5DHXB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
249
structure length
231
Chain Sequence
ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEIIQEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, light
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 56
structure length 231
sequence length 249
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhxB00
3MV7E 1JRHI 1SJEA 5CJQH 4HEPG 4MD0A 2R0LL 1RIHL 2DBJA 4KFZC 2YUXA 1T2JA 3W5MA 4UZGA 3VFOB 3MODH 1DL7L 1OW0C 4OKVB 4U1MB 2I25N 4YHPA 4QRTB 3HC0B 1ZWIA 2B8OT 4EI5A 5ITFA 4TYUA 2CKBA 2FJFA 4I3SL 3GMOB 5GJTH 5F8QC 4XP4L 3VXRD 4G3YH 1U2CA 1VFBB 4LRIC 2A2QT 4TTGA 1JF5A 4YXLL 4FQ2L 4TVPL 3CXDH 4UB0H 4RA0C 4PREA 4CGTA 4XNYH 1CZ8H 1U8QA 3BAEH 2Q8AL 5HHQB 4JZNB 3C08L 3U0WH 4PJ8B 3CZFB 1F6AB 5D7IB 3BUYB 3T0VA 4E41E 4L8DA 1H8SA 5BJTB 3Q2CA 1PEWA 1HHIB 2EH8H 5E00A 1OWRM 2ITDB 1DSFH 1S3KH 2R2EB 4JDZB 5TDOB 4L4JA 4QOKE 1I1YB 5HI4D 3QUMB 2VR5A 4IDJL 1CE6A 1ZA6A 3GSVA 4X7TB 2J88H 1ZVYA 4L8SB 4FABH 4DN3L 1UXSA 1C08A 1OOAA 1EEUA 3HE7A 1G84A 1L7TH 3E6HB 1VGEL 4J4PD 3AREA 3ZKXB 4YHNB 3GHBL 3TCXA 3ARFD 4P3DB 2HT3C 4NHUB 5DYOB 3P30H 1IBGH 1GGCL 3T0EA 2K3TA 4GRLD 4CVZA 2P7TA 3EYUH 2ZCKL 5DEGB 2IFFL 3V6OC 4X83A 5EO0A 2VQ1B 4KUZH 3EJZC 2DI8A 3DI3B 4WWKC 1YNLL 3QUXC 1T22A 1FVEB 1FAKT 1MHHA 5A2LH 1MFDL 2W9LA 2APFA 3G04A 4X4XB 4ETQB 5EC1A 3OWEA 4P2YA 4FQIH 5I73C 3DVGB 4IMLB 4RFOL 5DI8B 2X41A 3UAJC 4JFXA 4OCLC 3VWKB 3QDGE 4ODBD 5KVEL 4MHHI 2HTLC 3LVEA 1AKJB 3IDJA 4AIOA 1AJ7H 3V6BR 1CFSA 2W0KA 1UQSA 3FQUA 2NLJB 2C4FU 4R8WH 2YA0A 3VMPA 4LSSL 1U42A 2HP4A 5L8JB 1OAXH 1YPZF 4M43H 4JZJA 1K4CB 1QQDB 3F7RA 5HHNA 1J87A 4OQ1A 1P6AB 3WNMA 3HNVL 1T1WB 2VDKL 2FWOB 3B2UD 1ZA3B 3HMXH 1FH5L 2Y36L 4PRPE 5B8CB 1IM9B 4HH9B 1J05B 4L8BA 3HZVA 3QZWG 5A2JH 2Q3ZA 2GY7B 5EA0H 3HMWL 1GAFL 1I4FA 2BVOA 3D0VA 5IVXF 2WZPD 3FOLB 4NNPH 5SV3A 3IKKA 2VLRB 4F58L 3PWJA 2HKHL 3VXUB 1CGWA 3HI5H 43C9B 1NCAL 3MNWA 4PFEA 3MJ7B 4OLVL 3SEPA 4NBZB 2JE8A 4MD5B 1FNEA 1X5KA 5DUPH 3ZSTA 5FUZH 5JQ6H 5HPOA 5HYQA 4MJ6A 3NVQA 4HUWA 5IBTH 2AXGB 2ARJQ 2YA1A 2NZ9C 2YN5A 9CGTA 3HPLB 1LVEA 3V4VL 1JN6A 2Y06H 5IEHA 5J3HD 5K93A 1YUHA 4RMRA 5IHZA 3SDDD 3K74B 1IKNC 2ZUVA 3UTSE 4OCMC 4U49A 2CUHA 4I4WB 2JCCF 1QFUL 5I19H 3HAEG 2A9NH 3MV01 3TNNB 5CWSB 3T0AA 3EYQC 3SDYH 2DQEH 1I9EA 1NFDF 4KDTC 2I60H 5FYJE 3HHRB 3SDCA 4KKAC 4U1NB 1FV1B 4A2MA 2W0FA 4J3WA 4KVNH 2BFVL 4XB8A 4OBSA 4V2BA 3LPWA 5F7NC 4ZYKB 2DLTA 5F7WC 4YQXL 4TUJB 5F9WB 3EGSB 1P53A 3WDIA 2AEPL 3LRHA 3UPRA 4KDWA 4WFHD 5L2KE 2YA2A 1N5AB 1LE9B 3TYGH 4IHOA 5I1JH 4WW2C 5JDSA 3FL7A 1XGRA 3TA3C 1HIML 1NEZB 2J6EH 5EORL 4HAGA 3FT4B 4JFFE 4X8JA 3IAGC 4MXWL 1T1ZB 2A83B 4LLDA 1AR1D 4LARL 2Y25A 3RTQC 2FEEL 2WIIA 3AS2A 1WJ3A 5BMFL 1HYRC 5B4MC 2GFBB 5HGDB 1AO7B 4C56A 1HKLH 2YEZB 4G42B 3UO1H 1NSNH 1QFOA 1JUFB 3WNKA 4FQCH 3PXJA 5D93C 2YC1A 5I9QB 3C8KB 3QCUH 3X13B 4U1GB 5EO9B 4PRIA 4G80B 1QLEL 1UCBH 3WN5C 1J0HA 3DPBA 3QR2A 2GIYA 4JRXE 3QQ3A 3TVMD 4HJGB 4Q9RL 3QIUB 2ARJB 2GJ6A 3RHWF 2OP4H 4GW5B 1JNNL 1KIPA 3HPJA 1A7RL 1FO0H 4FMFA 2V5RA 3ZTJH 3WSQL 1QD0A 5BOZG 3O3BB 4NPYB 3TJHC 3L1OH 1CL7L 1WAAA 5IGXH 1CFNA 1OAKH 4JHWH 3BKYH 5KZCB 4EUPG 3Q6GH 1LEKB 1TTUA 4X6CB 4YR6B 5KSUA 1ZMYA 1UEMA 4AH2A 5J11B 1NCWH 1RZIA 2AJVL 4M7KH 5JHDB 4WWKA 4U6XB 3DGGA 4YHYB 4PJDB 5IB5B 4ZOAA 3KPOB 3AROA 1B9ZA 5BS0D 4JFQA 4JO3H 4JRYE 5FGCB 5C09B 3BP6B 1YA5A 4IRSB 2XRAH 4Q2ZB 5CINL 1BAFH 3PP3K 1DVFB 1A9EB 3MREA 1NJ9B 3HZYB 5TPWH 5MENE 2ZOKA 4TULL 1MLCA 1CN4A 3IDIA 1X4XA 5BW7C 4NP4L 5HHOB 2YBRB 2W9DH 3TT1L 4C83B 2CIKA 2I9LA 5IFJB 3KPTA 5KJRH 2YZ8A 4N9GA 4F57H 2R1WB 3VFVB 2RIKA 5DURD 1KJ2L 4A2LA 3GMMA 4BQ8A 3OTTA 4IRJA 1QRNA 3V5KB 5H2BA 2V2WB 3BSZL 1KXVC 2QADD 5FO9B 4WV1C 3UZEA 3BGFB 4F7CA 1RULH 3JWOC 3W2DL 2EC8A 3KYOB 1X5HA 4N0UB 4H88H 3P4NB 4H25A 4X4YA 1A0QL 5KG9B 4N5ED 4LIQE 1VFUA 3BUTA 3RPIA 3L7EA 1M71B 5D6DA 3VXMD 2BVQA 3KAAA 3NOIA 2ICEA 3QFJA 1A3RH 4ZAKD 1Z2KA 1QBBA 1HHGB 4M9OA 2O5ZL 1A5FH 2AV1B 2X4UB 1BFVH 3MOAH 1P4LB 4QYOB 2IAMD 1A6WL 3EO0B 3P9WB 2ZCHL 3WFBL 2ENSA 3RKPA 4KJWC 3EZJB 5JW4M 2R56H 5D7JB 2C1OA 4G8GA 4X0KA 2BRQA 2Z9TA 4MDIB 4WY7H 3KVQA 5EU4A 1F00I 4ODTH 1AGBB 6FABH 2HFFA 1HWGB 1FG9C 3NTCL 2AQ1A 5F88A 4RAUB 1H5BB 2Y6SD 3V6FA 3GFUA 2ZUXA 1FVDA 1BX2B 5AG9A 1MNUL 2PXYD 1DQJB 3HLAA 2VDQH 1UZ8A 3NABH 4RGOL 1IEBA 2X09A 4XH2B 1NL0H 5ALCH 3ROLA 3VXRE 4HAFA 5D7LB 3V0WH 1JZ5A 4FTVB 1EAPB 2FH6A 5FGSA 3O6FA 4HW6A 1FPTH 4U2ZA 3ULUD 2CR3A 2ZKHL 5T1MB 4LKCB 4DCQA 5IUSA 3U0TA 3KNBA 4HWNA 1JWMB 4G6JL 4FA8A 3KYMB 4GG6E 1JYVA 3MUJA 3HI1A 4PJ7E 5IT2H 4P2CG 1V3JA 1Q9KA 1Z9LA 3KPSD 5C08D 1KB5A 3MA7B 1PG7X 1AGFB 2CMRH 1NDMB 3NH7H 3MLTA 5B21A 3RL2B 4KQ3H 4Z7WA 1G6RH 5ENWB 3AMKA 2GHWB 3RNQA 1U91B 2ED9A 3BWAB 3PP3H 4R2GC 3JWDH 5CJ5A 3DSFL 2FX7L 3TZVC 2EZ0C 1SVZA 3BH8A 4GLRH 4NJAL 3VU2A 2IBZX 2H3NA 3MLXH 4I18C 2AJSH 2J5LC 3DYPA 4RZCA 4WHYG 1U8OB 3MRJB 3VGFA 5TH2B 1IM3B 3OKDB 1X7QA 5DA4A 5D1XC 1NGZB 5H94B 3ROOB 4LLMA 5LXGH 3BFOA 4P23B 1N5YL 2H9GB 1TVBA 3IU3A 2CDEB 3OKMA 3G6DL 1UACL 3DVNA 4XAKD 1X6NA 3HG1A 3T1FB 1UA6L 1SEBA 3WE6A 1FBIH 