5DHXB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
249
structure length
231
Chain Sequence
ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEIIQEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, light
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 56
structure length 231
sequence length 249
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhxB00
1IVLA 1EK3A 3I2CH 3DMMA 4FABH 4LKCB 1KJ3L 4Q9RH 4DUXA 2HVKB 5D5MF 3V2AR 4TPRH 5TE6L 1HHKB 4LVNB 3HAEA 5KBNC 5I1HH 1KIPA 1AD9B 2EECA 1EVTC 1MRFH 2BVUA 4QHMB 2IPKA 1VFUA 4Q6IB 1VSCA 5HVFB 3ARQA 4P57B 5F8QC 3WIFA 1FG2B 5E5MA 2E7LA 5DHVA 1F2QA 4PRDA 3DO3A 1F6LL 2GKIA 1OCWH 2XNAB 3CCHA 4KUCF 2EIEA 1CK0L 5C07A 1FSKC 4I77L 3VXMD 2X9WA 1CD1A 1X7QB 1WAAE 1A3RL 2MQ0A 4ZOBA 2ATKB 3OBAA 4U1SA 3TPKA 1T5XA 1L0XA 5FCUL 2I25N 3SCMB 2DQCL 2VLKB 2AQ3A 5A40E 3N85H 3VG9C 3BEWB 3SJVA 1N4XH 1UZ6F 1VPOL 1I85C 3D85A 4YFLI 4MDJA 1DQLL 1NL0H 3O2WH 3VXOA 3AREA 4FQ2L 3KPRD 1G6RH 2QHRH 3CU7A 3FJTA 2R0KL 3E0GA 2PO6B 2OJZL 4Z7QF 3SQOH 3D87B 1ORQB 4AMKL 1FL3B 1OSZB 2R8SH 1NCCL 3LV3A 4JY6A 3VDCA 3SDYL 1CDCA 4JJHA 5IBLC 1UXSA 4QRRD 5C0ND 3NVQA 4JRYD 1OF2A 2DKUA 2HWZH 4FOMA 4RAHA 1RURL 4PRAB 3IAQA 4QXUL 3K80A 2EICA 4OLVH 4Y1AA 4HULB 4Z78B 4UNUA 1FYTA 4HHAB 2GTZA 3HUJE 4WI5A 3HC0B 2BOBB 1IGYB 4JKLA 5GSVA 4BFGA 2ILLA 1TCRA 3HC3L 4GW1B 1MJ7L 4KJPD 3RKDD 1NCDL 5BXFB 5IWLC 1LO2L 1BIIA 5IHLB 4HKBA 5DVOA 4ZAKD 4MCYB 5FYLL 1XF4A 2QV2A 3O6MH 1RUAL 3OSKA 4L9LA 4X4XA 4HH9A 2DQTH 3TJEL 5HYQA 2VL5A 2PYFA 5HGBA 1BX2A 2BY3A 2HFEB 1KN4L 3D2UB 1MPAL 2X4PA 4JO3L 4FQIL 1YYLH 4OIIL 5FA4A 1NCAL 2ITDA 1B3JA 1DVFC 3BPNB 4U49A 1Z9SA 4RNRA 4FN0A 4U1GB 3HRPA 4IMLA 2H2SD 3CMOH 3IETB 1RIVH 2CK0H 4RFNC 1EO5A 2X7LA 2Z4QA 1H3PH 4Y89A 1FFOA 1J1OL 1DLHA 1N5AA 4YHMH 5EOCJ 2KZWA 3H9SE 3SKJH 1UKSA 3DX6B 3FMGH 2X40A 2BSRB 3QEGL 2DTMH 5ESAA 1M7XA 1PLGH 3MREB 4FFYL 3FKUS 5FM5O 5C07E 2GCYB 2PN5A 2Y6SD 3QEUA 4E41A 3PWUA 3KG5A 5HY9B 1U0QA 4FRWA 4OLYH 4OIAA 1MF2H 4HLZH 2HJFA 5EU6B 3RVUD 2VISB 4R26H 5DEFB 1YEFL 3PL6A 3QZWG 3FO1A 4LLAA 5D4QA 4EVNA 1TJIL 1GXEA 3PXHA 5T3XD 3SJVE 3NBNA 2FYYB 4JY4B 2PTVA 2J8UB 4ZNEE 5SX4H 2ITCA 1U8MB 1UM4L 3C09C 5ALBH 4HWBA 4PREA 2NY6D 5ESQB 3VGGA 4OLWH 4FQ1L 2Y5TB 3MLVL 5D7LD 5D71L 4AEFA 2GJ6A 3FO0L 3OKLA 3MBEA 3MRLB 4ONHA 5DGQA 3HUJF 1BJMA 5C8JB 2XACC 4PGDB 1Z9LA 3PQYB 4PGEA 1P9MA 1JZ6A 2AXGB 5IESL 3TA3D 2XRAH 4M8VA 4PTTA 2FHCA 4LCWE 4ODUB 3QUXB 4ZUTA 3CFJB 2BMKA 1KF9B 3GB7A 2AGJH 4L4JA 4JFQA 3ILQC 3IF1B 3FQTA 4NQEA 5A16B 3G5XA 4JFDB 1S7TA 1V3MA 1JPTL 1U92B 2RQ8A 1IAIH 3L5JA 32C2A 3C6SA 4KAQL 2WWMD 4ZOCA 2Z93B 3M8OL 1DP0A 1AI1H 5IMKB 4V1DA 4O58H 3BH8A 3CFDA 5I1EL 5ICZB 2GQHA 1YY8A 4Y16B 5IR1A 2FJHA 2HLAA 1VFBA 4JJ5B 1DDHB 2X4RB 2JCCB 5JUEL 3TT1L 1TIUA 5ERWA 2QSVA 3VJ6B 2NW3A 4WI7A 3GJFB 4N8VB 3IKCB 3L3KA 2O61A 3NCYP 3RPIB 5C09D 4Z0XA 2DS4A 3GSRB 4P49A 4N9GB 4X7CC 5LG1A 1CGYA 3CDYA 1K6QH 2APXA 4P5TA 2O5YH 1ZHKB 5F1IA 2DIBA 1PX3A 3QUYD 4YHYB 2X2YA 5GRJL 1N6QL 3MZGB 1HYSC 2N7AA 3OAUL 4PP2A 2GY5A 1KCVH 3EKCA 1JPSH 2DIJA 2OSLA 1HSAB 3EYOA 4PRPB 1CVRA 1ZT4A 1BWWA 1WCBB 4JZNB 2VLLA 5FM8A 3RX8A 1AGBB 1QRNA 1BFOB 4NOBA 4WUUA 1U93A 4JGUA 4MA8L 4R8WH 2D0FA 2DWDA 4DVBA 4U1JB 5EO1B 5C9KA 1ZVSB 4NNXA 3ARDD 4MNQA 5GS3A 4K7FA 4X7FC 4GXUN 1PQZB 1N0XH 2WWKT 4EN3B 1KEGH 4G8GD 3VWKC 2XWTB 4QRRE 2YZ8A 5ALCL 2HYMA 3N50A 2IALB 4NQCA 4KK6C 4YE4H 3CVHA 3O0RL 4X5XA 4F58L 1DFBL 3M17B 4G9FD 4DN4L 3IFNL 2BSTA 1RK1A 3ES6B 3ARGB 3D69B 5EZJB 1KPVA 3QBTB 5CGMA 1NMCC 3KLHC 5EBMA 2YPKB 3AS1A 4HFUH 4FZEH 4RMQA 4H20L 4QRSB 4LEXL 5FYLD 3QEHA 3WKNA 1AKJD 1E27A 3B9KD 2XWJA 4EUPA 4OSUH 2OTUB 4PRBA 3QIWC 1ZLVH 2AJSH 1UQSA 4LOUC 1ZLWH 2VIRA 2DWEB 3PWPB 3RPKA 4DGIL 4JO1L 4MD0B 5MEOB 4V1DE 3ARFD 4MNHA 4HGKC 3H0TA 2JJVA 1PYWA 2VUYA 4LNRA 4Q6YA 3VRIB 4XNQA 1WBXB 2I24N 2Y72A 2B0SL 1BFVL 3D3VA 1JYWA 4RIRB 5BW7A 4GBXC 4EKXA 3T2NL 1E28A 4LF3A 3VGHA 1U8KB 3IDYC 3N0PB 3RUGA 1N6VA 5C0BD 1A1MB 4BSVB 2DI7A 1XF5A 3F58H 1CDIA 2C26A 1IRAY 1UCBH 1A7QL 2VDLH 2CLVB 4HUNB 5B3JE 2X4UA 1NQBA 2GITA 5IHUL 4PJHB 1HILB 1TPXB 3SE8L 4Y2DA 3MV8B 4LCYB 4U1MB 5ID1A 5INCB 3NH7H 1T2QL 1JHKH 2BFVH 2WAHA 2JJTC 3K46A 4U2ZA 5HI4C 4OF3A 3P0VH 5FUOL 1R6VA 4HK3N 1U91A 4OUUB 2A6JA 5DHYA 3QG7H 4XXCC 5T3XE 1PSKH 4XCCL 3ZYIA 5AZ2L 4PJFA 2NCMA 1G7PA 3OKNA 4YWGL 1BJ1H 1CCZA 4WUUE 5DWUL 5I8OL 4L4VA 4P3WA 4TUOB 4M62H 1UYWH 5CEYA 4X9GA 3X11A 1N2RA 4LASH 1BFSA 4MNQE 3UAJD 5LXGH 4QTHA 3RGVD 2VOTA 2NTSP 4HFWB 2Z8VC 1BEYL 1Q0YH 3MGAA 5E8NB 1P4BL 3QWQB 2HT4C 4POYA 3OR7A 4R7NA 3RVXC 3S35L 5B8CB 4NQCE 2F53A 3OKDB 2UZYB 4BZ2H 5E24E 1U95B 1TJHH 5GS2H 3GMLB 3DX9B 5HHXH 2SEBB 5DK2B 2VZ1A 4H1LH 4Z76A 3S5LA 2AJUH 4MQXC 4P46B 1VFMA 1JNLL 3G6JB 1PG7X 5DYOA 5E2TL 4QHNA 3R4DA 4QOKB 3JBG7 1ONQB 4G43B 2IJ0C 3DI2B 4G6AC 2W65A 4G6FB 1J0JA 1X5ZA 1B6DA 4H5SA 1PX4A 4X4ZA 3HG1A 3EJZC 4YNYB 3MV9B 3AB0C 1K2DB 1O7SA 2VR5A 1BMGA 4JQXA 4HX1A 1DEDA 4HBCL 3BHBA 3MFFB 1QTYT 1AY1L 1RZGB 2F58L 4FG6D 4G3YL 5AYUH 2QADD 1ADQH 5ADPH 3QNYA 4HUWA 2Q86B 3FB5A 4NWUH 2GSIA 4PPTA 1A1NA 2X1OA 4MAYD 1U8NB 4GKZA 4HS6A 5C09E 