4YL9A

Crystal structure of wild-type of hsp14.1 from sulfolobus solfatataricus p2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
MNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAGFNKDKISVRLSAQNELIINAEREIQYIGTKYATQRPLKIHKVIRLPVKVKRDSQVTAKYENGVLTIRIPVEGSVSIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein Hsp20
publication title Active-State Structures of a Small Heat-Shock Protein Revealed a Molecular Switch for Chaperone Function
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain 98/2)
molecule tags Chaperone
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4yl9A00
2JKIS 5DS1A 4RZKA 3L1FA 1X5MA 2KLRA 3AACA 4M5TA 4YLBA 3GT6A 3L1EA 2K8QA 2XCMC 2KMWA 4ELDA 5LUMA 3AABA 1WH0A 3L1GA 2N0KA 3QORA 3QORC 2WJ5A 4JUTA 4PCKA 2BOLA 3VQLA 4YLCA 1SHSA 4MJHA 3IGFA 3VQMA 1GMEA 2MNWA 4FEIA 3W1ZA 3Q9QA 3GLAA 2CG9X 1EJFA 2WJ7A 3Q9PA 5DS2A 3EUDA 3N3EA 1WFIA 2CR0A 2Y22A 4YDZA 4ZJ9A 4YE0A 3QORD 4M5SA 2Y1YA 4PBDA 4JUSA 2RH0A 4YL9A 1WGVA 2O30A 4I88A 2Y1ZA 3J07A 1RL1A 2N3JA 3QORB 3GUFA
chains in the Genus database with same CATH superfamily
1B2WL 1JHKH 5JTWA 4OM0L 1XH3A 1Q9KA 3PFUA 3GXIA 4TLKA 4PJXF 5CLWA 4F5CE 2BVQB 4LPWA 4M43L 3AREA 4Y4FA 4CC0A 2VL5B 4CMHB 3KD4A 2VDNH 3S5YA 1MUJA 1C5CH 1FYTA 3DURA 3HKZA 4JM4H 4X5LA 1M53A 2ZXDA 4LOUC 4PS4H 2WZPD 2BSEA 5IM7A 1MJ7H 5IJVB 3PQYD 1FVDB 2KI6A 4YZWA 3HRPA 4I3RH 2HVBA 1SXAA 2W9LA 3TTYA 3MNWB 5IUCA 2DWYA 1DVFB 3C5JB 3TPUB 3SBWC 1JK9B 4XMUA 1C5BH 1UKSA 4AENA 3F6IA 4CGUB 3NAAH 5JUEH 5D1XA 2P80A 4MD5A 3RL1A 3VRLF 4LNVA 3IPBA 1V5JA 2BRRH 1HC1A 3MJGX 2XTJE 4B5ZA 3RA7L 4GSDH 3HTLX 4HUNB 2CDGA 2PP7A 3FB7A 4PLOB 1GC1H 1DE4B 4D9RE 5BQ7A 3LVTA 4L8SA 1HAWA 1LEKB 1NCOA 3CAFA 3N91A 1OCOB 3B9KA 4PWHA 1JBJA 2CLRA 3O41A 3ZT7A 3RKPA 1A6VL 4NQDA 1I3RB 1E6JL 4QXTB 3W56A 2FLMA 4X6DF 4XZUA 3MRLB 3CXHJ 3TEZA 2BNUA 3LAFA 4K94H 5AD0A 2NYYD 3E1F1 2COVD 1Y6KR 5DYFA 5ICXA 3VA2C 1SQMA 3WFDH 4NNXB 3DROB 3NK4A 4G7RB 3X17A 4QAWA 5ESQB 3KPMA 1LE9A 1OGTA 4L05A 4OCYL 2O5YL 4H20H 2J44A 1XF5A 3MRPA 4TVSa 4ZFOA 4ZPTB 2XTSA 4PRPE 4QNPF 3UBXB 1X9QA 2QSCL 4LLQB 5ECJE 2ADFL 3QJUB 4W68A 3N3EA 1FNSL 1EEZB 1UVQA 2R2EB 1MCEA 1YECH 3BN3B 4HKJA 3OWEA 3VCLA 2NMSA 4K7FB 1AMXA 2BIOA 1Z5LA 1E3XA 4G1EB 3VI4E 2VLME 5A16A 5GZNA 3QDGA 1BXVA 4P46C 1HH9A 1MLCA 3LRKA 5C0BD 2AV1B 4OIAA 5ICZB 3S36L 1DQJA 3E8VA 4I0KA 1E90A 2W60B 4PCYA 5TDOB 3U46A 4APXB 1OLZA 5I8OL 1M05B 5DYOA 2XVKA 4RQQB 4L0PB 5IIEA 4F9LA 3CSFA 4UIMB 2HFGH 1XGTB 4PS8A 2I07B 3HG1A 4FGMA 4HSCX 5GS1C 1U8QA 1ZT1A 5T1KD 2P24A 2PYEA 3MBED 1BZQK 4QHNB 1ZE3H 2QR0A 1MI5A 4UOW1 3VO0A 3B7SA 3T3PF 4HQQL 4OZIA 3KLAA 2IQAA 3DX1A 1FAIH 2Y7QB 1DN2A 2EXWD 1Y0LA 3C2AL 3K8KA 1UENA 3UMTA 5AYUL 3D08A 3KDPB 1FNFA 2O6PA 2FX9H 5T3ZD 1SN0A 2WQVA 2WLHA 3LKSA 5EPMB 2YPVH 3RUGA 3MOBH 1LDPH 4KKQA 2Y0SA 4BZ1H 2AXGA 5F6HJ 4NC1C 2ZXAA 4AJVA 3IDJB 2P8MA 3QG6A 5HHXH 1XL6A 1VFUA 3CMOH 3PWLA 1JZ7A 2KQNA 3TCLB 1FN4B 3VQ2C 3U30B 3BD4A 2X2HA 1UH4A 2IMMA 2X28A 5IFAH 2DLFH 3SBQA 2XPGB 2G2PA 1GH7A 1Q9OB 5BJTB 4KJYA 3O8XA 4BELD 1NL0H 3MRIB 3F6LA 3L1EA 1BQHG 3LRHA 4I0PB 5SWSA 1FFNA 1BEYH 4UB0H 3ZIMA 3BQVA 1G9ML 1URIA 1AQDA 1N7ML 4AEIH 3HC0A 2CKBB 4YO0A 2XPZA 1BF8A 5IHBA 1QTPA 4YJZL 4JMXA 4FNTA 4X7TA 3S8FB 1BM3L 5IW1A 2XICA 4YXHL 3LDBC 3IETA 4UAOC 2NYZA 4BWUA 4PJXA 4WSGA 1SFDA 2NY5C 4PJHF 4QRPD 4TULL 4Y16C 5T1DH 4P2CG 3LS5H 5HGBB 3S35L 1F90L 3Q3GB 4KV5F 3WFBH 5IOPA 1ETA1 1YEDB 1KB5H 4RSYA 3P2DA 1HTYA 1YY9D 3L3GB 3Q1EA 2H2PD 2MEJB 2YPLB 4AKPA 3SDXE 3IJ8A 3PPEA 4FEIA 5GSRB 3TBSA 3Q5OA 3TGXA 5IHHA 1QKZL 4ZQKA 1U8MB 3I9IA 4U1SA 3VH8A 3VGBA 1MJUH 5GGTH 4FZEL 3TH2T 3FFDA 1I9EA 3VFRA 1Z1WA 1F6FB 5EOCJ 1W0VA 4O51B 2AK4A 5CIPH 4RDBA 1CK0L 1MCOH 4R26H 2ZUTA 3OKLB 3SDAC 4F92B 4DVBA 1XGUA 3N42B 1ZANL 1KTJA 3VWJD 1OM3L 4IMKA 3EJPA 4ZO7A 2YAFA 4TM9A 3OZLA 4PJ7F 1QHQA 4I3SL 4UUJB 2WM0A 4P23B 1HHJB 3ZL4L 1HX0A 4ILDA 1DJHA 4N0CC 4X6DA 4HPYL 4LVOB 4H0HB 4MXWL 3QJHA 3FSZA 3N50A 3O6FC 1B3IA 1IAOA 3DV6A 2QHRH 2XA3A 4MA7H 4J39A 3GJEB 2I85A 3BSZH 3CK0L 4W9LC 3D06A 2R69A 4PFEA 1PLCA 4WW1A 4R8WL 5L2KD 4CC1A 3D3VE 4NZRH 1RJLA 2AQNA 2D0HA 5EORL 3PV6A 3GWJA 4EIZC 5I5MA 1UT2A 4KTEL 4X4ME 1XF4A 1MFVA 2DJ4A 4P2OB 4ZFGH 4WI7A 1XVSA 2HFEA 3QQ4B 4HWNA 4K8RH 1QVOA 1S9YB 4RAUB 3TEUA 5JDSB 5TD4A 3FZUC 5D93B 4Y19A 1OP9A 1BQ5A 4JFPA 1KLFB 1MRCL 4B53A 2NXZC 4CSPA 2P8PA 4A7QA 1A8ZA 3UTOA 4BYHA 15C8L 4FFYA 5C0FB 4NKMB 5F44A 3SYAA 3P11H 1L9RA 3O9WC 4PGDB 3U4EB 3WDJA 1BWMA 4X80H 4X83A 4FXKC 4F3FB 4ZS6D 1KJ3H 1U8LA 2EDFA 3DK0A 1BIHA 5EC1B 1SDAB 2EDOA 1ZEAL 2ZPKL 4IJTA 1B0RA 4Z5RA 2BP5M 2YAPA 4Y9BA 5GGRA 4OTXL 3L95B 4XR8C 3V95A 2WINA 5L4FA 1LP9F 3KM2A 4YOKA 1HWWA 2F5BL 3KPLB 1BMWA 5CEZL 3KYMA 3F64A 1U9KA 1ADWA 1MCNA 4LIQL 3UJJL 2WP3O 4BQ6A 5L9DL 1EXUB 3JVFC 1FZMA 3AWGA 4WU7A 1BQRA 1H9VA 3TVMC 3W39A 3VWKC 4B9FA 2IQ9H 2X89D 3MROB 3GMOA 4G8GA 5DMGC 4H1LH 5C0JA 1TQWA 3CJJA 4M7LH 1UEMA 3SJVA 4M4PA 1IE4A 3MU3A 5AVRB 4IU2B 2FH8A 4U6VL 5IHLB 2Y2YA 4RBPK 4N0UB 4QCIA 4UINL 3L2NA 5ITBH 3GSWB 2KC0A 4JRXD 1UD6A 2BCKA 5L2JA 1FCCA 2VLKE 4RIRB 2PWFA 1JNNL 4IBYA 3S2AA 2GVYA 2Q8AL 2VN7A 