 5CJOL 3T0VA 3AREC 1CDHA 1T1WA 1NC2A 3RWJB 2CXGA 3ZE0F 3NIGE 5HHOB 2X4OB 1JN6A 4WV1A 1KELL 2NY4D 4PJAE 1BREA 3V8OA 2YA1A 3EYSL 1VGKB 5GRJL 4ZDHA 2X05A 3D1MC 2IFGA 2GAZB 1EXUB 5ESAA 2AI0L 2HFGH 3JVGA 3W0WE 2F74B 4JFED 1YDPA 1X5XA 3HZKA 4BYHA 1F4WH 1W8NA 3HHRB 2CD0A 4QRUA 2VAAA 1UEMA 4KK5D 4UMGA 4L3CA 1JF1B 3O6FC 2MKLC 5C0RL 5GJTL 1T5WB 3WHE0 3MA9L 4GRWB 2M1KA 4RQQB 4HFWA 4PJEE 4GKNA 4GW4B 4WGWB 2FGWH 4RISH 4HQQL 2F5AL 2PTTB 1QQDA 3V6BR 5IM7A 1D6EA 5DF0A 5KS9B 1ZE3C 3QWOB 2Z92A 2QV2A 2CMRH 5EUKA 3GO1H 4CNIA 1MFEH 3X3FH 5E9DE 1ZEAL 5I1EH 4BELD 4WDIA 5B39A 5JLZB 4GG6A 4HBQA 4LLVB 1S8DB 1J11A 2VMFA 5DUPL 3TBTA 4ETQB 4TTDD 3MFFA 1CGSL 3BRFA 2BSED 4YHOH 3KPOA 2CRYA 1LO2H 3JUYA 2EDFA 3QEUA 4HCRH 4I3SL 3GSUA 4I13B 3ZE2F 3PIQA 2WZPD 2V9TA 3KJ4C 1KPUB 3P9MA 2HTLC 3QNZB 4J3UA 1RUPL 4YBQD 2EXYC 4I2XB 1F58L 4PTTB 1CICC 3NFSL 4NCC1 2JJWA 4DVRH 4N8PA 4N90D 1F5WA 3QP3A 3VG9C 4XGZB 4OZFH 2BNRE 2VLKB 5DO2D 3C2AL 5DZLA 3HG1E 3OKEA 2O5ZH 4PGCB 1DQDL 1M1SA 1ZT1A 1HEZB 3CFDB 3AMLA 4YXLH 3CFJB 4DKAA 1SEQH 2NY6B 4HUXB 3OKKB 3V5DA 4RAVA 1F3JB 2XTJC 4KXZI 3BIBX 3DECA 2V7NA 5D7KE 3RDTC 4GXVL 3BMVA 3GIVA 4Y7MA 1F4XL 1YNLH 2HG5A 5FYJD 2IAMB 3G5ZB 3QJHA 3VD9A 2DM4A 5DC0A 2YA0A 4IEFB 3INUH 3IDXL 4H8WL 1Q1JH 4CMMA 4O51B 3EJZC 1LO2L 1MCWW 2BVPB 3O9WC 3QJHB 4MNGE 4KRNA 1BVLB 4E42A 1EBPA 4PP1D 4UB0L 4I18A 5D1ZD 1NC4B 4U2YA 4DN4L 4L5FL 1G7QB 3LSOB 2HTLD 2JB6B 4PGJA 5IMKB 2Z31D 4QOKE 5E2UH 1I1AC 2IANE 1JPTH 2DQDH 2QSVA 2DICA 3QDJB 4WFHD 2DJ4A 3AAZA 2FIRT 3N06B 2D0HA 2VC2L 4WHCA 3PP3K 4QHLA 4BK4A 2H1PL 3SJVA 1EAJA 3HR5B 1HWHB 1ZK9A 5HYJD 4ORGA 4HK0A 2VXTH 4Z7WF 2DQTH 2VSCA 4BSWA 3NZHH 1AQDB 3S96A 2DDQL 1UM6H 2YD8A 2VLKD 4MCZB 4FQLL 4U7MA 4NP4H 4P46D 2QL1A 4P2OD 4LLWA 5DJ0B 4RBPK 3C5ZB 3ARBB 3B9KC 4UIKL 3OPZL 2H8PB 3OQ3B 3RVUD 3MCLH 4XMKH 5GGVH 5I8OH 3LQAC 5IFJB 1INQB 4LLYB 3SE3C 1JRHH 4KUCD 4UTAH 3OAYK 5FUCE 3BWAA 3KPOB 3ARTA 3LEYL 4C58B 5J1AB 4OZGB 4ELKA 4EIZC 3MJ9A 1EFXB 2A0LC 4YC2C 3SDAC 5GS0H 5C09D 5I73B 3TA3A 1KPVA 1M4KA 5B39B 5JLZA 5IEKA 4UNTA 4JRYE 2P45B 1CDIA 4HUUB 3KPQA 2EE6A 2FECI 1PZ5B 3VGGA 2BRRL 3ULSB 1P6AB 2BSSA 1CICD 5GRVL 5BXFA 5K9JL 1SY6H 3BPLC 2L7JA 1FH5H 4PJ7B 1A7QL 4XNQB 2GW5A 2CLZA 3LB6D 3KPPB 1KB5L 3RVVD 5EPMB 3AREB 2ZG3A 4MJ5A 4DGVH 3RIAF 5KW9L 3GHEH 1JWMA 3NAAL 1BF8A 1DSFL 4KVCL 3GSXA 2RQ8A 3MV11 4QXUH 3KPNB 3TIDB 4AENB 1YN6B 4YFLF 3O8XD 2C7UA 4ODSH 3IKKA 1A4KA 4NBZB 1C1EL 3PHOB 5DQJB 2ED9A 1QR1A 1EEZA 1UCTA 2YPLB 5EU6E 4YZFF 4R90L 3L5XL 4MB4A 4WFFD 6FABH 4WFGE 4DUXA 5CMAB 2XZZA 4Z7VF 4PJDE 2ILLA 2I07A 2QSCH 4Y2DD 3RGVA 5A3ID 2Z9TA 2H9GA 3WDIA 2FDBP 2DLFL 5JQ6H 4PJ9A 1OGAA 2YBRA 3UTZB 1KGCE 2IBZX 5EOCH 3MCG1 4K7FB 2X5PA 2X09A 1HHKB 1CFTA 1TLKA 3TZVC 3V79C 3QCVH 2ICEA 4KU1A 5F7HA 1AD0A 1F02I 1Q8MA 4X6CE 4XP9H 2RAMA 2VLJB 1V3KA 1D5ZB 1CICA 4OIAA 1CDUA 5L88L 3BISA 1FL5B 2VLJE 3WJLA 1XIWA 1JZ3A 4X6CB 2Z31A 5ACMA 3S7GA 2EDRA 1M6OA 1T2XA 4K7PH 3VGAC 5D6DC 5DDHB 3B43A 3TO4B 4XMLL 4Z0BL 3KYNA 2P8LA 3F58H 4HUVB 1I8KA 5CZXC 1LP9F 4PRHA 3O0RL 5MENE 2G75A 1J1OH 5E8EA 3LPFA 2P46B 1KJVA 3LRSA 2HFEB 1QYGH 1KTLA 2E9BA 3PDGA 2EXWD 1B6UA 3U9PH 3EOTH 3ULUH 4HLZG 5BV7H 1EGJA 2D2OA 5FA3A 5C0IB 1G6RA 3FRPG 1DQLL 3GMQA 3PV7A 4GO6B 1P4BL 3B9KA 3BXNA 3TPUA 2E3VA 5HYFA 5F7WC 1OM3L 5INCB 1P5VA 2WBWB 3DOSA 3MOQA 4UT9H 5DTFA 4J4PA 1NBYA 1NAMH 4YHYC 2A77H 1KENL 1HHGB 1O0VA 1WT5C 5GGQH 5C0FA 1HILA 1T22B 2AS5M 3DROA 5I76B 4LQFH 5EO1B 5AG9A 3RVXC 1A64A 2NY2C 4XPFL 5FO8B 4MNGA 2W9EH 4JDTL 3H9SE 3I3DA 4Z7QF 1RURL 2NY6D 3UTZA 2NY3B 1I8IA 3RWIB 4PJ7E 5MERA 3ARZA 