3TF7C 5B3JF 1EX0A 4LCIL 3FFCB 4LLWB 1I7TB 5CEZH 1IQWL 2NXZD 1CGXA 1BZ7B 4LCUA 3RUGE 3TO4B 4HIIA 4QKXB 3KJ4B 1Q9WB 3MLZL 5TE7L 3UZVB 3SE9L 5BMFL 4KZEH 4OT1L 1CXIA 3HS0A 4KI5D 3VFTB 2ED8A 3S88H 4MCZA 5CP3A 1CLZH 2YUVA 1NC4B 2XN9B 3N1GC 3S6CA 1Y6MR 1S7RA 2MMXA 1W72H 4NRYA 3LB6D 1GJIA 3H42L 2FEEI 1IC4L 3VXPB 1P4IL 4ACPA 1C12A 4NBXB 1NDMA 4NQDA 3RNKB 2H9GA 3H6JA 5F3BB 5IFJB 5GJSL 5I8CA 1ZTXH 4PJFE 4MHHI 2VKWA 4OJFL 5DMYA 1MCOH 2ZZUT 2PETA 2ZCHH 1GGBL 1XGTA 2IH3A 1G9NC 1CL7L 2KPNA 4L4VE 2V7HA 2BC4B 2E6PA 1EXUA 3LZFH 1E4XH 1RZKL 3LEVH 4G9FE 1JWMB 5D70H 1GH7A 3QFJB 5KTEH 2E7CA 3SCMD 5BQ7B 2VLKD 4TOYL 5C92A 2GFBB 5E9DB 3RZCA 1BJ1J 2F53E 1FZOB 4R96A 1HQ4A 3BDXA 3JTTA 2OJEA 2YD9A 5GZOD 1QRKA 4XP1H 1NLDH 1X44A 2VLJB 1XGPA 2PO6D 4CBPA 2I9TB 1QLEL 4OZ4A 1L6ZA 1U8HA 1JTPA 3HN3A 5FYLE 1DN0A 4XNXH 3EYUL 3SBWC 1WISA 1DL7H 1T6WA 3ARYA 1NFIA 1I3GH 4M7ZB 1U3ZA 3S34H 3ARVA 4RGNC 4S1SH 3RWFA 2HG5A 1CFTB 3HG1E 5CBAB 2AW2A 4XXDB 3DGCR 1SM3L 1B2WL 4OQTA 1F00I 3GMRA 2QQKL 5E08H 1UA6H 3DVIA 3DETD 3RUGF 5L9DH 2WZPD 3LHPH 3JV6A 4S11A 3QHFL 4LSTH 5JXED 3QPXH 5EU3A 1DBKL 1UG9A 3RWHA 2A9ML 3U9PH 2DDQL 1UZ8B 5AWNH 3ZHLA 2A74B 4HUUB 2VO5A 1P6FA 4Z95H 4KKBD 2ID5A 3D2UD 5KZCB 5TDNA 2IF7A 5DK0B 2CIIB 5HBBA 2PXYC 1IBGH 4LPVA 1VEPA 3SGJA 5F7DA 5DVLA 2AI0H 1JPST 1R3KA 4PJFF 5GXBB 5IKCB 4OI9A 4YC2B 5IB3B 4S2SA 3A6BH 4YHLH 1QFOA 2W92A 1UJ3B 1MFCL 1JWSA 4NQDE 5ILTL 2VZUA 4N8VG 5MHSE 4I13B 5TE4L 3OKYA 3VRJB 3IFLH 35C8H 3ESUF 4UIKL 1QBBA 1BQHB 5GHWH 3UTSA 1G9NH 2ADJA 3EOBA 3L7EA 2DJSA 5I15H 5EU6D 2VDRH 5CIPB 4JHBA 4LHUB 1EO8H 1H0DB 4ZSOE 3VFVA 3TGXA 2X1XR 2WBKA 2XZAL 5DDHB 3G08A 4OM1L 3WUWB 4ODBD 3HNVH 2AEQH 3SKOA 4M61A 3WE6B 4GAJH 1X5LA 1B6UA 2VDPL 3S98A 2VMFA 1K4DA 4KVNL 4MD5B 1OB1B 5DMKA 5E6IC 3GMMB 4JG1H 4M6NL 4M8QB 2COQA 4JHWL 2YBRB 1U3YA 3ROLB 5DS8A 3DV4A 5F89B 3W2DH 3BGMA 5D7JB 3PQYD 5TQ0H 3JWDL 3D39A 4KMLB 3O6KH 5FO8A 3RA7H 4ONFL 2EDWA 5C0GA 5IEHB 4PGBA 4MMXC 5CUSH 4OUOA 3QUXD 4ALAH 2C3VA 2H26B 4TSCH 3SGEI 4O5LL 1ZS8A 2MQCA 3ZDZE 4JFDD 5SX4I 2V9RA 3LKSA 4YO0A 1HDMA 3BP4A 1HHIB 1DQDH 5IVZB 3WHE0 5KSUA 4R4FH 5GRZA 3NZ8B 3Q1SH 2DLFL 3WIHL 1JL8A 3WLBB 5IQ9B 2L7UA 3E1F1 3EZ8A 3TBYA 4OKVA 2Q1EA 1WT5C 5IJKA 1KUMA 3O81A 4MA1C 1S5HB 4XC3L 1ZA6A 1WWAX 4Y16D 4I1NB 4RAVB 3GUTB 2P44B 1I75A 1P6AB 1ZE3C 1AE6L 4JY5L 4OI7A 3GI9H 5C0IB 1NUNB 4PLKC 5DSCB 2IFFH 3W5MA 3QQ3B 4CVWA 3HI5H 4F8TA 3RWJB 5DD0H 12E8L 1HQRB 1XGRA 2HRLA 3LKPB 2VXTH 1ZGLP 2I9LB 3MREA 3RU8L 5JW5A 2A0LD 1IAII 3CK0L 4OI8A 1BP3B 1J12A 3GBNH 1F58H 3NMEA 4UOW1 4WVRA 2XXMB 4ISVB 3WD5H 3SGKA 1LK2A 4ETQB 3VW3H 3LQMA 5A2FA 2B1HH 3KPMB 1OP5K 5FUZH 3S36H 4QRTB 2ZUQB 4LIQH 1OARH 4PRPD 5CJBA 5DJDA 3UTSE 4YHNA 4I9WD 4OLZL 5ITBL 1JNHA 2ORBH 4ZS7H 1T21B 3UX9B 4PJ9B 1AIFB 1F45A 2EKSB 3QXAA 4LLYB 3EGSB 2FNBA 3HPJB 4KH2A 1YEJH 4GRWE 4YBQD 3BGAA 4MA3B 3VE0A 2YR3A 2VXQH 1TNMA 3BPLB 3LEYH 1KSRA 4G8FB 5KJRH 4EI6A 2NYYD 4LLDA 5IIEA 1PVHA 4DKEL 1TLKA 3RWGB 1U8LA 4X6CB 4EN3D 1OAYL 2BVPB 3DVGA 4DCQB 1WWCA 5KSBB 1P1ZA 3C9NA 2ICWB 2VLRA 1MCPL 3FQRA 1JBJA 4NM8H 3WXWH 3TV3H 2RGSA 4PRIA 4PTUA 3WS6A 1GC1L 1H15A 2F8XC 1F8TH 5HHQA 2AP2A 1DBML 3QXVA 3ZDZF 1J87A 4JFDA 3ARGD 1AO7B 4PUBH 5GS1B 4YR6A 1JGDA 5I66A 3ILPB 4JO4L 4F33A 3BQUA 4JHAL 5HGAB 4WNQA 4UILL 1EZVX 1S7SB 2OTPA 1U36A 4IS6B 4J8RA 5KSAC 1OAXL 1EHAA 4EIZC 3FT4A 2FBOJ 3SKNB 3T4YB 3MSPA 4UV4L 1YEEL 3K2UL 3H3PL 1RAMA 4RAUB 4CRPA 4NSKA 3ARBA 1WICA 5IMOB 4CADA 3PWPD 4MSWB 3MLSL 5GGQL 1U8JA 1KTLB 1RZ8A 4FQPA 1OLLA 1T4KA 1D6VL 1U8IB 1T1XA 3ZT5A 3KYOB 5K59E 3LPGA 3WFEL 4Q2ZB 1ZLVK 1WLHA 3UAJC 1ZLWK 3VFOA 4OCYL 4AQ1B 3GKZA 2AABL 4Z7VA 4F9LA 2AK4B 1ZHKA 1IKNC 5TPWH 4UT7H 4KRNA 4LVOB 4NJ9H 4NQXB 3U0TB 3MRPA 1V7NH 5C9JB 2CDFB 5HVHC 4KHTL 4LKXA 2FBJL 1A7PH 2YD5A 1R3IL 2QTEA 1EEYA 5CJXA 4J2XA 2X4TB 3MV8D 1QYGL 1RMFH 3GSOB 4JGJA 4XPHL 5F6IC 4NCC2 1BBJA 2DMKA 3HAEG 4E5XA 3IFPA 4ZUUA 2ZJSH 3BIKA 4PJ5B 1AP2A 4GRWF 3A67L 2HH0L 5JDSA 4WTZA 1UJTA 5JOFB 2WBJB 3KYNA 3NIGE 4G42A 5GISL 1FVEB 5IP4A 4PLJC 4QHLB 1H5BB 5I1KH 2G9HA 4PY7A 4ZDHA 1XGQA 4ZUVB 5JO5A 4Y4FB 1XH3B 3CLEH 4YPJA 5J4MA 4MJ2A 3WDIA 4ELMA 4S1QH 3T0EC 4AENB 3F62A 3TVMC 1AGCA 3HZMA 3EO9H 2X70B 3MLTB 2VLRE 3KWWB 2R0WL 1A9EA 2Z91A 1ZHNB 4JB9H 2FEDD 2NXZC 3I75B 5EO9B 1TVDA 3CUPA 1GAFL 3QDJB 2DB8A 4XP4H 3WXVL 3LS5H 4KI5C 3RVTD 3SY0A 4P46D 1A3QA 3QIUA 1A5FH 4JFDE 3OKEA 1TCMA 3O6FA 1PJ9A 3KAAA 4QOKD 4GQ9L 3L7FB 2W38A 4WHYG 3L3JA 4WV1C 1INEL 3G04A 3MGOA 4WHTB 4XCNB 2Q8BH 4K94C 4G6FD 1DUYA 4NNYB 4CU6A 4HQQH 1TTFA 1IGTA 3MV9D 3MRRB 4XHJD 5K59F 2GUOA 4I0KA 1F6AB 5EBGA 3QA3A 4XPFL 3ULSB 3O41A 2OR9H 3U6RA 4LSRH 5CD5C 4OM0H 1KGCE 2F74B 2L4OA 5IFHH 1B4JH 4XMPH 1MVUA 4HC1H 3SE3A 3BKJH 4MD4B 3H2WA 3RIFF 4N8CL 1UXWB 4WEBL 5EOQL 3FFCD 1RUML 1GGYA 4UAOC 4NUGL 4P3CL 1A47A 3ZKXB 2OL3A 5DJ2B 5ENWA 3TO4D 3VXUB 3AXLB 3MV8A 2XTJC 5E5UB 5IJVA 3LQAL 1F4XH 3EYQD 1KACB 3TH4T 2OZ4H 3WO4C 3NCYS 4P5KA 1OAKL 1FDLH 4OUUA 5I1IH 1NC4D 3BPCB 2C1OA 2XN9D 4PRPE 5MENB 3GI8H 1DE4A 4HDIB 1LO4H 1GVIA 4YDLC 3NIGF 3EJYC 2EC9T 1CG9B 1EUUA 3T1FB 2W0FA 5CEXA 4XVUC 1NJ9A 3IDGB 