4YL9A

Crystal structure of wild-type of hsp14.1 from sulfolobus solfatataricus p2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
b'MNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAGFNKDKISVRLSAQNELIINAEREIQYIGTKYATQRPLKIHKVIRLPVKVKRDSQVTAKYENGVLTIRIPVEGSVSIRIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein Hsp20
molecule tags Chaperone
source organism Sulfolobus solfataricus (strain 98/2)
publication title Active-State Structures of a Small Heat-Shock Protein Revealed a Molecular Switch for Chaperone Function
pubmed doi rcsb
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4yl9A00
3EUDA 3Q9QA 4JUTA 2Y1ZA 3GUFA 4PBDA 3W1ZA 2KLRA 3L1FA 2MNWA 2WJ7A 4YDZA 3L1EA 2Y22A 3J07A 2O30A 4YL9A 5DS2A 3IGFA 4I88A 4MJHA 3QORA 2Y1YA 3QORB 3QORD 3AACA 5DS1A 4JUSA 3AABA 2JKIS 3L1GA 4FEIA 4ZJ9A 4PCKA 2N0KA 4M5SA 4M5TA 3GLAA 5LUMA 2KMWA 1RL1A 1WFIA 1X5MA 2RH0A 1SHSA 3GT6A 2WJ5A 1WH0A 3VQLA 2N3JA 3Q9PA 1EJFA 2XCMC 3N3EA 2CR0A 4YLBA 2BOLA 3VQMA 3QORC 2K8QA 4ELDA 1GMEA 4YE0A 4RZKA 4YLCA 1WGVA 2CG9X
chains in the Genus database with same CATH superfamily
1BAFH 1U6AL 4FHJA 4NWTL 1KPRB 3MXVH 4Y4KA 3QO1A 1BHGA 2HLFD 3P73A 3BJLA 1HDMA 5EIIB 4JBSA 4M43L 3PL6A 1C8QA 2HWZH 2YARA 1TOXA 2E5EA 3QNXB 1XT5A 1CN4A 4BUHA 4GQQA 1KY6A 4BK5C 1JIBA 1VGEL 4ZO8A 2OMWA 5DJ0A 5AW4B 4HMDA 3ZTNH 3IDIB 2BIHA 4LVHC 3TVMA 2X42A 3AXIA 4JFPA 5D7KD 3T2LA 2X53A 3MUHL 1ZV9A 1IVTA 3A4AA 3P0VH 4E9VA 4Z6AT 4X4XB 1KTDA 2C9XA 4DSYA 3DUUB 1WO2A 1OTSC 3D06A 3U0TA 3HLAA 1PW3A 2Z65C 4OU3A 5C0DA 2G60H 2WZAA 2IWFA 5FYLD 2B14A 4GBXC 4F7KA 5C71A 1NCCL 2XACC 1NDGB 4PBXA 4GP4B 1M9WA 1RD6A 1BFVH 1RJZA 1N18A 2ZCHL 4MQXC 1BMWA 1CFQA 3V6FB 4ACTA 4XPHL 1CK0L 2GI7A 2A99A 5HDRA 3WFDH 1BD2D 1UD4A 3OXRB 1LNUA 5KVGH 3B9KB 3IJHA 4WHTA 4GUOA 3FQWB 1BAGA 1NBZA 3L54A 1JK8B 4PJAE 3ULUH 3Q0HA 5J8OA 4F2ME 1Y6MR 2NNAB 3BKYH 1A3LH 3JV6B 4BK5A 4WW1A 2FO4A 3LKSB 4P9HH 5F7UA 3EGSA 2DBLL 5TH2B 1KGXA 1TQCB 5TQ0H 1FRGL 1F90L 3ZDXE 2E47A 3FT3B 3X3FH 2UY6A 4PPTA 2C7UB 1U93A 1EJ8A 1FE8L 4XMVA 2EE9A 4Y16A 3FQTA 1ETZB 3V7MA 1A3LL 5EZJA 3UZQB 3WFEL 2K6YA 4LASL 4CMMB 3QRGL 2R1XA 3OKKB 2X4PA 1P7KA 3LZLA 1DSWA 1KCUH 1I1AA 1MFEH 3AACA 3BE1H 4NC2B 5C0FB 1YYML 3OMNB 4QRSB 1E0OB 5B38B 4Y4FA 5JW4Q 1Q94B 2L7EA 3GYRA 2OW7A 5IHBA 3AQZA 3GRWH 2IBGA 1PS3A 5IOPA 3LDBB 4ETQB 3VW3L 2VLJE 1WZLA 3S3PA 4BUGA 1OSPL 4NZRH 2QHRH 4TSCL 1QEWA 1UEMA 5HVFB 5HVHB 1T2QL 1INDH 4WNSA 4GSDH 1M7DA 3EZ8A 3FTGA 4Z0XB 3NEOA 5J06A 4P4RA 2HFFB 4EBQH 1S7UB 3AC0A 3GXMA 4I77H 5E1GA 1JYVA 1IUZA 1YN7B 1H6FA 3HC4H 3RWDA 1CLOH 1KGYE 1ZAGA 3P9MA 3Q2NA 3F7YB 3ENEA 3HZMB 5GISH 3VACA 3OZKA 3KR3L 1TQSA 1GJUA 2EH7L 1A9EB 3MBED 3V4VL 4R6UA 2BX5A 3PNWB 2WNGA 4C8XA 1C1EH 3SCMB 1NMBH 2ARJA 2BSED 4GY4A 5HD8C 4OQTL 1E27B 1EEUA 3PGDA 5DUMH 3MNZA 3VGFA 3C5ZD 1I75A 3V6BR 2CCVA 2IH1A 2NY4D 3SO3C 3ULVL 4CVZA 4KI5E 1QSZA 1L9PA 2VDRL 1GH7A 4OFIA 1E40A 1YN6A 3IFLH 2UX7A 5EIIA 5T3ZD 3IGUA 1IE5A 1QP1A 2YUVA 3NSDA 4D0BA 3Q8FA 1M1XB 1MVUA 1TJMA 3QZOA 1SHXA 2GJRA 1VACA 1NDTA 3FBKA 3MGOA 4K23H 1AHWC 3FQXA 5JHMA 1I9IH 4Y19E 4OZFB 3N50A 2DMCA 1AE6L 4O51B 4HGWA 4N0RA 2W9DL 5FO2A 3TFKC 4EZJA 3BLPX 3BXNA 3M7OA 4FG6D 4L1SA 4PJ5D 5G4OA 4F5CE 5ANMA 2YAFA 1YY8A 4I1RA 5MEPA 4UILL 5F7KC 4OLWL 4PS3A 2A0LC 4IBZA 4AQ8C 5D1ZA 4BCZA 1DUYB 2YRBA 3SD5A 1OSEA 4HLJA 4PP2B 3HI6H 2WB7A 1IAKA 3CWGA 1FGNH 3GD1C 3ALPA 3B9KD 3US1A 3SPJA 3OKDB 1IJ9A 4GW5B 4NLHA 4EZKA 4YSUA 4L9DA 1HYSC 4KJYA 4QKXB 2XVLA 4NHUB 3RPIA 1EEYA 1A4CA 4IOSD 5AB2A 3C08H 4ZFOL 1FZKB 5FM4A 4GQPH 1BF2A 1RURL 5HHNB 1QHOA 4APQD 4NQVB 2QJDA 4M7ZB 4FA6A 3BUBA 3QZWA 4LEEA 2GFBB 4D9RD 1DUYA 1NAMH 1W0VB 2E7DA 5J12B 1DJYA 4YK4C 1UTDA 2Z8VC 2VLJB 5LGHH 4ZUTA 4J6RH 4NPJA 3P4MB 1UXWB 4N2FA 4L29A 2YGQA 3EFFB 5C0FA 4NUMA 4UQAA 4XB3A 3UYRH 5SWSB 1KXQE 3CVDA 3ARGB 5E6ID 4EN3B 2Z8RA 5MENB 4Q2ZB 4LP5A 4RGOL 1UFUA 4GKNA 2NR6A 4IKJA 2Y25A 3B2VH 4ZTPL 4CADB 3J27A 1NGPH 3OKKA 4KJPC 3U9WA 1YVLA 2OR8A 4G1MB 4XMZA 3HG2A 4JFDE 4J2XA 1HEJC 1NBVL 2H2SD 3OMZA 4ZW7A 1DN0B 2PR4H 3C5JB 5I16B 2R0LH 4XZUB 1JCVA 2QVMA 5J56B 3CFJA 4C58B 3VNZA 4BELD 3QJXA 1P5UC 3GNMH 3PGFL 4M61B 2WYHA 1CDJA 4G8GB 1L7TL 3U4BH 3U9PH 4U1JB 1BQLL 2I07B 3WELA 2KPNA 4ZMLA 4KJWC 1ZT1A 3QPQC 3VMOA 4A55A 1FZJA 4YSQA 5E8PA 4JHWH 2GCYB 4AJ0A 3SJVB 2F68X 2IADA 2CRMA 4FS0A 4QF1A 4YH6A 3MLVH 4UUJA 3TJPA 5I1GH 2J4WL 2NUPA 3T4AA 1D7BA 4IOIA 4CSPA 4NQXB 2X0UA 4RWYL 5KSAA 3Q48A 2UV3A 5DTFB 1SOQA 5IB5B 1XF3A 2EILB 4ODWA 3S5LA 5EV7A 5I1CL 1JWUB 1RQ5A 4YPGB 4HMCA 2H1XA 4DN3L 4LE8A 1E8WA 5DD3L 3MR9B 4RWHA 1I9JL 3O6FB 5ANME 3THML 3KLDA 3HFMH 5I8KL 1E9PB 3WKNA 3ROOA 5LNGA 4PJEB 4FI8A 2J2ZB 1INEL 2VLLB 3B7RL 5TGBA 3E3QC 1RHHA 3VD1A 3ARVA 3OL2A 1V8HA 4KZEH 4QRUA 1BW8A 4GMTL 4JPWH 4LLWB 2BDNH 4RH4A 3MGTA 3T6VA 1NBYB 2ZOKB 3S37L 2CR3A 1T1YB 4Z18A 5T1KA 3FCBA 4FNLL 5I30H 2XIIA 4UIKL 2H0EA 3DRTB 1NGWB 3DX7A 1TXKA 4IRSA 5I74B 5CS7A 1WIOA 2GTQA 3ET9F 3TA4D 1YQVL 2O5ZH 2JKLA 4MRCA 2RFXB 4WTXA 1WWWX 1XX9C 4HGWB 2CHXA 3FFOA 3GHEL 3H4HA 4NDMA 5FKAA 2PUQT 3NK4A 3P73B 3QSKB 2RGSA 2C4XA 4PJCB 3MGTB 1N19A 2DH3A 1P1ZB 4L4TA 2JLPA 