4YL9A

Crystal structure of wild-type of hsp14.1 from sulfolobus solfatataricus p2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
MNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAGFNKDKISVRLSAQNELIINAEREIQYIGTKYATQRPLKIHKVIRLPVKVKRDSQVTAKYENGVLTIRIPVEGSVSIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-State Structures of a Small Heat-Shock Protein Revealed a Molecular Switch for Chaperone Function
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain 98/2)
molecule tags Chaperone
molecule keywords Heat shock protein Hsp20
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4yl9A00
1GMEA 4YE0A 4YDZA 2WJ7A 2CG9X 2N3JA 2Y22A 4M5SA 4PCKA 4YLCA 4YLBA 3L1GA 4ZJ9A 3QORD 2JKIS 3EUDA 1WFIA 3AACA 2CR0A 2Y1YA 3Q9QA 3QORC 1SHSA 2MNWA 3AABA 4FEIA 1X5MA 3QORB 1WH0A 3J07A 4JUSA 2K8QA 2WJ5A 2RH0A 5DS1A 3GUFA 3Q9PA 2N0KA 4PBDA 2BOLA 2O30A 1EJFA 3GT6A 1WGVA 3VQLA 4JUTA 3W1ZA 2KLRA 3L1FA 4MJHA 3N3EA 4YL9A 2XCMC 4I88A 4RZKA 3QORA 2KMWA 3IGFA 2Y1ZA 4ELDA 4M5TA 5LUMA 1RL1A 3L1EA 5DS2A 3VQMA 3GLAA
chains in the Genus database with same CATH superfamily
1YNKH 2EIJB 3LQAL 3DXAB 4JPIB 4U1HB 4X80L 5EC2B 5SWSA 4QAMB 4IRJB 1MDAA 1NMAH 5FKPA 2EYSB 4M00A 2HFEA 1VFUA 3QJHA 1VENA 5DMKB 2XFXA 5EFIB 2CBTA 3NZ8B 1QSEA 4GG6E 3STBA 1FL3B 4FC3E 1BREA 3BP4B 3B5GA 1Q1JH 4XC1L 3RE0A 3V5KA 1DVYA 1OGTA 1ECZA 2YUXA 2O6CA 3BD4A 3I50H 4PREA 4ELMB 4BK5A 1XTMA 3BPCA 3HNVH 5ESQB 4LEXL 5KBPA 4JJOA 4ZOCA 4LXFA 1MVFA 3K6NA 4LF3B 4PS4L 5EPMA 1U8KA 2IGLA 3DX9A 3OLIA 2GJZA 3OGCA 5DURB 4HWBL 4J1UB 3P73A 1T1YB 4LLUA 3TM6A 4RISH 1QLEL 3CZKA 3QA3A 3QCVH 4E41A 1MKFA 1NICA 2DQFB 3FUEA 4WUUE 4OCSH 1R46A 3N40P 4GP5B 2HVBA 2F74A 1OGAE 3BZ5A 4IU2B 4XP5L 3K2UL 4Y4HC 1YEIL 3MACL 2DAVA 2WKOF 3E6FB 4MQXD 3TLRA 1N10A 4NWTH 3LNIA 5A6IA 1J5HA 4G8FB 1TO4A 2Y2YA 4KJWD 3STZA 3GBMH 4M7LL 1ND0A 4GQRA 1NBVL 1SFDA 3PF2A 3OHXA 4ILDA 5IR1B 5JW4M 4GXVH 4GUCA 5DHVH 3VQMA 2W0KA 5ESVB 4P5TB 2ENJA 3ZHLA 1GS7A 2Y5TB 4Y4FC 2IBGA 1W0VB 3B2XA 1JZJA 4ORZC 1OM3L 1M05A 2ISDA 3MRFB 4HISA 3KPRA 1E5BA 1G7JA 3O3BB 4OFIA 4LCIH 2Z8SA 2F7OA 2X4TA 4PJ5E 2QHLA 1ZHNB 2ITDB 3IBEA 4XXDA 1IO4C 2XWTB 1H5BC 3WNIA 1ZHBA 4KK9D 1W72A 4GSXA 4OUOA 3O8XC 3RVXD 3MV8B 2X88A 4CILA 3TBTA 1IC7H 3ZDYF 1M3IA 1A6TB 2W60B 2DIAA 3F7VB 2J12B 4Y1SA 2J5LB 1DLFH 1P4IH 3GXMA 3TWCL 1RULL 4GAAA 3E80A 1XIWD 5JHLL 1BSIA 1IARB 2CE6A 4WK4B 1G84A 3IEAA 4M5ZH 4G8GE 1BZ8A 3GSRA 1MG3C 2BPBA 4A2GA 3GSXA 4I8DA 3ARFC 5BO1H 1Y1DA 4WWOA 3WGVB 5CD5D 4HXBL 1EX0A 3GTNA 4WDIA 5GGQH 4XCNA 4BZ1L 5KN5B 2WO3B 4WHYG 1E43A 1MCOL 1N7ML 2UWEB 3GDCA 3LB6C 4MS6A 3MCYA 4QHMA 1QEXA 1WGVA 2Y7NA 2YFNA 4RIRB 4AYFB 2F2HA 3QJFB 1U8MA 3ROLA 1IGJB 3HS0C 1CL7H 2AVFA 3F7YB 3P9LA 1G7QA 1CF8L 1UG9A 3LKSA 1LO3L 4M48H 4FNRA 5IREA 4X6DB 1JFHA 4TUJB 5IHUH 4PVBA 1XGQB 1G4RA 3AREA 2GI7A 1GGCH 2CNYA 1MCOH 2EDKA 2GBAA 2Q3AA 3Q9QA 4Z1PA 1BEYH 4M3JA 1RZFL 2GFBB 3QAZC 3L8QA 5TDPA 1ZCRA 3OJDA 5HYIA 3CN1A 3ESMA 3MNZA 3P0YL 4Y5XA 4ELME 3CSYB 3HMXA 4NNPL 2VKXA 4N8PA 1DSFH 1DJZA 5F6IB 4OLYL 4JKLA 3HZYA 3DNKA 1HK6A 1QSEE 1J05A 4HSAC 2AV7B 2CK0L 5I1JL 2J8HA 3HHSA 2H2PD 2WTOA 4JZOA 1QVOB 3SCMD 1QNIA 1ADQL 5CMAA 1ZMYA 1XF4B 2GK0B 2OL3B 5DJAB 2FE0A 2BXZA 4LCWA 2Y7OA 2IANA 5E1QA 1MFEL 4PLJC 2XV2A 2DLTA 4M93C 4UQ3A 1XF3B 5CBEA 1WLHA 3VB8A 4DIXA 3ULUE 2YJLA 1R3IL 4NUQA 2HJKB 2EKSB 1PYWB 4HJJH 5I1HL 1N67A 4NKDA 2AQ2A 3MRRA 2NQDA 3ABGA 1JTTA 5FUOL 1FFOA 3BXNA 3HC0A 1B6UA 1M42A 1VA9A 5D5MA 5CD3B 4PLJD 3L7FA 4PWKA 1OPGH 4NXKA 4XRCB 5AW2B 2C9SA 7PAZA 2BSSB 1B88A 1JV5A 2B14A 2CLZA 5C0IA 4FKEA 5EUKB 4LNVA 2W0LA 1MLCB 4Y2OA 4DJMA 4GW1B 3KLAA 1MCJA 2XIIA 4HT1L 4QHNA 4Y2DD 3MXVH 3CN3A 2AGJH 2IC2A 5JPMB 1AZRA 3KWVA 3DGCR 3MA7A 1OPGL 2VABA 3AMKA 3IJ9A 4NKMA 1FNEA 2L04A 3ALXA 4U6XA 2QPFA 4MD0A 4ECNA 4F1ZA 2C7UB 5DQJB 4F92B 5IW6A 1K4CA 2YAEA 1KDIA 4EUPG 1PQZA 4L3EB 4BK5C 4DPRA 4NC1C 2XN2A 4FN0A 1JJUA 5TE7H 3C08L 3X3GL 1V7ML 4L0YA 4K2UH 3S5LB 4P3DA 2OMUA 2WZPD 1FWXA 2JTYA 2WQ8A 3KPMB 1JPTH 4X9FA 4MAYA 4UQDA 3TZVD 3L5IA 3MV7E 1MJ7H 1B2YA 2XG5A 3KJ4B 4PJAA 5D1QE 3PGDB 2OSYA 2CDFB 4FFZA 3SDCA 4U3XA 1NIDA 1ZLVH 2WCPA 3ZHDA 3APCA 4Y9FA 2NW2A 3ZTEA 3MJ7B 5I15L 5I6KA 4A67A 1MPAL 1ASQA 1QA9A 2WOYA 3GBNH 2N3JA 3NFPA 4HKBA 4IOIB 4XBEL 4X4ZA 1BLNB 1HH9A 2D4FA 4AIXA 3QARA 4ZG1A 5GRUL 2E6PA 2WWMC 2X05A 4ONGH 4NZTH 1ZAGA 4XPGH 3FDWA 1RSFA 4YHYB 5DFVC 4ODBD 1RZFH 1LO0H 2YMXH 3VXRE 4LHUD 4UINH 3A4AA 3LN4A 5IHHA 1HNYA 1LE9A 1CLVA 1TXKA 3GS0A 1YY8A 3NRQA 4IU2A 5T3ZE 5GRJL 2K8MA 4PJHB 4WENB 3MUHL 4MQ7A 3AT0A 2V9RA 2WLLB 5GRXG 1ZXKA 1UKTA 1EV2E 1PKOA 4Q6IB 4UNTA 5IQ9A 5DJZA 2YPKA 3U1QA 4MMYB 4WW2B 3VD0A 1CZ8H 4L4VB 3NFSH 5I66B 2YGNA 2Z7WA 4PJHE 4P5TA 5JOPD 5DO2C 3BZEA 1JGDB 3VXRD 3SKMB 2WY3B 3LIZH 4U6HB 2OL3H 1JK8B 3B56A 4I3SH 4QRAA 4D8PB 3P54A 1SXSA 3I02A 4PV8A 3VXSB 4QDGA 3NJVA 2CGRL 1YUKB 1LLAA 3QUMB 4NQSA 1T0NB 3II3A 4LPXA 1KLFA 1CDCA 3L95A 4DKFL 4A68A 4GEIA 4HQQL 1KCVL 2Y6SD 4U1JA 5C0NC 5FV1L 4IQHA 1ZKAA 1RIHL 4G7SB 1NGZA 3WIFB 2AJXH 3H42L 4DZ8B 1GZPB 4Z7UE 5ABDE 3U36A 2E4FA 4Z77B 4M29A 1U8OB 2KPWA 1XGTA 1KTKE 5I8OL 4ZI8A 1D3CA 2CGRH 