4YL9A

Crystal structure of wild-type of hsp14.1 from sulfolobus solfatataricus p2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
MNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAGFNKDKISVRLSAQNELIINAEREIQYIGTKYATQRPLKIHKVIRLPVKVKRDSQVTAKYENGVLTIRIPVEGSVSIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Heat shock protein Hsp20
publication title Active-State Structures of a Small Heat-Shock Protein Revealed a Molecular Switch for Chaperone Function
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain 98/2)
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4yl9A00
4YDZA 5DS2A 2WJ7A 3L1EA 2O30A 3AABA 2Y1YA 5DS1A 3N3EA 3GUFA 3VQMA 2BOLA 2N3JA 1X5MA 3Q9PA 1GMEA 4MJHA 2CR0A 4FEIA 2Y22A 3AACA 3QORB 2CG9X 4PCKA 3Q9QA 4YLCA 3IGFA 3QORC 4RZKA 1RL1A 4JUTA 1WGVA 2Y1ZA 4ELDA 4PBDA 2KMWA 2XCMC 1WH0A 4ZJ9A 3W1ZA 1SHSA 3L1FA 1WFIA 3VQLA 2WJ5A 3QORD 4M5SA 3GLAA 3L1GA 4YE0A 4YLBA 2KLRA 4I88A 4M5TA 4YL9A 2K8QA 2MNWA 2N0KA 1EJFA 5LUMA 3GT6A 3EUDA 3QORA 2JKIS 3J07A 2RH0A 4JUSA
chains in the Genus database with same CATH superfamily
4G43B 3F12A 1SXSA 3WIHA 1QATA 3RL1B 5HPMB 5IM7A 1L9NA 3NCWA 1BVKA 3DSNA 3JWDL 4HXAL 4QO1B 4S11A 4LZKA 3REWA 1OTSD 2VC2B 4LL9A 5J0BA 2FQGA 2KHAA 2F7OA 1WYJA 3FQUA 4PHXA 1MY7A 3FO2B 4LSUL 1ZANL 3ORJA 1UYWL 2BNQE 1BZ8A 1DDTA 1MFUA 1RU9L 1EEYA 1A6ZB 3FO9A 3HKZA 4QYOA 5AW7B 3CVIH 2DQDL 2ADFL 2C7FA 4XMTA 3SD5A 4H0LC 2BMKB 1J0KA 1O5DT 1QFUH 3HB3C 2BOCB 1ZIBA 3EFFB 3W56A 1AE6H 3N40P 5D1ZA 1DSWA 1U3HA 3OR6A 1KY7A 5JHAA 3KPNB 3WMPA 4PCYA 2V3DA 3UZEC 1K8IB 4IS6A 1QTPA 4HUMB 3MAWA 4N0FA 4X0NA 1AZNA 4X4YB 4ZPTA 2WSKA 2DH3A 5GSRB 4UILH 3RVTD 2HRGA 1U4FA 1Y7VA 2FVNA 2WJ5A 1PU0A 4LVEA 4WFED 3RWDA 3WS6A 4BRJA 2FTAA 1NIBA 1QUPA 4KRPB 3MFFA 4Q4IA 5DMIH 1MFBL 4BBWA 2EAEA 2ZKWA 3EXJA 4NYLA 1X5AA 3C2AL 2X7LB 1UKSA 4M3KB 4WO0A 2H3NA 1IM3B 1VEPA 3FNKA 3DRTB 4P23D 2MCAA 1TENA 3K8LA 3LZQA 3WIAA 4BXVA 3FFCB 4JS7A 5ANHA 1W8NA 2UYLB 1BQUA 3U0TA 4BSVB 5FO9B 5E2UH 2VN3A 4M6OL 4K5PA 3KHOA 2GSIB 1H0DB 4QTHB 3SCMA 4X0KB 1ACCA 5L6YL 2NPLX 1ICTA 3OX8A 1OAKH 4QAMB 4TTDD 2N7AA 5TFSL 4WKXA 1EAOA 5H35A 4IBUA 3SQBB 2APFA 2OCJA 2OMUA 3PDDA 1Y18B 3NIGE 3A4DA 3F6LA 1XCTB 1G0XA 3MR9B 5AWNH 4OZIA 1THCA 1JXGA 4Z3EA 4P5SA 3MRPB 3GSVA 1PLGH 4DP9X 2QADD 1P5UA 4JBSA 2IH3A 1CD1A 1QKZH 3HFMH 4PJCA 5JOFA 2DTMH 1FJ1A 1ZE3H 4RRPG 3PJLA 4D8OA 1K4DA 1IEAB 1KIUA 4QHKI 2KZBA 2HT4C 4YDKH 3U6XA 4KUZH 3AVEA 4Z7IA 3B9KA 4M4PA 2B9BA 2EC8A 4W6WB 2M2DA 1G6RL 3SDDB 2VLRB 1E8XA 4HAGA 4LB8A 4LLQB 3D3VB 1P84J 4PJEA 5FKAB 1LNUA 4PWFA 3EGSB 1XB6A 4LDOB 5FYKH 4QXWA 4IJTA 3IJHA 4YSPA 4N0UA 4QRSB 3GM0A 3WS3A 2FRGP 4KDWA 4B60A 3W0WD 4DN4L 2EVJA 1XIWC 3GIVA 1JZ2A 3FMGL 4HUUA 4OZFB 4KU1A 4YPJA 3CV5A 5J9PB 2DH2A 4ZMQA 5C0FA 4OAWB 4FTVB 4AENB 1AGBA 1BQRA 1YMME 4QXVA 2X4UA 2HKFH 3HS8A 3WTUA 4NRYA 4JG1L 2C9UA 4NIKB 1R34A 2R59A 4YK4B 2OMYB 1T83C 5L7XH 4LQFH 4XPHL 2C9SA 4YLBA 3LH2L 3PWJA 1XL6A 3FB5B 4LMQI 2X2YA 4GLRI 4GUQA 5I8CA 1NLBH 3IJSB 2BSRA 4HJ0C 4X9YA 2UZIH 1CFBA 3WHXA 3LRSB 4Z5RA 1J12A 2G30A 3QDMA 4ODXB 1I9JL 4JQIL 2NX5B 2PPDA 32C2A 3LEYL 3LKOB 3HHSB 1S3RA 2WBJC 2V0AA 3HS0C 1DL7L 2LLNA 5BQ7A 3VW3L 1T20B 4IKLA 3TO4D 2F8OA 5ADPH 2YMXH 4EUPG 2WM0A 2XYBA 4U6TA 1H6EA 3CDFA 3WFDH 5HBBA 3SGKC 4YXKL 1N9PA 4E41E 5F7WC 3H7LA 1I3UA 3P3UA 4XCCL 1Y07A 3HZVB 4KKBC 1OF0A 2DLTA 3BCFA 1NCBH 1N64L 1MCCA 1E4KA 1RLBA 2Y6SC 4BK5A 3L8QA 3ECWA 4FYQA 4WGKA 5AB2A 1DJZA 3N2JA 2P5EB 4FMVA 4JPKL 3U1PA 5AEAA 5GQBA 5GGVL 4AQAB 1QBMH 5DURB 5CEZD 4JFEE 3OZ9L 4RZKA 2X53A 4E9LA 1IBHA 3S9DB 4IW4C 1CN4A 5E5LA 5HHQA 1PZSA 2N1TE 3C5XA 3O41B 4JO4H 4WTWA 4XCNB 2VDQL 5ITFB 3WFEH 4AYBA 2VAAA 3MNZA 5EIQA 1EZVX 1VDGA 3JUYA 4ERSH 4H26A 1BZ7A 1BVLB 2R2HB 4ZAKA 3UXFA 4I4WB 1SYSB 1SDDB 5DHYB 1RCYA 4HG4K 3HG1A 5I66B 4XPGH 4Z7OE 4XN4A 2RA1A 3RWGA 3M17B 4JJ5A 3VGGA 5JIDA 4JM2A 4X4ZA 3NABL 3VXNA 3EO0A 2ORBH 5DZOA 5I17A 4QXUL 1UUSA 4OZIF 4RFEB 4KKAD 4ZX3A 1J48A 4LXFA 1QVOA 3CE1A 3VO0A 3NJGA 4X5RA 5CILH 3DVIA 2AJXL 1U8CA 5AKSA 3SPVA 3U2JA 5IB5B 3PLYA 1HXMA 2IQAA 1J5DA 1OGTB 2JF1A 3DMMB 4PJCF 2F53D 5SX5H 2YKLL 4PI0A 1K3ZA 1WK0A 1OW0C 2WAQA 3QB7C 5D96C 3GYRA 5AZEH 4K9EH 4UAOC 3C60B 3MZGB 2YXWA 5FDWA 3MTXA 3GC3A 3MLZL 5DC0A 5SX5K 3CFCL 3O3EB 5FO7A 4NKIH 2XXCB 1IGTB 2FJGA 4YR6A 2BDNL 3V7AE 1BPVA 2G5RA 4HMCA 1BFTA 1UH4A 1RIUH 4Q74A 3P30L 4KV5F 3WUZA 2B5IC 1NEZB 4RIRA 2WY3B 3QULA 2O5NA 5ECJE 1IE4A 3T6VA 4Z8FH 1NC2A 1J1OH 2CKBH 4U05A 1WT5A 5EUKB 2NQCA 3ESMA 4OD3H 1OTSC 5MENB 3BUIA 3FUKA 3G5XA 4JRYE 3KYKL 4U6VL 1U3ZA 4U4IA 5BPPA 5KG9B 4CADB 3E2HB 4L5FL 2BERA 2H6UA 4LK4A 5B8CA 5KW9H 4DFIA 1UXLA 3ULSA 4P5MB 1DUYA 5DRNA 1VKXA 1WGVA 3PJSA 1F00I 4OGAD 4HUXA 3I9PA 1JZFA 3MOQA 3ZYIA 5D1QE 1ZLVK 3RU8L 2P5WE 1UT9A 4Z3HA 1HXKA 5DVNA 2CRIA 1IIIA 2DOCA 3PCYA 4PWKA 5J6HA 4DJMA 4KXZI 2WLIB 5EIIG 1MIML 3IDNA 5J11B 1CI5A 1ZLUH 1GPOL 2LQRA 3RVTC 4XC3H 1TPXB 4HHGA 4JRLA 4L4VD 1KIRA 1OIOA 2X09A 3CZGA 3DOSB 3L2LA 3EYFA 1NPJA 1M56B 2C5DC 5LBSH 1Q9LB 1QSZA 4GSDH 5AW2B 4P23C 1XGYH 5HHMB 1MFCH 1G7QA 2F61A 3IJYA 2Z91B 1CDJA 1KN4H 5FUZL 1TZGL 1HEJC 4H88L 1FLTX 4AGPA 