4KKBD 2GBVA 4WI3A 3QUXD 3S35H 3WXWL 2GJ6A 3QDHA 3QR1A 4F1ZA 2FR4A 2D8KA 3MRIB 1KXTA 4X7SL 2WBJB 4ALAH 3LX9A 3EJRA 4LLDB 2GITB 1SPDA 1GS7A 4P07A 4CW1B 3ES6B 3VNYA 1AKPA 1JV5A 3GSUB 1Z9NA 2F7PA 4G71B 1OIOA 1CE6B 2P28B 1AI1H 1MRCH 3WS3B 1R24B 1L5GB 5FFGA 3MLXL 5C0RL 5BS0D 3SDDC 2OULB 2B4CH 4Y2NA 4LSVH 3ZUNC 4XOBA 5FYKU 5KYXA 5DJ8B 4GRLC 1JDDA 3IMTA 2YFNA 3BO8A 3HAEB 5IG7B 1FI8C 1BSIA 4M3KB 3GSNB 1KWKA 1FNAA 1RULH 3QQDB 4PV1C 1TO4A 2VQUA 2EH7H 5SWSA 1M1SA 2DF3A 2XFGB 4N20A 1XGZA 2FO8A 1HWWA 4LARH 5DJCA 3ME0B 4UQIM 4MMZC 3F2LA 3JT0A 4RISL 4NRXA 2W0FA 3DX2A 1OSYA 4G1MA 2WWNA 5DHVA 2CO3A 3ARRA 4DP7X 1G7QA 2K1MA 1KCBA 4U0QB 2YR3A 1KB5L 2BNRA 5HGDB 4YC2B 4XCYA 3S96B 3Q6GL 4NQDB 2DWSA 4PBVC 3ZDWA 1AS7A 3IS0X 1DEEB 4CRPA 5K33A 2OI9B 3DXAE 4Q56A 4DTGH 3X12A 2WUBL 3LQMA 3TEYA 2BZCA 5D4IA 5E5LA 1DBJH 4GT0A 2DPKA 1GHFL 4BFBD 2ZUYA 1QFWL 3D3VB 4J4PC 4GRLA 4FL4C 5C0BB 1NGPL 4S2SA 1A1MA 1XF5B 1EHNA 1W8EA 5L0QB 2ZUXA 5I1JH 1J05B 4HIIA 1JPFB 4TLSA 3L3KB 1J86A 5F3FA 3ARBA 5FDWA 1PVHA 3DIVA 3HI6L 1XEUA 1O6VA 4UT6A 4OB5L 4TTGA 3F6IA 4ZD3H 4KKBC 4YHKL 1XBRA 2VN5A 1FJ1B 3IDNA 1RHHB 2C5DC 3WN5B 3TVMC 4IEFA 2YIHA 1C5CH 5K1NA 2KHAA 3GC3A 2AAVA 4MLIA 1NC4B 4OLYL 5AOMA 1PCXA 1NUGA 1A1MB 5E9NA 4JZJA 3RVUD 2O6EA 2XZAL 2YKLH 1HIMH 3DRTA 3WFDL 4Y2DB 4Y4HB 1RZ7L 5SWZA 3C09C 5D9SA 4J8RB 1SDYA 4FI6A 1U8LB 1WSST 4WTZA 1QATA 3F3HA 4E9SA 3DECA 5FM8A 2ENPA 3V0AC 2LGNA 3BP7B 2WOBA 3PJSA 3G5XB 3LQZA 2R1YA 2DQHH 3WLBA 2C1OA 1KENL 4WFHD 3QIBB 1N59A 1SEBB 1MH5B 1S7XA 3FU0A 3O0RL 5F7YC 2Z64C 3O6LH 1N4XL 3LNEA 2WLNA 4Y9EA 4N2KA 3FPYA 4QY8A 2VDLH 3FO9B 3LKPA 3X14A 1SXAA 1SEQH 4XO4A 5GGSY 2CHDA 4NKIL 5F1NA 3HZ3A 1S78C 3K8LA 5IHUL 3ARDA 3LB6C 4J3SA 4DZBA 1PG7X 1SM3H 1W16A 1YNTF 1ZEAL 4DEPB 2YA2A 2VXSL 3F12A 3V4LA 2VN6A 3GLZA 4L9LC 3IFLL 5BQDA 4YSPA 4D2NA 3CQPA 4ZMTA 4N2LA 3PXLA 5FWQA 3VWKA 5ES4B 1A9VA 3KPOB 1W0YT 2BM3A 1IB5A 3GXPA 3K71A 4LEBA 5D7LD 3WY1A 3G7TA 5FYLL 3NJXA 1E7VA 1X7QB 3X13A 1U3ZA 4DT2A 1AZVA 1CLZH 5E9AA 1WWAX 1S9WA 5HI4C 1KIPB 1RJLA 4JN2B 5EZIH 3VQ1C 1FH2A 3UJTL 3P4OA 2NY0D 2EDWA 2NY7H 5IJBC 1J5OL 1DJZA 4FQXC 1UXMA 4TNFA 1NKOA 3IDUA 4TF4A 5CBAA 1TETH 1KXHA 2BVPA 3KJ6L 1KF9B 1OP9A 2DYRB 2AQSA 2P5ED 4FFYA 1MCWM 1YEKL 2OXHA 4HPHA 1CR9L 1X9LA 1FGVH 1E9OB 3DIDA 4W9ZA 3R8BB 4NQEA 3M1OA 3S96A 3KS0H 4WI4A 3MX0A 3HZYB 4PGJA 2E4TA 1F2XK 3MRFA 3CLEL 4DPAX 3ESVF 2J55A 4U1GB 1JWMA 4P3DB 3NABL 3DI2B 2O5NA 2WXMA 3C8HA 2F15A 1R3LB 4NXKA 1U8NB 3DURA 2RCSL 3R18A 5CFAA 2ZUWA 1T7VA 2DQJH 1B3JA 2EH8H 4EIZC 3Q05A 1GS6X 2Q3AA 3D48R 1QSVA 3JV6A 3V9EA 3DYOA 3GHEH 1ZSDB 2QPUA 3C12A 3KZ8A 3NABH 2PTTA 3DBXB 4X6CB 4ZMXA 3RNQB 1SBBA 3P3UA 2V5SA 1MREL 1BMGA 4OF7A 4OFYD 3LNHA 4UI2A 5LCVH 2O72A 4ZXBD 1NCDL 1IT9H 4FEMA 2ENSA 3L5JA 3LZOA 3FQTB 4PWHA 4UM9A 1X6LA 2WUCL 4H26A 5GHWL 3I9PA 3UZEC 1OO2A 2FD6L 4I3GA 5BO0D 2HWZL 4HT1L 4P9HL 3UZVA 4XVUC 1MCFA 2IBBA 3VGAC 5K39A 3LNGA 4X4MA 5T33L 1VFAB 5HYQB 1T6WA 4X5LA 2EKJA 4NFDA 2XQYA 1MG2C 1TEGA 3RPBA 4F2EA 1KGCE 2EVHA 4L3AA 5AW3B 5I0XA 4TUOA 4KK8C 5B8CB 4W9CC 1JVLA 4N8CL 1BIHA 4ETYA 2NUTA 3NCMA 4IJTA 3AXLA 2CCWA 4POYA 2XPGA 4L2YA 1WFOA 1ZLWK 3X1GA 4DGYH 3PU7A 2L8AA 3MGAA 4APXA 2APBA 3BC9A 2FHBA 2ZE0A 2A73A 5F0LB 2D2OA 1AGBA 2JKSA 4ZG1A 4X7EC 4OCNC 2WLKA 1KCSL 1A6PA 3AUWB 5L6YH 1PZBA 4JDZA 1KCRH 4FG4A 1PPIA 1U8OB 4HW6A 5EBWA 4KNUA 4GW5A 1A7QH 3B34A 1OAZL 3E8UL 4JKMA 4FQXD 5D7LA 1FZMB 1ZS8B 4Z7AA 3SE8L 3U1SL 1S3KH 3WSQH 2JJTC 2V2XB 4UDUA 5I9QC 1DE4B 3IJ9A 4KY2A 3SDAB 2WJ7A 1IKOP 3KXFB 4K5MA 4I88A 3P1VA 5A2BA 5ADPL 3FCTA 2D03H 4RAHA 1YN6B 3RJQB 2VDOH 1MELA 3W0WB 1GZHC 2X4NA 5IROD 1IE4A 4AW7A 4KKAD 4MX7B 3WUWB 3KEHA 1MG3C 1K2DA 4DF9A 4IGBB 3FK3A 5IBUG 1UYWH 4ERSH 1GCYA 2VDKH 3DX6B 5DEFA 4BRJA 1QQDB 4G82A 2P9RA 4HEMA 1Q9KA 5DUPL 2J88L 1B6DA 4WAFA 1QO3A 3L7EB 1KTBA 4DETA 5F9OL 3TXAA 4RNRB 5JUEH 4LP4A 1N6QH 3P4OB 3VD2A 2H2PC 1CFTB 4LCIH 4ABQA 1ZPUA 4YFDB 3UTSB 1DLHA 4TVPH 4UIMB 3OG6B 1WHPA 4PGCA 1N8OE 1TTRA 5CEZD 3II1A 1EHLH 1CBJA 1C5BH 1DBKH 4UNUA 4CVUA 1T2QH 4Y8AA 1WAPA 4LHUG 1NEZA 2N7AA 7TAAA 4MBRA 2MPAH 2PXYD 4LGSB 4WHDA 4M7LH 2AXHA 3OGOE 2RHEA 4UCFA 3MROB 1V7ML 5C6TL 1FZJB 1KEML 3ARFC 1K8IB 2X6AA 4P4KA 1EQWA 3BGMB 3G9VA 4DP6X 3HG1B 2H45A 3CXHK 1P2CA 4ZX4A 2HKFH 3QCTH 2ADJB 4HPYH 1H8OA 2EDXA 5F9JB 1C16A 3V4PB 5IESH 1P69B 1AO7B 4GUPA 3V6OE 2FLBT 3VSTA 4Z78B 3FMGL 2YLHA 1VEOA 4Z7NB 4GP5B 1ZHLB 3CPLA 1DDHB 2EUXA 5A2IH 2EYRB 1FGVL 5IROC 3B7UX 4IIZA 2ZXWB 3RWFB 4BGLA 8FABA 2HVJA 2XUWA 5GGSB 3VGBA 2WO2B 4Q2ZA 1SUJA 1F13A 1HFUA 4HPOH 5DQ9A 1SUHA 3NESA 4JHBA 4QRUB 3ZYZA 4RISH 6PAZA 3NG5A 4FLRA 5KSBB 1T04A 1AC6A 1GC1L 4H5SA 4KK6C 3H9HA 4A7TA 3N43F 4YHOH 4P46B 5MEOB 3DMMB 1PZ5A 3K6SA 1OCOB 2OK0L 3BZFA 4JCMA 2C3WA 4QMEA 3OGCB 3CHPA 3EJPA 4U1JA 4UQDA 1YLBB 2MH4A 4P4KC 3L2MA 4X99B 2GK2A 2VRKA 4I3RH 4AUUA 1GOHA 3SY6A 5HDQH 1EIBA 4AC4A 1MLCA 1Q9OA 2CIIA 5HHMB 3T2PA 2CRIA 2Q76A 4UNTA 3V4PH 1AANA 4HT1H 4GS7B 1OAUL 3QDGD 4RX4D 5T5FL 4M5TA 1K8DB 5HD8D 5HDBB 4WO4B 4BV1A 1UB6B 2ZUUA 2Y3AA 2CUIA 4KBPA 2O5XH 3OZLA 4JR9H 3RVXD 3NDZE 3GO1L 3WNLA 2H6PA 2CGYA 3PF2A 4HJSA 1O6TA 3FQUB 4IDJL 