4DN3L 4P4RA 2EXWD 4RMUA 2C7UB 2R9HD 3MRDA 3L5XL 4HF5L 4L8SB 1R3LA 3VD5A 4KKLC 2XQYK 1CBVL 4ONGL 1EGJH 1F42A 2R4SL 1CFSB 2IAMA 4EOWH 4P23B 1A6TA 3SDXB 3L6FB 3PWVB 4QF1A 4UQ3B 3QFJD 4NQSA 1BQHG 4U6YB 4YH6A 3T08A 4U6VL 5E9DD 3ZTNH 3WFHB 1RUKH 1IM9A 4LHUG 4GRLA 1JHTB 2VLJD 3RX5A 3WUWG 3H7LA 3WIIH 5DJCB 4D0CA 4O2FA 1N5YH 1CU4H 3BPNC 4TULL 3DO7B 3C8DA 1MELA 5FECB 3MRGB 4NBYB 4JM2C 1DTUA 2R15A 4K94H 2DIAA 4JR9L 1JK8B 4Z7UA 3BAEH 3F7QA 5C3TA 1UGNA 3NCEB 2EYRB 5TDOB 4PJCA 1LE9B 4CMMA 2A77L 1I1FA 5DC0A 4BQ9A 3FHAA 3BIAX 4UB0H 3BIBX 5D7KE 1IKFL 4BUGA 4ODTH 1I7RA 5ESVB 1EHXA 3WCYA 2EO1A 4PJHE 4L4TB 1X6LA 4KVCH 3MV8E 1DEEA 3B8YA 4JN1L 3QIBB 5KVDL 3MOAL 4NKQB 5KZCD 1FZMB 3K1DA 1JZ3A 5CJQL 4Z5RA 4AK1A 3AAZB 4K71B 5FOBA 1VGKB 4YDJB 5E4EC 4IHOA 3VD3A 5I8KL 1IC5H 1F90L 3LDBC 2HT2C 3RWEB 1QR4A 4MB5A 5DJ6B 4GRMA 4JFPA 5I1JL 5KSVA 1NCUA 3CC5A 4XTRD 4K23L 2B20A 4NPYB 1KT2A 1J5OH 2B5IC 3FRUA 1NAKH 3V0VB 5GJTL 1Q9OB 3KHOA 9CGTA 4BZYA 1M7DB 4I5BB 1ZGLA 5BZWA 5D6CB 1T0MA 2P5WA 4WW2B 2Y36H 2DRUA 3MMEB 1CD9B 4LHUD 1N7MH 1CFNA 1PKOA 1U2HA 5KANI 3QWRD 4QO1A 4B53A 1IQDB 1JZ2A 4UDUB 3C08L 4WCYH 1IL1A 4LGSB 2DBLL 3VDAA 4HS3B 4U1KB 1K5NB 1FIEA 4QOKE 4CU7A 4QGYA 2LQRA 4RMVA 2N4IA 1FNFA 2EXYD 1KFAL 2P24A 3JXAA 3QI9A 4CVUA 1RQ5A 3NACH 1YEDB 5KW9H 4XAWL 4OLUH 3UJJL 4LCCB 3T0VA 5HJ3A 3KXFB 2XOTA 5D7JD 3G5ZA 3VXTA 1AD0A 3HFML 3NCFB 3QQ4A 5EC2B 2EIDA 2NY3B 2EDDA 1SEQH 3EYVA 4Z7UE 2HRPL 4HJGB 4YHPA 5E7BA 3UTTB 3QHZH 4Y5VB 3BMVA 1GZPB 5I30L 1HHJA 2HA1A 1OAUL 4OCMC 1YEIL 3O9WB 1V7MH 4UI2A 5SWSB 1ZT7A 4ERSL 4R9HA 5E00A 1FLTX 4BZ1L 1I3RB 5BZDA 2XQBL 4NZRH 4PJHF 3L3HA 3X12A 1DSFL 3EHBD 5E6ZA 3TWCH 3HB3D 1A7NL 3VXRA 3RWCB 1QFPA 4UINH 5GGSB 1MCNA 3BKYL 2OK0H 3V6OC 5I1DB 4PRHB 2FO4A 2XN9E 5F9WC 2GYSA 3QULA 3FB8B 2JK5A 3IS0X 4LVEA 3MRJA 2AJVL 3X14B 1KBGH 4JKKA 1URLA 3WFDL 3EYFB 5JW4M 1JMZA 4Y0GA 4LHJB 2DAVA 3W0WB 1CI5A 1MCKA 3W9DB 3UPAA 4JPWL 4WI9A 2Q20A 4C83B 3TO2A 3VWJC 3B5HA 5JXAL 4ODSH 1XAUA 2X09A 2R2BA 4KPHH 4KUZL 5C2BH 3NN8B 3PV6B 5B3NA 2YPVL 4F57L 2Z31C 3ARZA 4YIQA 1NUFA 3MJ6A 2Q7YB 4NRZA 1U3HA 4FXLA 1Y6KR 5DTFA 2CXGA 2N7BA 1FL5A 2V9QA 1H3XA 2Q8AL 3JTSB 3QWRA 4LSVH 3QFJE 2CUMA 1UM5L 2JLLA 2P5WE 3T8XA 3F6IA 5CBEB 1OW0A 4PJ9D 4O02H 3QUKB 4FNLL 1Z9MA 1N59A 4GG6A 1LGVA 5EC1A 2GK0A 3G5YA 1UT9A 5DJYB 4XVJH 3M1BB 2VLJE 3GSUB 2CRIA 4AEHH 1JF1B 3CAFA 3OF6A 3WSQL 4HK3J 2DLHA 4LDEB 2YBRA 5IEKB 5IT2L 4LARH 2JELL 3TN0B 3SKMA 5E6YA 1MQ8A 4PB9H 4GG8B 4XX1E 5L8KB 1T2JA 4Z7UF 1NCTA 4DUVA 4Y5YB 2D7MA 3GRWL 5TH2B 1KEMH 4K8RC 4L29B 5IEHA 1FBIL 1IT9H 1XCQA 4TNWK 4HKJB 5F6HI 4XBEL 1K8DA 4KQ4H 1MSPA 3ZO0A 1C08B 3S5LG 3L1OH 3LPWA 3NCJH 1T0NA 1AO7D 3INUH 4XZUB 2WK2A 4WU5A 1TPXC 3MCLL 1RUPH 4TN9A 5DRXB 3MJ8B 1WVZA 1KNOB 1SHMA 4XBGA 3H9YA 4EI5B 4MB4A 1KN2L 3TZVB 4AIZB 4BFIA 4C4KO 4DVRH 3MNVA 4ZTOH 5CHNA 1KTRL 5CWSA 4U0RB 5JDJA 2BOCB 4PRNA 3LSOA 1P7KA 4X5WB 3I02B 4P9HL 4RAVA 3OX8A 2IQ9L 4YHOH 3AY4C 4C56A 2XZQH 4ZUSB 1VFAA 1KLGA 4XP9H 1OTSC 2EDBA 3BVNA 1RI8A 5JOEA 4DK6A 3ZYJA 4HIJA 4U1LB 5F96L 4DTGH 3ZT6A 5KS9B 5FO9B 4LSUH 5DJ0B 3LKPA 3MRBA 3C8HA 2B2XL 3RBSA 1I8IB 4D94A 2AK4D 5FM5M 5F9JB 2AXJA 4WRLA 5F9AC 1DUZB 4QT5B 2RFXB 2VH5H 2XKUA 3RRQA 4CUCA 3L3IA 3ALWA 1IEAA 1VGEL 3WEXA 1IM3B 1L7IH 1XF2A 2X4SB 5DRWB 1V5JA 7FABL 3SGDI 4HEPG 2AJZB 1INDH 1MCFA 3ARUA 4RGOL 4LHQB 4PJ5D 3HPJA 2BK8A 1A7RL 1Z5LB 4DZBA 4IRSA 4DKDC 1S9VA 1FC1A 1YJDL 3V6FA 5K93A 2WBJD 1PZ5B 3D9AH 4UTBH 4YEEA 4YDIL 5IBUB 1R24B 1Q1JH 3QCTL 1EV2E 4QCIB 2OI9B 4QRUA 4QXGL 4LPTA 3OKOB 2P8MA 2WINA 4Y4FD 1C7SA 2GK2A 3S4SA 1I8KA 4L8BB 5FHAL 4G6KH 1LO0L 3JUYA 3B9DA 3MRNA 3QSKB 4Z6AT 3BD4A 4X6DB 2JJSA 2A1WH 1Q0XH 3T2PA 4AEIL 3WFZA 3UDWC 4G6JH 3DUUA 3NAAL 4K8RH 4MMZC 3C5ZB 2VDMH 3KJ4C 3QDJD 3DMMC 3K8LA 1FLRL 3NFSL 3SHSA 4PJEB 2ZOKA 3TIEA 4NO0A 4PV9A 4M3KB 1QA9A 2Q76A 2P46B 4LQ1A 2FWOB 5JLZB 4C55A 1PKQA 1NKOA 2ZCKH 4RFOL 1Q9KA 3FOMB 5EDXA 3F12B 3ET9F 4JRWA 5D96B 3DVNB 1ED3B 2E7LC 3IU3A 4Z0BL 4TTGA 4YBLC 4X9HA 1QO3B 1ZVHA 4PJIB 1UACL 2D0HA 4A2MA 1P5UA 4XCEA 3LQZB 4A6YB 2JB6B 5C0RL 2BCKA 3ABZA 1FNGA 1HKLL 3GSWB 3O8XA 1MFDL 4XC1H 3QO1A 3TPUA 4WU7B 3PJSB 1HSBB 4Y19A 2F54B 3DGGA 4GW4A 5F1NA 2CDFA 4AH2A 4WUKH 1YPZA 1FYHB 3DPBA 4OQ1A 1G0DA 4Y5XA 1XFPA 4NNPL 5JPMA 4BFEA 1NPUA 5I16B 4KROC 3VXUD 5L6YH 1LEGA 1TZHB 1G0XA 2NZIA 1GIGL 3OHXA 4PS4H 1TQCC 4N90E 5J1AB 3LMJL 2EDJA 2XZCH 3CLFL 5FDYA 3LOWA 5MEND 4LAQL 3U0PA 3EBAA 4HKZA 3GMOB 2WBWB 1MFAH 1B0GA 4KKCD 3K4DA 2DQFA 1GPOL 5L0QB 1MIEH 3T3ME 1YEKH 1JN6A 4NQVA 3V4UL 1I9RH 1MLCA 4YDVB 4R4ND 2VXUH 2OBGA 4FXKB 2IPUK 4R97C 4JFEA 4ODWB 1IC1A 3IFOA 1ACZA 4X6CE 5I17B 1S9YA 1N8ZA 1KPRA 5KSBE 4WGVB 2YC1B 1G7HA 5IK3B 2QQLH 2O93L 2NXYB 3GSNA 4P23D 4FTVA 4L9LC 1P5VA 2ESVA 1UB6B 1YDPA 2GTWB 1T66D 3BP6A 5I74C 1AR1D 3MO1A 2D9QB 5L8JB 2HT3D 4Y2OA 4RWYH 1Z0MA 3VI3E 3DRTA 1AO7E 4LSPL 4O4YL 3FN3A 3L7FA 4XI5C 4UQ2B 2WQ8A 2I5YH 4CVZB 4BQCA 3VGBA 1Q94B 1T7YA 2N1KA 4L5FL 1S78C 4P4KA 3HAEH 1WWBX 2J88L 1KJ2A 3ULVL 1S7WB 2AJ3B 1R5IA 4I3RH 4F7TA 5F1SA 3Q6FA 4NIKB 2E6QA 3CDGB 2J8OA 3KNBB 5DD3H 4JPKL 3NA9H 5DHVH 2FR4A 