1I1AC 3RWIA 3VA2C 3VDAA 1OXYA 1EEZB 1VRSA 1EO8L 1CXLA 3HR5B 3K7UA 3W38A 1RL1A 7FABL 3PWJA 2NUTB 4WGWB 3CFCL 2K3TA 2FHBA 3ILDA 2DTML 2PWEA 3LEVH 5DHDA 2C3HA 3O45A 1T83C 4LOUD 1S7XA 1WIOA 2X3BA 1W9XA 3QIUD 4DK6A 4I0PB 1RZGB 1ZIAA 2CR0A 3WFEL 4OF3A 2HKAA 1HHKB 1QRKA 4HZAA 2OR9L 3RBSA 1I9JL 4JZNB 3D9AL 2WIIB 2J8UE 1RZJC 3H4HA 2MQCA 2YN5A 4O00A 1VPOH 3AREB 3Q1SH 2H2SC 4DUXA 1Q0XL 4YPJA 4N2BA 1F02I 2GFBA 1AR1C 4MDJB 3RVTC 5F89B 1SJHB 1AHMA 1KYUA 1ZK5A 1XXDC 1AGDB 4HLEA 2ZNXA 4KUCF 1FLRL 2I25N 4JM4L 4CKVX 3SDXA 1TZAA 4H88H 4NQDA 2K4WA 3IFPA 1ZWIB 2J8UA 1BXXA 4V33A 3L9RB 1E6OH 4XC1H 3TPUB 1NGQL 2VKWA 1I31A 3LV3B 4X4MA 1TVBB 1GPOH 4PUBL 5FAAA 2P7TA 3D50A 1XD1A 1EBPA 3CH1B 5C71A 1WEJH 2BJMH 1A6PA 2R59A 5EULV 4JZJB 1BZ9A 2OXHA 3O2WL 4N86A 1V7MH 4ZRGA 2E7CA 2K1MA 4Y16D 1HEZB 3FOMA 3TJHD 1U0QA 3MRQA 1MHEA 4NP4H 3ULSB 5FYKU 1JZGA 5E2WH 1B0RA 4OLZL 3GNMH 1CDBA 4KX7A 3C5SB 5C0GA 1NBZB 4ZUSB 1X7TA 1J12A 1HL8A 3CDZB 1S9WA 2QMJA 4JDTH 3MXVL 3K6IA 3OX8A 2EE9A 3QNYB 3IU3A 1A9EA 3K5SA 3VACA 5CR1A 3Q3GB 2CLZB 5M94B 2IALA 3CBRA 4ALAC 1K8DB 2UUDH 2XHNA 5C0BB 2LU7A 4IBYA 1QWNA 5F97E 1A7BA 1A4JB 1IM9D 3OQ3B 4PGCB 2CUHA 3FFCE 3T0EE 4KXCA 1NCWL 4BE5A 1J86A 2B3IA 1JERA 3QXDB 2BDNL 4KK5C 1MY7A 4PJFA 4PRIA 1U8QB 2VN4A 3WDJA 4YHMH 4HGKC 4XC3L 5EF0A 4F37F 5CFHA 3R8BB 5KBMA 1I75A 1NCAH 2EDWA 5K9KA 4PRDB 3KPMA 4OF0A 4I13B 4JO3H 1Q4NX 3N85H 5SWZB 3V4PA 2PYFB 1FCCA 4PYHA 4LRNL 4EZJA 4H1LG 5ICXA 5K9QI 3WLWD 4GKZB 4YEEA 1NMBH 4LP8A 2JJSA 1UM5L 1YMMA 2PPCA 2GIYA 1MJ8L 3R4DA 5FGCB 4AQ8A 3V0JA 3NGBB 5IJVB 1LDSA 4LDEB 4GUQA 4J5VA 1CLOH 2ICCA 5L4IA 4JHBA 1KTJA 1NKRA 1XIWA 2F8OA 4QXUL 2NXZD 1KACB 3AGWA 2V9QA 5HXMA 4RMSA 2ZXEB 5G5DA 1KGCE 2JV6A 2YPLB 3ENEA 3N0PB 4JB9L 5A2IH 1MJ8H 4R4ND 5BW7A 3K6FA 3SE9H 5C08B 4J3XA 2D9CA 4OZIE 1OSEA 3BO8A 3HI6H 2UUDK 2YGQA 4MQ7B 4LL9A 4Y7MA 4CMMB 2ZUQB 4D94A 1R9FA 5DJDB 5B39B 1BVKA 1JYNA 3KNBA 1JXJA 4LU5L 4XI5D 1J0JA 3R06B 3FTWA 3MLUL 1VADB 3G5YB 4FNUA 1G0DA 1YDPB 3DMMD 4JAMA 3LIZL 2UY6B 3O0LA 5DEFB 1RK7A 3UG4A 3H3PL 4JPWH 4HUUA 3I84A 4I3SL 5EO0B 3HG3A 4WUUB 4PRNB 2P5WB 3GIZH 3GC3A 4YSEA 5GRZA 4IRZL 2OJZL 3ZKMD 1IGMH 4AGLA 2K6WA 1PZBA 2ZICA 3UEQA 3CK0H 4L2LA 1N2RB 1UD3A 4HKXB 3UC2A 4OQTA 3VXSD 5KUMA 2ITFA 5IROA 2N0MA 4F2MB 5FHAL 4G43A 3H55A 1A7RH 1M9SA 3UTZA 2AV1A 5DMIH 1XAKA 2F8IA 1RSYA 4BKLA 2VDOH 1ETB1 3UZVB 5D5ME 3CPLB 3NIDB 4DZ8A 1KLUB 1FVEB 2JTDA 3GMLA 2ED6A 4G8IA 4FABL 1FFNA 4ISVA 2IADA 3KDMA 3QCUH 2AQPA 2R27A 1G1YA 1UB5A 2LHAA 2R23B 3MZGB 3QUMH 4R7NA 3PQYA 1YNTB 1TMCB 4B9GA 5KYWB 3D3VB 5AOKA 3ZDYB 2R4RL 2R29H 5AVQB 1CTMA 4ZUWA 1DVTA 4JFZH 2VN7A 3KBEA 5JR1L 4H5SA 1KFGA 4KK8C 3HZKA 2HKFL 3T04D 3KZ8A 1T04A 2B9AA 3TBWB 1ONQA 1WD9A 4ZQKB 1IBGL 2F15A 5DVKA 1O5PA 1AI1L 4Q14A 4MNHA 1KJ2A 3HHRB 4WWKC 1UWXK 4JY6A 4KVNL 2XQYA 1YUHB 1T20A 4UF7C 5G4OA 2XQYK 5C0JA 4MJ5A 3UPAA 1AY1H 3B7TA 4MDJA 5F89A 3Q2VA 3QZNA 3BSZA 5AOJA 1MHCB 3VRLF 4HWBA 3F84A 1UGKA 3NABL 5C9KA 5EBMB 3DYOA 4PJBA 5KSVB 1PZ5B 1MNNA 2CPCA 2C5DC 2ZOTA 3HNVL 4Z7VA 5B1BB 3QUHA 2QZQA 4U3SB 2EIZB 2ADFL 1MVYA 3MUGB 4LBAA 1NGWA 1OD9A 4MA3B 4KMQA 4M93B 3MN8A 2J8UB 1CXIA 3FTXA 1BYOA 3TPUA 4H8VA 5I73C 3U79A 3PIQA 4FOMA 4YNYB 1YECL 3F2LA 4AJYV 2V2XB 4CVZA 4MAZA 4JG5A 3VSUA 4KUCD 1MAML 2Q3ZA 4JO2L 3K72A 4PGDA 2DZEA 5L8KB 2XC8A 1SN5A 1TJIH 2V17H 5F6HI 5CF3A 1VFMA 1DQDH 1DBKL 4WJG3 1A7PH 4YVNA 2BIPA 4RWYL 1DEEA 1FNSL 4OUUA 1I8IB 5BVJB 3FONA 2RCSL 5AB9A 1MHEB 3WHE0 3CSBA 4JMNA 3RP1A 5GPRA 1O6SA 3S8FB 1NKOA 2MCAA 5CGMA 3MA9L 4FQXB 1ZS8A 1FL6B 4BELD 2X2HA 3BW9A 3MYZA 2E4TA 3PL6D 4PG2A 4MCZA 4FD0A 5E4AA 3X3FL 4P2QB 3ZMEA 2F58H 4JHAH 2EVHA 3GO1H 4C56E 1D5RA 2DY2A 3LZRA 3VNYA 4PRPA 1C5CL 3ULUF 4QNPF 1JRHL 4HP5A 3OX8B 2P5WE 2MRYA 1IFHH 2PPFA 3CHQA 3MBED 4DP6X 3EBAA 4CVUA 4YE4L 1O0VA 4PTTA 1T2XA 1E4KA 1O5DT 5F9WB 4R2GD 1X5KA 1RIUL 1LD9B 1PW3A 3RGVD 1IQDB 1XZ0B 1G94A 1SOKA 3FAXA 5KEZA 3ZE1E 4MJHA 5DT1L 1DUYB 5G2NA 2OL3L 2Z7UA 4F8QA 4ZX3A 2FK9A 1B2WL 1C5DB 1NDTA 3S97C 2YEQA 1FDLL 3ECUA 1GS6X 4UYPA 1GHFH 1HZHH 3V4LA 3WS6C 2K6ZA 4GAJL 3ZL4H 5I6MA 2ZNWA 1OSZB 1MVUA 2BHYA 3HRPA 5IFJB 3JYBA 3SCMB 4WKZA 1UXSA 3DVFA 1DBAL 3O3AB 4R9HA 1E7UA 2GSIB 5I1LB 3V52L 4OZHA 4IM8A 3O6ML 4Y4KC 5HHOD 1MRFL 2P5PA 1IX2A 3VQLA 2WBWB 3QO1B 2CCLA 4OLWH 5E1GA 4U6VH 2HCZX 1YYCA 4NJ9L 4S1SL 2B9BA 3QUKB 4YSTA 4LNRA 3MCLL 3W81A 5LXGL 3DO7B 1OAYH 5I6NA 1X4XA 4NEHB 3C60C 4WI0B 1MXGA 2ZZUT 1NUDA 2H0PA 3GMMA 5J06A 4PD4J 4HIHB 4X8JA 5C6WH 1NH6A 1OF0A 2X6VA 4OIAA 2L7JA 5DS8A 3WFDL 1S3KL 3B7RL 5D7IF 2I9TB 3C5ZB 1NGYB 2EYTB 2Y9RT 5MENE 1NPJA 4JQVC 4GKNB 3P4MA 1TMQA 1XB6A 4F93B 1VLXA 2BFVL 3IGAA 1DBJH 1ZLDA 3W0WD 3H7BB 1QFWH 2D03L 3UTSA 2IAAC 4YK4C 3MJGX 1ZY9A 2PXYD 4K3GA 1VADA 2HLFC 3G5YA 4N85A 1J1XL 1RZ7H 5F44A 3QWNA 1JUFB 1FBIL 1DP0A 4LLDB 1KTLA 1YY9D 2X4UB 4YAQB 1U41A 3ZKMC 1CXEA 4ZSOA 2XZCH 4IBVA 3L17A 5A6MA 4ZYKA 3UZEA 1KJMA 4NCC2 2DLGA 2W0FB 2BOLA 2W8CA 2WOBA 3JV0A 2PW2A 4GQZA 1CGSH 3QDJA 4OCRH 1ESOA 3ZE0E 4AYBA 4Y1AE 1ASPA 1ZV2A 1E4XL 3K0WA 1L3NA 4G9FB 1IAKB 4Y5YA 2J20A 1WIPA 4MCYB 5IJCC 3KLHC 3HB3C 1ILUA 2A73B 2APFA 3VU1A 4G6MH 2HP4A 3LCYA 4UV7H 