4IIQC 1F8TH 4HEME 4JANB 5C0ND 2VSDA 1INDH 3QQ4A 4X98B 2O26U 3WIHL 1BJ8A 5D2NA 5C0CA 4H0HB 1BPVA 2IH1A 2CGRL 4YUEL 1W72A 3ESUF 3O8XB 4M48L 1LP9E 1E27A 2MQ3A 3ZKND 1R3LB 1GZQA 3DX6A 2NXZD 2MFNA 4DKFL 1XZ0A 3U4EB 4W81A 4Z76B 1ZLUK 2R0LH 5IJKC 1VFAB 1MHCB 5EPMA 2ZWLT 5IOPA 2BSSA 5ELIA 3IJYA 5MI0B 1S9XA 4L4VD 1H0DA 4YDIH 1IC4L 4I3SH 2OQJA 4MNQA 4XP4H 3OPZL 1AHWA 2JCCB 4G43A 3L7FA 1H3UA 4NQEB 4Y7MA 4FQ2H 4YXLH 4ZSOB 5AD0A 5CSZB 1WC7B 5HPMB 2BHZA 2DLGA 3BP5B 3ZLQC 5JXEA 3MBEB 1CDJA 5B3NA 5AG8A 1YNKL 2Q8AH 5JA8B 1NFDB 3G6AA 3C08H 4Z5RA 3UTQA 3VGGA 4NNYA 4GMTL 5BQ7B 5KN5A 4F7MA 3JWOH 1A14L 3ZYZA 1YQ2A 2BSTB 4GUPA 2CKBL 5SWSB 4OFVA 3MGOA 4HFUL 1PAMA 1HQRB 3QIWC 5EZLA 1NPUA 4IDJH 1WCQA 1AY1L 4KHTL 4NQUA 2FECI 3ARDD 3IFPA 5GGSB 5IVOA 5FEBA 3RWFB 1PKQA 3G5ZB 1P1ZB 2VLKB 5DRNA 1L9NA 4HC1A 4LCCA 4DN3H 1G9NL 4GRWF 4LEXL 3FO9A 2A6DA 4Z7VF 4GJTB 4BQCA 2H1PH 3IRZA 1VGEH 2LVCA 1MFBL 1UKQA 3EUUA 3LQZA 4JN2A 1AXTL 4U6YA 1LEIB 3SKMA 3AC0A 2K1MA 5TDPA 4JJ5A 3VD7A 4ZFGL 5EIVA 3RVXD 2IALB 1UB5B 1KXTB 4MA3B 1MQ8A 1RUPH 3KPRA 2ZCKH 2IFFH 5DJXB 3MLZH 1DQQA 3I02B 3B9KB 4U3XA 2G5BA 3MGTA 4PY7B 3OB0K 2AXFB 4AZ8A 1YNLH 5HHXH 4QHKJ 5C70A 2G9HA 3L3OB 3UPCA 1UVQB 4NWTL 1MFDH 2ZCLL 3EJYC 4XCNB 2FJGB 3O6ML 3QUZB 4WFHE 4CU6A 3OJ2C 1B0RA 5F6IC 2ERJC 2XZCL 4XT1C 3PQYB 4U2YA 3OKNB 2XPGA 1YYLL 4Y16C 5DVNA 2HT4D 1CD0A 3A6CL 3D6GA 5F9DC 4CN1A 1NC2B 3UTZA 1PD6A 1U8KB 3MV9B 4HWZA 5KVEH 5DTFB 3LEVL 1P7QA 4JFOA 2VXVL 2ESVB 1ZLUH 4LHQB 2HG5B 1INEL 3O3AB 5IHBA 5KSAA 4QHLB 3U9PL 4LSSH 3UJTL 5LWYL 1QHPA 4G9FB 1BLNA 3DV4B 5I71C 5BV7B 3FO0H 1UT9A 1QR1A 2NY4D 2VDKH 5IEKB 1XF2A 1YY8A 1FH5H 3EDDA 5EOTB 3FT3A 1CXKA 3F7YA 5E1HB 4UU9B 4P4KA 2JJSC 1NGQH 1A22B 4P2QD 1WSST 2NY1D 4FQQA 1GAFH 3IJHB 1KIQB 3ES6B 4LQ1A 4UBDD 4GKNA 4KROC 2OMBA 2VERN 3CCHA 2FO1A 2XWBB 3V0VB 3LKPA 4RA3A 1AQKL 4F58H 4CKVX 2HKHH 2X7LA 2VYRE 4PJIE 2W60B 2NTFB 4G8EA 4OLVH 2FATL 4XC3L 4MJIB 4ZODA 5GGRA 1IARB 3JZ7A 3CU7A 3PHQA 4MAYB 2DTSA 4J3OC 3QUYD 1KNOB 3V4VH 4F8QA 3ZTJG 4PRBB 5KTEL 2PUQT 4HV8A 1FIGL 5F7UA 1AC0A 1LD9B 2ICCA 2Y5EA 2BC4A 4X6FB 1QFUH 5BS0E 4OD2A 2CK2A 2X4NA 3RDTD 2PW1A 4L4TD 2F53D 3VCLA 3BQUA 4AM0A 4WNQB 1HH6A 1J12A 4Y5VB 1RIUL 1GOGA 3I9GL 2BFVH 1T03L 2BCKB 5HYSA 4M6OL 4QNPE 2ICWA 3N1GC 3OB0H 4R97B 4UDUA 4YQXH 4L9LA 5KANG 4I3GA 1MUJB 3P77B 4RQQB 1LMKA 4TVPD 3WD5L 2AEPH 3LKQB 1IEAA 3VDCA 1G7MA 1ED3A 4JM2B 2X6MA 5FAAA 3KLHD 2YPVL 5E6IC 4NZDA 1JHTB 2Y7QB 2YRZA 4XCEB 4OSUL 3VXSD 2V5SA 4RDQF 2VDNL 4W70A 5EORH 5DHVB 3GKWL 1JL8A 4MXWH 2DKSA 4K71C 4LHJB 3OX8B 4HHAB 1H3WM 1OL0A 4HT1L 2VLMD 4U1KA 3WDJA 5BMFH 1I3RB 1FAIL 1FC2D 1J1PH 4GG8A 3WEXA 3UCRA 5CD3B 3U36A 4LLAA 3SDAC 4MZ3A 3QULB 1SMOA 4KK5C 4ZD3L 3HC3L 1OAZL 5JPMB 1A6TB 3BD3A 4S1QL 1QLEH 2NMSA 1ETZB 5FYLL 2V5TA 2XKUA 1A4JA 3S5LA 1T2QL 3MYJA 1ZLSL 4Y2DD 1FYTA 4Q9RH 2FB4L 5J1SC 3KPLB 3SJVA 3QDHA 4ERSL 1KEGL 1JNNH 1T0MA 2X4RB 4NRZA 1A7RH 3PWUA 3WSQH 1MCLA 5ECJE 4PJAE 1FYHB 2X5PA 3D39D 4A6YA 4HBCL 4ELMA 3T04D 2CH8A 5B39G 1ZXQA 3QNYB 5DMKB 2PTUA 4LCUB 4C59B 4Y4HA 1KG0A 2M8XA 5C0JB 4IOIA 1MRFL 3M07A 3ULUE 1O7SA 2EXYD 3AXLB 3V7AG 1B6DA 1WBZA 3QDJA 4HKXA 3TFKD 4LCWB 4N8CH 4X4MA 5CP3A 2P46B 4NN6C 3PV6B 5HVFB 1DE4A 3D0LA 3H9YA 5FGBA 3I50L 3KPSE 2B4CC 5C08E 3W9EB 3L9RB 2VKXA 4POUB 2XN9B 3HUJB 2P24A 3D25B 1S5IL 5CINH 2J7LA 3RU8L 2DQUL 4Y4KD 4PJ5B 4ZMAT 3OQ3B 1HCFX 4TVSa 1WIOA 3BDBA 4NP4H 4F80A 3LSOB 4G5ZL 3TT1H 2NY5C 4GBXB 1BIHA 2Q7NA 5HJ3B 1Z5LA 1C16A 3CFJA 5C6WH 5BOPA 3L5XH 3GMNA 1RQ5A 1H15B 5ERWB 3IU4L 1GVIA 5I15L 4QHUA 1MCDA 3BKJL 5ESAB 2IANB 3ARGC 3LB6C 4I2XE 5B38A 3MNZB 3W2DH 4BH8B 2GTZA 4XAKE 3IYLW 1A0QH 2X42A 3P4OA 2DI9A 4PTTB 4I77L 4EVNB 1IAIL 2YUZA 3TBVB 4F7EA 1RUMH 5JZ7D 4LVNB 1FNSL 4O2CA 2ADIB 2XFXA 3U1SH 2EIEA 1GGYA 4DK6A 3PABA 4MDJA 1WZ1L 1UH2A 4P57B 4FQHB 1XGYL 2AV7B 5DJ8B 1CD9B 1T7ZA 1RUKL 2P43B 1F4HA 2DLHA 3PWPD 2O5ZH 2Y9RT 2EE9A 4RMSA 4X6EB 4TNVK 4GS7C 1A6WH 4P9HC 3SKOA 3OKLB 2ZCHH 2JB6B 2NPLX 4D0DA 4EI6A 4BH7B 4G8IA 2FIKB 3KHOA 2MHAA 4LU5L 3MRHA 3OKKA 4OFIA 1R3HB 3DMMA 1KYOK 1TZIA 1YN7A 3UYPA 3IXTB 2M2DA 4GRWB 32C2B 1SJHA 4RRPG 3NTCH 1ADQA 4Z7VB 4L4VE 4UT7H 3EHBD 1MWAA 4HIHA 1MNUH 3VFGH 2GYSA 5FB8B 4RGOH 2HT2D 5SWZA 4ZUTA 4KDVA 2NCMA 2PYFA 2WP3T 1QNZH 1J10A 3SE4C 5ESQA 5SX4I 5LBSH 4LF3A 5ACZA 2ZKHH 4CAGA 4AG4L 1MCSA 5A2FA 2OSLB 3MRIA 3N1MC 4G6JH 4KZEH 3V5HB 2WAHA 3KHQA 1ZTXL 4YIQB 2FHBA 4L3CA 1ZVSB 5E8EB 2AJ3A 5GS2D 4QXUL 3SE9L 1YNTB 5EBLB 3VXTB 5I1IL 3CFCL 1J1OL 1YECH 3MV7B 5E4EB 1LDPH 3BO8A 3T8XB 2AP2A 1R3KA 4H1LB 5I2IA 1IZJA 3NZHH 1WZKA 3DLQR 3ARBD 2NXYB 2Y23A 5IB4A 5A3ID 3RZCA 3D5OF 4KTYA 4NJAH 4PJXE 4PLJC 1MVUB 3DO7B 4EDXA 2E7HA 3VH8B 4UQ3A 1BGXH 4LRNL 3MFGB 4WTXA 1XF3A 3EYOA 4QWWD 5DJ2A 3TN0D 1S7RA 2CLZA 1KB5L 5FA4A 1N5YH 3L5WB 3G6DH 1UACH 5DZLA 1T89C 5ESVB 1EEQA 1C7SA 1XGTA 3MCKB 2PR4L 1UA6H 2DQJL 3V7AE 4ODUA 4HWUA 2BSRB 3WS3A 2WLYA 3FQNA 5D1QD 5KVFH 4E41B 5DT1L 4R3SA 4LAQL 2VITB 3OKEB 4K9EC 5IMLA 3X3GL 1UB6A 4QTHB 5J6HB 3WIHH 2FHCA 4JO2L 4LPVA 5KOVC 3ZKMC 4QOKB 4ZFFB 4M48H 5FUOL 3C2AL 2VE6A 3BRFA 4NIKB 1CVRA 4EIGB 2CRZA 