4JM4H 4Y8AA 3V6FA 5CP3A 3C5JB 4L4TA 3SDDB 4I18C 3O11A 3OKLA 1CFSB 4KKBD 1XIWC 4RGMC 5ILTH 2HN7A 2AGJH 3O0RH 4HIEA 1EO8L 3VRLE 1UH4A 4JRYB 4NN5C 3C9NA 4QGYA 2MTPA 1EEZB 3UTQA 4L8CB 1WEJL 4U1HB 1PLGH 5DJ6B 4XPHL 2H6PA 2D7NA 1CFQA 1BFOA 2I5YH 2VE6B 3O6FD 4FQIL 4NFBA 4PRID 4QHMA 4U1IA 3QHZL 4ISVB 4WI8A 3LS4L 3WO4B 4PG9B 4KJYA 3GSXB 4OCLC 4KQ4L 2IF7A 2UUDH 2VOTA 4XZUA 3FO1A 4IJ3B 4KK6C 4KJYB 1KENH 3V4VH 3QQ4A 4S2SB 3M17A 1G7MA 4LHUD 3QAZC 2MCPL 2BDNH 4IOIA 2EDXA 5H94B 5IFAH 5B3JE 1P4BH 1G7LA 1YNKH 1P4IL 1JV5B 2YA2A 1WICA 2V2TA 2GY7B 4GG8B 3P30H 5ICXB 1QHPA 3DVIA 5DHYB 3U30C 5FF6B 1BLNA 5JZ7C 2D03L 5I1JL 3PWUB 4R8WL 4EN3B 1KN4H 3VE0B 5HVFB 4KUZH 4R90H 1IQDB 1A7OL 4FTVD 2UZIH 1N5YH 5DLML 4MS8C 1MFBL 3BPNC 4L8SA 4LGSB 3VWKB 4AM0B 3TT3H 1CR9L 1OARH 1KT2B 2R29L 4G5ZL 3U46A 3OKNA 5DURD 1BVKA 5ACZB 3I02A 5CCKH 2MHAA 2K1MA 1KLFA 4P23A 1N0XL 4E41B 2XWTA 4YK4B 2F53E 4Z7WA 3QUMH 2WBJD 3IDYB 4HPOH 3KWWB 4YK4C 1DE4B 1YNTB 3BW9A 4ODSL 1JYWA 1J8HD 3B9DA 2EYRB 4Z77A 1R0AL 1SJHB 1MWAH 4IMKA 2OCFD 5ITBL 1GOGA 1J1XL 2YZ8A 1EVUA 5J6HB 1WF5A 4ZQKB 3PWVA 3HR5A 5E6YA 2E7LA 2WLYA 5E2VL 2AP2A 1JPGA 4NZRL 4U49A 4F37F 1FL5A 5E0QA 3QB7C 4G9FE 4PJDA 4R3SB 2HLAA 1P9MC 4AG4H 5F7LB 3U4AA 2X4NB 5GS1B 1VFUA 1A1NA 1Q9WB 3MR9A 2WBJB 1IM9A 1ZT4B 4GRWF 3K7UA 4UZGA 5I16A 1NCCH 2IFFL 3DX6B 1G9NH 1I8KB 5JW4M 3DIFB 2A73A 3LZFL 1KACB 3TO4A 3ZHKA 5TPWH 4MJ2A 3RAJL 5LBSL 4UTAL 4IRSC 1T2QH 2OL3L 2A1WL 3H42L 1KJMB 4GMSL 3DVNA 3S98A 4E5XB 5HHPA 2UY7A 4PV8B 1MCDA 3G5XB 1XR9A 2WSKA 4ZSOB 5SWZE 4IIQB 1B4RA 2COQA 4TSAL 3WXVH 5F8RC 4JHWH 2A38A 3QXTA 3KLAA 3LS5L 3JWDL 3CVHA 4C56E 3MRPA 2R2HB 3L3JB 1C5CH 2OTWA 1FFOA 1HHIA 1K3ZA 5JIHA 1A3QA 1TVBB 1UCBH 1MPAL 5E9DB 1LE9B 1YEGH 3V52H 1NCWL 3IVKA 2VXVL 3D87B 2Z91A 3BN3B 3REVA 1S7UA 2J6EH 5FYKL 2DKMA 1WUNT 2O5YL 1N6QL 2F54A 3LH2H 3T0EE 1E4KA 3HRZA 3DX9A 5DFVD 1P9MA 1XZ0B 5D93B 4E0RB 1VADB 1YECL 5DYOA 5KZCD 3L3DB 1YMMD 4XCNA 3U0PB 1XF2A 3FFCA 1UFUA 1CIDA 5IT2H 4XHQA 1UKSA 4WU5A 1FZKA 3FN0L 3FQRB 4QRRD 5LCVH 4Y2DC 2HLAB 4PJDB 1HQ4B 4R3SA 4MQXD 4Y89A 2DWEB 3AREA 5DJDA 3QIWC 4OCRH 3DUUB 4KK8D 1ZSDA 5CSBA 1Q9OB 4NUJB 3MLSH 4CL7A 2VXTL 1T80A 1MEXL 2GY5A 1A3RH 4HMCA 1RD6A 2YC1A 1KN2H 4NZJA 5K9KB 1CDYA 2X4QB 5MHSD 4UQ3B 5JDSB 1WZMA 3UPCA 5IM7B 4U3CA 4JO4L 4TPRH 1KCUH 5J0BA 1EX0A 4LRNL 3HKFA 1F58H 3EJYD 5DI8B 2Q7YA 4A6YB 2E5EA 3VFWA 5DZOA 1K8IA 4JG1L 3WN5B 1MRFL 3L3OA 5F7UA 5EOQH 2ZOKA 4G42A 3VE0A 1YQ2A 5A2IH 5BS0A 2ZWLT 4WHYG 2HH0H 4XWOD 4B50A 5C0EA 3L3OB 2APXA 5GIRA 3S37H 5LQBH 1PBYA 1ZKAA 1PG7X 1CE6A 3RI5K 1G7LB 2FWOB 1ZVSA 1UVQB 3MRGB 1Z0NA 4JZJA 1TZHB 4FXGA 3G5YA 3O3DB 5I1EL 4OZGE 3UPRA 1MQ8A 3R1GL 3MJ7B 3KPRE 5F1IA 4POUB 2WLZA 1MAKA 2LU4A 3J7HA 5IESH 5A3IC 5DD6B 3RIFF 3IFPA 1U8MB 2CJUL 4ZOBA 1KIPB 3JV6B 1E6OH 1KC5L 1JJUA 2Q6WA 3N9GL 1L0YA 3NPSC 3VFWB 3V8CA 4KKLC 3PHQA 1JGEA 4RX4D 3P77B 1DLFL 1I9IL 2DWEA 5DJDB 1VACB 1AXTH 3ZE0E 3UYRH 1X5JA 3STBA 3FQRA 4GRLD 1D5IH 4N1EA 4DFHA 5GGTH 2ICWJ 4ELMF 2YPVH 2ZG1A 1MRCH 2IPTH 2NNAA 5C1MB 2HYMA 1FN4A 2QQLH 3L3DA 4FZ8L 4O2EB 4LMQI 2YUWA 3OMZA 5ISZE 1F11A 4OLYH 3DHMA 4TUJB 2R1YB 2UWEA 3O3BA 3IS1X 4HPYH 4WEBL 4OM0H 5EBGA 3REVB 1UGNA 3DX7A 4MNGB 5GZND 5FO8A 2WQ8A 1C08B 2FO4A 3PIQB 4MX7B 2ZCKH 3MOBL 2AI0H 2HFGL 1XCQB 1XF1A 3L5JA 2YD1A 3MLXL 5B21A 3GB7B 3IFOA 1QSZA 5E8DL 1AGDA 5I1AA 1HHGA 2VDQL 4G9FD 2QHRH 2W0LA 1QKZL 3TA3D 4PRIB 1QFHA 2AV7B 4PJEA 4Y4FD 3ZSSA 3DNKA 3ZKNC 2HT2C 3ECBA 1T7YA 5JHLH 4LASL 3RWDA 2OJEA 4LLUB 2WBKA 3BKYL 3BQUD 3FFDA 5D7LB 4TRPH 1S78D 3AB0C 3MZTA 1CLYH 4MZ3A 4LVHC 3LOWA 