4YL9A

Crystal structure of wild-type of hsp14.1 from sulfolobus solfatataricus p2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
b'MNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAGFNKDKISVRLSAQNELIINAEREIQYIGTKYATQRPLKIHKVIRLPVKVKRDSQVTAKYENGVLTIRIPVEGSVSIRIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein Hsp20
publication title Active-State Structures of a Small Heat-Shock Protein Revealed a Molecular Switch for Chaperone Function
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain 98/2)
molecule tags Chaperone
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4yl9A00
3QORB 4M5SA 1SHSA 3QORC 4YE0A 4JUTA 3QORD 4YLCA 1EJFA 1X5MA 2CG9X 2JKIS 3W1ZA 3AACA 3Q9PA 3VQLA 3QORA 4M5TA 2KMWA 3L1GA 2Y1YA 4YLBA 3AABA 4JUSA 5DS1A 2Y1ZA 2WJ7A 2K8QA 4MJHA 4YDZA 2CR0A 3L1FA 2WJ5A 4PBDA 3L1EA 2MNWA 4FEIA 2BOLA 3GLAA 2Y22A 2KLRA 2O30A 3N3EA 5DS2A 4ZJ9A 3EUDA 1RL1A 1WH0A 4ELDA 1GMEA 4I88A 5LUMA 4RZKA 2N0KA 2N3JA 3J07A 3GT6A 3GUFA 2XCMC 3VQMA 1WFIA 1WGVA 3IGFA 2RH0A 3Q9QA 4YL9A 4PCKA
chains in the Genus database with same CATH superfamily
1WD9A 2MPAL 1JP5A 5ADOH 3FB8A 2OW7A 4FQIL 1MFNA 1U0QA 1E50A 4M1CC 2WQXA 5CS7A 5D7LA 3LEVH 3U30B 2CK2A 5CO1A 2VMEA 4OF7A 1JXGA 2V5MA 3IXTA 4L0ZA 3TVMB 4Q2ZA 4WUKH 3KYAA 4R96B 4G8GA 4DKEH 4DCQB 1A1MB 1QNZH 4X8JA 5CMAB 1BVKB 3D2TA 3LOWA 3GIVA 1PFOA 3KG5A 4MNGA 4HZAA 5JOPE 2ZX6A 5KJ4A 5EOCL 5E9DE 4LBAA 5IROC 4A63A 2AJXH 3B6SB 4E36A 3RGBA 3I3BA 2HVJB 1KSRA 4PJ8D 1LQSR 3PJLA 4BIKA 3QJFA 1JWMA 1FNHA 1G5AA 1PEWA 4KJPC 5F3FA 3QEQE 1JDCA 3QHTC 1P5UB 3CFCL 5EEWA 4UTAL 4L4VA 4Y5YA 3V79C 4N2EA 1TZIB 2ATPA 1TKWB 1K4CA 2HJKA 2VUYA 3KL0A 4MGXA 4BELD 1J8HB 1K8DA 3EO0B 2NUTA 5IMLA 4JN2B 2IAMD 3O9WA 1INEL 4HWEH 4GS7C 1WCBA 4LKXA 5D70H 2ZYSA 4F9LC 4YSQA 5BZWA 2JELL 2W0LA 4W81A 3IJYA 4S1QL 3MHZA 4FP8H 4BQBA 5BS0D 5IFJA 1TJXA 3UCRA 1SJEA 3CN1A 3LHPL 3VX1A 1MREL 1U8CB 5DFWH 1GGCH 1UVQA 4GKOA 1B2YA 2FEEL 4NHCH 2OMNA 2X12A 4FQXC 3ARFC 4HGKC 2WQVA 5HGDB 4CMMB 5GGUB 1I8IB 1F3JB 1NOFA 4P9HL 4Z7WF 1F1AA 4A39A 1JPSH 3MJ7B 3FTGA 3GJEB 3GC3A 3EZ8A 1SZNA 3NIDF 1JYVA 2BIHA 1PKOA 4Q9RL 4PP2B 4I1PA 3K91A 4KRNA 1S78C 4A6YB 2FECL 3T6XA 1PLAA 1SM3L 2GW5A 1KIQB 3SY0B 1E4JA 1T03L 4CJ1A 4YHNB 3EBIA 4B97A 4Y5XB 4MD4A 3AB0C 2A9MH 5FO7A 3ZTEA 1HJBC 2PCYA 2WQAA 3ZL1A 2FCBA 2Z1KA 5D7SH 1H9VA 3TBSA 3MFGB 2N0KA 3EJTA 5F1KC 1V55B 3GT6A 1ZT4A 3T0WA 4X6DA 2OTWB 4NENA 1ECZA 4UANA 5B3JE 4NP4L 2J88H 3QIWA 4TQPA 4YK4B 3F7VA 2DM7A 3CSFA 2RQEA 3DK0A 3H9SB 1AD0B 3OQ3B 2WW8A 4XC1L 3ARBC 1I8AA 2Y23A 3ZDXE 5IEHA 3JBG7 4OM1H 3CPLB 3NCMA 2GABA 4XBGA 1S9VA 2UZIH 4JO4L 3TZVB 1IGTA 1S7XB 4C4KO 1QLRB 4KZDH 4ACTA 5ETUB 4ODWA 5KYXB 1Y7VA 2E9GA 2WWOA 3IETA 5D7KE 4CSPA 2MFNA 4NJ9H 4JY4A 2K7PA 2BP8A 4ZMPA 4OFIA 5ACZA 1RMFL 3DOSB 4ZOAA 3LKPB 4NJAH 3EOAA 2R4RL 1I3GH 2AKRB 2AVFA 2F1AA 3MNZB 2DKUA 4G70B 4PJ5B 2O61B 2DLFL 4Z7OB 2VXUL 3F6IA 4D94A 1D7BA 4HUUB 4WI0A 2TAAA 2UVEA 4NBYB 4PP1D 2FECI 1E8YA 3KPQB 3M45A 4U6YA 4BGDA 1C8PA 1V3LA 4ZTOL 3D34A 2A9DA 2AJYL 1SMDA 2WBJB 2FO8A 5HPOA 3RDTD 5EORH 5AVZB 3VXPB 1KJ2B 4PRHD 4GAJL 5SX5H 2H2SD 1GYWA 1J12A 3HMWL 1L6PA 3NP4A 4G7VH 3T8XA 3UC2A 3WS3A 2EDXA 3ARDD 3SDDD 3DIFA 3OKKB 4NLHA 4ZS7H 1QR1B 4YE4H 2ZP0T 5I1EL 3CDZB 1VGEL 3MV8B 3P4NB 1Q9KA 2L8AA 3PWVA 4BFKA 1P4LB 2ADFL 4KTYA 1F4HA 1NLDH 4ZSOB 5DMIH 1UYWL 3QHZL 1EXUA 3S35X 5FGBA 4R7XA 5ECJE 4HUKB 1J05B 1DBML 1IC5L 3NFSH 3OKMB 4BSWB 4NZTL 4F92B 1WA1X 3L3IB 5CLZA 4HLEA 2I9TA 1JYWA 4BUGA 4FS0A 1TQTA 1CBVL 2NT1A 2JJSC 2XXFA 3SGDH 3EYVA 3GPSA 1ZE3C 2C3VB 1A3LH 1X7QB 3T2NH 3ZKNC 1SUHA 2R2HA 2WBWB 2XA8L 3UEQA 1OARL 5E2UL 5F1OB 3CNKA 4L9LB 1E5BA 1U8QA 3LIZL 3ZIYA 1N2RB 4NQTA 1YC7A 2NY5H 2OZNA 2YC1B 1JD7A 5E8NA 2QSCL 4RFNC 4PB0L 3DHPA 4Z7QB 1O6TA 2AW2A 1S8DA 4KAQL 2V33A 3SE9H 3Q6FB 3EHBD 4PJXB 4TKWA 4D3CH 5D5ME 5AOIA 1YAIA 4QXUH 3FF8A 5GISH 4DJMA 3QPXL 5IHWA 4PBXA 5FYKL 1XF5B 5KSAD 2B4CH 3IKCA 3B5TA 2JKNA 4JPVL 5MEND 5KYYA 3VXNA 1L5GA 5CGMA 4QRAA 3NFPA 2VXSL 4YBLC 3M1BB 1CF8H 4Z23A 12E8L 5DK3A 3TO4B 1YEDA 3VYPA 2VDOH 1WIOA 2DQGH 2Q7NA 2J6WA 2NY0B 2YUXA 3FQXB 2DW5A 3MLUH 2D2CC 4HXAH 4HFWA 5JW4Q 2X3CA 3HS8A 4HLJA 4PRHA 4UV7H 3X17A 1VERA 5BVPL 4JFXA 3GJFA 2GK0B 4GXVL 4NT6A 2VWEC 2ZCKL 5EC2B 3FL7A 3W39B 3X11A 5EOCJ 2VXQA 4XP1L 5GS0D 5EOTA 2Q76A 5IBTL 3JUZA 1GS8A 1GZHC 4RFEB 4MX7B 1G1YA 4PW4A 1K4DB 4DKAA 2DKMA 4JZJA 3OR6B 4X42A 4KKLC 4N0FA 3HC0B 3O4LD 5C07E 2OSWA 4LVHC 2NR6D 2HRHA 2JKWA 2QJDA 2FSDA 1G7QB 4JDTL 2PYED 1C16B 2AXFA 4WWID 2AQPA 1RIUL 5IFAH 2WN2A 5DD0H 3HG5A 2X6BA 1JZ2A 4UT7L 4AM0Q 3FXIC 2FATL 4QNPF 4NDMA 2WUCH 5JW4N 1MIML 1A4JA 3K2IA 2B7DT 3H4HA 1TZOA 5T1MA 2F7IA 4JRLA 4HULB 1ZTXL 1KEML 3DURA 4LSSH 3DMMA 4PV8B 2HJLA 1FAIH 3TN0D 2BNUA 1F4WH 3NEOA 5GHWH 1OT2A 3S3SA 1UB6B 2FL5A 2OL3A 4LXFA 3MRPB 3TO2A 4WK4B 3FB5B 3V0GA 1UCTA 4G6AD 2RIKA 5CSGA 2CR3A 5C0RH 1W80A 3CFEA 1VEMA 3OMAB 3X1EA 1A22B 4CC0A 3EDFA 3G6JB 4HWZA 4QTIL 5DS1A 3BRGC 1B0GA 4HQQL 2W5PA 2YARA 3D85B 3IFLL 1NGYB 4U1LB 1F58L 3NCBB 3EXLA 4H1LH 2YKKA 2WXHA 1JGVH 4OZFG 3VTMA 3B1UA 2UXVA 1SY6H 2YD9A 4K8RC 4X6BA 1VACB 3ULUF 1OAZL 