2GI0A 1JN6B 2J2ZB 4H5SB 5I0YA 5FB8A 4GG8A 5G5DB 3CU7A 3BFOA 4Y4HA 3QG6A 1YY8B 2GSMB 5JQ6L 1J0ZA 4AVKA 3IXAA 3P77A 4I5BB 4Q9RL 1SM3H 4K3DL 4KVCL 1TSRA 4R83A 4ZZKA 5IEKA 2G3NA 4JO2H 5KN5A 1CFNA 5IJKA 5G55A 5JIIA 1S8DA 1G6RB 1QSEB 1OCWH 1RJLA 2QADC 5J6SA 3X13A 4A37A 2OJZL 3DO7B 3SKOB 5I1EL 3E8UH 1OWRM 4GG6A 5D1ZI 1W6WA 4UYQA 3KYOB 5DK3A 4ZG1A 4ZS6D 1AI1H 2A4CA 3T9WA 1JXKA 4NN6C 4JKPL 1EIBA 2VABB 2NY1D 1ZLSL 1XX9C 3G6AB 2JELL 4FQHA 5C0CD 1Z5YD 1MEXH 5F6IC 1CU4L 2W65B 3JT0A 4KRMB 4X5XB 2DI8A 1QTSA 4O2EB 1ZVSA 3WFHB 1WRFA 5INCA 2Q76A 4P46C 4RDQF 4MA1C 5E1HB 1AXSB 4E9RA 4PTTA 3FQWA 3LRLA 3MYZA 3VWKD 1SN2A 3VRJA 4P9HC 4LCCB 4IHBA 2LABA 2ZF8A 1V3KA 1NDTA 4RA3A 3D50A 1MCNA 4U6HA 5BZWA 3NJIA 4LL1A 1A3QA 1WP6A 3IFOB 3T0VA 4LDEB 2ZOLB 2J8UA 2OZ4A 5F9WB 4KQ3L 5C07B 2R83A 1CFMA 1EXUB 3KPRA 4NQVA 4D9RE 4XXDB 1H3UA 4WIQA 4PJ5A 5DR5L 4YL9A 1XBRA 3VU2A 5B3JE 1FGNH 5ESVB 3U6RA 4I0PC 4BKLB 1QLEB 4X7TB 3SY0B 3X12B 2WXOA 3V52L 5FKPB 3NIDB 3L54A 4JKNA 1TTBA 4MCMA 4PG2C 4D0CB 1D6EA 1G87A 5F7HA 3E7JA 3BRGC 2AJVH 2LU4A 1GC1H 1N6UA 4KAQL 3GBLA 1RZPA 3EYQC 3V5HB 2CO7A 4HHAA 4JN2A 4DQOL 2R0WL 4IMLB 12E8L 3RB5A 4HOWA 2E27H 1XH3B 2VDQB 4NFCA 5T5FA 2LU3A 2YPLE 5FYKE 4MJ2A 2OA9A 5D72L 5F9JB 4W81A 4NI3A 2ERJC 1IAII 5E5MA 2KLSA 3C8DA 3MRRA 4HKXA 2EYRB 1YECH 1OHZA 2Z93A 2A4EA 1MVUA 4WSJA 5EOCJ 1INQA 4HOZA 1T66C 4P49A 2D03H 1P5VA 1HDMB 2XQYA 3MRMA 1DQDH 1OLLA 1HIMH 2ZP8A 1GHFH 3QRGH 3O11B 5CSZB 1NAML 1Z7JA 1W0YT 4U0RB 3G6JF 3DRQA 4OM1H 2KDYA 5TE6L 4FA7B 3QEQA 3BISA 4N9GB 4ODUA 4WU7B 3V55A 5D1XA 5DS8B 3VFTA 4FG2A 3KL0A 2DYRB 1L9PA 3RUGF 2DDQH 4OZHA 2CK2A 1RERA 3QUKB 4B5EA 3SE4C 3H3PL 4Q97A 1T1WA 2BRRL 1BMWA 4G7SB 2NLJB 2LVCA 2YKKA 4WFFE 3VXUE 4IM8A 3LS5L 5DJYB 4NQXA 4YHLH 1REIA 4YE4H 1DBBL 2Q9OA 4B95C 5BO0D 3GNML 1L5GB 1U92A 2IIJA 5E95B 1UQSB 3NCXA 3AXIA 4M8UA 5GRVL 1I8LA 2HSIA 3ARRA 1I1CA 1CXFA 4IBWA 1Q0YH 4RFNB 2XBZA 3ZZLA 1AYOA 4KJPD 5EEXA 4OZFG 1UKQA 4OLXL 2VN7A 3D2UD 1E50A 2BK8A 4K71B 3OKMB 2R4RL 5EF3A 1DVUA 2XN0A 4Z23A 3I3EA 1E67A 1UD5A 3W57A 4DKDC 4ZXBA 1AMXA 4OY9A 2VN4A 3PUCA 5T3ZH 2YPKA 3EGDA 1RSYA 1U91B 4KVNL 3FU9A 2Y3NA 4IK7A 3NFNB 4FG0A 4P2QE 4MA3A 2C3VB 3VG0L 3ULVL 1AHWA 1IEBA 3WTXA 2EECA 3CAFA 3LQZB 3VG9C 2X2UA 3Q8FA 2J8UF 2OMBA 2DPKA 2UWEE 2GBVA 1USZA 1VCBC 1AO7E 1WAEA 2V33A 3S96A 1D9KD 3RIAF 2Z34A 1NDMA 2XA3A 4MKMA 4UT6L 1GTNA 1YMHB 2FIRT 4Y9FA 5CP7B 3U4BL 1FNLA 2X2HA 1C08B 5IHBA 1WA2X 4NC2B 1K4CA 1JAEA 1IC5L 4ZNEA 3SGJA 1QRNA 2E0PA 4XP6H 5D1ZC 3H53A 3VQLA 1QR1B 1OKEA 1RHHA 1XF4A 1HI6B 4FYSA 3FTVA 4G8GE 4XB3A 5ACLA 4LSSL 1VPOH 1P4BL 5CJOH 1AFVL 3MOBH 2PXYD 2W38A 3MUJA 4QOKE 1ZTXH 2VW6A 4H0IA 2YLHA 3MVSA 3VXMB 2X4TA 3GXFA 3X1GA 5HDQL 2G3ZA 2AQSA 3WAJA 1MI5B 4JFQB 4FXGB 3V9FA 1FNHA 4OCWL 1JVLA 1XZWA 1S4IA 4MJ5B 4NI6A 4L0ZA 3EADA 4YVNA 1IQWH 3H4FA 2W91A 4EE2A 4HV8B 2X0UA 2GJPA 2Y07H 1OD9A 3STZB 3GTNA 2ED7A 5IFHL 5ICXB 1E90A 1E2ZA 1TMQA 2YGNA 4TV3A 3LHPL 2CU9A 1SJVA 2CLZB 2VDKL 5F9AC 3QEHA 3UFIA 1FIGH 2Y5TA 1TTCA 1KCRL 3EUUA 3ZGHA 5DD5L 3Q6FB 1VGEL 2HJFA 3BP4B 3KM1A 2QGCA 1G9NL 3AMLA 1HHHB 4L2LA 1WIPA 4FNSA 4UZGA 1CLYH 1ONQB 4P5TB 1U8QB 2X4RA 5CJBA 1SOQA 5E6ID 2VM3A 2MCG1 4W9GC 4U1HB 3DOIA 4Z7NF 1PNDA 3STLA 5JPNB 3BOVA 4OZHF 1F11A 3NSXA 5FO8A 3D39E 3P0YH 5DJAA 4UV7H 3MGTA 2JJTC 43C9B 5IQMA 1ZGLM 1HWGB 4CMMB 4Y5YB 2XQBH 2XACC 1F4XH 3KPQA 4J3TA 5EC1A 1LE5A 3PDOA 1KTLA 4ANUA 3FAXA 2XV0A 5I1KL 2YN5A 3HC4H 3MXVL 4FMFA 4GKZB 4MCZB 3MJ7A 4OGYH 1LO2H 3VFPA 2NY5C 3QZLA 1OLZA 3UEZA 1EMTH 1TQTA 1A9BB 4WWKD 1DQLL 1U8PB 5SX4I 3K4DA 1XH0A 2AJYH 3VWKC 3F5WA 4JFWA 1NEZG 2BP3A 2EO9A 4PGDA 3CZLA 1G1KA 1H5BC 4KMLB 2EZ0D 4YGVA 3FRUA 1R3JA 4GSRA 3FFCE 4PGEA 3CZEA 2WZAA 2DWDB 4QRTA 3ABKB 4TVPD 3O9WB 5H94A 3SBPA 2ZOOA 3FUNA 1CXKA 1KLGA 5C7XL 4I0CC 3DXAE 2ROYA 3O8XB 3FSWA 1DL7H 3TH4T 3BWAA 3KS0J 2RJMA 4K8RL 4LAQH 1EZSA 3EYVB 3FTSA 3O4LD 1KGXA 2OMTB 2QMKA 4PREB 4MASA 4GT7A 1V7NH 3G04A 3A23A 3QQDB 3VXRD 4LCUB 4XPAH 2ZICA 4JZJC 5HHOA 3MGAA 3HN3A 5J6GB 2FUQA 2AERT 3PIQA 4OV6F 5DO8A 4G9FE 4ZUWA 4M5TA 3VWJD 1XEUA 3QC5X 1S7WB 2AXFB 2NY4B 5B1JC 3QUYA 2R1WA 1I7ZA 3BP5B 4G11A 2O6DA 3KDPB 4ZW6A 3ULUF 3ZTJG 2PYEA 2WWNA 1B0GB 3M7FB 4JREB 2FLBT 1FZOB 1NAMB 3AQDA 4YPGB 5HHNB 2DEWX 3HG0A 1T5KA 3BZFB 3EFDL 3I85A 4MXVE 3QQNA 3RVVD 1UEYA 43CAB 4GIPD 4FL4C 2BXYA 3DX9B 3FDWA 4LCYA 1QMUA 5DDHB 1OAZL 2ADJB 3S3SA 3M8OL 4HSAC 1N7ML 3COOA 4FRWA 3QXWA 1RZIA 2GCYA 5BQDA 2WOBA 2A9AA 4PJ8A 4HUVA 4R0LC 4FQJL 4HIJB 2BOBA 4FLRA 3NZUA 1M4KA 1JGUH 1JV2A 3K6OA 3KNBB 1CJYA 3E6FB 4ODWA 4C8XA 3G5YA 4FNUA 5B38A 2PUQT 3FSZA 3ZDXE 3MRQA 2EYSB 3WKMH 4A6YL 3TEUA 1BHGA 1J8HE 1N0XH 5IW3A 3FHAA 3ZJAA 3MLXH 3N9GL 3SYAA 4FLQA 4ENED 2APBA 4UT7L 3WV0A 1CR9L 4QRRE 1DQMH 1L7IH 3US9A 2R8SH 2CRZA 2OW6A 1HILA 4FHBD 5JXEA 4E0RA 2EJ1A 1BGXH 4HZ1A 2H32A 4UQ9A 4XPBH 2YAQA 2BVEA 3DX3A 4G6AC 1CLOL 1MHPL 4UIMA 1BCIA 2BDNH 3C8KA 2A0LC 3DDGA 3LDBB 1E9PB 2XPYA 2JI2A 4Y1AE 5JHLH 4KY1H 5MEPA 3AADB 1U8MB 4XZ4A 2QGEA 2GUOA 1HQRA 3NAAH 1UXSB 3EDFA 4KO6A 5SWSD 5TDOA 3IN0A 4X6EA 1ET7A 4M29A 1FYTB 3MNWB 4DGYH 1LDSA 3VSVA 2K1MA 3CK0L 2VZ3A 4U1MB 5K1NA 3S3CB 