3QNYA 5CBEB 3PV6B 5A2FA 2NY5C 3E6HA 5JDJA 3FO9A 4P2OC 3BJLA 4WNQA 4PUBL 4JZJC 4MD0A 3X14B 2HLFD 1IVLA 1AE6L 4M7ZC 3QG7L 4HUVA 4ZAKA 1A7RH 4HWBH 1INDL 1E28B 3QJFB 1CD0A 5E5MA 3F7PC 1PY9A 1BP3B 4ZTOH 4PREB 2NY5L 4LFHD 3MJ9L 5D8JH 1MFBH 3KYMA 1FVEB 2BDNL 1TTUA 3VH8B 2Z4QA 3LEVH 3Q48A 3P40A 2VL5A 1NANH 4PPTA 2CR6A 2YKLH 3IFPB 1MCFA 5F7DA 1CWVA 4P5KB 3O6LH 3L5HA 1QRNB 3MJ7A 3RL1B 4LKCB 3O4OB 2BK8A 3CFIC 1VFOA 4KV5F 4OF0A 4YDLB 2CK0L 2ZG2A 3ULUC 4MA8L 1XT5A 4GW4A 3VXQA 4X4ZA 1G9ML 3FL7A 5LWYL 1DN0A 2UZIL 4EBQL 5F7MC 1NCTA 1C5BH 1A4JB 5C08E 1PG7L 1L9MA 1N59B 4TOYL 1WBXB 3WE6B 5AD0A 5C0EB 3VJ6B 4L4JA 2BHZA 1UZ6E 3MLYL 1B9ZA 3OKNB 4FFVC 5ACZA 4AEHL 4WO4B 3RY6C 3HZYA 3H2WA 3QCUL 3BDYH 3T65A 4NHUB 4CVXA 1NAKL 1HI6A 3MLVL 2FHFA 4P57A 3A6CL 1W0WA 2P8MB 4GRLC 5JUEH 4XPFH 5BMFL 4PJEB 1DLHB 3UAJC 4LSPL 4JR9L 1F90L 2LABA 2A0LD 3RTQD 4LNRA 2H32B 1AGDB 4XPHH 5A2LH 2B0SH 2BCKA 1FNAA 4JFXB 5CILL 3KPRB 4GQ9L 4OZFB 2K3TA 2V2TB 2GAZA 2WUCH 2AXJA 4HS8H 4MA1C 5GS2H 1DBKL 3I02B 1BVKB 4ZDHB 4IOIB 3FQUA 3PWLA 4PLKD 4BQ9A 3S9DB 3ARFC 3FOMA 4XCYA 1DL7H 3VWKA 4AM0A 4R6UA 1MHHA 4NQEE 4JM4L 4HMEA 2EZ0D 5TF0A 2QSQA 4EI5D 4XWOC 5IMOB 3FO1B 1PZ5A 4NC1E 1BBDL 5IV2B 4NN6C 4YGVA 2YSSB 2YHGA 4XCEA 1XF2B 3EOAB 4CW1B 1MLBA 3RJQB 3SKNB 3BPCA 3CXHJ 3WKMH 2R69L 4X6EA 2RFXB 1MHEB 4J3TA 2AJYH 4PD4J 5HHOE 3RNQA 2NTFB 2Q8BH 1UWGL 3HZYB 1W72A 4OCXL 1NUNB 3Q2CA 1WWWX 4G8IA 4D0BB 4WI3A 3LMJH 4L4TB 3SDDA 1AKJA 4NT6B 3BO8B 1Q72L 1TVBA 3O6KL 4UILH 4KRPB 1OLZA 1U8LB 3QIWD 2XI9A 4JPKL 3MRGA 3BHBA 1S7WA 3F58L 3MACL 2BNRD 4N8VA 3GSRB 1N64H 2FGZA 5ETUA 4D9QD 5I1CH 1X5HA 4D9RE 1HSBB 5AWNL 5DHVB 4K7PL 5EO0B 2VDOL 4MA7L 5MEND 1MY5A 4OF7A 1CLCA 1OD7A 4IIQA 5FGBC 4RIRB 5IVOA 3L3HB 2NXYD 3AAZB 1IAKB 2W9EL 1EIBA 2MOVA 2AKRB 2ZOKB 4M62H 5DTFB 1A6VH 5I74B 4PREA 2FNBA 3D0LB 4XVUC 5KSVA 3VD5A 5DI8A 2AXFA 3VI4F 4N0UA 4HWBL 4YO0B 4L3EA 5CGYD 1GC1L 4PJCE 3VMNA 2FX8H 1JUFA 1YY9C 2XZCH 4FZEL 4LEXL 5CLTA 3LDBC 3RWHA 4XVTL 4GRLB 4ERSL 3FO9B 2GJ6A 5DMYA 3QDMD 4N68A 5HXMA 4OZGF 1B3JA 2JCCE 1FH5L 1QLEH 2V7NB 2ZP0T 5EUOA 1MHCA 4JQXA 1BIIA 3O6KH 3TPUB 4NO2A 2JKXA 4LCUA 1G6RB 2VH5H 1FVCB 1HWGB 1ZT1B 5C7XH 1OW0C 2QEJA 3BP5B 4PGCA 4B7IA 5C0AD 2W0KA 3UZQA 4WFFE 3GGWB 2Y5EA 5I75C 1I9RH 4OFPA 1BF2A 4XCNB 4DGIH 3G6AA 4E41D 3D25A 3OR7B 12E8L 4DJMA 3I50L 4NCC2 2AV1B 3MV8B 2DTSA 3NZ8A 3RX8A 3H3PL 1QBLL 1T1XA 2CPCA 1JZ4A 3OR6B 1CF8L 1QBML 2Z91B 4ZTPH 3NCJL 1IILE 4FZ8H 3IVKB 4Z7VA 3HMWH 4Y5YC 5MP6L 4JPWH 1NLDH 4NZTH 3K1DA 4UDTB 3AS0A 1OHQA 5D7SH 5DJ8A 1TJIL 5ECJE 4P2RA 4AH2B 4QY8B 2VDKH 5I15H 4GAGH 2RB8A 3QUYC 4ZODA 1S7TA 3ABZA 3SDCC 2F53B 2P44B 3MRHA 2ARJA 4XZUB 1NGWB 4LRIC 2IPUK 1QKZH 3ARYA 4U1JB 3ARDA 1U8KB 1HZHL 3U0TB 4OZIA 1K85A 2CQVA 4NO0B 4X9GA 2JJVA 3V7AE 5D2NE 1HK6A 3HMXL 5GGSB 3GM8A 4FQLH 3ULSA 3FOLA 3RA7L 3ZKXB 2FWOA 1EJ6A 3UTQB 4OLYL 1GC1C 3DSNA 4PY8J 4OF6A 5SX4I 1IBGH 3CFEB 2APTA 2D7TL 3T0AA 2ITDA 3O2DL 1HHHA 2FEDC 2Y9RT 1FGVL 2DF3A 1DN2A 2JB5H 3UBXI 5GS0D 4DN3L 3GSQB 1T0NB 3W9EA 1QSED 3ARBC 4Y19D 1HXYA 3U4EA 3X13B 4KDWA 5LQBL 1M7DB 1U6AL 1R5WA 2BC4B 1INEL 2MSPA 4ZOEA 1X5IA 5D2LA 2XXCB 3MJ9H 3GDBA 5D8JL 2R1WA 3ETBF 2EYSB 3TA3B 4HWEH 3H3KA 2VQ1A 4MCZA 5IHLB 3MA7A 1A21A 2EDLA 3MRMB 4OM1H 4XTRC 3V7AG 3T0WA 5FM4A 3ZT5A 2H2PD 3HUJE 1CLZH 1JWUB 4NHUA 5GPRA 4CVXB 3JZ7A 5GISL 1EHLH 1NC2B 3RWJA 1RHFA 4PG2A 2AEWA 1U92B 1NLBL 3NZHL 4LHJB 4XRCA 3F65A 3P4OB 2BVEA 2LVCA 4TULH 1J5OL 2G75B 5E8EB 3MLSL 3PWNA 4Q7DA 4YFDB 1MQKH 4J4PD 2NY0D 3O2DH 4Z7OE 1HINH 2Z31B 2I25N 1N6QH 3DXAD 4HC1L 3WIFA 2GSGB 4WI7A 5TGBA 