1LMIA 3T2NL 1HHGA 2HG5A 1GOHA 4XXWC 3IVKA 2IDTA 3T2QA 5T1JA 1L6ZA 2R23A 2YRZA 3P4OA 5K5YA 5I1HH 3KPNB 4M7LT 3UTPD 2ODHA 3RL1A 3OL2A 3DSFL 2WTRA 5AW7B 1P5UC 3C5JA 1UCTA 4HC1L 5LCVL 5ES4B 3D2TA 2J5LC 2EDOA 1S2EA 3T6XA 5IOKA 2QKIA 1S5HB 3S37L 4FG0A 3KG5A 4FQHB 3ULUC 3QJUB 4JDZB 2NQ3A 3PNRB 1O7DE 3S7GA 4FNLL 4FQ1L 3UH8A 1UENA 2RMNA 1AOZA 1R5WA 2QT6A 3FU9A 1A14H 4JPKL 4DGVH 2FHFA 1I3VA 1OAKH 3UBXG 2NY3B 4MD4A 3N0AA 3RUGA 4BCXA 3L4XA 2E9IA 2B8OT 5F6IC 3AQYA 3GGWB 4KITB 3RDJA 3UJIL 5CD5C 1FFPA 1T0PB 1C16B 3KEDA 1PY0A 4H4NA 4LLQA 4WK0B 3TEZA 1GSMA 2Y7LA 4Z7NE 2K78A 4JGMA 1FZMA 5DJ6A 4QD2E 1OCWH 4M02A 2VO5A 3FOLB 1GKEA 5EH1A 4YNYA 4CVZB 2ED7A 4P05A 1OGPA 3KHQA 4N0CC 1OALA 3EYOB 4D7BA 1OF2B 1OAXL 1H6TA 1AD0B 4JFDA 3OG6B 3FUNA 5E8PB 1WBXA 5T3ZD 3CDGA 3VWJC 1EHLH 5EO1B 1KN4H 5LQBL 3II2A 4Y16A 3Q48A 5D1ZC 1LNUA 3WTXA 5A16B 2F54E 4W4OC 3O11A 1T4KB 6FABH 3WL9B 2WXIA 1I8MA 2ZX9A 1SQ2N 4RA0C 4TNFA 1X7QB 2OSLA 2SODB 1JDCA 3MLUH 3RZCD 5IFAL 1FG9C 4YXKL 4YHKL 4HD5A 3WDIA 4TVPH 2NY3C 3G6DH 1IBHA 3SGEI 3OJ2C 5I8EB 1EA9C 3EJTA 4LCCB 3R7RA 2I32A 2QQLL 2ICWB 2XN9E 3ROOA 4E2OA 2DWDA 2VLRB 3WTTA 3RZCC 4MA7H 1PZ3A 5CWSA 1WICA 1CUOA 1X9RA 5JTWA 1I9EA 1TQCB 1IQDA 1XZ0A 3BP7B 4EUPB 4JO1L 1G1CA 4JQVA 3U9PH 1UUNA 4HXAH 5GISL 4X42A 1EJ8A 4BUHA 1HINL 4QTIH 1OW0A 1Z0MA 4NNPH 3IN2A 4DQOH 3MBXH 4BSVB 5K69A 2AQSA 1QX1A 4XODA 1MVUB 3RDTC 3WYRA 3V52H 5J12B 4QHUA 5I1IH 1ORQA 3CD4A 5DLLA 2O61A 1FZJB 1XMEB 2YD8A 4OAWB 2NY1B 1ACYL 2JSFA 4CN6A 3K4DA 5I1AA 3RGBA 1ZT1B 3FRUA 3IPEA 4HS6B 4AXWB 2EXWD 1TEFA 4EF3A 3H3KA 2NXZB 1DQVA 3BESR 4HAKA 2H6PA 2F5AH 4FHJA 4HWNA 4I4WB 4R3SB 2A0LD 2VISB 3WI9A 1I85A 1HCVA 3L5XL 4LDCA 5GQBA 1JNJA 3N42F 3HVNA 1Q0YL 5G55A 3CH8A 4Y5VA 4LEOB 1XGPA 4HLZH 4ZD3H 1KXTA 2FGZA 3N04A 2ZCHH 1QWHA 1NGYA 1UJ3B 1OD7A 1IRAY 3HZ3A 3GSNA 5DSCA 5ICUA 5K9OB 2IDFA 5BOJA 3FCUB 3K2KA 4LOFA 4GRWH 5FUZL 3IGAB 3GHBL 4BH8A 5ADPL 5LGKA 3HPJB 1NJ9B 4CC0A 1HHJB 3MLSL 4LSQH 2AXFA 3OD3A 4U7MA 4NO5B 2ITCB 4N6QA 1UD5A 2QVKA 2E27L 5E6UB 4X0KA 2HFEB 5DXWA 4AYGA 2O5ZL 5IMMB 3X1EA 2Z31B 3ZR5A 5KVMC 2AJSH 5T5NF 4ZS7H 5IHZA 1EHXA 1SQMA 4D0BB 1F4YH 1JHLL 1CLCA 2FGWH 4QOKB 5T1MB 1MAMH 2OMZB 4JO2H 3JVGA 3PDOB 1Q9OA 2R2EB 2NZ9D 4NQDD 3TS8A 1H8LA 4ODHH 4XNZB 1A7PL 4JHVA 4RWYH 2D3NA 1CLYH 1CT8B 4OGAC 2F61A 1MN4A 4LLUB 1WCQA 4YC2C 2V4LA 5CSZA 4DF9A 3FYIB 3MKKA 4IBUA 3LPFA 2FX9H 2MEJB 3TA4D 3U7WH 1HXMA 2QADC 3CLWA 3P77A 3RWCB 3KW8A 4P0DA 3HNSL 4G7YH 4PJ7A 4Z3IA 5A2AA 3H4FA 3ESVF 3OR6B 3NZ8A 1F90H 3GS7A 1MFAL 3ZHNA 1FV1B 4AVJA 1SOXA 3FH8A 3I6LD 5CEZL 4Z5RA 2HSIA 1PDKB 1UZGA 1I7TA 3CCHB 4NQXA 1BBJB 2WBXA 4UQIM 1WGOA 4BFRA 1T7WA 1N6UA 3FFCD 4N2GA 1YCSA 4HJ1A 3RJDA 5ESQA 5CJXA 3HNTL 3NTCL 4L9DA 5ID1B 1S5HA 4S11A 1U8KB 3DX9B 1UWXH 4P5TD 1YNTF 4M6AA 4ODTH 4K3EL 1MY5A 5ICYB 5BJTB 4U6YA 1IAOA 5I8CB 3JWDC 1UHVA 4YGAB 1JPGB 4YBLB 5E24E 3WELA 3HI5L 3FTGA 2VRKA 3KWWA 3B2VL 2DL2A 3NRFA 4MD4B 3RUGB 3D6GA 4KV5F 2CRZA 3FMGH 4U7KA 3RX9A 3TBTB 1TVHB 5B8CA 1KWGA 3TNNA 1XCWA 1P0SE 4CNIA 2EVJA 3G5VB 2NNRA 3WLWC 4N2AA 1F1DA 2VL4A 3FQRA 4WHTB 4M8RA 4QRUB 4W4OA 3FOLA 4O4YH 2K4AA 3KPSA 2J7LA 3H8NA 3RTQC 4HG4J 5E94B 1IC4H 3HFMH 1ZVSA 4HQQH 4U49A 4BRVA 4HWZA 2OX5A 5KANG 2NYYC 4LPYA 2EADA 4DGWC 5FYJL 5KSBE 1OGAD 12E8H 4OCRL 4W4NA 3C9NB 2Q7YB 3BSZL 3DBSA 3QFDA 2JKSA 4K7FB 2PYED 4PWHA 3TH4T 5L8LB 2IH9A 3INUH 1OL0A 4UIKH 4Z0XA 4O51A 3DX7B 1AR1D 3H3PH 4NDMA 1CDHA 1IGML 3F7VA 3PP4L 2ZCZA 2QDWA 1GYWA 1ZLSL 1JWUA 4TSCH 2J8UF 3QDGE 2X4NB 3HBZA 1WHOA 1X7QA 2OSLB 3L3JA 4AMWA 4FX5A 4A7SA 3UTSD 5LLIC 2QVFB 1OAQH 3Q01A 3GZKA 4QHPA 3SE9L 4YSRA 2VLLB 4NX0A 1YYMH 4XCNB 4B3VA 4DK3A 1S7UA 2BCKB 2X6UA 4W9CC 4PI2A 1LL1A 4RIRA 1KIQA 5ITFB 3HZYB 1JPST 2F68X 4GRWB 4R0LA 4HUVB 5D7LE 1A6ZB 3F7YA 4FQIH 1FZOB 1BOGB 5AVSB 1B4JL 1ES0A 4G5ZH 3AM8A 5ESAB 4AEFA 1S78C 2RIKA 3MV9D 3MRJA 4OQ1A 2B4CH 1BD2D 3QDJD 4BFOA 5ISZD 5IB1B 4OIIL 4J3OD 1MH5A 3N50A 1X5JA 3UJTL 2BK8A 2A6IB 2J55A 1EIBA 3WIHH 4HUNB 4LB8A 3NIGE 1ETJA 2K9FB 2NY5L 2CBQA 4NKDB 4KTGA 4MJIB 3DX6A 1MREH 1P9MA 1KUMA 2DF3A 2WSPA 4Z7UA 5KBKA 3R8QA 4RLDA 5GRYA 4JRFA 3QO0B 3POHA 1TKWA 5DZNA 5ERWA 4YDVB 2OTUA 4GG6B 1LQSR 1JAEA 4C58B 3AJ7A 1EO5A 2FZ3B 2WPGA 4LVHB 3SZKC 1IT9H 3NSCA 3GRBA 2YD0A 4UOW1 4JZOB 5I76A 2W88A 3BJLA 3FS9A 1EDHA 1ZA3A 2GABA 2PTUA 3WEMA 4GW1A 4FA8A 3HZMB 1O6VA 3TWYA 4FS0A 5ID0A 3N55A 5ACZA 1EHLL 4KJYB 5KBNC 3FNKA 4DVRH 1XF3A 3SPJA 4ODWA 4GSRA 3ZY7A 4MD0B 5D7EA 4NB7A 2NTFA 2F7IA 1YEEL 4KVCH 3ZTJH 1RJZA 2QQKH 2W9EL 1K4CB 4XN5A 5D5MB 4WGKA 3ZL2A 3BGMA 4UV4H 4MRBA 3C8KB 4J2XA 3L3DA 3WHXA 1EJ6A 4ZAKB 3EGXA 1MZYA 1TOXA 2B77A 5IV2A 2AXFB 5E8DL 3VM5A 4HBQA 3FQYA 1BD2E 1IBDA 3Q8BA 1PX8A 4HHGA 4MAYB 3CN4A 3GXPA 4NYLA 4RMQA 4ELKB 1ETZB 3FQXA 5HGAB 1MLCA 4CRPA 3SDCB 1CLZL 5GRVL 1GZQB 1ADWA 5DF0A 1VFOA 3RY6A 3V6ZA 2IAMB 4RZCA 4D0BA 3UPCA 4ZFZB 2JQZA 4K73A 2X89A 4V2CB 1TZOA 3QWQB 2BIMA 2BY2A 2CDEA 4WI6A 5E8DH 3T77A 3TJHC 5A1AA 3HZVA 3BLBA 3DHPA 2BZDA 4FYTA 4HDIB 4JFWA 4N0CD 4DN4L 2F53E 4EXKA 3KD4A 2P52A 2VMJA 5FLUA 1MCEA 3EYFB 1KIUB 3FFOA 5F7EL 2ZYSA 5FA3A 1YECH 4YWGH 4BV1A 3ZLQC 3D18B 3EAKA 3UTQB 