1D5XB 2NW3A 4UTAA 3WIHL 1MRDL 1G6RH 1XTMA 2CKBB 1MRCL 1QYGH 2JB6A 5I16B 4N2FA 5IB4A 1JGDA 1AYRA 2KZ1B 4KPHL 1I8UA 3ARED 3DSNB 5B7EA 2HRGA 5DMJB 1HDMA 4FQLL 2WIIB 4UM9D 4NZUH 2QLYA 4PVBA 3HI1B 4D7BA 4NO3B 1DLFL 5IUSA 3TEYA 3REWB 4F20A 4PRBA 5TE7H 3ZR6A 4K9EC 4KI5D 1RUQL 2EO7A 3BVNB 4G42B 4J3UA 2QVIA 1RL1A 2D2OA 5CZXC 4GEIA 3EO9L 4U1JB 3GXNA 4MZ2A 3NIGF 4AMXA 3QEUB 4KK6D 1F3RB 5D8JH 4F2EA 2Y7MA 1K2DB 4WNQA 5C0AE 2ETWA 2XQYG 2P43B 3O4LA 1S5IL 2CLZB 4LLUB 3ZL4H 3I6LE 4PHXA 3LHAA 3DSFH 2JTDA 3QNXB 3SGEI 2PYEA 4O00A 4IMKA 5DMYA 3QRLA 5I17A 1ZXQA 2K7QA 4JFWA 15C8L 1BAWA 1JXDA 5FF6B 3X13A 4OT1H 5A7EA 1GOHA 4N25A 5DD5H 2J8OA 4KRPC 5J1AB 4RGOH 1OOWA 1CL7H 1BAGA 1YCSA 3H7BA 4DP2X 2BX5A 3TN0A 3T8VA 4AJ0A 4YEFA 3ARWA 1KB5L 2CUAA 1XSJA 3PWPE 1S7SA 1YEEL 1LEKA 2DF3A 1KBVA 4NC2B 3SN6N 4MJ5A 3SYPA 1U8PB 1PAMA 1I1YB 2QHRL 3CFIC 3DYPA 3O6FB 5SX4I 1N0LB 2Y06H 3QUYD 4L4TD 2Q87A 1PL3A 1ACCA 5D2LE 4QTFA 3TV3H 4E41A 5ID1B 4ENEC 1XAKA 2YWZA 1ZRUA 1I7UB 2RHEA 2WO3B 3GO1H 4Q56A 1XMWA 4C58B 4OZGE 5D7IE 2Q9OA 5GRYA 3AU1B 3M07A 2XCMC 1UKQA 5I6OA 3FCSA 1N4XL 2P8MA 1PQZA 2V3FA 5DGQA 5ISZD 3MV01 4DGIH 2X2YA 2IBZX 4FAAB 2AJSL 5DLLA 3IWUA 2XFGB 4WWOA 3AREA 3RFRA 4GUOA 4UM9A 5HI3D 3DVGB 4KUCF 3WNLA 2IGFH 3NUKA 5FYKD 2ZCZA 3MLSL 1CICD 2KH2B 1R24B 1M05A 4IRJC 4QHKI 2H0PA 3Q1SH 3BDYH 2QSVA 4Q9QH 4NZ8A 1YVLA 5HVHC 2IG2L 4JE0A 3UG5A 5FYLE 3K1KC 4M7KL 4P2QD 3LNEA 5DD6B 4NM4H 2HPTA 4L3CA 2ROYA 4FYRA 2NY4B 1J9SA 1IT9H 1QI5A 5DT1L 3JWDL 2WXOA 1KTJA 3ALWA 2C9RA 1AKJA 4L1BA 5F0LB 3D0AA 3N9GL 4HETA 3DECA 4JFDE 2GSGB 3E6HB 3EFFA 4P23D 3C6SA 1GTFA 4C4KT 3CHOA 1VKXB 4M1CD 4I3SH 4AQEB 3HB3D 3QDMB 1DBKL 4ELMF 1OGPA 4R3SA 4BGLA 5I1GL 1HZLA 1Q1JH 1PF3A 1WIUA 5GIRB 5FLUA 1CDUA 4L1SA 3VFSB 5IVZA 4AW7A 1JXKA 4Y7MA 3DJTA 3JTTA 4WFFE 2M8XA 5KVEL 1WBZA 1DQQA 4PJ9C 2D7NA 2VR5A 3DTUB 2GY7B 2VQ1A 4KJPD 4F58L 1QVOA 5I28A 2IDCA 3HE7C 5C0JA 2CLVA 3ABMB 2OQJA 4AIXA 2DWEB 2XWBB 1BECA 2Q8AH 3MO1B 2YEZB 1KCRH 3QUYA 1W72A 2VDQL 2YMXH 2L0DA 4JM0A 3ULVE 3VXUD 3BX7C 3KCWA 3QFJA 3CE1A 1FIGH 2DL2A 2UWEE 1XGTB 1NGWB 5ADPL 1FYTE 2VC2L 3L17A 3EYFA 3RY6C 3V0AC 1MJUH 3OSVA 4LFHG 1HHKB 1OWRM 2VQ4A 5ICZA 5ISZA 4O51A 2IIJA 3F64A 5EO9A 3CZNA 4FI6A 4LVNC 2LLGA 2OMWA 3SY6A 4YFLI 4EZKA 3WAKA 1PYWB 3KAAA 1CICA 4FQXD 3LRSB 3ARFD 3MLWH 4CVXB 1MCOL 2NSXA 3RP1A 2V2TA 2WXMA 3A24A 1SXAA 2R23B 4Y4HB 1E4XL 3SEPA 2XPGB 1EX0A 2W0FB 2CDFA 4BJLA 4L8CA 4P2QA 3MYZA 1HE7A 4OF5A 2D3VA 4FHKA 4L3FA 1VF5C 3WSQL 2J7LA 4XE0A 3BPLC 5KVMC 1A6VH 5CXPA 4N8VB 3HE6D 2LFEA 3P77A 1MH5B 4AQZA 2XWJA 3PP4H 2V37A 4XBEH 1PG7L 2PYFB 1XGQA 3KD4A 4RAHA 5E8DL 1NDMB 4P23A 5TFSL 3UBXG 1AKPA 4TTDD 2JCCE 4N5EC 4DP6X 4DP4X 5JA8B 6FABL 2X1QA 3MTRA 4J3TA 5BRQA 1E2VA 5TDNB 5D1ZB 2DL9A 4HIJA 4OLUH 1KT2A 1IM9B 1FL5A 3L5HA 4ZMWA 5LCVH 4UDTA 4CVZA 1IL1B 4P5MA 1EHNA 1MJJA 1C5CL 1TTCA 4PJAA 3HBQA 5AVTB 2ZXAA 1BZOA 4N0RA 1VFAA 2NQ3A 1R5WA 2TSAA 5G55A 5JHDE 2FJSA 4R2GC 1F8TL 3U4EA 2WLZA 3ARBD 1CLOL 1IBZA 4HUWA 5DRZB 2MQGA 2XC8A 3VCLB 4X4MA 4C83A 5D1QB 3AXHA 4K8RL 1E5UI 1OP5H 3WY4A 4ODSH 3BKMH 1FLTX 3M17A 3MLZH 2ZJSL 4OQTL 2I32A 4PJHE 1A64A 5E6UB 1A47A 1NGXB 3QIBD 2K3TA 4KNQA 1YMHA 2R56H 4WW1A 1E5ZA 1XB8A 4K23H 1F3DH 2JIXB 3MNVB 5DDHB 3STZA 2ZZUT 1EHLH 1VGKB 4X6FA 5A2KH 1J0ZA 2CHDA 1OHQA 3B2MA 4LO9A 3VSUA 1E4XI 4TOYL 3DO4A 1WT5A 4AL8H 2WLNA 3MXWH 4X7SH 3MRLB 4P59H 4QHKJ 3D9AH 3SE8H 2MIZA 3QPKA 4JO2L 5IW1A 3V7MA 4HIIA 1YSOA 3T3PE 3QZLA 1MLCB 4IBVA 5J6HB 1P5VB 3OKOB 3ARFA 1DL7L 4HKBB 1ZK5A 2NZ9C 5FO9A 3ECBA 2KT6A 1IC7L 1BEXA 3KPRE 2PF6A 5IHZA 3A5VA 4ELMA 3G9AB 3MJ9H 1PZSA 4MFHA 2LTQC 4BKTC 4FQIH 4M5ZH 4QJ4B 3FT4A 3KPPA 1EFXA 3HE6A 4WU7A 1F42A 4A2EA 2F8IA 3VRLE 1YEFH 2PR4L 2PW1B 4UNUA 1SLWA 2QKIA 2ITCA 1QATA 4WSKA 1CD0A 1JGLL 3NN8A 2AV7A 1HI6B 1ESOA 1GC1C 1ZDQA 1BF8A 4BDVB 4QXGL 4JZNB 1Y0LB 2APXA 4GSQA 4H2CA 2WWMC 3UBXI 4LPYA 4Q4EA 4WSGA 4PG9A 2ESVA 3DDFA 4QDGA 1ZLWH 4JN1L 4OZFA 2J25A 3BE1L 3SO3B 3UO8B 2P46B 1AS6A 1B3JA 4OLYL 3HHSB 2YO3A 1A7PL 2EEDA 3C6LC 4TN9A 5LGYA 3Q0HA 4UIMA 1LO3L 3EGDB 1BLIA 3BXNB 3CK0L 3IDIA 5C0CB 5K59E 1GTNA 2C7UA 3ZK0A 4RWYL 3ZKND 2XTJC 4XCEA 3PABB 4ZX5A 3UMTA 3KM1A 4XBMA 5DHDA 3R7RA 1IFHH 1AGFA 5FUZL 3ARBA 5JW5A 3F83A 4RAUB 3STLA 3GHBH 5ILTH 4ILDA 4KJWC 2VUKA 4RDBA 1FRGL 3EYUL 1INEH 1ZD6A 2NQCA 1X7SA 4GNKB 2E4TA 1NC2D 4K3GA 4MHHG 1X5AA 4GUPA 3LN9A 3QIBA 4PWIA 4PRPE 4IKJA 5EU7E 2XV0A 5F97E 4F93B 3CLFH 4R5VA 4KKPA 4FXKA 2XQYK 5BRZA 4HWBH 4FQHB 1I7ZA 1DBBL 5AQ0A 3NSCA 4XBPB 4AGQA 3WTTA 3LHPH 2GFBA 5I8EB 1BZ7B 3RKDC 3U6XA 5IQ9B 1IM3B 2XQYA 1Z0MA 2DAVA 3IDGB 5H94B 1IJ9A 2QV2A 4YO0B 1YNKH 5L0QB 3ABZA 3RDJA 2ZOKB 4GLRI 4X6CE 5C0BE 1YN6B 2VT0A 3H7LA 3JWOC 3F6LA 2AQRA 3BGMA 4NYLA 1DFXA 2AEWA 2LAGB 4E42A 5HDQL 4DO4A 1AD9B 2EDRA 2V8LA 3HN8A 1LEIB 2XVBA 1I7RA 1U8NA 4KX7A 5E8EB 1X5FA 1HC1A 3FQWB 1MVYA 2VLJE 3AY4C 3X3FH 5HVWA 4NQCD 1FLRL 1U8JB 1R5IB 3D30A 3KEHA 1T03H 3L6FB 3WKNA 5HDOA 3UTTB 5EDSA 2HJFB 1O7VA 5DZPA 3TH2T 3LKOB 5KS9B 2IANB 3IBOA 1RZ8A 2DQTL 4FCHA 1MFCH 1TOXA 5IQMA 1IGFH 4C47A 1AANA 4R4BB 5IW6A 3N85L 2WQ8A 3DV4A 1KLUA 2EE3A 4ANVA 2YS4A 3VFVA 5HHVH 4KKLD 