4XXDB 3L95B 1BJMA 4NPYA 3WLBB 3L6FA 3Q5OA 4FQ1L 4H25B 3GIVB 1QLRB 3EDFA 3U0WH 9CGTA 1AD0B 2DQUL 2WANA 3L3JA 3CFBA 1CFQB 4OGAD 5DD1H 5ADOH 2FX7H 4S1QH 4K7FA 2Y07H 1YYLH 3OV6A 5HPMB 2YBRB 4Q9QL 3TVMC 2EE2A 3FN9A 4Y16D 2CDEB 5MENB 2F54D 4PRAB 2HG5B 1Q0XH 2DL9A 4JPIA 3OKLB 4LSRL 2VDKL 1I1YB 3N1PC 1RJYB 2NY7L 1J8KA 1CK0H 3EHBC 2Z8SA 1LO3L 1A6ZB 5GRUL 3HMWL 1FZJA 1U8QA 1SM3L 2W38A 1IC1A 3TIDA 1OGTA 1MELA 1LK3H 1Q9WA 4X5WB 3S88H 3MA9H 4F9LA 4JQVA 1NFDE 3BH9A 4JKPH 5BRZE 3EYSH 1UH3A 5GRJH 1NCBH 3TZVD 1E4XH 3M8OL 4R2GC 4H0IA 1TFHA 3TBTB 1YJDC 2YD5A 1JPGB 1IC5H 2OL3B 2NXZC 1JNJA 1GC1H 2EEBA 3Q6FA 4M61B 4Z7NE 5E2VH 3MV7A 1LEGA 4ZFOB 3V5KA 4LCCC 4QCIB 2KBGA 3PWPB 3VFNB 1CGUA 1HIMH 1V3LA 2FATH 4DZ8B 4GFTB 4N0FA 1ROWA 5C0RH 3RKDD 4WTWA 2VB5A 4JPWL 4PRPD 1LVEA 1ZEAH 5DQ9B 4IRZL 1RULL 4MAYD 1JNLH 1N3NB 3G08B 5T3XE 2KZWA 3DMMC 3KYNB 4ETQA 3RWCA 2A74A 1S5IL 4GKNB 4Z76B 2UVEA 5C7XL 4J8RB 3HE7D 2Y25A 5E9DD 3OF6A 4MLSA 5MEPB 4PJBE 1QFWL 3RDTB 1IL1B 4CNIB 1QRKA 2OTUB 5E70A 2FX8L 1UM5H 4LOUC 4M1DH 4MHHI 3WKNA 3FQNA 1JF6A 4LPWA 4NYLB 2Z31C 4MNHA 1L7TL 5IBTH 1JHTB 2AJZB 4HV8A 5EFIB 4BH7B 4H26B 3GSRA 3HG1D 1S5HB 3V4UH 1UKTA 3MJ6A 1C7SA 4YDIH 4S10A 1F6AA 4NRXB 3T4AA 5KN5B 3KPTA 4HXBL 4FFWD 1ETZA 3BO8A 3NTCH 1I1RA 2GKIA 5DWUL 5E7BA 1CQKA 1MCEA 1MCPL 3HNSL 1H9VA 2V2XA 2BXYA 4G6KH 1MLCA 1LE5B 5KVDH 5IMKA 2H2SD 4ISVA 4YEEA 4X8XA 1NC4A 2MCPH 3WFCH 4JRXD 4G7YH 5EULV 4PGDB 3DTXA 3F7YB 4WFEE 3HZKB 3I85A 1J0KA 3BZDA 3GBNH 3X3GH 4G9DA 5ESVA 2GSIB 4F15C 1U91A 2Q8BL 4HS3A 1UYWL 2OR8A 5FOJA 2BHUA 3V6FB 4GMTH 3TBVA 3VMPA 3QIBB 5E8NA 3LQAL 4BFIB 3F12B 3QHTC 1HN1A 1H15A 2VLLB 5FB8A 4AMKL 4WW1A 3BUYA 2Y6SD 3SDXF 4F7CA 3KJ4B 3ZTNH 1J0YA 1IAOA 1TVDA 2J4WL 1TPXC 3ZDYF 4HUUA 2EE9A 5EO1A 4KGJA 3FHQA 1WFOA 4YC2B 4LBEA 5AZEL 4LNRB 3GBMH 2C1OB 1A2YB 4ODHH 3L3IA 4J12A 1FORH 3B5GA 1R3HA 4GW5A 5ILTL 2NTSP 1I8LC 4OCSL 5DVNA 1KXVC 1N2RA 3K4AA 1AC0A 3BP6B 32C2A 5D4QA 1QSEB 5F89B 2CUMA 1F4YL 1IM3A 5FYJU 1I3RA 5F1NA 3P4MB 3O9WD 5F7YC 3MJGX 3B9EA 2XQYG 3O6LL 2A9NL 1N59A 1KXTB 1B2WL 4JAMB 1TTFA 5IWLA 4GG6E 4WENB 4JKLA 3QH3B 3ES6B 4EI6A 2UWEF 2BNUA 5IJVB 1EMTL 4NSKB 1VKXB 4IMLA 3NN8B 1OB1A 3IDJB 3OAYH 5IR1A 1D9KC 1HQRA 5FYLH 3UBXA 4F7CB 4KVNL 2Z4QB 5EBMB 5A1AA 3D85A 5CCKL 5FB8B 4FHBD 1H15B 2VLLA 3MNWB 3OZ9L 1N6UA 3QUYB 3RL2A 2F54E 3B6SA 4FFWC 4LIQH 3RRQA 3U9PL 4YX2H 3S37X 5F71A 2PW1B 2ICEB 3LHPH 3VFGH 5DJXB 4GG6F 3Q3GB 4XX1G 3WNKA 1CGYA 2FLBT 4ONHA 4WWKB 1KJ2A 3E6HB 1U0QA 1CXEA 5EWIH 3MGAA 1T5WA 4XPGL 4Y19A 1AXSA 2H41A 4M1GL 4UNVA 3ULVL 1TETL 5D7JC 5IEHB 1EERB 1DSFH 3MOBH 2O26U 1CYGA 4LDOB 3T2PA 5AZ2H 3HCVA 2FEDD 4ZUWB 3CFDA 1J05B 4YDIL 4MQXC 3N50A 3DMMA 1YY8A 4Y1AE 1MCHA 1SY6L 4I0PA 3RGHA 3VGAB 4RSVA 2EC8A 4KWUA 5C0DA 4OLWH 4HWUA 5D5MA 3FQWB 1RU9H 1I7TB 4G6KL 1YEFH 2AEQL 2X70A 3D6GA 4R7NB 3QYCA 4AIXA 1KTRL 4M1CD 4QOKA 4WFHE 3FT4B 1EZVX 1ONQA 5C0CD 2VQUA 2FR4B 1RIVH 1CIUA 1C1EH 1UG9A 4NQVA 3N1GC 5IROC 2G5BB 3HPJB 4X8JB 1S9XA 1CLOL 1PGRB 5A2KH 1T7VA 2DQEH 2GUOA 4Y5VB 3VXMD 2XNAB 3RBGA 4PTUB 2V5YA 2R0LH 4G6FD 5BVJA 3GMPA 3LKNB 1SM3H 4OGXL 1UM4H 5T33H 1WAAF 4JE4B 3MV8D 2ZUWA 1YJDH 3SKJL 1QP1A 4LLYA 3VDAA 1VEPA 2CDGB 2XN9B 1BWWA 1FFRA 3S3JA 3ZDZF 3ZYZA 2OJZL 3VFNA 3NVQA 4WI9A 2AJVL 4M6MH 3O4LB 5DGQA 3LN9A 5JW3L 1MF2L 7FABH 2NY6C 5CP3H 5T3ZD 4Y5XB 3HS0A 5E6ZA 1A8JH 2ESVD 3T1WA 4AEHH 3QFJA 2RHEA 3MLYH 1UB6B 3LEXB 2K9UA 2B4CC 1FL3A 1RIHH 2NY2D 3C9NB 4CMHB 1UWEL 2XIDA 3O6FB 3O9WA 4JRYA 2BY1A 3SJVB 5HVWA 5ICYA 4LHUA 1FVDA 3IF1B 5IB4A 4PR5B 3L3KA 3WHE1 2NXYB 5F6IC 4G42B 1N8ZA 2ZSVB 