1WCBB 2PYEB 5ACMA 3O41B 4ZO6A 3N50A 4AT6A 1RK0B 2B4CH 3UX9B 5EU6D 4DUXA 2EYRA 4NQDA 1Y18B 4UT9L 4DVBB 4P59L 4BKLB 4JLRA 4Y4FC 2C3HA 5K33A 3BPNB 3RWEB 4N0CD 3L3KA 4EN3A 1IC4H 2EO1A 4L8SC 3FJTA 3OPZH 4X7SH 5C71A 5FYKL 4GG6F 2QSTA 3MJ6A 4P2OC 4PJ7F 1K4DB 4P2QE 3PL6D 3TO4A 1A6UL 4DQOL 4JAMB 1BMGA 1YNKH 3O4LD 3IS1X 4LP4A 5KAQF 4LASL 3IJSB 5ADOL 3V0AC 1RI8A 1V05A 5TDNB 4GMTH 1EEZA 1IC5H 1FZOA 4NZTH 3WJLA 1A14H 4PGBB 5DD1L 3MR9B 2EKSA 1EO8L 5TGBB 2X89A 2VLLA 4FZEL 1AY1H 4KHTH 4Y8AA 1JPGA 2DMKA 5JUEL 2H26B 1G9NH 1TNMA 3DETC 3NCYP 4ALAL 4R0LA 3FZUC 5EN2A 5IM7A 1TQCB 1LNUA 4MNGE 4ODWB 5I8KL 1NC4D 4I3RL 3KJ6L 4D9RD 1AXTH 5D2LB 3CDGA 5D6CA 1BQLH 4HUXA 4P9HH 3G5YA 2EICA 4WUUD 3VWKC 1GIGL 1AQDA 2Z35A 1DLFL 4G6ML 1FL3B 1ROWA 4ZFGH 2GCYA 1EMTH 2E7LC 3E6FA 3DHMA 2DJ4A 3TH4T 4HKJB 5ILTL 4L4TE 2F53E 1J8HB 4PTUB 3VFRA 3RJQB 3W0WA 4OF3A 4YFDB 3M8OL 4PRDA 1LP9F 4YBLB 2A74B 2K7PA 4NO3A 5B8CC 3IETA 4HC1L 4NWTH 1IAOB 3BP4B 2ZCLH 5HHPB 2HVJA 4TVPE 1UH4A 4RMVA 3O6MH 4M03A 3EOYG 1ZGLA 4E0RA 5E9DD 5DUML 1SY6A 2WBJB 2OTUB 2XZCH 5FA3A 1YYLH 5HSFA 2EDLA 3CNKA 3A6CH 4RFEA 1I9IL 2OR9L 1CICA 3VXSE 3LEVH 4RAVA 1WICA 4YX2H 3UTSB 1INEH 1E4XL 3BI9X 4GO6B 2BP3A 4JY4B 1U92B 4FQXD 3WIFA 1WF5A 5LWYH 2BY3A 3RVUD 2VLME 3DJ9A 2XZAL 5EIIB 1CXEA 4QKXB 1Q0YL 3GSNA 5MEPA 2SEBB 5CMAA 1ZE3C 4I48A 5ID0A 2BNQA 3GNML 3WUWG 1T1XA 1F11B 3X11A 2G2RB 2JLLA 4IEFB 4HUVB 3MO1A 3EO9L 4MQTB 2NX5E 2EDYA 4MCZB 4YAQB 4DZBA 3DUSB 1QPXA 5JLZB 5BRZA 3TC9A 1AQKH 5JW5B 3IXAA 15C8L 4JGUA 1GH7A 2VMFA 4APQD 2BSED 1CYGA 5I1CL 1JPTL 3D39E 5EBGA 1UWEH 2FATH 1XGUA 2I26N 4XC3H 3CVHB 5DJCB 5L7XL 1OAQH 1D3CA 1KIRA 4K9EH 2YRLA 5JO5B 1CFTA 5LVEA 4G7VL 4OKVA 1JWSA 3HC0A 3QG6B 1D5ZA 1A6ZA 2R9HC 3GSUB 1EZVX 1IGFL 1BJMA 3BH9B 3BHBB 3MRQA 4XHJD 5CEZL 5KTEH 1JBJA 1EIBA 2PO6B 2VIRB 3W5NA 2ARWA 4S11A 3PHOA 4P5TD 3OR7B 4LSUL 5I1GL 5JMOC 1A4KB 3QWQB 3IFOA 3CDYA 4M8VA 4WJ5B 1IVLA 4OCRL 2EIDA 1CXLA 5D71L 3O11B 4QT5B 3P9LB 1RIUH 5J1AB 3HB3D 4D0CB 4NQVB 4PJ8A 3I9GH 4Y89A 4JZOB 3WKMH 1A1NB 1T03H 3LKSA 4CNIA 4W4NA 5DMYA 4ZUUA 2XTJB 2N7BA 4QRQA 5I9QC 5IG7B 3I6LD 3DX9A 4U1GC 3WD5H 5J9PB 2BVYA 3DX7A 5TDOA 1INQA 4J23A 3FAWA 4C55A 4X7TA 2YPVH 4I0PB 3LAFA 3QIUC 4L8SA 1II4E 2V5YA 1GGBH 2VDNH 3E6HA 2C4FT 1OSPL 3GKWH 1DP0A 4FMKA 1F3RB 3RVTC 2J8HA 1QFPA 4EI5D 4HT1H 4V1DE 5GQBA 3QI9B 2X4PB 4TTDC 4X6DA 1T66D 1FAIH 1L0QA 3MRLB 2COQA 4YDVA 2JK5A 3PWPE 4KRPD 5FUCE 1OGTB 2OJEB 2PW2B 5MENB 3T4YB 4F7PA 1U3HB 3RWHA 1R0AL 5J11C 2A6KA 1T20A 1G7LB 2VXUL 3BXNB 4OCYL 3S3PA 1ZHLB 4YEEA 3HC3H 1OAZH 4YHYC 1UJ3B 4S1QH 5HDQL 2PCPB 5FYLH 1FVEA 1OP5K 1QEWB 5I1AA 1ZLSH 5HVWA 3K3QA 3ULVD 4IRSC 4PJIF 3UBXG 2FB4H 5ADPL 4ERSH 1KEGH 1DVFC 4ETQA 2XWTA 1DUZB 2X2YA 3DVGA 2RBLA 3GO1H 3DROA 1A1MA 4HG4J 4HBCH 3U46B 3AS1A 1K5NB 1GGTA 3VWKA 3TYFA 3GMLA 5EULV 2Z31B 1IKFL 2E7LA 1AKJA 1MRFH 3DV6A 3FRPA 3HE7D 2NLJA 4KAQL 3ARED 1NBZB 1D5BB 3KGRA 3BGFC 1K4CA 3OR6B 4YHIA 1JIBA 1T1WA 4PB0H 4WI5A 4ZS6D 2FWOA 1I1AB 2FEDD 1ZA3A 3I50H 3T0ED 4UUJB 2BX5A 1YY9D 1IQDA 2MKWA 1NGYA 5J0BA 3UMTA 5EBMB 3RU8H 1HHHA 3RIAK 2HRPL 5H35A 1RZ7L 4QNPF 3DARA 4A6YL 2UWEA 3D85A 4RGND 4XNZB 1TCRA 5DD6B 1S7UB 3RY5A 4G5ZH 5K9QG 3FOLA 1GPOL 1S9VB 1EFXA 5D1ZA 5C0BB 3IAPA 1FC1A 4OGYH 1RFDL 5DJYB 4K8RL 3VXRB 5J57B 3IU4H 3QRGH 3L95A 5I15H 3BKJH 3MJ7A 4BSVA 5EU3A 4PJGE 2D7PA 3MJ9A 3FB5B 2CXKA 3P2TA 1MVFA 3IS0X 1HI6B 4GG6B 3EO1A 3OHXB 1OD9A 5C0GA 4Q7DA 1KPUA 3VRJB 1NUFA 2YPLA 1FNSH 4BZYA 4QRUA 1W2KT 2H2SC 1AGCB 5JIKA 1WZ1H 4WI7A 4JRYA 3TNNA 5ISZA 5IW1A 5CWSA 2R8SL 4XXDA 1BFOB 5I18L 3CX5J 4IJ3B 4KC3B 1G7HB 1TZHB 4PJAF 3UYRH 5GXBB 1LO0H 3KLAB 4TUJA 3CU1A 5EU6E 3EGSA 1OP5H 5JW3L 2OXGA 1NUDA 3CIQA 4WO4A 1I3GL 4GRLB 3DBXB 5FXCH 4JPWL 4DWHA 5I66B 3SCMA 3ULUF 1N5AA 1LO4L 1LE9A 4G8FB 5IWLC 2HTKD 2VAAB 4XBEL 5A1AA 5I8CB 4Y5XA 4G7YH 2DLEA 1NEZA 2D9QB 1WWAX 1OSZB 1MCKA 5CBAB 1KLUA 2P8MB 1T1ZA 4KTDL 4AG4H 5DQ9A 6CGTA 5JXAL 3GMPB 3O4LE 5BCAA 2MJWA 4P23C 1A47A 4MQXD 5DRXB 4N9OB 4O02L 4XRCB 3CFIC 3HAEA 3CVIL 1H3PL 2OZ4A 5TQ2L 1Q9OB 2KQNA 3RRQA 3SE9H 1YEFL 3O3EB 3C8KA 5F7DB 3CFCH 3FQXB 1MWAL 1J1OH 1Z9MA 4LBEA 3SO5A 3H3BC 2VZUA 1OGAA 1IFHL 3BEWA 4JDVA 2MCPL 3AM8A 4TUKH 1PFCA 3SDCD 1JFQL 3N0PB 1X5XA 3HKFA 3IDYB 1YC7A 4NBYB 1AXIB 2VDOL 4R7DB 4NFCA 4GW5A 3U48A 4NQXB 1QOKA 4D9RE 1NCDL 3QXAB 1MCHA 3O3BA 3W9DA 1S5HB 4LRNH 2A9MH 4NPYA 4Z77B 3DIFA 3IKCB 1SBBA 2E6JA 4WUUE 2AQ3A 2C7UB 5AUMB 1UENA 1KB5H 1CD1B 3MRNB 5FYLD 4AQ1B 4J3XA 3L6FB 3TBWA 2J12B 3MV8A 4PRAB 5MI0C 1TXKA 2QSCH 4YR6A 2DQJH 5MEOB 2QQKL 3I85A 1MHEB 3QA3B 2V2XB 4U0QB 5F21B 2DF3A 3LZFL 5DT1H 5IB5A 3F7PC 3PDOB 4TUOA 4LAQH 1MY7A 3MLVL 3G6JA 3KPOA 4O5LL 4OGAC 3X3GH 4BFGA 5FHBL 4EEEA 4JO2H 1FZMA 1S9YB 4P46A 5C09A 3BP6A 2WP3O 4JKKA 4IRSA 4C56D 1IEHA 4Q2ZA 5EBWA 1AD9B 4QY8B 5FUOH 1A9EA 3MBEC 5HXMA 2Q7YA 3C2AH 1NJ9A 4Z7UA 5E9DE 2D0FA 2QR0A 1U93A 1B0GB 4PRID 2YBRA 3B2VL 4C83A 1JTTA 3SOBL 5IFJA 3U9UB 1U8JB 3VFVA 1S7TB 4S1SL 3S35L 1MY5A 2GJ6D 4KMTH 3SDDB 4UT9H 3JV4B 2BVPA 4P59H 4PD4J 4S2SB 3WNNA 4PJFB 2R2HA 4NZRL 2NY0D 1TCMA 2YWZA 2AXHA 3KYOA 5FYKH 4M9PA 5K9OA 