3U7YH 5KG9A 2GSIB 3L4CA 3X1FA 1CLOL 1J5HA 3NSFA 1E40A 2C3WA 4YDJB 4JHAH 1MH5B 1BQLH 2GITA 4L4VE 3K72B 4RAVB 2F54E 2J2ZA 3IXTA 3OQ3B 1DVFC 4OZGB 1NBVH 1Z3GL 3CCHA 4M02A 2V2WB 2OTWB 4MAYB 5FF6A 4Y2OB 4X7EC 3H55A 5AVZB 4J5VA 2HFTA 5DQDH 1GGIH 2WXIA 2WXJA 3H9YA 5EOQH 2GSMB 4PJHA 1YMMA 2ISDA 1G1KA 2FT7A 5HHMB 2O61B 3PXLA 4MB5A 1SQ2N 4LDLB 1HJBC 1CFQA 1IM3B 3UGEA 1UZ6E 1HESA 2PTVA 1ND0B 1N4XH 3BKYL 4U3SB 1N2RB 3EYOA 4R5TA 2YD8A 1WC7A 4KMTH 3DMMA 1A3RL 4IRJC 2ADJA 5DUJA 3S4SG 4GXVL 4YHKL 4GI6A 4U4IA 4A2GA 5L8JB 1GCFA 3TN0D 4QOKB 4ISVB 5LWYL 4Z7QB 4X0NA 4I48B 3VM7A 4QKXB 5T5FL 3T65B 3MXWL 1F3JA 1Z9PA 2FNWA 4GT0A 4LU5L 5DD3L 4PJFB 4M7ZB 1SVBA 1OCRB 3SE8L 1IBGH 5AALA 3ZK0A 4OZFG 5CHNB 3PNWA 5FUCC 1S78D 1KXHA 5FA3A 4LCIH 3QFDB 2DI9A 3QJOA 1J1PH 3OR6A 1F02I 4YZFF 4O2EA 5E8DL 4HLEA 2YR3A 1FFPB 4PJ7A 4ZW8A 3EH4B 3LD8C 1T1YB 5INCB 4QRRA 3CVIL 4PLJC 5DF0A 3MVSA 2PW1B 3B8YA 3EJYD 4YS4A 1SHXA 4HJIA 3LIZL 3UTSA 4D0CB 4AOFA 1FZKA 2AK1H 3QDMA 4M7KL 1QOKA 3MX0B 4N0YH 1IGCH 1K5NB 2DRUA 1LO4H 4MYWB 5HVHB 1EVUA 3SGJC 3CPLB 4P2QA 4XE0A 4YGAB 3SPJA 2X4TA 4BUQA 1ZRUA 2AXFB 3ZO9A 1NLBH 3NN8A 3PYCA 5E24E 2R7EB 4J6RL 3P73A 4JHZA 3VRJB 4IHBA 4U0QB 4N2KA 1ZLVH 1D2PA 5TH2A 1E9PA 4LP4A 3W0WA 5CJXA 5I8CB 4JFED 3CGTA 5A3IC 4MLSA 2VN6A 4N4YB 1LM8V 1D9KC 4KMQA 3RI5K 2VXTL 4ONFL 2FYYA 3FQRB 4GT7A 1TTUA 3UC0L 3P54A 2CBTA 1NSNL 3HMWH 3V10A 4AG4L 1UH2A 3L4XA 1CZ8H 2B0SH 4LKXB 2QQKL 2YC1B 4V11A 4EUPH 3KBPA 3SDDA 3PIQB 1UG9A 4XVUC 3N40P 3WKQA 1CDBA 1U91A 2EDNA 5HXMA 4UV7L 4G80A 1OPGL 1I7TA 2AJXL 3C5ZC 3VFPB 1LP9A 4QKTA 1CFTB 2MQ3A 2Z0BA 2UVEA 3EYFB 5IJCC 3QUGA 4FYSA 3INUH 1YPZF 5CP3A 2BMKB 5DFVD 3RGVB 3AG1B 4HK0B 1QUNA 3TTSA 1WBXA 4E41A 5C0EA 4KQ3H 2YQGA 3BZ4B 4JPIB 4BM7A 1CR9H 2VDKH 3AS0A 3DARA 2Z35B 2WWOA 4NUJA 1PLBA 4G7SB 3T0EE 4GRLA 1KB3A 1IGMH 1DBKL 2ERJB 1QATA 4DGUA 1T21A 2UXFA 3G04A 5ACZA 2VXQH 1KNOB 4FZ8H 3MBWA 2QFRA 4P2RB 1AFVL 4XPAH 2ZP8A 3KPTA 4TMPA 4HS3A 5D4HA 3FUJA 1QFUL 3RZWA 4TUJA 1JNJA 1EHNA 1FDLH 2X6VA 1QSEA 4GS7B 4P4KB 3EHBB 3DBSA 1OGAE 3GHBH 3WO4C 5ID1A 2FUQA 3D05A 1OB1A 2J6EH 1XR8A 4HIXH 1S7WB 4HKBB 2BJMH 4HJ0D 3ECQA 1OTTC 1GZHC 3EH3B 2WOYA 3E80A 4LAJH 2HLAB 3I9PA 3KNBA 4U1GB 3MLVH 4LK4A 3CSPA 1N64L 4P5KB 4UILL 1PYWA 1WAAE 4Q89A 4Z3GA 3RURA 4Y2DA 4FEMA 1WP6A 3EJJX 5JOPD 3CC5B 5I8EA 3RU8H 1BFTA 4KPHH 2ZKHL 5DU7A 2LABA 5T1LD 4KITB 4JKNA 4LVOC 4Q0XH 2IGFL 3ARFB 2HN7A 3AFLA 1MY5A 4RA3A 2DQFA 3CUPB 1E9QB 4LSPL 4DKEL 4J4PC 4CC4C 3VB9A 1TZGL 1QRKA 4XMTA 5F9OL 3MHZA 2FD6H 4WO4B 1P2CA 3T77A 3QXWA 1JF6A 4M3HA 1XIWC 1JTTA 3MV9A 5KJ4A 3K2MC 5KYXB 1AZUA 2MOGA 1RULL 1T2JA 5E4AA 5EU4A 2Y5QA 5DRNA 3U9UB 4ZMLA 3QUZA 3M17A 2AJYL 5HJ3A 3EYVA 2EEBA 2ILLA 3VTMA 1U3NA 5ABDE 1JGEA 5LO7A 5D93C 2WWMC 4DGIH 4NCC2 5B8CB 5BS0D 5EZLA 2DW5A 4AYFB 3K8LA 3DJRA 5GHWH 5G4MA 2WCGA 5JXEA 3C6LA 4MSWB 4NFBA 1RSFA 4H0LC 2DJUA 4M6ML 5FA4A 1HI6B 3DO4A 5FO7B 1XL4A 2E9IA 1J9RA 3HAEH 4DGYH 4NQEE 1R5IB 4QJ4B 4KXAA 5D7IF 2AQ1A 3TM6A 5KW9H 1VLXA 3GMNA 1JCKA 2EDEA 2VC2B 4IEFA 1AY1L 1WUNT 4F24A 4NQQA 5FW7A 1OARH 1COBA 2EECA 4TPRH 1WWAX 1AO7A 4EVNA 5GS2H 5JW3L 2CJSA 2VMJA 1BOGA 1ES0A 1QLEL 2HVKB 3M07A 4OV5B 1HK6A 3L08A 4YEEA 3FFCA 2IBGA 4FKHA 4ZSOE 2MCAA 2XG4A 5FFLA 2WBXA 3T8MA 5AOMA 3BW9B 2GFBB 1BVLA 2LU3A 3PWPD 4G9DA 4M9PA 4XO9A 4XXDB 4CNIB 2F7PA 3BE1H 1NOFA 4RGNE 4YDIL 5E8OB 1FYHB 3GBMH 4WW2B 3T09A 3QIUC 2AC0A 2Z7YA 3VXPA 2N7AA 4LFHD 3RQ3A 3LXCA 3VFNA 1TTBA 3GMPA 4OI7A 4BH7B 2WTRA 2BDNH 1SDDB 5CZVL 4NPKA 1Q9WA 4L3EA 3B2VL 1CVSC 3S96A 1HHIA 1MHCB 1ACYL 3A6BH 1UT9A 3TURA 2DMKA 1SXBA 3CDCA 2OYLA 5LGHL 2WYTA 1R46A 4UNVA 4PR5A 3LN4B 4BSVB 2A9MH 3ARGB 3M1BA 2GJ6E 4LOFA 4HH8A 5DJCB 5DTFA 1VRSA 5HHQA 1PW3A 4N2OA 1YPZA 3MUZ1 4QI3A 1MHHB 1CLYL 1YEHH 2WYHA 3UH8A 1MG2C 4YSRA 3RWHA 4HKZA 4DO5A 3ESOA 3UZVA 4KXZI 1UHVA 3VUAA 3SPVB 2GI7A 2OS7A 3UXFA 3VRIB 1VFAB 2OMTA 3EBHA 2ZG1A 5FCSH 3HHSB 4L8CA 2X40A 4OQTH 5C0RH 4PRNA 1BQHB 3CQQA 3VFMA 1HWHB 2YD2A 4H88L 4Y4HB 3T3ME 2XJKA 4AJWA 2QQLH 1PG7W 3LEVL 4PU2A 3NPSB 4JO4H 4F33B 2CO1A 1V7NH 3E9UA 2AEPL 4CVZB 4GO9A 3IDGA 5JNYB 3G5ZA 3X11B 4BV1A 4XX1G 1A4CA 1MF2L 5IROC 4OCLC 5MHSE 2TAAA 4ALAH 3ZZLA 3V5HA 3D48R 3U0PB 5BZWA 1U8JA 1WV7T 3MBEB 3OZ9H 1AJ7H 4M7ZC 5T33L 1E9OB 2ZAGA 3APFA 2HLFD 3GXTA 4YLBA 5EUOF 5D7LA 3RILA 1UXSB 1SLUA 1T2QH 2J5WA 5FGBC 4AMWA 1S5IL 2E27H 2NNCA 2BP0A 5JIQA 4JLRB 1UQSB 1GPOL 5ICYB 4G3YH 3BGAA 3NJHA 3WD5L 4HWEL 5MI0B 5C0AB 1G1YA 2E74C 1SOKA 3P3UA 1BECA 3BP7B 2B15A 5JIKA 5E9NA 1WZ1L 2P7TB 1ESOA 2FO1A 4JDEA 5FWRA 3VFTA 4HUUA 1X5AA 4PP1D 4A2EA 3DO7B 5DUML 2E46A 1FV1B 1KENH 3WNJA 5GISH 3BZ5A 1R3LB 4HCRH 4M8RA 2ITFA 4E5XG 3R7RA 2B16A 3L5XL 3N43F 2ZCHH 3G3LA 2X9XA 4YSAA 3NA9L 2ROYA 3UJTL 3HKFA 4Y4KD 4LL1A 1HE7A 2AI0H 1FLTX 1UWEL 1FL3A 3BD5A 1J05B 4G8AC 5B4MC 3ARZA 2VSDA 2J7LA 5B1CA 2QTEA 4QRSA 3DSNA 2EINB 3KVQA 4JQVC 2FZ3A 2B39A 1RZ8A 4B7IA 3ARVA 4LEXH 2AZAA 1BIIA 1F1AA 3T0VA 4BDVB 4CN6A 4PJCE 3OV6A 3L5IA 4M5ZL 3QUKA 4OUOA 4UQIM 3W2DH 1LJMA 1D2OA 1QX1A 1WEJH 2VJXA 1A14L 5DT1L 3BIKB 5AWNH 1ZKAA 2WLIB 3AWFA 1L4IA 4GKNA 2NY4C 5D7IA 2MWCA 1BP3B 3EOYG 4D3CH 3U79A 4XO3A 2WXMA 