1PEZA 5JO5B 4GLRH 3VDBA 1OAQL 2JB6A 2NZ9C 4KZEH 3VFOA 4IOSD 4WFGD 4LNVA 2MMXA 4H0GA 4XPTL 2ERJC 1IGCL 4GXVH 1ZLWK 1HCFX 1DBJH 1XGQA 5KSBB 1MQKL 4F7MB 3F7VB 2HH0L 4OCRL 4NKOB 4GUPA 1PKOA 3HZVA 2D0GA 4EDXA 5C0AE 3DROB 3L9RA 1H8OA 1RZ7H 2UY6A 2X4QA 4PJCB 4IMKC 5EOQL 4DVBB 2AQ1A 2XKUA 4HIHA 5EBWB 4PGEB 3U6RA 4YZFE 5GGTA 3MRFA 2R0ZL 1FIGL 1AGFA 2OMBA 4OTXL 4PJIA 5EU6A 1UENA 4JFYB 1UJ3A 2R1XA 4NQCE 3B9AA 1KCUL 4NO3A 4BH8A 2J12B 4HAFA 1K8DB 1ZHNA 2BVYA 1N7ML 1I85C 3WNLA 4NUGL 1YQVL 2A6DB 4DQOL 4LGPB 4LL9A 4YQXH 4JFDE 4PJHB 1BZQK 1I1CA 3ZDXF 5GZNC 3OAUH 3QPXL 3IAGC 2VIRB 4NM8H 5HI3D 1J12A 4OFYD 3TO2A 1LWRA 4G8GE 5EZLB 1IGML 1FLRH 2DMBA 4DN4H 1U3HD 4TNWF 4WCYL 4L4TE 4PJCF 4G3YL 4XPTH 5D1ZB 4HKZA 4F7PB 4G7VL 3VXRA 2PNDA 4XHJD 3T8XB 1LP9B 3RFZC 4WHTB 4TSAH 1A6UL 2ED7A 3TYGL 5DURB 1MFDH 1K2DA 5C0ND 4MDIB 1CK0L 3H6JA 5L0QB 1C12B 2CMRL 5DEGB 4ZUSB 3B2VH 1BJ1J 5L0QC 5L2KA 5HYSB 3BH8B 3ARGD 1IEBA 1P5UA 4N0UE 2PO6B 3HC0A 4RMUA 2APWA 2LFGA 4NO3B 5FGCE 4BH8B 4G8EB 4KI5C 5GGSY 2XFXA 3HI1B 1CXHA 1KCLA 1YEGL 4HWBA 4PJEF 1UT9A 3VI4E 5T1DL 4AY0A 1FRGL 1J7VR 4QRPE 1JYNA 3I9GH 5L8LB 2J6EL 5FYKH 2O5XH 1B6DA 3QWOA 1ZTXH 4D0DB 3DRQA 5F6IB 1D6VL 2J8UB 4NQEB 4DVBA 4P5TC 2FIKA 3D3VE 1QR1B 3MRBB 4X9HA 1YY9D 3DGGA 2ITDB 1RJZA 5FYKD 2FGWL 4RISL 5ID0B 1ODAA 5AUMA 4U6YA 2R0KH 4NM4L 1PSKL 3U7YH 1LK3L 1MCOH 3EFFB 4N0CC 4ACPA 4NOBA 3VFOB 4BZYA 4I0PD 3ZE1F 3DUSB 3UAJD 5GGSA 1UA6H 5EPMA 3HAEG 1WBYB 5TPWL 4M1CC 3V4PH 5D72L 3AS2A 4ODTH 4YHOL 1ORQA 2B5IB 4WI5A 1YEEH 1Q9KB 5HDLA 3S37L 2B5IC 3MXVL 3V5HA 2Y5TA 2WWMC 4FFVD 5E08L 3B83A 2W0PA 2ARJB 3BW9B 5GJTH 4ZS7L 4QWWC 3HS0B 3R06B 3MJ8B 4HH9A 4HWNA 3LDBB 1FYTD 3OKOA 4KPHL 4K3DL 3VFSA 1KIRB 3LKQB 4ZTPL 5E5RB 1ED3B 3PP4H 3KPLB 5HGDA 2VLRB 4TNVK 2V5TA 3C8KB 4JZOA 4L8SC 3F7QA 1ZVHA 1T20B 4R96B 3INUL 4APQB 3OB8A 4F58H 1KV3A 1ONQB 5I15L 3OB0K 4HBCL 1AO7A 1P53A 3UZVB 5D2NA 2OM5A 3L1OH 5L8KB 5CZXD 3VXNB 1FSKC 2GJZB 4X6FA 1DDHA 4XBPB 5FO9B 1UZ6F 4NDMA 2MFNA 5CFHA 2VDLH 1O7SA 1OAKL 1WBZB 2NYYD 3QIWA 2F53D 3LCYA 3P11H 4JN1H 3AB0B 1NJ9A 3SQBA 3HTLX 4U1KA 4DWHA 1S7QA 4JKWA 4X7SL 5ITFA 2OR9H 2BERA 3MV9B 4K2UH 3RI5F 4YE4L 1F13A 4NO0D 1NFDF 4LEOA 3DO7B 1W72H 3PQYE 4Z95H 1CL7H 4OTXH 1H3VA 1X6NA 4I18B 3CSYB 5E5UB 4XAKE 4FP8L 5I1HH 1ORSA 1FC1A 1RJLB 2VN7A 3WLWD 3DVGB 4C56A 3VH8G 2VXVH 2Z35A 3KPMA 1FFPB 3EOYG 4PFEA 2Z8VC 4K3JH 5KVEH 3EO1A 2DL2A 4URTB 4ZFOL 4M5YH 4YDJA 2VDRH 1U6AH 4K3EH 3Q3GA 4YHLH 1P69B 1EEYA 5DJAA 1ZMYA 3STLA 3JTSB 4DN3H 2FZ3A 2J2ZA 4KC3B 4NQCA 4XP5H 1OTSC 4UT9L 1AC6A 1Z6JT 4ONHB 5L6YH 4ZS6C 1DFBH 2W1NA 2AGJL 4AEIL 4MDJB 4BQCA 4HJ0C 1AR2A 5D1QA 5JR1L 3RWFB 1HILB 3RL2B 2LTQC 3EOTL 4Q2ZA 3ULUL 3PWJB 2NLJA 1DUYB 3BHBB 4POZD 2E9IA 2ZUVA 5GSRA 3QDMB 1U8LA 3EJZD 4I48A 2P49B 1P1ZB 2V17L 1BBDH 2AXGA 2UZXB 5FDYA 2C3WA 3T3ME 4QLRA 3OHXB 1FFQA 5HDQL 4Y4HD 3LKSA 5BQ7A 4MA7H 2EDBA 1A5FL 5F1NB 3KLDA 2EDHA 3QWRA 5GGQL 3VFMA 1VDGA 4LF3B 4Z7VE 2G2RA 3VGHA 3SDXB 3Q0HA 5F1KC 4PRHB 1OAZH 3RVWC 3BZEB 4L29B 2IH1B 5IB2B 1TETH 4OCNC 3CGTA 3TCLA 2V5SA 3O3EA 2P5EB 2P7TA 4Z7UE 4YDKH 1BOGA 4X8JA 4OFIA 1FNEA 1NCAL 1I3UA 3IXTA 4XVTH 2IANA 2YK1H 1IKNC 1SJEA 5BS0E 2HWZL 3BGMB 3RY6A 3ZKMC 5MEQB 2WWKO 2V7HB 4XC1H 3ALXA 3WNPA 3P3YA 1OW0A 2IGFL 3VRJA 3DXAE 1D6EB 3RUGB 2BY0A 2B0SL 3SE4A 5JR1H 2PTTA 5KANI 4PJDF 2A83B 4K07A 4MDJA 5KZCB 2NW3B 2AVGA 1RU9L 2X9WA 5DJCB 1ND0B 5CJOH 1FYTB 4P9HL 4Y5YB 3PJSA 4GKOA 4PBXA 3TESA 4PJ9B 5FAAA 4M6NH 3IFLL 4UIMB 5F9JB 3IU3B 4TUOA 4OD1L 2QLVB 4LVHB 2APVA 4KKLD 4IBLT 1V7NL 2ADGA 2IADA 3TJHC 4P3DB 2GSIA 4NGHL 1G7PB 