2KS0A 3AY2A 3V4VL 4Q89A 3WL9A 4Y4KC 3ZO0A 1KCSH 5E4EB 4YL9A 5F2FA 3TASA 5FK9A 1CGUA 1J5OH 4R6UA 5JW3L 1G87A 4PTUA 5GZNA 3UGEA 4XC1H 3RJOA 3KLHC 3VW3L 3L1OL 1TPXB 1JERA 1KXQE 2XETA 4HS8L 3QQ3A 1NFAA 3EDJA 3UC0L 1PY4A 5E2JA 4KGJA 1EDQA 1BD2B 4GQRA 1MXGA 3ESOA 4YQXL 3ILEA 5I73B 5I76A 4PJEE 3C5ZC 3SOTA 3GSNH 3O8XC 2HFEB 3CC5A 5HI5C 3WKML 1HILB 1RZPA 1NC2A 1IC1A 2R4RH 3QUZB 5FW6A 4CL7A 3BP6A 1KTDA 4JG5A 2DLFH 3ARGD 5T33L 1I4FB 1CTMA 1IBDA 3MOAL 5EEXA 2FLBT 1NCDL 2LHAA 4ZUSB 5FGCB 5FB8A 2ZNWA 2HWZL 2BSBA 1NZRA 2DPKA 3BQUB 4LCIL 4ZTOH 3O6LL 2DQCL 4HEME 4AJVA 2X4UA 2AJYH 3P02A 3RWFA 1JNLH 5DJ8A 3GS7A 3ZSSA 3AG2B 1Q72L 1DDHB 1JCVA 3L3GB 1NDGA 1BVZA 1Q0XH 2VLLB 5IHLB 1I31A 2ZT9C 1ACXA 1YYCA 1RQ5A 3TLRA 5C6WH 2QZ5A 1FBIL 1A02N 4IM8A 3VUAA 2A0LD 2EIDA 2MH4A 5EN2A 4NQCA 3TWYA 2GC7C 5E08L 2Y2TA 1CBJA 2RQ8A 1NOLA 1VGEH 4C55A 2AP2A 5EZLA 2Z0BA 5AW7B 3QWRD 1C12A 4JFOB 3RL1B 1UYWH 5F7DA 1KGYE 3R19A 1P9MC 5CZXD 4F80A 3FRUB 4ZS6C 1YJDH 1GZHA 4P5TA 3KPOA 4C4BA 3OTTA 1P7QB 4EI6A 3KWVA 1AGCB 3QQ4A 3P9MA 4G5ZL 2ZSWB 3EJYC 1CD1A 1JHKH 3EFDH 1SBSH 2E7DA 3PJSA 4XGZB 1KEGH 2OMZB 3HPJA 4I85A 3GBNH 4LEEA 4L1DA 1AO7D 5IMKA 2IBBA 4KVPA 1O6SA 5LN4A 3S34L 1OARH 5E2UH 5IMMA 4KVNL 4CJ0A 4LGSB 1QEWA 3DRTB 5F7BA 5I15H 3LIZH 4N68A 5HGAA 4UTBH 3V5DA 1SPDA 4IKKA 4KRPD 3TYFA 3N1GC 5MI0B 4YAQB 3F3HA 2HN7B 3VU1A 3ZRCC 3S0PA 4O9HH 4KQ4L 4FMFA 2QQQA 3JTSB 3NA9H 1AIFB 1LEGB 3ZY7A 4QHLA 3QRBA 4WRLA 3MRJA 2OTUB 3FQYA 4PJBE 1F4XL 3ARGA 3VGAC 1NPUA 1QX1A 2GJJA 2XN9D 2VXSH 3OVUB 4H88H 3RAJL 2WMPA 2X4RB 3P11L 5E5MB 3SYCA 3TS8A 5IGXL 5B1JC 12E8H 2WXNA 3GEFA 2O30A 1BQUA 3UBXA 4ENED 3NA4A 3ZE0F 4DVRL 3SGKC 1LWRA 1CU4L 1KIRB 3GSRB 3AUWB 3L95B 1OLZA 1BFVL 2H32A 4JAMA 2WLLA 4CKQA 1FZOB 4MZ3A 3EOBA 4U6VL 1RUPH 1II4E 2C4XA 2F53B 2I9LA 2V5SA 3FUIA 3I50H 4GXVH 4LLYB 1Q4NX 4FNQA 4QRUA 4AGOA 3ATDA 2Y1VA 4F37K 2VN4A 4NKMB 1RZ7L 5DK2B 5IBTH 2B15A 5C0IB 1GC1L 2YEVB 3HN5A 3L3HB 1Z66A 1RLWA 3OM3B 1AGBB 1B4LA 1SXZA 3QUXC 3L3DA 2JQZA 4U0RB 5DRXA 3QAZC 3L2NA 3BI9X 4OJDH 4ZD3L 3S3PA 4NQDE 2QADB 5I8OL 1NCUA 4JDTH 2YMOA 4F8TA 1WFMA 4U7KA 1UM4L 2JH2A 4P57B 5D93B 1MRFL 4PEEA 3SJVB 1EV2E 3NMEA 3MV7B 2ARJB 3V9CA 3IMTA 1MIMH 3RGVD 4ANWA 5C0NC 1NAKL 5IK3A 1ZTXH 3FOMB 4GSDL 1KEMH 2YZ1A 1GCYA 3TH4T 1EBPA 5F7WC 5TK2A 5BVJA 2MCG1 2ZTBA 2CMRL 1P4IL 1E6OH 3GXTA 5F7HA 5KSUB 1OD9A 2DWDA 5T5FL 2YD2A 5F8RC 1QTYT 1W91A 4M61A 5DWUH 3DX9B 4DQOL 1Y1DA 1QBAA 1W9XA 3U4AA 4NZRH 4W9ZA 3KVDD 3C5SA 4IGBC 4PJ9D 3O3BB 1DCLA 2UY6B 1YY9D 1QHOA 3MPCA 4HQQH 2FO1A 1R3LA 1Y6KR 3HE7D 1XGRA 3OB0K 2XWCA 3R1GL 1RHHB 2QLVB 2PO6A 2XN9A 2C8NA 4YXLH 4I8DA 1R34A 3JWOL 3MRMB 5D7JC 5DU7A 3X1FA 3HLAB 3VI3B 2WVVB 3CX5J 5IB2B 3V2AR 3LZPA 4IS6B 2XKNA 3SYOA 4CRPA 3MRIB 1XGPA 2DJSA 2AJVH 4XAWL 4KPHH 1QWNA 3PXLA 4MDIB 2F1EA 1BZ9B 1E90A 1ZMYA 4YE0A 4BUHA 4U3CA 4OD1L 2GJ6D 4WWPA 3LEYL 4EBQL 1IFGA 4IEFB 4KKCC 2OSLB 4UAOB 1CLZH 3GM0A 3V6OC 1OTTC 2GSIB 1X4XA 2YXWA 1EZVY 4N2IA 2ZYHA 3BIKB 1YY8B 3EO9H 2ZG2A 3TNNA 1U4FA 5F89A 1TU2B 1KCUH 3BLKA 2EABA 2CHXA 1ZAGA 1TVHB 4P06A 4DFHA 5IIEB 5CJOL 4Y16D 1T22A 1XR8B 3LRLA 5H2BB 4UWQB 1R9FA 4I18B 1AHWC 5FOBB 4XWOD 3LPOA 5CP7A 15C8H 1M1XB 4JFEA 2CR6A 5BZXA 2NSQA 2R0LH 2BVPB 3JV4A 2K6YA 4XPBL 4LCUB 2GTWB 5DRWB 3U4BH 1A4AA 2B08A 3RGVA 4D0BB 4NZJA 3ESMA 3OXRB 1KB9J 3PDOB 4JHBA 4OFPA 5E8OA 2GSMB 2O5ZH 1QG3A 4JGJA 4M93B 5C86A 1KB5H 3FCUB 2IH8A 3F58L 5JA9A 3U1QA 2EXWC 3OHXB 4MLIA 3V4VA 4RSVA 4FLRA 2FGWH 2J8UF 2E8ZA 2Q8BH 1E4KC 2QVFB 2UXTA 2VDNL 1C5DA 2J56A 5I8KL 4KJQD 1UOKA 1WEJL 4PJ9A 4R2GD 4M3JA 4LQFH 1KELL 3U7YL 5EPMB 4CU8A 3Q2NA 3QCVH 3BD4A 4OCXH 5IWLC 2KL6A 3IFPB 2M1KA 2Y5QA 4RESB 5AZ2L 3SQBB 1JXFA 1D3CA 5A2FA 1IU1A 1KBGH 1MFUA 3L3KA 2X42A 4AV4A 3K74B 1FZMA 1G7LB 4RAVA 4YHPB 4A7VA 4W6WB 4Z6AT 4EF3A 5TDPA 1S7WA 2WQRA 3CQFA 3K0WA 4P2RE 5EO0B 3APMA 1IZJA 4Y19B 3WHE1 3ILPA 4AYID 5D1XA 1T20A 4KH9A 2GJ6A 4X2UA 3IGLA 2HZHA 4EUPH 5E1HB 2R2EB 2IG2H 3JWNG 2A5UA 4M7KH 4UIKH 1R4XA 1S9YB 3K2UL 1A2YA 1UFGA 2QKSA 4OCYH 4QRPD 4U2YA 3IMBA 4EDXA 25C8L 5CFHA 5EEVA 3EW3B 2VAAB 4PM1A 1GY1A 4GSRA 4W9EC 5FKAA 3N9GH 3BVTA 5F0JB 3WEOA 5J6GA 1R3JA 5LVEA 4BK8A 4Q97A 2CO1A 4PGJA 3FAXA 4QAMB 1AG0A 2EIMB 1NMAL 3TBYB 5CZKA 5IB1A 4Y16A 1MQKH 5DEGB 5C0FA 2UZXB 1ZE3H 2IQAB 1D5IL 1T0NB 2X4QB 4UQ2B 1XF4B 2FO4A 4PI2A 1FL6B 5EFIA 3H53A 4XO3A 1ZHLA 3FTZA 2XBZA 3IGUA 3JTBA 3MMEA 4K7FA 1G84A 1LO2L 2CXKA 2F54E 4Y2DC 3CZKA 4KMLB 1Z5YD 5CHNA 5HYSG 4JMXA 4LLDA 4OGYH 2WLJA 5BUGA 1WYJA 3DROB 4A7GA 5HGHB 2WWMD 5HDBB 4BZYA 3P3YA 3NJHA 4FC3E 3KXFE 4U1NA 2Q7YB 3TM6A 5FPIA 2AGJH 3JVGC 5C0EA 1E6JL 2ZF8A 3L48A 5DJYB 4ZFOL 3KHQA 4ODXA 5CIPH 2K4WA 4F58H 1UJ3B 3C6LD 4N8CL 3FFOA 4G83A 1OLLA 1A4KB 4TSAL 2XTJD 1F2QA 5H35A 2XDHA 5BOJA 3EJJX 4FQJH 5G2NA 3KGRA 2V4LA 3MRQB 3UTSB 4OCWH 2EC9T 2ADGA 4A67A 4LAQH 3DPBB 4NRZA 5CCHE 4LLAA 3ULUC 5G5DB 2F5BH 1ZEAL 3U1PA 1FO0L 1S7TA 1XIWB 1PY0A 5GZOC 1TFHA 2R15A 3HPLB 2BP0B 4CAGA 1U3HD 2ZOUA 3PGDB 1TXKA 1AS8A 3UTQB 4Z3JA 4GG6E 1T66C 2FJUB 1R19A 3BWAA 1T1WA 1YPZF 3RKDD 1P7HL 2CJUH 4M7ZB 4LOFA 1E4XH 3MRCA 1EA9C 5EF0A 3ZHDA 4QRPA 1EZUA 3UAAA 2WQSA 4MJ6B 