3S36H 1DSFL 4M5SA 4ZUUB 4X6BB 4NUGL 4X6CF 2P5EA 5J5EA 1E5YA 3NSFA 1MFDH 4YDKL 3GM8A 3KPNA 1AJ7H 3HE6D 4E9TA 5DZLA 4TSBH 5TQ2L 1U0QA 4DUVA 4CSZA 1I9RL 3DX0A 4AITA 1PBYA 2D3LA 3K6IA 1ML0A 1YC8A 4NUGH 1OAYH 1U8KB 3BGFC 5D4JA 4ZTOL 1M56B 2Y23A 4G8IA 3WKPA 1CGTA 1JUFA 1JN6A 1VFMA 4QY8B 4HJEA 3BVXA 3HRZC 2BNQE 3L2LA 4OLUL 2IDCA 1TPXB 5E6UB 5DHVH 5GZOC 4LL4A 3TBYB 5FCSH 5E9DD 3AG1B 4XOEA 2W9EH 2BNQD 1U91B 5DRZB 1ZGLP 2BDNL 4NQCA 1KYOJ 4NDMB 2AQ1A 2OJZH 3GXDA 4ABUA 1XF2A 5JPMC 4X4YA 1ZA3B 4O00A 3VAEA 2ENYA 1OWWA 2QKIA 2Z31A 4M93B 2PWFA 1XBDA 4JFFA 4EDWL 1QYGL 4QRTA 2FEDD 4QDGA 3T0EA 2VGLM 4G6FB 2CIKB 1GGCL 1TQVA 1GMIA 2PPAA 2DM2A 2VDNL 3OKEA 1PX4A 5JPMA 5B7MA 3OKNA 5EUOF 1B0GB 2PCPA 2PYEA 3RJDA 2DWYA 5C9KA 5EU5A 2MQ3A 1FAIL 1LK3L 2LFEA 2VXUL 4EDWH 3SSGA 1YC7A 1AZUA 1H9VA 3D09A 4KTEL 5I6XB 3WHE0 3WXVL 4XP1L 4KNTA 4G59C 8CGTA 3NTCL 3O2DA 4PJ9A 2ZXCA 1MCLA 2Y5TB 4ANXA 1AO7A 1U30A 1AQMA 4X4ZA 1A6ZB 4N90D 5DMIL 3GSRA 3I6KB 2YRZA 4OLZH 5BJTB 1ES0A 1GL4B 1BVOA 2PO6A 3ARBB 3PWPB 1DBKL 1D5RA 3RY6A 5A1AA 2HG5B 4MJ2A 2Z35B 3QUZC 1ORSA 1S2EA 4PD4K 2YZ1A 3D05A 2H2SC 5BUPA 1PQZA 3CE1A 1JFQL 2GCYA 4GG8B 1MXGA 1KENH 4FKEA 4URTB 3RIFF 1PKQB 1V7NH 3P9LB 4FD0A 3V4UH 5DHVB 3MAWA 2GT9B 4I0PC 3DVNA 4UF7C 4PS4L 1EFXD 2F1EA 5E5MA 4B9KC 4JZJB 4HIXL 4L23A 4ZZFA 2QPFA 5C0CA 4OUUB 4UTBL 2CHZA 2XCMC 3RQ3A 4D0DB 1I7UB 1Z0NA 3NSXA 2X3CA 4A68A 3AAZB 3WEAA 4FABH 2X4OA 2ISDA 3O8XD 3Q7JA 4J27A 1TCRB 3UCQA 2YHGA 2H1PL 4WSGA 2ZT9C 1HJBC 4K3DL 4UV4H 3MRMB 4O02H 4G8EA 4N2EA 1IX2A 4Z8FL 2C3VB 1GGYA 2BS8A 2MKLC 4ZDHB 5KVEE 1MF2H 4HX1A 1A65A 4HZ1A 3AB0B 1WUZA 4O58H 3RTQA 4URKA 4OZGF 1BVLB 2CG9X 2IPTH 4W68A 3UP1A 1YSOA 3GI8H 1KTDB 4XP5L 4OI7A 3C6SB 4I85A 5A2LH 3O9WB 4JQXA 1B0RB 5CJQH 2ICEC 3SDCC 2DL2A 4UT6L 3RA7H 5DSCA 4E41B 3DO7B 1HAWA 5FYKE 1UGKA 3VCLA 4APQA 1AY1H 4AJWA 2CDGA 1DCEA 1UWGH 3Q43A 2IPUK 4YHZL 1NQBA 3D0VB 3BZDA 1RIUH 1IGTB 1MW2A 3TFKD 4XNDA 3CN2A 4PCSA 5FYJL 3RTQB 2NXZD 3WEOA 5CMAA 1FL5B 1MVFA 3IRCA 4KK6D 3W9DB 2NZ1A 2VE6A 1QR1A 3KYAA 3CZJA 3MRBB 4TS6A 3CFBA 4NM4L 1JK8A 5D1ZD 4UQ2B 2VZSA 5FPIA 4LVOB 2ZP0T 4MCNA 3OR6B 1JNJA 3GZKA 3NZSA 2P44B 1KTLA 4H1LB 3BGAA 4RGOH 4HUKB 5B1KA 4A6YA 3KW7A 3E1F1 5E51A 5K9QG 4M29A 1EAOA 2ZUSA 2WVUA 2DQCH 4YZFE 3C2AL 4G42A 4KQ4L 5J1SC 3MRQA 3X14B 2R9HD 2M26A 5DJZB 4LSVL 2J4WH 2IFFH 2WD0A 3QUZA 3MRLB 4MDRA 4Y19A 5E2TH 5T33H 1QRND 3MRCB 4LU5L 3QQXA 4KROC 2ARWA 3VU1A 3S5LG 2VL5A 1QX1A 4UIMA 4HMEA 4FEIA 2WVSA 4NXSA 5DK0B 2R15A 3QDMA 2GABA 5GS0C 3IMVA 2WO3B 3MA9L 1MCCA 1KTKE 3MJWA 1G1CA 2AK1L 2BP0A 3BSHA 4JRYA 5IGXH 5FGBA 4NQDA 1MOEA 2D7OA 2PO6B 1BM3L 1UXWA 3GMQB 5DYFA 3T3MB 4FLOA 4JHZA 4WKXA 2ZXAA 4GYBA 2LLLA 5L7XL 4ZX6A 1G9NL 1S7UA 2K45A 5DI8A 2KLSA 1O7VA 5IW6A 3T8XB 2EYSA 1I1YB 1O5DT 2P3YA 2WVVA 2EDQA 1C16B 2FO4B 3LKSA 4JKPL 1LMKA 1XCQB 2DLTA 3QDMB 4U3HA 5FR3A 2Z3FA 4Q6IA 1WFMA 1S9VB 3QFDA 1Y07A 3BP4B 3RUGE 6TAAA 2HMIC 2J1KA 5DWUL 5EMYA 3I6LE 2JF1A 3WTSA 4JDVB 3X3FL 4R0LC 3RVTC 4XP6L 2LVEA 4H4NA 2CGRH 2Z0UA 3CVIH 4QRRA 4M6MH 5CD5C 1TETL 1Z9MA 2MIZA 2QVTA 1F3RB 2HKHL 2AMGA 2VR3A 3GMPB 3HMXH 1PY9A 2A73B 2P5WE 3L3IA 5GIRA 3UBFA 3ZKMC 1L9MA 5IMMA 1A6VL 3MNMA 1FL3A 1GYCA 2K9FB 4IK6A 1MHPH 4R7DA 2OMXA 3IWUA 2JI3A 5KSAB 5IK3B 2NX5A 2CBPA 3ORJA 4L3ED 1P4LB 3L2NA 3Q1SH 3EF4A 3D6GA 3H7BB 1G9ML 1G6RB 3B6SB 1DL7L 1CIDA 1FPTL 4HXBH 3FQXB 3KL5A 1YMMD 3LEXA 1ZLWH 5KG9A 2FZ3A 1B3IA 1U8HA 3T0ED 4AQEB 4YR6A 1G7JB 5GJSH 3K1KC 4FQIH 4NFCA 1U33A 3BLBA 1MWAL 2DIJA 2ZYIA 4HHAA 1N0XH 5H2BB 1OP5H 5F9WB 2ODHA 4FXGA 3VG0L 3I3EA 4LRNL 2HH0H 2X70A 3BISA 1E6OL 1U3HD 2G3MA 4UU9B 1TKWA 4OZIE 2F7RA 4W93A 3PL6B 3QI9B 5AZ2L 1SEBA 2KYIA 5L8LB 2WBKA 4ZK8A 2ADYA 1PAZA 2R0ZH 3FFCA 1WDAA 5LCVL 3WIHH 1B90A 2YD4A 5ICXA 3EHBD 4QNPE 5IKCA 1UWXK 4R83A 5BVJA 2R2BB 3QJRB 3RHWF 4EUPA 4HGMA 1GJWA 1LL1A 3H53A 3AMLA 2ESVA 3RDJA 5IMKB 4KTYA 4L05A 2CDEA 3QG6B 2JQMA 4C83B 3DUUA 2QQQA 3FHEA 2R7EA 4OGQC 4YXKH 4MJHA 5CBEA 3U2IA 2R2HA 1OALA 3W5NA 1D6VH 3FRPA 3UYRL 4HJIA 3L95B 4GKZA 2AJSH 1UT1A 3FTVA 1EBAA 3FU7B 3KD4A 3TYGH 4NBXB 3LRLA 1PX8A 3D07A 3WTVA 3Q6FA 4R84A 4PWFA 3HA0A 5DZAA 3ARUA 2O4EA 1T22B 4ZPTB 1QFWH 2E6PA 2E46A 4KZDL 2B1AH 4UQ9A 3AQXA 3BGMA 3LZFL 3VTMA 3FFCE 4FDWA 4H40A 1A4KB 3QXWA 4NO0A 4PRPA 4JFEE 1R24A 2QKIB 2Z31B 3B5TA 4K8RC 4NAMA 1VKXB 4FXKB 2P5PA 4OZIA 2AJUL 1HYSD 2CAKA 4PP2A 3BPLC 5BRZA 4OB5H 4MX7A 2WSKA 1EO5A 4MAYA 1IGMH 2AJYL 5HHVL 4DK6A 1DYZA 2EYRA 3KPRE 4HJ0C 2OSYA 1DBAL 2O5YH 2H8PB 1FA4A 2F53B 1CK0H 3CGTA 2WN3A 1F4WL 2HT4C 2M2DA 3UAJA 3IB4A 4BH7B 1BG9A 2CMRH 3KCWA 3CXHJ 2NX5E 4KFZC 4BFEA 4LOUC 1T1WB 4WGWB 4XXCC 1JXDA 2F8IA 3GWJA 1G5GA 4NKDB 5I2IB 2G5RA 2PW1B 3EW3B 3WJMA 4ELMB 4N24A 4LBAA 1GGIH 1FRGH 1RP9A 3NOIA 4FFZH 4ZUVA 4M8UA 4JJ5B 1CICC 1N3NA 1BVZA 1U3HC 3Q2VA 3HVDA 2BCKA 4R4FL 2OSLB 3BPNC 3DMMD 1UA6H 1O0VA 3NACH 3G6JF 3GPSA 3QPXL 3FB5A 1HNYA 3K72A 1AG6A 1OGPA 2JKRM 2SEBB 5KVGE 4E9XA 3NTCH 9PCYA 4YHPB 3ZE0F 5I66B 5KS9B 4IU2B 4U0RB 1TJGH 1XZ0B 4G43B 2ZWSA 4JFEA 4ZFGL 4HKBA 4MAUL 4XPHH 2J8UA 4L1DA 3FSWA 3VM5A 3GTVA 1CYGA 1JHLL 2K3TA 4JO4H 4MAYD 4OV6F 3AM8A 4RAUA 4MVBC 2YBGA 2A4ZA 