4NHCH 1F86A 4Z7UA 2L8AA 3UJJH 2IEPA 1EXGA 2DQIH 2J1XA 1AGDB 4AJ0A 2HKHH 1GYUA 1SGKA 1DQJB 2XXFA 4HJSA 2OL3H 1SUJA 5CZXD 1L9TA 3N1QC 3QW9A 3HRPA 3TT3H 3QEUA 2WXQA 2XTJC 2NW2B 5D7SL 3IDYC 2A6JA 4XN7A 1MCLA 5ECGA 4DP1X 1DQVA 2CJTA 1IQDA 4YDZA 4P04A 4QAWA 4AYID 4W4OA 2PP9A 3L45A 1AQKL 2IQ9L 2ITDA 2KERA 2Q86B 3QNYB 3VFUA 4N2OA 2CMRH 3TTSA 1YEGH 5HD8D 4APXB 2N0MA 1GYVA 4X5LA 4FCAA 2VSDA 2J73A 4PV1C 1DQIA 4K7FA 2DEYX 2PXYC 1I7UA 3RNQB 4UQ2B 4NUJB 1UWYA 3U6XS 3ALPA 2VDKB 2R15A 1H19A 1I3VA 3OKOA 4FNPA 4PTUA 5E08L 5AYUH 4DCQA 5C8JB 5I1HL 4OZGB 5D9SB 5E9DB 2YUWA 5CS7A 2WQXA 4NNXA 4ODHL 3QZNA 2NCEA 1FAIH 3VXSB 1JWUA 2QQNL 1XB8A 3DROA 5T3ZE 1TNNA 2VDPH 5FM8A 1JZ5A 3GXUB 4YHPB 5HGHA 5GZNA 2NTSP 2UY7A 5MENE 2OJEA 3WEAA 4IGBB 5EFIB 1TZIA 3L3IB 3LKQA 5BRZD 3FTWA 4ZUSA 4AGOA 3WFBH 4GI9A 1VA9A 3O4OC 3D4CA 5HVFB 1MAMH 1NIDA 5AW8B 1GW6A 1KNOB 2I32A 2IAND 5E6IC 1IC4H 5BO1L 3ZRFC 3I6KB 4PR5B 4TSAL 2VQTA 2I7OA 4I87A 2CDGA 3GMRB 5IESL 3FK3A 3RWHB 2BP8B 4HULB 1Z66A 4PRDA 4PPTA 4LCWB 3VI3B 1ZLEA 4QT5B 3BSZH 3TBCA 1XR9A 1ZTXE 1AAJA 1RK7A 4W93A 1WICA 5DD3H 2R29A 5ANMA 4MNGB 5AVQB 1U42A 3BSHA 4NPYA 4OW6A 5DJCB 3QJXA 2AQQA 2YD5A 5LGYA 4IBVA 4WWKC 4MJID 3VGBA 3MRDA 4XCYB 3UAFA 2IWKA 1YPZE 4UQ3A 1ACZA 3KPMA 4R7NA 2VITB 3DVFA 4NAMA 4Y89A 4J3XA 1UG9A 3UGUA 5ID1B 2ESVA 3CH8A 4IMKA 5DEJA 4XT1C 2Y7SA 5J06A 1NJ9A 5JW4M 4TUKH 4WHTA 1XBDA 3QPXL 2E8ZA 2B3RA 3UTPD 1RFDL 4QEGA 4OD2B 5I15H 4Z7UF 1ZIAA 3C75A 1OVZA 2V9UA 4GBXA 2CUAA 2EKSB 1I4FA 2ZP9A 3O6MH 2L7JA 4K5MA 2VLLB 3VA6A 1GZPA 2F15A 4MMXA 5C0RL 4YHNA 5G4NA 1KTCA 3BAEH 4OCMC 4PRHD 4L8BA 5CR8A 1TQSA 4DGIL 1NBCA 4OLZL 2CJUH 1QSEE 3KXFD 4YFLF 1E5BA 3MOAH 3VWJC 3Q48A 3MLWL 2G60H 4F9LA 1TZAA 1W72H 5J7CC 2NSQA 3LH9A 3IMSA 1P84K 5JW3L 4BFOA 1T03L 4JFXB 1F2QA 3H54A 2WXHA 4PSRA 3ARDA 2P8PA 1K8DB 2JKIS 3EBHA 4AZ8B 1A02N 4XMVA 4OLWH 3BCDA 1JNLL 4R2GB 3CSYA 5AD0A 4GPVA 4PV8A 4FXKC 4XVJL 2D7TL 1RZ8A 3IGAB 2HZHA 1F4YL 1EAQA 4A6YB 2KKQA 4KQ4L 1EEUA 3LCYA 3CBJB 3INUL 1KXHA 4ZZFA 2YAEA 5J3HD 3E38A 1EZVY 1IAMA 4K5OA 4EI6B 3IJ9A 3TT1L 3UYPB 3LV3B 1J9QA 1MW2A 1NCHA 3SPCA 3QNXA 4HLZH 5FK9B 4OT1H 4JRXB 2A9DA 3ZKSD 4K3JL 3OKLB 2EILB 2VLJD 2OXGA 1CT8A 1IEHA 2AQ1A 3K6FA 4NS0A 4Q8BA 4ENEC 1YMMA 3HZYA 4XTRD 3QQ3B 3PHSA 1IFHH 4N2LA 5AW4B 4R9HA 2G3MA 2NY3B 1PY4A 3BDXA 1ORQB 4FE9A 4Z7WB 4J3OG 2VXTH 5AAMA 3T3MB 3LPWA 1HXYB 1FVEB 3WI9A 3RI5F 4HJGB 4JCWA 1BQKA 4GW5B 3TF4A 3NIFF 1RJYB 3AMKA 5E1AA 5C0DA 5KTEL 2Z92A 1YAZA 4HXBL 5D7LD 2BNRB 4J39A 4K94H 1KJ2L 5DHVH 2ZSVA 4C57C 4WUUA 3C8HA 4ZOCA 1S9XA 5EU5B 4LU5L 4BDVA 3NQIA 4DTGL 4Z76B 2OP4L 1TTRA 3BZEA 4J6RH 1YRKA 2NY2D 2CGRL 4E41A 2RMNA 2AAAA 3TO2A 3KPPB 1HNGA 4JFDB 4YDJA 5E6UB 4PJ9D 5J1AB 5E00B 5I73C 3IEAA 3EOBA 4DZBA 2IADA 1L0PA 2R0ZL 3QUML 4FQCH 2E9GA 4NM8L 1A1OA 4F7EA 5D6DA 1WA0X 5CZXC 4LSPL 1AHWC 5FYJD 2OFQA 1NANH 5IV2A 1DFBL 2FWUA 5AW6B 4OQ1A 4TSCH 3FPYA 2NMSA 5GGQH 1Z6JT 4XP9H 3EZ8A 1VFAB 4NBXB 2JLPA 4PFEA 2QQKH 4N8CL 2IWFA 3O3BA 4OQTA 4BZ1H 5I23A 3C5ZB 1G7PB 1BMGA 4NUGH 4AGNA 3DYOA 4XHQA 5EUOB 4C47A 3MPCA 3ULUC 3SGJC 5T1MA 4PRPE 3VE0B 4H1LH 4KPHL 2EDKA 3IBEA 1P9MA 1PKQE 4MXWL 4OF5A 1EX0A 1TO5A 2HTLC 5DS2A 5I1CH 1UGKA 4L1HA 1Z9OA 3UP6A 2HRPH 3NIGF 1HZLA 4UOW1 2XKNB 4AK1A 3KL3A 5BJTB 4EN3B 2OMZB 3GB7A 4NXKA 3UC0L 4J5VA 1ITCA 3PU7A 3T04D 1DQQA 2V5SA 2X4SA 3P3RA 2EE6A 4FEMA 4NQTA 4ENZA 2D3VA 2VXQH 3TV3H 2FJFB 1G7LA 2DI7A 4LCIH 2X44D 4P3CL 1CIUA 2YBGA 4NPKA 3IKCB 2HH0L 3KWVA 3VYNA 1A6WH 1BBJB 3EH1A 3D4YA 1OF2A 3ECQA 3GSQB 2JCCE 1OGAB 1LD9A 1EUUA 2Z4QB 2PABA 2WWKO 3BYYA 5I0VA 2X6UA 4JQXA 1U8JA 4AE1A 2DBJA 1IJNA 3MV7E 1OPOA 4XR8C 4RA0C 5ICYB 5LWYH 1ACYL 2HA1A 3X14A 1JYWA 3B2XA 3HE7D 2X9XA 4LVHB 4X6CA 3UZVB 2CIKB 2P48B 5LAPA 4JRYA 3L1OH 4UU9B 5IMLB 5JUEH 2AK1H 5FFOA 4AQ1A 2CIIB 3MLSL 1YEFH 2YRZA 3MCLL 3KCPB 3SBWA 1JIBA 3BUBA 2BNQD 2Q8AH 1LTXA 1HT6A 2X1XR 3H8NA 4N8UA 1T3FA 5SWZD 5PCYA 3V0WH 3L5XH 2QR0A 2C3HA 2IXQA 5JTWA 1NCWL 3NT0A 4LOUD 3QDJE 2P5WA 3V8CA 2FL5B 1MI5E 1MRDH 4GAJL 4LPWA 5BRPA 4H8VA 1T22A 1E9QB 3CFQA 1QI3A 4RRPA 1WVZA 1AANA 5D4QA 4Z0XB 5I1JL 3SGDI 2YD1A 2FWOA 2B0SL 2HAZA 5EF0A 4PS8A 1OZUA 2VDOH 5EF2A 4K7PX 2GK0A 4MZIA 4JZNB 5ISZA 3FPXA 3BDYH 3VXQB 2K9FB 3CFDB 2IBZY 3MODH 1XCQA 2ZNXA 1XHHA 3R06B 2EDTA 2JMRA 3PABB 1VESA 3C5JB 3RWCB 5CLWA 2ENQA 3D0LB 4U0QB 1MJ8H 1FV1A 4OKDA 2XIIA 5EG6C 2ICWI 1QPPA 1PGRB 2NZ9D 2WYHA 4PCTA 3B8SA 1AKJA 1CICD 3I6SA 4FNTA 5IW1B 4WCYH 3IDJA 3B4NA 4G6KH 1BYNA 1UD3A 4TNGA 4XMKH 1J8KA 4FJZA 4IU3A 3P9LA 5MEOA 3NYKA 1IGCH 2H4EA 2ICEA 3U82B 1XMWA 1OV8A 4GXVL 5DQJB 5E8NA 3N41B 4NBYB 3AQZA 4NAQA 5JO5A 1NL0L 4KHTL 3WFZA 3GJFB 2DBLL 3BKJH 4Z7OF 4FFWC 2IAMD 4O2CB 5CHNA 1TO4A 3BPNC 1FRGL 1Y0LA 4GW1B 5EA0L 1TOXA 2YFNA 1PW3A 2W0KA 4PRNA 3UMNA 3LB6C 1DN0A 3RTQD 2VH5L 2WD0A 4NWTL 5J3HC 4EUPA 1WWWX 1BVOA 3P40A 2VUYA 4PJ8C 1R0AH 2WINA 3VD9A 1GKEA 3RNKA 3RWEA 4D9QD 4D8PA 2F54E 3MV8B 1A21A 1CR9H 2E7MA 1KY6A 2J72A 3MRFB 1FL6A 1VF5C 2X4QB 2ZCLH 4RFOL 4W6XB 5GGSA 3UYRH 3VD3A 4DUVA 4J28A 5MI0C 3QBTB 3HB3B 4E9SA 1GGCH 2QQLH 5EEZA 4Y5XA 1S5IH 2PCPA 1ZGLP 4HKZA 4P4KA 4AT6A 2EACA 3FQ2A 4NX0A 4XTRC 