3HZKA 5KG9A 1XFPA 2ATKB 1M71A 1FZJB 4DQOH 1BBJB 4LLYA 1YYML 2MKLC 1T3FB 3ARWA 3UDWC 4WWKD 4UT6H 3OL2A 5FYKU 5ADOH 2ZUTA 2E9BA 4TNWK 5AWNL 2RCSL 5LAXB 2AV1A 3KLSA 4JJHA 3RX8A 1QLFB 1P4LA 3QJHA 4N8VB 5I1EL 1A7PL 2XT1B 5DD1H 4LSTL 1NBVH 1EO8H 4MA8L 4MXQD 1MLBB 2VR4A 2PNDA 2X9WA 4PJXF 4FZEH 5D7JA 3CFBA 3B5HA 4MZ2A 3VE0B 1AGBA 4Y5YC 3IDMB 2AW2A 4ALAH 2FBJL 2A38A 3QUZC 4DKDC 1BWMA 1H5BA 1KN2L 3N06B 2FH8A 3PWLA 1A2YB 1YMHB 5I8KH 4I3RH 3KJ6H 1JZ4A 1ZSDB 1SM3L 1U8LB 2R23A 4IRJD 2LU7A 4NYLB 4OTXH 1DTUA 3D87B 4XH2A 3VI4F 5KS9E 5DGRA 1GIGH 1EFQA 1DLFH 1Q1JL 4FTVA 4G6MH 1IMHC 1MEXL 1FE8L 3WV0A 5ILTH 3NFNB 4LVHB 5HY9A 2ZJSL 5JPNB 1JWMA 4FP8L 4FXKA 3UPAA 3LD8B 3C5SA 3UEZA 3HE6A 5BV7C 5GGTA 1FJ1B 4OGZA 4DEPB 2QQQA 5JNYA 3CC5B 3SBWC 3WO3B 3QFJD 4HC1H 3MA7A 1ZHBB 5IVZB 2R2BA 4PJIB 3I6LE 5FGRA 1CDBA 5CIPH 3BESR 1GOHA 2EECA 3LRGA 5TE4L 4OI8A 5DUMH 1JF1B 4YGAB 5CP7B 1QA9A 2MPAL 3UTPD 4ZTPL 1W0VB 1I9IH 4QRRA 3CMOL 4G8GD 1T4KA 1I75A 4L8CA 1U9KA 3VG9B 1E4XH 1UXWB 1IM3A 3I84A 1CT8A 5BS0B 4JKMA 1NGZA 2FSEB 5H94A 3ROOA 1RJZB 1KTDB 4CUCA 2KDGA 2H9GA 2XZAH 1OVZA 1QVOB 3QUKA 4KVCL 4MAYC 4XTRC 1W0YT 2BXZA 3T1FA 4Z7NE 4S1RL 4PJCA 3O6FD 5GS1A 1I3UA 4QHMB 3C09C 1IGJB 1SY6L 3GNMH 4KY1H 3EYQD 5HGAB 2UZXB 5ITBL 3IF1B 3C2SA 1NCTA 1F58L 3MRFB 4QXTA 5DURB 3EO9H 3ULVE 4UI2A 4C4KT 5MERA 2IF7A 4R4ND 1KCUH 1PJ9A 3JWNC 1A7NH 2QADB 3O8XA 4OZGB 1N4XL 4Y5VC 2R29L 5IVNA 2J8OA 3PIQB 4NKDA 1CR9L 4Q97A 5I1CH 4GAYB 1JPTH 2EH7L 2P8LB 4TQEL 1FL5B 4XPFH 1MCPL 4OZHA 1G6VK 4HSQA 3GSNL 5L9DH 5L7XH 4R97C 2IH3B 2DICA 4U1LB 3VXMB 5C7XL 1A9BB 1CGSL 2WW8A 5DRZB 5HGGS 4G7VH 4GAFB 3VFSA 3RKDC 1XCQB 2DQCH 2P5WA 4BSWB 4RIRB 1M05A 4LSQL 5E8PA 2L0DA 4ZAKB 4J1UB 3MLYL 1HEZA 1K6QL 1IGFH 4Z0XB 5CEZH 3NA4A 4K3GA 4KKLC 3UXFA 3G5VB 1RZJC 1D5MB 3T0EE 1W8NA 2IAMB 2L7UA 3QXVA 3HNSL 4ZUWB 3QQ9C 4NQEA 4LSUH 5I1GH 2CDGB 5CSZA 5HPMA 3PJSB 3L3HA 1JGVL 3U83A 3HG1D 1I8MB 3BP5A 5L8LB 1ZT4B 3NCFB 5D71H 1I7UA 5FKPB 1N64L 2IBGA 2DWEB 4RGNE 4JREB 5DJDA 5IMOB 3WFEH 1JYWA 5F1SA 1U8PB 5DJ0B 4PJAB 2VXSL 4PIRF 5C0CD 2PXYB 5C8JA 2OR8A 2E8ZA 1NGXA 4ISVA 5GISH 2EC9U 4KH2A 4NSKB 3DX8B 2HFEB 5INDB 5KVDH 1F2QA 3RWDB 1P1ZA 2VLKA 3A67L 1HHJA 4NOBA 1G7PB 4HD9A 3RNKA 2Z93B 1EO7A 4ZPTB 4D8PB 1UM6L 3RUGA 1M6OB 3H9HB 1T1YB 5BZWA 3KPSB 4HJ0D 2ADJA 1C8PA 5FM5O 1RZKC 3OAUL 2EDBA 1A6AB 3I3BA 5CILL 5EZJB 4MNQD 2D7MA 4WDIB 1GCFA 4YHML 4JQXA 3RZWA 3SGKA 1DN0A 5DR5L 4HPOL 1R0AH 3KPQA 5DJXA 4PJEB 2DQTH 2VXUH 3I02A 3B9KA 3BIAX 3FKUS 1G0XA 3GSQB 5HDQH 1OTTC 5JXED 2VN7A 3L3GA 2LAAA 4DGVL 1J5OL 3L3OA 3R1GL 1UVQA 2G60L 1Q9WB 5EDXA 5D5MB 3K2UL 1JNLL 4XCNA 3QFDB 5CZVL 1WBYA 4ZDHB 3EFDL 4I2XB 5C0EB 4UTAL 2IQ9L 5F7YC 3PQYA 3OKNA 4GBXC 1NC2A 1PY4A 4GOSA 5I1DA 4W6XB 3KPPB 3QJFB 4HMDA 1IKFH 1FO0B 4YE4H 2ESVA 5HHMB 2HG5A 2A1WL 1DCLA 3O3AA 3T0XA 4KAQH 4DAGL 4H8WL 3SQOL 4OFYA 5BZDB 1JCKA 3GGWA 3TIEB 5DK0B 4ZUSA 4GKZA 1IGYA 1OF2B 3FFDB 4U1JB 4K94C 2NXZB 5EOTA 4WI3A 4KRLB 4I5BA 2APVA 2XOTA 5B3JE 1CWVA 3VXOA 3IVKB 1CGVA 2D4DA 2HRPH 2EXWC 1IL1B 1RZ7H 3KPRD 4LVNC 5JIPA 3IJHA 1HK6A 1BQUA 1W0WB 4KJWD 1NCUA 1QZ1A 1T04A 4JN1L 4LGSB 1GPOH 4L4VB 3DURB 3QXDB 3REVA 4PG2A 1RFDH 3FO2B 2N56A 4K8RH 1MF2L 1QKZL 1XF4B 5DMGC 1NQBA 1R24B 2Z8SA 5FYLE 2JJVA 3F5WB 3KG5A 2A73A 2DQHL 5IV2A 3PWVA 3TLRA 4DUWA 1P7QD 1FLRL 2Z8VC 4JFHD 3RY4A 5KSAD 5DO2D 4ZOEA 1Z3GL 2NY3D 3UZQA 1N3NB 1ZOXA 1B6UA 1JPST 3MTRA 2BXYA 4UTBL 4C56E 4QCIB 2R8SH 4LFHG 1CDCA 3NPSB 3EDFA 4P4KD 4FN0A 3TT3L 1V7NL 1KTLB 5I18H 3G08B 1AD0A 4QRSB 2GITB 3MJ9L 4U3HA 2YRPA 2BCKA 2IWGA 4PJHA 4CMMB 4PR5B 5CEZD 4M4PA 1ZANL 4L29B 3V6ZA 4OJFL 3MLUL 4R2GD 1Q9LA 5JHLH 2GJ6E 3ZDZE 3P77A 5I74B 4XPBL 5JW3H 2JJWA 5E4EC 3WS6C 2Q6WB 5B39B 2WSKA 4JM2A 1I3GH 2DKUA 4JPWH 2FEEI 5JORB 1LO4H 2P5EB 3BJ91 3KPMB 1WAAE 3F7QA 4FHBD 2YUWA 1EJ6A 1TETL 2E7CA 3U82B 4RNRA 4XBEH 5CHNB 2Y7QA 3I6KA 2NXYC 1E6JH 1G7QA 4XCEA 1TENA 5CJBA 1U41A 4PRHA 2OS7A 1EPFA 1JI2A 4QTIL 5KBNC 5DHVA 3STZB 3O9WB 4KTDH 2XTLA 5GGSY 1EHAA 4CVXB 5JXAH 3OX8A 4HHAA 1KEML 3AS3A 2WMPA 2BRRH 4O02H 5F9JB 3HI6L 2QL1A 2KBGA 2PETA 3CVIH 3TPUA 1H3PH 3DXAB 5TQ2H 5CD3A 4CN4A 5IW6B 2R1YA 2JTDA 2Z4QB 5CD5C 1JGEB 1YEFH 2H6PB 5DJAA 2B5IB 4JR9H 1R5IB 1MWAH 5A16B 1A6TA 2NTSP 4OCWL 1IFHH 4YNYB 3BQUD 5ICXA 3QIBA 1ZV5A 3QG7L 1CL7I 2VH5L 2OXHA 1JFQH 4MGXA 4NC1E 2HJFB 4NUGL 5HHVL 4XCYA 3VXNB 4GKSA 2VDOH 2YSSB 3KPLA 1XGQB 2E7BA 3MROB 1P5VA 1G6RB 4PJGF 3IDXH 5HGHA 3Q48A 5CEYB 2XICA 1NCDH 2NY4B 2OR7A 4R4FL 5T1KB 3H42L 1U58B 1EXUB 1UH3A 1CTOA 5EC2B 5DMKA 2OZ4L 4LCUA 3RVWC 4P2QB 5C0JA 5EFIA 4PLKD 3NZ8A 4M7JL 3LCYA 3AXLA 1U36A 5T5NG 4HGMA 3OGCB 4XX1G 4WTZA 3TV3L 3BPNC 1Z9OA 2DQFA 2UV3A 4W6WB 4XZUB 3PV6A 3LZFH 3WN5B 2HFGH 3MLVH 4J6RL 4O5LH 3QFJE 5EIQA 2Q8BL 1Y0LA 2O5XL 3LRSA 2ADGB 3W9EA 1OLLA 3GBLA 2PTVA 1BJ1H 1F4AA 4MS8D 3HUJA 2YD5A 4KJPD 4KU1A 3CPLA 5E5MB 3H2WA 4ZXBA 3UTPE 5FO8B 3B2VH 1BZ7B 1ONQA 2X1WL 3B5GA 4G8GE 4P4RB 1MJJA 1F02I 1KN4H 3PGDB 1FYTD 4FFWC 4S1SH 2J3SA 5CEXB 2WINA 4KKNA 3SJVD 1H15A 4JQVC 3UTTA 3NCEB 1U8IB 3U0PB 4NZRH 4P99A 4PPTA 1I8KB 2F19L 1D5XB 3G9AB 4OGXH 3MNZA 3RDTB 