2ZPKH 4UB0L 3HMXA 2NW3B 1JYXA 4PREB 5GRJL 3BD3A 1BVKB 1UKQA 4PRPD 3B43A 4UM8B 1G7IA 4XPBL 4YIQA 1W0WB 3SKOA 5IB4B 5AW1B 3VXMD 4AGOA 2XQBH 3P77A 4QD2E 1OV8A 3KLQA 2HKHH 3HMXL 3O2WH 3CZFA 2GJ6B 1E4XL 1F5WA 1SOXA 4FG6C 4GSDL 1AKJD 4CL7A 4KPHH 5HHXL 5K9KB 1BP3B 3VI4F 2ICES 2HT2D 4JRYD 5CLWA 2R2BA 2Y1AA 1EK3A 5E03A 4X7FC 4Z7QB 1YYCA 1DL7H 1FPTH 2VMJA 4HXBL 4XPTL 4PY7A 3L3DA 2BMKB 4KK5D 1VFUA 4KNSA 2JVUA 3SKNB 1OAKH 1QAWA 2X4TA 1X9RA 3V6OC 1QFHA 2LHAA 3QWRA 4KZEL 2MOVA 1NC2A 2R69L 3ASOB 3UTSD 2WQRA 3QULA 4AV0A 2QSVA 5AAMA 1QFPA 3TBVB 1L9NA 5I73B 4LLUB 4OLVL 5KSAC 4QAMB 5M7QA 3UPRA 5FLVA 5JHDB 2BVQB 5E8DH 4XBGB 3KYNA 3POHA 1JZ3A 1EX0A 1B6UA 3O81A 1NJ9A 1NCUA 3HG0A 2VDKB 4LOUD 1U58B 3U1QA 2BSTB 4HD5A 5BOPA 2DWTA 4Q4IA 3VB8A 3QZWB 3UTPD 3K1DA 5HYJE 3PQYE 3IJEB 1FORL 3KXFD 2I85A 4FXKA 4JPIA 1VSCA 2EDBA 5G4NA 2XXFA 2E7BA 3EUUA 5DGQA 2RCSH 4XXCA 3K3QA 1IJNA 3TASA 4ZFFB 1NIFA 3RWFA 1KXTB 1J88A 1XAUA 2V17L 2JJSA 1XGRA 2R23B 4HUUA 2W8CA 2X9ZA 2B1HL 4AK2A 1S9WB 3M86A 3C8DA 1HT6A 4XNYL 1NGQH 5FGCB 5JNYB 2G60L 3ZDYB 2HN7B 4KUZH 5TDPB 4OI8A 2Z6FA 1KZYA 1HX0A 1X5IA 3U0WL 2ZYRA 2AMUA 2UY7B 1IQDB 4F57L 2XN2A 4OUUA 1YMMB 5CCJA 4IM8A 3QC6X 3OHXC 1R6VA 2PCFA 3L9YA 2C8NA 3CU1A 3M8OH 3C2AH 2R0ZL 4Q9RH 1WFUA 3OAYK 4WJ5B 3IDYB 4KQ3H 3PPSA 1FP5A 2B77A 3HR5B 2FE0A 4UOW1 3PWJB 4WUKH 3OR7A 1K3IA 5CEXA 4F7CB 1VERA 1VF5C 2CSPA 2CBMA 3OSKA 3SGDI 4QHNB 4JVUA 5FKPA 5AUMA 3BI9X 2JB6A 1FN4B 1FSKC 4JQIA 4ZDHA 5IB5A 2W0LA 1EZUA 3A6OA 3G3LA 5CSZA 3ZTEA 4DPCX 3ZR6A 3D87B 4NO3A 4UIKH 4IBWA 1AD0B 3AQDA 5C0AE 2EDEA 1QEWB 3QDMD 2DIEA 2DIBA 3DBSA 5B3SB 4YJZL 3X12B 4TOYL 5SWQB 1A1NB 2KLRA 1JHTA 3RUGB 3I2CL 4WW2B 4KDTA 5FOBA 4S1SH 1YUKB 4O9HL 4ZFZA 1IGCH 1VFAA 4HCRL 1TMQA 2NYYD 2B16A 2X1QA 1RZPA 2G75B 5JXAL 1R5VA 1KGUA 1ZD6A 3QAZB 4J3OC 4KK9C 3QG7L 1L0QA 3GT6A 4KV5F 4LLVB 4TPRH 2QSQA 1AYRA 4FE9A 4PCTA 3RDTB 5E94B 5JXEA 2FDBP 1FL5A 1OE2A 1I7RB 3GSXA 4HHWA 3S98A 3WE6B 2QZQA 2V7NA 1LP9F 4TUKL 1UB5B 1X9QA 4RMWA 3IMRA 4GW1A 2CLRB 2TAAA 5GJTH 3JXAA 1F8TL 4F8PA 1FDLL 3PE9A 2WANA 4NGHH 3OR6A 4G9DB 2J1WA 4ELKA 3I85A 4MJID 1T0MA 3D2TA 3G6JB 5EU4B 4U1KA 4M8VA 1U8KA 4K3JL 4L4JA 1FNLA 3BLKA 3BYTA 2E59A 3K8KA 1CU4H 2EKSB 4YBLC 2Q0ZX 2H7WA 4MXWL 5D70H 5D6DA 4O5LH 3PDGA 1PZ2A 4PLJC 2R4RH 2ZTBA 2EYTB 4GIOA 1JGLH 1VADA 2R2EA 3DSNB 1AR1C 2OXGB 4L5FH 4GAYB 1A8JH 1MUJB 4ZS6D 3IXTA 5HYSB 4HV8B 3WIIL 3HRZA 2NY7L 3A3YB 1N0XL 2JELH 3KG5A 3M1CA 3QORA 3WO3B 1TJHL 5C92A 1JNLH 5IVXE 3SE3A 1INDL 4ELKB 4NWTH 2KKQA 1X5JA 4YSAA 3EFDH 1G0YR 2DMGA 3IDMB 3LAFA 5D2NE 2KBGA 3CDZB 3MKKA 4DN3H 5I5RA 2VWEC 3GLEA 2O61B 1A2YA 3ULUE 3P3SA 4R9HA 2LU4A 4R5VA 5GSRA 2NY6B 3KDMB 5DRWB 1P6FA 2VIRB 4LHJB 4KK9D 3FFCD 2Y06L 4TN9A 3ULVF 2E7MA 4M4RB 1A6VH 2XTJB 4AGQA 4P06A 3D8MA 4LQFL 4YDNA 1ZEAH 4DP0X 2GAZB 4JFOA 3V7AG 1KGCD 3AWGA 3MU3A 3KJ4B 4NQSA 3TO4D 2M83A 4JO1H 5F7HA 1OY3B 3KDPB 4I0PA 1U8IA 4QTHA 2PW2B 3GQFA 4G80B 2NCEA 3V6ZB 2VH5L 3SE4C 1T5XB 4ENZA 4TTDC 3QH3B 3KLLA 3ATEA 2P52A 3LV3B 4O02B 3VRLE 3AJ7A 2W07A 5D7IB 5T1LD 3SQBA 1SY6A 1HL8A 1R0AL 5C7ZA 2UUDK 2VDQH 2UZXA 1JNNH 3N85L 4G9FA 1GZQA 1Z5LA 3QIUC 2GT9A 3QPXH 1JPSH 3FU6A 4QOKB 1HEZB 4PHXA 2IMMA 3X1FA 4H20L 1U8IB 4YDIH 4KUCD 3WJMB 3EBIA 3DTUB 5JO5B 1XIWB 3O4LD 2YWYA 3CLEH 1CBVH 4PTUB 4UAHA 3RJOA 4LCCC 1YNLH 3AAZA 4YFLF 3PP3K 3UP6A 1R5WB 3P0YL 3U7YH 1HXYA 5EN2B 3OXSB 5GGVY 3RKDC 4F5CA 1UZ6F 5ANHA 2FT7A 5CZXC 5CIPB 2ZOWA 5JHBA 2EYSB 3UABA 5CLXA 3C87A 2VMFA 4HEPG 5F1OB 2HTKD 1EVTC 2G75A 5C0AA 3ZE0B 1ADQL 4XNXH 3MPCA 4AX3A 1H3PL 3S3DB 5EOCJ 1F4XL 1NLDH 5A6MA 1RZJC 4HUWA 4ZXBB 1HSAB 3MREA 3QZNA 2X1WL 4M5ZH 2AEPH 4OZFA 4CA4A 4RMQA 4CSTA 4UDTA 1MXDA 3ZE2E 2VR7A 3IJSB 5BS0A 2E3VA 1D6VL 2X1OA 3IFOB 4PD4J 4I9XA 3BT0A 2G9KA 4YEFA 4ZX3A 4E68A 3C6SA 3EKCA 3D85B 4GW1B 2HP4A 2A3TA 4OT1H 5F7DB 3ZO9A 3O4OC 1NAKH 4JM2C 3DUSB 4B9GA 2VXSH 4IU3A 5FV2A 1YQ2A 4IIQB 4TLTA 1Q9WA 4U33A 4C4UA 4Y19D 3KJ4C 3LB6D 4GINA 3QHZH 4OZHE 4YHLL 5I82A 2EC9U 1EZSA 3TEXA 4CUCA 1KTRL 2JJUA 3EH3B 3UO1L 5LLIC 1UASA 1UUSA 3LKRA 4BSWA 1HCYA 4O4YL 4JL1A 3IAPA 3OQRA 1VFBB 3LEVH 1DQJA 2I5YH 4JFDA 2NLJB 4ODUB 3LKOA 3QEUA 3UJTH 4WCYL 4C55A 2Z0BA 3FXIC 5E9DB 3DMMC 4KMTL 2O6PA 3RKDD 3W57A 2ZOLB 2VLJA 3J8F7 1QWUA 5HHQB 5E2JA 3VGHA 2FYVA 1L0PA 5JQHC 5I0WA 3CK0H 5D7IE 5B21A 5ISZA 1FO0L 1WZ1H 1YEWA 3L6FA 4XVSL 6FABL 5ICZB 4WWID 4CW1A 1D7DA 3MLYH 2WBJD 3PGFH 3B37A 3QDGA 4IBLT 4KHXH 3APNA 2CHWA 1U58A 3O3BA 4S0TD 1XD1A 2WXRA 1S3RA 5F70A 1PZAA 2AITA 3HE6B 5F88B 5IHUH 2JIXA 5EU6E 5DMYA 1JHKH 3GBNH 4XO8A 4YBLB 2EJ1A 5TDNA 2V3DA 3LPOA 4JFFB 2GEQA 2E27L 2X4QA 1GSKA 5DK0A 4R7NB 2HT3D 3FDWA 1OT1A 3IDJB 4JO5A 5D70L 4C56B 3T0VA 3VXSA 4DOHB 2D9QB 4NIYE 2FUQA 4WO4D 4G11A 3EGXB 4GSRA 2CD0A 2KC0A 3IAGC 4HIXH 3MA7A 4WNJA 3QT2A 5CEYB 3ECBA 2YGPA 1NFDE 5KVFH 4R3SA 1BPLB 3MNWB 1EERB 4NO0B 3GMNB 3I75A 5C08A 2UWEB 3ZDYF 5K5YA 5JYLA 4MMXA 3MACL 1VGKA 3TCTA 3LRSB 2R27A 2PLTA 1R9FA 4GNKB 2ALWA 1YMMA 2K6ZA 2QDWA 4A2MA 3VE0A 3QJHB 1KBGH 1WRFA 1YPZF 3OKLA 2H8PA 2B15A 4P46D 35C8H 1MCIA 4JM2D 5CP3H 3WUWG 3NFPA 5I6PA 4X99A 1OAUH 1K4CA 1E6OH 3P3RA 3FUEA 4AK1A 4K73A 