3FQTB 3WSQH 4BSVA 3D48R 2DJMA 2CGRL 5GSVB 1A9VA 4U4IA 5J3HC 1MY7A 3K6IA 3FU3A 2PNDA 4M62L 3IXAB 4MNQE 2RAMA 4H2AA 3SDXA 3ULAB 3KR3H 2YPLD 2A1WH 3BKCH 4N9GA 4YDJB 5E8DH 4Z7VA 1NEZB 4R26H 4JREC 1SN5A 2ENQA 2L7QA 3EIFA 3FT3B 2HTKD 3GGWA 3D3VA 1Z3RA 4H0IA 4K2UL 3SYQA 1CYXA 1QSEB 3LKSA 1D5BB 4K7PH 2VMFA 2VLKA 2AZAA 1NCHA 3QYCA 5F9JA 2J8UA 3QZMA 1YEJL 1MJ7H 2XWDA 4NQXA 3MRRB 5E2TH 1A1NA 3VFRA 4Y1AE 3DJSA 3M88A 3REVA 2NY3B 4K15A 2FUTA 1C5CH 4Y4KD 1KTBA 4E9RA 2VDLL 1ETZA 3FAWA 2YK1H 4GKSA 3P73A 4YXHH 3MA9H 1UFUA 3OAYH 3CUPA 5EF3A 4LPWA 3GMNB 1F8TH 2Y5EA 3ZKQD 3VU2A 2WNKA 3C6LA 3VM5A 3L3OA 3KLHD 4PGEB 4JY5L 3GMMB 1U30A 4BQ9A 2DN7A 4K8RH 4MMZA 1MVUA 2ICES 4NERA 4X80H 3N0AA 4K5MA 3EO1B 5FA3A 1TYJA 4OQTH 3NABH 4BZ2A 5DD3L 4JHAH 4WFEE 1SJHA 1B0RB 4YDKL 2QGCA 1QSFB 2NLJB 3MRKA 3C5ZD 3KCPB 5C09D 4UQBA 3O8XD 2AXGA 1Z3GL 4UOQA 3WN5B 4TOYH 2KYIA 4XCFL 4WKXA 1HXYA 3H6JA 5DC9B 3LKQB 3E2HC 3C2AL 5T5FA 3T2LA 3W2DL 4K9EH 2VDMH 1EEZB 1U3HA 2KHAA 1A6UL 3HFML 3PGFL 1U8IB 5D4HA 4KZEH 3L54A 1KIPA 3D8MA 4W9KC 4M7LL 1RJLB 4XPFL 3ENEA 1H15A 1QPXA 5I2IA 1DBAH 2OJ1A 3KBFA 1IC7H 3QVAA 2Q6WA 2N3JA 2IWFA 2EVIA 1HOEA 4MMXA 1MFVA 2C1OB 3II1A 4F2MB 4PH8A 3KZ8A 3KPSE 1YN7A 1WLHA 2EKJA 4IRSC 4BD4A 1DQLH 1JN6B 4GBXB 5EUOF 1VPOH 5AAPA 3GBML 3IB4A 1BQRA 2VERA 1MG3C 1MNUH 3CDGB 1BPVA 4FFYH 1JGLH 1IBHA 2CSPA 3LKRB 1ID2A 1NIEA 1PDKA 3PHOA 4F9PA 4WEBH 5HHOB 1BOGB 3BUYA 4OJEH 4E9WA 4KMTH 4Y5VA 4QXGH 3V0EA 4N28A 3EUDA 1ND0A 4I87A 3V95A 2R0ZL 3VE0B 3FOLA 4GUCA 4HV8A 1JWUB 1LWJA 2YZ8A 3A67H 5GS2D 4M56A 5GRVK 1A6ZB 2KDGA 1ZHNA 1XGYL 2TRYA 3Q9QA 5DJCA 1K3IA 3FFCE 4Y4KA 4OLYH 3OJVC 3EJYD 5J1TC 3K3QA 2OXHB 3RJDA 2YOCA 4CVWA 2YBRA 4HU8A 5HGBB 2JMRA 2DQHL 3B9KC 1NKOA 1IAOB 4IIQB 4PU2A 2HFTA 2APVA 2Z35A 3D39E 4G9FB 1DBJL 3I9AA 3S37H 5IV2A 4XP5L 1QWUA 1Q9OB 4OIIL 3EYUH 2H6OA 1YPZA 4NPJA 1RUAH 2V5YA 3CZGA 1QRNB 5DUML 1L9TA 2Y6TE 3CFJB 2V2XA 1PLGH 3QFDA 4DO6A 1D6EA 4HK0A 5DO2C 3SE4C 3VXSB 2BNQE 2BPBA 1PMYA 2VITA 3C5ZA 5DJ2B 5C09A 2YQ2A 2R1WA 1QZ1A 5LDSA 2NNAB 3P54A 4H5SB 3WXVH 2UZPA 3VDCA 1DUYB 2CO7A 1NAMB 3LRKA 5A2AA 2AF2A 4FYSA 2NY2C 1A4BA 3G5YB 3DOIA 4OU3A 4ZQKB 4WY7L 4PBDA 1M7IA 2RFXB 4F7EA 5DC4B 1YMMD 3GSVA 2SEBB 3GDBA 4N0UB 4TVSa 2HT4D 2VGLM 4QCIA 1G6RB 3D4GA 1J5CA 2A6DB 4YC2B 3FB8B 5HHNB 4JB9H 5CM1A 5INCA 4FXGB 5D7LB 2GEQA 1I9RH 5HYFA 3HRZC 4WI9A 1PU0A 5D2NB 3IXTB 4ESKA 2R27A 1ROWA 3LPFA 2W80C 4PJ7A 1J1XH 2DQTH 2V8MA 3GSQA 3QE5A 4DKDC 3GBDA 3QQDA 2WLKA 3N85H 4MNGB 4MCMA 4G8IB 3ML9A 1UWGL 2DQJL 3QUXD 5CD3A 2R1YA 2W8CA 2JQMA 4R8WL 4XMPL 5B1BB 5K9OB 3NSXA 3RU8L 1KYDA 1ES0B 4KDVA 3QJFB 1JWMB 3VM7A 3G5ZB 5CEZH 1DZ0A 5H4ZA 1CFVH 1OAKH 3ARZA 4DW2L 5AAWA 3AACA 4BUQA 2ALAA 2A6IB 4L4VB 4Y5YB 1R1CA 4HPOL 4ELKB 1ZT7A 3L1OH 2ATPB 3HJ0A 4AGPA 1RFDH 1R47A 4M1DL 5C0ND 1H8SA 2HJKB 2P1YA 1K8DB 4YVNA 5IG7A 5IMLB 4IBWA 3O6MH 2ALWA 3NSJA 3O9WB 4YQXH 1OP3K 2XVLA 4PR5B 1WCBB 4LKXB 1IEBB 4RX4D 3IYLW 5BZWB 3V5HA 1T5WA 3IJYB 3SKJL 1S7RA 1UZ6E 4NOBA 3WKMH 5IFHH 5KAQG 1ZIAA 1UXMA 3DJRA 5IFJB 1VHPA 1BMGA 4AQOA 1SJEB 5SWQB 4F1ZA 2N56A 1DZBA 4YIQA 5T33H 1Z2KA 3QS3A 1JGEA 1UVQB 3U6RA 2C4FU 3MOAH 3B83A 4L5FL 1N5AB 4M8RA 4G82A 5GRZA 2AK4E 4N20A 1MN4A 1UH3A 1KJ3L 3OLDA 5I6MA 4NS0A 3C75A 2E8YA 5EUOA 2EACA 1F6LL 3FTGB 5DS2A 5DZOA 2DQCH 2VIRB 4H26A 4J3OH 1Q72H 1YMMA 3EXJA 3D1MC 3QQ9D 2BCKB 3H9YA 4YHYB 1AP2A 3QFGA 2ERJB 3MGOA 5A2LH 3G3LA 3CSYA 1BXVA 1AE6H 1PS3A 1U93A 5IR1B 4FRWA 2J55A 2QBWA 1FBIH 2RA1A 4ONFL 4DP9X 5HYJE 1R3HA 1IJNA 4MD4B 3AC0A 1J10A 1JK8A 5FO7B 1KNOA 5L9DH 3INUH 3LH2L 2V17L 2FNWA 4GY4A 4KKCD 1VENA 2OJZL 4NBZB 3TBSB 3EFOA 2G3MA 2O5XL 2XJLA 3OAZH 3QJXA 4MS8C 2NX5D 1A14H 1OTTD 1OF0A 3BAKA 5ANMA 1ZT4B 1QFUH 1YECH 1R17A 5I6NA 4X6DB 4NENB 4WDIA 2GPZA 1S5HA 4OTXL 2J12B 1QPKA 4J39A 3QUXA 4LSDA 1ILSA 1QA9A 3EBHA 1AGEA 5IVXE 1KCLA 4DT2A 1HHJA 4K3JH 4PJ8B 4U7MA 5IMOA 2V3DA 4UU9B 1BX2A 1CFQA 5C70A 4ISVB 4DTGL 3L4VA 4UQCA 1BQLL 1O7DE 3D0LB 1S9VB 2HTLC 2GEEA 2JLLA 4KVNH 1F2XK 4LDLB 5E5RB 2Z0UA 2DWTA 1U9KA 3IETB 4WF7A 4YEEA 4Z3EA 2ZWNA 5ACZB 4W9JC 5G4MA 2IAMB 1SMOA 1LE9B 4HJ0C 1TVBA 3UYRH 2L7JA 2O72A 2PN5A 4FZ8H 4RX4A 1EUTA 1JF1B 3F5WB 1G0XA 2WV3A 3MSPA 4WI6A 5MP6H 4MBOA 5BS0B 2Y6SC 2RCSH 4WI0B 3LKNA 4Z77A 5IQ7L 4HK3J 2HLFC 3KJ4B 3CZFB 2ZCLL 4X9FA 1TQBC 1Y1UA 2DQEL 4GB9A 3AU0A 2HLAA 4DK6A 5GGVY 1E9PA 4PCYA 5BXFB 1N9PA 3WHXB 1UZ8A 1W6LA 4EZMA 3N0PB 2R69A 5L8JB 5JIKA 1ZGLB 5F7KC 1B6DA 2IOMA 1J9RA 4PRDA 1KFGA 1TQCC 3ASNB 3MOBH 4P5KB 2C3WA 1EZLA 3EH1A 4PRAA 3T8XB 2D4FA 5E4AA 2CIKB 3WS3B 2LU3A 3DIFB 2XWXA 3FONB 5DQJA 1J8SA 4O02L 1U58A 1KYOJ 2HRPH 4LLVB 4NN6B 3I75A 3CH8A 3WDIA 2VDPL 3PWVB 1Q9KB 2ZUSA 1BIHA 3CQQA 3E0GA 2W60B 3ISYA 3L7EA 3NSYA 4PJGB 4Y2NA 3WMPA 2KERA 3UH8A 5FHAL 3VD4A 2V3EA 5FYJL 2PLTA 5I1AB 1VZGA 4XPAH 3S7GA 2NRDA 2NX5A 3NJVA 5F71A 5I8OH 3TH3T 5ID0A 2B0SL 2OMUA 5AW2B 1SN2A 1OCWH 4YOKA 4K3HA 3SZKC 1RZFH 1G7HA 3QZOA 5GQBA 1QR4A 5E8PB 2VNCA 1D2PA 3NEXA 1UM4H 1HH6A 3ZDZE 1KLFA 3ZDYB 4LLMA 1NCNA 1L3NA 1V5JA 5DJXA 3Q9PA 3MXVH 1JDDA 5CINH 3PHSA 3WNJA 1YEKH 5JXAL 1AHWA 4HPYH 1NAKH 4GAGH 5FAAA 5E8NB 1RJZB 3QJVB 5JO5B 4Y2DD 5IHBA 