3IDJB 2ZCLL 1T89A 2DQHH 3HLAA 4QHKJ 5EN2A 3K2MC 1IAMA 3TT3H 3BMWA 1MI5B 3BYTA 1I3UA 3W9EB 3FFDB 3QRFM 2RCSH 2DQJH 5LBSL 3Q0HA 3TYFA 4H25A 5JQHC 3PL6C 1U41A 4UT9H 1MCWM 3QJFA 1K4CB 4IJ3B 4BSWB 2DQDH 4PG9B 3PDOB 1T04B 1HN1A 3I6GA 2R1WB 3LKOA 3EOTH 3OQ3B 1IGMH 2CLZA 3L3DB 4LRIA 3LRSA 4L4TD 4KRPC 1MJUH 4XAKD 2XKNA 4BK5A 4LLUB 3KVQA 4B7IA 1IFHL 4FQQA 3VXNA 5LGJB 3DWTA 3QIBD 5DA4A 3DRQB 2QKIB 1QBAA 3T3MF 5KVFL 1DBAL 1VEMA 4UDTB 5FGCB 3MBEC 1JZ7A 4PJ5E 3QRGL 1S7QB 4NT6A 4U1IB 4WHYH 4HWNA 1BGXH 1ND0B 1N64L 5INDB 4UTAL 1P9MC 5HYSB 1MRCL 5IVXB 4JZOB 4X6CF 3S3PA 2CH8A 1X4ZA 3DIFB 5KSBF 5D1XA 3LEXA 1KIQA 1OT2A 4IMKC 5E2UL 5ITFB 3K4AA 3QDAA 1NFDA 2D4FA 5FM4A 4RX4D 2VL4A 3L6FA 3GRWA 4JFEE 3RWIB 4XWOD 5JA8B 4YXKH 4R3SA 3JWOC 3ARWA 5DO2D 3VI3F 1M4KA 1XR9A 3CDFA 3OGCA 4WI3A 3FT3A 5EO0A 5JZ7C 5CSGA 3QDJE 4JQVA 5HHOA 4M43H 4UU9B 3HZYA 3BUYB 5IB1A 1NCWH 4AYFA 3MZTA 2J6EA 2G2RB 2YKLH 3MBXL 3IDXH 3DO7A 2VQ1B 1F4HA 4UBDD 6FABL 3F6LA 1RJZA 4NN6B 3VGDA 5GRVK 3P4NB 4L9DA 4OZGB 3MLYH 1OGAB 5IW1A 3QYCA 2NTFA 4P5TC 1FFNB 4DEPB 4YK4B 3KXFD 3F7RA 1D9KA 4OGXL 4YHIB 2D03H 4XNUH 3WJJC 2NY3D 2O5ZL 3ZTJG 5JIIA 3UTTD 4MZ2A 1MUJB 4N5EC 2DD8H 2J8HA 5GGVH 3O9WD 5SWSD 2CRZA 5D9SA 2VITB 3P9MB 3MFGB 1HINL 1QBLL 4XPTH 2M26A 2DL2A 3MRFA 5AZEH 3N9GL 3VFNB 4M9PA 5H2BB 1ZT1A 1CTOA 5DMJB 1OWWA 4PRHD 1C5DB 1QLRA 5JIHA 1DBBH 4NGHL 1NBVH 4HWBH 5ACZB 5MENE 3F7YB 5A3ID 4K3DH 3HE6A 5DJ6A 1ZANH 1S9KC 3EOAB 4APQA 3EO1B 3MRMB 1V3JA 4UNTA 2X89D 3W0WD 2FGWH 1M71B 3GIVA 1ROWA 5F21B 1JI1A 3VU2A 3QNZA 2WNGA 3V0VA 3DARA 3T09A 5BV7C 3O6LH 1D5IL 1X5IA 4OFYA 1LVEA 3SOBH 5EU5B 2W9EH 4NZTH 1FH5L 1MJJA 3EAKA 1JYNA 2WUCH 2R1YB 4LMQE 4LSQL 3SDXE 2CPCA 1LDPL 3KPQB 4LRNL 4M7KL 1G6RB 5CKGA 4KTDL 3JWOH 2GY7B 4X5LA 1SJHA 3LKRA 1F3DH 4GSDH 4NHUA 3V5KB 4WTZG 4OZHB 4MQ7A 1V3LA 4JDVA 5ID0A 3TIDA 3H9HB 5ADOH 5CJ5A 1KXVC 1TTGA 3A6OA 4R2GC 2F19H 5J13C 3PHQA 2OLDA 2R0LL 5JR1L 1BZ9A 2GJZB 4Q9QH 3I6KA 3JSSA 5BO1H 3MJGX 1NEZB 1D5ZB 5BW7C 3BH9B 4PIRF 5C0FB 3TN0D 3ULVD 1KB9J 4WJ5A 5I76B 4QEGA 3S8WA 4KK9C 1OTTD 2XKSA 4JZJB 2ZSWB 5TFSH 3WJLA 4GKSA 4U6HA 2EZ0D 4OCWH 4FS0A 3D18A 2VZTA 4JN2A 4EDXB 4Y2DC 2FATL 2MHAA 4O51A 1CF8L 3MLRH 5DUPL 2DM7A 3VH8A 2GAZB 1S7UB 2V5TA 5C0JA 1R5WA 4FFVC 2ADGB 5FA3A 1DCLA 3STBA 4OZIA 1CE1H 1YUHA 1Z3GH 2BSSB 5DFTA 4X4MA 4CJ0A 1WEJH 2DQIH 5CZVH 5GGSA 4EI5D 2EIZB 3PNWA 3QO0B 2C3GA 2R0ZH 4IIQB 3TZVD 4MDIA 5FYKD 4HZAA 3O11B 4QTIL 3MPCA 4J3TA 1MNUL 4L4TE 1LO5B 3QUMA 4WWKA 4U1HB 3UJTH 3HI6L 3PWJB 1NCBL 1BBDH 1TQBC 1TZGL 2WQRA 2FH6A 2V17L 1H5BC 3V5HB 3LIZL 4ZYKB 4DQOL 2BY1A 3NFNB 4Y4FC 5J9PB 2AERT 1EBPA 1WIUA 3MACH 4Z8FH 1U8QB 1FVDB 3L3OA 4NO5A 3KPNA 3T2OA 3I9GL 5JHDB 4J7RA 2KKQA 1FSKB 1NGWB 4YGVA 3SDXF 3TJHD 2Y9RT 5C08B 5IB4B 5BV7H 1KLUA 4NC2B 1NGXB 3WV0A 4X99B 5DF0A 3FONB 3O2DA 4AQOA 3BEVA 2VDQL 4ZQKB 3DI3B 2MSPA 5HGHB 4DAGL 4KTEH 5GS0C 4AG4H 3MRIB 1BHGA 2EEBA 4ORGA 2Q6WB 3MRQB 4YDKH 4XP5L 5H94B 3P0YH 5EA0H 3EYSL 1UFUA 5D72H 3OMZA 3DXAA 2UUDK 4JQXC 4EUPH 5DJ8B 3HCVA 3GSXA 5H35A 1KJ3H 1YMHB 4LL9A 4Z77B 2OQJA 4DZ8A 4GMTL 4HV8A 2DMCA 4BH7B 5H37G 3RVWD 1RZ7L 1KJVB 1CDBA 5IQ7L 4OCRL 1AGDA 1FAIL 2YXMA 1NAMB 1MEXL 5E8OB 1JFQH 1F3DJ 2AKRB 4OZFA 1TMCB 2Q3ZA 5FGRA 3I50L 1W8OA 4I77H 5LGHH 1K8IA 2PW1B 2AV7A 1A3RH 3O45A 1EEZB 3HI1A 5HTSA 3UTTE 4M1GH 5GGSY 3C5ZD 2FRGP 2W60B 4ODXA 5SWSE 1KNOA 2EH8H 2X05A 2GT9A 4OCNC 3ULUD 1F11A 4U6XA 1AFVH 3I3DA 5T33H 1CXHA 1JF5A 4OZIE 2BRRL 2BOCA 1O7VA 1I4FB 1X5AA 2UY7A 3RVVD 2Y1VA 4WFED 1J05A 5J3HD 5HXMA 3MNWB 2FEEL 2R0KH 3BSZH 2PYEA 3HRZB 3BE1L 1ITCA 3UC0L 4UT6H 1CE6B 3U1SH 4IOIA 4J1UA 1I1AA 4HAGA 5BRZA 4JQIL 1BQSA 1DVFB 2DKSA 1TVBA 1NCCH 4L8SC 1JGEB 5AD0B 5EUKA 1KC5L 2BSED 3OPZH 1EO7A 4RFNB 3FQXA 1W0WB 3GMNB 2R1XB 4MQSB 3A6CL 3UCRA 2AEIT 3RZCC 4UIMB 2F54D 1F3JB 4LEOA 1FNHA 2AXFA 4OTXL 4FFWD 4FABL 5E1AB 1JUFA 3L95A 3VG0L 3QJHB 4Q9RL 4E42A 4WW2F 3LN4A 2E9BA 3KLAA 5I1HL 4YFEA 3PWNB 3BDBA 2JIXA 1MRFL 1L9NA 4N0FB 5A43C 3O3AA 1I9EA 1LEKB 1ODAA 4MXVE 5C0EB 5I0DA 5J6HA 5IMMA 3MLPA 3BP5A 1NMBH 3QDGB 5GS0H 1I8LA 1OCWL 5DVMA 4P2RA 4F7CA 5KG9A 4FQIH 3PGCB 3GHEH 4OIIH 3C09B 4N0CD 2W1NA 3DXAE 5KVMC 3FO9A 1D5MA 3DHJA 3D25B 5HYSG 3P40A 4U7MA 5AEAA 4PR5A 5AG9A 3SDAA 1ZKAA 5K9KA 5HI5C 1ZV5A 2Y5EA 3E8UH 1X5GA 1AXTH 3ULVE 2AJXH 3N85L 4V2BA 2CKBA 1N4XL 2I07B 2WUBH 4OF7A 1FJ1A 1NL0L 3SE4A 4F80A 2WP3O 2NXYD 5EBWB 3I3EA 3WHXA 4LDOB 2QHRL 3S3JA 2XFXB 3Q3GB 4YAQA 3VMNA 1GRWA 3SQOL 4HZLB 5HD8D 5D1QA 1FRGL 1ORSA 4J6RH 4PJXA 4OZIF 2R8SL 3DSFH 3IDMA 5CP3H 3IRZA 3BISA 3SGJC 2G60L 1T2XA 1C8PA 1QACA 4YFLF 4OD1L 3BZEA 3JZ7A 3RX7A 3LAFA 4F7EB 1F4AA 4WDIB 1VCAA 2HWZL 1A6WL 2CD0A 3EDJA 2NY4C 1A7OH 4OLVL 3MUY1 5I8EB 3GMQB 5DUBB 2V2XB 1U6AH 1MAKA 2X4OA 2PYEE 2A6IA 3KPPA 4D0BA 3DURB 4D9RD 5BRZE 3ARXA 3MRCA 2HFTA 4ZFZB 1ZA3B 1MI5D 3T3PE 3E6HB 5E8EB 3P9WB 1CFVL 3O6ML 4FMKA 5CGYD 2DQTL 4ZOEA 5IESH 2QHLA 4YGAB 4OBRA 3ARTA 3HE7D 3K3QA 3FQWA 3KPOB 3CZFB 3SPVA 1YYLL 2J4WH 2BVQA 4LPCA 3W82A 1VERA 1BVKA 4OGYH 1FNLA 2CMRH 1UB5B 2WMPA 1JPTH 4MXVF 2I60H 3CH1A 1F4WL 4AZ8A 5J6GB 4HGMA 3BZ4A 4JFFB 4U7SA 