1NFIB 1UWGL 4YHZH 1XIWC 2IQAB 1GC1C 3HG1A 1I1RA 3DVGA 2X2JA 1CLVA 1N70A 4N2NA 5F9JA 1PF3A 1NL0H 1O9ZA 3D3VE 3PP4L 3F6LA 1VGKB 1BFSA 1JZJA 1XCTA 4LCWD 5KYUA 1CGXA 3RWHA 3MFFB 1IV8A 3T4YA 1MFAH 1WGOA 1AD0A 5F89A 5AVQB 1HHGB 3U4EA 1DQMH 3VXNB 5J6SA 3MNZB 1CXHA 5F7FA 1NL0L 3NAAH 2OTWB 4YHIB 1YEJH 5FCUH 2OMNA 5ERWA 2QR0A 3TWYA 4LSQL 5CAYB 3SKMA 3WTTA 4X83A 4DERA 1ZIAA 1HINH 2WC7A 1MQKL 4YBHA 1AI1L 1MRCL 5KBPA 4S1DD 5EF3A 3BMVA 3EYQC 3UBGA 2A77L 1ZANH 2EVIA 2NY3B 2W80C 4OQTH 1NANH 3KPLB 1IMHC 3MODL 3MXWL 4GXVL 1CU4L 3G08B 1KJMA 2BSRA 3O6MH 4HUVA 4HFWA 3QO0B 4XT1C 4YAQB 4Z3JA 3A67H 1I7TB 2NTSP 1DQJB 4JFDB 1KBWA 4R8WH 4WTQA 3K81A 4LCVA 3A6CH 2RAMA 3COOA 5CXPA 5AVUB 4UZGA 4LDEB 4EOWH 4TULH 4P57A 2LAAA 1BZ8A 5EOQH 5HHPA 4HG4K 4PN6A 4WI8A 3CV5A 3VQMA 1T5KA 3VTTA 3B2UD 1ASOA 4ZOEA 3RFZB 2OYPA 1LJMA 1OW0A 3T0XA 4PJ8A 2YD8A 3L7EA 2WLLB 4A7SA 1I31A 2ZIDA 1PL3A 1OARL 2XU9A 5JHAA 1JMZA 2QFPA 1BFOA 1MJUH 4OAWA 4AJYV 5LNDA 5L2JA 4G70B 1FDLH 5C0ND 4PJ5B 4HIHA 1IQDA 5IREA 1ZVYA 2D7PA 2R69A 4BYHA 3WNKA 4Q9QL 3FTUA 3LHAA 1RKRA 4RGNC 2YAQA 4WJ5A 1IQWL 3TP4A 3FB6A 4FYRA 4LL1A 3SZKC 4GKSA 2WKOA 5KVDL 4CU7A 2APWA 1HWHB 3FQWA 3P0GB 3MDJA 4K9JA 4JG5A 5KSUB 2Z92B 1D7CA 4H25B 4XP4L 3TH4T 3RHWK 3PGCB 3KWWA 5AYTA 4FABL 1J05A 4KAQH 2X6VA 4IS6A 2AZUA 4CC1A 3O3UN 1OGTA 2F58L 5CINH 3MRFB 1JGVL 1ETB1 1IC5L 4BHUA 1QLEB 3NJIA 1N8ZB 1BLNB 1OAXH 5FYJD 1U2CA 1KXVC 2CA3A 4PJ7A 1KJ2B 4OBRA 5I1DA 2V2TB 2BS71 1NBVH 3PYCA 5DGRA 4LCUB 4M48L 3WNPA 3L1GA 1GW6A 4G5ZH 3BUIA 5FUOL 4LARL 4Y89A 3RB7A 3T0WA 1YAZA 4PJIA 4WFGD 3TF4A 4F37F 3LRHA 1D5MA 3I6GB 3N5AA 1RLWA 2MOQA 5D7KE 1RZFH 1NM9A 4FA8A 4V2BA 4I1PA 1OGTB 4RAUB 5HXMA 3TFBA 1BXVA 2D3JA 2XT1B 5J1AA 2LU3A 2VZTA 3V5HB 4B0MB 1UEYA 4I9WE 3UTTD 3FBQA 5FV1L 3D50A 2XA8L 3EJJX 5EN2A 3PQYD 5KUKA 3KCPB 3WYRA 5IFHL 4MWFA 5INDB 3BP7A 4IRSC 3U0WH 1HKFA 1T21A 5HHOE 3SJVD 3I74A 3NCYP 2AP2A 4ZT1A 3SDXB 5B39B 1HHJB 3RU8H 1AQDA 5DEZA 3WJLA 43C9A 5KVDE 4D7BA 1P5VB 4KOCA 5IQNA 4BXSV 4D0DA 3WU1A 1A9BB 4W9FC 4N0CD 2EDKA 1DVSA 4GAJH 4FQQA 2Z8WC 1BBJB 2R2EB 2P5EB 3DSNA 2W60A 1KJ2L 1FZOB 1S5IL 3B8YA 4YNYB 2BH0A 3MV9E 3VTAA 5K9QI 3FQ1A 2F5BH 2RQEA 3S6CA 3U7WH 4ES8A 2WAHA 4OJFH 2BIQA 3J07A 5H2BA 4Y4HC 4PGEB 1QWNA 4K94H 1G9HA 5KBNC 1CL7H 3QXDA 3REWA 1T21B 2IANA 5I0DA 4WCYH 1O75A 4OZ4B 2I9LA 3MNVA 1OAKL 5E8OB 4QKTA 4FXKC 1ZGLB 3B1UA 5KJ7E 1YHPA 3KYNB 5AVRB 2JCWA 7CGTA 4Y4HA 3DOHA 2AQ3A 4ZSOB 3VD7A 4PCYA 1G6VK 2FL5A 4O2CB 1O7SA 4LEOB 4P5KA 2JKXA 2VLJD 4HCFA 3L1FA 3L3JB 2JTYA 3U46A 3EJTA 1OW0C 1GS8A 3IU4L 3MUY1 3QO1B 4OAWB 4W6XB 3HEIB 4U1SA 1YY8B 2F5AH 4HDIB 3ZY7A 4PUBL 5EZOL 2P48B 4Z95H 4APQB 3AXHA 5CJOH 1TEYA 4DP5X 4AXWA 1VEMA 3QUMA 1R0AH 2DQIL 1NUDA 2GY5A 4YDKH 5K1JA 5KYNA 1LO3H 1SJVA 1ZWIB 2YO3A 3FN3A 3M17B 1AO7E 1MJ8H 4OCXL 4P99A 2DY2A 4M8QA 4WI0A 5B39G 4AEIH 5GGVH 3A5VA 1OE1A 3UBXG 1MRDL 2AW2A 3NCFB 3UXFA 2P80A 3ZZLA 2QTEA 4NRXB 2UZXB 1LEGB 1SLWA 2KT6A 2VDNB 1BZOA 2KDGA 2Q7AA 5D71H 1ZVSA 1D5BB 5J3HD 1UA6L 1WWCA 2FJFB 5BRZB 2GK0B 1BJ1J 3P0YH 4BM7A 4DH2A 2C4FU 4NNYA 4ZOAA 3UBXI 5HP5A 1X5HA 3RL2A 4J3UA 4L8SB 3BOVA 1IFGA 4JFFE 4JEGB 4MMZB 1WZ1L 5CLZA 3SYCA 4RGMB 3VSQA 3VXPA 6FABH 1A7RL 1KB5B 2VAJA 4RX4A 3VFGH 2OMUA 2OA9A 5HTSA 4OT1L 2NY5L 5G55A 5CN3A 2IGLA 4XMPL 4HS3A 3RVTD 2JJSC 1F42A 4OJEH 4GKLA 1CT8A 4OV5A 1BX2A 3DTXB 2VW6A 3D25B 3A6CL 5EZLB 3EXLA 2UWEF 3C5JA 3CVHB 3LKNA 5I16A 4PJIB 1RK1B 3SDDB 2HFEA 2YUZA 3G6AA 5CM1A 1WCQA 3UTTB 3CPLB 5AD0A 3CHRA 4XPAH 1J18A 2BSCA 2GSMB 3IYLW 5KG9B 3LV3A 4KGJA 3MRHA 4R5XA 3A4EA 1BWWA 4NOBA 1MHHB 1YEKH 1MCOH 2XXMB 4JHAL 3SE6A 4JB9L 4KZ0A 3KCPA 1TLKA 4OLVH 5D7SH 1BVNT 1RHFA 2XTSA 5T1DH 1IGYB 1P7KB 25C8L 3MJ9A 1VENA 4MJ4A 3IETB 3NN8B 5AZEH 3L08A 1S7RB 3P11H 4EMZA 4PB0L 4TQPA 1XB6A 1A25A 4L1LA 3SODB 4HKXA 5L8KB 3SPIA 5D7JC 1P6AB 3QUYC 2X3BA 1AQHA 1IIKA 4P2QD 3QFGA 2IDSA 5I74C 3SGKC 4Z3TA 1MLCB 5D6CB 4J3OH 4YQXL 4OFKA 1MFCH 1NCWL 4RDQF 3RZCC 2XQYK 3FZUC 1DN2A 1HHIA 1DZBA 4LCIL 4KRPC 3BPLB 1A47A 4I3SL 3QJFA 3T0EC 2ED9A 5EU3A 2ATKB 3SE3C 1MHCB 3QEHB 1TJIH 2NNCA 2WLHA 5CILL 3ZDXB 3MLRH 3H9SD 2ICEA 5ICZA 3PAUA 5D7HA 2E8ZA 3QQ3B 5ISZB 5F72S 2WZPA 4ZUUA 1W72A 1C12A 1CGWA 1EHAA 3ZYJA 3F58L 2LOEA 2X4TB 5EO1A 3GRGA 4YLQT 2PCXA 2DQHL 3QWRD 5TE4H 2BIOA 4U1LA 3V4UL 5TJWK 4YBQC 3VG0H 3CG8A 1P1ZA 5A7BA 5C09A 1IKNC 4AV4A 4F2FA 3S7GA 1HZHH 1WF5A 3B5GA 3RX7A 4M5ZL 3BKJH 1VACB 4JRXB 3MRRA 5ISZD 1OPGL 1CFQB 3V6FA 4C57C 3U25A 4OFQA 3D7PA 3TURA 3INUL 1TR7A 2WSPA 3TESA 1DQQB 1PNCA 1S7VB 3LVTA 1UATA 3GI9H 1IBFA 1LK2A 2W38A 1X9UA 4C83A 2ZF8A 2X4RA 1J1PH 5IFAH 4ZMOA 4BXVA 4MJ5A 4QO1A 1QRNE 3S2CA 1Y6KR 3PHQB 2DLFH 2NXYD 3PJLA 4N85A 3HKZA 2BNQA 3INUH 4NBYB 4XNQB 1IGFL 3LMJH 5F7BA 3QI9C 2CIKA 1P0SE 2ED6A 1HHKA 3U2SA 4Y5VA 4JNXA 3GFUA 4Z7OB 1RZIA 1KBVA 1IAII 2D9CA 3HNVL 5LNEA 5HHVH 4GSUA 2WLIA 3BN3B 1KYDA 1PU0A 3OKOA 2WAQA 1QYGH 3V0WH 3CN3A 2BFVL 2HLAA 2IADB 4ATWA 5FX3A 1J9SA 2Y1YA 2I69A 3OKMB 1QFUL 4PG2C 3NUKA 3BUPA 2NUPB 3AS3A 3T2NL 1NGZA 3PHQA 4DCQB 4NC0B 3CFUA 5ITFB 1HSBA 1K6QH 3LN5A 4AQAA 5KYUB 4BFFA 1XO8A 3BW9B 1TZOA 3Q06A 4J4PA 5MHSE 4MD5B 4TVSa 5I18H 3NJVA 