4BGDA 1AP2B 3RUGF 5MP6H 5LGJB 4OVUA 2PW1A 2BIIA 1M7UA 1TPXB 2OMTB 3EBGA 5ANME 1QD0A 1IGYB 3WFBL 1CFSA 4PV9A 5GGVL 1YEHH 3SE8L 3S98A 1S9VB 2UXTA 2E75C 3K80A 3ETTA 1J9SA 1NUGA 2G3ZA 2OXGB 3F5WA 4MMYA 3BGAA 1PDKA 1HH6B 1I7TB 2EZ0C 3ZPDA 3ZKXC 3REVA 3K2MC 1EZSA 1DN2A 4DVBB 5JLZB 2JJSC 5H4ZA 1OW0C 3ZU8A 1ZSDA 2DQCH 3GRWL 3KS0H 2FJHB 2D3VA 3MRKA 3DMMA 1IGFH 3I6KA 3TTYA 2BCMA 2MCPH 1FIGH 3EZ8A 1SY6A 4IJ3C 3QG6A 2IDUA 4N2DA 1KXVA 4ZMYA 1SRDA 5JHLA 4Z7WB 4KK5D 3BUBA 4G6AC 3LPWA 1KLFB 1NCCH 5DRWA 2FBJL 4YXLL 4NBXB 4PGEA 1OE2A 3O8XD 4NIKB 5I16B 2M2DA 2WLLA 4EI5C 4U1JB 1CYGA 4ANVA 4ETQB 2DWEA 4Q7DA 1A5FL 1G9HA 4JPVL 4RGNC 5FPIA 1NGZB 4P2CG 4FFVD 3WIFA 1HJCA 3ZZSA 1RURL 1I1AD 5FYJH 1FP5A 4QRUA 1Z6JT 4MKTA 3OF6D 1J5OL 2X4RB 1AMYA 3SKMA 1A3QA 5C8JA 1I1AA 2BVOB 4LPTA 5LVEA 3JWDH 3SN6N 4U6HA 4X8XA 1EEQA 4LCWE 4N2FA 5IG7B 3QZLA 4PV8B 3VXSA 3CVHA 4RA3A 2CUAA 1A7NL 4EE2A 2LW3A 3VFOB 1XH2A 5FYLD 1G9EA 4HEMA 2W95A 2ROXA 5DMKA 3CV5A 1OARL 5EFIA 4K8RD 1JBJA 4GP4B 4KKPA 5KSUA 3TTSA 1N8OE 2BH0A 2OI9B 3FRPG 2A2QT 4HJSA 4HZLB 4DW2L 1OGTB 4ES8A 4J3OF 2MHAA 3L7EA 1EDQA 5B7MA 3C5XA 4PJ9B 5F9WC 3VX1A 1XGTB 1Z7JA 4F2ME 2ZONA 5EZOH 3ARSA 1HZKA 4MXVF 2EVIA 5JPNC 2HWZH 1NCGA 1RY7B 2VC2L 4ANXA 1SYSA 2ZXWB 1EQWA 3QA3B 4N1EA 1KIQB 4OZGA 4R90H 5AOZA 1HQRB 2D7PA 1AGCB 2Q8BL 4R0LB 4HUVA 2P4AB 5D6CB 1E2WA 5BV7C 1AO7B 1JGIA 4NOBA 4JM2C 1HHKA 4GH7B 2C1PA 2GBVA 1D6VL 1MFCH 4XCCH 1F6AA 4G6KH 4PTUA 1VEOA 4GXUM 5GGVH 3KLLA 1MI5D 3GSOB 4ONGL 4M4RB 5HHQB 2VE6B 5AVYB 5LO7A 4ZOEA 5HHMD 4MVBC 4PJBE 3HFFA 4TSAH 4JFPB 4P9MH 5I9QB 3HE6C 2ZCKH 1JYXA 4UOW0 1IIIA 2AEPH 4J3TA 1J0KA 3KPRB 3FTVA 1TZGL 5D4QA 4ZUSA 1MAJA 3BVDB 3RTQB 1NCBL 1TKWB 3MV8D 3ZHKA 2LLLA 4CL7A 4FI7A 3SE3C 1J1OH 4J3BA 4QNPE 3TH3T 5J0BA 3CH1A 2W9DH 3UBXI 1HSBB 2OMYB 1E9OB 3ILEA 4PG9B 4R6UA 1OANA 3DX0A 1E5AA 4ZMWA 1PKQE 1FE8H 1M1XB 1OTSC 1QNZL 1ET8A 3QUYB 1BXUA 5I19H 3Q2NA 4OZ4B 3PJSB 1RPKA 1MCIA 4PLOB 4JCMA 3G6AA 1WUZA 3VXNA 5H4YA 2WANA 3MGTA 1GTNA 2CJUL 4PAZA 3PABA 1NFDE 1GYVA 3CTTA 3O6FD 3N9GL 3PGFL 4PJIA 3EGXB 4FQQA 5FUCC 1KT2A 1M7IB 3CMOH 3FQUA 4XCEA 2W38A 2WXPA 3EO0A 3D87B 5BV7L 3AQXA 1J9RA 2P28B 2P8LB 5E4EB 3RNKB 3IE9A 4APQC 2C4FU 5J1AB 4PIBA 1CGYA 3V0WL 3WMQA 1M7XA 5IBUG 5IMKA 4A6YB 3MV01 5MP6L 3D48R 5LGHH 4HJJL 4YK4B 4MWFB 2G3NA 2FR4B 4BJLA 2JB5H 2G0LA 1TCRA 1DCLA 1UYWL 3PGCB 4XP9H 2FUTA 2VO8A 4Y5XB 1AJ7L 2BY1A 3B43A 3MNWB 1EZLA 4YHIB 4IW4C 4AI7A 2VSDA 5LHDA 3CU1A 2FSEA 3CVBA 4OLYH 2IWFA 4LASH 4PJIF 4N1HB 4U1SB 1CD1B 3MRHB 1I8UA 3WIHL 3FB5B 4W1TA 5D7IE 2DM7A 3ESUF 1BFVH 3ISWA 5GJSL 4QTIL 4PS8A 1QVOA 3ATEA 2HMID 1I8AA 4C83B 4GKZA 3MHZA 4JGJA 5JORB 1JNNH 3QIUA 1YMMB 2BWQA 4NQVB 4FJYA 4NO0A 5F9JA 3REVB 1U8CA 1N3NA 2ATAA 1A1NA 4PU2A 1ZSDB 2BERA 1YYML 4HLZG 3BIKB 4MDIB 4UMSA 1CFQA 1FFOB 3BXNB 2H2PC 4ZOAA 1C12B 1GGCL 2P5WA 4WY7L 5F9DC 3V4UH 3W9DA 4Z3GA 4G71B 1V7NL 5JQHC 2BC4A 3JV6A 1T7VA 2ESVE 2MCMA 4HK0A 2APBA 2CKBH 2WNWA 1ACYH 1B3JA 4NHUB 4YDNA 1IGCH 3MTRA 1NDMA 1J8RA 4H0HB 5K39A 4R7LA 4Y19D 4E36A 3P30L 2GEEA 3MXWL 4MQTB 4HJUA 3VFRB 4FI8A 5FW8A 3PWLA 2B0SL 4FFVC 4BFEA 1KPVB 2NQCA 3O6KL 4H8QA 2VXSL 5I71C 1WFNA 1N7MH 3T3MB 4M1GL 2KBGA 1JD9A 2HB0A 5GS1C 1A1OB 1LTXA 4A2DA 1KPUB 2X4RA 4KTEH 4OVVA 3UO1L 3ZL1A 3SJVE 4NZUH 5AZEL 1YSOA 3QEUA 1Z3GL 2F53D 1N18A 2GSGB 2Y7QB 4GUPB 4AIEA 4Z7WF 1NOFA 3CVHB 5I19L 4GJTB 4WU5B 2A9MH 4DTGL 5EEXA 3CNKA 3VFOA 4EAEA 4KKAC 2YPVA 5TK2A 3VD5A 4L3CB 3U48A 1WS7A 2WQSA 3MX0B 2DJSA 2G5UA 2R0KH 2WXFA 1KOAA 2V37A 1ZLEA 5LDSA 2GAZB 2Y2TA 2KDYA 4TQPA 1Q38A 4QRTA 5CINL 4MJ6A 5EU3A 1J1OL 3TV3H 2AJ3A 4FXKC 4FTVD 4HZLA 4KXZH 4QRRB 3VFWA 4YHOL 1C5BH 4PJ9A 4U1KA 5DJCB 3WUWA 3FSOA 1MHCA 3M1CA 3RZCB 4BKSC 1BAGA 2QHRH 3K81A 3RVUC 4DPCX 3P9MB 2DLHA 3CXDH 1PZ5A 3RY5A 1TITA 4K3EH 3MNDA 5F88B 1NCAL 5DYOA 4LEEA 4ZUWB 3VXSE 4HC1H 4FLOA 4NC0B 3LN4B 5LCVH 5AB2A 5D96C 1FNLA 5KYUB 3DX3A 1YY8B 2ZSVB 1I85C 4PW4A 2PO6B 3UMTA 3EDFA 3QQNA 3VXMB 1ONQB 1X5XA 2ZX5A 4X4XA 4OZFA 4PGDB 3K72B 2UVEA 1ZXQA 2HX9A 2QDVA 4RISL 3WG7B 1PEWA 4Q6IA 3QRFM 3ZZLA 2GJ6A 3N2JA 4LMQI 2XUWA 2ZG3A 4L4VA 3QCTH 3EGDB 2J73A 2QLVB 2VE6A 4BRJA 5I15H 1MFDL 1KYDA 5DD1L 2ADJB 1SXAA 4UYQA 4KX8A 4Q4IA 3L5HA 5DHXB 4G59C 3EW3B 5KSVA 3ABLB 15C8H 4Z7VB 4NHCL 1GRWA 1HHHA 1ICTA 1JK8A 3OB8A 4D8PA 5DUPH 4MA3A 3VNZA 3VSQA 1SM3L 4QGTA 5A2KH 3VWKA 2VM9A 4XP4H 5A2BA 3C6LB 3T0BA 2EDTA 4JS7A 1QSED 1X5FA 2DQJL 4Z7VE 4YHZH 5CN3A 5CZVL 4HWEL 3QUYC 1UOKA 4Z3TA 2V2XA 1HJBC 4F27A 3SDDD 4BFNA 3QUML 1ZVHA 1M6OB 1RHHA 4G80A 4S1QH 2XZCL 4PTTB 2NY0B 1L7TH 4Y8AA 1RK1B 3HVDA 4RGNB 2J88H 4AOFA 3MRIA 1H3VA 1X9LA 3NJGA 4HFUH 1U8JA 2K3HA 4P5TC 1DR9A 5ITBL 3EDKA 3NSYA 1M1XA 4I0CC 1G7HB 1YN7B 3JSSA 3NA4A 1KEGL 4WV1B 5C0CD 2WINA 1SXCA 3NACL 2YZ8A 5BZWA 5DUML 5ALBL 2OMWB 4PBWD 1EEZA 3MC0A 2BFVH 4AMKH 3TEWA 5JA9A 4HGWB 4HK3J 3GUTB 3ASWA 2H8PA 3X12A 3GJFK 5AW3B 4K3JH 4Y4KB 3LKOB 2DJUA 4HAFA 3W3BA 4ATWA 2Y0SA 2FAUA 3S35X 3ZQWA 3OLDA 4GG6F 2H32H 3LZQA 3US9A 4FQQB 4KTEL 3EJSA 4WEUD 3JTSA 2OK0H 4I0PA 2L4OA 2DQTH 5E9AA 1HEHC 3EO0B 4TQIA 5D7IA 1AZZC 4JZNA 3DSNA 4HJTA 1YAIA 2BP0B 3BWAB 4IRJD 1D6EB 2EDNA 5DC2A 