1YDPB 4MDJA 5CU5A 3U0TB 2JCCB 3GXPA 4G7YH 2OMXB 2XLLA 3QVAA 3NIFF 3VFVB 1CD0A 4OM1L 3LIZA 1IGTA 5J1AA 3IDMA 5EC2B 3IE9A 1A4JB 5PCYA 2NXYB 4R7DB 4WWID 4KRLB 1ZLEA 2QADC 5CP7A 3RGVC 3V7MA 1MCSA 3VXSD 1JF1B 5LGYA 1ASPA 1W80A 4H5SA 3S37X 1IBHA 4ECNA 4J1UA 5AOZA 4XNYH 4O9HH 5KSVA 3RPKA 5JYLA 2R8SL 1E3ZA 3VWJB 1TZAA 3OJVC 2A74C 3AUVA 2XKNA 3EBAA 1SEBA 3BMVA 3DI3B 3WSQL 4QXUL 3ARBC 4KHXL 5DZLA 3GHEH 2G5BB 4YSQA 1T1ZA 4QRQB 2PTTA 4FNLL 3FAWA 3B2XA 3GXNA 3GRGA 5J0BA 5EEXA 3RVUD 5DHXB 5FCUH 4XXWA 4RMTA 1PZBA 4JHBA 2NY3C 4HIJB 1PEWA 2M8XA 3RNQB 2NCMA 5CIPA 5KOMC 1QW8A 3EHBC 4LGPB 4X6CF 3O3EA 1SRDA 3BH9B 4MZ2A 4PIRF 3JSSA 1X7TA 3VXMA 1II4E 5JHBA 1NC2A 4OFKA 2UZIL 2R56L 3BEVA 4LPVA 2X87A 5FEBA 2GIMA 4U1GC 3PQYE 5TDNB 2D31B 5CCKH 3DVNB 2RB8A 3K80A 1I8LA 1RZJL 3BP4A 5IR1B 1FHGA 4JDZB 1TQCC 3GKWH 3TO2A 3PAYA 4YXKL 3ULVL 3VAEA 3TYGH 2V8LA 2CO6A 5C8JB 2DBLL 4I5BA 3H2QA 3ARFC 2CJUH 4FABL 4WHTA 4RESB 3CFQA 1NGXA 4BZ2H 1JZGA 3FB6A 4OZ4B 5JZ7D 3LHAA 5EUOA 3E3QC 2VE6B 1I75A 2F7OA 7CGTA 5IHWA 3LHPH 1DLHB 2H32H 4Z7OE 3G5VA 4PRHD 4ZW3A 1KEGL 4XNMA 3O6KH 3S4SB 2XQBL 4KRNA 1H5BA 1YY8B 1UXWB 3WGUB 1CURA 3MXVH 4X5XA 5B8CC 1JYVA 1RVFL 1I9JL 3IVKB 4E68A 4RZCB 3DIVA 3G6DL 5ALCH 4BCXA 1UM6L 3IGUA 3MREB 1VCAA 5EIIA 1P7KA 5HI5C 3QORD 4P5SA 1J1OL 1T89C 4UDUB 3OKOB 5HDBE 3Q13A 2B59B 2G60H 3IMUA 4MBRA 1OTTD 1RUKH 2YO3A 1ODUA 4YMPA 4XVSH 3LSOB 4YHYC 4HF5L 3PRZA 4FQLL 4ZO9A 4I77L 3BRFA 3LZLA 2GSGA 2JLLA 1YC8A 3DX2A 3P3YA 3ZMEA 3RVTD 5J57B 4XN1A 1DVTA 3OG6B 5DSCA 1XBDA 2VIRB 4R84A 5HHVL 2D03L 5C0BE 3SDCC 3QR2A 3O8XD 2VWEE 3D4ZA 1IEAB 3SOBH 4YBLB 3F12B 4DW2H 5KSBB 4X5WA 2KDYA 4LMQE 3T08A 4PJ8C 3TF7C 2MSPA 4U7SA 1DQQB 3B2MA 2D3JA 1EO5A 3MRMA 1TETL 3EYQD 1EZUA 1BD2D 1LTXA 1TJHH 4X7CC 2ICEB 3WE6B 1OAQL 2Q5BA 4P57B 3NSDA 4MNGE 3TT3L 1IM9D 4HUXA 4JRYA 3T6WA 4PY7A 3OQRA 2JELL 3U25A 1AG6A 4PY8J 3U1SL 3FC8A 5J06A 5T3ZE 4GUOA 2YSSA 4D8PB 1U8KA 2WXKA 2DM4A 4L5FL 2ARJB 4GAYB 1UYWL 3ARGC 3SO3B 3ZDZF 1IZKA 3CXHK 3WHXB 4TSCH 4PRID 1QBMH 2D9CA 2NUTB 4CVXA 1TVBA 4J3SA 1TZOA 1GR7A 5I0DA 2GJZB 3FO1B 1WFNA 4OGAD 2JXMB 2DY2A 2N01B 4TF4A 1NCNA 1ZHBA 3QPQD 1AKJA 2YGNA 4G7VL 4ZAKB 4R4BB 2LGNA 4XMWA 3WKNA 2Y7NA 2XC8A 1AQKH 3VFUA 2A3TA 1PZ3A 4BK5A 1CT8B 5PAZA 4NQVA 1S7SB 1TNNA 5EO0B 4GO6B 3N1QC 4Y4HC 3JZYA 3U9WA 1W9XA 1N8ZB 5E94B 3QI9B 2VO8A 4M3JA 4IK7A 3NPSC 5C0CA 4JVPA 5AVWB 5D6DC 2D7TL 3FSVA 4R7NA 5ANME 3UTPD 3UOAB 5FK9A 4NZUL 2Y5TA 3GB7B 5C86A 4FQPA 1OAYL 4LLYB 1G7JA 3KH4A 1EPFA 4H25B 1MCWW 2Z9TA 3HE6D 2FATL 5DRZA 4X6CA 5FXCH 2IDCA 3TZVD 4AGPA 1G6RB 1QQDB 4QRPE 1UB5A 2ZXQA 3EJTA 4HAKA 1CPUA 1QPPA 4CJ0A 3CZSA 3BAKA 5BO1L 1P6AB 1CYWA 2LW3A 1K4DA 3HUJE 5MENA 4CW1A 4B9GA 1T3FA 3JWNH 3MRKA 3BPNB 4AYEC 5GIRA 4AUUA 5INDB 1VKXB 4W9CC 4KUZL 5EZOH 5EEVA 1URLA 4IS6A 3C8HA 4U1NA 2AQTA 3BVNA 5FYKL 4AWJC 3I85A 1RIHH 4LSSL 2JB5L 1CS6A 3MRHB 2XN9A 1HZKA 1KJ2A 1U3YA 4PBWD 2E6JA 4M43H 3RZCB 1CL7L 1I8AA 3VH8G 4MNQA 3KYNB 3RFZC 3WENA 4N26A 4L3CB 4GXFA 1JP5A 4FNQA 4PJDB 4S0TD 1HH6B 1A5FL 4JB9L 4MMZA 3ZDXF 4YL4A 5GS0H 4R7LA 5DWUH 1ZLUK 1CXFA 3ULVF 4JG9A 3MV11 2CLVB 3ZZ1A 2R0LH 4LRIC 4NKDA 1YEFL 1NM9A 5DJAB 1YNTF 3BUTA 3FUHA 4P49A 1HWGB 3EZJB 3FU7B 4OZHB 4TVUA 4UMSA 2AW2A 1DSYA 1OOWA 1HEHC 1YEEL 2GT9A 4N2DA 2Y06L 5FM4A 5L2KE 4ONOA 3V9FA 4WK4B 3EO0B 5F6IB 3GJFA 1HT6A 2WD0A 2OMWA 1NDMA 1E4XL 1JFHA 3HG4A 2LVCA 4U6YB 3F7QA 4B7LA 4K9EH 1FPTH 1J5DA 3WN6A 1YN6A 2V7HB 5D1QB 2JTYA 3NZ8A 2AXHA 2ZF9A 3WGVB 2XNAB 3ELAT 4FS0A 4IOIB 2YOCA 4UQEA 4IBLT 3UYPA 2VM4A 1KTLB 4FCAA 4E9YA 2F19H 1E6JH 3DXAE 3FU6A 3PABB 4TKWA 2EXYD 1HILB 4JQIH 2FJFA 4D2NA 4MQXC 5C0ND 3APMA 3DTXB 5KVGE 1PG7H 3DPBA 1CD1B 5DI8B 3F7VA 3PL6A 3NJMA 3O4LA 2NXYC 4R90L 5HGDB 3CZGA 5DJ0A 1E6OH 2Q8BL 2VISB 2WBWB 2XV2A 1N6QH 4ZODA 5DD0L 4QTIL 4ANKA 2EC9T 1QFWL 1KUMA 2TRYA 1D5ZA 5EWIL 3EJUA 4J8QA 2WSKA 5D5MF 4LLDB 1ZSDA 2BS71 1FNSH 2CO3A 1CF8H 3T4AB 5F9DC 2PABA 3WJJC 3BRDA 1LHZA 1ZA3B 4YHPA 5G2NA 4OH2A 1C8QA 1SGKA 3NIGB 3KPSD 2JMRA 3L3HB 1AHWC 2QPEB 3NACH 4LPYA 4M6OL 3QUXC 4J3BA 2K7PA 4L4TA 4LPUA 2PP9A 4TVPD 3O2DL 2FVNA 5GRXG 2JKTM 5KVEL 1NCBH 2HCZX 2C9SA 32C2A 2Y07L 4BKTC 1AZBA 3RWFA 2FWOB 3MLUH 5I8OH 2A38A 3DGDA 2YEZA 4J28A 3LH8A 4J8RB 3UDWA 4HVBA 1TQBC 2VZOA 3C9NA 3MV7D 5LVEA 3B2DC 4ZNCD 3FT4A 3VFSB 4KTYA 5DEFA 2ADGB 3ZE0B 4JRXE 2VAJA 3HFMH 4N24A 3NZSA 1E42A 4CMMA 2W81C 3BQUC 4TOYL 4HQQH 3STLA 3INOA 1W72L 1KLUB 4BFFA 5JXAL 1HINH 2GK0A 1P53A 3OJDB 5EDXA 5CJ5A 3C2AH 1AACA 4HLZG 1IAIM 4ENEC 4K7PY 2OKMA 3SY0B 3BGFC 5BS0B 1SFHA 3QIWD 5D7JD 5IB1A 2DQUL 1X5HA 3OC8A 2QADD 3U1QA 2AS5M 1XR9B 3KYOB 4PJ5D 3GZPA 4X4YB 3JVGC 2CK0H 4HOWA 1A7NL 2MCPH 2L7UA 2YS4A 1PKQB 1MW0A 3QNXA 1R3IH 4G70B 4PEEA 4BEIA 3QCUL 1HOCA 3WELA 1JXJA 3F04A 4KTDL 2XQ0A 1DO5A 1TTAA 1WRFA 4P9HC 3NZUA 3OJMB 1U2CA 2N0KA 2ZOWA 1UEYA 4MXQD 4GUPA 4W9ZA 2L8AA 5DO2D 3DPDA 5GZOC 3RWEA 1DEEA 4Q2ZB 5FFOA 1N7MH 4OCNC 3MUHL 3TO4C 1MSPA 1CLCA 35C8L 3PWPB 1DL7H 3GXMA 2FGWL 4KROC 4ODVL 1DLFH 2W95A 4TRPL 1L6ZA 3ZKSD 2ZCZA 5F7AA 3LRGA 4DZ8A 2ED8A 4MX7B 1RLWA 4U4BA 3FOLA 2C3GA 1DBAH 5E8EA 5D71L 3KYKH 5G55A 4F2MA 4XCFL 4R3SB 3ZTNL 