4E9XA 1UB5A 3PGCA 4OV6F 2JTYA 5F1IA 1UG9A 2G9HA 1P4IH 5J9PA 3SDCA 2PWEA 1R3IL 5TTRA 5LNGA 3D05A 4AEEA 1T2XA 1SHWA 5KAQF 3UBHA 4ZUVA 1UWXH 1RZKH 4ODBD 1L5GB 1DJXA 2PABA 1YEHL 4WGKA 1BVNT 5LXGH 4XXCC 1NIBA 1DHKA 4HF5L 3SZ6A 4C56D 3JWOH 4WTZG 4GIOA 1A3RL 3LDBB 5DLML 4AUUA 2WBXA 4HFWB 3RDTB 4XAWH 1L7TL 2HFFB 4PRHB 1GL4B 3AXLB 3INOA 4NCC1 4JFXB 4LNVA 1UOWA 3QORC 4NT6B 1PLCA 5HVGB 5GZOD 2OFQA 3X11B 3EJCA 3SDDB 3ARDB 2W0PA 3NIFB 5EOTB 2GG1A 4XPTL 2DLTA 4ALAL 2VLRE 2B5IC 5F96H 1JPEA 1T66D 3NSFA 5TF1H 2DMBA 2EXSA 3UDWC 2IAAC 4JZJB 4ZO8A 4N0FB 1FGNL 5IB5B 4ADJA 2ZICA 3OWEA 2CO6B 1G0DA 2BY1A 3GHPA 2AXFB 4TF4A 1HXMB 5J3HD 1OF2A 3DV6B 1ZSDA 2ICEB 5GS1C 4JE4B 2CGYA 4ZT1A 2CALA 4IOFD 5GJTL 1GIGL 4YHLL 4GPVA 4PW9A 4HKJB 3VWJC 5T1MB 2Z8VC 1K9TA 2IJ0C 1FPTL 3QCUL 1BCIA 5LGHL 3QI9C 1KYFA 4JJOA 4V1DE 3DXAE 2BNUB 2Z93A 4XMKH 2YSTA 2ZXCA 4LF3A 2FL5B 3SCMC 1BFSA 3SPJA 3TO2B 2WLMA 2X9ZA 3J7HA 4JFPB 4TUKL 5EOQL 5LUMA 4LHJB 3HKZA 3EHBB 4LLQA 3CFEB 2YUWA 4LLWA 4MD5A 3W3BA 3BRDA 4HWZB 4FNLH 2M26A 5MERB 1B0GB 5KSAB 3U2SA 5C08D 3CCHB 1CR9L 5JYLA 5I8KH 5MENB 3ISWA 1JZFA 4JRWA 4NI6A 3US9A 1KELH 2BNRD 3VFNA 1BBDL 4IRZA 2NW3B 3UAJC 4J5VA 3VDBA 2CDEA 5AZ2H 1T7ZA 1Y18B 2QGBA 3RWIA 1NCWH 3D08A 2WSPA 3EKCA 3LS4L 3WFCL 2HYMA 2DYRB 4C56A 5IB4B 1JGDB 2IDFA 2ZUWA 3HNSH 1HDMB 3DX1A 3RJQB 4HG4K 1IE4A 2K78A 2YPVH 3T0EE 1KGIA 1WZMA 3K6OA 2E7LC 3ECVA 1GGIL 2ZPKL 3KMDA 2VW6A 2YD4A 4JM2B 4DF9A 2EDKA 2HKFH 2XZCL 4PRBB 4I2XB 3VVWA 5EZPA 1HINL 1M57B 3RX5A 4BFOA 1XO8A 4UQAA 1INQB 1NL0L 3K2UH 4HUCA 1X9RA 4J3BA 1AJ7L 3COOA 25C8H 4I9WE 1WITA 4X4ZA 4A68A 5C1MB 1F6FB 3MLVL 4OSUL 5J1SC 4LB8A 1E7UA 3RNKA 4HC1L 4WHDA 3KBEA 3LRMA 2PYEB 2A73A 2EADA 5B21A 3UBGA 1XWVA 2YFOA 2Y36L 4Z7OF 5I17B 3RUGB 2YQ3A 4HSQA 1J5DA 4OZHB 5E9NA 3CBRA 4XVJH 4B9KC 4PREB 2XTLA 2WXKA 4IBLT 3L4CA 1XH0A 2X4OB 4WGWB 5LNDA 1MCBA 1SJVA 3T2QA 1MG2C 4FGMA 1JRHL 3FKUS 4YZFF 1RK0B 1RIHH 1RP9A 4WVRA 3TN0B 3TVMA 5FYJD 1C08B 5LB1A 3EH2A 4R96A 3NJIA 4FHBD 1A1MA 1S7SB 1MCPL 5CMAA 1BVKA 3NOIA 1I3VA 2X10A 3SDYL 4APQC 2BNQB 3JZ7A 4XODA 3P9WB 1IFRA 5SWSD 3B6SA 3V52H 5GGTL 4OFQA 5ABAA 2HVJA 1EDHA 1NFKA 3ASOB 4R7NA 5C08A 1KWGA 1MW2A 1FZJA 3DVFA 2BNRA 3FNKA 3RIAK 5C0DB 1EMTL 1TKWA 2JKLA 2P8MB 1PQZB 1VZIA 5JPMC 4OGAD 2WOBA 1J8HA 4OLZL 3ZO9A 3AREB 3KH4A 4WO4C 5DO2D 4UM9B 4S2SB 1KYUA 1G7IB 1EZSA 3AT0A 3HHMA 1E3XA 4KTDL 1TEFA 3OR7A 3NCJL 1GVIA 2BRRH 1TJGL 1RIVL 4L3CB 5C2BH 1U8CA 3VB8A 5FUOH 4Z7QF 2EH8L 5K9KB 3LCYA 3CJJA 4U1GB 5DJDB 3OX8B 3L08A 4LSVL 4PJXF 3MRNA 5HGDA 2WBJD 5M7QA 1I8IA 3C6SB 1F3JA 4M62H 1AAJA 5GGSB 4DUXA 3MJ7A 3GJEA 1TIUA 1JRHI 4DAGL 3FFDB 4L8DB 5F9AC 5EEYA 4K2UH 1FJ1A 5CLWA 5J7CC 3ZKMC 2WB7A 1RH8A 4TXVB 3MVSA 4KQ3L 4R3SB 3SY0A 1AZZC 4O02A 4UT9H 4L4JA 2QFPA 4KDTC 1FV1A 1YEJH 3MV8D 4Y5XA 3WNNA 5EF1A 1TFPA 2R1XA 3RWEA 4OLXL 3BH8B 5IVZB 4ELDA 3NTCH 1YRKA 1EEQA 3JTTB 2VDLH 1KJMA 1WBZB 3QC6X 1DQQB 1IEAB 4ZX4A 2E86A 2OTWA 2VQ1B 3U0PB 1QVOB 1CPUA 3PAZA 3MV11 2CLVB 2E76C 2OQJB 5EU6D 5E9AA 5C0JB 1I8LC 4GKZA 2P5WE 4PLJD 4NXKA 3QUYB 4L4TB 4YR6A 1AXTH 3E1F1 5TQ2H 2EEFA 4J7RA 1U4EA 3QXAB 1IC0A 3T2PA 4NKIL 3WE1A 4WW2A 3VFOB 4DGVL 3DX3A 5DD3H 1Q90A 5GRWA 1L0PA 1S7XA 1QLRA 2VSKB 1JZ3A 5ETUA 3TA4D 5KYXA 2J71A 3GF8A 1Z3GH 3QSKB 3B2DC 3BZ4B 4O51B 2PXYC 4XCFH 5EO9B 1A6TA 3NDYE 4EOWL 2CRIA 2OMWB 2HH0L 4MA1B 3VI4E 3DOSA 4GMSL 4H44C 2OSYA 5EU5A 3W2DH 3WEXB 3LKPA 1JNJA 1TMCB 5C92A 4PJ5A 2AKRA 3WI9A 1FN4A 5JOEA 4L8CB 1RULL 2IPKA 3FCBA 2CDFB 4K3EH 1A7QL 4P2QB 4CMHC 1WO2A 4HUUA 4NAJA 2W9EL 4DHLA 5FECB 3T0XA 1EAPB 3UZVB 2R2BB 1Q0YL 4L18A 3QARA 2WXRA 1T1YA 3BUQA 2VZSA 3OKLA 3P77B 3V4LA 5IHUL 2XWJB 1UJTA 3B1TA 4XAKE 4X9HA 3WNIA 2WBJA 1QAWA 3PV7A 2HVKA 1XSKA 2YJQA 3HMXL 3VXPA 1QFHA 4N26A 3G6JF 5C3LD 2P8PB 4QXWA 3GBMH 4G6ML 4HCGA 3MCG1 3S35H 1MCFA 5AOLA 4DUVA 3HRZA 3WFDL 3OAWA 4HIJB 3V8OA 3OKKA 5C9JB 1CVSC 1FL5B 1FQ9C 1PZCA 4X7TB 1QR1A 4IOSD 4MS8D 1FG9C 1UACL 2ENPA 4UDTB 4UZUA 1GJIA 2HFGL 2R0ZH 1MHPH 4P99A 4KXZH 3MV8A 1H3TA 3P4NA 3PS6A 1EO8L 1G9HA 1P4LA 4PJAB 3VD7A 4MJ2A 1AQKL 4ZSOA 1KGCD 1TTGA 1I8KB 3AUVA 2RGSA 3GTVA 3H56A 4WHTA 4ZNEE 4WTZA 4PS3A 1J05A 3U4EB 1PJWA 1BJ1H 4BSWA 4MAYC 1AQHA 3H85A 4TULL 4AV5A 2X5PA 4C83B 4HGWA 5EU6A 3WNKA 2J1WA 4FN0A 2HTLD 4OCSH 1DBJH 3MZTA 4X7FC 1NSNH 3VXUB 2OYPA 3NBNA 1A8JH 4JFHD 1MWAL 2R4SL 1WGOA 3RIKA 4WW1B 3MAWA 1IGML 5DUMH 4X6FB 3HFFA 2W95A 1N2RA 2YC1A 2RB8A 3POHA 4HJ0D 2E74C 4GS7B 2DWSA 1BZEA 3H8NA 3X3GH 3WNOA 2VJ8A 3Q6FA 3C09B 1Q9WB 1FC2D 4EO5A 2QPUA 5C3TA 5CEZE 3IAQA 1GAFL 1AZUA 1IAIH 1E5CA 4UQDA 1KGWA 4UT6H 2HLFD 4HIIB 3QPQC 2FSEA 3LZFL 4WY7H 4Y4FC 4FQXB 4UB0L 3ARFB 4OZIE 1IX2A 1EERB 1XGZA 3ECWA 4EVNB 3ECBB 1LVEA 5IHZB 3HJEA 3M1BA 2B39A 4M6OH 4ELMB 1LO4L 3TO4A 2WCGA 5EV7A 3G04B 2E75C 4XHJC 1LWHA 3CFBA 2MHAA 3FQXA 3FT4B 4Y9CA 4TM9A 1YA5A 2CXGA 2KQNA 3VGDA 3OC5A 1FNLA 4AQ1C 2Z8WC 4PG2A 1UKSA 5EU4B 1DO6A 2GK0A 3AB0B 1IBYA 2A9BA 3W39A 4GFTB 4L1HA 1TJIL 1MFDL 4ZPTB 4GH7B 1UWGH 3NH7L 4JX0A 4PG9B 3MJ8B 1QFWL 4RFEA 5FUCE 5KSBE 4XH2A 3GXFA 3RU8H 4QEGA 5LO7A 4MXVF 2B2XH 5LBVA 1SVCP 1JIBA 3WY3A 4OUOA 4DW2H 4XRCB 3IDIB 3Q13A 2X9XA 