3CMOL 1RIVL 2CK0L 1GGUA 4RZCB 4YZFE 1H3PL 3L5HA 1TITA 4YHML 1X5KA 2HTLD 1ZLUH 1HXMA 5L2JA 3FMGL 5I1EH 1F3RB 2P43B 1OT1A 4F9PA 1PLGL 3ULVF 2CQVA 3VFPB 1UWGH 4OLYL 3GO1H 3EO0B 4OQTH 4U3HA 2CUIA 4RMRA 1XIWA 1CICA 1SYSA 3DV6A 1JGVH 5I6XB 3U7AA 3L9RB 3EFFB 4H1LB 4DFHA 5KN5B 4HS8L 4W4OA 5ALBL 3VFRB 2CK2A 3OAUH 2EE9A 5IJKC 2G5BA 1S7XA 1KTDB 4P2OA 4PJEE 1NMCB 1QVOA 5I1LA 3GSVB 4J4PD 1KB9K 4PJXE 3ROOA 3BN9C 4XRCB 2DM4A 3MJ7B 4PJBA 3TBWB 5E99H 1OLZA 5F7EH 5F7FA 4WFEE 4FQHB 3HR5A 3HNSH 4PV8A 3QIWB 1DQJA 5ELIA 3IDJA 3QNXB 1S9WB 4PJIE 5T1KA 3FOLB 4AM0B 5ANMB 3BESR 1FC2D 1OGAD 5M7QA 3UBXB 5FK9A 5E70A 3T3PF 3HMWH 4D0DB 3ZZ1A 3PGDA 4NDMA 5D1ZB 3RI5K 3NFPB 1Q38A 3REVB 4GAGH 5EOTA 1T22B 3C8KB 3V5DB 3SGKC 4KK8D 1IAIL 1MY7A 1NGZA 4GBXB 3O0RH 3HE7A 4F58H 2DM3A 3IDYB 2EH7H 2F54E 2YRLA 3MX0A 3IGAB 5FGSA 2P5EB 1AI1L 2WIIB 3IJSA 1UWXK 4NN5C 5HSFA 3P11L 5KOVC 5T3ZD 4B0MM 4X7TA 2EKJA 3TNMA 4NM4H 2VZVA 1W72B 4YZFF 3DYOA 2IADB 3KDMA 1I7ZB 1MHPH 3C6LA 1FO0B 4H20H 4IEFB 5B39A 4BFBD 3L5WA 3TFKD 1AQDA 4YPGB 2X1QA 4JZOA 3SO3C 2ZSVB 2O5YL 1C16B 4Y8DC 3WS6C 5D2NA 5ISZB 5AUMB 3QQNA 1YEGL 4KKNA 1KCVL 3T65B 4M00A 1I8MB 4S0TD 1JPSL 2B0SH 1BFVH 4MB3A 1Q72H 3T2NH 1EAPB 4KK5C 3BQUC 2NY2C 5LQBH 3TBVA 4H0IA 4MJIA 1NEUA 3BD5A 3GK8H 4HLZG 3T77B 3OJDA 1N3NB 4PJEF 4WO4A 4E0RB 3QPQD 4PJXF 3SE8H 5FUCC 3ARBC 5F3HB 1ZHLB 3QFDB 5EFIB 3U4EB 1N0XL 1KEGL 1MHEB 5T5NG 4PJIF 4B41A 4YE4L 2RB8A 4OLXL 1S5IH 5E94A 4F9LC 3U9UB 4TUJB 4J12A 3AB0B 3U2SB 1MY5A 5DWUH 3WO3B 3ZKNC 2R29L 5KVGH 2YEZB 3HPLA 4EDWH 4NO2A 4IRJA 1YQ2A 2BVOB 5J12C 1RZKC 1IEBA 4ZS6D 1BEYH 5CJXC 1MI5E 4K3EH 4HFUL 3MYZA 4FZEL 2BERA 4WFGD 1LP9B 1P4BH 5TDPB 3S35H 1BVLA 1J1XL 3FB6A 2UZXB 4OSUL 5GIRA 3IYLW 2D7TH 3FQUB 5C0CB 2VERN 1J0IA 4ZO8A 1G7QA 1JNLH 3D5OF 5HYJA 5FYJL 1LILA 4HMEA 1UM6H 2V2WB 5BCAA 5DQJA 5IROA 3D0LA 1D3CA 1S7VB 6CGTA 2IGFH 3AMLA 2Z92A 3OL2A 4QY8A 4BKLA 4WI2A 2P7TA 3P4MA 5IHZB 1YMMB 4N0UA 2PUQT 3IDIB 1JGUH 3F58L 4FFZH 1UCBL 3AU1B 1A4KA 4R4BA 4NZDA 4YHKL 1MFEL 5HHVL 1AY1H 3TBTA 3LKNB 2EE2A 2YD7A 5TJWK 3OZ9H 3LH2H 4MWFA 1P4LB 5D2NE 3U36A 5EBLA 1J86A 1A6AA 1NCNA 5JHDD 1IAKB 1J9CT 5I71B 1QP1A 2BFVL 3QIUC 3V6ZB 5C08D 2GSGA 3O6FC 3GGWB 4NJAH 4LCIH 4X8JB 3QG7L 4X4YB 4PYHA 1WGOA 5DD1H 1PSKL 3RL1B 4ZPTB 5TF1L 3ULUC 3MRHA 2DTSA 4ZTPH 2YD3A 1TDQA 5TQ2L 1FFPA 1QFWH 5F7MC 2A73A 5FB8A 1U3JA 5JPNA 4OLEA 5EPMB 2WM0A 2CXKA 3B9VA 5MERB 1X4XA 4M62L 1UYWL 3VFMA 4ZMAT 5IW6B 1XT5A 3CXDL 5FYKH 1HHHB 5IGXH 3QHTC 4KDTA 4Y8AA 4C54A 1HXYA 2KDGA 3ALPA 3IJHB 3H42H 1IC4H 3SE3C 3P77A 1NBZB 2ICWI 5IBLD 4RGNB 2VAAB 1LEIB 1FIGH 5GJSH 2Y07H 3IAPA 3BT2H 5FF6B 2R56H 2AJUL 4XPGH 4UV7L 4F2MA 2HJLB 4QXWA 1BD2A 4X9IA 3S37X 2D31A 5C6TL 4AIXA 1RZKH 5HGDA 1KJMA 4XGZA 5D7IB 1FZJB 1PG7W 2BNRA 1AGFB 4OAWA 1BECA 4P3DB 4HXAL 5HDOA 2MOVA 1GSMA 4MA7H 3LCYA 4LLQA 2ZUUA 4XWGL 4ZNCD 4W6XB 2K7QA 2Z0BA 5AYUL 2VABB 1ADQL 1FAKT 1XEDA 4R0LA 4NWUL 1H3TA 4M7JL 4YFDB 5HYJE 3EYUH 2PXYB 4Z7WB 3H3BC 4ZYKA 2HAZA 1DVFD 3NFNA 1TENA 3K0WA 1XCTB 1CT8B 1HIML 2IAMC 2A6DB 3JWDC 4RDQF 5D2LA 4L3CA 1KOAA 5CEZL 4XVSH 1FL6A 3E6FB 4KZEL 1E6JL 3RAJH 4G7VL 4JFXA 4X8XA 4C57C 2W91A 1CLZL 1B2WH 5CD3B 4I2XA 3DROA 4XNMB 1GOFA 2WV3A 1UVQB 2HKFH 4GRLC 2BNQB 1JCKA 3CX5J 43CAB 2WLYA 5BJTB 1W72L 3GJEA 5HPMB 4XVTH 2A9MH 1FGVL 1HOCB 4QHUB 4I3SH 3X17A 2Z35A 3ULUH 1ZTXL 3WFCH 3GBMH 3QEQB 3QDGD 1MCOL 2DM2A 2KQNA 4KJYB 3GSQA 5K9OB 2AEWA 3LZFL 4CGTA 5E6IB 4L3EB 2JJUA 3IJYA 4JFOA 4A6YH 5D70L 5ABDE 3SDCA 3UPRB 1MCRA 2FSEA 3B3IA 1MFCH 2PCPB 3G9VA 4GKNA 3RNQB 2HKHL 2H8PB 3IT8D 4ZFOB 4KJQC 1ZSDA 2ADIA 3O2VH 2H3NA 4XP1L 1NLDL 2UYLA 5T1LA 4UIKH 2OL3H 2WLZA 4H1LG 4WFGE 2OTWB 1LD9A 4XNXL 1E4WL 1G7IB 5JNYA 2G75A 3ILQD 4S0SD 1DL7L 1VADB 4UZGA 3QZWB 5GZND 1I3GL 1AGEA 2E9JA 4P2QB 5D5MA 1RIHL 1RPQA 4P59H 3X3GH 2H6PA 4NRXB 4BH8B 4X6BA 2VDPH 3EOYG 4MA1B 5IOPB 4TRPL 1T5WB 1UA6L 2H1PH 5BVJA 3CFKA 1YC8A 4JRXA 4O2CB 2R69H 2BRQA 3LHPL 4JHWH 1GZQB 2IFGA 4KKAC 1GC1C 2FX8H 3UBXG 4LSTL 1QQDA 1P7QA 3U9PL 2X4QB 5C0AB 3T0WA 1OY3B 1JF6A 5D2LE 1J0ZA 1KB5L 4HPYH 5FDWB 4M5ZL 4QRPB 4Z95L 15C8L 3F7VA 5JHDE 2NW2B 3O3UN 1JRHH 5CZXC 1M7IA 1HYSD 4I2XE 4O5LH 1NLBH 1OD7A 1PG7H 2B1AL 2NX5B 1MHCA 1M05B 1J1PH 4HCRA 4JFFD 3QI9C 3A6BL 3ZYZA 4YHLL 3QH3A 1N0LA 1YN7A 2XQYG 2H32A 4JPIA 4M6AA 3C60A 5IB5B 3UYPA 1JPGA 1QPPA 1RZIB 3IFLL 4MX7B 35C8L 4I18A 4NKMB 5IF0A 4GW5A 4YK4C 5GHWL 3U4BH 4KDWA 1G9NL 1ZLUK 5KVEL 1VKXB 3VFSB 3N1FC 4RRPG 4CJ1A 5DC9B 4PJ8A 3KR3L 3VXSA 5I15L 2IBGA 1T1ZB 3BKCH 4HGWA 4PBWD 2VDRL 4MJ6A 1EO8L 2FL5A 4JLRA 4KK6D 3C5SA 3LPFA 1NBQA 2ARJB 5GS2D 3HNVL 3RU8H 2R4RH 5DGRA 1RUQH 3MRKA 1HH6B 2CIKA 4GAJL 5JORA 2EYTB 1GCFA 3IXTA 4Y4KA 3TNNB 1WBZB 2P8PB 1WQVT 4JG1L 2P8LA 2BVTA 3KLHD 1QR1A 5CMAB 5ITBH 4XCYA 5GRXG 1BFTA 3BZFA 2BX5A 5EZLB 2EDEA 3W2DL 5I75C 5KSAB 3PDDA 4HIHA 2DICA 3UTQB 3QIWD 1MIMH 3IVKA 4LOUD 3P9LA 1L7TH 3DURA 4OF5A 4KRMB 1NUGA 1JV5B 2J5LC 3DX7A 4X98A 2MCPH 3QWOB 1U3HC 4TSCL 5D1ZD 1OAYH 1WAAA 3CNKA 5D2LF 1ZHBA 3VH8G 1DQQB 1MCSA 4JRXE 5CJ8A 1MCPH 1INQB 1KCSH 4QXTA 1DQDL 4GBXD 1FNEA 5CEZD 3PGFL 4R4FL 1BREA 3HKFA 