3GBLA 4O00A 3FMGL 3B7TA 3HE7A 4JZJB 5J5EA 5HPMA 4GI8A 2J21A 3P0YL 4FXGB 4JO8A 4ZMAT 2R2CA 4APQC 1TVHA 1WISA 2P44B 2UWEE 1Y07A 2VDOL 1TENA 1G1OA 1QMUA 1VFOA 3AG3B 3IDUA 4JL1A 3WTXA 4AE1A 1YNTA 1SY6L 2H0EA 5GGSB 4XPFL 4X9IA 5MERB 3QNFA 3SKUD 2XA8L 1F3RB 2YUVA 3Q8FA 4EOWL 4YBLC 1RJYA 2XKUA 2BIPA 2CLZA 4LCWA 4RSVA 2ESVA 4QRTB 4NIKB 2CGRL 2NY2B 4P3DA 4BFJA 1LK3H 4E5XB 3NH7L 3QH3A 3RX9A 1L9TA 2CBPA 2ICEC 3NJVA 1F2XK 3KZ8A 3RTQB 1M1SA 1JZ4A 2NUPA 3I02A 1FH5L 2ICWI 3ATBA 1TFPA 2VYRE 3I6GA 1THAA 4JFEE 2E4FA 4JO3H 2C9QA 1ET8A 3FT3B 1J8HA 4N25A 2ODIA 1S7QB 2DQGL 5B1BB 5I15L 5F1NB 5T5NG 1RIUH 4MXWH 1QSFD 2V8MA 3C12A 4FG2A 3SO3C 4WHYH 4JS7A 4QHPA 5DJ2A 4XPHH 3B4NA 1NAML 5AB1A 1O7DE 2XWZA 2R1WB 1LO2H 4GQQA 1EHXA 1NBQA 3KPRD 2CRYA 3ABZA 5AB0A 5GGQL 5D5MA 4ZAKC 1WZAA 1P4IL 1TKWA 4I9WD 4YQXL 3LCYA 4M4RA 4NJ9L 4M8QB 3WEOA 5I6XC 1GZQB 2UVFA 3WFEH 4PTUB 2IPUG 1T5XB 1YN7A 2XWJA 2EP6A 5D7EA 3BN9D 3BVXA 1IKNA 3QI9C 3R8QA 4GRWE 2F7RA 4M9OA 4PV8B 4UTBH 2E7BA 1U3JA 4XB7A 2VERN 4PJ8D 1TYRA 2GCYB 15C8H 5HGAB 4AM0Q 1IAII 3DIDA 3WDHA 1EUTA 2CDEA 3OWRA 3QE5A 4QR7A 1VCBC 1J11A 3T1FB 4FF9A 3DTUB 3ZN6A 5IK3A 3FCTB 5DHVB 3BJ91 3RVVD 3PF2A 1EFXD 3CC1A 1ZHNB 4HJ1A 2AEQL 4ORZC 2Y9RT 3D0VB 4NO3B 5CEYA 1EHLH 1QHOA 3L3OB 1ORQB 3K71A 1RP8A 4LSRH 2A5UA 3UZQB 2R9HD 5CEZH 2X53A 1T7WA 3MUGB 2Q6WA 4PWIA 2H6PA 2J8UF 4LIQH 3UJJH 5L9DH 3DJZA 1KJMB 3VGHA 2X4RB 2R83A 2AV7B 3O3BA 4L2LA 2CMRL 5GJSL 2EIBA 4HFWB 3FT1A 1Y1DA 2DS4A 1QSZA 4G8IA 2VDRH 2MMXA 3K4DA 3RZCC 1Q9KB 1VFBB 5T3XH 1MW2A 1HZHH 1OE1A 3ZX1A 3OPUA 3AREB 4GMTL 1DVQA 4HFUH 4J3OD 1H6FA 1JNNH 1KCRH 1I53A 1MUJB 2Z31A 1OO2A 1FYTB 3DURB 3DVGA 4OGXL 5JOPE 2DTSA 2GEQA 4K5PA 2CBOA 1ODAA 3GIZL 1MCLA 5E9DE 1MAML 1ED3A 4U6XA 4Z7UE 2HG0A 3R8BB 1IC7L 2NQ3A 1AR1C 1JGUL 1S9VA 2YQ3A 5G5DA 4M48H 5JQ6L 3MRCA 5JHAA 1F2QA 2NNXA 3IJHA 3SGEH 4JFWA 2D7MA 3EXJA 3FQWB 4LHUD 3BO8A 1PF3A 2ATPB 3N44B 1MKFA 2BVPB 4C4KO 1A6ZB 3GZKA 2Q87A 4PJAE 2CDGB 5B1JA 4FFTA 1GY2A 4GSUA 5D1QC 5BQ7B 4L8SB 1I8MA 3BKYH 1VZHA 5IFHH 3B9KB 4JFZL 1UOKA 2PPEA 2CLRB 4XCCH 1A3RH 1VIWA 2BC4A 3LKPA 1S3KH 4MCZA 3AVEA 3HZYB 4DVRL 2XIDA 4YHKH 5D96B 1BZ7A 1FE8L 1WUZA 3JT0A 1T1XA 5B21A 4HIQA 5F96H 4OJCA 1W0WA 4XAWL 3VG9B 5ICXB 3ATDA 1CBVH 4HD9A 4XOEA 5DD3H 4V1DA 5D2NC 4HUCA 1QBLH 3M1CA 1KEML 1LNUA 5IVXF 1DFBL 1MQKL 2VLJA 3MRPB 3SEPA 4AQEA 2AABL 3QC6X 2HTKD 1OTSC 1YYCA 5A2IH 1AGCA 3MRGA 3QCVH 3H2PA 1KIRB 1F41A 2ATAA 5E8DH 4DO4A 3LEYL 5J13B 1UVQB 1CI5A 4YHNA 1N68A 4J3WA 5HI4C 3VCLB 4ZZFA 1P84K 5I71B 1Z5LB 4N8CL 3B2PA 1QI3A 5A16B 4CU6A 3T2NH 1X5IA 4NKIH 3STBA 4G6AC 4N86A 4XBMA 1KXVA 1HH9B 4A1RA 4HOZA 2XUWA 5KYUA 5AZEL 1DQJB 1P4BL 4FLRA 2NLJB 4BFEA 5I18H 3FUDA 5DYOB 3BIBX 2BFGA 3D33A 5TDPA 5IIEB 43C9A 2CGYA 5ADPH 3JBG7 1U2HA 2YD4A 4KJPC 4NIYE 4GPVA 1U8QB 1Z9NA 5AW1B 2BO0A 2P24B 3EYUH 3FJTA 5TE4L 3X3FL 4PPTA 1MI5B 4YIQA 1JPSH 1A9VA 1LO5A 1QRND 4RWHA 3H9SD 5F3HA 2QGDA 1Y0LB 2ZE0A 5LDSA 4O58L 5AW5B 3LN5A 3QEUA 5DJ8A 1O6SA 1NCDL 4MVBC 1XH2A 1IAIH 3LKOB 3UC0H 4R6UA 3WFHA 3QXVA 3CHRA 4KO5A 1NSNH 4F1ZA 4PBXA 2VJ0A 2AXGB 3HI5H 2DMHA 3IFLL 5EV7A 2NW2A 4NHUA 1N5YH 1UZGA 3IJEA 2YRBA 4MXVE 5CN1A 3LKRB 3PWLB 4POZD 4Q6YA 2AJXH 4Q6KA 3UYRL 3ZHLA 2JFCA 5K9JL 1U41A 2EICA 2HVJA 2YGQA 5CZRA 5KBPA 2VH5L 4M5SA 2D3VA 2J8UA 1EZLA 4NO0A 3O8XB 4NUGL 5F70A 3DIFA 2VL4A 5F7MC 2HG5A 4WCYL 1FFNB 1M4KA 4JKWA 5BPPA 4LAQL 1ZGLB 3MAWA 1S5HB 3HC0B 4YO0B 4EI5A 1RUAH 3Q7JA 4ZT1A 5KSAD 1BD2B 2BERA 1R5VB 4X7TB 4TNVF 5KBNC 3ZUCA 3IETB 4FTVD 1E4WL 1W72A 1HQRA 3WFCL 2DQHH 3ZVVA 2DQ6A 3F83A 2HTLC 1DBKH 1JF5A 4N5EC 1U8NA 1SM3H 2B1HL 2I9TA 1AFVH 3D12B 5IJKC 3LNDA 5IOPB 1I7RA 3UCRA 3KWXA 4FXGC 1O9ZA 2B1AH 3ULUH 2VXUL 1KIQA 3FTYA 2EKJA 2OSYA 1UWXK 4RRPA 3OTTA 5DZOA 4GBXC 2K8MA 4JR9H 4XN4A 3TBSB 1N5AA 3AG4B 4ZQKB 1Y6MR 3P0VH 4FRWA 3H3KA 2OMUA 4TUKH 1XTLA 3QO0A 4U1SB 1NCAL 3OKMB 4X6BA 5TJWK 2APWA 1YAZA 3TP4A 1W0VB 4ODXA 3VI4F 4NPJA 2AK4B 3GYRA 4JFVA 4LT7A 4KRMB 3RTQC 1N64H 2BFVL 3QXTA 5KUMA 1MCIA 4QF1A 3WS6C 4DVBB 1XGUB 4NPYA 4PGZA 4Z76A 4R2GB 2NR6A 1XGYL 1F4YL 1KBVA 4ZTOL 2CIIA 3ZSSA 1XV8A 2ALAA 5E8NA 1CMOA 1JWUA 4G1MA 3HNTL 5CU9A 4TQ8A 4KX8A 2ZXGA 4LSPH 4CSZA 3QJHB 2P45B 4B27A 4N6RB 1IAOB 3IGAA 5FUCE 3TZVB 3DV6B 1OP5K 2C9XA 4Y5XA 2VN3A 5LCVH 2G2RA 2A73A 3QFGA 5IVXA 5IGXL 4PREA 3IF1A 3ET9F 2RCSL 1RURL 4WW1B 2UZYA 4EN3D 4OF5A 4MRBA 3S7GA 5F88B 1NLDL 4HC1H 4Q97A 3QUYA 4PSPA 1WA0X 2VMCA 4KNUA 3VXTA 1XF4B 4N5UA 2V9RA 2Z1PA 2X9YA 1SY6A 3GSOA 3VFWA 1BCIA 3ATAA 4XNZB 4Y19B 1VSCA 1B0GA 1MFCL 2AXJA 2XWRA 3VXSE 3CZUB 1IC0A 5HHOD 2ZKWA 4O02H 3T8XB 1IVTA 2BW4A 4KXBA 1J18A 3VDAA 5I8KL 2G4GA 1MJ8L 3QFJA 3S3JA 3L1OL 3TJHC 1I7ZA 3QYMA 2BNQA 4RMUA 4JG1L 3QWRD 4Z77A 3VXUA 1C7TA 3CQFA 3IMWA 2WGNB 3Q1SL 1B0RB 3L3OC 4AJYV 5GGRB 4K8RD 2Y6SD 3VFOA 3KGTA 4QD2E 2WINB 3MJ8A 4PS3A 3THMH 3VGDA 4F57H 2IAND 4XGZA 3QZPA 4WWNA 2N7BA 3KYMB 2R4SH 4KUCD 4RGMC 4K07A 2APSA 3U7WH 1LO0L 3IGLA 4JKLA 2VDPB 4F5CA 1FZMB 4WU7B 4EEEA 3W39B 2B3IA 1NMAL 3IFPA 4OLZL 2EUXA 5E0QA 3GMOB 1JNLL 4G8GB 4JFDD 3H3PH 3QJQB 3KAAA 1YYLH 3HC3H 2F53D 5EN3A 4C57C 1HCZA 1PY0A 3SDXF 3MCLH 1IBZA 3PP3K 