4ODSH 4L4TB 3UBXI 2VZ1A 4XB7A 4JFDA 4NNXB 4Y4HD 3Q3GB 5JDJA 1TQCC 4XVUC 4N1HB 3S8WA 1IE5A 3QDJD 3UYOD 1YYMH 1RV6X 2J4WH 4K8RD 4ORGB 3MRDA 4DVRL 4P57A 4FQHA 1OPGL 3S36X 5AWNH 4K7FB 5DWUL 2B39A 3EYVB 5I1EH 1A7PH 3OKLA 1Z0NA 4Z7WE 4LSTH 2X1PA 1BVLA 2YXFA 3QPXH 4MA8H 3W81A 2AJUL 4ZNEA 5FM4A 4YBLC 4XGZB 3WFDL 4LNVA 2FZ3A 2LQRA 4C54A 2A6JA 5CGYC 3O2VL 3F6LA 32C2A 5HD8C 1N8ZB 2FBJH 2AEQL 2DBLL 1KN2H 4IOSD 3B6SB 4HLJA 4PB9L 2WBJC 1YMME 3SGJC 1UEYA 5FB8A 1KV3A 4MSWB 5IB1B 1K8DB 2H2PC 5JW4R 1YN6B 1SJVA 5K9QI 4Y0GA 1Z0MA 1Q1JH 4U1IB 4OV5A 4OAWB 5CZXC 1MEXH 4BZ1L 2GEEA 3MRKB 2WUBL 4RAHA 1KBGL 5FDWB 2AK4E 3HG1E 5F1OB 2ZJSH 2OSLA 2F9BT 3U79A 2NY7L 4FP8H 5EZIL 1XIWA 4Y2DB 3CUPB 4M6AA 3FAXA 4YGVA 3L3DA 3D18B 2XKNB 2ITCB 8FABB 1ZVSA 5HYIA 3HNTL 2Y1VA 3W11C 5EBLA 5C0CE 3WFCL 4F8TA 2QEJA 3VXTA 1F5WA 1MAML 4AIZA 3BVNA 5A43C 5TE4H 5E2VL 3WLBB 1JGUL 1HXMB 1C5DB 2MPAH 2QQNL 4H1LA 3RWIB 1BF2A 4ZTPH 1K8IA 3BGAA 5DC9B 1KJVB 3B9DA 2JIXA 4JFEA 1NAMA 3DMMD 3CMOH 3QWOB 2VLJE 3N9GL 4YEFA 2HN7B 1LE5A 3TJEL 3CFKB 2D7QA 4DGIL 2ZSWB 4U6VL 5L88L 4R4BA 5D7KD 5FK9B 3FFCA 4MNQE 3L5WA 5SWZD 4XVTH 1BVKA 1CIUA 2VDML 4KVCH 1T0NA 2YPKA 4NQSB 5J6GB 2G75A 3IDNB 3LKOA 2BSRA 4NBXB 4XX1E 4WEUD 1SY6H 1BFSA 2IQAA 1MJ8L 1R5VB 5ITBH 5DEFA 1VERA 3AUVA 4EQ3A 4PBXA 2PO6C 3TCLB 1F58H 3MUZ1 1QSVA 1MJ7L 3RWCB 1EVUA 5HYSG 2XNAA 3SE8H 5D72L 2P45B 2BHYA 3TZVB 1HNGA 3OGOE 4TSCL 4XWGL 4OCSL 2AI0L 1N4XH 3O45A 5JOPD 2GJJA 1V3LA 2R29H 3U2SB 3C6LC 1NGPL 1CR9H 4HKZB 3VFMA 4OZIF 4TQEH 1L0XA 1MCPH 3GSXB 4MVBC 4ODHL 2PYEA 1MSPA 1VADB 2DQGH 4Q74A 2XTJC 3VXSA 3GSNH 5C0RH 4M1DL 1C1EL 2GAZB 1RK0A 5C7XH 1T6VN 1CGSH 1A3LL 5KS9F 3ARUA 1Y18A 3CX2A 3RZCD 3BMWA 4BKLA 4H0IA 4CW1A 4TNVF 3RWEA 3MLYH 1K6QH 4KPHL 3NGBB 3QNXB 2X4TB 2GSIB 3PWPB 4ONHB 4PUBL 3D69B 1MH5B 3EDKA 1P9MC 5IFAL 3T4AA 4OZFH 5C0DB 3WNOA 3HNSH 2DTML 2E9JA 5DRWB 3VFWB 4ZUVB 1I7RB 2XYCA 1JGVH 1HH9B 2DN7A 3KPRE 4IRZL 4O58L 4UINL 1N64H 2N7AA 4KK5D 1DBBL 4Z78A 2NX5A 3S5LG 1E4JA 5TDNA 2DYPA 2I9TA 4ZQKB 2VXSH 1U3HC 1CF8H 3BISA 2X70B 3MR9A 3WLWC 1UJ3C 4EXKA 4NDMA 1RJYB 1GZPB 2H8PB 3WL9A 2R4SL 1JYNA 4R96A 4EDWL 1J1XL 1N2RA 3A67H 5F93C 5EWIL 1LO5B 3QT2A 2FL5B 4ZOBA 4WGWB 3VA6A 5C07E 3ARPA 4PGCB 1UM6H 4JFHE 4UILL 3MRRA 4NQDD 5D2LA 4S1DC 5AZEL 2GJZB 3QO0A 3ECBB 4MJ5A 4Z7NF 1GGIL 3O2DA 4WW1B 3OAUH 4EN3D 1IC7L 2Z31C 2YN3A 4U4BA 4X7FC 4YHMH 1VACA 3E2HB 2CD0A 3GBNL 4RWHA 1J8HA 2XI9A 3PGCB 4PTUA 5DR5H 4HWEH 5ICYB 3ULVF 4HGWB 2GI7A 3TO4D 4F7TB 3ARBB 1HILB 4X6BA 1J5OH 3KDMB 3R1GH 4XNQA 5CEZE 3MJGX 4NO2B 1XF5A 2G60H 4TRPL 4LCIL 1DQDL 5HHPA 1F4XH 3T65A 1JNLH 5F1NB 2XIDA 3WNLA 3TN0B 5CZVH 3PGFL 4XNZC 2IQ9H 2OTUA 2WBJA 2Q86B 2X89D 5JOFB 5B38G 1D6EB 2B1HL 3K1DA 3MBXL 3P4LA 2A1WH 2ZOLB 3V8CA 2ZPKL 1JWUB 1W8OA 4H8WH 3SQOH 5IQ9B 3VFTA 4V1DA 5ANMB 5FYJU 3GSOB 4H5SB 1KTKE 3LQAC 2SEBA 3PP4L 3BZEA 1D9KA 2QLVB 4MNHB 1XH3A 2G2RA 3FTGA 5HI3D 4NO5B 1HHKB 3W0WD 2M1KA 1EK3A 4OCNC 5EU6B 4JN1H 3Q6FB 1A7QH 3FCTB 4IJ3C 1YEHL 3VMOA 1T21A 4QRPA 1YEJL 1QKZH 4PP2B 4PV8B 2CLVA 4J4PC 1FQ9C 5IROA 2EYSB 3PL6B 1KJ2B 3P73B 5JO5A 1ZAGA 1EHLH 1CICD 3O4LB 4M5ZL 4W4OC 2AJXH 4UQ2A 3QG6A 2FR4B 4GRLC 3GSUA 1FLRH 5I16A 3BHBA 1Z3GH 5DQDL 4J2XA 5GGVL 3FQTB 4MLIA 2VIRA 4X9BA 3RGVA 3OR7A 4NKOA 4HIEA 1A4KA 2ZUUA 2V6HA 4NRYA 4O51A 3TT3H 1PBYA 1V7NH 2BNQD 5DHYB 5J1AA 3MZGB 4D0CA 4NQVA 1TJIL 3MJ9H 1K3ZA 4RISL 3UBXB 5F3BB 4IDLA 1V3MA 1RK1A 1ZANH 1FYTE 3MLUH 4OJFH 5BVJB 4IS6B 3IB4A 4HX1B 4KJYB 4MQ7B 4RMQA 3SJVE 5BRZD 4XPBH 5J9PA 4GXUM 5E5RB 3BIKA 2BNUB 2CIIA 2WWKT 1QFWL 4OQTA 3OXSB 4I0PA 1ZHKA 1GHFL 3IDYC 1TETH 5KSBB 4ELME 1FFOA 1VFOA 4GRMB 1OHQA 1IAKA 2BNRA 5DJZB 1SMAA 3HRZB 3IGAA 4LPTA 1HSBA 5GS0L 4XCCL 3X14A 3B2UC 4M5YL 3C60A 4KI1A 3QDJE 3QHZL 1IGIL 1KEMH 2JF1A 1RJLB 1MIML 3TBTA 4X4ME 5B3JF 3LN4B 3OJDB 1I9JL 1T7VA 3QI9A 1ES0A 5D70L 3MRLA 2FJHB 5E08L 4JPIB 5E9DB 1DBML 3TBYB 1ZT1A 4J3TA 2NW2A 4F9PC 4M00A 3BXNA 1FL6A 2HLFC 4NKMB 1NGWB 3FRUB 5F1KC 1FFNA 3NPZB 5HHVH 4NUGH 4PJ8D 2CLRB 2GKIA 5GRXG 2X4QB 4LIQH 2FLBT 3MLWL 4M62L 4M61A 5FCSH 3LN5A 2DQIL 1DUZA 5GSVB 4QHNB 5GGUB 2VZVA 4R4FH 3SDXB 1LK2A 4K71B 1QSEA 5D96B 1F97A 1N7MH 2PKDA 3DOSA 4ODXB 3HAEH 4X9FA 3TBSB 3D9AL 1K5NA 2OZ4H 1L9MA 2JJTC 5FOBB 2W1NA 4JO4H 1S9WB 2RHEA 4JKPL 2HJLB 3SDDC 3MUHL 4M7JH 1AGDA 1RVFH 3GJEB 1NBZA 3TV3H 3C8HA 1HCVA 2VDRL 2MCG1 3OR6A 4DKAA 3ZDXE 1MRCL 1AI1L 2FX8L 4J6RH 1I1AA 2F58L 2Q8BH 2O5XH 4HK0A 3V4PL 4OLUL 4Q0XL 4APQB 1BZQK 3EDJA 3ALXA 2QKIB 2UY7A 4WU7B 3CH1B 4ONGL 4B5EA 2O61B 1P7KA 3VMNA 4CVWA 1FZKB 3ZDZF 4JEGB 4OZIB 5I17A 1KB9K 2F5BL 4J3SA 4YPGB 3NCJL 3GJFA 4KWUA 5C0BA 3CLFH 1WAAF 2HMID 5DJYA 1U8HA 1XF1A 1QG3A 2EDOA 1IAII 4WUUA 4JFYB 2F19H 3S34L 5E2JA 1OTUD 5D7KE 1PG7H 5SWZE 4ZNCD 1AR1C 1KPRB 3QXUA 4HUUB 2Y07H 3BW9B 4YO0A 1S7QA 3VWKD 5TF0A 3WJJC 4X7DC 1HI6A 1CG9A 3OHXA 4P5KB 2N4IA 1AKJD 2ZSVB 2X4SB 4PBWD 2D31A 4XXCA 3ZMRA 5J89A 4WUKL 3RBSA 4MMZC 3MRBB 4D0BB 2C1PB 4DVRH 4PS4L 3UP1A 1OPGH 1DANT 1KULA 1ZHNA 3HR5B 3FQRB 4LVHC 1UC6A 3F12A 5DWUH 3T09A 4X5XB 5IBUG 5JOPE 5EU7E 3LD8C 4EJ1C 5F7HA 3H3PL 1KENL 1HNFA 1SJEB 