5DK0B 3BEWA 4DKEL 2O61A 1KJ2B 3EF4A 4QHUB 2UZYB 2ZCHL 4ZSOB 4HCRA 25C8L 5EDXA 4A55A 5CINL 3A4FA 1UA7A 4JHBA 1JHLH 2CNZA 2BSDA 4X6CF 1FL3A 3LNDA 1KB9K 5HJ3A 1CZ8H 2YXVA 2FEDD 3T4AC 3UTSA 3L9RB 3IPBA 5EOCH 5F8RC 2DRUA 4GJTB 5LAXB 3MLTB 1X5HA 1WFJA 2FBOJ 3UIZA 3LN4B 5IK3A 3ZN6A 5HYQA 5HI3D 3CK0H 3IS1X 3QUMB 4XE0A 1CB4A 1KF9B 3DVGA 4EF3A 1BXAA 4YXLH 2YQGA 1AGEB 4WNJA 3ZW3A 2ARJB 1U2HA 2NR6C 4HMEA 3L2MA 1A47A 1DSYA 3DBXB 2NNAB 4FZ8H 5DEZA 4P2OD 3BESR 2CDFB 2UXFA 1S9VA 2PN5A 4L3FA 3OHXA 3KH4A 5IGXH 4PJ9C 4N0RA 1DR9A 4UIKH 4LRNL 3ARQA 5ELIA 4PJAB 4RLDA 3MRIA 5DGRA 1GOFA 2DQFA 2PKDA 2N0KA 4OCNC 1UM6H 2TRHA 1GZQB 4R3SA 3QISA 3PWPA 4JFED 5JXAH 3QIUA 4NGHH 1ADQA 4ALAH 4J3SA 4F80A 4F7TB 2MTAA 2H0FA 2QSVA 4HSQA 2FR4B 1U9KA 4FMKA 4N2NA 3O2VH 2WUCH 4I48A 4OFYA 1OARH 2GB2A 1NCCL 4M43L 3RRQA 3BW9B 1SHSA 3DX0A 1USQA 3GSXB 3GTTA 1PYWB 2FBJH 1NMCC 3FUHA 1D5BA 3MRNA 5HHPA 3BAYA 5IOPA 1KC5H 4HS8H 4GKLA 5DJDB 4H4NA 1BP3B 4F2FA 5KSUB 1JGEA 3MBED 4JVUA 4R7DB 4HWZB 3M46A 1XIWB 4APQA 1OE3A 4GMTL 4UOQA 3BAJA 2QSCH 4XMPL 1FGVL 5BRQA 1FNAA 4U2ZA 4F5CE 5IVXA 1KB5H 5MHSE 2BZCA 4X42A 2CLRA 3BD3A 5ESQB 4ACTA 5FECB 5E2JA 1FYTE 1U8IB 4N22A 5IT2H 3EYUH 3LKRA 3RKDD 2D3NA 2XICA 5EIIA 1R3KA 3RP1A 4XNQA 1OAUL 4MVBD 1RUMH 4P9HL 5BO1H 3DSFL 2R69L 1VJSA 2K0RA 3NEOA 4NZTL 5ESAA 5IF0A 4A7QA 1Z3GL 3T6ZA 4AWJC 2WBJB 3HS0B 2K8MA 4P99A 4AM0B 4MDJA 3L16A 1JNHB 3D52A 1J0IA 3HE7C 3U0WL 3Q3GA 1S2EA 3L3JA 4JQVA 1LVEA 2FSDA 1W80A 3TBWB 1R9FA 1GH7A 1ES0A 2Z65C 1YO4A 1UCBH 4RQQA 2NQDA 1MRCL 2V5MA 3N42B 4NQEB 2MOVA 4P2QA 5CD3A 4ZUTA 5CCKL 4XO9A 4A7TA 1HH6B 3KJ6H 3MUUA 3QCVL 2GIYA 1AQ8A 1AO7A 3MRCA 4S1DD 3O2DL 4GO8A 3DURB 1WC7A 2WYZA 1MCDA 4YSAA 1F4WL 5IKCB 3IFLH 1AG0A 4PD4J 4UANA 2FO8A 1ILSA 2HX8A 3O0LA 1RURL 1RY7B 3X11A 3QUXD 2V2XA 3N50A 5D1QD 5B3JF 1NQBA 4G8IB 1AD9A 4LOUC 4OIIL 2H1PL 5K9JL 4E9YA 4O02B 2YZ1A 3CMGA 5C0AA 5EZOL 4EI5D 4ZQKB 4OZGE 4AEHH 1SXZA 1RZ7H 4XXCC 2BZ7A 2OX5B 3RWFB 1FE8L 1FVCB 4GRWH 2HVBA 4DAGH 3FO1B 1N8ZA 4W9DC 4YHOL 4IMKC 5F7DB 2LU5A 3AU1A 3QFJE 1XF2B 4FADA 5CEZL 2VXVL 3PY9A 5CEXB 4WQOA 4ZFZA 4BFBD 4N20A 2WK2A 3DX8A 4HJTA 4Z0BH 4C56D 3IDXH 2AJSL 5EU6B 5KYYA 4PLOB 2YIHA 1ZLWH 3TLRA 3TYFA 3UPCA 1YUHA 5EBWB 4M6NH 4PJXB 3SO5A 3QO0A 4X99A 4FFYL 2RGSA 4G43A 2PTTA 3IMUA 4HMDA 4TPRH 3H0TB 1ZLWK 2DQCL 3RL1A 3FU8A 3PWNB 5HPMA 1OPGH 2I85A 4QO1A 2YN3A 4DP4X 1V3MA 3F58L 4D3CH 3D0VA 5D96B 5EWIH 2Q6WB 2VO5A 4UAOB 3S88H 3NPSC 4LCWE 3ZMEA 3HRZA 3RBSA 3FO2A 3VGFA 1UA3A 1MZYA 1K72A 1A6ZA 4NQDE 4XCEB 3UEQA 3ABZA 8FABA 3RX7A 5CIPB 3IKKA 4HEME 4HUKB 3SODB 3T3PB 5L9DH 2IAMC 4G6ML 1EV2E 2BMKA 1P7QB 4ZFOA 2B5IB 1DBKH 2B77A 3KS0H 4KMTH 4TQPA 1TLMA 2B59B 2A7BA 3RTQC 3KPNA 1BD2E 1OEZW 2GVYA 5HYIA 1K8IA 1BQLH 5I8OL 1WUNT 3B2DC 1A3ZA 5GSRA 4MQSB 3HC3L 2B15A 1RZJC 3MJ8B 3NJJA 3HMXA 4ZW5A 1UA6L 1LHZA 3V0VB 2L7QA 2X7LA 3VRIB 5I2IB 4OJFH 4QJ3B 1IM3A 3CLFL 3DRTA 3PG2A 2P44B 3FFCA 2UYLA 2VDNH 3GPSA 5FO9A 4NJAH 1T7XA 2Z4TA 3V8OA 5AW3B 4C83B 3QJTB 4DOHB 5D8JH 2GSIA 1H0DA 4GQQA 4QTHA 4X0KA 4JL1A 2FEDC 3GHBL 3IWVA 4K2UL 1ZHLB 2UXVA 4W1TA 3ZE0B 2XZZA 3SQBA 5IW6B 5FOJA 5JR1H 1Y18A 2JKRM 3G9AB 3MR9A 5DC2A 3UBXI 4ODSL 3WKNA 4C4KT 3MRPA 5HI3C 4H8PA 3KEHA 3ZL1A 2ROXA 4P23B 5I1GH 2BFVH 4G9FA 1QEWB 1QFPA 1CVRA 4RETB 2DD8L 3GKZA 3H9SD 2IWGA 5C2BH 4ZW3A 1SBBA 1IEAA 2CRYA 2NTFB 2BC4B 2EABA 1JPSH 1OD7A 1UXWB 1YHPA 1KYDA 1B90A 1A3RL 1HQ4B 1JV5A 3P0GB 2JB5H 2OKMA 4NM8H 4P2OC 3RX9A 5BXFB 2Y1YA 3VQMA 4DW2H 5KVDH 1P4LB 1YEJL 4QXGL 1PLBA 3WKQA 3F3HA 4MD5B 4LLDB 2YRLA 5CZKA 2HJLB 2VLRA 5FYKD 3SDDA 4M6ML 4LLQA 1ZS8B 2Y1ZA 2YRBA 3D3VA 4HBCL 4ZMXA 4IRJD 2V7HB 3EGSA 3K2UL 4QRSA 2QADB 1R5IB 1U93A 3MLVL 1A0QL 4XO3A 2BHFA 3LIZA 3AS2A 4G9DB 4OZFA 4XAWL 5EU4B 4AMXA 5J9PA 1XT5A 4FTVA 4OAWA 5CKGA 5A2JH 1M7UA 4NN6B 1JRHH 5IHUH 3CFNA 3EJYC 1EHAA 4XCFL 3D33A 2OMYA 3U0PB 4WDIB 3P02A 4G7YH 1MJUL 3WMQA 5F6IB 5CN2A 1R5WB 5J5EA 4PUBH 5L4IA 3A67L 3FB5A 4QJ4B 1JZJA 1FA4A 3E3QE 4IOFD 3SKNB 3IJSA 1C1EL 1FAKT 4OUOA 4P46B 4MA1B 3JZ7A 2GTQA 1M3JA 3KPOB 3MBEC 3LRSA 1T80A 5I28A 1I9RH 2WQVA 4RGND 4ODXA 2X5PA 4I0KA 1HYRC 4IU2A 5TF1L 3W0WB 2NX5A 1CURA 3LKOA 1WZMA 3HHSA 1FH2A 3K2MC 1M57B 2A73B 1IVTA 1MIEL 1T20A 4JCLA 3A6BH 4J2XA 3B2PA 2FBRA 4HT1H 4CRPA 3ESPA 3VXUD 4WFFD 1MCKA 3ZE2B 5BNXD 4CC4A 3I75A 3H2QA 2NY5L 1MCEA 4KXCA 4HCIA 3VD2A 4JFDE 2SEBA 2WNKA 4Y1AA 3ZHDA 2J3SA 4XC1L 1VIWA 2FJHB 3HZVA 3IPFA 4M8QB 1J87A 4MVBC 1MF2L 1TLKA 2ENSA 4U1SB 2F0CA 4AV0A 3TJEL 1HCYA 3MJ9H 1IAIL 1A5FL 4LPCA 1EJOH 2P5EA 35C8H 4HJJL 4JQXC 1XTMA 4TQ8A 4AQAA 4PB0H 1KEGL 4I0PB 5FYLH 3EUDA 4XI5C 3B5HA 1BYOA 2W0FB 3J07A 3N1PC 2K6WA 3B1TA 4XNUH 1I7TB 3NCJH 4AQEB 5IVZB 4FI8A 1T6BX 3WTVA 3O41A 4XCNA 3GZQA 4Q6IC 5ITFA 4MB3A 2WANA 4GQ9L 3CNKA 3QQ9D 1ETZA 3VGHA 4O4YL 2R0LL 2GAZB 1K6QL 2NZ1A 5CP3H 5KSAD 1BVLA 2XN1A 2KPWA 2R2HA 2C9VA 4I4WA 2Q7YB 1PD0A 4OCSH 5DHYA 3SBWC 4S1DC 2ZCKH 5E1QA 4L8SC 2ERJB 5I66A 3P0VL 3LSOB 1GAFH 1RZGB 3GSUB 3AXLB 5C3LD 3QUXC 3DYPA 5D1QC 1FO0L 3CBKB 4RFEA 1I8KB 4U2YA 4A68A 3MNMA 2DWEB 5CGTA 4GFTB 5A40E 2L04A 4EI5C 1AGCB 5JOPD 3BD4A 1OGTA 1S9KC 3N85H 1EHNA 3WFCL 4GRLD 