2A9DA 4YE0A 1CGYA 2WIMA 1G5AA 3CFTA 4M00A 3LD8C 4NO2A 1X5GA 2ICCA 4KHTL 3GBLA 3FZUD 1JTOA 4XC1L 1BYOA 2BRRH 2NQCA 4NO5B 2Y2WA 4OIIH 4YSCA 4OJYA 4R0LB 4Z7WE 4LSPL 1FVDB 1SDDA 5E6YA 2BVUA 3F7RA 4MA8H 4WDIB 4OM1H 5CZVH 3I6SA 2PWGA 3ETTA 1PKQE 5FGBC 1KPVA 1LD9A 5AWNH 4HAGA 3VGGA 5J6GA 2ZOKA 1NMAH 2K0RA 3BP5A 1F11B 4Y2OA 1JL8A 3VD4A 1AGEB 3O4LA 4R2GB 1TSHA 2G2PA 3ERXA 3QISA 4FNQA 3KVDD 1JPGA 4E5XB 1CI5A 3ARTA 1KCKA 5DA4A 5BRZD 4AGNA 4X6EB 1H3VA 4P2RA 1DJIA 1JNLL 4LGPB 4X5RA 3VI3B 3W56A 2J7LA 3HMWL 1DFBL 2NW2A 5DZNA 1FNFA 5E6RB 2IBZX 1XVSA 2X70B 2BY1A 1U3YA 3Q5OA 4ANKA 4HOZA 4IU3B 3MZGB 4GJTB 4IOIB 1HHIB 4K2UL 2DKMA 5JUEL 4AL8H 2VSMB 1EH9A 1JPTH 4G7RB 3KYOA 5H4YA 3X11A 2X4UB 1BZDA 3JV5A 1U8MB 5I75B 5E08H 4JM2A 4GG6A 2ENQA 1L9SA 4YDLC 3V6OA 5IHZB 3B8SA 3BQVA 5I6XC 3BVVA 4MBOA 5E70A 3NZ8A 4XMKL 2NXYB 1U36A 1BJMA 1QFOA 2YPLA 1SLVA 3DRQA 4KDVA 4GUQA 4RETB 2GKIA 4H8WC 1FO0B 3EYOA 5ANMB 1GIGH 3FT4B 1SHWA 4QXGH 4PJEE 2G9HB 3PAZA 3NJFA 2PR9A 3QPQD 4FNTA 1A7OH 3SKJL 3TCXA 4ACPA 3EIFA 4XMLH 1KFAL 4I4WB 3QE5A 1U42A 2C3GA 3QUGA 3T09A 4M93C 3V8CA 4LVOC 1LMIA 3MJ8A 3HAEA 4F24A 1UM6L 1H19A 3LS5L 5E8EB 4G8GE 5JPMB 2BK8A 3H3PH 1KJMB 3NZ8B 1UUNA 5T1JA 1E3FA 3EOTH 1ND0A 4JO1L 3WFHA 3NRPA 5L6YL 4XBEH 12E8H 1H8NA 3HRZB 1RY7B 3OSVA 4B3EA 3T2QA 4QRQA 3BWUC 4UMSA 3TBVA 4XN1A 4LSDA 4U2YA 4E9YA 5JIQA 3RFRA 3K71B 4PS8A 1U95A 5L88H 5I17B 3B2PA 2Z8SA 1K5WA 1E9QA 2VIRA 1BFVL 5FW8A 2V17H 5HHME 2AXGB 3FQRA 3MRPA 3EJQA 4GAFB 4Y0GA 2YMTA 1BLNA 1F3DJ 4GKNB 2B4CL 1LE9A 1KEGH 3LH2L 4TVPL 3WY3A 5IROA 3IGFA 2ZX6A 4P2QB 5C08B 5FHAL 3R06B 3C5ZB 4U6XB 3VXMA 1J1PL 1XEDA 1JSYA 1ZVSB 1T89C 3RPKA 5C8JA 4CJ1A 5ITFA 1B0WA 3CJJA 2WKGA 1A7PH 4AT6B 1RP8A 5F7EL 2UZPA 1ZHLA 5IJKA 1U95B 2RACA 3LPPA 3HE6C 5JIKA 4NO3B 3SPGA 3LMJL 2JE8A 2ALAA 1EGJA 3HPJA 3FB8A 2IC2A 2JJWA 4QYOA 4PBDA 2NT1A 4JY4B 4OLXH 1OD7A 2O1AA 4G6JL 1FJ1A 1LGVA 4PP1C 4G83A 1QI5A 5I76B 4YL4A 5IFAL 1PZUB 1RPUA 3S4SB 4CBZA 2R1XB 4XPBH 5AQ0A 4MJIE 1OB0A 1Q0YL 3QJQB 1M9SA 4LSUH 4I8DA 4WTWA 4AYBA 4MDJA 1AP2A 4ZZKA 2BFVH 4L4VA 1MNNA 2X2IA 1HOEA 4ECNA 5F6IC 3X3GH 4QOKA 1N9PA 3ZQ9A 1VPOH 3DX9B 4AMXA 2JH2A 2SODB 3G6AB 4RZCB 1E4HA 1FFPA 1S78D 1X5LA 4LDLB 5DD6B 4BK4A 4HP5A 1XIWD 5C0IB 1HXKA 1MCWW 1HZHL 2ZNWA 4N2CA 4PB9H 3DX3A 3NYKA 4M6NH 1AH1A 2H3XC 1N5AB 3IDGB 3WE6A 2CUAA 4NQDE 1HS6A 32C2B 5CNHA 1I85A 4B50A 4BWUA 3QYNA 4AH2B 4PUBH 5DVPA 1ZV2A 4AWJC 2AEQL 5DHMC 1F1GA 3PJSB 2KQMA 2DM7A 5T5NF 4E41A 3RNKB 1RURH 4PTTA 3UERA 3U2JA 4OZ4A 4JCLA 3C5SA 1AMYA 3FN9A 4OGAC 4XP6H 4P2AA 1ZHBA 4EI5C 4QYAA 4N87A 5GGVL 3ZYIA 1DLFL 5ADOL 2AJVL 2YOAA 2K6WA 3IRZA 3W82A 5E1QA 4XN9A 4JO4L 2RFXA 1EAPA 1XXFC 5AW6B 3L5IA 5BOJA 2XG4A 3IRPX 3MRBA 4PJDA 3TO4B 1XF1A 1TJGL 3LPGA 1MHPL 2IH1B 2K9UA 3NCXA 2Y72A 4EVNA 4QWWD 1WWBX 4FXGB 4G9FD 4JHVA 5T1DL 3FW6A 3HZKB 3UYPA 4DNLA 2B1OA 3AWFA 2WXJA 2H3KA 4OJCA 1RIVH 4LSTH 4H1LA 3A0OA 3R1GL 4BKTC 3B83A 5EBWB 1D5IL 1AGCA 2WBJA 5ICXB 3KPPB 4MNHA 3U48A 4LOFA 4DVBB 2F8VA 2YC1A 4G6KH 2MKWA 2WMPB 2AV1B 3TZVD 1XL6A 1QSEB 4UTBA 5D9SB 1KNOB 1YEFH 3NSJA 5B1AB 1PYWB 3O2WL 5DJAB 4UYPA 1JS4A 1RK7A 4FC3E 4N0FA 1EEZB 3B9DA 3TA3A 1GVIA 1B9ZA 2XPYA 5BZWA 1E50A 1YDPB 3ISYA 3ZRCC 1DQIA 3FRPB 2CDFB 1AG0A 2YAMA 2ZD0A 3EBAA 1WBZB 4GB9A 4LB8A 2BHFA 2XN9E 4LAQH 3ATDA 3M1BB 4YX2L 4IRJA 4MD0A 5IT2L 5DQDH 2N01B 4Z76A 1DQDH 3GIVB 5E1IA 3NFSL 1ZT7A 1UOKA 3DX6A 1ZLEA 1AXSB 1YJDH 3PUCA 2OMTB 4N8VB 1JPSL 3RVUC 3RIFK 3FB6B 2A6DB 2IGFL 1QTSA 3O3BB 2HXAA 2Y2YA 3ULUD 1FH5L 3UROR 4MJIB 3CLFH 3IXTB 2VRAA 2WXLA 3SJVE 2VDQL 4QCIA 5FYJU 3HS0B 3D18B 2LE9A 2PP7A 3QORB 5IEKB 2YK1L 1WJ3A 2VZVA 5KW9H 1BX2B 3DTXA 5JW5B 1YDPA 2VERA 1F4HA 2YXMA 2Z92A 3UG4A 4AQ1B 2X7LA 4BRVA 4WEMB 4GRWF 4YHNB 3EO9L 3RNQA 1NICA 3CDZA 3T3PF 1UM6H 3LS5H 5E2WH 3NIFB 1DEEA 5DT1L 5C7XL 4Y1TA 5BRPA 1EFXA 3OB0K 2VISB 4AUJA 4HEPA 1RUAH 2NX5D 5I8EB 2C9VA 1KJ2A 3CHQA 3ZHNA 5EF1A 2M8XA 3UJIL 2HKFL 3QCTL 3NRQA 4Z3GA 5HDWA 3LJ3A 3R8QA 5B1JC 1B88A 4R7DB 3TJHC 3TTSA 1NCBL 2PWHA 4ODSH 5SWZE 4N28A 1CVSC 3ELQA 4FNUA 4FNPA 3N3EA 2JTDA 4J6RL 1RFDL 1AE6H 1CD1A 3WL9B 1KLGB 5LAXB 3V8OA 2X89A 3ZPDA 4PVLA 3KPQB 2YGOA 3E6FB 5HI3C 5EWIH 2AK1H 4G8FA 3PFUA 5EBLB 5E8PB 4PJXA 4WW2A 4WZ9A 5GS1C 1N2RB 1F1DA 1WQVT 1DVFA 1FQ9C 2E0PA 1ACCA 3JWDH 4MA3A 3ZHDA 5ILTH 2G2NA 1P4UA 4JQIH 4W6YB 1S7QA 1R3KA 4B60A 1I8IA 1NIAA 4IJ3B 3MVSA 4M6AA 4EXPX 1A3QA 4HLEA 4LRIA 2BY3A 3FHQA 4BZ1H 2Y36H 4OIAA 4OQ1A 2AQPA 3WL9A 1KN2H 4N2HA 1WC7A 2AJSL 1ZTXE 1ADQH 4DP4X 4Y1AA 1BXXA 2E4FA 4L8CB 3GUFA 4ANWA 3I02A 4JFFD 3KGRA 4S1DC 1YNTA 3F01A 1ZHKB 1G7MB 4Y4KB 5ACZA 2WXOA 2NR6D 3RDTC 4DGIL 5DK2B 4MA8L 1S9XB 3AU1B 5EO9B 3REWB 4EUPH 3RI5F 1S5IH 1J48A 1V5JA 4L1HA 4AZ8A 1XTMA 4CGUB 3HAEH 2G3XA 4B5ZA 5T3XH 4MSWA 4XVTL 1P4LA 3WIHA 3S2AA 1G7PB 3GO1H 1IVLA 4PRNB 3UC0H 3P4LA 2XZAH 4JQXC 4OGYH 5D4QA 2NZIA 1RZKL 2XIBA 5DO2D 2A6JA 2R0LL 1E27A 3MOAH 4Q14A 3NIDE 4FAAB 2XPGB 1W6WA 5DJXB 4BFJA 3CU7A 3WHE1 1MCPH 1OP3K 1OKEA 3FT1A 3GRWA 3LS4L 4FOMA 4PLJD 1DDTA 4F37K 3BE1L 5DHDA 5A2CA 1S9XA 5JW4M 5A2KH 5GSVB 3ZZSA 1T7WA 3GKZA 4IOSA 4K5PA 1JZGA 5F6HJ 5I1HH 1CYWA 1YY9D 1G1YA 