2B1HH 4EVNA 1A0QH 5J57B 1KY6A 5F9OH 3Q8AA 2D2OA 1NGPH 4G9FD 4OGZA 2ARJB 1FYTA 4A04A 2FR4A 2EC9U 3AFLA 4TSBH 3CFNA 2BINA 3LAFA 1RH8A 4GINA 1UVQA 2WUCH 3R4RA 2VQ4A 2V0AA 1OPOA 1UUSA 5DS8B 3BC9A 5F3BB 3QEHA 5I1IL 2ICEB 4OZHE 1QBAA 2A9BA 4YHNA 2UXGA 2RFXA 1PL3A 1CFMA 4IRSC 3UCQA 2NR6A 2AJUL 5JNYB 4O2CA 4HOWA 1MWAL 1A5FH 4JPVH 5EF1A 1QYGL 5F9JB 4AQ1B 2MPVA 4JRYD 4POZC 3AWFA 5FGBA 2VGLM 3K3QA 5IK3A 1KTLB 3O3DB 2F8VA 3UG3A 3JUZA 4DKFH 1JZHA 3ABKB 4DGYL 3KHOA 4HUXA 1DJWA 3GLEA 4F7TA 2W0FA 3WN5A 2FX7H 3ZGHA 4LGSB 1G6RH 1DJXA 5D1QA 1MJJA 4HKZB 3GMPB 4L3AA 5FGSA 3WBDA 1TIUA 3D07A 4ZAKD 1K8DA 3IE4A 4KRPB 4FZ8L 4ZFOL 3H2QA 5D7JA 2ETWA 3JT0A 5KUKA 1J9CT 3OKEB 4BCZA 4U1HA 3IMUA 3QVAA 4R5VA 4A2FA 3EFDH 4WSKA 1VCAA 1IKNC 1NEZB 2FSDA 5J1TC 1KIPB 4LLDA 1DL7L 2X1PA 3QHZH 3QXDA 2VZ1A 4PWEA 4K5PA 4KDTA 3KPNA 3NMEA 2NXYB 4AMKL 1HL5A 4PJFB 4RMUA 1IQWL 1U8QA 3Q5YA 2ORBH 3FCSA 3H0TB 4YLCA 1OAXH 4OFKA 2PW2B 3US0A 3FHEA 5AD0B 2ZOWA 4BZ2L 4F9PC 5F7BA 2HRPH 4JDTL 1M9WA 1B0GA 2UX7A 3UC0L 2EIMB 2GBTA 2IBBA 1IZKA 1JWSB 4FFYH 2FD6L 3VG9C 1IT9L 2V3DA 4MCYA 2LU3A 4LO9A 2YXFA 1MIML 4YDKL 3LEYH 3UJIH 3VM7A 3OAUH 1IAMA 4P2OC 4YHZL 1CTNA 5E95B 2FLRT 4E41B 1OGSA 1KIRA 4N8CL 4C47A 3QEQE 2F74B 3QXWA 4U1KB 3E7JA 1H3XA 1A6VL 3FO0L 3VGDA 4Z9KB 3RGVA 5BQ7B 3ULVH 1KGUA 4JGNA 4LSVL 5G5DB 4KDVA 2VL5A 3HRZA 4QJ3B 1N0LB 4Q74A 1P7KB 3CSPA 2VIRA 1MSPA 2X6CA 1JN6B 3WD5H 3QCTL 8CGTA 4TLUA 3IDYB 2PO6A 5MERA 5A2JH 3CFKB 3MOAL 3D33A 2AEQH 3MJ9H 4HK3N 3B9KD 4I87A 4OZFB 4FQHA 4AUYA 2F9BT 1GY1A 3TXAA 2PLTA 1HYSC 3EGDA 4TUUA 3FH5A 2JKRM 1AKJD 4XXDB 2XWTA 3OKDB 4X6EA 3I9AA 1IFRA 5FK9B 1IC0A 4UQ2A 3WMPA 5D7LA 1FFPB 2WKGA 2RQEA 3HOGA 3JV4B 4Y88A 2BSTB 1UZ8A 2CHXA 1RZKC 2OMBA 3CC5A 3DVIA 3HPLA 2KERA 4F57L 5IW3A 4AM0B 1I1FA 5CCJA 5HYQA 4AX3A 3GSRB 3SGKC 5F0JB 6CGTA 3F7LA 3TGXA 1YNKL 3PHQB 4G43B 3O3EA 4N8VB 1M6OA 4GUOA 1SDDA 2X4OB 5LBSL 5JXAL 2CMRH 2H9GA 3D8MA 3MLWH 4LCCA 2WVTA 3WOVA 2X7LB 4X9YA 4BKLB 4YOKA 4CSSA 1BCIA 3LS5L 1G9NH 3CPLA 1URZA 4K0OA 3GD1C 3RWEB 5I1DB 1PF3A 3WN6A 1U8MB 5D8JL 2WINB 3ROLB 3UERA 4ALAL 3QCUL 1UT2A 1XB3A 5GS2D 3N41B 4UU9A 4BFJA 1RIHH 2XKNB 3GLZA 4GMTH 1X5HA 2RGSA 5T1KA 1EMTL 1A4BA 1FORH 1VZIA 4KXDA 4IS6B 3UACA 2EVFA 3KYMA 1I8LA 4H1LB 4X9HA 3DV6A 4B96A 3BZDA 4XVUC 5I8EA 3TJEH 1SJXA 2IAMC 3QS2A 4JY6B 4PRHD 2VLRA 3S88H 4KZ0A 2WUBH 3GEWB 3JWNH 3KYOA 4HS6A 2O30A 4YXLH 3P1VA 4NUPA 4YFDB 2NY1D 4PRHA 3TBYB 4XPFH 2GHWB 2IAMD 3MV7A 3F7KA 3N3EA 2X42A 4LRIC 3SYOA 5IJBC 3M1BB 3QRGL 4WY7H 1VFAA 2PTVA 4NSKB 2EIZA 3E1ZA 3FUDA 3MUGA 2WLMA 4NQEB 2NT0A 4UINL 2VZTA 3WY2A 4NERA 5IEHB 2FH6A 3WFHA 2BS71 4RAUA 3VRLE 4B95C 4E0RB 3FC8A 4WI8A 1PU0A 4PJDB 4MHHI 4XNUL 5CBAB 3UROR 4PH8A 1BG9A 3FTUA 4LVNC 3SQOH 4MASA 4HUWB 4ZZFA 3A4EA 1DBBL 1IU1A 3E1F1 4ZUUB 2MOVA 5FYLE 3FRUB 3C6SB 5LG1A 4L8SC 4S2SB 4AJVA 5EDSA 4F5CA 5DT1H 4AQ1A 2DPKA 1ZS8B 4WW1A 3ATBA 3HLKA 1BP3B 3OV6A 5JW4Q 4MCZB 5IMMA 3GBDA 3L4VA 2ZUWA 2YGVA 3H6AA 1A8ZA 1DSYA 1KEGH 4XWOD 2ATPA 1T6WA 3MA7B 4WO0A 4NKMB 4YE4H 4JNXA 4ZSOE 4Z18A 2O5XH 1MJJB 4HKZA 3GMPA 5JXED 2IV8A 3GSNB 1TR7A 5DSCB 4X99B 4FG6C 1BHGA 2UY7A 1FFQA 2VDQB 1PLGH 1KC5H 1LD9A 3PXHA 2FJGA 4GQPH 5I5JA 1P9MC 5D7JB 4UQ9A 3IDJA 1CS6A 4L9LC 3WJMA 4L5FE 3S5LA 2JJVA 4HF5H 5GZOA 4N0UB 2EYRB 4NHCH 2QSVA 2RCSH 2XSKA 3EUUA 3NBNA 5BS0D 5B3SB 2J21A 4PS7A 1YEIH 1QBML 3MACH 1KN2L 4WI5A 5HVHB 2R51A 1HQ4A 3SPCA 4RQQB 4KQ3H 3RU8L 4Z5RB 1S3RA 2NW2B 3MJ7A 1E5ZA 4I1RA 4C8XA 4MZ2A 3WKYA 3D3VE 2OMZA 3IU4L 3NACH 1BZQK 2YUVA 4HF5L 3BVWA 5TDNA 1CL7I 5ITBH 2HT4C 4FFWC 4PJFF 4QWWC 3N41F 1GKOA 5CSZB 1U3ZA 2XQBL 4XHJD 5EOCJ 1SJMA 5BUPA 2IPUK 3P40A 2N56A 4PGZA 4OCWH 5EA0L 5IMLB 4JVWA 1UEMA 1HKFA 4TLKA 4MMZB 3UIYA 43C9A 4G7RB 1TVHA 5B8CB 5DC0A 1YEDA 3KYNB 3QDGA 5DUPL 4BYHA 2B2XH 3G5VA 4JKKA 3ME0A 2BXYA 1A3LH 4XHQA 1QFUH 3G3LA 3IS1X 5F21B 5CLWA 1S3KH 4F8LA 3RL2A 3CX5J 1T7ZA 3QXAA 1E27B 2OSXA 3QI9D 4JM2B 1CGUA 4OSUH 5E94A 2C9UA 5IBLC 4DESA 1ZVSB 4FFYL 4I9XA 3H7BA 5BJTA 1L6PA 3CFQA 3VGGA 2W81C 5I8CA 3BIBX 4P5RA 4GPVA 5ACMA 3ALPA 4JFDD 4Z76B 2BP3A 3EZJB 3HE7D 5GGTA 3P0VL 3A47A 3KPSE 4GW4B 4EIBA 4AK2A 1G1KA 5DD6A 5GRWA 4DNLA 5FR3A 3C6LD 1Q0XH 3JQOB 4BQ9A 3E2HB 2CLVB 5HYQB 5KAQG 2EXYD 1F00I 4M7JL 1KCUL 4FCHA 1QHOA 25C8H 3KPSB 4GFTB 1BYNA 3SGJC 4D0DA 1QI5A 5K9JH 1A8JH 1XCQB 2PR9A 3MBEC 4L1HA 4J28A 1WAAA 2VXUH 4HWZB 1S7UB 1QR4A 2ZKXA 7FABH 1SLWA 2JCCF 1A4CA 4NAJA 3QYNA 4HFWB 2DWTA 4DP9X 2XX0A 3MCKA 2VMFA 1L9RA 1F0LA 4KUZH 4PJDE 1F3JB 3QQ9C 2XA8L 5E70A 3RWHA 1CIUA 4J3OC 3GJFH 2YMTA 4P4RA 3VYPA 3MRBB 8PAZA 1I1CA 1A9VA 4BWWA 4KZEH 4IKKA 1OCWL 4NZRH 2D7TH 2ZUQC 3DECA 4Z7QE 4QAWA 4A63A 1SJHA 2XYBA 3P3TA 4H1LA 1G0YR 1XSKA 4OKVB 3VXQB 1DQQA 2Y5TA 2X9YA 3ZO0A 1ZTXL 2VLLA 4LSUH 3PUCA 4I18B 2ZE0A 3AU1B 1TQUA 5LBSH 2H6UA 3G5ZB 1TQTA 1PCSA 2AQNA 1WAAF 4C56D 5JXAH 5EWIH 3CQFA 5FLVA 5CGBA 1EXGA 3DPBA 3IFPB 4JKMA 2AXWA 1UT9A 4OLEA 4Q8BA 3ZYIA 1BZOA 3EIFA 1ZGLA 4JY4A 4P2OA 4G82A 5HVHC 3IAQA 2C3GA 4BK8A 1ZA3B 1RUQH 4DKEL 3BQVA 5HYFA 1N6QL 3T6ZA 3UTSE 3LNFA 4U1GC 4F20A 5EOQL 1EZVX 4ZK8A 4TTGA 5FM4A 3ECBA 4IK7A 4ENEC 4OFDA 4BFIA 3MZTA 4YGVA 