4P57B 5JIMA 2ADYA 5GISH 1TQVA 3QFGA 4QOKD 3C60A 2AXWA 3SDAD 1UZ8B 1WPCA 2IJ0C 3BIBX 2IV8A 3P4MB 4LE8A 4R8WL 1R5VB 3GT6A 5I6XC 1IGTA 5F71A 4LIQH 4MXVF 3T8XB 3UTTD 2QZ5A 4ONFH 3AWGA 1ET8A 2CKNA 5CO1A 2E4FA 1NEZA 4MX7B 3PGFL 1DP0A 4X50A 1KCBA 1MLCA 4Q58C 1BPLB 4NC1E 3HAEB 2OLDA 4ZFGL 2F53B 4LNVA 5EUKA 3HEIB 4Z7AA 1G7MB 5MENA 2EXYD 2DQEH 2AEPL 3J8F7 1G43A 3PJNA 4FYRA 4CADA 4N26A 1B9KA 4PJGB 3PXHA 4JO3L 4ZAKD 3ZDXF 1NCAH 2UVEA 4NB7A 3IT8D 4WEEA 3WXWL 4NO3B 5KUMA 4JM2D 3HNVH 3Q8CA 2AVGA 4AYFB 3RX8A 2VMEA 1IT9L 4K3EH 1TETL 3EH2A 5GS0H 4F58L 2WO3B 4QCIB 5GHWL 5GZOD 2A1WH 1OK8A 5TF0A 3PWUB 4YBQD 3WXVH 3VG9B 5IBTL 1JDDA 1V7ML 4M7LL 3MU3A 1BF5A 3OJDB 4OGZA 4P9MH 5B3SB 4PLKD 1Q9LA 5T1DH 4NO2B 2IPTH 3ALWA 1O6VA 4FEIA 5EOQH 2DMHA 3GRGA 1AY1H 3TYGH 5G2NA 1FFPB 3MXWL 1YQ2A 3KCWA 4F1ZA 2IBBA 5D1ZB 3QUZD 3QDGD 3ZL4L 1JN6A 2J2ZA 4H5SA 4NKOB 1MQKL 4OFPA 1PQZB 5G5DA 4WI0A 4KOCA 1YY8A 3GXNA 3KLAB 3FTZA 3DXAD 3O0RL 4UV4L 4I5BA 2ENJA 4L4VB 4P05A 3DHPA 4U3XA 3RWDB 4X83A 1X6LA 2BOLA 3MFFB 4XOAA 1TJGH 5AVYB 1ZVHA 3L08A 4TL4A 4NYLB 1G6RA 1QSEA 3FCBA 1ZE3C 4GP4B 3DO7A 3SKOA 3OMIB 4MGXA 3TWCL 4P5KB 1J5IA 5CD5D 3KYOA 1I9EA 5L2JB 2HFEB 4P4RB 5FGCB 3VX0A 3TWYA 4E2OA 4N2CA 2J88L 1KXVC 3A22A 1A7PL 5CLYA 3G6AA 1QAWA 5DMGD 3P3YA 1RIHL 2W65A 4FQ1L 5IQOA 4ZMTA 1IBYA 4X5XA 5H35B 3S37H 2YAHA 3X3GH 4O2EA 2OMUB 4UQCA 2WXFA 3WFHA 1U6AL 1Z1WA 3N04A 2RTTA 4MS8D 4UM8B 3U25A 4IRJC 1AXSA 3GSVB 5AKRA 3I2CH 3EYSH 1CF8H 2Y06H 4XNMB 4YSTA 3T0ED 3H2PA 4LCCA 1CD1B 2FB4H 3Q5OA 4AIZB 4OB5H 5G4OA 4PJCB 2AEQH 3QJSB 4JQIA 1JUFB 1LM8V 3BT2L 3DTDA 1YNKL 3ASOB 5C0CB 3SKMA 3UAEA 2ZOLA 4UNVA 4ANWA 3A6CL 1XGZA 1AKPA 4QWWD 5FDYA 4JGUA 3GMQB 2ZD0A 3N06B 5C07A 4PLNC 3L9EA 4IOFC 4EOWH 3QO1A 4N2EA 4A39A 4B9KC 1J8HD 1CDGA 1EXUA 2YK1L 1LNUB 2I27N 2EICA 3B6SB 1MFDH 3CVHH 3CXFA 4GI6A 4YQXL 1ZVYA 3VWKB 1HL9A 4QRRD 4BKLA 5FOBA 3KW8A 4X7TA 3GIVB 1SF5A 2DAVA 2BIIA 1U8LB 4ZD3L 4EDXB 1H5BB 5FKPA 4D0CA 2XZCL 5C0FB 3AGVA 4UNUA 5L88H 4I9XA 1CXLA 3UG4A 3DSFH 1NKGA 2G5BB 2KL6A 5KVDE 1EQWA 3V5HA 1GGUA 2OTUB 4RISL 4ONGH 4IMLA 1M2OA 1NGPH 1QSVA 1XH3A 3D07A 3VVVA 5GPRA 4QHPA 2XZQL 4KI5E 2YD2A 2HLFD 3R19A 3RJQB 2L4OA 2NYYD 4XOCA 4ELKB 3E1ZA 4ELMB 1BBDL 1SJMA 5A2LH 5C3IA 3GMPB 4LAJH 4AYSA 1OM3H 1J9RA 1QWHA 4A63A 1E0OB 2WC7A 1TVHB 4JZJB 5IMKB 2EYRA 5DD6B 4TVPL 4I1PA 1YPZF 3QCUH 2X41A 3LOWA 1NFIB 5PAZA 5BQ7B 1A14L 2A3TA 1RZFH 3MX0B 1HDMA 1FO0B 3QQ9C 4XN5A 3MACL 1P0SE 5T1LD 3SPIA 3O11A 5CSZA 2GBAA 5AZ2L 2CZNA 4PJ7E 1INEL 3I50L 3RGBA 3BVWA 2W5PA 5KSAC 4OJDH 1X9RA 5EPMB 3C6SA 4PJDB 4N9GA 2H1PH 5K9JH 4WU7A 1QTYT 2O5YH 2A5UA 5DS8A 1D3CA 1MAKA 5AVVB 2YC1B 4C54A 4XXWC 4F2MB 1PG7X 4HJIA 1BAFL 4FL4B 2KPNA 2BY2A 4WFHE 3CVBA 3UGXA 2ICES 4HKBB 4GOSA 3QUKA 3H9HA 1IGIL 3SDXE 1F8TH 2X12A 3M1BB 2OCCB 3BKCH 3GHEL 5A2BA 5DK2B 1D5IL 4HLEA 4H44C 2ZX5A 4R0LB 1EAPB 2V17H 3O6LH 2QFPA 1EWHA 1FLRH 2AANA 2NLJA 4RRPM 4DPAX 3C08H 4Q6YA 3GSOA 5T33H 1IGMH 4AIXA 5JHLA 4OJCA 2X9WA 3MNZB 4HUWA 1NINA 4TSBL 4GRLC 1M1XA 1UQSA 4FQ2L 3SDAC 3PGDA 4F37K 3SOBL 4XVTL 5FYLE 15C8H 2ZXBA 4DESA 2V7NB 3RWGB 5BW7A 3VXNB 3EO0B 3W2DL 2ZQKA 2EEDA 5I19H 3U48A 1OTTD 3O3DB 4PU2A 2VL4A 3JSSA 4M93C 3OKMA 3Q6GL 2ZOKB 4RAVB 1YC8A 4PGZA 2GJJA 2HVKB 2JCCA 2DQGH 4PVMA 4PW9A 1U91A 2JIXB 3W81A 1A7BA 5K5YA 5E4EC 3QJRB 3NFNA 4NQEE 5F1NB 5FCSH 5CCHE 4G83A 2C3VA 1OTUD 3HRZC 3BQUD 3LQZA 1OK0A 2OMWB 3L95A 4TNWK 4LO9A 1QABA 5FO7B 1OP3H 2FJGB 2YARA 2ZE0A 1A6VH 1LP9E 1E6OL 1SFHA 1YMHA 4UDTB 2P9RA 1DUZA 3D2UB 1C08A 3N5AA 2KQNA 1N59B 5TE7L 2NUTA 1OP3K 3CCHB 2ZKXA 4HFUH 4N8VB 1NC2B 1F1AA 4GI8A 4UOJA 3NIDF 2FHBA 1P1ZB 1CK0L 2Y3AA 5HDWA 4DETA 5BS0D 1QR1A 3LZPA 4NDMA 2EE9A 1HI6A 2ZPKH 3IWUA 5IJVA 4HQQL 1R3IL 4YBQC 1N26A 3ZTNL 3VXMA 3EO9H 1NFAA 4F92B 4LIQE 3LNIA 5I5IA 2XWJA 4ETYA 4M5SA 3OXSB 2PLTA 1MI5A 2XTJB 1XEDA 4FXGA 4PLKC 1VKXB 1W8EA 3IDYB 2AK4D 1E4HA 2QLYA 2W0PA 5EU6E 2DQ6A 3WNKA 4MJ5A 1ITBB 4ICWA 1KEMH 5KEZA 4HV8A 3ZE1B 4GXUM 2W9EL 1JMXA 1FC2D 1RPQA 3FOLB 3GHPA 5IB3B 2F8XC 4W70A 1SYVB 5EN2B 5JIQA 3STBA 3HKFA 4LOEA 4W9KC 4X80H 5F7EL 3S5YA 1B4RA 1E43A 4X7EC 5CN3A 2PXYB 4XMLL 3WNPA 3DYMA 3Q6FA 1Z9NA 3BP4A 1BIHA 1KG0B 2M83A 5IQ7L 1JZ7A 1KIRB 1V10A 2C4XA 3O3AB 4LPVA 1HHHA 2B2XH 1JNJA 4S2SB 1ONQA 4D9LL 4P5TA 1U8QA 3V9EA 3ULUL 1MUJB 4U1HA 2CD0A 1BJ8A 2ADGB 4OFKA 4OCXH 3WENA 5JPNA 2ICWJ 1QHOA 4ZOBA 2YPVH 2W9LA 2EQDA 4KZEL 3MI6A 5DRXB 43C9A 5CBEB 2UXGA 3G6JB 4CMMA 4Y5YA 2N56A 3JQOB 3V4UL 4L0PB 4TYUA 1G7HB 4KKRA 2BIMA 3CZFB 4ODBD 1L6XA 4FFZL 4J1UB 1QNZH 4MCZA 3RUGB 4NLAA 4P2RE 3AUWB 3T2LA 5I6OA 4MB4A 1KGCD 3ZMNA 4QRPE 2ZYSA 4MS8C 3O4OB 1JD7A 1NA8A 2XY2A 1A9BA 3TEXA 5KN5B 5E6IB 1U8PA 1CFQB 2IGFL 1S8DB 4XCFH 4RMWA 3T0EC 1OCOB 4IOIB 4MJJA 2WCGA 4NZUL 4X8JA 5E2VL 3HAEG 3VI4B 2QQQA 4AUUA 2Z7UA 5DHMC 3CXDH 1ZWIB 4HWEH 1MRFH 1JGVH 1SHMA 2DWDA 2V3EA 1B4LA 3PFUA 4RZCB 3PV6A 1HU8A 4GRMB 2BY0A 2R1YB 4QWWC 2VL5B 3MCKB 3VD7A 3SY6A 5I8KH 3O8XA 2JCCF 2XKSA 5ES4B 4G6JH 2MFNA 5INCB 3EYVA 5CUSH 4BIKA 4WWKB 2OMTA 3PP4L 3HPJB 2Q2LA 4PREA 3TEWA 2K4WA 5CZVL 5LNEA 4PTTB 3QQDA 1NOLA 1W72A 4LCUA 3CN1A 3LQAH 2A83B 1EERB 1OB0A 2GTZB 