4WY7L 4A66A 4Q56A 4QCIB 5IVNA 3AREC 4Y4FC 1AS7A 4K3GA 2BCKB 2CKBL 4GW4A 4NCC1 5L2JB 4GMSL 4B41A 4B97A 1Q0XH 3LQAC 3FTVA 4AIEA 1GMIA 2JCWA 2WQWA 2Y7OA 1ECZA 3VNZA 5IMLA 4DKAA 4Y9EA 2LT9A 2GITB 2IOIA 1RUQL 2Z7UA 3KL3A 1CDYA 1GHFH 2DQDH 2J2ZB 1PGRB 1J0HA 3IXTB 3OLEA 4DCQB 3CCHB 4KK9C 3D5OF 3GI9H 4B95C 2P3YA 5DS8A 3FCSB 1NCTA 5D1XC 5FF6B 3WUWA 1KCSL 4LF3A 4F7TA 2VLRD 1KTCA 4PRHE 4M93C 3WMSA 4FQQA 5J12C 3KPSB 4LASH 2MCMA 4PJHB 1YMMB 1DVZA 5DJZA 4GIOA 1EV2E 4L8SC 2FX7L 1E30A 3ARTA 1CFQB 1AQHA 1UKTA 4KKLD 3QNYA 4UQ3A 5AKVA 4AIXA 3B9KC 2XG5B 2DKMA 2QKIA 1M3IA 2E6QA 1IC4L 2NYKA 4NBXB 3EYOB 4URTB 1AZRA 4ZMQA 1BWWA 1WC7B 3GINA 4PRPA 3WI9A 3KBEA 1CXKA 3DMMB 1IRAY 1ZY9A 2ADJB 3C6EA 1EUUA 2AJSL 2WUCH 1KGIA 1GW6A 3MV7B 3GNML 3NCYS 4YHLL 4WIQA 3A23A 1E43A 1EJOH 5IVOA 4MKTA 3VI4A 1I1AA 3AUWB 3CX5J 5EIIG 1S5IH 1ZMYA 3PNWB 5C0IA 4X98A 5DFTA 5FA3B 1QD0A 1P6WA 2ZYRA 1GPOH 2FEJA 1IAMA 1AANA 4RH4A 2X41A 5E2UL 2BSBA 3OR6B 5AOIA 1H3PL 5EZJA 4O2EB 4PG2A 4HWEH 3CSGA 5EU6A 2P43B 4LCCA 4PJ7B 5I71C 1AR1D 5FB8A 4QRRB 3BVDB 2CPUA 1JZDC 5GZNC 5KVFL 4UQDA 4W6YB 5C7XH 5LQBH 2BHZA 4FTDA 4OFIA 3UTSB 1FZKB 3B9EA 3D0LA 5DUMH 5LUMA 3QDMB 4XMVA 2FEEI 2MRYA 3KM1A 5F8QC 4AZ8B 4F9LC 2C9UA 3L5XH 5DFAA 3FQTA 4P2QB 2X4TB 2VSKB 4UT6L 1B3JA 4N2HA 5IMMA 3WIIL 1V10A 3BWUF 5LBSA 3NN8B 2IG2H 4NJAL 4ABVA 3MLRL 3FUKA 4XT1C 2YXWA 4HIHA 1M2VB 1Q94A 5TH2B 1E9PB 5IV2A 3W0WB 4RNRA 4DP7X 5BV7L 4BH8A 4PRIE 4L8DA 4DKDC 4LMQI 1SNRA 5IHUH 4W81A 2FYYB 2K8QA 3PHSA 1RHFA 3IJ7A 2K45A 1XH1A 1PPIA 2IALA 4MHHI 3DETC 1A7BA 3NCXA 3Q2CA 1WZMA 3APDA 2ZIDA 4GG6B 1M9WA 3MCKA 4PM1A 4ZUTA 3SDDB 2W8CA 2PKDA 2G75A 3DYPA 4F15B 2C7UA 4GW1B 3VD2A 1U91B 2OCFD 3SE9H 1CXEA 2W9EH 1KZYA 3IJYB 2TSAA 3UTPE 1LP9B 3NFSL 3ABLB 4G6AD 3EH2A 5J6HA 2B4CL 3S9DB 4LSTL 5AFAA 2GABA 3CTTA 4GQ9H 1GSMA 4J3TA 4XC3H 3QEQD 2UY6B 4OIBA 1QUNB 3STZA 1WBXB 4E41B 5C0EB 1KCKA 2JJTA 2BH0A 4ONGL 3VGEA 2GK2A 4QXUH 3SDXA 5FYLD 4F7EB 4NUJB 1JZ6A 3ISWA 4GRLB 5EOTA 5IZ7A 2IBZX 3G04B 1IFGA 4LBEB 4IU3A 2IFGA 3FHAA 4BK8A 3FRUA 2WMPA 4HS3B 4JG5A 5ABAA 3QEHA 4MRCA 4TUJB 5EBMA 1JI2A 4H40A 3D39D 2BZ7A 1QSEB 1R3HB 5DA0B 2N1KA 2EH8L 3PL6D 3WY2A 43CAA 2C4FT 4QT5A 3A6OA 3H0TA 3Q06A 4F8QA 4H0GA 1OB1B 4IRSD 1XR8B 1S7TA 4H0IA 2R56H 3U2IA 2DYPA 5A6IA 3JWDC 2D2CC 3P3TA 3QK0A 1NCGA 2P47B 3KNBB 5DZVA 1T83A 1JXFA 4JAMA 4OLUH 4JJHA 2Q86A 2A1WL 1PYWB 3VSTA 4IMKC 4R2GC 3DGGA 4L0ZA 2WJ5A 2B20A 4G42B 3P9MA 3CXDL 1MWAA 5I8EB 1E67A 4OVUA 3D3VA 3QG7L 4HMCA 4BWTA 4AM0A 5A2KH 3HS8A 3SPHA 4FYTA 4X4MA 5L7XH 4IBSA 2HN7B 2ENSA 2DQFB 1Q1JH 3POCA 4MNHA 1N9PA 2F68X 4PJIB 3SDYH 4LDEB 1UATA 5FHAL 3L8QA 1FRGH 1P2CB 3T77B 2I25N 2YD1A 3NQIA 4QLRA 4R4NC 1YNKH 1YRKA 3I74A 2LU5A 2CO7A 3MV9B 5HYEA 1KEGH 3KG5A 4U0RB 5DRNB 4UTBA 3QUZB 3GLDA 3EYVB 5ECGA 2G9HA 1UWYA 1E5BA 1RVFH 1JAEA 1I9JH 1RZFH 3S3DB 4XNZC 3N42F 2V37A 1PG7X 5EZLB 3N1FC 4LPXA 4NQXB 4TSBL 3MO1A 4CVWA 4OB5L 3C6LB 3IJSA 4LQFL 4HCFA 4XBEL 1YG9A 5FA4B 4U3HA 1BX2A 4FQCL 4B3EA 2UY7A 2JI1A 1RZQA 3KXFD 4FQLH 3ALWA 5D9SA 4I77H 5I1DA 3TONA 4X4KA 5IBLD 3MRLA 2CGZA 4XMKL 4FFZL 4H8WH 2NY6C 3GXDA 2H1PL 3GMNB 4IEFB 3ILQC 3ZO0A 2X4OA 4TVPE 1FL5B 5HHVH 2IDFA 2H2SC 4AMKH 4HOXA 1AO7B 4W9EC 1BOGB 3ASWA 2CR6A 4XTRC 3UADA 2OJ1A 3BXNA 3FFCB 3QRGH 2KS0A 4N0RA 3H4HA 5J56B 4CA4A 1JOIA 3EOAA 3D2UA 3HG2A 2XG4B 4Z0XA 1JFQH 1AGFA 2VZUA 3U2JA 5CBEA 5IV2B 1PZSA 3FSWA 4G9DB 1BVLB 1TETH 1YEKH 5DS1A 4NC2B 2HPTA 1W0YT 3S5LA 2VLKA 4XVTH 4K7FA 5E6SB 3AQXA 2XBTA 1QAWA 4PJ9D 4PTTA 3VFNB 1T04A 5FO8A 1XGRA 2Q7AA 1BXXA 3GMPB 2NNFA 3ZKXC 4AT6A 3UP1A 1BFVH 1ZDSA 2VXVL 2X44D 1Q9WB 3GFUA 3K2UL 4L3EB 5ICZA 1NUDA 5TDOA 2JB6A 4P3CL 1EJ6A 1XF3A 1HHIB 2MQ0A 2F54A 5GS2D 3S96B 2IPUK 3WNMA 1XSOA 2BSDA 3KLQA 5I28A 3LPGA 3CHSA 1IBBA 4UIMA 4FERA 5M7QA 4DERA 4PJ5E 1ERNA 4PP2B 3D69B 4PR5B 5D1ZI 3M1BB 4QHNA 4M62L 3CLEH 3AU0A 5CNHA 4QHUA 5LNEA 1YPZB 1CFSA 3B34A 4XHJC 1BJMA 2CU9A 5I9QB 4PB0H 4G7VH 2FHCA 3RWHB 4HKZB 2ZUYA 3UZVB 1PD1A 3TS8A 1D5MA 5I0WA 3GEWB 4FQ1L 4KK8C 5I74C 3TNMB 3SKJL 3DI2B 4FQXA 2HT3D 5EPMA 1F5WA 5KJ7E 1ET7A 4NBYB 4L8CB 1EBAA 5FYJU 1L9SA 4KXDA 4PRNB 3MYJA 5GRVL 1U30A 3VFMB 5IY5B 1FG2B 3IDJA 3KMDA 1R24A 4WEEA 2CHXA 1BJ1J 1BZOA 5CBAA 3TBYB 4LLAA 3BVTA 4NZUH 3TCLA 3C08L 3S2CA 3WLWD 2EQDA 1GGBH 1JV5A 3WMQA 1D5IL 3DMMC 1ZAGA 3IDGB 3M7OA 4NZTH 3V0HA 1G9NC 5BJTA 1G9EA 1ZD6A 2G0LA 4GAAA 2ICWA 2LLGA 5TPWH 3V5HB 2B8OT 2H26B 1RU9L 5BRQA 1U8JB 5BZWB 5CJQH 4NO2A 3QXUA 4ZTEA 2DD8L 5EBGA 5D7LB 2OSWA 4BZYA 2O30A 4W4OA 1JV2A 3NT0A 5EA0L 3QPXH 1OANA 4KUZH 2BP0B 3ZDYB 1INDL 1VEOA 1J0JA 5I1HH 2WTOA 3LZPA 3FBQA 2GBUA 2IO5A 5ES4B 3WBDA 2VCOA 5HGBA 1FL6A 2YXVA 3B7YA 2JB5H 3Q3GA 3NJIA 4D9LL 2V9QA 4DZBA 1DANU 3U6RB 1YEDA 4HX1A 5TE7L 2OQJB 3E3QE 4JDEB 5BZXA 3EJQA 5MEOA 3VFTB 4OKDA 5B22A 1A5FH 4AUJA 3MI6A 4FQHA 5E08L 1OB0A 1GJWA 3QCTL 3WV0A 2XY1A 5ITFB 3FH8A 5DJDA 2LE9A 3OMZA 4M1GH 5IQ7L 4Z7QF 4CN1A 4X8JA 4AQZA 4BXVA 4GP5B 3SD5A 1QSFE 4RLDA 3GDCA 1YEFH 4F8NA 2PETA 4K23L 1X44A 4QXWA 5ISZE 1U42A 1CCZA 1FL3B 4FNSA 2R23B 4BIKA 4HOMA 1IGJA 3FQ4A 5KBKA 4HULB 5IEKA 4AY0A 1CGYA 4PJEE 4JRWA 5E70A 1WCQA 4L1BA 4C56D 