4MD0B 3Q0HA 1KIUA 2XZZA 4EUPH 1TZHA 5ICZB 3D85D 3WFDH 1KELL 4OLXH 3AMLA 4YHPB 3O2VH 5GZND 5ITFB 1E28B 1ZWIB 3BKCL 4EI5B 1D6VH 1EFXD 2CKBB 2AEQH 5D1ZD 2DBLH 1OY3B 2FJFB 3T0DA 4PB9H 2KKQA 1JF6A 3LMJL 4KRPB 1N0XL 5CGMA 5A40E 3E8UL 5I8CA 1CBVL 3D3VB 4HBQA 4NZJA 4BZ1H 4KV5E 4PREB 5CBAA 2WUBH 1B88A 1KBGH 3VG9C 2LTQB 1U8QB 3S35X 3LS4L 1CFVL 4G6KL 2NY7H 2UUDK 5EZIH 1TFHA 4AENA 2R1XA 3WHXA 2YPLD 4XRCA 4L8DB 2CJUL 5KW9L 4GQ9H 3HNTH 2WWMD 3P0VL 3BYTA 3WFCH 1UM5L 3O3EA 5ISZD 1MAMH 1BEYL 1DEDA 3SE3C 4HWBA 4HGKC 4N0FB 1PZ5B 1OAUH 5IB2A 3GSVB 4PBVC 4OFKA 3S96B 1F13A 1JGUH 5KVMC 1C08B 4DKEL 5A2KH 3LN9A 3VI3E 3AREB 1Q8MA 3RWJB 2QADC 3JUYA 2CSPA 3N9GH 2CPCA 4OBRA 3ZE2E 3SPVA 3V7MA 2ORBL 4I13B 3TJEH 3QXAA 4NQDE 3BPOC 1S5HA 3FB6B 4DGIH 4U6VH 4WO4D 5L88H 4CVZB 2P7TB 4TSAL 3SCMD 4N5EC 4QGTA 5FM5M 5C9JB 3ARRA 3M1BB 2VDMH 3QEGL 4BJLA 3R8BB 5EO0B 5CFHA 4ESKA 2LVEA 5MEOA 3E3QE 4F9PA 4ZAKC 1MHEA 2V2XA 3LEXA 1MJ8H 1T22B 4OLYH 1MHHB 2I24N 3PDOA 3G04B 2IAMC 4GAGH 1NAML 4Z7WF 1MJ7H 3GSRA 4OV6F 3WNPA 3O6KL 5D72H 3KYNB 5EC1B 5HI5C 3QEQE 1AD9A 4Q6IC 1CDHA 4QY8A 2R15A 3RY6C 4OCSH 2AI0H 1V7MH 1NGPH 1U8NA 4L1HA 4JFXB 1B0GA 4JREC 3PNWA 1OGAD 2W0LA 2IEPA 4ODHH 4XPAL 2EE3A 1MFEL 2Y6SC 1UYWH 1CFSB 4M1DH 3U9UA 1C1EH 1U8JA 1S7TA 2PXYC 5K9JL 1A3LH 1C12B 1L7IH 2FRGP 4PJFA 2Q20A 4JZJB 4LLWB 2MTPA 5HHNB 4KK8D 4LHUA 1KCLA 3MRCA 3ULUC 3RVTD 4PUBH 5IFAH 5F1IB 4L8BB 3HZVB 1BBDH 2DTMH 1ZLVK 1XGPA 3MV8D 1I4FB 2BVOB 2H45A 1T5WA 4IRZH 3D0VB 1X5FA 3JTTA 1ND0A 4O58H 1CU4L 4UINH 3W0WE 1T3FA 1X4YA 1MAKA 1DBBH 1VA9A 1DQLH 3OXRB 4WI9A 1YEIL 2UUDH 2YXMA 3PWJB 4RGMB 4Y19A 3SKJL 5LAXA 1RU9L 1YC8A 2E5EA 4P46D 5C09D 4WHYH 3V95A 4OB5H 4IRSD 4N8VA 3QSKB 1P7HL 3GI9H 4U6HA 5LGKA 1MLBA 4Y4FB 1FNEB 5FKAB 1JHLL 4EDWH 4MJ6B 1MOEA 3O3DB 5EWIH 1JN6B 5IEHB 1YUHB 4P2OB 3FRPG 5IHZB 4UILH 4NGHL 4QGYA 1ZSDA 1U8LA 2IBZY 2CR6A 5GZOD 1GGIH 4OM1H 4P3CL 4JFZL 5EOQH 1ZVHA 5C0NC 1C7TA 5D7SL 2UYLA 4HFWA 3GBNH 1KPVB 1VCAA 3SDCB 5DD0H 5JPNA 4OZ4A 2W0FB 3DRTA 2BNQE 4UAOB 3H9SE 5INCA 3VGEA 1FJ1A 4KK6C 4PJ9A 3ZKNC 3CC5A 1TJGL 2VOTA 3LIZL 2NXZC 1FVCB 4NZUL 4TRPH 2VZ3A 3L3JA 4NCC2 1DQDH 3UPRB 5BRZE 2VXTH 4JGJA 4NRXB 2ADFL 1E4XI 4KHXH 3PGFH 3MJ8A 3GI8L 4YHOL 4IHOB 1KYOJ 2DM2A 4K7PL 4OUUB 1XGRB 1A7OH 4HF5L 5D7JD 4X8JB 2DAVA 4BFIA 5IIEA 2DM7A 1F6LL 5FOJA 3VWJA 3MBXH 5CJXC 1T5XA 4BFEA 3ARSA 2WIIB 3RI5K 1F2XK 2ZPKH 3JVGC 5MEQB 1TTGA 5T1LA 1A1OA 1RJZA 2ZUWA 1Q94A 1K2DB 1I8LC 2NNAA 2YC1B 3JTSA 4FTVD 2NY2D 4U1SA 2CRIA 4X5WB 1MHPL 4PRIB 4K2UL 3PP4H 4CJ0A 1QFWM 1WBXA 4PLOB 5HGAA 5T3ZL 1ZLVH 5E99L 3JXAA 1HINL 1RZGA 1YZZA 3HE6D 3RWGA 5C2UB 1D7FA 1FSKB 1KIPB 3HPJB 1E4KA 3H7BA 1DQTA 1I85C 4FNLL 5L0QB 3NPSC 4EOWL 4OZGA 2EC9T 3JUZA 1YEHH 2APXA 3PIQA 1CFNB 5IBLC 3MUGA 4J12A 3ME0A 1VEPA 3SKNB 4OI7A 1JYXA 2YUVA 3MMEB 1PYWA 1REIA 5KSUB 4TNWF 5I74C 5DD5L 4IMKC 1NEZG 2XA3A 4QRRD 4AH2B 1XCQA 4M5ZH 4RIRA 5F7LB 3DGGB 3RVXC 4Z0XA 5DQDH 5GGVH 2V7HA 4JFQB 1V5JA 3QWRA 2DS4A 3GKZA 4X6DE 5BVPL 3C5ZB 1QO3A 2CDGA 3MREB 5AAWA 3LS5H 3O9WC 2HVKA 2ZOKB 1MLCB 3RY6A 3RL1B 5D4QA 1AP2A 2CIKB 1TJIH 2YR3A 3GK8L 1QRKA 1RHHA 3U4BH 4LLUA 4N9GB 2FO4A 4BQ9A 3ULUH 3GMMB 1MQKL 1JGLL 4IRJB 1QRNB 2B5IC 4ONFL 5H2BB 2HT4C 1OW0A 1C5CL 1P5UA 3O8XD 3AU1B 4F7CB 2DL9A 1MI5B 4NSKA 2BVEA 2D4FA 1QFWH 1GHFH 2J8UA 3RWDA 2ICWI 4H25B 3NN8A 4LRIA 4X4YB 2RJMA 4GH7B 3ABZA 4X9HA 2EDDA 5GS0H 4ZPTA 2BVQB 4XCCH 1QHOA 2NY4C 2H41A 4M5YH 3OKOA 2ICEB 2P5WD 3QFJB 3QHZH 4JY5L 3JWDC 1MIMH 3BJLA 1I9JH 5D70H 1A6AA 3ZDYF 4WDIA 1MELA 1BD2A 5E08H 3C6SB 1DBMH 4EQ2A 4NQED 2AKRA 4UBDC 4PJEA 1XEDA 3WXWL 4KJQD 4X99B 5HVGB 3P0YL 2C1OB 1JPFA 4X0KB 1J88A 5EU4B 1X3DA 2UWEE 4M02A 2MQ0A 3R06A 5D5MA 5F88B 1UG9A 1WFUA 3V6FB 1FVDB 4G6AC 4M62H 2DQIH 1N6UA 3HLAB 2BMKA 1UZ8B 3M17B 1SBSL 1IEBB 1LDSA 5H37G 3U30B 3O4OC 2YHGA 3B4NA 3D9AH 2MQCA 3QUYC 1OLZA 1S7VB 5BXFA 1HYSD 4JKPH 4LPUA 4DCQB 1BQSA 2VLKD 3U0TB 2CXGA 1EERB 4WTWA 3UJIL 4XVSL 4OF0A 3V6OA 4HIXL 2QBWA 5BZDA 2VDRH 3TIEA 2C3VA 5EUKB 1Q9KB 2YPLE 4Z7OE 3CSGA 3ILQD 3RDTC 2E9WA 1AI1H 1KB5B 5DS8A 2WWKO 3PHSA 3QUXA 2FX8H 1OT1A 2F58H 5IJVB 3V4PH 4OLUH 4Q0XH 4Z7WB 1CFQA 5ISZE 3P0GB 5E8NA 3RVVD 4FQ1L 4H26B 4ONGH 2LU3A 3TNMA 3RNQB 1IL1A 2GTWA 5HDLA 3MLRL 1TZGL 3B9KD 1VEMA 4TOYL 4YHKH 1W0WA 4PJBB 3R0MA 1CIDA 3B3IA 3BD4A 1BQHA 3Q5TA 4TPRH 3WDHA 2HLAA 3QXDA 4RZCB 1MCRA 3KLHC 1X7QB 4ELMF 4WIQA 1FLTX 4QF1B 3EOBA 2OTWA 4LLMB 4F3FA 3VD9A 1XF4A 3NAAL 3S34H 1TVBB 1FG2A 3OKMB 3PQYD 3DVNB 1NC2D 1I8LA 3AGVA 1SEBB 3WE6B 2ESVD 2HFTA 3QQ4B 4BA8A 1N3NA 4LEOA 5K59F 4OFYD 3FQWA 5D2NB 1JNHB 4WUKH 2RAMA 2BOBB 2IH1B 1DUYA 5CBEA 4HJJL 3T3PE 2IADB 1E27B 2DRUA 4JB9L 1GZQB 3HFML 1RZ8A 3DX6B 5ETUA 1XZ0B 4Y2DC 2D7TL 3QRFM 3H3PH 3N1QC 2X9XA 1OGAE 1KENH 5DXWA 5EPMB 4CMMA 5IOPB 4PR5A 1A7BA 1KELH 3TM6A 4JCLA 3MFFB 1NH6A 2FIRT 3BKCH 3H3KA 1FNLA 1H0DB 2Q6WA 3LPGA 4NQCA 2OQJB 4MNQB 5JORA 5IB3A 3LMJH 2P5EA 3KPMA 1N0XH 2EXYC 3O6LL 1AHWB 1IKNA 3E8UH 4FQLH 1I1CA 1IGML 4G43B 3TFKC 1CBVH 4NOFA 3FO1B 4MJID 5AD0B 1MJUH 3R4DA 5HYJA 3UC0H 4WCYL 4GW1B 3ZDXF 3MV8E 3G6AB 2VN4A 4LPXA 2D7NA 3ZTNL 3LS4H 