4UM8B 5T3XH 1YO4A 4MYWB 1LO0L 2YMXL 3N1QC 3QJFA 2J56A 2H45A 5L6YH 5HDQL 4K7PX 3QNYA 4G7YL 1P7QB 1ZT4B 3S35L 3O4OC 3P9LB 4P23A 3BWUC 1HXYB 3WD5L 4LSVH 3WJLA 3QZMA 1F6FB 4NYLB 1PLAA 1E4XH 4KU1A 2XPGA 1IJNA 3IF1A 1I1YA 4QY8A 3HZMA 4XTRD 2UWEF 3FYEB 5FDWB 4QTHA 4JGUA 3SD2A 2VR4A 3PWPA 4L4TB 4NOFA 5C6PB 5D5MF 3JWOC 4WV1C 5D7KE 5AAPA 2XKSA 4MAYC 1F4WH 5F1SA 1BFTA 1Z9PA 1NLBL 1UCBH 1B9ZA 5DZVA 2NSXA 5C3TA 1N64H 4CVWA 2OQJB 3T2PA 2Q0ZX 4S0HA 2E7BA 5CP3A 2QEJA 1KGJA 4HOXA 2IGFH 1AHWC 1S8DA 2OTPA 2IH3B 5L2KA 2YMOA 2OR8A 4JRWA 1X5ZA 3T0EB 1BA9A 1S9VA 3VH8G 3H54A 1ZA6B 2WXNA 4L0ZA 2F53B 3FO9B 3WY4A 3FB7A 3T4AB 4WJKB 2CNZA 5B7FA 4FZEL 4WU7B 4XPBH 1ZLUK 5I6OA 4LKCA 4NFCA 2YUWA 3MPCA 4FP8H 4UB0L 3I6KB 1NCNA 2FL5B 3ARBA 4MGXA 4E42B 2VDMB 4RDQG 1EJFA 4UMGA 4IMKA 1NWPA 1U92B 2BIOA 3REWB 1H3TA 2D7OA 1JV5B 3DDGA 2HG0A 5E99H 3ULUL 1FAIL 3AG2B 5C08A 3ARYA 3GXDA 5C0IB 2EVGA 2AI0H 3MBEA 1P7BA 3DX1A 5SX4I 3SKOA 3V9FA 2RALA 2VDKB 4G8EB 1DJHA 4IEFA 1QBBA 2VLME 2ZUXA 5KSAD 2CCWA 2A74A 4IRJC 4U3CA 1GXEA 3NSJA 2WUBL 1RUQL 3FPYA 4ZOBA 5L4MA 1OK8A 3TJEL 2C7UA 4PGJA 5AOIA 3SPGA 1KGCD 3NIFF 1M57B 2IDCA 1JGVL 1A7NH 4J2QA 4L4VE 1D6VH 4XCCL 4L37A 4OLUH 2XXCB 1L5GA 2GTQA 4M5TA 4PWJA 3VD2A 1H9DA 3LB6D 2BZ7A 4OJAA 3DTDA 4BQ6A 2XG5B 1AYOA 1EMTH 3EJYC 5I1KL 5AFAA 3SJVD 4ZMZA 1JV2A 2WUCL 1SHSA 4UBDD 3D08A 3UZVA 3M7OA 1WTLA 4OF5A 1QA9B 4BINA 5M95B 1Z9OA 4HKBB 4ODSH 1T03L 3EOAB 2VXUL 3ZT7A 3F7QA 1LO4H 4PR5A 4WHDA 5IVXB 2YKLH 1DBKH 4H5SB 3S8WA 1QLRB 1UXWA 2FIKA 3V6BR 1LMKA 3AROA 3JTTB 3TO2A 2C1PB 3G9VA 3V7AE 3P69A 2CRMA 3ASOB 3D39D 4F9LC 4X4YA 1J5DA 5I66A 4WWID 1DCEA 4AQEA 3D0LA 3EDJA 5T3ZL 1A47A 1VGKA 5AVXB 4U6TA 2P43B 5J11B 4DERA 5IIEB 1WCBA 2VAAB 2XY1A 1Z9SB 3UG5A 4EOWH 2G2RB 4KQ4L 4L2YA 5FGBC 3SEPA 1XQ4A 1SYSB 3BH4A 4NZTL 4PP1D 4XBEH 1JPGA 2NX5A 5CEZD 2P3YA 4NRYA 3LHPH 4MXWH 2FB4L 3SGDH 1TVDA 1AO7A 1WK0A 2CR3A 2LOEA 5FF6B 2WWKO 1U8HA 3ZDXE 2J25A 3TNNB 3H9HB 4KJQC 3GXFA 4MMXB 2WP3T 1E9OA 5I30L 4PG9A 1U6AL 2NCMA 1X9UA 4BGLA 4JRXA 1IC5L 4P06A 1CLZH 1QPPA 1LE5B 4K94C 3GRWH 4A2LA 4Z77A 2B5IC 2Z4QA 3DTXA 3LRGA 4KGJA 3KLSA 4HPHA 3N1FC 2D0GA 3S35H 1SOSA 1FL6A 2VITA 3NPSC 4O02L 3VXNB 2X6MA 2X9XA 2XBDA 3LXCA 4HALA 1LQBC 3PABB 2FD6H 1MW1A 2NRDA 3K4ZA 3X1NA 4PRPB 1Z66A 4BHUA 2VDRH 5GIRB 1RZKH 1ZTXE 3GSVB 1P7QA 4TULL 1RUMH 2DW5A 2L7QA 4HIEA 4UT7L 3NABH 4JHUA 4BQBA 4XCEB 1HXYA 3WMSA 1F97A 3OGOE 5HHVL 5IEKA 4HT1H 2R69L 5KYYB 3KCPA 4DKEH 4IMKC 5KWYC 3SO3B 4KNUA 4HCRA 3UTTE 3BFQG 5E9DD 1U2CA 5MEOB 2YOAA 4NI6A 1AR2A 4MS8D 5CEYA 1JZ6A 2A38A 1X5GA 1TQBC 1AKJB 1YC7A 2KZBA 1G6VK 4JPWL 5FHBL 4BA8A 3FBQA 1EO8H 2V3EA 1COBA 2QKIC 5EOTB 3QUZC 1YQ2A 1CICC 1D7DA 3B8SA 2YBRB 3P2BA 1K4DA 2XVGA 3IXTB 2Y1ZA 5IFJA 3LV3A 3VI3F 1TVBA 3NDZE 4WI4A 3B4NA 1SY6H 3B2PA 3O3AA 5KS9E 4XB7A 4APQA 4AC2A 2D03H 4FHKA 5E6IB 4C83A 4DGYH 1IM3A 2P80D 3T65A 5HDOA 4KKLC 3FOMB 2QQKL 5DMIL 3KL5A 2WK2A 5HYSA 3ZSTA 3T4AA 3TA3B 3ULSA 2XTJD 2IIJA 2C34A 2UV3A 4WVRA 4MDIA 5IQLA 4P46A 1MEXH 4QRRE 2ZWNA 3L1EA 3MXWH 2QADB 5ERWB 4WO4A 4OTXL 5D4JA 5D2LF 2J1ZA 3T6VA 1U92A 5IJDC 3QFJD 3OC8A 3VI3A 4OGYH 2EYTA 2PWDA 4MX7B 4W9FC 1A1MA 3LPGA 4HU8A 3AG4B 3QR2A 1E8ZA 4HCRH 1OE1A 3EF7A 3P4NB 3QORC 5GZNA 5MEQA 4WO4C 4TLSA 3OKNB 4PJ5B 5ACZB 1A4JA 5EO9A 2QGEA 5HGBB 1KJ2H 5IB5A 1JK9A 3SPHA 1AQ8A 1I3RA 5GJTH 5D1XD 3DROA 4XVSL 3MI6A 2Q2EB 5DZOA 5BO1L 5F70A 3W9DB 4FP8L 4UB0H 1MG2C 1SPDA 3FN0H 1DQLH 4FNQA 2F1AA 4CMHC 3H3BC 1OWWA 3QDJB 4G8GD 3WKML 3OB0K 2QJDA 5C97A 5IBTH 4HS3B 4KMTH 4L3CA 3U2SA 5CJBA 2L3BA 4IK6A 1KPVA 1TNMA 4FERA 5ADOL 2ADYA 3ZX1A 5HI5D 3HC2A 2R39A 3EHBC 3AXIA 1UM5H 3QG7L 4G42B 1PVHA 2E59A 2WKOA 3JT2A 4QRTB 2IAMA 3MV7D 2C3VA 5A2CA 1GTFA 2IGFL 4PWFA 3UZEC 2GW5A 5C1MB 3WXVH 1XIWB 4P59L 5C09A 3IRPX 1M2VA 5KSBA 2XXMB 4WF7A 1T1WA 4NENB 3HBPA 3BDBA 4F7EB 3D06A 2DOCA 1G87A 1HS6A 4AV0A 3GXUB 1TYEB 4O2FA 1CFSB 5HYJA 4PV9B 4UT9L 3JTTA 1ZDQA 5TTRA 1QO3B 3RU8H 2A3TA 2ZUTA 3DJ9A 5EU3B 4LVOC 5E03A 3NIGF 4YDZA 3DJZA 1ED3B 2UY6A 4WUUD 4S0SD 1FE8L 5DEFA 3S34L 3D0LB 1JI1A 3N5AA 2R0LL 4MVBD 4ZO7A 4HUUB 5CCHE 1HVXA 2B15A 5EO0A 1EAPA 1R3KA 1AO7E 3EKCA 3GGWA 4TULH 4I89A 1N4XL 3SBPA 4GAYA 3MJ9L 4KRPC 5F88A 5C0AB 2XWJB 2J88L 3I9GH 1S7TA 4IKNA 2I60H 2E7HA 3B9VA 1AYRA 4TPRH 3VWKB 5FFLA 2APXA 4MZRA 1N2RA 3BT0A 3CZNA 4HMCA 4AEIL 3WTSA 4B0MM 5AW1B 3CVHH 2AEQL 3L3OC 1I8KA 1SJVA 2WNGA 5JO5B 1WZ1H 3LEXA 1KCRH 4AZ8A 5I0ZA 1H8NA 4MQXC 4IU3A 1AD9B 1WUNT 3D4ZA 2LFGA 3L3IB 3WFEH 4YS4A 4FULA 3KYKL 5FKAA 1LWHA 1D2PA 5E8PA 5H37G 1R1CA 1KLUA 3I3EA 4MSWB 1FVEA 2XZAL 5F72S 2BNRD 1U30A 2Z4QB 3C2AL 1HSAB 2IADB 2X2YA 2XNAA 2DYRB 1LEIA 3PREA 4H2AA 5C0CB 4HGWA 2NY0C 1F6LL 1KTDA 4GLRH 1P2CB 3RB7A 3MLSH 3LKOA 5DZ9A 1WT5A 4TVSa 5H35A 4H7VA 3EYQD 4G6FB 3S5YA 3GSUB 1OSPL 3U1SH 1TJGL 2HUEA 5GIRA 3GSVA 4EI5A 2D7TL 2HZHA 5D7SH 1FVDA 3F65A 2XXGA 2Z4TA 4OZIB 3BSHA 1I53A 1WAPA 2UYLB 2IFFL 3GBLA 4LBEA 3VH8B 4OGQC 4K94H 5EU5B 1D6EA 1U8JB 3DYMA 5L7XH 3NIDF 3NN8B 1KBKA 4DK5A 2R1WB 1T5WA 1UTDA 5MEOA 3FFDB 4JUTA 4N2IA 3ATAA 4CUCA 4XH2A 1F4XL 4X0NA 1UOWA 4J3UA 2CM5A 5DUBB 1FFRA 3BKJH 2FRGP 2EH8H 3QPKA 4Y4KA 4FF9A 