3DSNB 5CILH 2HT2C 4KNSA 4ONHA 2FZ3B 1RZ8B 1BAWA 2WLYA 1YEJH 2J1ZA 3KPRE 1PMYA 4MA3A 4F7MA 3RAJL 4FTVB 2YN3A 3CPUA 2VRKA 1PCXA 3QUKB 2R59A 4I9WE 4W9DC 4YBQC 3KWUA 4C55A 1X7QA 5I16A 5EEWA 1C9SA 5JW5B 5IBTH 2WWKO 3DX3A 3LKQA 1CGUA 1G7LB 4PVMA 2VDQL 3SDDC 3UTQB 5CCJA 4MDJB 4IMLA 4LDCA 3WNKA 1YEIL 1SMAA 3FN0H 3GJEA 3M88A 2FECL 4ZUWA 1XF2A 5KYNA 5KVGH 2W9DH 5DRXA 4R5XA 4JVUA 5C09E 4PB9L 4YDLB 4F93B 1IGTB 1NAKH 4R90H 3IDMB 3V0DA 5J1AB 3VI3E 4F58L 4DAGH 1VGEL 1FGNH 2ZKXA 3QQ4A 5DLML 5SWQA 3T3MF 1CGWA 1WGVA 3GSNL 4KAQL 4H5SB 4JHWL 5H4ZA 5JDSA 4UT6A 4J1UB 1KLFA 5KSVB 1NGQL 3F05A 1T66C 2E9JA 3TX4A 1KB5B 1MEXL 2XKNB 5JA9A 3G9VA 3HVDA 4PN6A 4GRLC 4TQPA 3H6JA 4LLUB 3VFGL 4YEFA 3O2DH 4PGDA 5KVEH 2J71A 4RX4D 1T1ZB 2PTTB 2A77L 3MZGB 4FE9A 4IGBC 4HUVB 5CJOH 3BKJH 1DJIA 1QTYT 1RERA 5I76B 1OF2A 9CGTA 2VW6A 2RTTA 3L95A 3DETD 5C0DA 5KAQG 1N10A 5CIPB 5AEAA 4IOFD 4KI5F 3UCQA 1N70A 1T4WA 2Z7WA 3O3EB 3Q6GL 3FYIB 4WU5B 2QV2A 5AAWC 3WXWH 2H7WA 1PJ9A 3NTCL 1NC2B 1QLRA 2APTA 2YUWA 3LNFA 4LL9A 3MQIA 1BOYA 2UUDK 2R29L 1AQMA 4YHML 2KT6A 4JKMA 2BS9A 4G6MH 1CYXA 1RZPA 2DWXA 1AZVA 4YK4B 3BP4B 1G4MA 4Y2DC 4MAZA 3TO2B 1G9MC 3TEXA 4ADJA 2KZKA 5E5UB 4D0DA 3ARDC 3JV5A 1IGFH 4DQAA 5C07D 4NP4L 2CO6B 4KZ0A 5LCVA 3ISYA 3P9LA 1BBJB 3O6MH 4I5BB 1MLBA 4N2LA 4CDGC 4RIRA 1PS3A 2KLRA 4EDWH 5A2CA 4DWHA 4Z7WE 2ZP0T 2ZD0A 3U48A 2GSIA 1UWGL 4X9GA 5EU3A 4YDJA 1A1OA 2J4WL 4QXVA 1MCJA 3BUQA 5T3ZL 3S88L 3EO9H 1HHKA 1IQDA 3B7RL 3FB6B 3QQDB 3MRDB 5EUOB 2W59A 2IV9A 4FOMA 1BG1A 2V2WA 4KRPD 3G5VB 3E38A 3OAZK 4ORGA 3QUZC 4MAYA 4XNMB 4Y2OA 1L7TL 4WGKA 2I7SA 2IIJA 3RB7A 4U1LA 4PWFA 1H5BB 4NM4L 1G7PA 4NQEA 2WGXA 1X5MA 4ACPA 2WV3A 4JFDB 5ERWA 3MJ7A 3EJSA 2Y3AA 1I9RL 3C6LC 4WEBH 5GJTH 5JXEC 1A6AB 5J6GA 3WTSA 1P7KB 5D71H 3REWA 4AGLA 5J89A 2VDLB 3BUPA 1NKOA 2WO2B 1MVFA 2CK2A 3NCJL 2HJFB 2WJ7A 4ZSOA 4ES9A 1MPAH 3N43B 2GSGB 1J86A 4FYRA 2XXGA 1I85C 3FO9A 5F7UA 3TWYA 2ZX9A 1YQVH 4P9ML 4B0MB 4NAJA 5CHNA 1CDHA 2FJSA 1RZ7L 3QFDA 4X5WB 1FGVL 3F7RA 2LVEA 1OAJA 4HYTB 3TJEH 5HPOA 3SKNA 4DN3H 3Q8EA 3FTZA 3P2TA 4HCGA 4O5LH 5INCA 3JTSB 1VAHA 1EO8H 4L1SA 4ZJ9A 1Y18A 2GJ6A 1K6QL 1QRNE 3UAJA 3H9SE 3RG1C 4PY7B 1X6NA 3MOQA 4S1SL 1QZNA 2DQGH 2XETA 3PJSA 5GPRA 1ROWA 4K7PH 1K5NA 1KC5L 5LXGH 2PXYD 3CPLA 2YSSB 3NIFB 2WIIA 2AXFA 3MLYL 1B4JH 3HI6L 3Q43A 5E2WL 4YHZL 4PYGA 5DJ6A 4Y1SA 2JVUA 4I2XE 1NAMH 3JV6A 2F6AA 4AQ1C 3ARUA 4CVXB 1TVBB 3NOIA 2DM7A 3MNVA 1FO0H 2FB4L 4UT9H 5GGQH 3MV8D 4QPEA 4FFZA 5HYQA 1ZHBB 1P4IH 1HSAA 1L0PA 2A6IA 1C08B 4XCYA 1U8IA 5MP6L 5D72L 1I1CA 1GIGL 2HFFA 2X4UA 3BISA 4Y9FA 3I50L 2NY0B 1K3IA 4JN2A 4UMGA 4WW2F 1QLEB 4G6KH 4NQVB 3B7UX 1RUPH 4GRWH 5A2LH 2P48B 3JTTA 2EYTA 2CZNA 2FWLB 3U82B 2EDRA 1C12A 3ZKND 4BRJA 1RK1B 1WH0A 5F7HA 1EX0A 1QWHA 5C0CB 1B4TA 3ZUNC 4ADIA 2GAZA 3TT1H 2C7FA 5FK9B 4DF9A 1KWGA 4JGUA 2HKFL 3FQXB 4YUEH 5AB2A 1I1FA 4Z7OF 1CE1L 1G7JB 2ZJSH 3C5XA 3RPIA 3QUML 3EDFA 1UB5B 4KGJA 1C1EL 2FQGA 2HKHL 4OSUH 4LSUH 3KEDA 4PI0A 5DC4B 4JK0D 2BMKA 2GQHA 5MENB 5FDYA 2ID5A 3V52L 4DK5A 1B4RA 4CW1B 4JFSA 4K71C 1DJSA 2KLSA 2D2OA 2O5ZH 3MRKB 3HJ0A 1UD5A 5GIRB 4E9TA 5CEXB 1O9WA 5E6IC 2CMRH 5GJSH 4WI5A 4ZUSA 4CGTA 4U1NB 2EEXA 3OHXA 2EIMB 3BVNB 3QR1A 5F0PB 2DYRB 5M95B 4RRPG 4YVUA 4P2RA 2E75C 3S34L 1U4EA 3ILDA 1T22A 1X5ZA 2DL9A 2X70A 3MPCA 2CQVA 2XN9B 1KJ2B 4WUKH 4WFFE 5T8IA 2GG1A 4KC3B 1EGJL 4MNQB 3QHZH 1ORSA 1AIFB 2F1EA 2WBJD 4OGXH 3L6FA 4MMZB 3WY1A 1CU4L 2DAVA 2BP3A 3HC4L 4KI1A 4PJCA 5CS7A 1IGIL 1S7WA 1LGVA 1WCBA 1S7XA 1ZSHA 4NKDB 2HRHA 1A3ZA 2NY5H 3RIAF 1EWHA 1JG9A 4MAUL 5IJDC 1IT9H 3MLWL 3QJXA 4XMPH 3SGKC 4AITA 3HPLA 4ZZKA 4CL7A 3CH1A 4HG4J 2GT9B 4R0LA 5C2BH 4KBPA 4G5ZH 5EFIA 3RWJA 3HMXL 4HJUA 3CFNA 4ANUA 5FKPA 1NDMB 4D7BA 5B38A 2J25A 4OD3H 5LNGA 4UQBA 5CINL 3AGWA 1XZWA 5JPNA 3N85L 1IB5A 1YN6B 4JG0L 3BAIA 4J27A 5GS0D 1XB6A 2OV0A 1CFVH 2DOCA 3CUPA 2W92A 5EIQA 4EBQH 1FIEA 3UYPB 5FDWA 5EOCL 3EGDB 2FJFB 2KZWA 4C54A 5HHOE 1OL0A 1EDQA 4LDOB 4DP4X 2HMID 1O6VA 3UBXI 3F7VB 3PL6B 3FT2A 25C8L 3O4LB 2VDKB 3OZKA 1DFBH 2XTJD 5DJ0B 5LG6A 2AABH 3V5KA 1A3LL 1J7VR 1E28A 2V6HA 1D5ZB 1DBMH 2YD6A 3EFDL 1EZSA 3GQFA 3KBHE 4XC1L 5FAAA 3BUBA 1FWXA 1AGEA 3CFIC 3NCFB 4AYFA 1ZSDB 3DWTA 4B96A 3Q01A 2IANE 1L0YA 4PVNA 2X5PA 4YHPB 3TN0B 4R7VA 4E9SA 5ADOH 2WP3T 5FM5M 4XMZA 3LKNB 3RY6A 1WFMA 4CILA 5JORB 1JDAA 3G08A 1UXMA 32C2B 4FYQA 1YA5A 3RWFB 1P4BH 3B6SA 2JCCF 4XXWC 2DWEA 4LVHB 3HUJF 2WZPA 3ZDZB 4EN2A 1DJGA 5A7EA 1UH3A 4XH2A 4BRVA 1MCCA 2A7BA 2F53E 4HPOL 3PQYA 1MZYA 1UC6A 3CFBA 3P4NA 4ZFFA 3KWVA 1G94A 2HVKA 2Y6TE 3FT4B 5DEFB 4HIPA 4KHTH 1XB3A 3GSXB 3JV4A 3W11D 2WUBL 4CMMB 2LTQB 3ZU8A 2R27A 3STLB 4PJGB 2GFBA 3SCMA 4NX0A 2C3XA 2GK0B 3MACL 2ZCLH 4WW2A 2ROXA 1TZHA 2L7JA 3H8NA 2Z91A 4PH8A 3VNYA 4PVBA 1A7QH 3S3SA 1I8LC 4YK4C 2YD3A 3ZRCC 1JK8A 1G6RL 2VSCA 4TSAH 3D30A 4M5YL 5CXPA 2N56A 3GSNA 3QQ9C 3JXAA 4NN7C 2R1YB 3RHWF 3EG9A 5E6RB 3AADB 4PV9A 3KXFB 4YC2B 2VLRE 1XGPA 4HH9B 2X4PA 1CD9B 4Y8AA 3QNXB 3LN4A 1T03L 4L48A 3AS2A 1P9MC 3PG2A 4HP5A 2BIIA 4P2YA 5K9JH 2MPAL 3M7FB 1JPFB 2DQJL 4LB8A 3WUWG 5KJRH 4NUGH 2PPCA 2GEEA 2A0LD 4ZXBD 2V2TB 2PYFA 1HL4A 2JQMA 