1CFVH 4G6KH 5JMRA 2E9IA 4KDTA 4XPHL 3UTQB 5I76A 4NNYB 3CSYA 5GRVL 3DECA 4JG1L 3QDMB 4KUCD 4Y4KC 2CJUH 5KN5B 3G6JE 4P48A 4F7MB 3DXAA 2ED7A 4MHHG 5IW6A 1QACA 2KH2B 2Z4QA 4GUPB 5FGCE 5C09E 1UM5H 5EU5A 4CL7A 3MGOB 2GSGB 1G7JA 5A16A 1BEYH 4JGMA 1QSFB 5EZLB 3S4SA 4PGJA 3IFPB 4Z7UE 5GS0D 1PKQB 5DRNB 5F7EL 4LCCB 1JZ3A 4DKEH 3FO9B 2A6DB 4KK9D 4WW2A 1NBYA 3GMQA 3TA3A 5CIPB 5DJ6B 3LQZB 2NY6B 5CEYA 3QYCA 2ORBH 4HS3A 1YMMA 4XAWL 1AR2A 2PTTA 3BMVA 3EOAB 5T1KA 3RKDD 5TDPB 1EXUA 3RTQA 3T1WA 2HJKA 4G9DB 4JM2D 1YPZB 5C1MB 1L0YA 3BN9D 5JZ7C 4K3HA 3KPRB 5C0AA 1Y6NR 2AK4A 5LCVH 1DQQB 4PRHD 2BY2A 2G5BB 3MZTA 3MGTB 1I8IA 3BZ4B 1T6WA 4HWBL 3K7UA 3NGBC 2IMNA 2D3VA 1T0PB 2G9HB 5FUCC 2FDBP 3WN5A 5I1KH 4AEIL 1NAMH 4ZTOL 2ADGA 5IVXB 3O6KH 2I5YH 3CJJA 2D03L 1ORSA 5E5MA 3GB7A 1B0RB 1JE6A 1S78C 2DWDB 2XPGB 5IMKA 3N1PC 5IK3A 3UTZB 4L3EA 3BPLB 4K3JL 1BZ7A 1QPPA 3QIBD 1MFEH 1ZEAL 4XPAH 2WANA 3EHBC 2VLJA 1RIHH 4P4RA 4LLQA 1YEGL 3PGDA 2DLIA 5KSVB 2HT2C 2NY3B 1DL7H 1XMWA 5CEXA 5LGJB 1U95A 4NO0A 1BLNB 1U8IA 1KGCD 1MPAL 1I8KA 4KV5F 1QR1B 1XF2B 1XR8A 1RY7B 1YY8B 4DN4L 4RSVA 3FT3B 3F7YB 1CGYA 1PQZA 4NNXA 3VXQA 4FTVE 4P4KB 3L3IB 3MRGA 2YD3A 4TVPH 3Q3GA 4XP1L 1YEDB 2MWCA 5L8KB 3Q1SL 5HVHB 4GKNB 3CX5K 2XWJB 2F74B 2YK1L 5BW7A 1A6VL 1OTTD 1F3JA 2X7LB 4AJ0A 5SWQA 3RFZC 3E2HC 4K7FA 5IF0A 1RU9H 1CGXA 3EYVA 5DVOA 3GIVB 3DI2B 5EUOA 4G8EB 2A77L 5F89B 3VI3F 3ARBC 3I6GA 4M7ZB 5A3IC 3ZE2F 4ZXBD 4FZ8L 5GGRB 3K4DA 1E4WL 4JDTL 1JHLH 4WV1A 3NACL 2UZIL 3PHQB 5IR1B 1A8JH 5GIRA 4KI5D 1WEJL 4QRRE 4QWWC 5FFLA 3TN0C 3GHBH 3I3EA 4LMQE 3B6SA 4HV8B 4NGHH 4U6TA 3UTTD 4MX7B 1YN6A 2BHUA 4OD2B 3ULVL 1GGCH 1X5JA 3KWWB 5TFSL 2X4NB 4P3CH 1XCTA 3CXDL 4JFZH 3SO3B 5D1QC 3ZYOA 2PW1B 4LLVA 3VCLB 4JFDD 5D7SH 3BQUB 5FDWA 3CK0L 1CZ8L 3BAEL 1KT2A 1CI5A 4PJCE 1R5WA 2MMXA 2F5AL 5HYSB 2EXWD 5DDHA 3W39A 2RFXB 2ICWB 3IDGA 1TJGH 8FABA 4UDUB 5M94B 3LIZH 4WVRA 3WFHA 4F33A 7CGTA 4NZUH 5CLWA 3RGHA 4Y5YB 1IEAB 1G7MB 1ED3B 4HIIA 3WXVL 1M4KA 4MCYA 3S88L 2ADFH 1F4YL 4YHOH 2OMNA 3GI8H 2J88L 1DEEA 1HXMA 4RFOH 1C5DA 5GRWA 1KJVA 4OZHE 4HF5H 1L7TL 5CUSL 4PYGA 4KMQA 4WHDA 5E2UL 4N0CC 1KJ3L 1P2CA 3C5JA 4S10A 2HN7A 5C07A 4O9HL 3CFKA 5JQHC 4B50A 2P5WE 3CDCA 3GDBA 4U1KB 5L2JB 2VL5A 4WU5A 43CAB 3VRIA 4GG8B 4ZFOA 3PL6C 3HNVH 5C0FB 5I1LA 3EYUL 2Y36H 4KUZL 4NQSA 3JV6B 4GW4A 4NQEE 1HWHB 1MHPH 1MCEA 5J6GA 4ZSOE 1JTPA 3T2NL 2ZG3A 4K2UH 4K55A 1VGKB 5K9KA 1OCWL 1VB9A 3HMWH 1A4JB 4KTEL 5T3ZH 1R5VA 3MYJB 3TCLA 1XIWD 1FYTB 3ISWA 5DC0A 1ORQB 4JHAL 2XQBL 1T0MB 4NRZB 3TZVA 3PWUB 4FNLH 4FFVD 1WT5C 2YZ1A 3GRWA 3I75B 1CE1L 1U8MB 4X5LA 4I18A 2XY1A 4A6YB 1ODAA 4N90D 4ZPVB 5SWSE 3VXPA 4ELMB 3GM8A 1NCAH 1UM4L 5DK3A 5C86A 4Y4HB 1G7IA 5D1XA 1CDIA 1KG0B 3ULSB 1RUAL 4IOIB 3EAKA 1AJ7L 2XZQL 2GAZA 3FT2A 2VLKE 1WBZB 2JIXD 1GRWA 3QDJB 4JFED 2R69L 4LOUD 1OAXL 1HOCA 4M43L 4IIQA 3C09B 5CS7A 3RUGE 4RX4A 3D0LB 1IT9L 4ONHA 1MH5A 3FMGL 1CCZA 2P24B 5BVPH 3FFCD 5EA0L 1B90A 4OUOA 2NYYD 1HH9A 5CD5D 5E1AB 2Y72A 4NNPL 5FDYA 3GK8H 1QLRA 3B8SA 1NDGA 1C16B 1UZ6E 1R3IL 2XACC 1MQKH 5IJKA 1JGLH 4XNMA 4CRPA 1I9RL 2X70A 4ONFH 5I1HL 1C5CH 1JMZA 1FNFA 2HA1A 2B0SL 1GZPA 1JZ7A 2F8VA 5B38B 5GS2H 5JQ6L 3PQYE 2GTZB 4U05A 2PYED 5F6HI 4K07A 1HIMH 3P4OB 2CO7B 5E8OA 3FONB 3RVUC 2IPKA 3KXFB 3RVWD 2FL5A 5D9SB 4JFPA 2ESVE 5JIHA 4M7LL 4O2CB 2XFXB 4LARH 4MD4A 4WTZG 5D96C 3OZ9L 3PABB 3QAZB 3GJFK 4MDJB 5I19L 4R26L 1RMFL 3MYZA 1EAJA 1JGDB 1HSAA 4JPKL 4S0TD 2DQEL 3SKOB 3GIZL 3U7AA 3ARTA 4D0DB 3GSWA 4YFLI 5ICYA 4KKCD 3WXWH 4KVNL 2MHAB 3MRHB 3OKKB 4BELD 4F7TA 4KGJA 3DMMB 4G6FD 3QIWA 1HILA 1TZIB 1YN7B 2VR9A 3KDMA 3SQBA 4PG9B 4APQC 4MYWB 2NX5D 1SJHB 1G0YR 4MJ2A 2DYPD 4JRWA 5F1NA 3AAZB 1MWAB 4HIHB 4E5XA 1S7XA 5EZOL 5D8JL 1SBSH 1JMXA 5SWZB 4ZUTB 5FO7B 1CL7H 2E6PA 2PYFB 4W68A 5IKCA 2OL3A 5ESQB 4MJIE 4U1HA 4LF3B 4YFLF 5ACZB 4XHJC 5GRVK 3MRIB 4M93C 4OIBA 3UJIH 2ZOLA 1ZT7A 4XVSH 1NFKA 4DTGL 4X6DF 5HBBA 2AJVH 3MX0A 1F45A 4L3CB 4OF8A 2Z92A 4MJ4A 1KSRA 2JJUA 5F96L 2I27N 3HB3C 4H5SA 4U7KA 4FQ1H 5I8OL 1AXSB 1J8HD 4MNHA 3H9ZA 1P4IL 5AAMA 1PX3A 4TULH 3MLRH 3OSKA 1TZGH 4TOYH 5I2IB 4BUGA 1U3ZA 4IOFD 4Y16A 1S8DA 5C3LD 2FX9L 3RZCB 4PJHE 1KJ2H 5CGYD 1YEEL 3EYOB 4DFHA 5DJ2B 4JHWL 3BKYL 3BSZH 4NN7C 2CLZB 3NAAH 3AY4C 3QEUA 3Q6GL 3U7YL 5T3ZD 2WBJD 4XP5L 1XGTB 5F3HA 3P73A 4EI5C 2ICWJ 1FN4A 4ODUB 4CDGC 4PRHE 4M7KL 2JJSA 2FR4A 1T66C 2M26A 4HS8L 2AJZA 5F70A 4KRPC 4N1CA 5IMLB 4WGVB 3MNVA 4E42A 2GUOA 3FQTA 5DLML 4V1DD 1G9NC 3MPCA 4HJJH 1BAFL 2EE6A 1BIIA 3GJFH 4JB9H 2C3GA 2IBBA 4UOW0 2LTQC 2Q76A 3ARYA 2UWEF 2VE6B 5HGBA 2A6IA 3ULVC 3WFBH 5DHYA 1D9KD 1BM3L 3RIFK 1PY9A 4AT6B 3U6RB 4H1LG 5DSCA 2EYRB 4NQDB 4IS6A 4FRWA 1EDQA 4NFDA 4UIMA 3L3KB 1PEZA 1KGCE 4EN3B 3VH8G 3SY0A 4QRPD 4XI5D 3O6LH 1RUQL 5KSBA 4N0RA 3AREC 5C6TL 4GRMA 4ONOA 5DJZA 3HRZA 2F54A 2KPNA 1MCBA 4Z7OF 3TO4B 2XG4A 4WCYH 4Z9KB 3RX5A 4ZS6C 1JP5A 2FEDC 4NWUL 5HDOA 1YY9C 4ZO8A 4QXWA 4XPHH 4M1CD 4JG1H 3OJDA 3CGTA 1WUNT 3AVEA 1LEGA 1A5FL 1EEZB 1BFVL 3MOAL 5J06A 5ID1B 1TPXB 3C9NA 3CXHK 5C3TA 3RGVD 4RGNC 2NR6D 3HUJE 5DFVC 4MA1B 3KS0H 4NKMA 1JPGB 1NGWA 3FRUA 3OB8A 