1GC1C 5J6GA 3FQXB 1PIFA 3BXNB 1CF1A 1ZEAL 2OMXB 5FW7A 1LWHA 1S7WA 2AXFA 5CLTA 1B3IA 5B22A 2XG5B 4OSUL 1H6TA 1KCUH 1M42A 3BP5A 4OLVL 1MN4A 4Z95H 3TZVC 2XWRA 2AHIA 3QEGH 4J6IA 1B0GA 5JMRA 4PRAB 5DJ2B 1MNUH 3WELA 2O4EA 1FZOA 1TMCB 2NYYC 1NAMA 4DWHA 3O4LB 3KPRB 2ETWA 5HHNA 5JYMA 5AW9B 3BZFA 3MNDA 5F93C 43CAA 1WWAX 3APMA 4PJ5B 2BJML 4QKXB 4W9IC 5KSBE 3DX9A 4XPTL 2ADJA 1KB3A 3FN0H 4HUCA 3VWJB 5DJXB 2H6OA 1D6EB 1EO7A 5IMOB 3O2WL 3QS3A 4HVBA 5ADOH 1H9VA 4HIJA 3QZWG 2BFGA 4JCMA 3L13A 1WAAA 3B7YA 3NJLA 5JA8B 3MC0A 4K23H 2VLKB 2BVPB 3KNBA 3GIZL 4AX3A 3F7PC 4TM9A 2EYSA 1KWGA 5BMFH 4JN1L 5I0WA 2X89A 4M7KH 1RUPH 3AS0A 3RHWF 3RBGA 4FXKB 4N2GA 3MFGB 3P3SA 4ZTPH 3OJ2C 5AZUA 5KJ4A 1IFRA 4EAEA 3W0WE 3C6LD 3DJ9A 3F6IA 1C5CL 4TULL 2I07B 1F58H 2TSBA 3GXTA 3EJCA 3IFNL 5AYTA 4HPYL 2E47A 1I1AD 4PRPD 3MDJA 2LU7A 5KJRL 3S34H 3ENEA 3ZE2E 5AAWC 5D7JD 2IPUG 5E2TH 4AYEC 1G84A 1UWFA 2ARJQ 3DRQB 1T2QL 1E9PA 3UAJA 1B6DA 2X6VA 1HSAB 4J3OF 1CQYA 1Q8MA 1U8MA 2UV3A 2VW4A 4JPIB 2AI0L 3V4PL 1C8PA 5DUMH 5DJ6A 3VRLE 1CBVH 4F5CA 5F97E 1UXSA 2MPAH 5AL0A 3ZR5A 4JB9H 1OTTC 4IRZH 1X4ZA 1FYTA 3ATBA 3MNWA 3NCYS 3UO1H 1T1WB 1CG9A 3DGGB 5H8DA 4UT6A 1QWNA 1TKWB 1LO3L 5C0BD 3NSYA 3RVWD 3F7KA 2IOOA 3R1GH 2ZYRA 4I89A 1DBMH 4NQXB 1AGDA 2KT6A 1A7QH 4PD4K 4G5ZH 1DQJA 2ZSWB 4MB5A 3MBXL 1PX3A 3FH5A 1OTUC 3MV7D 4RX4A 3BQUC 4LRIC 2A4ZA 2DWXA 2P24B 4Q9QH 1ZY9A 2QVMA 2NW2A 3K0YA 3UH8A 3WY3A 1WD9A 4G8EB 2IGLA 4N0YH 1OM9A 1F56A 5SWSB 1RXLA 2AV7B 4FAAB 3DO4A 5DTFB 4KTDL 4AQZA 5JXED 5ID0B 1EHKB 1IKFL 2HLAB 4NRZB 3SO3C 2Q86A 3QNYA 4CUCA 3K4AA 3KD4A 3PRZA 1JDCA 4APXA 5I73B 3B5TA 5IQ9A 1AS8A 1UB5A 2YPKB 5C09E 3EGDB 1KTRL 2R56H 2L7UA 3IJEA 3RNQA 4X6DE 3NH7H 4UQ2A 5TK2A 4PM1A 1AHWB 4DK3A 5GJTL 1AHMA 3DPBB 1KENL 1OCZB 4GMSL 3QDJD 1BXVA 5C8JA 5GRJL 4L8CB 4OZGA 1NDMB 4N0CD 5D9SA 5ABZA 2CUHA 1WHPA 5C08D 2B1AL 4PRBA 4PEEA 5GRWA 1HKLH 4FDWA 5LQBL 3VXSA 4MD0B 2QHRH 5DWUL 1Z0MA 4AM0Q 5FYJL 4PJ6A 1TJHL 1XF4B 2F53E 1Q9KA 4YHPA 1HCFX 4BM7A 1Y6MR 4XNAA 4IGBA 5EFIA 3HR5B 3L3IA 5D93C 4KXAA 4WI8A 1IGFL 4FERA 2E9JA 3PNWA 4QR7A 2CA4A 4GY4A 1KNOA 4P0DA 1EBAA 4PR5A 5CSGA 3RY6A 3RA7H 2XX0A 3GSNL 4H7VA 3GMRA 3T8VA 1P53A 3N1MC 4JPSA 5JNYB 5C97A 1ASPA 3RWHA 2BP8A 5D5MB 2BLFA 2VQ4A 3KGTA 4LCWA 1GS6X 2BCMA 4QT5A 2B1OA 2PR4L 3MGOB 5DT1H 3KG5A 1DJGA 4HIXH 5BRZB 3VYPA 2DN7A 1G5GA 4MNGA 4YEEA 5BVPH 3JT2A 3SKJL 4R96A 4HEMA 3E9UA 5DUPH 3CMOH 5DJCA 4HIPA 1FNSH 1RIVL 3WIFB 1FH5H 4I7ZC 4OGXL 2IANB 1FN4A 1KELH 3OF6D 2F5BL 4XCYA 4LHUD 4A2LA 5DFAA 1QZNA 2VITA 1KYUA 4NNYA 4DKAA 1JGIA 3FT9A 3STLB 4ZTOL 3B2VL 1R6VA 4NP4L 1LE9B 1EO8H 4KO9A 5FO8B 3SYQA 5ID1A 3SPGA 3WJLC 4WK0B 4XVSH 3R7QA 5DJAB 2R2BB 5I16B 2J8HA 3UIYA 2QDWA 2YD7A 3ECBA 2XNAB 5JW4R 2F2HA 4Q9CA 2ISDA 4S1QL 4Y4FD 3KPQB 5EC1B 4RDQG 1NCGA 3RWJB 1LE5B 5ICZB 4OD2A 4X7SH 1BLNB 1JP5A 3GBML 3WNNA 3AM8C 4TRPH 3GK8H 5GZND 1LDPH 2EKSA 4XNXH 2EIMB 1DO6A 2AFNA 2J5LC 3MA9L 2VLLA 2GJ6E 1NSNH 3VFPB 3ARTA 4L4VE 3JYCA 4MJIB 1SLWA 4W9FC 1O7DE 1F0LA 2P7TB 3LZNA 4JHZA 2XN9E 4NC0B 1CYXA 3E1F1 4RISH 3OWRA 4PN6A 4PGDB 1QP1A 2AJUH 4R26H 1UD2A 1GIGH 4G72B 4N8VG 2ICCA 4YGVB 1R3JB 3PWVA 1E5AA 4AH2B 5EZIH 1E65A 1GL4B 1RD6A 3QXVA 3ZKXC 4JFXA 5FGCE 1NCNA 4ZT1A 3SD2A 4I9WE 5FV2A 2APVA 4HX1B 4OJAA 1DBAH 3VFNB 3OPUA 4AZ8A 1ZT7B 1PY0A 3BWAB 2CCLA 4Q89A 1V55B 4UT9H 3D4ZA 3IGAA 3IJ7A 3F7LA 3HNSL 3KXFB 5HHOB 4U4BA 1QFWH 5FS5A 3KGRA 5LGJB 1RK0A 3LMJL 1J1PL 4OZGF 1UASA 3AC0A 4LEXL 3D1MC 1VZIA 4PBXA 1TVBB 4IBYA 4YC2C 4WO4D 1NLDH 1UOVA 3GMLA 2OYKA 1I7ZB 3X3FH 1D6VH 3UYPA 4C58B 4EI6A 2V9RA 1F02I 3LV3A 3EH5B 4LKCB 1LGVA 2CUIA 2CLVB 3N55A 4JRXA 4YUEL 1J1XL 2VXSL 3OKLA 2HFGH 5HYJD 2QPFA 4OLUL 3QWRA 2XXMB 4DO5A 1YYMH 1CD8A 3BPNB 4RWYL 5A3IC 3SJVE 4JY5H 4TOYH 3C6LC 2DIBA 1CGWA 2DQTL 3QQ3A 3U46B 3VX1A 1ET5A 3V4PB 5DS1A 2ZOUA 4JFPB 1KBGH 4XPFL 2CBOA 3BUQA 1GJIA 4PJ8B 2Y22A 1I1AC 3CZSA 2H26A 3PUUA 1SXNA 1HXYA 1FVEA 2JK5B 5D7JC 3WJJA 4HJGA 4GW5A 2ZXGA 3ZX1A 1RJYA 4WGVB 2XIBA 1JV2B 1M7DB 5L2KD 4F7PB 4ODWB 2BNRA 4WW1B 2FX8H 1FWXA 4UB0L 2JSFA 5MI0B 2FECL 1EGJH 4OLYL 1XFPA 5DQDH 2D4FA 3TBBA 3GM8A 4B9IA 1AQHA 4UBDC 5EU5A 5GGTH 2E59A 2WUBL 5FEBA 1JZ8A 4Z76A 1TQCC 1BFVL 5MHSD 5EOTB 3RAJH 3BAKA 5DVOA 3S2CA 2DMBA 1HILB 3T65B 1B9ZA 4FQXD 3ARED 5KVFH 3RWIB 3KPPA 2IFGA 1TU2B 3QI9A 4JFDA 1RZJL 4PJIB 1JXDA 3RVWC 3T4AB 1G9MH 1KGWA 3ARFD 5IROA 5J1AA 4BHUI 5E00A 4EN2A 3ZDYB 4UTCA 2X70B 4IK6A 3V4VL 1MCFA 5FHAL 4PGJA 3TNNB 3CG8A 2F8IA 5MEPB 1I53A 5DO2C 3FQNA 4WK2B 5IBUB 4KUCF 4NZRH 2R9HD 3WE6B 4UINH 3J27A 4JUSA 2GUOB 1WA1X 2NXZD 3OMZA 4JM0A 4NNPL 5LN8A 4TLSA 4OKVB 1VFAA 2EDYA 3SE9H 4UTAH 3TH2T 2VDML 3C5ZA 1G7PA 1CFVL 4WVRA 4BZYA 2Y2TA 3G6DH 2EC9T 5EUOA 4X5WB 4PJ9B 2HMID 1DVYA 3VE0A 4GUPB 2X40A 1LXMA 1WAPA 5HVGB 5L8KB 2DWYA 2Q87A 5GRYA 3GO1L 3NFPB 2XTSA 4YDNA 1U8OA 4BWWA 5JIPA 5FHBH 5E99H 4OF6A 1PZ2A 4YDIH 2XKNA 5BJTA 1K2DB 3WD5H 3F7VB 1QPXA 1B4JH 4LSTH 1EA9C 1KJVB 1IGYB 1YVLA 4XAKD 3KBFA 4N0CC 1HX0A 3GMOB 4NLHA 3CFJA 4WI9A 2FJFA 1IQDB 1I9IH 2AQNA 3RDTD 1UM4L 2WZPA 4ES9A 1NANI 4FABH 3GSNB 1NMCB 4XP1H 1BBJA 5ILTH 4YE0A 5IWLA 2KLRA 3GSQA 3UERA 1OGAA 5E7BA 