4JFFD 2ZUXA 3FN9A 4WCYH 4JCLA 1QA9A 3SPVA 3RWEB 1DEEB 1SVZA 1H5BC 3FQNA 3FF8A 1BW8A 4JDVA 3TBBA 4A7VA 4AGQA 1ZGLP 2PCYA 3GZOA 5AVYB 2OMYA 1F3DH 1J5OL 3HAEB 1OV8A 3N2JA 4U31A 1E4WH 3WFCH 3BPOC 2R2HB 1GKOA 1SMOA 5I6PA 3VSUA 2H3NA 4Z7VE 4OVVA 3WXVL 4XRCB 3SE4A 2EH7H 2WSPA 5C0BA 5E8EB 2VN5A 4MJ5A 4F2MB 2BW5A 3BZDA 1EEQA 4TL5A 2FGZA 5TQ2L 2AJVL 3IMVA 1OP3K 2YMTA 2YXFA 3X11A 4N3TA 3ZDXB 3HE7B 4H8QA 5C6PB 4DGVL 5HPMB 4A2LA 2AJUL 1TVHB 2I69A 1NCIA 5T1KA 3S0PA 2YXMA 3U0PA 3A4FA 2P8LA 3ARDD 3MBEA 4JUTA 4ZO8A 1E9OA 1MJJA 5KANI 4U1HA 1YNTB 1YLBB 4MNGA 4UYQA 3AGVA 1NOLA 1TMCB 1RJYB 5B7EA 2J5LB 2WLZA 2CLZB 1MY7A 2ESVB 2BSRA 3LMJH 4P3DB 5CSZA 2OK0H 3CX2A 5ICYA 4A6YA 3ZHFA 1DBJL 3QH3B 3GXFA 2BNRD 2G3MA 2NCEA 3OSVA 3JQOB 4WFED 1E5AA 1NFDE 2XHNA 3GJFK 5AOJA 5FUOL 4AKQA 2HSIA 3BP7A 1U6AH 3UIYA 2NUPB 1WBZA 3I02B 5HD8C 2EDTA 1MREH 3I6GB 3IU4H 2OJZH 1G7HA 3DHMA 3ZE1E 4C59B 4W6WB 1J8HB 3O0RH 5K5YA 5D2NE 1FV1A 4MBOA 4B50A 2ZYHA 4FL4B 4K0OA 1U4FA 2X2YA 3L7EA 5DFWH 4ZO6A 3FSOA 3MODH 2PCPB 3LY6A 4W9JC 1ZTMA 2VW4A 5IGXH 3EJZD 2DIJA 4MJJA 1F1DA 1N0LB 4XWGL 3RE0A 5EF1A 1AIZA 2Y69B 5HGHA 5GGSY 3LEXA 4P0DA 5SWZE 4PW3A 4WI6A 4KQ4L 1V05A 3TOPA 2FIKA 5D5MB 3CZJA 5ANMA 5L8LB 4NWUL 1TKWB 2OI9B 3D4CA 5FUZL 5A6LA 1RZGA 4BK5C 1H9DA 3VG0H 3MOAL 1V55B 1XHHA 2Q1EA 1Q72H 3BCDA 4HHWA 2FHFA 3N9GL 1YN7B 5KZCD 1AXTH 2XWJB 4Y5YB 3VMNA 4QRPA 4RMVA 4FXTA 2OFQA 2A2QT 4Y5VA 3QEQE 4P5RA 4UM9D 1TZIA 3VXRE 5LG1A 3VVVA 1I3VA 3BFWA 3U0TA 2GTQA 2JCCA 3HUJA 1DVUA 1MJ8H 2CDEB 2VZSA 5CFHA 5G4NA 4JG1H 4XNDA 1C8PA 4OIFA 5IK3B 3VFVA 3DX7A 4FNRA 3Q1SH 3IMBA 2VMEA 1D5XA 1A4JA 3FKUS 4U7KA 1PSKL 4NXKA 5CEYB 5HYFA 4PLNC 3K71B 1KN2H 2C9RA 1RPUA 3MLSL 4GI9A 2JJVA 4ABQA 2IDUA 1FNLA 1CC3A 2Q6WB 3MJ9H 2H6PB 4LOVA 4IKJA 4RBPH 1OWRM 3PJNA 3D39E 2ZUQC 3V0GA 4QUOA 1A22B 3VWJA 5I0VA 1B9KA 4OLZH 4YFDB 1NC4D 3O3BB 1A7RL 1U58A 4IBWA 4NQCE 4N3UA 1FA4A 4KOBA 4G8IB 5EU5B 1KPVA 3NESA 2UWEF 4WY7H 1JS4A 5I1AA 1QBAA 4F2FA 1MCDA 3KJ6H 4L3AA 5BNXD 4F27A 4HIJA 4HS8H 5CEZD 3N41F 1ZHLB 2RQEA 1K85A 2Z31B 3K74B 3AB0C 3DVGB 4B9IA 1K5WA 2P5PA 2WC7A 5L2KA 5TF1H 1WFUA 4OAWA 4B9CA 1YNLL 3MUJA 3BH9A 5IT2H 4JANB 4U6XB 1R33A 1KBKA 1UTDA 4JRFA 1S9VB 5G5DB 3PDDA 3MRCB 2D31A 3QUMA 2AZUA 4M29A 3IJHB 3M8OL 4FHBD 5T3XD 1F4XH 3BO8B 3WEXA 2EZ0C 2W91A 4NOFA 5DLLA 3TBCA 3U9PH 2GJJA 4PJGE 3OM3B 1MFAH 2OK0L 3A6CL 2FX7H 4M6NH 3LVEA 5F7EH 1U8CA 1JRHL 1KOAA 1U33A 1I8MB 4FG6C 2WXNA 4I88A 4L4VD 5HP5A 4RMSA 4KJWC 2YK1H 3QO1A 1RMFL 2EDWA 3LKPB 4MCZB 3GSQB 5JOEA 1GOGA 4PJDF 3SZ6A 1BZ7B 1T1XB 1M71A 4FKEA 3GNMH 1DBBL 2Y36L 5DVPA 4Q8BA 1KTBA 2NY7L 1DLHA 4YHLH 5C3IA 1YAIA 4U1IA 2QVMA 1KB9J 1FNAA 3BIAX 3WYRA 3KLHC 1FBIH 1LNUB 4HIIA 5DMKB 4AQEB 3TV3H 4TXVB 4PJ6A 2X89A 2ZNWA 3MRGB 3GC3A 1BQSA 1GAFL 5E2UH 3WTUA 1AI1H 4YHNB 4UDUA 4OJDH 4W6XB 1NM4A 3VX1A 2YBGA 1ZLSH 1TU2B 5KVFH 4XP5L 5I1JL 4JRXA 3FTXA 1EJ8A 1FIGL 4IKNA 3HMXA 5KYUB 3BP5B 2C1OA 1QI5A 2J6WA 2ZQKA 3PWJA 3QEGL 2Y22A 3UDWC 4ADGA 3PDGA 43C9B 4Q4EA 3L17A 4ETQA 4PGJA 5DMIH 3TASA 3S5LG 1UJ3A 5I0YA 1UD2A 2LTQC 1KJVB 4M7JL 4WZ9A 3K1DA 1OSZA 4KRPB 5AW0B 3S3PA 2JKJA 4YIQB 4G8EA 3G6JE 4X4XA 3VD1A 3VD7A 1BZ9A 5KN5A 2AQSA 3JWOL 3MRNA 4P59L 2EDLA 3MBXH 1LL1A 3BZFB 5F3HB 2ZUVA 3V6OE 3LN5B 1ZTXH 5DJ8B 5AW8B 1O6SB 2CUIA 1AGBB 2EDMA 3HRZA 1O9VA 2F5AL 5H37A 5L4IA 3IFOA 1OPOA 1I1YA 4Q9QH 4HUKB 4UTAL 2AXWA 4YDZA 2R4RL 4Z7AA 3Q2LA 2A9NH 4OKVB 4YC2C 4DP1X 3CFCL 4D8PA 4NHUB 5BUGA 1IKFH 1PZAA 4L1LA 5BVJA 2XT1B 4BINA 1F45A 2YGPA 3TN0A 4HXBL 5JIIA 3WHXA 4JCMA 5IMOA 2WSDA 4NGHH 5I5RA 4YDKL 3T4YA 2AHIA 5E8PB 2JXMA 3LYRA 4GIAA 4PD4J 1KBBA 2HVJB 1QI4A 3ARSA 2J8UB 1DSFH 3ZE0F 3DIFB 4R4BA 3GUTA 3T1WA 2V5MA 4L9LB 4Z0BL 3U6XA 4PJAF 1KGJA 4YXLH 1Q8MA 4GSRA 4EI5B 4LO9A 2X6CA 4JJ5B 4YGVB 4I18A 3OBAA 4AV5A 2UWEA 4S1RL 3SPCA 2QPSA 1W72B 1HQRB 3QA3A 3TIDA 1UM5L 3H56A 3UJIL 1MRDL 5IQOA 1NBYA 1U8NB 1DO6A 3IN0A 5TGBB 5GRUL 1UB6B 3NEOA 4UQ2A 4K3JH 1GRWA 2HT4D 3K5RA 4LLYA 2P9RA 2I9TB 1MIMH 1RZJC 3HE7C 4RCAA 1I7RB 3K4AA 2BX5A 4P06A 2PXYB 1G6RA 1QQDA 5D70H 4HMEA 3ULVC 1KIQB 4GAGL 1D6VH 2NTSP 3IDYB 3ZTJG 2ZOUA 3MGOB 5D1XE 4XWOC 3ILPA 1TQUA 4IIZA 3DC0A 3L9BA 1N5AB 3LH2H 4MA8L 2J5LC 3U6XS 3CFTA 3MV8B 4JFEA 1J48A 3BDXA 2IFFH 4X6BB 3T0ED 4E9QA 5INDA 5ILTH 1VKXA 3EF4A 1KBWA 5IEHA 4OLVH 5LKNA 4JO2H 2YEVB 2XVLA 2K4WA 1X5YA 2BPBA 4N8VA 1DCLA 4WTWA 4IBQA 1QYGH 1KN4L 4LSQH 4NQDE 4NPYB 5DR5L 4NHCH 3ULUD 1OSPH 4CBPA 3H7BA 4Z76B 1E7VA 3VD5A 2WLJA 3CVBA 4UDTA 4C56E 1MFEH 2OZ4L 3S48A 2CIIB 3KYNA 3GD1C 1OGAD 4WGWB 5E8NB 1C5DA 4N68A 3GRWH 4PGCA 4PJDA 4YDVA 4G1MB 1J9QA 3GI8L 1GVIA 1SEQL 1I4FA 4OD1H 4PLKD 2DN7A 3CHXA 3IGAB 4KDVA 2XZAH 4U2ZA 4Y5XB 5D2LE 5GGVL 1KGWA 2G2RB 2A73B 5IVXB 1I3GL 2KZ1B 1MVYA 1G7IA 3IF1B 2UZYB 2JJWA 2YA1A 1CG9A 2YMXH 2V3DA 1XSIA 3AWEA 1JZ2A 5IMKA 3FCUB 3EJRA 3KEHA 3PREA 4QWWC 2G9KA 3VXTB 3PWVA 2VDOB 3QDGE 3BZEA 3CH8A 1E50A 2OMZB 5J9PA 1QLFB 5CWSB 1NA8A 4KDTA 3VFWB 3RWCA 3PGCB 4NNPH 1IKNC 1N8OE 2DTMH 4KO9A 4OB5H 4TNEA 1B0GB 4WUUD 2UX7A 4LQFH 2XNAA 4ZX4A 2XFXB 3MZTA 1TO5A 5FO9B 2VXSL 3GS4A 1EHKB 3HG1E 2XXFA 4Y1AD 2WHVA 1OHQA 3LQMA 3PABA 1KPUA 2PLTA 4XMKH 