4J3VA 2VC2L 4UNUA 4HZAA 4ODTL 5F7EH 1CK0L 4AQOA 4N1EA 5E6IA 3DSFH 4AL8L 2FX7H 4KI5E 2KQMA 5EN2B 2GK0B 5I30L 4OF6A 2XTJD 4S0SD 3O0RL 2VABA 5T3XD 3JV5A 5D6CB 1A02N 4FXGA 4NKIL 4HUXB 2W38A 4R6UA 4XAWH 4POYA 3G5YB 3SDXA 3UTTE 2Z35B 1JV5B 2GCYB 3S36L 5C9KA 3E6FB 1FPTL 5FOBA 4I0PD 1O7VA 3G5XA 1MCIA 3EDEA 4JFDE 3VFRB 2KZWA 2BNRD 4JZJC 3SDAA 4Y1AA 2H32H 1T7XA 3T3PF 4PRDB 4M8QB 3GMRA 3C60D 2Y4SA 3IETB 4ENED 2CMRL 4AEIH 3D2UA 3QI9D 2HVJB 1M7XA 3H8NA 1DDHB 3IDUA 2CGRH 3NCCB 2D03H 4JKWA 2QKIA 4YUEH 1ZGLB 3S3SA 1U3HD 5FA3B 3OF6A 4DKFH 1TVDA 4NC0B 4XP6L 4RFEB 3WIHA 1CICB 4ZNEE 2EDNA 4K3JH 1P84K 1ZEAH 3QEHA 4RGMC 5GRUL 4XNXL 1DLHA 1YEGH 4P2RA 4HULB 3QISA 4WHCA 1TNNA 2EDTA 3TIDB 2AEWA 3WIFB 3I2CL 2HTKC 2AABL 3QO1A 4GRWE 4RDQG 1DJSA 2V2TA 1J0IA 1H3TA 5I8EA 1QSED 3GSNB 4DN4H 4PRNB 4LGPB 1D5IL 1X9QA 3X12A 1ZS8A 4YC2B 5MEPB 1W72L 3FOMA 4I48B 5CMAB 4XP1H 5ID0B 3QHTC 3TO2B 1RSFA 1T1XB 3X11B 3Q1SH 2DM3A 4QHKI 2F8XC 3G6JF 2X4SA 3MO1B 3NFPA 5ACLA 1AIFA 3CFDB 4OZFB 3MA9L 4D0BA 2C1PA 4DZBB 2YK1H 3GBML 1A6VH 4HK3J 3H0TA 4Z7UF 3QEQA 1I1AD 1WVZA 3SDCC 1X5AA 5FCUL 1CXFA 2G5RA 3ORJA 4HLZH 4UAOC 2CKBH 4N90E 2A77H 4HFUH 3T0WA 1XGUB 3NIDE 1FHGA 3QDGB 4FZ8H 3AY4A 3ARGA 1E4WH 1KIRB 4JDTH 5ICZA 1T7WA 3NACH 2UZIH 1CFTB 1EHNA 1JWSB 3LKRA 4JFEE 4XMPL 1WEJH 4LEXH 1E28A 1D5ZB 1A6ZB 4PP1D 1PG7W 4YDIL 3DYMA 3RJDA 1MFBH 3P4MB 5C0BD 3UROR 1FNHA 3MRQB 2BOCB 1AGEA 4HIJA 3BPCA 4PRPB 3ULVH 3PHOB 5GPRA 2AJYL 2D7OA 3D3VA 5TFSH 5IMMA 4RFNB 3FFCE 3IFOB 3MRPA 3CK0H 1BJ1J 4I0KA 1XR9A 2HRLA 4QXGL 3LKSB 2F5AH 4CNIB 2X9YA 4ZUUB 4CMHB 2FLRT 4ELKA 3JWOL 4QRQB 1H8OA 2YD7A 3DX9B 3STLA 3DX7B 1INQB 4POZD 3WXVH 1WWWX 2BVUA 3S88H 4N0FA 3WKNA 1PZ5A 4R7NB 3CFEA 1F4YH 4U7SA 3T2OA 1S7WA 2XQYG 2FCBA 3S96A 5I75B 4P49A 1FSKC 2H1PL 3BZFA 2PYEE 1Q38A 5CUSH 5L0QC 2NY0C 3ILPA 3RWJA 2EYTA 5E2UH 2LE9A 1KJ3H 3SE4A 2VXVH 3TGXA 4U33A 4O2FA 2R2CA 4O9HH 4UDTA 4I1NB 1KJMA 2VSCA 4X80L 3U9PH 3FB6A 3UJTH 1YDPB 4URTB 4X6DB 1VKXA 3OJMB 4YDVB 2JK5B 5IHLB 5C9JA 1SVCP 3M1BA 4F7PB 1RUPL 1FP5A 1MCOL 3RWHB 3MLZL 2A6KB 1T20B 1DZBA 3DUHA 4YXHL 5JR1L 4LMQI 1HN1A 3BIBX 3T2NH 1WTLA 3H9SA 3ALWA 1OCWH 5HHXL 5TF1L 4KTEH 5I1AB 5DZOA 3QQNA 3C5ZC 4GSDL 4H0GA 4JHAH 2XQBH 3KYNA 2XWTB 4MXQC 3K46A 5L2KB 3VRLE 4NC1C 1CE1H 3DROB 1A1MB 1UM4H 3TYFB 4ZFOL 5T5FL 3GMLB 1RUAH 4JFFB 2XZQH 4IRJC 3DV6B 5DHXB 4PGDB 2IGFL 4GAJL 2EIZB 3QH3B 3VFOA 1T89A 2R0ZL 1C12A 5F9OL 2R69H 4U1MA 4BK4A 4JG0L 4QRTA 4YHIB 4LLWA 4JKLA 3BWUC 3FO0L 3PWNB 5D2LE 1IT9H 3GMOA 1FIGH 3FMGH 1IQDB 4PJCF 1VFBA 5F1IA 4K7PX 1NGYB 1NGQL 4WI6A 1HHHB 5D6DC 3BEVB 5H35B 3GRWL 4WEBL 4X9GA 1J8HE 1TVHB 2UWEB 3D85B 4JRXB 5HHQA 1TCRB 2EEDA 4JZNA 1P6FA 3C6LB 4CN6A 3SHSA 3CZFA 1F6AA 2HLFD 3OXRA 5D7IA 1EFXB 3BUYA 4M6OH 5D1ZB 5AEAA 5HYEA 1R3IH 1OD7A 5BJTA 1HHIA 2ITDA 1I9RH 2KL6A 3L95B 4OZHF 2R2EA 4JDZA 5I1HH 4BSVB 2B0SH 3LOWA 4H20L 5EU3B 1I1YA 1MFNA 4Y4FA 3QUMA 4ZO9A 5FKAA 5T3ZE 1VHPA 5IP4A 3NCYS 1CDUA 4OFDA 5CCKL 1J7VR 5FIEA 3EO1B 3O3DA 3VGAC 4OSUH 2Z0BA 5CJOL 4YHNA 5C0GB 1KPUB 2VQUA 2V5MA 2YPLB 4P2OA 3WHE0 4M7LH 3OAYK 4P3DA 3U30C 4QRUB 1ZKAA 4NHUA 1X44A 3OZ9H 5DYOA 4LHUD 5GRYA 3O6FC 4JRYB 1KC5L 4KKBD 5ISZB 4R26H 1NKOA 5IW1B 1RMFH 5E7BA 3QZWB 4JPKH 4XXDB 1EEYB 1YJDL 3WBDA 3GIZH 5MHSD 1KPVA 1H9VA 5DEGA 2VQ1A 4YBQC 3ZO0A 4ZD3H 4R4NC 4BUHA 4PYHA 1RURL 1MFAL 1T2QH 1FVCA 2XKSA 4OI9A 4X4XA 4Y19D 3VGDA 1IAIM 4WO4B 4M1GL 4NRXA 3SCMB 5EZOH 3OAZK 5D8JH 3ZT6A 4IMLA 2R39A 4QRPE 4XWOD 5DI8A 4Y5XB 4OUUA 4JY6B 5CSGA 4KXZH 1VEOA 1KLUB 4XHQA 3RUGF 1JPSL 5E2WL 5DQ9B 3VGHA 2RR3A 4DTGH 1EO5A 1NFIB 3QPQD 5MEQA 3HAEB 1J1PL 3NCBB 1QQDA 1K2DA 1OQXA 2OTPA 5CLTA 5KAQG 3LH2L 5B8CA 1DFBL 4BQBA 5F96H 1IM9A 4HH9A 1SJXA 4X5WA 1J05A 4LBEB 1S5IH 3BEWB 1OGAB 4JDVB 2QJDA 2BERA 1MREL 2DQUH 5I8OH 1UZ6F 5E95B 1P4IH 5D2NC 5GJSL 3WFZA 2OL3L 3GM0A 2MSPA 2FX9H 4PJ9D 4XNUL 1F4WL 2P8PB 2VLRA 2XTJE 4HCRA 3W9DB 5T3XE 3FB7B 1YEEH 3DIFB 3VXUA 2VZSA 2DIBA 43C9A 3SKNA 4MD5A 3U7YH 3TBWB 2VDPL 3MMEA 3MV8B 4XP5H 3IFNL 2RGSA 4HJ0C 5JW4N 3OG4B 2BNRE 4MA7L 5F6HJ 2AXGA 4N8CL 1CXHA 2F8OA 3VWJD 3HPLA 4XMKL 1FCGA 2VWEE 5EOCL 4HS8H 4I77H 4PJ7B 5GSRB 4TUOB 1IAIH 3G6JB 1AHWC 1EUUA 3ETBF 5DLMH 1FZMB 5T1LD 4P46B 4I4WA 3OAYH 1XGYH 5EBWB 4JO1L 3C5ZA 4RMWA 1RUKH 5JXEC 2Q7YB 2DL2A 4Z7UB 3RBGA 2YD2A 2QR0B 2P42B 1U93B 3PDDA 3RL1A 3ARZA 4U1NA 1FV1A 1BM3H 4LU5H 1QFWI 4X4ZA 1N59B 3L5XL 5I0DA 4UMGA 3CSBA 3ARFB 4ZYKA 2Z91B 1FNGB 2BVPB 2VDLL 2R2HB 3F58L 3AU1A 1MI5A 4EUPB 4LCCC 1QSEE 1E6OL 1RUQH 1CLCA 1HQ4B 3OAZH 5K9OB 5C6TH 4FQPA 3HZKB 2C3WA 2NY6C 4KUCF 3FT4A 1RUML 2W91A 4LLYB 2A83A 1J0ZA 4W6YB 4OLZL 3U1SL 4NWUH 4NJ9L 3NMEA 3K81A 1ZTXH 2IPUG 2GFBA 5HGDA 3VD4A 1AO7A 1LP9B 2YEZA 4G42A 1JJUA 4YXKL 1JUFA 4QXUH 3C6SA 3QJHB 3QWRD 3RP1A 1KF9B 1PKOA 1DANU 1ADQL 3VFUB 2ZUYA 5I1IH 5HI5D 3X13A 3T3ME 5EO9A 3RI5F 4X99A 4PJHF 4G80A 3CFBB 2Y5TB 2VC2H 4OCXL 3KLDA 1CK0H 4HJGA 4NCC1 4AL8H 1TQBB 2ARJA 3QIUA 5ABDE 4RWYL 5I30H 4UT7L 4JM2F 3PWLB 3O0RH 2R23B 5C0BE 3VFGL 3M17A 1VPOL 4NKIH 1MFCL 4HLZG 5FF6B 4K23L 4LHUG 2NY2B 3BPLC 1QNZL 3S36H 3S37L 5LBSL 1S7VA 4OF7A 2BDNL