4ZMAT 4NBYB 1X9QA 3KR3H 4QXGL 1HHJB 3UJIL 2A2QT 2X4PB 1TQBC 3EO9L 5C07D 3W11C 5LAXB 3BKJH 1OY3B 5F9WC 4HIXH 4ZD3L 3HAEB 3WIIL 2HLFC 4JCMA 3OJDA 4I77H 4XT1C 4K55A 1E27B 1KNOA 5HGHA 4LDEB 4LHQB 1JYXA 1DN0B 3NIFE 3UTSB 5CJXA 1CXKA 4K2UL 1EJOH 3S4SG 4A2MA 4V2CB 1PY4A 3SGEH 3MRRB 1JN6B 1GSMA 4WV1B 3WMSA 1WAAE 2EEAA 5J7CC 2HTKC 5F7DB 3GBLA 4FQQA 3S97C 1MUJA 5D2NC 1XF3B 4DEPB 1DEEA 4M93B 1QTYT 1QA9A 2C3GA 5E00A 3RKPA 2FYYA 2QADC 5DSCB 5C08D 1KPVB 2PYEB 4NSKA 5GGUA 1VKXA 3P0VL 4UV4H 4QXUL 2CRZA 4JPKH 3BPNB 4R4ND 4C83A 4L29A 3DYPA 4KJQD 4F2MB 4M5YL 1JP5A 3TT1H 3BT2L 2M2DA 3E3QC 3Q6GL 4KROB 3KNBB 3HE6D 4NQDA 4D8PA 5DC4B 1SQ2N 4OCWH 1WCBB 1PYWA 1AJ7L 3CSBA 1JCKA 2IH3A 3IJYB 3EYFB 1IM3B 1E4KC 1INDH 1OGAE 3CC5A 3LKSB 2EH8H 4JREC 3SPVA 4MVBD 4N8CH 2NPLX 4JG0H 2LU7A 3ZL4H 3CX5J 4QYOA 1OSZB 3W39B 3ARGB 4MA1B 1YMHA 4KRLB 1CDCA 1S3KH 4WUUD 4M9OA 1QOKA 4BFGA 4JM2F 1G6RH 1F97A 1L0QA 3D39B 5CD5D 3QWRD 1EHAA 1YEEL 1U93A 3MUHL 4TOYH 3NIDE 3V0AC 4M61A 4MB5A 4M4RA 3QBTB 4W4OC 1FGNH 3T0XA 2BOCB 3ZTNL 4I48B 1A6ZA 4M43L 4X7EC 3PDOB 1NAMA 5F93C 3ARDC 2KH2B 2GITA 2M8XA 3TBVB 5BCAA 4G80B 4Y16A 5GRZA 4ZO7A 5DRNA 3ZE2E 2X89A 1F4AA 4O2EA 5SWQA 1ADQH 1DBKH 4ZYKA 5JXED 2CR3A 3QCTH 1EGJL 3EGSA 4R4BA 3WIHH 3RHWF 1CGTA 1KCSH 2ZPKL 3S34L 3EYQC 4WJ5B 1IC4H 3HZMA 2QBWA 5BRZA 2DLTA 1NDGB 5CIPA 3NCYP 3OKDA 5BZWB 1GOHA 5JNYA 3NA4A 1A1OA 4I5BB 4RAVB 1JNHB 3MV7E 4LEOB 1A9EB 2X4SB 4BQ6A 1JMXA 5GHWL 3KLSA 4NPYB 3UYRL 2FATL 5I19H 3ARED 3UJTL 5LXGL 4M7LH 1NGZA 4HUWA 5DUBA 4LLQA 4U6VH 5C2BL 4PJ5E 2RIKA 1F2XK 1GCFA 1CD1A 5K33A 4NFCA 3BX7C 3MSPA 2BVOA 2ZJSH 3F8UB 4FXGB 1KTDA 1R5VA 4M48L 4JFQA 5KSAA 1SEQL 3GJFA 4JFHD 5I1DA 2VAJA 5LGHH 5B4MD 1U8PA 4OUUB 4WU7B 2VQTA 3MBED 4A2LA 5FFLA 2EYTB 3BIKB 1MEXH 2VSDA 4X98A 1KJ3L 3ARDD 4JFFB 4ZUUA 2ZCKL 4F3FB 2W65B 1XR8B 5EIIB 1DDHB 5FO9A 4XBGB 3C60A 1WZKA 3SKOA 1P84K 4B5EA 4JGJA 3S5LG 3IDXH 4JFEE 5KVEL 4JZOB 2WINB 3W5MA 5EU4B 2VZOA 1QEWA 4A6YA 3IJHA 4Z7OF 3I6KB 2XTLA 3CIQA 4ZXBA 4HGKC 4XC3H 3OKOB 4WGVB 5DQ9A 1FP5A 5E7FA 4HKJA 3U2SB 3BD4A 1MVUB 4KUCF 1U95B 5E08H 2FX7L 4EJ1C 4UAOC 2XQBL 4Y2DB 2H32H 1NSNH 3QDHA 1LEGB 1C5DB 1NBZB 1ACZA 4FFYH 3N9GH 2DRUA 4KMLB 4JDZB 5C8JB 4GUPB 4NKOA 5A40E 3BOVA 4N0YH 3WHXA 1DBBH 3NBNA 4J6RL 3PDDA 1INEH 4P2QB 4GAGL 1R3JB 2DQGL 4DOHB 2DB8A 3GJEB 4RQQA 4QTHA 3GKWH 4OF5A 4EQ3A 3BDXA 3J8F7 3OGCB 1JL8A 2LE9A 2W0FB 2XZQH 4U2ZA 5GRUH 2KPNA 3O3UN 4F58L 4I0KA 3L7EA 1LO3H 4RMQA 1XZ0A 4E0RA 3DGGB 5DJZB 3L3KB 3GSNH 5DA0B 3SO3C 1OF2B 4NUGH 4U05A 3SO3B 5F9OH 4K3DH 1JNNH 2J88L 4QXWA 4HIJB 2ZCHL 4Z0XA 3OX8A 2I26N 5CEYA 4P0DA 43C9B 1NEUA 3GIZH 4P2RD 1C8PA 1NMBH 1T7ZA 1EXUA 2E7BA 3LH2L 4PB9H 1WV7T 4DGIL 5JOPD 3TFKC 1A0QH 1MOEA 4MMXC 1R3LA 2RCSL 2OJZH 1OVZA 2YS4A 3HI6H 3N85H 5DK3A 4M93C 1HDMA 1MVUA 3EKCA 2OI9B 4Z5RA 4TPRL 4V1DD 1MJ7L 1MFDL 5F8QC 4OCWL 4NRZB 4NJAL 1EBAA 5EOTB 4XCFL 1ADQL 1A14L 3QWQB 1EFQA 3U7WH 4X80H 4H0HB 2Q8AH 5HYSA 5L2KB 5E6IC 1AHWC 1PD6A 1XGYL 4L9DA 4QHNB 3HNTL 3C6SB 1IGYA 4GKZA 4X5XA 3T08A 4MCYA 4WHTA 1OGAD 2P5ED 2ATKB 4M6OL 3QUMB 4RMRA 4HMDA 2A6DA 1ZTXL 2J6EA 3B3IB 4G6AC 4X4YB 3UO1H 1PDKA 1MJJB 1J18A 2NY1B 4BSVB 4NBXB 3NGBC 3C5ZC 1OT2A 5SWZA 3SDYH 5A43C 3OG6B 1NPUA 1KTDB 1R5VB 5CBAB 3BZFB 5HBBA 15C8H 2H3NB 2P24A 1AGFB 4WI2A 1T7XA 4IHOA 2EYRA 4Z77B 3EYOA 3RTQC 3QXAA 1H0DA 4QRRE 1K8DA 4ODXB 5AYUH 1WLHA 5K9QI 1YNKL 5T5FH 4GLRI 4M7JL 3S34H 1MPAH 1N5YL 5SX4H 5IOPA 1X7QB 1BIIB 3MUGB 5FCUL 4EKXA 1JZ8A 5IEHA 4PJHF 2Q76B 4NQCD 1QFWM 4OSUL 3LMJL 4JFPB 1AQKH 3SCMB 3P30L 4KH2A 5I2IB 3P73B 1ZOXA 5F7EH 4M00A 1BQHB 