3Q1SL 1WIOA 4HKXB 1GC1H 2OR7A 2NPLX 5ICXB 1MLBB 3GHBH 4DFIA 1ZMYA 1HCVA 3OKMA 4ZXBA 1OW0C 3V8CA 2P5ED 1Y18A 1DBMH 4KWUA 4I48B 5CP7B 2QQQA 3CFBA 1XZ0A 1CFQA 2LVEA 4TVPH 4HWUA 4ZUWA 5C0DB 4JO4H 2ATPA 2ICEA 1Y0LA 3IDNA 5CAYB 4NQTA 4UILH 5F6IB 5HI4D 5I19H 1RZFL 3GI9L 2IFFL 4M1CC 2VWEE 1OAXH 1ZWIA 3TCXA 5TGBB 1FV1A 3HI5L 5DD0L 4HXBH 4OV5B 1MHHA 3K2UH 4WI4A 4ZPVA 8CGTA 1C1EH 4D9QD 1J10A 5ISZD 3MLSH 1NBYA 3GBNL 1CZ8H 1F58L 1OP9A 3HUJA 4H26B 3VWKA 3WS3B 5SX5K 4A2LA 3CFEB 3WD5L 3VW3L 2IQAA 1T1WB 2B1HL 4RMWA 4U1NB 5FUZL 3S36L 4WTWA 3T0EB 4LIQL 1OARL 3TVMB 3B6SB 4M93B 2DMBA 4I4WA 4LLMB 5HHPA 2ORBL 4ZS7L 5CSZA 4KC3B 3VXSE 2HT4D 4C59B 1A6VH 3RVXD 5AYQA 1BLNB 5GGRA 1YNTB 4AL8L 1JZ4A 1XF1A 1T20A 2FBJH 1YEJL 4X83A 1R3IH 3VFGL 3U7WH 2YN5A 4LVHC 1HI6A 2ARWA 1NGPH 5D8JH 3OR6B 4MQXD 2Q3AA 1MJ8H 4PJDA 3VCLB 4LPYA 5T3ZH 1F5WA 1JVKA 4FHBD 4D8PA 1EFXB 1SJEB 2AAVA 3BO8A 4WV1B 4NM8L 3FCTB 4WW1A 3TV3L 4HK0B 2XV6B 4G6AD 3BXNB 3CSYA 3RDTA 5DRNB 4Z7NE 1YY9C 4JDTH 5ACMA 4K3JH 3EJZD 5B38A 4ZFOL 1HHGB 1J8KA 3SDDA 3H9SA 3P4LA 5DEGB 5FYJE 1XR8B 2QSTA 1T3FB 4Y4HA 8FABB 4PUBL 1MFNA 1DQML 3K74B 2R2EA 5BS0B 1MH5A 4AT6A 3NTCL 3FO2A 3RTQA 2HJKA 3KYKH 2W07A 5DLML 1JWUB 2CDEB 1EEUA 1L0QA 3C5JB 4I8DA 1DR9A 4ZO6A 4ONOA 4NKOB 4UAOB 1FVCB 4P2CG 2DLGA 4IRSC 5C0CD 2XTJB 4ZNEA 1ZK9A 2HN7B 43C9B 3WO4B 1IAOA 1NMAL 3WL9A 1OWRM 1A6UH 1XF3A 1AHWB 4G5ZH 1LNUB 4NO3A 2HFGL 3U46A 4KGLA 4I0PA 3EFDH 1INEH 2FX9H 4YDLB 2C1PA 1RJYA 2JJSC 5TPWL 4UT7L 3G6AB 1YMMD 1V7NL 2J1KA 4RQQA 4G7YL 3MR9A 2A83B 3CX5K 4JAMB 2VZSA 1A7PL 2C4FT 3O3DA 4PB0H 4NZJA 3QG6A 4LCWA 3S9DB 4ZFGL 1RMFL 4HLJA 4NFBA 5GGRY 1JP5A 4NYLB 2IH1A 2FJGA 4N8CH 1WC7A 4EBQL 2ZJSL 1RUMH 3RWDA 3QUZA 4NUGH 3P73B 1GHFL 1CR9H 1BPVA 3GNMH 3DUHA 1YC7A 4MJ5B 3O3BB 1CD0A 3IXAB 5I1KL 2FD6L 1LK3H 3AM8A 3CLEL 1NGYB 1TZIB 1MFBH 4Z7NF 3AMKA 4JREC 4PJDE 4N1HB 2NLJA 3ECBB 1R3HB 5DJXA 4KZDL 3H7BA 4RGND 1MAMH 1IMHC 1T1YB 5IG7B 4JB9L 4JM2B 4B5EA 4F7MB 3O4LB 5F7KC 5ANME 1KCUL 1QHPA 3L5XH 2ZOLB 4Y5XC 3LS5L 1D6EA 4G9DA 1G7LA 3VXMA 1CLOL 1WAAF 1A5FL 3AS2A 4DOHE 2E8YA 3FT2B 3O3EA 3S96B 2BXZA 2DYPB 1KB5A 5CEZE 2NY1C 2Q8BL 2XXCB 5EU4B 3S35X 5FYJU 5MEQB 2E3VA 1JNJA 2P5EE 4U6VH 1BOGA 3KPRA 1UENA 3PHOA 4OCLC 3I3BA 1UH3A 4G80A 4XBPA 2OR9L 4OM0L 3V0WH 5IFHL 2IANB 1B4JL 4XMPL 1I1YA 2VE6A 2ED9A 2ZUWA 2PXYD 3BKJL 3HZVB 1BQUA 2FZ3A 5E4EB 3AC0A 2R23B 3AVEA 4OGZA 4QRRA 3LDBB 3LRHA 4JRYA 4NP4L 3T4AA 2VDNH 3LN5A 4LQFL 4D9QE 4R7DB 5ISZE 3OXSA 1A2YB 2ZG2A 1A0QL 3PWLB 2B5IB 2OZ4L 4YXLH 3WNMA 3WDHA 2ED7A 3MV7B 4ZFFA 1NAMH 1A6ZA 4KJWC 5I1IL 3V9FA 4F7PB 2BNQD 3GI8L 3RL1A 3DJ9A 3WNPA 1G9MC 2FJFB 1IGJB 1LO4L 4ZAKA 4HIXL 1R0AH 3UO1H 2HVJB 3STLB 3CMGA 3UROR 4P4KC 3W39B 5GZNC 5SWQB 1EJOH 3Q6GH 4MLIA 5HDBE 3MNZA 3EZJB 1HHHA 4PJDF 1CGSL 2NMSA 3BWAB 3QEQD 4CNIB 1A1OA 5KVDH 1T89C 3MOAH 1P84K 5CJQH 3ZSSA 1QEWB 3ARSA 3P30H 1MWAL 5IMLB 2EEAA 5DQDH 1JE6A 2V7NA 4EOWL 3OKKA 1D7FA 3MCKA 3MXVH 5E6ID 4L3ED 1IGFH 3QDMB 4Z9KB 1A9BB 3CPLA 1EIBA 3X13A 1EBAA 2HJLA 5GSRB 5I73B 3ZTNL 1QUNA 1RUKL 3MUGB 3HZKB 4JFYA 5GJTH 1OP5H 4LRIC 5ETUB 3TCLB 4Q74A 1QKZH 2NNAA 3VXME 1XGUA 1G7JA 2P47B 3MQIA 2DQEH 1F97A 3TBSB 1LP9E 3WIIL 2X1WL 3PABA 1II4E 1ZAGA 3V7AG 1N5YL 5EWIH 3LRGA 1KIUA 2XYCA 3MUZ1 2XZZA 4X0KB 4P2QD 3SN6N 2VABA 2HFFA 4X6EB 4HIEA 4K94L 5FO7A 3UJIL 3BAEL 5DUMH 3KPRE 1U8PB 2PW2B 1P2CB 3V8OA 4O2EB 1U58A 2WW8A 5D1XC 1NDGB 5F9WB 5D7LA 5EUOB 1CT8A 1FN4B 2ICES 1KFAH 4TNVF 1NKRA 1C7TA 3LKQB 3B8SA 4XAWH 4LBEA 2ZWLT 1T03H 1LO3L 4PLKD 4UB0L 1HEZA 2IBBA 4CN1A 1PFCA 2PNDA 3TA3A 3VWJB 4JRYE 5C0AD 2V2TB 2R2HA 2QR0A 3REWA 1KLFA 3S7GA 3GSNH 1GOGA 3PF2A 3MA7B 3QXTA 3KPSB 4KMTL 2Z8WC 4KVCL 3OXRA 5I2IB 4QRPD 3VFUB 5I6XC 4JQVC 2Z31B 5I30H 1D5XA 3MA9L 3RL2A 4ENED 4WEMB 5IFAL 1BF8A 4P5MB 4LLVA 5HDBF 2XQBH 2CRMA 1IC5L 2NX5D 4Q58C 1DSFH 5E8PA 1G9MH 2FIKB 2IPUG 4P9HC 4ZG1A 2YRZA 3KYMB 1ETZB 4GLRI 4POZC 2XIDA 2R39A 4U3XA 1J5OL 1KJ2H 1KPUB 1NAKL 3UTZB 1D9KC 2YPLB 2AJVH 1TVHB 2QEJA 3W11C 1KIRB 5DFVC 3T0BA 5DD5H 3BP7A 5FKAB 5D1ZC 4K2UH 5C09A 1CDUA 2BNUA 4PJ7B 1MRDH 4M4RA 4RCAA 4RGNE 5DQ9B 5IM7B 5IB2A 5I1AB 1FZKA 1OTUD 4QYOA 3GMPA 1U8OA 5JXAH 3NABH 1WFOA 3L3GA 4KUZH 3QUYA 1ACYH 4CVXB 4JANA 4WCYL 5MEPB 1LP9F 3BW9B 4F57H 2YD1A 2L0DA 1AXSB 1KCKA 5LAXB 3R06A 4OB5H 5D7IE 2EEDA 3JV4B 1HZHL 1RHHB 3NACL 3HE6C 1QLFA 1YJDC 5KW9L 4OLUL 4X6FB 4FQXC 2VC2L 5HDQH 4APQC 1W0YT 4FNLH 25C8H 4G8EB 5KSAD 5KAQG 4L8CA 3EDEA 3FTGB 5EIIB 1SEQL 3ARDA 3ARPA 1OGTB 2BJML 3QHZL 2VZ3A 5HHNA 5DI8B 4G8GA 1V7ML 1EHLH 3M45A 3I84A 4NKDA 2JELH 3OB0H 3DTXB 5D7LE 1MCDA 1F6FB 5T1MB 1S8DA 4NZRL 1R3JB 3TYGH 5DMIH 3WN5A 3T1WA 4GUPB 4WIQA 3TWCL 4LSSH 3GRWH 3MGTA 4G9FA 2Q87A 1CIDA 4F3FB 2YSSB 1FBIH 4FQJH 4OF8A 1NC2B 2OK0L 3QQ9C 2AQ2A 4XPBL 1D5BB 2EYSA 5DJZB 5F7LB 4ELKA 4LIQE 3FB7B 1W0VA 3G5VB 3Q5OA 3CIQA 2X44D 5DD6A 2Y7QB 5DZNA 3RIAF 4PJAA 1SYVB 1IC7H 4HWZA 1AKJA 4OD2A 2J6EH 3B9KA 3WNOA 3VFWB 2VTFA 2UWEB 2EC9U 5LGKA 4ODSL 3ZSTA 4MX7A 4KPHL 1I7UA 4Q7DA 5DRZA 2NZ9C 3WJLC 4P9HH 5C2BL 4UUJB 4PY8J 2FB4L 2LTQC 3ARFA 3K8KA 4OF6A 1RK0A 1I9JH 1YN6A 2PTTB 3F65A 