1H8SA 1TEFA 2F54E 2OL3B 2WWMC 4IRJB 4MD0B 3VYPA 3JV4A 4X6CE 1S3KL 4RIRA 2YSTA 1JDCA 1ZT7B 4KHTH 1A0QH 3D39A 4B97A 4X50A 3FQYA 3MRQB 1JK9A 1UC6A 2EQDA 2YEVB 5DJYA 4G3YH 5LXGL 1T3FB 5C0NC 3IDYC 4KKCC 4XMTA 1K6QL 1LE5A 2C3XA 3MLVL 5I1GL 3IAQA 5LG1A 4ZPVA 5DJ2B 4JL2A 2QELA 4Y5VC 3ZW3A 3W5MA 5AW7B 5JPNC 2ADJA 3B2UC 1CG9A 5GZND 4QRQB 4PG9B 3MCKB 3NRFA 2FJGB 4LHUB 3L4TA 5DJ8A 3UMNA 5LXGH 1KULA 3VQLA 1QBBA 2NNRA 1T66D 2PW2A 4FTVD 1J1XL 2VZ1A 4PJ8D 2NY3D 2WO4A 4NNYB 3O3AA 3OWEA 2F19H 5KZCD 1D9KD 3FOMA 1I4FA 1KFGA 3GHPA 4PJ7F 2IWGA 2A6KB 2I25N 3BDYH 3LHPH 5FUCE 3NFSH 3EUDA 3FU5A 3IMWA 2L3BA 2D0FA 3KYMB 3C09B 2ZWYA 3LKQA 4ONHA 3KBFA 5B3JF 3RVWD 1VKXA 1OK0A 4TQEH 4HKJA 4Z7WF 3ZK0A 1UOWA 3AQYA 4JGMA 5E99H 2OL3H 3MFFA 1ZLVK 5E0FA 2KQNA 3V9FA 3GTTA 1MF2L 3VGAB 1XIWA 3ATFA 3FT0A 2V5RA 1GZPB 2FYYB 3TC9A 3WTWA 3W1ZA 5IB3A 2X3AA 4UM8A 1HJCA 2FJHA 4R3SB 1NGYB 5F2FA 2FEJA 2HLAB 2V5MA 3HB3D 4GSQA 5CIPA 4OD2A 3LH2H 1TMCB 3RX5A 3ZIMA 4KKQA 3QJZA 5D5ME 3DVNB 2DQJL 1B4RA 1T1YA 3Q8BA 1HH6A 4XCNA 4ODXB 4OSUH 2I9TA 1E42A 3SQRA 3D0LB 1A9EA 1CXLA 1DO6A 3DI3B 2VXQA 3FUFA 3BAEH 1HTYA 2DQDH 3LIZA 4NZTH 2BY0A 4G7YL 1NEPA 2DDQH 5AOIA 1JGUL 4PW9A 1O9VA 1GC1H 2CO7A 4F27A 4FXLA 3DHMA 5ICYB 5FKAB 1QACA 1YEHH 5KAQF 2XTJD 4YVUA 4UV4L 3O2VH 4J1UB 2J73A 1TKWB 2N4IA 5HBBA 1F58L 4JLRA 5A40E 1MRFH 4IIQA 1H3XA 3QW9A 2B1AL 4KMQA 1CBVL 1Z3GL 3CVIL 2YRPA 3BVNA 4P05A 2LR4A 1BQRA 5E1AB 4TQIA 2R29H 3L3OB 3T2OA 2G2RA 1J8HE 3QGVA 3QXAB 3TJHD 5MHSD 4IMKC 1P7QB 4HS6B 2JB5H 4M43H 1ND0B 4AM0B 3JUZA 2B59A 4UDUB 4YXHH 3QG6A 3H56A 1I3RB 5FCUL 2Z31D 5DVLA 3P77B 3UYPB 3KBEA 2FSEB 3S9DB 1MJ7L 3JBG7 4IOFC 4OF3A 4YS4A 4X98A 2WZPD 2QQNH 4N26A 4OBSA 1MFDL 1S7TA 5DMGD 1EZLA 1HOCB 3N1GC 3NH7L 5PCYA 3U9PL 3MV8D 4HUMB 3CFKB 4HA1A 4HFWB 4K7FB 3K4DA 1MREH 5D1QA 1ZXQA 5I0YA 1BF5A 3TGXA 1OZTG 1PZSA 2BOBB 2Y5QA 5E6SB 4F33B 2H6UA 4AZUA 1F6LL 3QB7C 1BZ7B 4TV3A 1ACZA 1HILB 4K2UH 3FTSA 3QUKA 4WK4B 5AKVA 3CC5B 1FH5H 4Z5RA 4MLSA 3SOTA 4L4TB 1A6WH 1GAFL 1XMWA 2ZG2A 4ODTH 1WBZA 2XZZA 3D51A 4OLUH 2QMKA 2EIEA 2D73A 4GXFA 4I4WA 2GJJA 4XHJC 2QGBA 3U6RA 4BCXA 4OCWL 3DK0A 1E43A 4IS6B 1DEDA 4LCYA 4KXCA 4XNUL 4N2GA 1RZIB 2DJUA 5CJ8A 2A6KA 4ZO7A 3H85A 4AKPA 1WIPA 1Z66A 3MV7B 5EUOA 1TJHH 2WYZA 1GAFH 3CSYB 3QG7H 3PAYA 4XPFL 1ECYA 1PD6A 3VFWB 1L7IH 4NYLA 3UDWC 3AITA 1KCWA 1VAHA 4AKQA 4Z5RB 1JZ8A 3D85D 3PWLA 5CBAB 2VL5B 4S1QH 1KTJA 3WEXA 5F3BB 4RGND 1WVZA 3ZTJG 2EDNA 1AGFB 1JZHA 4DZ8A 2XVKA 4NSKB 2J1XA 2HPOA 4P2RD 2K78A 3L3KA 3REVA 4XCFL 3G04A 2C7UA 4E2OA 4N1CA 3T3PB 1N3NB 5AVTB 1CR9H 3IDGA 3NFPB 1UURA 4I0CC 4I87A 4M1CD 5EIIG 4NNPH 5EU5B 4L3EB 4LLQA 4NI3A 2ITCA 2W81C 3O6FC 4QRPE 3MBXH 4KU1A 2YFOA 3FT2A 4LSRL 3VXTB 2IV8A 1TTFA 5SX5H 2DI9A 4QRSA 1T1XA 1U6AH 1GYAA 3AFLA 5F3HB 1F4WH 1MAKA 3JWNC 4I0KA 2O5ZL 3O4LB 1IL1A 3QUMH 4QOKE 3WFBL 3FNKA 1H15A 5HJDA 3JYBA 4NNPL 5FC9A 5H94B 3UBHA 4N5ED 1OP3H 1E28B 2IFGA 3CXFA 1PNDA 4AENB 4HAFA 3FCUB 4QOKD 3EJZD 2ADIB 5JLZB 1JZ2A 4R90H 1YUHA 3FTGB 3O41A 1QVOA 2N7SA 3KXFE 1OCRB 2CPCA 1RPKA 1RCYA 1WCBA 5CEXB 3ULSB 4PRAB 4HWZB 3F62A 3G5VA 3BEWB 4H44C 4HISA 2YD1A 4B5EA 1F00I 4X8JB 4ZMYA 2VM4A 1QEXA 3MREB 5GRWA 2PXYA 4U7MA 2VXVH 2C1PB 2EDDA 2K70A 2MNUA 4HS6A 3SGJC 1F6AB 4EN3C 1UZ8B 3DJTA 3PP4H 2Z7UA 3QA3A 5F1NB 2AFNA 4AMWA 4IMKA 4HV8A 1IBGH 3HNTL 5AVYB 4FP8H 2A74C 5C0EA 3B7YA 5BZWB 3D2UD 2FLMA 3UTQB 4TM9A 1RI8A 5E8NA 3RWIA 3CMOL 5I23A 2EXWD 4YK4B 5B39A 2ORBL 4IBQA 4PYHA 5D7JD 2ATKA 3BUDA 2HX8A 2ZCKL 2J8HA 2OSWA 3FN0L 3TWCH 3UO8B 2UYLB 1E4KC 4B7LA 3GS0A 4M7ZC 3MV7E 3MLTB 4X6DA 5HPMB 2NYZA 3NCYS 4XTRC 3G5ZB 4LOEA 3W0WE 5D1QB 3RZWA 3KWUA 5FHAH 5GXBB 3GEWB 1H3TA 4L2LA 4DOHE 3BPCA 3GMRB 5CEZH 2VC2L 4JPKL 2WXFA 1NCNA 1KDJA 1YYMH 4XO3A 1QLEH 1HYRC 5EDXA 5H4ZA 4MKMA 1TYRA 3N9GH 4I7ZC 4LVEA 3UTQA 1JOIA 3TPUA 5D1ZB 1D2PA 3SBWA 1MJJB 1WEJL 3EGSB 1YEGH 3RGVB 4D9QD 2XWBB 2AJZA 4KO7A 4PJBA 1DJWA 4HWNA 5JOPD 1UM5L 3MX0B 5F0JB 3VFSB 1ZGLA 3QH3A 4M7LT 2YD2A 3QR2A 2CHNA 1AZCA 4L3EE 4P49A 5CLTA 1TIUA 3BWUF 2Y6TE 1E6JL 4M1DH 1WT5A 4GKSB 4XNXL 4FZEL 2X4RB 3G5YB 4D9RE 4D8PB 2IWKA 3T8XA 3WHXB 4CN4A 2XN9A 2WGXA 4HWBL 2IGTA 1H6UA 2G0KA 4KKLD 4XRCB 5IVNA 1DVZA 4G2AA 3RIAF 1KOAA 1AGFA 2XI9A 4JB9H 2VSDA 5I1KH 1KWGA 4MAYB 3VO0A 3IXAA 1WFTA 3RDTD 4EIUA 4XPAL 4KROB 4K7PL 5CGMA 5LGJA 3DJRA 4J12A 3FOMB 5TQ0L 4BGDA 1JZ7A 5HJBA 4ERSL 3QR0A 3SDXE 3TT1L 3RGBA 4JE4B 4WGKA 4ZO6A 5J3HC 1JPEA 2BOCA 3U0PB 1VZGA 3PWJA 3TJEH 2GHWB 4CAGA 5DVKA 3F5WA 5I1DB 3GJFH 5FYJE 1MWAB 2VW4A 3N40P 2AJXL 3VXRD 4JFOB 4XAWL 4YSOA 3VFVB 3O8XB 3LEVL 3BWAB 1DQVA 1NZRA 2C34A 2ED8A 2GK0A 3QZLA 1E3XA 4XMKH 4YHNA 4OGYL 3HZYA 2LTQB 6PCYA 4ZMPA 3KPSE 4PJDE 1WC7B 5JQIB 2DYPB 3KGUA 3WIHL 4B9ZA 2FJSA 3DLQR 5TE7L 1U8HB 2JI2A 5D7IA 4K3JH 2ZP9A 4ZUSB 1JZEA 5EH1A 1SYVB 2BOCB 2PCYA 3C6LA 2X4OB 4I9WD 4RMRA 1CF8L 1SQMA 2APSA 3FB5B 2HB0A 1MFCL 1NCWH 2EO7A 3LDBC 5JHLH 4NC1E 2BS9A 1LD9B 2WTRA 5J6GB 2WKLA 1ADWA 2F54D 3JWOC 2VSKB 4YZWA 2F53D 3SDYL 4NJ9L 2CRZA 1U8OA 1ILSA 1ODAA 2HFEB 3EOAA 1WICA 4RMVA 1JHLH 5F7WC 2JKWA 1RIHL 2E74C 4NI6A 1VGEH 1GGTA 3K8MA 5AW0B 4LKXA 2AQRA 2VNCA 2C1PA 2LT9A 