2W59A 1BAFL 1YMME 4LPCA 4XOEA 1HQRA 1ZV9A 4FZ8H 5D96B 4LPVA 3PU7A 3WKPA 1BJ1J 5I1KH 4JN1H 2WVVB 4GKSB 1RD6A 4LHJB 2O61B 2AF2A 5D7IB 3LH9A 3DSNB 1F6AB 4P5KB 4LLWB 3BLPX 3D4CA 5AG8A 5BW7C 4KROC 1JF1A 3GSOA 2HN7A 3L48A 4DEPC 2VXQL 4I88A 5IBTL 1B90A 2C4FT 1TZHB 4U2YA 4OI8A 4HAGA 4AWJC 1NLDL 2HFGL 3TBSA 2VNCA 4OZGF 1ZDSA 5CCGE 2IQAB 1O9VA 1JRHI 2MQ0A 4Y4FB 4YPGB 4KV5E 5L88H 3RTQA 1KB3A 3QBTB 4PJBF 4KMLB 4XMLH 1OO2A 4QXTB 5C0ND 4UUJA 2ZKHH 3FU7B 5I2IA 4HKJB 3KPOA 3NIFE 3CLFL 3QHTC 3C60A 4AQZA 4HCFA 1INDL 3VD1A 1A1MB 3BDYH 4FE9A 1F3RB 2VLKE 5D9SA 2VERA 3QNXA 1F11A 3L5WB 4HZ1A 5GS1A 4I85A 2P8PB 1GYCA 4ETYA 3D2UA 3QQ3B 4K23L 2CDGB 1AANA 5EBLA 2GSMB 2IH1A 2DQCL 3QCVL 1KIPA 1JK9B 1DJIA 1YYLL 1LJMA 4X0KB 2XKUA 2HJFA 3HAEG 5J89A 5I6XB 3ARQA 1IKFL 2BVUA 1P5VA 5FXCH 4LOUC 5DK2B 4Z7QB 2ZWKA 3B83A 3FK3A 3QUZB 5GGUA 3U1PA 1Q9KA 1OSZA 3N1GC 5DGRA 2ZKYA 5I74B 2LQRA 3CMOL 3SCMA 2FNBA 3KXFB 4OLVH 1MIEH 1WVZA 1KWKA 4HS3A 4POYA 2BVTA 2P8LA 3DETC 3RNKA 4FZEH 4YHPB 3HN8A 2DBLL 2ZOUA 4YWGL 2VZUA 2HFTA 4OFPA 4HOZA 1IFHL 1KBGH 4OH2A 5AAMC 1MRCL 3QUKA 3SDXE 5J13B 2C9QA 2WLYA 1N8ZB 5BRZA 1MQKH 3WFCL 4AIZA 2D9QB 3VD4A 4EJ1C 2ZUVA 3FHAA 1OCOB 3PWNB 4KH9A 5K1VA 3MNWA 1BJ1H 1R3IH 2LV4A 2O5NA 3UTTA 3M46A 4PY8J 4NQXB 3CCHA 4NENA 1UWFA 3QR1A 2I9TA 3PJLA 3ZYZA 3P11H 3E6HB 5HGGS 2VR9A 2F08A 4ACTA 2PN5A 3US1A 4V1DE 5FECA 3AWEA 4P9ML 4HWEH 2EEDA 2R69H 3VI4E 3W2DL 5DVMA 2ZSWB 1A25A 1WO2A 3QIUB 4WFFE 4ONHB 4K3DH 1IAOB 1DBMH 2WYZA 1CFTB 1PD1A 4BFBD 1JWMA 4R26L 4XAWL 4FG6D 5G4MA 4AV4A 5E8EA 4XO5A 2IF7A 3UYRH 5EBGA 3WNPA 3NJJA 1N4XH 2AKRB 4L1SA 5FK9A 3FJTA 3P3UA 1H3PL 5D7LB 2HAZA 2VSCA 1DZBA 4L05A 2G3XA 4P23C 2BSTA 2YAOA 3HPLB 1S7TB 1OTSD 2ZF9A 4P2QE 3T8MA 2N01B 4M1DL 2PO6C 3L3KA 1KYOJ 3HMWH 3I9IA 5E2TL 3SGKA 2X5PA 1BD2B 4PJCF 2O72A 4XAWH 2K0RA 2V5SA 3JV5A 2EZ0D 1PSKH 3TF7C 1NC4B 2ZWSA 4FNLH 4UT9H 2WJ5A 3QZPA 5GZOD 4XVJL 2BIQA 3DHUA 3MOBH 4L1LA 3ET9F 3S96A 5KYXA 4J6IA 3C5ZC 3ECWA 3HCVB 3EDDA 3E3QE 4X6EB 2QHRL 3DLQR 4JRXD 1CFVH 1RUPH 1XZWA 3EGSA 4LSUL 1XGYL 1WJ3A 4UU9B 5CJXC 1MCFA 2XKNA 5KW9H 2GSGA 1J8SA 4GUPA 3HMXL 3C5ZD 3R18A 2FNWA 3JTBA 1T22B 3VWJA 3U0WH 3SY0A 2BHUA 2WZ6A 2X4NA 3C8HA 1CBJA 3D30A 5DA4A 3FKUS 4O5LH 5J13C 2OFQA 3PL6A 3QE5A 2V9UA 5C08E 2H9GB 2DTSA 1WFTA 2UZPA 4L8BA 1U3HA 1NSNL 3ARWA 1ACCA 2GAZA 3HE6B 3F85A 3EJRA 4DFHA 5B8CC 3VFTB 1BVLB 3VXRA 2AJ3B 3VCLB 1W91A 3HC4L 4B41A 4QJ5B 3FFDA 1DQLL 2PCYA 3FW6A 5HHME 1F3DJ 3BKJL 2IG2H 4KKAD 4OD3L 5ESAA 3RUGE 4OCMC 3HS0A 3QPQD 3A4DA 2A6DB 5GGRY 4GRLB 2F5AL 5T1KB 3ALWA 2O6PA 3Q1EA 4RCAA 4PP2B 4ZO9A 1VIWA 4TRPH 4AYEC 3WS3B 1OY3B 2A6IA 3GXTA 3HG1A 4KPHH 3AITA 1J1XH 2JLPA 2WVVA 2NZ1A 4M6MH 1G5GA 4ZUVA 5JZ7C 4OB5L 4M4PA 2J44A 1OP3H 3QO0A 3MNMA 3HB3B 1GS8A 2OULB 2Q1EA 2X4PA 4XP6H 3DK0A 4XO4A 5EO1A 3VFVA 2RTTA 5FYJU 1HESA 2J1WA 4Y16B 4DN3H 1YMHB 1D9KD 4JFED 4NN7B 3SJVA 3FUIA 4WFGE 1ZK9A 3CSGA 4BE6A 2JK5A 3WAJA 1UD8A 5AW6B 1MUJB 3RAJL 4CC1A 5TK4A 5ID0B 2ZXBA 4ZMTA 3LH8A 5F6HJ 2ATPB 2Y5QA 4UUJB 2Y36L 1H15A 2WKLA 1HKLL 3MYJA 4F58L 5I5IA 3ARDB 2DQJH 5CZVH 5A3IC 1RU9H 2CHZA 5IVOA 1YJDH 1A6AA 1IM9A 3MRIB 3BP6A 3WNLA 1J8KA 3FHQA 4ODTL 3AACA 4ZAKA 2E8ZA 1J0IA 4X7SH 3GO1L 2WBJB 3AW5A 1PLBA 2OCCB 1ADQA 4GOSA 1KZYA 3ZTJG 2J1XA 4JHZA 4MNGA 5IQOA 3X12B 1ZTMA 2XN0A 3BKCL 5IWLC 3B9EA 3KL0A 1F90L 2LU4A 1ROCA 1V8HA 4WAFA 5BNXD 1WBYA 5KZCB 5HVGB 1FSKB 2DI9A 4N9GA 1BIIA 4TN9A 5E2UH 1JZIA 3UO8B 4KO9A 5ISZA 5IMOA 3VO0A 2BP0A 4N4YB 4RMVA 2ESVD 3TO4A 3UAAA 1CK0H 3LRMA 2FJGB 3Q0HA 3LDBB 3NA9L 1J48A 4M6OH 4PSRA 4BSWA 1WBZB 4GKLA 5IVZA 3WJMB 4EZLA 4XE0A 1EAQA 2CIKB 1QATA 5C0DA 5EU6A 4DVRL 2BOBA 2VR8A 2IBZY 4HIQA 5SWZE 3B5HA 3NCJL 2QTEA 4LCVA 2OMTA 4AIZB 1QSVA 3U1SL 3HIZA 1T6VN 3EO1B 3HG0A 3M8OH 1UVQB 2YC1A 2J6WA 3BAEH 1PZDA 5E2WL 1CVRA 4JBSA 5C09D 4KOBA 4RQQA 4RGMC 5E9NA 4BXSV 4Y5VB 1HE8A 4ORGA 4HOMA 2OZ4L 3BKYH 3RG1C 4BQCA 3V4PL 4AW7A 3D1MC 3O0RL 5IBLD 1FZKB 1K2DA 4FYSA 1GMIA 4G6JL 2BVQB 2QPEB 2OPCA 2EIEA 3KL3A 4MTMA 3V7MA 4MB5A 3AGVA 2XV6B 4PQXA 5GS0L 3IMRA 5JR1H 5DFVD 1XL4A 1HHJA 2WLIA 2ZIDA 3L3OB 1CU4H 2VDQH 4XCYB 2CHDA 1CFTA 3FN0L 5CJOL 2ITCA 3CQPA 3K6SA 1HX0A 3D69A 3O3DA 3G5XA 3BKML 4J6RL 2B4CL 3KAAA 4M56A 43C9B 3B3IB 3U7YL 5C0FA 1JNLL 4G8GB 4FXKB 4HUXB 5IB2A 5BRPA 2DYPB 3UCRA 4BD4A 2FH8A 1MLBA 4R4FH 4QOKA 2VXTL 3L3KB 4OCLC 5JDJA 2PCPB 1CGTA 1HOCB 3PUUA 5T1LB 4CN4A 5C8JB 2E74C 4HIIA 2KH2B 4NQQA 4GAGH 9CGTA 1BOYA 2BNQE 2CO6A 2OP4H 3MLRH 1XCQA 5AWNL 3OKEA 4Y1AD 3D09A 2Z9TA 3AG1B 3LHAA 4DKDC 3GJFB 4A7QA 5FYKL 4M6ML 2WW8A 2ZKHL 3OKOA 4UDTA 2H3XC 3BCDA 3NPSB 5GS0D 5DJ2A 3X17A 5L88L 1IEAA 1FV1A 2DBJA 4A6YL 3IGUA 4H40A 4V11A 3HN5A 1T22A 4RNRB 1JGEB 2DDQL 1KB5A 3DIFA 5JUEL 4DQAA 4Z8FH 1N12A 1H3UA 3IBOA 4LLMB 5FO2A 2EDJA 4Y9GA 1T7XA 3QFJB 4H8WC 3S3PA 3F7RA 3IAGC 1XBDA 1RJCA 2CG9X 1DDHB 3BZ4A 5IB4B 3VFTA 3VXRB 1V27A 3OM3B 3Q13A 1XCTB 2ODIA 4HHAB 1M4KA 3K6DA 2XG4A 5CIPH 5DUMH 3V2AR 3IETA 1TTBA 2YD3A 2YZ1A 3FMGL 3RPIB 4P2RA 2FHCA 1OWRM 3RGVB 5BQ7A 1ZGLB 4P2OB 1XGRB 2GC4C 4POUB 4P4RB 1XGYH 1PJWA 2CALA 2NY6B 5AAMA 2VL5B 1XH0A 4CNIB 2HX7A 4ERSH 3UGEA 1D5ZB 1G1OA 5FO8A 