5FCUL 4K7PL 4Q6KA 1D7BA 1HL4A 1UM5L 1CE1L 2WXMA 3D7PA 2QV2A 2Y7MA 3CX5J 2IALB 4U6YB 3H6JA 1IBZA 5ICYA 5JMOC 3S3DB 2MKLC 2MCPL 2YMTA 2B4CH 4LOVA 4OJYA 1MCPL 2VXUH 1O7SA 3BPOC 3UZVA 1U4EA 2B16A 2CIKA 2CHWA 1U2YA 2HPTA 1JWUB 4UU9A 5IMLA 2IMNA 2R0KL 4PS3A 1JXJA 2CIIA 1AJ7H 2OMVA 4E5XB 4OUUB 4NWUH 3GBNL 4TNVF 5FM4A 3OKNA 3MV01 4KITB 3KCPA 5HGHB 2UY7B 4A7GA 1EANA 1LEKB 1TZIB 1U3JA 2FX7L 4F1SA 3KBPA 3B43A 5E2WL 2BS71 4MNQE 2AMGA 3ARPA 4TL5A 1ZHKB 3TJHC 4F3FB 3VACA 4P07A 5D2NC 3HE7B 2FL5A 4E9QA 5CF3A 1K5NB 4B5ZA 3QG7L 3WEBA 1G5AA 2ICWB 3L3HB 3QHZH 1E9QA 3IU3A 3L9YA 4Z0XA 1HHKB 4RAUB 3VNZA 1MFNA 1PEZA 2DB8A 3VSTA 2I69A 4IBZA 1BA9A 3BE1H 4FX5A 1OAQH 1WZAA 4KDVA 1QFOA 1XVSA 3OAYH 3ISWA 4JZNA 1YEIL 2BNQB 4OTXH 3VXQA 4DZ8A 3FQYA 3MO1B 4LGSB 3L3KB 3R06A 5SWZB 4A66A 4EQ2A 3PABA 3C5JA 5MEQB 3PQYE 4NIYE 5IB2B 3D0LA 2VQ1B 4TKWA 2B1HL 1NFKA 2M8XA 2AGJL 4W9ZA 2X1WL 4MA8H 1ZCRA 3V6BR 2H5UA 3OC8A 3H9YA 4EIZC 5IW1A 3BLKA 1QG3A 2ZKHH 2F5AH 1VGKB 2CM5A 2H7WA 1VADA 3MLRL 1NFDE 4B9JA 2PWFA 1P7HL 4QY8B 3R0NA 3MTRA 5EUOF 5DQJA 4IRSC 2F19L 2JLLA 4I8DA 1CTOA 3BX7C 4M1CD 2ITFA 5I18L 1WTLA 1FCGA 4JHUA 3GJFA 2BHZA 2FHFA 1NCDL 2J20A 4CC1A 4O2CA 2BSED 4GW1A 1ZTMA 1VLXA 3EFOA 4MMYA 5DFVD 2ATPB 4J2QA 2C8NA 5A7EA 1LQSR 2XJLA 5F9OH 2WB7A 2XYCA 2K45A 1I3GH 3B9AA 4NQCE 5DZLA 4ZS7H 4WO4C 3UBHA 4WWNA 4YHIB 3DOHA 3NPSB 2Z64C 1BXXA 5T3XH 1TR7A 5A2AA 1YY9D 3MRFA 3IMTA 4GS7C 2IAMB 1DJXA 1SY6H 1YEWA 3AG2B 3K2KA 2F68X 1RZ8B 5T1JA 2R2EA 5DK0A 5LN4A 3KYAA 4GKNA 1KJ2A 2WSDA 2Y5EA 3RTQB 4BH7B 5CFAA 1RZKH 5C0ND 3NZSA 3UZEA 2IO5A 3GPEA 3ZYZA 4CJ0A 5LUMA 3CVIL 1PAMA 4Z18A 4ZX6A 1E5ZA 2Y7LA 4N3TA 1QFUL 2Y69B 1AE6L 4BCZA 1TYRA 3IF1B 1JK9A 3MLTA 1CUOA 1KGJA 1COBA 4K94C 5KVEH 3EBAA 4JPVH 4QXTB 3PL6D 3LN4A 1V3JA 5IUSA 4JRWA 3LKPB 1CT8B 5DRWB 5C0GA 3V4VB 1A3LH 3NZHH 4A7GF 3QUMA 3M88A 3ML8A 2MHAA 1IBDA 4UILL 3OPZH 5FX3A 2IF7A 5L4MA 2Z35A 1AGEA 3HZYB 3VXRE 4U1JA 1EJFA 2ARJA 5F8QC 4UOZA 1UD4A 5DMIL 2B8OT 2NNAA 4FQXC 3GGWB 1JNNH 1YEHH 2CDFA 2HRHA 3P11H 3G08B 5T1KD 2GYSA 2DWTA 3NCEB 3WIIH 3KWUA 4ADJA 3UOAB 1H3XA 3ARFC 1JYNA 2VDMB 3GJFK 2X3BA 3RFZA 3GRWH 4PJAA 5HDBB 4CA4A 3AACA 5DMJB 5E2UL 5JW5B 2Z92B 2VNCA 2NY0D 2YBRB 1GZQA 1TJXA 1IM9D 5BOJA 4RMSA 2E8YA 1OAKL 5D7IE 3RB7A 4F7TA 1QWUA 3O6FD 1S9XB 1GSMA 4MRCA 4ZMPA 1LWJA 1KV3A 4HDIB 5D71H 3UJIH 4BDVB 2FR4A 2GY7B 2R7EB 4UMGA 1OHQA 5AWNL 3V6OE 5EBMB 1CMOA 1FORH 4WTZG 4P2OB 2BO0A 3TC9A 1Q9OB 1U33A 3TBYB 1FP5A 1PLGL 5EU3B 3BW9A 5HI4C 2HMIC 5GRUH 1QKZL 2FJSA 4A04A 3HFML 1PYWA 4M4RB 2DTML 2ODHA 4KK9D 4BQ6A 5DJDA 1R3HB 4YDKL 5E0FA 5KSUA 4KUZL 4TS6A 1DANU 5K39B 5LG1A 4R7DA 4HWZA 3BP7B 4JFEB 1O7VA 5EF1A 2Y9RT 3TIDA 4GFXA 5J8OA 1XIWA 1EVUA 2KYIA 4QRFA 1MHHB 1F3JB 5ENWB 4NCDA 1T7YA 2F9BT 2DKUA 2B14A 4YSRA 3BPCA 3RIFK 3FT0A 5KVFE 4KROD 5DVMA 2HP4A 1CS6A 3RDTC 5FYKL 4S1RH 1MFVA 5ESQA 3LNFA 2GC4C 3BVXA 5FECA 1U8IA 1T83A 3BKYH 4KK5C 2X6AA 4KRNA 3TASA 4CSZA 5T1MB 2EDLA 3KHQA 4AITA 2ALWA 4Z1PA 2ODIA 2ATAA 2XQ0A 3FUMA 1FDLH 1X9QA 3BH8A 2HKFL 4Z7OB 5LXVA 2Q3ZA 2R51A 3MBEB 1JHTB 5DHEA 5DA0B 4AOFA 2IDCA 3F7YB 4LQFL 5L7XL 2WBJA 3HS0A 4AM0A 1OSYA 1JNHA 3TBTB 3NACH 2D3LA 1DCLA 2P80A 2UZIL 2J44A 1F6AB 2NNCA 5SWSE 3V95A 3KGSA 4YSEA 4KHXH 3TBWA 3SGKA 2VR8A 1EJ6A 3E8VA 1N19A 4NQEA 4W9JC 3U2IA 3CZKA 1KBWA 4H40A 4XHJD 1DLHA 2RBLA 2MPVA 4GP5B 5ADPL 2YMXL 1HH6A 2GFBB 2BVTA 3DURA 3WFDL 1HWWA 1LP9A 1W8OA 1ODUA 1Z9PA 2KH2B 3NK3A 4HH9B 4NT6B 1XMEB 5I1DA 4DN3H 1E28B 1E42A 3SPHA 4OD1H 1NCBL 3APCA 3X14B 2PW2B 5KS9E 2X0WA 4ZQKA 4Q6IB 4P06A 3U4KA 1GGTA 4WI2A 2OX5A 2AQ2A 4LSVH 1FVCA 4JRYB 4L29B 1NIFA 2LFGA 1QBML 4KZ0A 2FO4A 3FO1A 5F7DA 1QRKA 2K6YA 4AQOA 5C9KA 5ALBH 1F45A 5D2LB 2VDRH 1ASQA 3CHRA 5EZJA 4QKTA 4BKSC 4JVPA 5CEXA 4JO4L 3A3YB 3WFEL 1SOXA 1MCOL 4ZBJA 5IBUG 4L8SB 4KI5F 2ZUWA 4PJAF 5EU6A 3DX7B 1G4RA 3QUXB 2RH0A 5D1QB 4MYWB 3ME0B 1L9RA 5EBWA 1GGBH 4EDWH 4ERSL 4PJXA 4OZ4B 1LMKA 2O30A 1CL7H 2P5WB 4JDEB 4EI5B 4IYKA 4X6BB 1U58B 3T4YB 3H0TA 2Q3AA 1B2WH 4XPGL 3PWNA 4N2DA 2COVD 4YIQB 2J8OA 2BHUA 3ZQWA 2ORBL 1M1SA 2XDHA 4AZUA 1OW0A 3MV9E 3NCYP 2GK0B 2Q6WA 1ETJA 5CILL 3CLEH 3Q0HA 4QIRA 1X6NA 4K73A 2GITA 2LV4A 2VDLH 3ZKMC 5I6XB 4XCEA 3FTUA 4LLUB 2CPCA 5B39B 5CIPA 3EAKA 4X6FB 1P7QA 3HHMA 1SMOA 2I24N 5AZEL 4K9EL 3K6IA 1TQUA 5I9QC 4X4ME 1AKJB 4PCKA 4C4KO 1SPDA 5C0AD 4NKIL 2KI6A 1J1XH 2HG5B 4F2EA 1FUNA 4O02H 4HD5A 1RIUL 4U1NB 3LVEA 2E7LC 2HX9A 4WNSA 3H42H 4MWFB 3S36H 1QA9A 2CJSA 2K8QA 4Z8FL 1S9YB 3QH3B 4OH2A 5KVMC 5L8JB 1J1OL 2CKBL 2CO4A 1JPTH 3MJ8A 3ZVVA 4DGVH 4Y9CA 4OD3L 1SOKA 1VZGA 3IGLA 2DM4A 2I9TB 1UWXK 3UBXB 3DX4A 2AEWA 5I2IA 3B8YA 3FCGA 3KDMB 3T77A 4BFFA 5KW9L 2FUTA 1C16B 4LP4A 1XV8A 5C0NC 4Z7VE 1AR2A 4C83A 4E5XG 4HD9A 1LWRA 1IB5A 1WFIA 2AEOA 2VZUA 4BRVA 3Q8AA 3H7BB 1QD0A 4HF5H 1DEEA 2OTPA 2XHNA 4AI7A 3E3QC 3RNKB 3UTPE 3DECA 3WJJC 5CAYB 5IW6A 1DO5A 2WOYA 5CBAB 1TQWA 4N2HA 3O6KH 1PFCA 4ZFOL 3JWNH 3H6AA 3ILPB 3WTTA 1FL6B 3VMPA 1CGVA 4Y5VC 5GGSB 3T0AA 4WY7H 4P23A 2YSTA 4DVRH 1QEWA 4LSDA 1LP9F 3TN0C 4XC3L 4PRHE 3PWLB 4XN9A 3BEWB 1ZXQA 3QXDB 1AIZA 2BC4A 2NTFA 3KXFE 3OQRA 5LBSL 1HQ4A 2BCKB 4BQ9A 5BXFA 