4PLJD 2P49B 1G7MA 3MROB 3P4OB 1A4JB 3HMXL 3DBXB 5F96H 5FKPA 3ALXA 4LSVL 4O9HH 3T0ED 3MOBH 4MNGA 5C0BA 3TVMD 5JW4Q 1R5VA 4O02L 4R90H 5E2WH 3K4ZA 1ES0B 5JA9A 2CDGB 2X4NB 3DUSA 1GGCL 3LS4H 4TUKH 5D7IF 3PIQA 1M6OB 3B2VL 1VACA 4AEHL 4M48H 3DMMB 1XMWA 4QRQA 3STZA 2YRPA 7FABH 4G8IA 3WKML 4LARL 5F88A 2W0LA 3HAEB 1KIPB 5J06A 4PB9L 4NKIL 4P2QE 2IPKB 2FO1A 1EFXD 3QAZB 3VXQA 1A7RH 1X5HA 3WIFB 4D3CL 3BN3B 3UZQA 5E5MB 1GYAA 5DHVB 2GEEA 5HYIA 1RJLA 4YBLB 4PRDB 1IT9L 1YJDH 1KG0A 5ICYA 1FO0H 2OP4H 1B0RA 4PJGA 4W70A 4YDIH 3CCHB 2NY5C 4HUVA 5C3LD 1MCIA 2XPGA 2Y23A 5C07B 1FORL 4L8DA 1CD1B 3V4PL 1DQQA 3RGVA 3INUL 4GXUM 2PTUA 4U1SB 5CD5D 1T5XB 5K9JL 1RUPL 3F5WA 4D9LH 1CYGA 4G8GE 5I71C 2AV1A 5BS0D 5F7NC 2HTKC 3SJVB 5C0AE 3D85B 1JPFA 4WFHD 4DVRL 4MDJB 4ZSOA 2IMNA 2YN3A 3VXOB 4QRPE 4YHOL 4KROB 4HMDA 1ITBB 4NQUA 2XTJD 4GAYA 3MV11 3D0VA 5J11C 2VXSL 1TQCB 2NX5E 1HH9A 3LV3B 1YYMH 4JY6B 4LSUL 1YNLL 4RISH 5GGUA 4PJAE 1UXSB 3EJYD 1LE5A 1OF2B 4XVUD 5I1GH 4NHCL 4QWWC 1MWAA 4Y1AB 3RY6A 2VH5L 4WFFD 3MODL 1FYTB 3MYJA 2GTZB 1S9XA 1HKLH 1L7IL 5GSVB 4R97B 4DKFH 4MAYA 1TCRB 1A14H 2A6KA 3OTTA 4KKLD 5CCKH 2AVGA 1INDL 1BIIB 1ZEAH 4HKBB 2DN7A 2FH8A 2F8OA 3QXDA 1WZ1L 1XF4B 4L9LB 5CJOH 4KXZH 4X4XB 4HH9B 4MNGE 5C0BE 5I74B 5HYQB 2PYFB 1WFTA 5HGBB 1GOHA 1BX2B 4RFEA 5IV2A 2X4PB 1BQLH 1Q1JL 4GXVL 5IBTH 4MQTB 1GIGH 1WJ3A 3DX8A 5FA4B 4BUHA 2ITDB 4LKCA 3LMJH 1C5CL 3QUMH 3CLFH 2HVKA 4RNRB 4G6KL 1HHKA 2D0GA 2XY2A 3QCVH 1AD9A 4FP8H 4QHMA 2A1WL 2X7LB 2Z4QB 4Q6IA 3KPTA 1FFOB 4P57A 1JGLH 1FG2A 1DLHB 3ZKMD 8FABA 4K8RL 4JM2D 3O4LD 2XNAA 4N9OB 2VDML 4TQEH 5ESAB 4PJGE 3ZLQC 2NY5H 3J7HA 4P0DA 5E8DL 1X7QA 3QEUB 4E41B 3BRFA 3PWUB 1H3GA 2ATKA 2D7QA 5JW3L 1Z2KA 2ZCKL 2HJFB 2DYPD 1DBJL 4C4KT 1DANT 3SCMA 2VLKA 3O2DH 3PL6B 3FO1B 3BEWA 4EVNB 4KI1A 2DF3A 1JJUA 3FRPG 1YECH 2BHZA 1J88A 3VRLE 1I8LC 2J3SA 2NQCA 2ITCB 1CLCA 4YUEH 3FAXA 4DGYH 3B2UC 4PREB 1TETH 2PO6A 4KRPB 4EXKA 1KXQE 4YHZL 4PJAF 3THML 1ORQA 4XC1L 3SDAC 1FL3A 2GJ6B 1OHQA 2IAND 1KV3A 1OSZA 5AAWA 3OKLB 3MBEB 4ONHB 4HWEL 3N1PC 2APVA 4PGEB 2HT2D 3SE4C 4ESKA 4WUKL 1C5BL 3RFZC 4PRAA 2UVEA 5GGTH 2ZCLH 5SV3A 4PTTB 4Z78A 1MQKL 4HHAA 4OZFH 4ZUTB 2BMKB 3HC0A 1PDKA 5D1QC 2BOBA 3GB7B 4NN7C 1IGYA 4PS4L 4JFQB 3FQTB 4NQEB 3MV7D 4GW1A 3G5XB 1MREH 1S7TB 5BXFA 4HG4J 5JXEA 32C2B 3C6SB 4MCYA 3NIFE 2ADFL 3WMSA 1YEKL 5F7YC 1I9RL 3KLDA 4V1DB 3HNTL 3TP4A 4OV6F 3BH8B 2HFEA 3D2UA 3CFDB 2JB5L 4KI5E 1YY8B 5IR1B 2FJHB 2HLAB 1VFBB 4C58B 2OM5A 1QOKA 4U3CA 5E2JA 5ERWB 5KVFH 4H0HB 2NW3B 3QRGH 1J11A 2QQLL 1NFKA 3L3KB 2O61B 3IETA 5D93C 1N64H 4Z0XB 2VKXA 1WIPA 4PJGF 3PP3H 3QDMD 5F97E 1CVSC 1IGCH 2YUXA 4P5TB 1RU9L 5F1IB 5E2UH 3DX6A 2BSRA 5F7HA 3MJ9L 4PP2B 4AIOA 2I5YL 2GCYA 2OSLB 1NGQH 2MQ3A 3EYOB 5HY9A 5K9QG 3VRLF 1ZT4B 5EU6A 4ENEC 2VLLB 2B4CL 3OJ2C 4OGAC 2VISA 5DEFA 1QRNB 1PBYA 4I3RL 4WUUB 1V8HA 1U93B 2VLKE 2FYYA 4JY4A 2DWDB 2XTJE 5DD3L 2J8UA 4CN4A 3NA9L 4DVBB 5HI3D 1Q8MA 5L88L 1U8MA 2DQHL 4NNXB 4MNQB 2ENYA 4K7FB 3TT3L 1X6NA 5ESQA 2X42A 2HLFC 2D7NA 4W6YB 2Y5TA 6FABH 2RCSL 1XGYH 2DQJL 1LMKA 4NQCB 3MRLA 3CVIH 4UT9L 3CVHB 4X5XB 1XIWC 1CICC 5C8JA 4PGDA 3ZKSD 3PQYA 2DQDL 2CKBH 4WFFE 2BSTB 5CFHA 2AXGA 1OTUC 3VWJD 3EOTL 3HMXA 1EVUA 4EZMA 5BV7B 1JHLL 1RK1B 3KPSD 4ODUA 2E8ZA 3QUXA 3CFJA 1KPVB 3QB7C 4P2OC 2Z31D 3IF1A 5EBMB 5A16A 4HUXB 5FV2A 5DVNA 1U92A 4L1HA 1CTNA 3QEHB 1BGXL 1E27B 4KI5F 2UV3A 2XWJB 4EUPB 2Z93A 1YEHH 1T6VN 1UQSB 2VIRB 5IMKA 5KAQF 5HVGB 1PEWA 4MNHB 1FCCA 5ICZA 4Y16A 3H0TB 4R2GB 1PYWB 4JJ5A 4LNRB 5J13B 1YA5A 3GEWB 1DDHA 2Q7NA 2X4RA 2YPLD 4XNQB 2JCCA 1NSNH 3D3VB 4YXKL 3VJ6A 3GDBA 5GRYA 1E28B 3GJFA 4N8VA 3IKCA 4LF3B 3RPIA 3RUGB 3IU4H 3GSRA 4GKOA 1XF5B 1CXKA 3O4LE 4N9GA 2OMNA 4K8RD 2X4UB 3TCLA 3NOIA 2GITB 2EE3A 4M43L 5GPRA 1MCEA 4Y2DB 1NCWL 4RGMC 4H8WC 3V7MA 5ID1B 2YKLL 4ODHH 1HSAA 4X0KA 4PRPA 1U91B 5DHYB 1LDPH 2A6JB 1WCBA 4M7KH 4JZNA 5JHLL 1QFUL 1AGBA 1BFOA 5EU6E 3OJMB 3MLYL 4PJFB 3V6OA 1G7PB 3OKNB 2X6MA 4U1JA 5EO1A 4L4VB 2D03L 2J8UE 1KCRH 1ZVSA 5CEYB 5DA0B 4YX2L 3QISA 3X11B 5DR5H 1N2RB 1GGIH 4QTHB 1PQZA 4H88H 1OTSD 1TQBB 5GGVL 4EN3A 3UYRH 2E7BA 2XWTA 1FFQA 5EORH 3WUZA 2IALA 3OR7B 2C3WA 4R7NB 2F53B 3M17A 4K9EC 4M93C 4I0CC 4WO4C 4XPTL 3PQYE 5AZEL 2VQUA 3OB0K 4Z76B 1NC2D 2VZOA 3S5LB 3ES6A 3ARGA 3D69A 3MV7E 5EZJA 1DBBL 4HWBL 2CO7B 5DYOB 4QHNB 4FZ8H 1IZKA 4NCC1 3B43A 4K3DL 2F9BT 3GM0A 2YPKA 5F70A 4P2YA 2D2OA 1ZANL 4QRSA 3ZKQD 2FGWL 4H5SB 3HG1B 2Z8SA 2OTUA 1AQKL 3F8UB 4DGVL 4HX1B 4KHXH 3BHBB 3O6LL 4WHDA 2DI9A 4MYWB 3HI6H 2DWEA 4N0YH 3PWPA 1F4YH 4XMLH 4IRJC 3QNYB 4MD0A 5MEOA 3BRDA 4HUWB 1IZJA 4NC1E 3FB5B 3SOBL 2GSIB 1A1NB 1TZGH 3BOVA 2V17H 2AJYH 2WUCL 4JM2F 3LIZH 1WBXA 3VRIA 4GKZB 4HS6B 2E9IA 4RIRA 2JCCE 1Z0NA 3D6GA 1CN4A 4GJTB 1U8KA 1UKTA 1A1MA 4BSVA 4XHQA 4N1EA 4LCUB 4HIIB 3FN0H 2CLVA 5DZOA 3HS0B 1OP3H 4NC0B 4MCZB 5ADOL 5LAXA 4PJHA 1HILA 2F19L 2CGRH 4U1MA 4LCYA 2W9DL 3DMMD 5INCA 4Q9BA 4XPAL 5FEBA 2VDQH 5BO1L 4H8WH 5IROC 4DAGH 4XNYH 4NRYB 1AHWC 1BOYA 3T0XA 2J8UF 4I9WE 1C12B 1NDMB 4NQDB 5TFSL 1M1SA 2CSPA 2X5PA 2ZUSA 2OYPA 5I8CB 4TSBH 2FCBA 4HJ0C 3V6OE 4X7EC 