3BRFA 6FABL 3FQRB 5KG9B 1IEHA 2WZ5A 2VW7A 1LK3H 3WS3A 5JQ6H 1I9IL 3UTOA 2JKTM 3VXQA 5IUSA 3NSXA 4EIGB 4M5YL 4AQAA 2VLMD 1AG6A 3DPBB 3KDPB 3THML 4D9LL 2BO0A 1HAWA 3GIVA 5AVRB 1EXUB 3PXJA 2CO2A 4FQCL 2ZUYA 4Y89A 3WY1A 2NY6C 2Z64C 4UQ2B 3ABMB 3GM8A 1MW2A 4JY4B 3LVTA 3EFFA 3WY3A 3IJYB 1AGEB 1I1YB 3B7SA 4QY8B 1CU4L 2VDQL 5KBLA 4OSUL 1VDGA 1U8IA 3LZFL 3O6LH 5DHVB 4QTHB 2GYSA 4OZ4A 4K3DL 3ECBB 4Z3FA 2C9VA 3G6AB 3QWRA 3ARDA 1BVOA 2Z92B 3NCFB 4JEGB 2XZQH 2X7LA 1DBML 5DK3A 1UXLA 5CR8A 1PFOA 2WMPA 2YQ3A 4L29A 3CXHJ 3PNWB 2H3NA 3KYKH 1D7BA 2Z91B 1P6AB 4JFQB 1HXKA 4JG0H 1FZOA 5DJXB 3NEXA 4ZTOH 3KS0J 2G60L 5KVDE 2J3SA 3BVNA 3B2DC 3T0EA 2F19L 3IF1B 5J11C 3V9CA 1P1ZB 2A5UA 2EDYA 4YH6A 5E0QA 3IDNB 5FHBH 2WZPA 4A6YA 4UOJA 1AQHA 3LEYL 4WW2C 2CGZA 4U1GB 3NGBC 1NL0L 1WBYB 5KVGH 3R0MA 2IO5A 3TVMD 1WFOA 4AQOA 2TSAA 3FB8A 3FU6A 3QWOB 5EU7E 3K1DA 1JZ5A 1HCFX 1O75A 3ZE1F 3EJPA 2FL5A 5F1IA 1ZPLA 2OTUB 3O2DH 4APQD 1LP9A 3RX8A 3MREA 3JXAA 1AHWA 5TQ2L 3LIZA 3N40F 3H9ZA 4FFYA 1FLRH 1NFIA 2XU9A 4PJAE 4NM8H 3WV0A 3N43B 5L8JB 3BT2H 2BM3A 3O41A 2VXSH 3L3HA 4GRLC 1BZ7A 4DT2A 3HUJE 5D70H 4DW2H 4F24A 3DURA 1ZVNA 1S7SB 4I7ZC 5AZ2L 4ZX5A 4KJYA 5TFSH 3FSAA 1YN6A 4XNYL 4JREB 2X3CA 4NO0B 4ORGB 3OSKA 1AAJA 2AXHA 3AY4C 1F86A 4LFHD 2F1EA 3KR3L 3S4SB 1C7SA 4DP8X 1Y07A 1GGUA 1BQHG 4HUWA 4QF1A 1T5KA 4X6FB 3QDME 1WD8A 2QVIA 4YUEH 1WISA 2VB5A 4MCNA 3BHBA 2Q6WB 1HDMA 2XN9B 3S3CB 1CC3A 2NY5H 1VKXA 4W9ZA 3K6SB 1H0DA 4N24A 3WO4B 2R9HC 2AJUH 4FL4C 4N3TA 4JKPL 5FYKD 4UTAH 4HPYL 4I3GA 2WQWA 1RUAH 4G8EA 4XMLL 1JHKH 2JLLA 5CXPA 5MHSD 2DN7A 2GTWB 4NN6B 4JFSA 1JV2B 1TETL 3S8GB 1DQJB 4MJID 4RZCB 4QRSA 3OKLB 3LKQB 2F54B 4HUMB 1V05A 3SGEH 3BAIA 1P4BH 2YSSA 1UASA 3PWUB 4PIRF 4I48B 3IFLH 3KXFE 3RB5A 1X7SA 2ENPA 5F7KC 1PJ9A 2DQHH 2ZOOA 4L37B 4W6XB 3O6MH 3VTAA 2K70A 3UP1A 1CGWA 3B9DA 4GRWF 5DURD 1BBDL 1DBAH 3T3PB 4LLVA 4A37A 1PGRB 5JDSA 3QQ9D 4XVUD 3PP4H 3TO2B 1QSEB 3VE0B 4YZFE 2ZOLB 1U58A 2VDKH 2R4SH 1NA8A 3II1A 4OJFH 3CVDA 1WE5A 4W9EC 4GY4A 5JLZA 4U7SA 4NPJA 4ODSL 4WO4D 1T03H 1E3FA 1PX3A 4M9PA 3BPOC 4Q52A 5TQ0L 3P9MA 4F8PA 1QAWA 1MCDA 1CYXA 4MNQD 4J1UA 1KG0B 4PY8I 2QQLH 4MMXC 3GZPA 2H6OA 4PB0H 2D31B 5DU7A 3G5WA 1ZHKA 4LGRB 4O4YL 4X6DE 2D0FA 2ZSVA 5DRWB 4GMSL 1UWEL 1CFNB 4X4XB 1U8HB 5F7HA 3GI9H 2BSRB 3BUQA 2AEOA 3FQWA 4X98A 4H20L 2BWDA 3STZB 4MMXA 5FYKE 4OLXH 1QRNE 1OOAA 5FO8B 4H44C 1A3LL 5KJ4A 1ILSA 1NMCB 2CA3A 2A9NH 2ADJA 4NQUA 1ODAA 3EHBD 2ERJB 4JM2A 4Y7OC 2NXYD 3GM0A 4IGBA 3B2VH 3M17B 5TF1H 3V6FA 3NCJH 2BNRA 5DJ8B 3L16A 3MRFA 4E9QA 4X5WB 4U31A 1WZ1L 5HHVH 4XPTL 4L1TA 3MODH 3ARVA 1KYFA 3GIVB 4AEIH 2DQUH 3ESPA 7CGTA 5JIQA 5DFAA 3ZTDC 2APVA 2ARWA 1W72B 4FQJL 1RHHB 3MV8A 4G80B 2DB8A 4DGUA 2EIKB 3CFEB 3AS2A 1QHPA 2BRRH 2JJTC 4LOVA 5KSUB 3F04A 5KYYA 2X4QB 2N4IA 1T7YA 3KCPB 4MS8C 4OT1H 2CLVA 3LH2H 1BW8A 4WV1A 3GT6A 4L1BA 5BZWB 2YLHA 4OGAD 3VFMA 4OFYA 4FTVA 1GIGL 2C9XA 4RBPK 2HWZL 5KN5A 3ZZ1A 2VLJE 4HLJA 4AJWA 4MHHG 5EZOL 2XX1A 1FUNA 2QR0B 4Q6IC 5J56B 5LDUA 1CXFA 2HLAB 4MJJA 1AGCA 2CH8A 3FQTA 2YBRA 4UDUB 3AY4A 1DSWA 1U95A 3ZMNA 2X0UA 4M3HA 5FA4A 1CGSL 4HIEB 3VQ1C 4NRXA 5ETUA 1FL5A 5MENB 2R2HB 3VG0H 4BUQA 2AJVL 4LSTH 5DJYB 5BMFH 4KAQL 3H85A 1X5IA 2OA9A 3MRBA 3L81A 3D0VA 1QI4A 3E3QC 3T65B 3TV3L 3G6JE 3HE7A 4KKBD 1SBSH 2XTJC 4M4RA 2ARJQ 5IT2L 2PNDA 4XB3A 3UBGA 5D7LD 1VGEL 2WCGA 3ZK0A 4N5ED 4L8CB 5HI4D 1SXZA 1B4JH 3FCTB 1D5XB 1FNAA 5F93C 4MBRA 3TIEA 1SHMA 2VJ0A 3NUKA 1A7QL 1M71B 1AKJA 3GMRB 1T80A 1Y6KR 4Y1AA 3MNZB 1BEXA 2YQBA 1B4RA 1ZGLM 2V5MA 5EOTA 4M7KL 1CICA 2VDKL 4TM9A 3MGAA 1BQHB 3OPZH 4H26A 2ESVA 3TO4D 1K4DB 2WVSA 3IXTA 1F58H 1R3LA 4UOQA 3VTTA 3NVQA 1BPLB 3NESA 4M8QA 4LAJH 4N2NA 3IKCB 1OEZW 5EN2A 5I5MA 4IIQC 4APQB 1DANU 2ZCHL 4FLSA 1QTYT 5HSFA 1IM3B 1FH2A 3SE6A 1RV6X 3A23A 5D72L 3LXBA 1ORSA 5I1CH 1WZAA 5EEZA 3O6KH 4ZFOB 1DANT 2PYEE 4QHLB 4X7TA 1AMXA 4ODUA 5GJTL 4DCQB 1T21B 1B4LA 5F7WC 2X3AA 2N7AA 5TE4H 1PYWA 5IB5B 3RFRA 4YGVB 3MGTB 1JYVA 3BMWA 1CI3M 1FIGL 1CE1H 3ZT5A 3MVSA 3FT0A 2WXJA 3JUYA 3QIUC 3L4WA 5EORL 5AWNH 5E6YA 1H5BB 3IRZA 4HIJB 2AK4B 1DTUA 1GHFL 2ENQA 4LL1A 1HDMB 2XN9A 5E6RB 4GFXA 3ZL4L 5DD5H 3RI5K 4PJ8B 2XCMC 2CWRA 1H0DB 4WUKL 5IFHH 5CP3H 4FMVA 5J1AA 5E5RB 5EC1A 3TYGH 4ZW3A 3P4NA 1N26A 4Y2OB 5MEQB 1KEMH 1DSFL 3GKWH 4WNQB 5C07D 2L7EA 1OP5K 1DQJA 3NCWA 1T1ZA 4MWFA 4NO2B 4XAKD 3EJZC 3KPRD 5LXGH 3DVGB 5AUMB 2F54A 3U9PL 1MCQA 3PGCA 1AQKL 4XP9L 3KR3H 1KLGB 4QOKD 5SV4A 4I48A 4JMXA 1RVFL 1MWAA 4LCWD 1M2VB 4OFVA 2IAND 5JA8B 3ARUA 5DRZB 3EJZD 3G04A 1S78D 1CD1A 4PVMA 3BE1H 2Z65C 2EECA 3MRHA 3CXHK 2V2TB 1B0GB 2AI0L 2X9ZA 4MD5A 4PLKC 4YHKH 1XF5B 3GJEA 3PGDA 3PHAA 1JWSA 3G7TA 5IFAH 1UA7A 2AJYL 1IKNA 2HT2D 3KLDA 1OAUH 5EU7C 1JZDC 3X3FH 3QDAA 4N5UA 4A39A 1SYVA 4HX1A 4QYOA 5SX4H 5CEXA 4FNSA 4XMXA 3Q5OA 5AKSA 1QBMH 3EH1A 1LK2B 3V0FA 4B9ZA 5HVFB 4XPBL 1E30A 3I9PA 1YZZA 4ZNEA 1HHIB 1OQOA 4M3KB 4UQEA 3U7AA 3L4TA 1N5YL 1QNZH 2P49B 1U8NA 3OLEA 2EDXA 2FJFB 5FOBA 1J1PL 1RUML 1NCOA 1CFNA 1UM4L 3CHOA 3SKOB 4IU3B 1QO3A 2CLRB 3L3IA 5GS3A 4KJPD 4Y5YC 3KWUA 1JZ8A 4NBZB 4ZDHB 4B53A 4NZFA 2MSPA 3U2IA 1WDAA 1FJ1B 3C2SA 3D85B 3RX5A