3GSWB 1X5JA 1JZHA 4GSDL 2LLLA 4FQPA 2AVFA 3QI9C 1FHNA 4N90D 5T3XE 2V5RA 2B7DT 1XGYL 3OHMB 4MD5A 3MUGB 4LLDA 1MFCL 5C9JB 3QCTH 1KN4L 4BCXA 3OKEA 3T1WA 1ZS8A 2NY0C 4OFVA 4XB8A 3I9GL 4ALAC 2V7HA 4P5RA 5FM5M 2HYMA 4JR9H 2WWMC 3VM5A 1M3IA 1CGSH 1JCVA 2IDFA 2W80C 4YO0B 4G9DA 3O6FC 3LKSB 3H9SB 1SM3L 5L8LB 4GIOA 3TCXA 4A7UA 5KYXB 4JO2L 2APWA 4ICXA 1NBVH 1I3RB 2ZXDA 2GPZA 2IG2H 2UZXB 2X38A 1OCWL 1S9VB 3U0PA 1N12A 1L7TL 2ED8A 3E8UL 1R5WA 3CHPA 3L7FB 1TFPA 1N2RB 2H2SD 2WLLA 3D34A 3LS4H 3QJFB 2YPLB 2DQMA 3CVHA 3RPIB 3THMH 1XGUA 2EXSA 1AI1L 3SKNA 2CHDA 4JFFD 3B7RL 4LSQH 2FE0A 4IRJB 4FLSA 3KPOA 4JE0A 4P46A 5D6CB 1YNTB 1QO3B 2Z0UA 1F90H 2WXNA 3ASNB 3W0WA 2VLJE 3OBAA 1MEXL 2F74A 1AC6A 3I9AA 4M7JH 2R69A 2A73A 3VFRB 2C7UB 5DJ8A 4PYHA 1IAOB 4KROC 3R7RA 3T3PF 1ZHBB 4CJ1A 3QYCA 1MCIA 2VRKA 1HN1A 1JF1B 3RJDA 4KTYA 2A38A 3ARWA 4EMZA 2CE6A 3P73B 5AL8A 3TEYA 3ATDA 1H3PH 3CQFA 1D5BB 3MRNB 4M8QA 5HHPB 1WE5A 3QUHA 4U1SA 3ZDYE 5J1SC 2MCPH 4DKFH 5DLLA 2JE8A 5D7LE 3L4UA 3QPQC 4H0HB 1HL5A 1FZKB 1A7OH 1JRHI 5E51A 3ARBD 3GKWH 4CC0A 5EEVA 3FF8A 4I0PA 5A2CA 2V37A 1QX1A 4U1KB 5I30H 2W0FA 3W37A 3O2DA 3TO4A 1QQDB 3GBNH 4PG2A 4XX5A 3NJKA 5A16B 5LB1A 4U49A 4AQEA 4NC1C 5IVZA 4HK3N 3VXUB 4AY0A 2CLRB 3ZZSA 2YR3A 1FGNL 2XJKA 2GAZA 4RMUA 5IJDC 3LZOA 4XHJC 3WGVB 4L4TE 4HGWB 2Q7YA 3Q44A 1GC1L 3L7EB 4GO6B 3S37X 1B0RB 2OR9H 4L48A 3ZE0F 2PPEA 3LSOA 4AK2A 1BFSA 1RZGA 1E7VA 3GSUA 1V3LA 3AXLA 5FYJE 2E27L 1I8KA 2DWEA 3P54A 1S7TB 3AQYA 2WYTA 4L1SA 3OZKA 1AGCA 3UYOD 1VB9A 5F96H 3WGUB 4PBWD 3TS8A 1N6QH 4OCYH 4CBZA 1ES0B 4GAGH 3FZUC 2R4SH 4FFYA 1ASOA 1YECL 2YZ8A 4JO1H 3L3OC 4HWBH 4RQQB 5KZCD 1KPRB 4X6DA 3BVUA 4P2QB 4P57A 2E9IA 5KSAB 3H9ZA 4ZUTB 4Y88A 1UZ8A 2D03L 2BP0B 2UWEB 1YN7A 3P4MA 5F3BB 1AO7B 1DQDL 1R5VA 1HIML 2C9PA 1GHFL 3QRGL 4LDCA 4RMBA 4KMQA 4AE0A 3WNIA 2FNWA 1TCRB 2P26A 3T8XA 1CLZH 3TFKD 2EVIA 4OM1L 2EIZB 3ZK0A 3SE4A 1MH5B 4MX7A 4C59B 5FFLA 3HAEA 4WWPA 2DDQL 3QR0A 5JQIB 2F53A 4P2CG 1MVFA 4K07A 5BZDA 1FIEA 3AABA 1G7MA 4ESKA 3LRMA 5E8PB 5I6LA 4G8GB 4GH7B 2E74C 3CDGB 4GRLB 5C6PB 1MFAL 5GRXG 4QOKB 1MFMA 2YEVB 3SDAB 4WV1C 4PJGA 5IHZB 4N68A 5HI5D 3D9AH 5DLMH 3B2UC 3W9DB 3L5WB 1G1CA 2D7PA 4YHLL 4XMXA 4YE4L 3TYFB 3UTTB 1JD9A 1PZAA 1WITA 1AXIB 4WTXA 2CKBB 5H37H 4IHOB 2CBPA 4M93B 5GS0D 4AYFA 2F7RA 2XA8H 4PAZA 2IGTA 2PTTB 1Q0YL 1X7QB 4DIXA 4OI7A 2EDXA 5E6ZA 3WHE1 1QASA 4QCIA 3DMMD 5EIVA 4Y1SA 3ETBJ 4FQQB 3D0VB 3ZOAA 5E4EB 1HZHH 3ZE2F 3GZPA 1ANUA 4AMKH 3PWUA 4P2RD 4BCYA 3FB8B 5JORB 3N40F 4QRPD 3HRZB 3U1SH 1IKNC 1K85A 2Y7NA 2NDGA 4Y19D 3VMNA 3OJDA 5T3ZL 2FT6A 5SWZE 1Q9WB 8FABB 1J7VR 4NO2A 4IIQC 3NCBB 1NEUA 3TGXA 3VRLF 2C1PB 2XVLA 2YUXA 3D39B 4WLCA 4ZFOB 3FQTB 1FFPA 1QFHA 2EYTB 2MOGA 4E42B 1WD8A 4M3HA 4NKOA 4NQSB 1PQZA 3QZWA 2AABH 3KLAA 4HWNA 4I77H 2Z7ZA 3EDJA 3WSQH 1QW8A 2I9LB 5CGYC 3U2SA 1MHCB 4L4VA 4V1DE 4XP6L 3V7AG 1PZDA 5KBKA 2YD0A 3J7HA 2G2PA 1FHGA 2F7PA 1PFOA 5KANI 1GZHC 4KXZH 4ZX4A 3MRLB 4V33A 2WXIA 1VPOL 4HCFA 1A6UH 5CJOL 3MOBL 1DANT 1ZTXL 3CD4A 4Y4KD 4P5KA 1WQVT 3IDIB 4IBLT 3QXTA 5L2JA 2HFEA 4P4RA 4LARH 3LH8A 5E70A 3ZDZB 3NDYE 4O00A 4OCRH 2EEAA 1JI2A 2FGZA 3D85D 5FO2A 4MXQD 3GI8H 1IQWL 3DXAB 3WIHH 2WTPA 1VFOA 5E6RB 3TTYA 2Y07L 4KI5C 3RFZC 3ARSA 2NOYA 4UM8A 4JDZB 4YL4A 1YQVH 4X6DF 5I5RA 2IV9A 3IFPA 2AXGB 7FABH 3VGAC 2EEBA 4AJVA 1SDYA 1NC4D 2QTVA 1FIGL 4NXSA 4XNMA 1UGNA 4TXVB 2HWZH 5D70H 1BM3H 4G9FB 1QBAA 4U1GC 4AIZA 3BIAX 4WGWB 3BWSA 2JJTA 4JDVB 4XH2B 4TNFA 1JUFA 3MMEA 3UJTH 1CLYL 4FZEH 1HNFA 5DD1H 2Y36H 4TNWF 1N68A 1JV5B 2BY3A 5C0CA 2V9QA 4X7DC 4B7IA 2H2SC 3S0PA 4YZFF 4PJBE 5DD0H 1WHOA 3GMQA 3WNMA 3P0YL 1MJ7H 4UV7L 3CPLB 1JE6A 4D9QE 1IFGA 4KJQD 2XQBL 5B39G 1F4XL 3B6SA 5EZPA 4A2DA 2A6KB 4PJGF 3VWKA 2CSPA 4GIAA 3T0EB 1U93B 4EDXA 5AW5B 4OGYL 3HC4L 1U8LA 4HISA 1H5BA 2I60H 1LO2L 2CR0A 2Y6TE 3NRQA 2EEXA 3D6GA 1ZJBA 4JPWH 4YAQB 4L9LC 3L2NA 1EMTL 3VQ2C 2G5BA 4QHMB 5GGRB 1UD6A 2AJYL 2OTUA 4OIFA 5AVUB 3T09A 3ZDXB 1DJHA 2PWGA 1EAJA 1ZKAA 4ELKA 2J4WH 1J8HB 4XBGB 4C4BA 5HDBE 4ELMA 1L9MA 2G5UA 1WFOA 3GMPA 4U6XA 4G1EB 2HN7B 3D4GA 4I3SH 3UBXG 4Q56A 3ARBC 2WB1A 4IU2B 3NZ8A 2PCYA 4QRRB 1TVHA 3ZY7A 4JZJA 5IMKA 4B9FA 4GUCA 3TVMD 1FNGB 5DD6A 3U79A 3VTAA 3LNGA 2IH1B 1HJCA 1NFIA 3IE9A 4LAQL 2WMPA 2ZUQC 2OSLA 3MX0A 1KBVA 5F0MB 1FO0A 3HOGA 5B1JA 3HG5A 3I75B 1QR4A 1V7NL 5IMMB 1KSRA 3CJJA 4XPAL 3TZVB 5EEYA 3A6OA 4LASH 1TEYA 3DJRA 2SEBB 4Y1AB 3K91A 1JS4A 5EPMA 4PJDA 3NJFA 4OFIA 5CCGE 3RGVC 4S1SH 2YC1A 4F2MA 4PP1D 3GBEA 3SQOH 1GGIH 1XGRA 3RZCD 4HKBA 5EDSA 3FYEB 3M1BA 1KMGA 2PPFA 1ZT4B 5DK2A 4R0LA 1EAPA 1T4WA 1JF5A 3QHFH 3T0BA 1MCOH 1OAYH 5EO0B 1YEEH 3QNZB 3DTXA 1JFHA 3K71B 3OAUH 1ETZB 2CK0H 3BIKB 5C09D 4ADGA 1XCXA 2V8MA 4FD0A 2Y5QA 1XGPB 3CX5K 1ZT1B 2WBKA 4YX2H 3JVGC 2OJ1A 3V10A 2ZG3A 4PWGA 3RY4A 2Z8WC 2D7OA 3JUZA 3GUFA 2XWXA 4JKKA 3V5DB 4D0BB 2V7NA 3FUJA 4EIUA 1JGUL 3TFKC 5JHBA 3O3DA 3PPEA 5F9DC 1W0VB 3U1QA 3KJ4C 2IDSA 1BECA 4BFEA 1LEIB 2XWCA 2ZOKA 4ZMWA 3EIFA 4RAVA 1N0XL 3MUY1 4YDLC 2Z9TA 3MLXL 3S3BB 5JOEA 2HVKA 2V3FA 5E56A 3S3JA 2JIXA 5KYUA 1DQML 1L7IL 2R8SL 2NXYD 1DCEA 5F1NA 2UY6B 4R90H 4RSYA 1BGXL 4XPBL 2VCOA