1P84J 3S3PA 5HI4D 3X12A 4CRPA 3BMWA 1FGNL 4RIRA 4KKNA 4HG4J 4Q6IB 4NZUL 5C2BH 1FBIH 4GG8A 3MUZ1 1VA9A 3B6SB 4M7LT 1UWXK 2FBOJ 1ERNA 3VGFA 1KGCD 5SX5H 2VR9A 5EU3A 5MI0B 3MTRA 3T0DA 1R6VA 1V7ML 4O00A 3BPOC 3LKOB 3C5ZD 1J8HB 2OX5A 3QI9C 2BOCA 1JGVL 2ZUYA 2IPKA 3LB6C 3QIBD 4NO0A 3GMNA 3EDEA 3PL6A 4HFUH 5J4MA 1HSBA 3ZDXE 3B8YA 1BD2B 4LAQL 4UDUB 2FO1A 2VL4A 1Q94B 3QT2A 2R2CA 3BP4A 3TYFA 3IGAB 4JDTH 4PGBA 3W0WA 2EH7L 4UV7H 4PJ7F 2LAAA 3ALPA 4K71B 1T4KB 3JTTA 3S36H 4LQFL 2VWEE 3T09A 5L2KE 3D2UD 2DIJA 3DETC 3EOAA 1WIOA 4CW1A 3ESVF 1BAFL 1QNZL 5IK3B 3TO4C 3LQMA 4JLRB 5F6HJ 4NZTL 5F89A 1QPXA 4UDTA 5IF0B 1JGLH 4NQVB 5BOZG 3GI8L 3GEWB 1U8JB 1HYRC 3QDJE 4U0RC 2R69H 3OL2A 3OR6A 3V2AR 4QOKB 3EO0B 1VCAA 5CEXB 1GGBL 3MBXL 2FLRT 5ENWB 1FV1B 2W60A 2C4XA 5CD5C 2HVKB 4P46C 2N7BA 4I3GA 1X6LA 1Q38A 4S1RL 1CDBA 5FKAA 1E6JH 4KY1L 4JM2A 1MUJB 2V9RA 4KDTC 5I1JH 4CDHA 2BOBB 3D3VD 4I77L 5J11C 3IYLW 4BFIA 4HULB 5HHMB 1FO0H 4I0PB 3GMLB 3T2NH 5AWNH 1MHHB 1YUHA 2VXSL 3CFKB 1EEUA 1YPZE 4FMFA 3HC4L 2DJSA 5L88H 1W0WB 2P8MA 4NGHH 5EC1A 1F8TL 1D5XA 3FRUA 4OUOA 1AD9A 4POYA 3HAEA 1RZGB 4MAYB 1IC7H 4KJPC 3CDGB 5D6DA 3RTQB 1KTLB 3CU7A 4QO1A 1AIFA 5IVXB 4JDVB 4LSSL 2P5WD 2XZAL 1RUKL 1HE7A 4XP6L 5CJ5A 3RKDC 4KHTL 2YUVA 1HH9B 1FJ1B 5F9JA 3T0EA 4PJIE 3HUJA 1WBXA 3EYQD 1QYGL 4HHAA 3WE6A 5AD0B 1I3GH 2HT2D 3BE1L 2HVJA 1A4JA 3VGBA 3HNVH 4P4KC 4FG6D 4YDVB 5EN2A 5FK9A 1IAIM 3KYOA 8FABB 3QQNA 4NQXB 1U42A 1H3PH 1ZANH 2ICWB 1I7UA 1EMTH 1NFDA 1JHTA 3KVQA 1PG7W 5DS8A 3FQNB 3C08L 3SQOH 1GVIA 5E2TH 3D85B 4ZAKB 5I6XB 2Z93A 1U8HA 3FKUS 3BYTA 3BGMA 4UTBH 5ALBL 3VCLB 3KYMB 1A9BA 1YZZA 3JV4A 3N0PB 1T1YA 2W92A 1JPFB 4LP4A 3TCLB 3FB7B 1J0HA 3CLEH 4XC1L 3LN4A 4TVPD 3IKCB 3G08A 4OZHB 2ZSWA 1IZKA 2YK1L 3O2VH 4MD0B 3C09C 3X14A 1TQCC 2DLGA 4MYWB 5CWSA 1MAMH 4F15B 3JSSA 2HMIC 1KCKA 4NOFA 3VW3L 2R8SH 4LBEB 4MJ6B 1NL0L 1D5XB 1AR1D 2VR4A 2OJEB 2R56L 3TIEB 5IV2A 2B7DT 4MX7A 3TGXA 2LV4A 5L6YL 4JRXE 5GSRB 2XPGA 3L3IB 1KYOK 3C6LA 4J2XA 5I1AB 3MBEC 3WFDH 1QO3A 1D5MB 2OS7A 3ILQC 4X5WA 5E2WH 3FB5A 4YHLL 2GTZB 4L3AA 2XA8L 5JTWA 4G8FA 1HSAB 1G7IA 2NNAB 4KMTL 5FKPA 2EH7H 4UV7L 3KPRA 3EDDA 4G9DB 1KF9B 3Q5TA 3MLZL 3TH2T 4M3KB 2WW8A 2GI7A 3D85D 3JTSA 1DANU 5SWSA 3UDWA 3MCLL 1DFBL 1WFNA 4UIKH 4U1GC 3C60D 4ELMB 3DO3A 3WN5C 1NMBL 4OFYA 4GRWH 5E8PA 5TF1H 5DRXB 2H2PC 2XG4A 3WFBH 1CZ8H 5IF0A 3ULVD 4IDJL 2APFA 2DDQH 1H5BA 1P7QB 35C8L 4NKIL 3ZKSD 2HJFB 3P77A 4BK5A 5KSAD 4LLWB 3GSVB 1J87A 2IALA 2P48B 2YR3A 3MX0A 3QZWA 2OQJB 5D70L 3TC9A 1GZPB 3QG6B 5KS9F 5JHDD 3O3DA 3MRCB 4HUNB 2IWGA 4XMLH 3DWTA 1YMMA 1TCRB 4ZO8A 4XMKL 5GGVL 5CLWA 2NY4C 5DD6A 4KKAC 3WIFB 2XTJD 4MNHB 1CL7I 4BKLA 4QHLB 5I30L 3BPOB 4R4NC 4J6RH 5KW9H 2E7LC 1UB5B 4NRXA 4NM8L 5A2JH 3O81A 1I7ZB 4OZIF 2AK1H 2E7MA 2R2EA 4K3HA 3AUVA 4PRHD 5K59F 5T5FL 4PJ8A 3GMOB 1V3MA 1D6VH 1GZPA 5D6CB 3D9AH 1GIGH 4KAQH 1S5IH 4DCQB 5GRWA 1QBAA 3LKPA 3TN0D 5I8EB 5JOFB 4WUUB 4X4ME 3CMGA 1NDMA 3O41B 3WCYA 1JWUA 3HPLA 3JWNC 3RQ3A 3GRWH 4JANA 4X7SH 3G6JF 4FA8A 3EFDL 4Y4KA 3RVUC 2BMKB 2NX5A 2JJTA 5M95B 4U7SA 5DUML 1FIEA 1WJ3A 4HF5L 4ZFOA 1FNSL 5FHBH 3GKZA 5D72H 4OQ1A 3AU1B 4FQJH 4X6DB 1T0MB 1IGTA 5CUSH 4U1LA 2EEDA 2BJMH 4N0FB 3L7FB 3FT2A 2RCSH 3DGCR 5C92A 3IRPX 3G9AB 1YEDB 1EK3A 2AK4B 1HXYB 5KSUA 2VDNH 1OGTB 1GYAA 2BXZA 1S7VA 4NN7C 2XKSA 4PJGE 1FZJB 5DVLA 2PETA 2XKNB 3QI9D 1MI5B 4ODVH 1B88A 4M48H 4HPYL 3SCMD 3CSPA 4JB9L 4CVUA 4NQDD 4NQED 3WUZA 1QLFA 5T1LA 1HYSC 5F21B 4F33A 2V2WB 2NY7H 4MXVE 2Q8AL 1IBGL 5C07B 4ZNCD 2PR4H 5FM5O 5TDPA 1WAAA 1S9YA 1HOCB 1TTGA 2BRRH 4F7TB 3VGDA 