3P11L 4JRWA 4NQED 3ARGC 2NW3A 1G4MA 4OW6A 2VDLB 1T66C 1QPPA 4PR5A 4DEUA 5FHBH 5ICYA 4KFMA 4MA3B 1A6UH 2VQ1A 2H0JA 4FQPA 5DSCB 1M3JA 5J7CC 4HZLB 1DZ0A 5FYKH 2WY3B 3AW5A 1TQCC 5J12C 1JXJA 4TOYH 3O2DH 2NT0A 4HD9A 2XY1A 5ESQA 5HVWA 5C86A 3H7BA 4RSYA 2L4OA 5CINL 4GFTB 3OKDA 3FO1B 3L3OA 2IMNA 4NP4L 4HOXA 1RUPL 4MYPA 4HWEL 4N2OA 4POZC 2L0DA 3CN1A 1N68A 3HTLX 4OZFG 1EEQA 2MTPA 4LEOA 5CN2A 4G6FD 4YXLH 3WI9A 3O6LL 5GRVL 2YPVL 1EA9C 3BPCB 3GMRA 5BMFL 2VTFA 3KLHD 4EQ3A 1XSJA 3CSPA 3V10A 4LMQE 5KTEL 5F0PB 3H0TB 3VVWA 4WHYH 1WYJA 2H3NA 4FP8L 1J1OL 2VDRB 2IAAC 3ESMA 4X9HA 5DCCA 5CCHE 4PV9A 2BNQB 1OB1B 5AFAA 5CD5D 4GBXB 1FLRH 2YBRA 3GK8L 4DTGL 4I5BB 3IU3A 4PJGA 5IBLC 3ZYOA 5JHDD 4AYSA 4Y5YA 1B0IA 1X7QA 1EBPA 2QSCL 4BSWB 5D93C 3D30A 2VJXA 2VR8A 3QI9D 5C0RH 3QUZB 4F8LA 1ZT4A 4HKZA 3KYMA 5HGHA 1KN4L 3KXFA 3HS0A 3D4GA 2WN2A 5MERB 2G5UA 3MCYA 5IB1B 3DGDA 4YFLI 3HUJB 3CBJB 2VDRH 4I3RL 3A22A 2ZYSA 3LN5B 4AQAB 2BO0A 1G9MC 5EZIL 4IRZH 5CFHA 5B1JA 1JF6A 4JRYB 5FS5A 1TTUA 3V6ZA 2EC9T 2OLDA 3MUJA 2MQGA 3VG9B 3VX1A 4XB8A 3VW3H 1LLAA 1AKJB 3MNDA 4FFYL 4XZ4A 5EZPA 5KSAD 3V52L 3X3GL 3OZ9L 3A47A 5IBTL 1ETZA 3AMKA 1T22A 4OKVA 2D0HA 3VFMB 1R3LA 3DOSA 5IQOA 4LZKA 2B2XL 5C3LD 4BH8B 2OR7A 2WQWA 5CZVL 2RTTA 4P0DA 2A5UA 4PJ9B 1CT8B 4OKDA 5CGYC 4ZAKB 4OV5B 2Q2LA 2YJLA 3R19A 5DYOB 4OZIB 4ZFOA 3O8XA 3A67L 1SQ2N 1RUAL 4P46A 5MEOA 4TNVK 3K6SB 4JFEB 3L9BA 4S0SD 4TPRL 1L9OA 4P8QA 1ASQA 2R56L 4KO6A 4Q9RL 1NIEA 3BRFA 1G0XA 1OGAA 1J87A 2A77H 5DC9B 2HG5A 1A7BA 4OLZL 3MRKB 2QADB 1UHVA 1PFOA 1W15A 1ICTA 3QYCA 1HL4A 1XCXA 4MNGB 1MI5D 3VSVA 5LGYA 5MENA 5C08E 1KCSH 3UAEA 2HX7A 3MNWA 4KY1H 5DF0A 4BFRA 5KAQG 1IC1A 2W94A 3H8NA 4XP1H 5GS2H 3WFCH 4QTIH 5IVXA 4HQQL 5EDSA 3BGFB 5C0BA 4V1DB 2K4WA 2DQEL 4X9IA 2VO5A 5JOFB 1IKNA 2LU5A 1D9KA 4AL8C 1LO3L 2YAHA 4OCXH 1IAMA 1V3KA 1WAEA 4LPCA 4RZKA 5DJDA 1SBSH 3ZX1A 2IOOA 4BZ2H 2ZG1A 1I9IL 2G4EA 4V33A 4QJ3B 3HHSB 1G7JA 5GRUL 5I15L 1CFSA 1U8CA 4HQQH 4MCYA 4Y8DC 5EU6A 4MWFB 3BVDB 4FQ2L 1BREA 4OIFA 4S11A 4N1HB 3RWJA 3IPEA 5JOEA 1VCAA 2NRDA 4Y9FA 2SEBA 4JUSA 2X5PA 3WTUA 1XF4B 3S97C 2VITA 3Q8CA 3QNFA 4MMXC 1IEBB 4K3HA 2VSCA 3N1PC 4MGXA 1F4AA 3AT8A 1WPCA 1YPZE 2J88H 3DVIA 4ODWB 3CVHL 4Z7WA 1GKEA 2AJ3B 1JRHI 1NANI 2XX0A 2KLTA 2C4FT 3B9KC 5KJ4A 4HUXB 4P2OC 4NAQA 5BUAA 1TU2A 4DQAA 3HMWH 4ODBD 3KYKH 5F21B 1M05B 2Q76B 4A7GA 2OMVA 4BIKA 3QXDB 1LWRA 3GGWB 3R7QA 4XXDB 2Z91B 4YGVB 1UENA 1BQ5A 2HRLA 4PIBA 5J11B 3DGGA 5EC2A 4BFIA 3BDYL 2ADGB 4A2HA 2FX8L 5CU9A 1S8DB 2NXZB 5BUGA 5F96L 5HDBF 2BSBA 4PRHE 4ZMZA 2DB8A 3ATBA 2OCCB 3D39B 1FCGA 4Y5YB 1BCIA 2PCPB 4IGBD 2FL5B 2ZOUA 4Z0BL 3MUGB 5JDJA 1XR9A 3I50H 5FA3A 4OZHF 3VI4B 3GBDA 1QLFA 4FFTA 4KJQC 1CF1A 1TU2B 4ODSL 2CKBA 1XSIA 4LVHB 5BZDA 2B0SH 2I24N 4FZ8L 4UQ2A 4PJCE 4D9QE 5IV2A 5KS9E 1TSRA 4UT6H 3RA7L 3VH8B 4DJMA 4PJFA 2XXGA 3C08L 1LXMA 3BSZH 1F97A 3UPRB 3EO0A 1A3RH 1RZKC 3QHFL 4WEUD 1GYWA 5LQBL 3LXCA 1T0PB 1YPZA 1E2ZA 1NEZB 4EI0A 2HJFA 1XTLA 5C3IA 2CO6A 2Z93B 4MNGE 4Z7UF 4W4OA 4GEIA 4H8QA 4AV5A 5JZ7D 1OOWA 5D5MA 4QYOB 2WOYA 1TVDA 3QNYB 5GZNC 5LGHL 5HDOA 1JCKA 1QUNB 2H1LM 1FORH 1H0DA 1KV3A 3PHOA 4IW4C 3EHBC 4RMTA 4Z95L 4WSKA 3TN0D 2G3ZA 3MRGA 1PEZA 4D8PA 2EXTA 1CGVA 3FHAA 5AL8A 3WIFB 4F7CA 4KXAA 5I26A 3T8VA 4WF7A 3ETBJ 2F61A 2BVPB 4MAYC 3GSNH 4M7LL 2PWDA 5FGRA 1IC7H 2Y5EA 5D8JH 1T7XA 3OJDA 2FJFA 15C8L 3CDCA 3LPWA 3TL5A 3WAKA 2GEEA 3TT3L 3NSCA 4FQJL 3ECQA 2I7OA 3TS8A 4ATTA 3BIAX 3U82B 2N1TE 3PG2A 2EDTA 3QUHA 4ZNEE 1AS8A 2Q20A 4Z7QE 1BOYA 2Q10A 5EUOB 4LVNB 4NO5A 1H0DB 3PHOB 4CU6A 4F8QA 4AYEC 1BLIA 5IB3B 3AU0A 5I1EH 1A5FH 5ITBH 3K6OA 4IEFB 1USZA 4YEEA 2YXVA 1T2JA 5TDPA 4YN3A 4E42A 5J0BA 4F7EB 3NPSB 4FX5A 3OF6D 1IQWH 1BWMA 3ASWA 1L3WA 5B38A 2OMYB 1XZ0A 4AW4A 5B7FA 4A2GA 4PJIE 1BEXA 2TSBA 3ARBD 4MZIA 3UTTE 3HUJF 3ABMB 4UQBA 4MA1B 1X5AA 4U3XA 1A4BA 1ZK9A 1OP5K 1I1FB 1NH6A 2PKDA 5T3XL 1X6NA 2ZUQB 4B41A 5ID0B 5D1QC 4LLQB 5IVZB 4PFEA 3AREC 3WTXA 4EVNB 4H1LG 3FT2B 1A64A 5PAZA 4RFNB 5KYWB 1FL3B 1Q1PA 3BVUA 3IT8D 5C0BE 4HC1H 3VCLB 4PJAA 1G9NC 4JAMA 2WW8A 3VWKC 1BD2A 1A02N 3LN4A 3DX9A 3D39E 1ESOA 1HH9B 5IR1B 3KPLA 2A74B 4HULB 2JXMB 3STZA 1Q0EA 4HKXB 4MB1A 4MNQB 5FUOH 1TZIB 3Q1SL 2HUEA 4U1IA 3TNMA 1RMFH 4KVPA 1A1NA 4BA0A 1AQKH 4W4NA 3ARDB 4U6HB 5GISL 4WU5A 2ZF9A 4TLUA 4J23A 3QRGH 4MJ6B 3QBTB 4RDQG 4UU9A 4HJGB 1DBJL 4EZLA 3CX5J 4HBCH 4MQ7A 2A9ML 5F7MC 4I18B 4PLOB 4RMUA 3KPOA 2CLVB 4A6YB 1MHCA 3PWVB 3IDMA 4QI3A 1G7PA 1TITA 3VWJB 1HZLA 3FO1A 3VFPA 4FNLH 4HU2A 4LLDA 2NYKA 5I6LA 4EI6A 1HKLH 3STZB 4YDJB 5D7LB 3MBWB 4BKLA 1G84A 1EVUA 5EO1B 1OAYL 3FUNA 3TYFA 5L9DH 3CIQA 1USQA 3MV11 2B9AA 2CLRA 2GHZA 5K9JH 1B9KA 1ZA3A 4XN7A 5DO8A 1T20A 3HZKA 5J9PA 1ONQA 1GIGL 1MCOL 3KYKL 1Q72L 4Q6IC 3ARED 4HK3N 4GAGL 4A6YH 1KCLA 3IGKA 2E8YA 3G6DH 1NMBL 4OF5A 4YDJA 2UZYB 5JR1H 1Q9KB 1Z2KA 2UUDH 4MAUH 3G5ZA 5AOLA 4BFGA 4PGBA 3GMLA 1LEIA 3OJ2C 1CXIA 1NWPA 4XO5A 3VUAA 4E41D 1EHLL 5HHMD 5JHLL 4U1GC 2JCCA 3T77A 3QIBD 3E7JA 2X4PB 4NT6A 3F12B 1AIFA 3R4DA 2JCCF 1UM4H 1F02I 1KIRA 2JLLA 2Y5TA 4AGPA 1TDQA 2BSDA 3LNFA 3N42F 4FQ2H 4GIPD 4F2MB 1FNSL 3IBOA 3KWWB 2AJZB 1HEZA 2CA4A 4HCRA