1ZS8B 1I7ZB 4OZIE 3ZQ9A 2D7OA 3OMNB 3DTXA 1CD1A 4RMRA 1XCWA 3VXUB 1MCFA 2UX6A 4Z77B 2ENQA 2PP8A 5DD1L 2VQUA 5HGDA 2VISA 1QP1A 2UV3A 3VFOB 4NSKA 5E2VL 2PWHA 1K3ZA 3MJ8B 4WDIA 4XNXH 4Y0GA 4XGZB 4KKAC 5LAPA 3VX0A 1YEGH 3RUGE 4GUQA 4LLWA 1IU1A 1OTUC 1JN6A 4LLDA 5KS9E 2FSDA 4XXCA 1FJ1B 5E4OA 5JIHA 2P49B 3RL2B 1XCTA 5I6KA 4JGMA 3TXAA 3IFPB 4GRMA 3EFFB 2OZNA 3D4GA 5T1LA 1GKEA 1MIEH 1SN5A 4BA0A 2VXVH 4F8TA 2BVUA 3R19A 2VRAA 4KTGA 1IGYA 2RIKA 4G6FB 5D7HA 5F3FA 1N0XL 3KH3A 4J8RA 3KBFA 5SWSE 2Z31C 3GUFA 4GW4B 4BHUI 1ETZB 4Y16A 1J8RA 5C07E 1A6UH 1F8TL 1MRFL 4HJGA 4M6AA 5DHMC 4U7MA 3VXQA 5I30H 1BQUA 2QHLA 3BUYA 1TYJA 5T1MB 2OSXA 2QBWA 2XTJB 3OJDA 3QNZA 3U36A 4NN6C 3ZRFC 4PJAA 5CKAA 3I9GL 2FLRT 3EO1A 4A2MA 1INEL 1Q38A 3FHQA 4PJXE 1CWVA 2K9UA 3WIFA 3A21A 5IG7A 3U0WH 3SKJH 1MQ8A 1JNHA 2IH9A 1CICD 2J1WA 5DK0A 2H1XA 4LF3B 2B08A 1KYAA 2UXTA 3MRJA 1SUHA 2W88A 2X0WA 3FU0A 1MCHA 4FQQB 4X4YA 5B1JC 5DJZB 5BVPH 1E8XA 5EZIL 3NJGA 1P4UA 3LPWA 3QNYB 4S1DC 2P46B 2QKIB 1LQBC 5FWQA 5IWLC 4AYSA 4C8XA 4PRPB 4XVJL 4M1DH 2A9DA 2I60L 5TQ0H 4NM8H 2IPTL 1RY7B 2NY1C 3CVCA 2Z92A 3TWCL 3V8CA 3L4YA 4N20A 4YDNA 1RU9H 4O4YL 1DQLL 2ZKMX 4RWYH 2DD8H 2O26U 3V79C 2NQDA 1I1AB 3VI4B 3PWPA 5DURD 4ZBJA 5C0IB 2M26A 3DSFL 4X98B 1LEIA 2EABA 4X6DE 2OR9H 3MRFA 3ROLA 4K3DH 3GO1H 4ODHL 5ALBH 2WB7A 1RI8A 2L7EA 5E4EB 2QLVB 2W80C 3BAEL 4YX2L 5MHSD 4WJKB 4D9LH 2VITA 2WAQA 2Y7SA 1KXVC 2I7OA 4JZJA 1DQDL 1GY1A 3LPFA 2Z4QA 4HWZA 5ENWB 1YMHA 4R9HA 4WO0A 2VAAA 3OPZL 4IRZL 4XOBA 4Z8FL 2EZ0D 4JN1H 3BRGC 2OR8A 3D0LB 2WBKA 5DD5L 4AYID 1KZQA 2XX1A 2WY3B 5I2IA 1WO2A 4A63A 1NIAA 3O9WA 3MA9H 4R4FL 1A6TA 5IMMB 1BQKA 4FXKA 4K23H 4KJWD 2YJLA 1H0DA 4HIHB 1Q94B 2CG9X 3AQYA 3L9YA 4K7PX 1J0IA 1QWUA 1A9BA 3BWAB 4H2CA 4RNRB 4BH8B 2ZWLT 1P7QD 1C7SA 2V17L 1N3NB 4L8DB 5TTRA 4JZNA 1QABA 2IWFA 3WNNA 1AD0A 2VC2H 4Q9RL 4WHDA 1E5ZA 1PDKB 1JHLL 4ZW7A 1KYUA 5LHDA 1KIUA 3NJKA 2IALB 1RFDL 3CVHA 3TVMA 1S7QA 2RBLA 4KJQC 1BZDA 3OJ2C 1ROCA 2AANA 3T3PE 3L9RA 4S1QH 4D7PA 1R3KA 1SJEA 3T6VA 3MCKB 4LSVL 2OTUB 2QPUA 3NA4A 4FI6A 4ZUTB 4Q9BA 5JR1L 1NGPH 2G75B 3VB8A 2VDPL 3IEAA 3QIBD 3QULA 1OM9A 4UZSA 4GKLA 3EOTH 1RUML 4PB9H 3FSAA 4QYOA 3KHQA 1A7OL 2R1WA 4XCEA 1UASA 3U2SA 1PZCA 2B9AA 3FL7A 2D8KA 4UIKL 4OFDA 2V9UA 3BYTA 4Y89A 4AV0A 2F8XC 1WA2X 3SJVE 4HKXB 3I75A 4JHWH 4EI5C 4PTUA 3STZB 4RDQF 4AC4A 1OD7A 4PV8A 1V7ML 3HJEA 3SDXB 7FABL 3QQXA 4MB4A 1XMWA 2R39A 2BS8A 2VQTA 5EOTB 5K9OA 3B1TA 4HMDA 4IU3B 4OGZA 4JKPL 3FCTA 3APNA 5DHVA 4PRAA 1QW9A 5AOLA 3HNVH 3CSBA 3FRUB 4XODA 5D8JL 5I1KL 3L45A 4ODBD 3D0VA 4UTAA 2B2XL 3QEHB 4TTDC 5GRZA 4W9KC 4Y4KA 2EVGA 5EBMB 3HLAB 1NQBA 2GIXA 5TF0A 3MUGA 2E8YA 2GTZB 1H19A 4IRJA 4ZPVB 1OGSA 3AABA 2Q3AA 5GRWA 1GGCH 2ZX8A 1QNZL 1KJMA 4B0MM 4QT5B 3NJJA 3H0TB 4TVPL 2HUHA 3NTCH 1DUZB 1B6UA 1RK0A 1XDTT 3C8DA 1S7TB 1QO3A 2AV7A 4UQ9A 4ERSL 5I0XA 3L2MA 2DYPB 2QSTA 4TNVK 2R29H 2EEDA 1DYZA 2C34A 4GKOA 1CE6A 4FFWC 4G43B 2APVA 4JFQA 4NI3A 2P28B 2Q86B 2NR6C 3DGGB 3DOHA 1VFBA 4NYLB 4UM9B 3P9MB 4JMNA 1MWAB 1FFOA 1OE3A 4Y8DC 3D3VB 4YSSA 4AM0B 3LZFL 3R1GL 3QJVB 2WZ0A 3VD3A 1GSKA 3HB3B 5IQNA 2CAKA 4MNHB 3NDYE 2CXGA 2J4WH 2P5WD 4RISL 3RVXC 1IMHC 4AQ8A 3TNNA 1OAXL 4N87A 4TN9A 3VXSA 4GSQA 1S7RB 2CO7B 3O3DA 5B38G 3QUYC 5I1IH 5L88H 4K5NA 1P4LA 1LO3H 3SCMD 3FQWA 4KO6A 2ATPA 3UPRA 1EHAA 1F18A 4HJTA 2BVPA 2G9HB 4U05A 3CZLA 4Y88A 1A6ZA 1WT5A 1A0QL 1OCWH 2XOTA 1I9RH 4DQOL 2QGBA 4OGYL 3MO1B 1SOXA 3IJSB 4FG0A 1UADC 1Y6NR 1BX2B 4KK5C 2UY7B 2FRGP 3HZYA 4LL4A 1P1ZA 3KLDA 2FO4A 4TS6A 3DV4A 5CLXA 5D9SB 5I1DB 3DYOA 3UP6A 2Q20A 3U4BL 3II1A 1D5BA 5ACLA 2XX0A 1Z7JA 4XO4A 2WK2A 3RTLA 1XB8A 2X4OB 2Y23A 3O3AB 4J2XA 5AYQA 2OZ4A 3NJNA 3HPJA 3ZBMA 2PO6C 1PVHA 5SX4H 1T4KB 1ETJA 3A5VA 2ZWNA 1BVKA 4K3EH 2MHAB 3A0OA 3X3GH 2ED6A 3BXNB 1RZ7H 3SPGA 1QR1A 1UACL 1KIRA 1RZKL 3D2UB 3EOAB 5DEJA 4Z0XB 2N0MA 2ORBH 2XIIA 1AGFB 3A47A 5CBEB 1MHPH 3DUUB 4JFXB 4YSOA 1S9WA 3UYOD 3GMQB 1TJGL 1H8LA 1U3HD 2VLKB 3S5LB 4HBCL 1JYNA 2X6BA 4PTTB 1GOFA 5FO2A 1T04B 5FO8B 4M61A 1XGRB 2E7HA 4AT6B 3NIDE 5C1MB 4DN4L 1YJDL 4L4VB 2NLJA 2JB6B 3V4VL 3VMPA 1XF3B 2QQNL 1MNUH 2F58H 2F54B 2VZTA 4JO1H 2GC7C 4WTZA 5DCCA 3MLYH 5E2WH 3CQPA 4ZD3L 3BYYA 1BAFH 3U1PA 2IDTA 3GM0A 4Q7DA 2P5ED 2O6DA 4K2UH 2J1YA 4PRHA 4XO5A 5DZNA 4QHUB 1CFSB 3G7TA 2BM3A 4LRNL 5I1CL 1AE6L 2HP4A 4G2AA 2MIZA 2N3JA 3CDGB 5EIVA 5D72H 1GIGH 2DMBA 5I1EL 2OP4H 3DECA 3C87A 4BFRA 3PP4H 1D5MB 3LKOA 1A2YA 2JK5A 2EEFA 2FBJL 4JFFE 4FQXB 4P5TD 5F3BB 3M6DA 4ELME 2ZOKB 3QORA 3RVWD 3RDTD 2ZG3A 4LHJB 1IILE 4U1KA 3MYJB 5JOFB 1CVRA 1GZHA 2YA0A 3NP4A 1O75A 1R24B 1HYRC 3V8OA 5CBAB 1NPJA 3LKRA 1O5PA 3DHUA 4HALA 5HVFB 1VACB 4NCDA 1F86A 1B88A 3ML8A 4E0RA 3ZY7A 1JV5B 5GRYA 2OXGA 2VRQA 3WIHH 1AYOA 2RAMA 1DP0A 1PQZA 1KCUH 2HKHH 1O7SA 2ICWB 3GMLB 3ZTEA 3TESA 4CN4A 3OR7A 3HNSL 1ZGLA 4NO2B 1S5HA 2BOLA 4WEMB 4WJG3 1WYJA 4GSXA 1W16A 1MELA 1D7FA 2JLPA 3PHOB 1JV2B 1BD2A 1X5XA 4ZUVB 1R5VA 2EYSA 1T7YA 2H6UA 4TL4A 3V9CA 3TFKD 3GLZA 5FLVA 2YLKA 1IM9A 4PG2C 3NDZE 4XPGH 4LCCC 4YHOL 2ZOLA 1ZLUH 2E56A 4P9HH 1FL6B 3Q48A 2V3EA 1ET5A 3ERXA 4DZBB 2Q76A 2BNRE 4GEIA 4WFEE 3SKOA 4HX1B