3B37A 3TP4A 5IBLC 4NNPH 4HPOH 1FVCB 3A4DA 3D18B 1IGIL 3CN2A 5FFOA 4FABH 5JW5B 3ARBB 4M1DH 5DVPA 1JWSB 1VADA 3GZPA 5AW3B 4JHUA 3IRPX 5DHVA 1SF3A 4UM8A 4CA4A 5BPPA 4TUJB 2J1KA 8CGTA 3QIBB 5HJ3A 4ZMVA 3ULUH 1GPOH 3PP3K 4PV8A 4NPYA 4XWGL 4PWHA 2Y07L 1UB6A 3QISA 3UAEA 1KB5B 3MRPA 3FZUC 3IFOA 2AAAA 5TJWK 2AV1A 4LARL 4LU5L 3ROOA 3SPCA 3WKYA 4DQAA 1U8KA 2VN5A 3OGCA 4W70A 3SE6A 4FQPA 1UEMA 3TCXA 1W72H 3QDGD 4Y89A 4POYA 3P2TA 2E9BA 5BV7H 3K71A 4OLEA 3H9HA 5GGTA 4L1TA 3SKUD 3PV6A 4U1LA 3D85A 3CSGA 2PTUA 3BGMB 1NGYA 4NYLB 2VN3A 1U36A 4E42B 4G71B 1M71B 1K5NB 2E6JA 4E5XB 1I7RB 2P44B 1U8NB 2X4SA 3S48A 1D5XA 1MDAA 3A4FA 3MUZ1 3DO7A 4RMSA 3BLBA 1LP9B 3RVVC 3T0BA 4M5SA 4O58L 2XZZA 3QORD 4ONFH 1NINA 3RVXC 4ZW3A 5FCUL 4TS6A 4R4FL 3DSNA 3BN3B 2DS4A 2HAZA 5A6LA 3JV5A 1QFWI 1WS8A 3UROR 1FH2A 1FH5L 2ZX5A 5IW6B 3HG1E 3BVXA 2MJWA 1EGJA 3HI1A 4ZZFA 2O5XH 1KLUB 4HIXL 2YGVA 4LSQL 2ITEA 2EJ1A 3VFVB 4JPWL 1VB9A 3WL9B 3BVNA 2D7TL 4G42A 3TPUB 3KS0J 4K71C 3HEIB 4OTXH 1MFMA 3FUEA 7CGTA 1RAMA 5JOPD 3O2DA 5E9DD 4UZGA 3QEUA 4PTUB 2IPUG 2DM3A 3TBVB 1RUKL 3X1NA 1NUFA 5L2JA 4HUXA 4DTGH 3MNWA 2VSCA 4X5PA 2BDNH 4JO3L 1PX4A 1ZY9A 3JQOB 4OH2A 1JL8A 2AANA 3QI9D 4AKOA 3ULVC 3RE0A 5FF6A 3HIZA 4ZAKC 1BYNA 4GYBA 2DLHA 1HT6A 4I1RA 4L48A 4JRXE 1NWPA 3CC5B 3GMOB 3QJRB 4X5RA 4ZFGL 3BAYA 4RFNB 4J6RH 5CZRA 1NC2B 5J1AA 3UG4A 1HHGB 2VXVL 2EYRA 3QG6A 3W1ZA 2NT0A 1G1KA 4OI7A 4QOKE 4YGAB 4LEXH 2OYLA 3HC3L 3NP3A 1T4WA 7PAZA 1U8PA 1JGIA 5JIIA 2F58L 1QASA 4YBLB 5E6IC 3RWFB 3UAJD 1E40A 3C8HA 3W0WE 3FB7A 5HHXL 2VDQB 1XT5A 3IU3A 1NDGB 2EUXA 4RMUA 4GQQA 4OJFH 5DI8B 5ID1A 1I7UA 4AIOA 2VC2B 3FCGA 3IGKA 3OMZA 4MJ4A 3P0VL 3AU1A 4E9LA 3K7UA 1K8IB 2IXQB 3TJEL 3K6SA 4NQCB 1QLEH 5K9QG 1DQDH 3QORA 3PPSA 3KLQA 2FZ3A 1XV8A 1SMAA 2CQVA 4YBHA 3DVGA 4ZPVB 3MLPA 1R0AL 2D3NA 1P84J 3STBA 1NWOA 2UYLB 1FFPB 4RQQA 4Y4HD 2P42B 4EI6B 1GMEA 2C7FA 4FG4A 4JL2A 4RGNE 3N1FC 1LLAA 4ZTPL 2B0SH 4NIKB 4KK5D 3VYNA 4LVHB 1TTAA 3PJSB 1JV2B 1FNEB 3CFKB 4XC3H 1R33A 5TE4L 3HPJB 3R8BB 2YD8A 3W82A 4PB9L 2KQMA 2O5YL 1JK9A 5E9DA 4F5CA 2IFFL 4DN3H 1FI8C 1O6SB 3S36X 5IMMB 4UCFA 4JRYE 2DDQL 5HGAB 4D0CA 5C2UB 2DZEA 4O2EB 1VKXA 4KNSA 4AQEA 1NCBL 1NUGA 3AS0A 3TYFB 2P28B 4NUGH 3WY2A 4OGXL 4YX2L 1NANI 4LSRL 5H4YA 2BOCA 3QI9A 5CKGA 3K81A 1R3IH 5D7KD 2OMVA 5BO1H 4R9HA 3LIUA 4AK1A 3WHE0 3VFSA 5GRVL 3AM8A 4APQD 3VMOA 2AEIT 4JM4L 3TNMA 2WCPA 3MODH 5DZJA 4BYHA 3APCA 1TITA 3HG3A 1CDBA 2VAJA 2WMPB 3JV0A 2J20A 3RTQC 4PJFE 4JFFE 4XN2A 5IEKA 4S11A 3DETC 3VFUA 3WLWC 1SXNA 1I1FA 4HF5H 2FWOB 4QKXB 4X0KA 1CXEA 2YEZA 4JAMB 3UFIA 3THMH 1DVTA 1NFDE 2WLLB 2WNXA 1HSAB 3GM8A 4QHNA 3VFGL 1BAFL 2LLLA 3V6ZB 3WD5L 1NGWA 3EOBB 4AGNA 3DGGA 4OFVA 4WO4D 2E46A 1HKLL 1UUSA 4RIRA 1MW3A 1N26A 3U0TB 4XPTH 4DPBX 3RB7A 2B20A 2FUQA 4HCFA 4WI4A 3WMQA 4JKPH 1U8HB 4TV3A 2EUWA 4TQEL 4AEIL 1Q94A 3TL5A 2KZKA 2FHCA 1CK0L 3L5IA 2WSKA 3KW8A 4IDJL 3LRSA 4CVXA 4HJEA 3IDUA 4B9JA 4IKLA 1T89C 2R23A 4Y4HA 2XPGA 4L37B 1NM9A 3N91A 1TVDA 1H8LA 4HT1H 3MUHL 4YHLH 5GJTH 1GYUA 4JHZA 5DRNA 3KE0A 2IOIA 1AO7B 2P5WB 2KKQA 3LNGA 1ED3A 5DR5L 3CHXA 1P4BL 2F9BT 5E5UB 4O2CA 2E0PA 2CUMA 5BVJB 4I77H 3C8KA 3T09A 4P4KC 4KRPB 5DWPA 2DWDB 2D31A 4NQUA 4WFGE 5D1ZA 5L4FA 4KHXL 2EE6A 3U2JA 1BVOA 4M61B 1IM9A 3ZMEA 1F97A 3IGFA 5EU7C 2D73A 1IL1A 1F4YL 3VACA 5JUEH 4ADIA 5KS9F 4S0HA 3FBKA 1XGRB 1CR9H 2ICCA 2I85A 4FL4C 4NN7C 4ONHB 3A6CL 1HKFA 4XN9A 3GINA 1HK6A 5FYLL 2H9GB 5DMKA 1YHPA 5GGQH 3MCLL 2XKNB 5DRZA 4AEHL 1XGPB 3VCLA 3QIUD 5D1QA 2CD0A 5I71C 3AVEA 1HWWA 3MREB 4GOSA 4LEOA 3KNBB 3RRQA 1IE5A 5KYNA 3GHEL 2WZPA 1GGIH 2ZPKH 2PXYD 1BXAA 3O2WL 5DDHA 2JIXA 1VGKA 3FCTB 3CZLA 1MFAL 4DH2A 4WO4A 3NRFA 4WJ5A 3WFBH 2J8HA 4LCCC 5EBWA 3QJHB 4O4YL 1D5RA 1OV8A 1BQHB 1A5FH 1THAA 2W9DH 2Y1ZA 1UOLA 2X1WL 3O4OC 4IRJB 4ONOA 4WGVB 2DQUL 4Y9GA 1AJ7H 3NRQA 2DTML 1J1OL 4EI5C 5F89B 3QRGL 3HOGA 2Z65C 1MVFA 4Y2OA 1GJWA 5DSCA 1MLCA 1B4TA 4OSUH 3CDCA 3U46B 2C9UA 4BZ1A 1IMHC 4RDQG 1T22B 3CDFA 5C07D 1V7NH 1U95B 4DP8X 2DLGA 3PAVA 3UYOD 4QHMA 5IQLA 3FQRA 4HOMA 2Y36H 1HL5A 4Z7WE 4F7PA 5CP7B 3BZ5A 4KBPA 2G0LA 4HEPG 3NIDE 3ZT5A 1DJYA 1NICA 1LGVA 3WBDA 5IJCC 4RH4A 2WLHA 3NG5A 3O3EA 1ZLSL 2V5TA 2AEPL 1FVEB 4PJCB 2W91A 3WIIL 1JVLA 1WCQA 5E8OB 2PW1A 3ULVL 3LZRA 1Z9MA 4K5PA 4XNZB 3W5NA 4JPKL 2X6AA 3AMKA 3TOPA 5CILL 1HI6A 4JANA 3KJ6L 3MLXH 4DFIA 1MCPH 3S3DB 3W9EA 4G3YH 1MCHA 5A40E 3V4VB 2JV6A 2JI3A 1TENA 4OLWH 5AD0B 4KUZH 1SOQA 3V4PL 4J28A 4XPGL 1OW0C 5D5MA 2K4AA 3RL2B 4PJ9B 5HI4C 3HE7B 2VRQA 1TETH 2VH5L 3AQYA 3CDYA 3EGDA 3L4XA 5H37G 3S5LB 3ZKXB 3LZLA 5ICYA 3L3KB 2X2IA 2OP4H 4J8QA 5CU9A 1SOKA 1V10A 3BWUC 4G7QB 5CP3A 2AERT 4KXCA 3F2LA 4DP5X 3IJ7A 1A4CA 4ODHH 1G1OA 3DI3B 3QIUA 5TDPB 1S7WB 4OIFA 3MJWA 3C2SA 5TPWL 3GZOA 3CZUB 3ILPB 4G43B 4YLCA 1X9QA 4LMQE 4YHKL 1T20B 1U3ZA 3PDDA 1URLA 1CDCA 1DQVA 3NCWA 2OXGA 3HKFA 5T1DL 4LVNB 1BG9A 3GB7A 1RIVH 1A2YB 2ADYA 1KWKA 3QPQD 4FZEL 4UBDC 4UOW1 4XBPA 2WJ7A 4XB3A 2YAHA 3ZTJG 5I1JH 1BZ7A 2EH8H 4AT6A 3IDGA 1WE5A 2Y3AA 4M3KB 5J6GB 4AY0A 5F9OL 4NO2A 4XVSL 3MLRL 2ZOKA 2XUWA 2KDYA 1U8MA 2IH3A 1YN6A 3BPLB 3QJOA 4MQSB 1TZ8A 1LO0H 2DBLL 1GSKA 