1N0LA 1CGXA 2IAMC 2WK2A 3QEQE 5B8CB 3MRNB 4NNYA 4KTEL 1X4ZA 1WFTA 3MRPB 4NQUA 2DQJH 3ZKMD 1MJUL 4JFHE 3OTTA 3VRIA 4NRZA 5BZDA 2XA3A 3HE7A 1PKQB 3IXAB 2QJDA 4OCMC 1HHIB 5DQDH 4G7VH 4PV8A 3HC0B 1CGSH 4XH2A 3TVMB 5IW6A 3W81A 1R0AH 4L8DA 5L2JB 1JFQH 4GSDL 1ZLSL 4XVSH 2DWDA 3QEHB 2AABH 3IDGB 4N0YL 3QPXH 1ZHBA 2DKSA 1BZ7A 4D9RD 4KTDL 4HWZB 1UKQA 2DM3A 1MJUH 1FNSH 5FHBL 1QSVA 1HOCA 3DVNB 2NX5D 1HXMA 5C07A 3VD4A 3H3PH 4TVPH 3ME0A 4LOUD 5T1LB 5T1DH 4ZFFB 1JZ5A 4V1DB 5T1KD 3TO2B 5BJTB 1QACA 4W4NA 1JRHI 1AGBB 4JY4A 5BW7C 2VDNL 1WISA 5I16B 1S7VB 4H1LA 5M7QA 4QT5B 3MA7B 4TTDC 3CDGA 1PEWA 4Y1AD 2IC2A 4PJ8D 3K4DA 1Z2KA 2BNQE 4I4WA 2GQHA 3DRTA 4XVJL 3RUGF 5C8JA 4NQSA 5GJSH 4X6DA 5JDSA 4K23H 4Y0GA 4U6HA 1CDJA 5K9KA 4Y19E 3G6DH 4X9FA 4RMWA 1YNLL 2ZUQB 4NN7B 3UJTH 1KPRB 3SQOL 3VFRA 4NHCL 4PRDB 1T0NA 5HDOA 3W9EB 4Y4HC 4DGYL 1Q9OA 3HPLB 5TF1L 2GJ6B 2EDNA 2QSTA 4ERSH 4NO5A 3O41A 1P4LB 5C9KA 2NY0C 3QFJE 3I75B 2DIBA 4N5ED 3ULVF 5KSBA 1XGQB 1BFVH 1R5WB 1YEKL 2BC4A 3BAEL 5FF6A 3QPQD 1F3DH 3CLFL 3REWA 4WU5B 1OCWL 1LDPL 4HX1B 3WUWB 1FV1A 4CJ0A 1OD9A 3GMOA 2WINA 1B0RA 4OLVH 1SMAA 4LLDA 5KG9A 5TE6H 4P59H 1A1MB 4MB3A 1IAKA 1JHKH 3CK0L 4FXLA 2X4RB 4K94H 3VFUA 4ZFFA 1FIGH 3V6ZA 4ZUVB 2D9CA 3HFML 4X99B 1V05A 3FONB 1QVOA 1BFSA 3ARDB 4JFFD 2VXUL 1L6XA 4G6JL 5EO0A 1JV5A 2DBJA 1UB6A 3T2OA 5D7IB 5E99H 2LQRA 5IB1A 5HYJB 1CGVA 2WMPA 2F53A 3KPRD 4Z7WE 4ZFZA 2V6HA 2C4FT 2GJ6E 4RGND 4MXWL 3MRLB 3M17B 4P5TD 4NT6A 4QHMB 3DHJA 5HYJA 1CD8A 5DGRA 5MEOA 3FCTA 4LCWB 4GKSA 5J6GB 5JPMA 1I9EA 4M8QB 4JVWA 1KUMA 4MA3A 1AI1L 1QHOA 2CLVB 3MLTB 5FYKU 3RNQB 1ZA3A 3U36B 4YHPA 5C0CB 7FABL 2HN7B 1NGPL 4U1IB 3DYOA 2X4UA 2WIIB 4OIBA 3VWKD 2X7LB 1DQLH 3ORJA 1YJDL 4PLOB 5GXBB 2CO7B 4L1DA 4Z7UF 1NCUA 3REWB 2XY2A 2FSEB 3T4YA 3LZFH 4F7TA 1EAPB 3S4SB 1B0WA 2CH8A 2WWMD 2X89D 3UTSD 4MNQD 4JKMA 2JTDA 5CD3A 1TZIB 3BWUC 4OAWB 4LLAA 5MERB 5E6ID 3K2UL 4OCYH 4U31A 2X4NA 5GS1A 3V0WH 3NZ8B 1IC4L 1CFNB 3DJ9A 3KXFE 1NAMB 2X70B 1CXFA 1MWAA 5DFWH 5E8OB 2AJXH 3RX5A 4JO3H 1B2WH 1IFHH 4W6YB 4KRPD 5B3NA 4OJFH 3W5NA 5J6HA 4AYFA 5EUOB 4JZNB 5EUOF 4PJIF 3QUYD 1IKFH 4HJJH 4BZ1L 1YY8B 1HNFA 3DMMB 1QSFE 4OI8A 1J05A 1IM9D 1FVCA 3TCXA 3W39A 1MCJA 4P3CL 3TNNA 1GRWA 1VFAA 3QRGH 1GH7A 3WL9B 1TZGL 5T5NF 1VFMA 1X4XA 3ZE1E 3ZT7A 3OBAA 2YEZB 5DMKB 4L3EB 2R0WH 4H20L 4XXCC 3WIIH 4APQD 2DLFH 4UNUA 5GS2D 1RUMH 2CKNA 1NEZG 2QSCL 3KHQA 1DVFB 5I17B 4DUVA 1CCZA 2XN9D 1FFNB 3BQUC 4IOFC 1WTGT 3PABB 3UP1A 1JUFB 1RFDH 1Z3GL 5F6HI 1V3JA 4EBQH 1EAPA 4N0UB 4UINH 3PGDA 2B4CL 1JWSB 1LEKB 2ESVB 4LSTH 1GGUA 5KVMC 5KVGH 5HVGB 3LQZB 4O58L 4LKCA 1ADQA 3MOAL 1VFBB 2Z8RA 3EYUH 3GMRB 5FUZH 3RU8L 4O4YL 3WIHA 5DJYA 1A6TA 3AS3A 4NN5B 5ALBH 1CVRA 1CFNA 4CN4A 4O5LH 1QLEL 5HY9B 3BDBA 2AK4E 2YD7A 3MNVA 5AG8A 4OZ4B 4RCAA 1SJXA 3SDDC 4JR9H 4P49A 4GKSB 2O93L 2D3VA 4P48A 4NNPL 4EVNB 2E8ZA 2JELL 1TXKA 1QG3A 4PJAF 1C7TA 2BX5A 4Z95L 2YRPA 1PZUB 3Q1SL 1NFIB 4GBXB 5FUZL 3NCMA 2RFXA 5K9OB 5IB1B 3IFLH 5C9JB 2WIIA 2ZKHL 5E94A 2F58H 1OP5K 4J1UA 1QSFD 4MJIB 3HE6B 4HEPG 3FFDB 1KB5A 3ZHLA 2FHBA 1S7XB 4N1HB 5HYQA 1AGCB 1JWMB 1XF4B 4KMQA 3DBXA 3BIAX 5JPMB 5J6GA 2D7PA 1G6VK 2WP3O 1JRHL 4EN3D 5KG9B 4HGWA 5TE4H 3KYKL 5SWSB 4YHNB 1YN6A 4HIXL 2PXYC 3GMLA 4M02A 4WO4C 2AJUH 4XCYB 2BSRA 4MXVF 4KJWD 3PHSA 1UH2A 5LGKA 1ZS8A 4CU6A 3PQYD 1EEQA 4RBPH 5KSBE 1V7MH 5FKAB 4DK6A 4JFXA 4A6YH 2HVKA 3AU1A 4CGTA 2CLZB 5JIKA 2DLHA 4KK6D 4LAQH 2WNGA 4L8BB 3O45A 4FOMA 3PWLB 3RVTD 4Q74A 5I1KL 5J11B 3S5LB 1U91B 3U2SA 1HNGA 3FJTA 3TV3H 3WEXA 3PF2A 3I6LE 3LQAH 5D1ZC 1FNEB 1CT8A 3DX8A 1J0IA