3UBXI 2A9NH 2OS7A 3MLRL 4TUOA 4TYUA 4MXWH 1XGTB 2IH3B 5EUOE 5C07D 2YHGA 5IQ7H 2V7HB 4YLQT 4HFWA 1EXUB 4XB7A 4IOFC 4JM4H 1Z3GL 2C4XA 5E8NA 2DQIL 4OCSL 5B8CA 3OKDA 3SJVD 3RZCB 3D85D 1U95A 3MC0A 4N8PA 4R96B 3GMLA 3DX9A 2SEBA 1HQ4B 5DK2A 3UJTL 3JTTB 3NPZB 2OJEB 4K9EH 5F1OB 4JG0L 4KROD 1XGPB 4P46A 3G6JA 4NFCA 1BBDL 4KDTC 1U8HB 4OZ4B 5BOZG 2V5SA 1DN0B 4QOKA 1A8JH 1ONQA 3OV6A 4G43A 4UOW0 1NFIB 2BRRH 2YUWA 3WIHA 3RWFB 2HG5B 2XA8H 4YNYA 3MV9A 4NZUL 3C87A 1K2DA 4KQ3H 5B4MC 4WY7L 3MFFA 3JWNC 3ZKMC 4Y1AD 1RZGA 4JQIH 1MCJA 2JCCF 1A4JA 1FYTD 4HG4K 4K7PL 3PWPE 2Q86A 2HP4A 1E4XI 3GMRB 4AJ0A 5I1CH 1U8NA 3JV6B 4KTEL 4PJ7E 2MPAH 4AG4L 4LLWA 5EU3B 3FFCA 1WITA 2ZG3A 3RWHB 3PHSA 3MJ9A 1I7TA 3P0YL 5EA0L 4GT7A 4OTXH 1BZ7A 3TO4A 1Q9WA 2FDBP 3VG0H 1V3KA 5J56B 3VFTA 4EXPX 5F1KC 3RHWF 4R0LC 5TDNB 1NC4A 1PY4A 2XN9A 4XI5D 5F7DB 1W8NA 3O4OB 3T04D 1R3KB 1S78D 2NR6C 2AS5M 4S2SB 2NY4B 1JFQL 3VXPA 5EUOF 2E7MA 4M1DH 1JWSB 3RNKA 1WFUA 5F3BA 5LGHL 5IFJA 3N1MC 1OD9A 3UMTA 4YEFA 4M1GL 1KELH 4KXZI 3H3KA 2MNUA 2EH8L 4W81A 1SEBB 1AFVL 3UTSB 2BC4A 2ADJB 3CXHK 4E41D 1QG3A 5T33L 1TJGH 5HYEA 5IHBA 3EOBB 3L7EB 4S1RH 1JWMA 2V9TA 5B22A 3QFJA 5E2VL 3VFVB 5BQ7A 3PL6D 2GFBA 3G08B 4MAUL 5E9DA 2H2PC 3BSZL 2MKLC 4GRWB 1FZOA 5JIPA 3SKOB 4M61B 1FRGH 3MLUL 4UT6L 3U1SL 2EDHA 3BFOA 4TSAL 5C71A 2VLJA 4KRPD 2G60H 1K4DB 2I9TA 4OD1H 5DMKB 3G6JE 3QCUH 3OPZL 2GJ6D 1A6WH 5EZOH 3SDCC 5LJYH 3MBED 2YZ1A 5DS8B 2OR8A 2UWEE 3DV4B 4IBLT 3BGMB 1CFTA 3D39B 3WFBH 5F72S 2EO9A 1IILE 5FO8B 2NY0C 1FP5A 3MV9E 5CBAA 5C0GB 2GJJA 4PGBB 4PJ7F 5I73C 4XXDA 3NGBC 1TTUA 2C3VB 3GIZH 1CFVH 4NQED 3PXJA 1ZS8B 4LAJH 4LNVA 3LKSB 1EAJA 4OFDA 4YO0B 1HDMB 3G6DL 3BP4B 2PR4H 5MI0C 5BVPH 1PW3A 5KSUB 1NMBL 5GS0L 3FFCE 3BKMH 3GHEL 3NZHH 1KTKE 1UZ8A 3TBYB 5JZ7D 4V1DD 2A74A 4HUUA 5JTWA 2K7PA 4OKVB 2DQGL 4EQ2A 4EUPG 5HI3C 1F4WH 5DK0A 1ZA6B 2CIIA 4LSDA 3E8UL 4M03A 1AXTL 2AJXL 4HT1L 2WUBL 1OOAA 2L7JA 4B7LA 3TESA 5IKCA 3V4VH 1PAMA 5IB3A 1UJ3A 1XGRB 2AQ1A 1OQOA 2LAGB 3R0MA 1BWMA 5EU7C 5JW5B 4P5TD 2FECL 4M6OH 5T1DL 4J6RL 4ZO9A 3VRJA 1X9QA 1AC0A 3DSFL 4X7DC 1LK2B 3PP3K 5FXCH 1BQHA 1RD6A 2VWEC 4N5ED 1JI2A 1A7BA 5DJDB 3D48R 5I18H 4YHNB 1J0KA 1PGRB 2IEPA 5GQBA 1JNHB 3SGEH 3MLXL 4JKPL 1A7OL 1SY6H 5CIPA 4LHUA 4RA0C 1H0DA 1QRND 4HS8H 1U6AL 5DDHA 4X7SH 3QXAB 4WUUD 4NN5B 3WUWA 3C60C 5E9DE 3G6JF 4IDLA 4GMSH 3WE6A 3VE0B 4I18C 4MNQD 2UWEF 4EI6B 4LLDB 1LQSR 4M5YH 5IIEB 4MD5A 1OB1A 1U8LB 3GMMA 4PJ8C 4M8QA 1SBBA 3DVGB 5I9QC 4KGJA 1P1ZB 3C9NB 5A2KH 2VLRB 3FQRB 2BDNH 2J7LA 4NQCD 3U82B 3ROLA 4PP1C 3SO3B 4PRIB 4PTUB 1HWHB 5F89A 1H15B 5D7JA 4J3XA 1SVCP 4BA8A 1O0VA 1CXLA 4Y1AE 5GRUH 2J4WL 4IMKA 1FYTE 1WZLA 4XP6H 3IKKA 5HHQB 4KTYA 4OGYL 5DMGC 2CMRL 4Y4KC 3U7YH 2I60L 4NC1C 2Z9TA 1Y6NR 4YR6B 1JGDB 1MCQA 5I66B 4J3WA 5FGBA 4UMGA 4F33B 1KENL 2H26A 3BQUB 4FQLH 2NY2B 2CJUL 4WNQB 1HHIA 5IVZA 4J8RB 3NZ8A 3FT4B 3AGVA 2AEPH 3WLBA 3P11H 5IQ9A 4N0RA 4P99A 4NSKB 3ARBB 4CADB 4W6WB 3Q5YA 5C70A 1U8JB 1RZ8B 1S5HA 1UWGL 3U0WL 1T4KB 3GO1L 3ZL4L 1ZOXA 3GUTA 1T1XB 4R2GD 4OQTL 5K33A 2VDKH 1RIUH 5GGVY 5JQ6L 3VFOB 3D3VD 4XMKH 2WP3T 1JGVL 4Z7VB 5C0IA 5DSCA 3IAGC 3PE9A 3BDYH 2I26N 3QQ3A 3RJDA 3TC9A 4R6UA 5LWYL 3RWJA 4KK9D 1YEGH 4ZXBC 1UEMA 1HQRA 3MRPB 3WJJA 2I9LA 1SMAA 1UWEH 2DQUH 4LKXB 5J12B 3KLSA 1EEYB 5DHXB 4Y2DD 4E41E 2B8OT 4ISVA 5E99L 5F71A 4ETQA 1FHGA 1FPTH 5F7EL 4FFVD 3KPMA 4QRTA 1BBJB 4E5XB 2UUDH 3IFPB 4ZUUB 3BIKB 4POUB 1AP2B 3HNSL 1HK6A 5JDSB 1T21A 2O5XH 4PJ9A 4HCRH 4M7LH 3PP4H 1AIFA 1UCTA 2EKSA 4LLYA 3KYNB 4G42B 3EGSA 3HMWL 2CO6B 2H32H 5FHBL 4IM8A 1H9VA 3I6LD 4GAGL 1BM3H 4MA3A 4L4VD 2G9HB 4PY7B 4ZDHB 1XGQB 5JO5B 4G8FA 2GJ6E 4ELMB 2DKMA 4OLXH 3RWGA 4X6CA 2EH7L 1HKFA 2BVPA 4DCQA 5KSBA 1AGCB 3V79C 1CXFA 2ICWA 3HZMB 1E4JA 3QT2A 2R29H 1A9EB 2Z91B 2F53D 2EDNA 3DLQR 3CUPB 4NM4L 5LKNA 1YQVH 1E6OH 1MHPL 1T83A 3BGFB 4HUXA 3SY0B 1IGIH 1AO7A 3QIUB 4NQEE 3UYOD 5GS1A 3OKEB 3ILPA 3O6FB 1J1XH 2VDOH 2PF6A 5HGAA 3L3JB 2YK1H 2HMIC 3MGOB 3G04B 1S7SA 4DW2L 2K3TA 1DUYB 5GS0D 2RJMA 4IS6A 3RDTC 4MVBC 3SKNA 3RI5F 3HG1D 3T4YA 5L7XH 1IGTB 3QAZC 3KGRA 4RAUA 3SDDC 2GUOB 1EPFA 3FZUD 5FYJH 3QA3B 4LU5H 5IMOA 4Y4HC 4OD3H 3O41B 4MSWA 5MP6H 3U6RB 1KTLA 1Q72L 3TH2T 5E0QA 1U8IA 3KYOA 5LQBL 1MVUB 3NPSC 4Q2ZA 3RTQC 3GK8L 4L1DA 2XTLA 3G9AB 1MFEH 4YHKH 5HHVH 2AK4A 1ULVA 1B9ZA 2H45A 3V0AC 2OL3B 2XY1A 5ENWB 4NQXA 3U0TA 5C9JA 5IJVB 3VGFA 1X4YA 3AS3A 4KY1L 3AREC 4P5KB 2C1OB 2X4TA 5IW3A 4I0PC 3GSOA 1DE4B 1G84A 1S5IL 5TF1H 1OP3K 1QRNE 2F5BL 2W0FB 5TQ2H 5CEXB 4PJ5A 1NJ9B 4URTB 2VNCA 2BY0A 2C9AA 4P4RB 4MXQC 5KVGL 1IEHA 4NQDD 5JOFA 3ZT7A 2WBJA 4EDWL 5MHSD 3MRDB 4EQ3A 3CXDH 1FVEA 3R8BB 1R3LB 1OM3L 4QHLA 4X9BA 1QHOA 1H5BA 1OAZL 4K3EL 5F8RC 4K7PY 4JO2L 4ZUVA 4Y4FA 1XH3A 5C6PB 1KULA 4GQPH 3WHE1 2IAMB 4AENA 1A6TB 3MXWH 2D7TL 5CILH 5A2JH 3OG6B 1GGTA 3QUZC 4QF1B 4NQSB 2X70A 3MLTA 2AXHA 3KWWA 4UV7H 4GS7C 1YNKH 3RZCD 2VN4A 5CINH 1ZHNA 3I75A 5EO9A 1X5XA 1IM9B 3EW3B 5F9OH 3QDJA 5DT1H 1FFRA 4FXGB 4GRLB 5C6TH 1UM6L 4NCDA 3AM8C 4WTXA 3QDHA 1RVFH 5SWZB 4PG2A 1I9IH 2IGFL 3LVEA 4D0CB 3MLWH 4O2FB 4HXAH 1JGUL 4FFZL 4WHTA