4Y16B 4XHJD 5C0AD 5EIIA 1QBLL 5E1GA 5C0FB 5C07A 4GRWB 3RFZC 4DAGH 2ENYA 1AD9A 2DV6A 4FTVE 3I6LD 5ADOL 1U8OB 1ZHLB 2W38A 4K7FB 3WTXA 5E8EA 5G4OA 2BSEA 3GRWH 2A74A 2LOEA 3LEVL 3DLQR 2NDGA 3QUMH 3W5MA 1HAUA 2XNAA 3LJ3A 1JGUH 2FEJA 1J1PH 4WUKL 4OLXH 1QNZL 3OL2A 1RPQA 1J9QA 1AYOA 3CIAA 4U1NB 3MUJA 4EE2A 2E7HA 2VL5A 3FPYA 2QR0A 1P7QD 2VR3A 4FOMA 4U1KB 2HCZX 3U2IA 3RWCA 3L9RA 4ODXB 1GA2A 2AJXL 2VMJA 2XV3A 3IMVA 3PWPD 3L4ZA 4UDUB 3CFTA 1T1ZA 2AJUH 5C7XH 1BF5A 2QT6A 3T77A 2EXYC 1O9WA 5IBLD 5H35B 4FFZA 1X4ZA 4R2GB 4NIYE 3S6CA 1PG7W 1UASA 4FNTA 4ODTL 3W57A 1ZV9A 3C08L 4NRZB 3E38A 5AWNH 1NEUA 2X2JA 2YD6A 5FYJU 4E2OA 5BZDB 3QUKB 4AYMC 4QRRE 4BFFA 4HWEL 1S7TB 3TIDB 3O4LE 3IF1B 5D70L 3UJIH 4NCC2 4EOWH 1CURA 5E51A 2HFEA 3FZUD 1A6WL 4FP8L 4GMSH 1HILA 3BWAB 3OKDB 3WTVA 2BIPA 3N42B 2D0GA 3UYPB 3DBSA 3D7PA 2P8LA 4Z7NB 3HG1B 4POZC 3VWKC 4CBZA 1GGCL 1I4FA 1A7QH 4J2XA 4BQCA 3OB0H 4NCDA 4AK2A 5FYLD 3BD5A 5D7EA 1B2WH 2XZQL 5AAMC 3TZVC 3S2AA 1OE2A 2B1AL 3BQUA 5IHUH 3ETSA 4PPTA 1JPSL 3SDXB 4GG8B 4N9GB 4Z7VB 3DO3A 4RDQF 2WTPA 3FYEB 4JFDD 5F1NA 3L3GA 2H1LM 3HMXH 5GJSL 4M6AA 5CGTA 2G4EA 2VLLA 3CV5A 3LKSB 3VRIB 1ZXKA 1BVLA 2GBUA 4YHZH 3L4WA 1LE5B 1ACYH 3WFDH 5CFAA 5F9JB 1BHGA 2GVYA 1HS6A 4NQXB 3VI3F 4E41E 2A9ML 1KJVB 3NCEB 2VDKH 1EO8H 1T7YA 3C6EA 2WPGA 4LE8A 1AQKH 1ETZB 4IYKA 4QUOA 2QDWA 5DC2A 2OK0H 3FRUA 5AKSA 3AQDA 3P3UA 3P73B 1P7QA 3V4UL 1M7DA 4WFFD 2J88L 5A43C 3PWPA 3C6LB 4DIXA 3L3OB 3H55A 4MMZB 1MVUB 2C3XA 3HCVB 1TZGH 4PTTB 4XGZA 1E5YA 1JSYA 4YLBA 3ZMRA 2WM0A 1IKNA 2XTJB 4D0DB 4M03A 3IU4L 3SOBH 4LRIC 4OM1L 1XGUB 4OV5B 3T2OA 1MWAH 2N1TE 2UZIL 3ULVD 1SJHB 4KZDL 3AAZA 3T65B 1IGMH 1FYTD 5CN3A 1NEZG 4E9TA 4NJ9L 2X2UA 2GB2A 4OZGA 4FQCH 5I5RA 4OM0H 4N0YL 1N6QH 5F9DC 4CSTA 1DVUA 4NJAL 5C9KA 2QSQA 3JTSA 1I3GL 1AIFA 3MR9A 3KLAB 1LEGA 3BHBA 4YDLC 1H15B 1GGYA 3KGUA 4UB0H 5EMYA 2OTUA 5I2IB 5IHHA 2EC9U 3ME0B 5E6ID 5L4IA 2Q6WB 2X4RA 4HOXA 5E5MA 1WBYB 2G75B 1LO4H 3VDAA 5DHXB 3UERA 2K0RA 2IH9A 5EORL 1KIRA 2H26A 4V11A 3ULUE 2YPLB 1G9MC 2QGEA 4K5OA 4HSCX 1KIUA 5FFLA 5K1VA 5BW7C 5ABDE 2IGLA 2K70A 3UPCA 4G7VL 1FZOA 4TUUA 4NFBA 4A66A 2ZF9A 4JRYB 1KBBA 2F53A 4U1MA 3T3PF 3TT3H 5CN1A 4DKFH 4LLYA 1TJIH 1MFDH 1JPTH 5KTEH 4HX1B 4TLSA 2NW2B 3FOLB 3NH7H 3QFJE 4HV8B 3BD3A 5DK2A 5C0IA 2Y7NA 2BVQB 1NLDL 2WXLA 1SGKA 2Y5TA 3FB6A 2NYYC 1P1ZB 4BH8A 2VISB 4FXLA 5DJCB 4Z3GA 4Y4KB 2BIQA 1SXBA 1HCVA 3BAJA 1B90A 2YBRB 3NFSL 3LN5B 1V8HA 3NIGE 4H8QA 5E95B 4U6XB 2Z35B 2XVKA 4ZMTA 5JHDD 3OLIA 2FIRT 5ACMA 4IK7A 1NGQH 2ZXQA 2ARJA 3KWUA 1NKGA 5E0QA 2I24N 4I0PD 4HCRL 4LVOC 1GHFH 2JE8A 3IE4A 3X1GA 4GKNA 2V2XB 1BM7A 3QWNA 4NC1E 4QLRA 4XWGH 2UWEA 2VITB 3C5ZB 2YRLA 3CQPA 5C09B 2R1WB 3O8XB 3SE9L 1FYTA 2NCEA 4D3CL 3CBJB 2JI1A 5KSUA 1FNFA 4B9FA 2CKNA 1X9UA 2CO7B 1CZ8H 5GISL 1FVDB 1P6AB 2B4CL 1GOGA 1M7IB 2PWFA 4F7EB 1O7SA 3F7PC 5JLZB 1GS7A 2APSA 3GSVB 1B9ZA 3WLWD 2VDNB 3O3BA 3H6AA 2UY6A 5I1DB 5C3IA 1CF8L 4ZX6A 2PUQT 5K5YA 3EJRA 5HDBF 5AEAA 3GI9H 2VDOL 3EH3B 5E6IA 2YIHA 2DQGL 1TJMA 5INCB 5HPMB 3VI3A 1ORQA 5IB2A 3KPRD 3MUUA 3RIFF 4F7TB 3I9GL 3CC1A 4PWKA 2VCOA 2H41A 4O58H 5I1HH 4MJIE 4MB4A 4MDIA 4PJ7B 3LQAH 5DUJA 3CBKB 3VQLA 1FH5H 4XN5A 4HZLB 4M5TA 1AY1H 3QQDB 2FD6H 2BFVH 3UL4A 1Y6NR 4HIXH 5DXWA 3ZT6A 4R90H 1EJ8A 4IEFA 5CD3B 3P9LB 1RJCA 2OSLA 4HW6A 3IDJB 2ZXGA 4IBUA 4JGNA 5BQ7A 4NN5B 4U3XA 3SGDI 1AH1A 1MY5A 2XQBH 1ZT1A 3MRHB 5JR1L 2CZNA 2YMTA 4DN4L 1OE3A 6CGTA 1USQA 3IGAA 1M3IA 4AQ8C 5DD0L 1ZT7B 2Q86A 5FDYA 4NUMA 2YHGA 5H2BA 5FOBA 3M8OH 5JHMA 5IG7B 2WUCL 3HS9A 4AYBA 3FO1B 4CNIB 1M1XA 2XZAL 1WTGT 3LZOA 2P49B 4M7JH 5AVRB 3K8LA 2JF1A 4I0PA 3V5HB 1T5WB 3WS6C 3D4CA 2WC7A 1S7RB 4D0BA 4ZFGH 3OXRA 3PDOA 4JCLA 3TCTA 5GHWL 2BRQA 2HXAA 4PJHA 2MCPL 5K9JL 4YIQB 4PRPD 1Z5LA 2MTPA 1WZLA 4ANXA 5I6KA 4ZFOB 1J86A 5AZUA 3P3TA 4RGMB 1KYAA 3X14A 3G08A 4JG0L 2F58H 3VGAB 4WWKC 4KK8C 3MNMA 2CAKA 1NBQA 1YMMB 1XFPA 2FHFA 3WOVA 1JGVL 2YXMA 3BVWA 4Z7UE 2BZDA 5C0BD 4JG9A 1AXSA 5DYFA 2W59A 1QYGL 1NUNB 2ESVE 3ECQA 2ZAGA 4PV9A 3SQBA 3PCYA 4MWFA 4NQEE 3N43B 4BKLB 4CDHA 1R3HB 1G7LA 4P49A 1N5YL 1F0LA 1QFWM 4YHPA 1JK8B 2VLJD 1XB3A 1KNOB 2IVFC 5I18H 1FO0B 1MWOA 1BXUA 4MSWB 2C9VA 4TRPH 3ZHLA 3A21A 4NC0B 2Y24A 4KKNA 5EO0A 1KDJA 5L2KE 4HUVB 3EFOB 5CAYB 1MZZA 5I23A 1R0AH 3O6FC 2CNZA 5TE7L 2ZKHH 1ZHKA 4HXBL 3OJMB 1CDYA 3QUXB 1S9YA 2V7HA 1QA9B 1I1CA 3QAZB 5EF2A 2CCLA 5FKPB 1AR1C 1HHJB 2NTFB 2VAAA 3A0OA 1X6LA 1AQ8A 1BX2B 2OX5B 1CFQB 4EZLA 3ZL4L 4PB9H 5BRZE 2O5YH 2IFFH 2P80D 3DSFL 2XN1A 3WE6B 3LEXA 4NM8L 1IVTA 3MBEC 3NZHH 5DEGA 1D7CA 1ASPA 2X4QA 3OHMB 4L8SC 4UQ2A 2H3XC 3RBGA 3Q7JA 3ZDWA 4OT1L 5IVOA 2FT8A 5I30H 3E9UA 3N1PC 4LSRH 2I7OA 3US0A 1OPGH 1TVBB 3SKNA 1KC5H 4JMNA 2Y0SA 2OCCB 1CL7L 3DBXA 3KGSA 1CE1H 5FM4A 1VESA 5F7NC 1YYLH 3DROA 3LZQA 3RIFK 4KY1H 5HGHA 4BBWA 3TBWA 4Z77B 3C5JA 2VDLB 2PPDA 2YLHA 1JZIA 4PRPA 5F0MB 2HLAB 1UA7A 4IGBB 2IPTH 1WA0X 2E56A 5D4QA 5FGRA 1FNSH 5HI4D 5KZCD 2Y06L 1E8XA 1IC4H 4W9FC 3G9VA 1OKEA 1Q38A 2CUIA 2HA1A 3IAPA 3PWUA 1SDAB 5D7JB 5CEYA 5C6PB 1JI2A 2WXFA 4XNXH 3BP7A 1BAFH 3IN0A 1CS6A 1FAKT 4HBCH 5C0BA 2X4TB 1NCCH 1JVKA 5DQJB 1TR7A 4Y1SA 2I07A 3LNFA 1U58B 1HKLH 3AT8A 3DX7B 1HQ4B 3B7UX 4X5XB 2AJ3B 4HOZA 5FEBA 5G5DA 5H8DA 2ZOTA 4ETQB 1XIWA 1XCXA 2IGFL 3GK8H 2BP0A 1CFMA 2ZXWB 4NGHH 2PP9A 3FHAA 2BJML 3FHEA 4LCCA 4OR1A 3BDYL 1DCEA 4UBDD 3VQ1C 3WJJC 4Q9QL 4POUB 3DHMA 3IWVA 2NX5B 4FEIA 3AROA 3CFNA 3K8MA 4IDJH 2MQ3A 4NM4L 2W07B 2EYSB 2F8VA 2JKSA 3KLDA 4UILH 3E1ZA 1IT9L 4N0CC 1I7TB 1B0IA 4JFZH 3T0AA 1TLMA 1SFHA 1UATA 3SBRA 1GYVA 1HH6B 1X6NA 4NFCA 4OKDA 5GSVA 1KY7A 5DJXB 1PNDA 3IXAA 1PSKH 43C9B 2NTSP 1AHWB 1YDPB 1SDDA 4YDJA 1NEZA 5DR5H 1CL7I 2P80A 1CGSH 1E8WA 2P9RA 4I3SL 3FT3A 3RI5F 4X4XA 2TSBA 2PPCA 4GQPH 1UA6L 1QSEA 1MLBB 1XQ4A 2Z7ZA 3PGCB 2G9HB 3J2PA 2FBRA 5F1IB 4UINH 1D5BA 4F7CB 1AACA 1KXQA 3SDAC 2EDNA 3DWTA 4HDIA 5J0BA 1Q1JL 1NLBH 1KBWA 3MRRA 3WMSA 1RJYA 5EBMA 4ZUVB 3VMNA 2BSSB 3FO9A 5B8CC 3O3AB 4HHWA 4XNAA 1E7VA 4N1HB 5FM8A 3B8YA 1U2CA 1QBMH 1TYRA 2PW2A 4PRIB 1O75A 1HEZA 1IQWH 4X83A 1HL4A 1CLVA 4KX9A 5SWZE 1EVUA 1KCRL 3SPIA 3MCLH 4FQ1L 2YMXL 4YWGH 4AEHH 1P0SE 2RTTA 5I0ZA 4TTGA 2EDDA 1GH7A 1FIGL 3U7AA 3EO1A 1OP3H 3IMRA 3JV6A 1IARB 2VXTH 1HNYA 1DVYA 3GUFA 2ZXDA 2HX8A 4HEMA 2AJZA 2DMKA 3QHFH 1MJUL 2ZSVB 1X5JA 4QHPA 4YPGB 2NLJA 3RNQA 1ODAA 3RKPA 3FU6A 5IUCA 1MFAH 2B1HH 3EYOA 3RILA 1SDYA 5E2WH 3ZVVA 4X6EA 1M2OA 2RALA 4MXWH 1XF3A 1AOZA 4YSPA 1ZVHA 4KVCH 4POZD 4KK9C 4XXDB 2ZE0A 4ZOEA 1J1OH 3Q8CA 3VWKD 2EDEA 1U8IA 4Y7OC 4I89A 3QG7L 1TTRA 3OF6A 3KLSA 3GDCA 5DJZB 4IU2A 1WDAA 4FKHA 4U3SB 2ZAHA 1WP6A 3C5XA 1ONQB 4XMZA 3APDA 4HJ1A 4NQDD 1NA8A 2Y1AA 3FU7A 3VFTB 1A6VL 2BMKA 5JORA 3BT0A 1T0OA 1F86A 4F2MA 3KEDA 1MHEB 2O4EA 3PP4L 4Q4IA 2YGOA 4XBEL 4ABVA 2WD0A 3EH5B 2G60L 2AEPH 1QACA 1T5XB 1B88A 1ZANH 1DSFH 3ULVH 4TQ8A 4LF3B 3CDGA 2WJ5A 3A6BL 1AZVA 4Y9EA 4JPKH 4Y2DB 1FDLH 3LKRA 5BZZA 4Q14A 5HHOA 1BOGA 3Q43A 4LLQB 3VTTA 4LLWB 4ZMLA 1CIUA 5LCVL 1GZPA 2YRZA 4BH7B 1YJDC 4MD5B 2H1PH 1GOFA 2LABA 3V4PH 1A6ZA 2J4WH 3LB6C 1NUDA 4XPGH 5IESH 2GJZA 3ZLQC 5TD4A 1Z1WA 3ATFA 3VFNB 2VH5H 5F3HA 1MCKA 4HOWA 2CDEB 5HGBA 5KW9H 1IAOA 4YDZA 4IIQA 4X6DF 2C4FT 5A3IC 4C56B 7FABH 3VXME 3MCYA 3C60C 3T1FA 3BKML 2MNUA 4WV1C 2FTAA 4LPTA 1NPJA 4WEUD 1EEUA 2R56L 4K23L 3CFJA 4YHKH 4AG4H 4TL5A 4AQAA 3WKQA 3VXSA 4MRCA 1V3KA 5DJ2A 5E24E 3GEWB 3L4TA 3MXWL 4X7SL 2EKSB 2NNAA 3IJ8A 4P59L 3RI5K 1TMQA 3D9AL 2EE0A 2N0MA 3SE8L 5I1IL 1DUYA 1T6VN 2QGDA 2AXWA 1OZUA 1F41A 3G5YA 3VWKA 1EEYA 4XT1C 4DEUA 2RFXA 3MLRH 3MRGB 4IJ3B 4AZ8B 4E68A 3RNKB 5GGSY 2AQTA 4H1LA 4BFIB 2DBLH 3GLZA 4F33A 4Z76A 1SY6A 2R83A 1PZAA 2K6WA 4G6JL 3MJ9L 4NQDA 1G6RA 5IW3A 2A6DA 5HHNA 3NZ8B 1LYQA 3B7YA 4M5ZL 5ALCL 4FXGA 1MFEH 1GGBH 1H3PL 1G9NC 4KZCA 1O7DC 1YEFL 4CW1B 5D2NA 2WXQA 1CYWA 1NGPL 1QW9A 4A38A 1ADQH 1T21A 4ICWA 5AKVA 4YN3A 4LP8A 2AZUA 4WCYH 1BZDA 4WU5A 3B3IA 5KYUB 4NWUL 2VZ3A 2WXPA 5LG1A 4G8IA 1T4KA 2NYYD 3ARYA 4BWWA 5AFAA 4YLQT 3NEEA 3WY1A 4QR7A 5K9OA 1TCMA 4ZZKA 1ES0A 3PNWA 4R7NB 4MQTB 3G5ZA 2P5EE 4PJGF 5FXCH 5C08B 5DF0A 1PTZA 3GD1C 3BQVA 4QRFA 2NY1C 4ES8A 1FZJB 4JFQB 3IE9A 2BNRB 2ZKMX 3F6JA 2A6IA 3ARVA 2COQA 3EGSA 4ODTH 4OD3L 2WLYA 4ELKA 3C08H 1IFHL 1OOAA 3KYOA 3NZSA 5LGJA 1H9DA 4RBPK 3GHBL 5ILTL 3ARXA 5EBLB 3FU5A 1FSKC 3DTXA 4J1UA 1ETA1 3UTZA 4NZDA 1QUNA 3BW9A 4PR5A 3ZDYF 3BMVA 2AEQH 1GYCA 1IEBA 3CLFL 1VZHA 3K4DA 3OR7B 4MJIB 1A6WH 4FULA 1KTKE 2YD5A 4P2RD 4QRQA 4HWBL 1ZS8A 2DWYA 4JFEE 3K80A 3E2HB 3BGFC 5SWQA 3S88L 3T3ME 3G6AA 1A7OL 2AABH 5DVKA 2WZ6A 3QEGH 2LLNA 2F68X 3FO0L 4AVIA 1M7UA 1N5AA 3MRNB 2XZQH 1YNKL 2FIKB 2B1AH 1NCGA 2D7MA 3FQ4A 2VIRA 1E9QA 4QRTA 5I73C 4IHOA 4JJ5B 4HIEB 3ZE0E 1FE8L 1FJ1B 2BCKA 5GJSH 2BP3A 1QHPA 1SYSB 4DUWA 2ITFA 1O0VA 3R0NA 4IRSB 1I1RA 4XVTH 3X3FL 1IGYB 2ZG3A 2IADA 5IR1A 4O02B 3CMOL 5BW7A 4LGRB 3TF7C 5DZLA 1FV1B 2OZ4H 4M02A 3DVIA 4FQ2H 2R1XB 3RWEB 2VDPB 3T8MA 3ZE1B 1MFCL 2F54D 3U9PH 4I7ZC 1IGFL 3LD8C 4MAZA 4OZ4A 1H5BC 2DEWX 1JZ5A 5HYEA 2E4FA 1KJMB 4ECNA 4J3VA 5HHVL 4U1SA 1CXIA 3KXFD 3V4UH 1KCSL 1W16A 2RH0A 3NIFF 1WWCA 3VG0L 4GKZB 5SWSB 4YR6B 4UTCA 1KTRL 1QP1A 5D1XE 1J5OL 4PJ8A 3B9KB 2NYKA 4UU9A 4ISVA 1BW8A 3IU4H 4WW2B 2CRYA 3N50A 2X3AA 3D0LA 3MRFA 2HSIA 3BAEL 1Q8MA 4JPIA 2OKMA 2EXTA 3CVHH 4Z7UB 3BZDA 1P7KA 2N01B 3RB5A 4AMKH 5J4MA 4KV5F 4IOIB 1TNMA 1A6TB 2QPDB 3GFUA 4NWTL 2FEEI 4U1HB 3F8UB 5E00B 4NQEB 3GSNL 2IAMA 3QQNA 4N0YH 1RUML 5F7UA 1LE9A 4PFEA 5EU5B 3U7WH 4Z1PA 5E99L 4U7SA 1JF1A 1MCRA 1FN4B 3F5WA 4YVUA 2ODIA 2IPKB 2MRYA 4EDWL 4IRZH 4UI2A 2R9HC 4K55A 4P2RA 1ZCRA 5BS0A 4YSAA 1NCOA 2NZIA 1OAXH 1N12A 3CZFA 3VXRB 3H3KA 4KK8D 5HP5A 1T1YB 3OKLB 2R7EB 2YWYA 4QHUA 5BXFA 3WHXA 5CJ5A 1UUNA 1JNLL 2X40A 2CBMA 2HVKB 2DYPD 1M42A 2R0WL 4MNQD 1U2HA 1Q0XL 2H6PA 1BDYA 1FCCA 1S9XB 1ZGLA 3QJSB 3ETBJ 3WCYA 3NJJA 3L45A 2B8OT 1EJFA 4P5KA 5IOPB 1SRDA 2CIKA 1R3KB 3HRZB 5EIVA 4M5YL 4APXA 3FONA 3KYKL 2LQRA 3KLKA 1XR9B 4LLVA 5IBUB 4B9GA 3K6NA 2J6EH 2Y7QA 1Y6MR 1AZCA 5GS3A 7PCYA 2VQTA 3OKEA 4PJGA 2Y69B 2W60A 4OQ1A 4GRMB 2ZKXA 4AYEC 2JFCA 2F54A 4HS3A 1NDTA 4Y1AD 3MBWA 5I1AA 1YJDL 2E7CA 5FW8A 4LPXA 4WHTB 4JM2F 1AR1D 5T1KD 4HKZA 4JK0D 2H0FA 4PGCA 4XO4A 4LGPB 3RURA 3WXWL 3KXFA 4U0QB 4HGWB 5EU6B 1JHKL 3EFDL 4AXWA 1SBSL 5E8PA 1KEGL 1PZBA 3GBNL 1AMXA 3MBED 3KPNB 3WN6A