4A2FA

Coriolopsis gallica laccase collected at 12.65 kev
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
496
structure length
495
Chain Sequence
AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPNDPHASLYDVDDDSTVITLADWYHLAAKVGAPVPTADATLINGLGRSAATLAADLAVITVTKGKRYRFRLVSLSCDPNYTFSIDGHSLTVIEADSVNLKPHTVDSLQIFAAQRYSFVLNADQDVDNYWIRALPNSGTQNFAGGTNSAILRYGAAPVEPTTSQTPSTNPLVESALTTLKGTAAPGSPTPGGVDLALNMAFGFAGGNFTINGASFTPPTVPVLLQILSGAQSAADLLPAGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHVFAVVRSAGSSTYNYANPVYRDVVSTGAPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPDVAATNPVPQAWSDLCPTYDALSPDDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords LACCASE
publication title Structural Changes Caused by Radiation-Induced Reduction and Radiolysis: The Effect of X-Ray Absorbed Dose in a Fungal Multicopper Oxidase
pubmed doi rcsb
total genus 137
structure length 495
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA03
3NP4A 3KW8A 4AKQA 2Q9OA 3QJSB 1V54B 3T6ZA 1OCCB 3GDCA 2IDTA 1L9RA 1SHWA 3IBOA 1WA0X 3IN0A 3PCYA 4QKTA 2Y69B 1DYZA 2EINB 2H47C 4FAAB 3DIVA 5AKRA 3NP3A 3AG3B 3U25A 2GC4C 3UACA 3PPSA 4FA7B 1J5DA 4DPAX 4G71B 1OE1A 3PAUA 2FT8A 1PLAA 1ASOA 1JZFA 1ZIBA 3QPKA 2BZ7A 2FQGA 4ENZA 3FT0A 3WKPA 3NJFA 3KW7A 3NJJA 5FC9A 1AANA 3TA4D 4DP7X 5I6LA 1IC0A 2FQFA 3OQRA 3IEAA 1PZAA 2BP8A 3X1EA 1SF3A 2HXAA 3NJMA 3S3DB 3ZX1A 2UXGA 3WNIA 2VW6A 4G7RB 1ET7A 1N68A 1BXUA 3ASNB 3G5WA 1JZJA 2B08A 3CDZB 2XWZA 4G72B 2OV0A 2BP0A 2XV2A 5I6NA 3S3CB 1AZRA 2UXVA 3PXLA 4GP5B 3FSAA 3GXUB 2GHZA 5B3SB 1A4BA 1J9TA 2WO3B 1AIZA 1EZLA 4E9WA 4X4KA 5B1BB 4WTQA 1F56A 2YARA 3D12B 1AS8A 2AANA 2PPAA 3FPXA 4AZUA 2VMJA 1NZRA 1JVOA 1AACA 8PAZA 2YQBA 4G7SB 2IDQA 3TBBA 5B1KA 1RZQA 1MG3C 2Y1AA 4TXVB 2IWFA 2I85A 2PPFA 2XVBA 2HLEB 1OOWA 1W6LA 2QT6A 4HCIA 1HAUA 3FSZA 4HAKA 1NPNA 3NJNA 1PLCA 2FT7A 4HHGA 4N8UA 4NAJA 1MZZA 2P80A 4YVUA 3QJQB 1WAEA 3BVDB 2YAQA 1JZHA 1SDDB 1T5KA 1CURA 3CZUB 1SHXA 2EILB 2BHFA 2BO0A 5E9NA 4E9YA 2HX8A 1ZDSA 3X2QB 5B7MA 4WKXA 1OE3A 1AG0A 4HHWA 3X1BA 4E9SA 3MX0B 3QJVB 4YSCA 4F2EA 2FJSA 4YSEA 2ZXWB 3IN2A 2I7SA 4Q89A 2N0MA 1WA2X 1MZYA 1M9WA 1AG6A 2VM4A 2XYBA 2I7OA 1DZ0A 5F7AA 4DP4X 4QLWA 1CYXA 2DWTA 1BYOA 2PP8A 5B1JA 1IKOP 3WIAA 1JXFA 3NJKA 3NJLA 3NSYA 4GYBA 4A2FA 1V55B 1JVLA 3NJIA 2HRHA 2PPEA 1SFDA 4JHUA 3BQVA 2GB2A 3NSCA 4KO9A 5I5JA 2FTAA 3FYIB 4HCGA 4DPBX 6PCYA 1A65A 1ZPUA 2YAEA 4KNTA 4YL4A 3T6XA 4CSPA 4YSAA 2TSAA 1L9QA 2YAFA 3UGEA 1JZEA 2PCFA 3ERXA 1J9QA 1MDAA 2DYSB 3FSWA 4HIPA 3NSFA 1HAWA 3CDZA 4NERA 2DY2A 4E9XA 1AR1B 3X1NA 2EIMB 4BWWA 3FU8A 3FU7B 2VW4A 1BYPA 4L0PB 2TSBA 2X88A 3UAEA 3ABMB 1ZIAA 1A8ZA 2EIJB 2CJ3A 2YAOA 3FS9A 1ADWA 1BAWA 3HB3B 3PLYA 4DP0X 1PMYA 1CC3A 4E9QA 4AKOA 1TKWA 5TK4A 2OCCB 1BQ5A 1JXGA 1L9TA 2XUWA 4NB7A 1PNDA 1J9RA 1W6WA 4GXFA 3EH3B 3SQRA 5EHFA 5AZUA 2BW4A 1SF5A 1AAJA 5B7EA 2DYRB 3OM3B 3PAZA 1AQ8A 3FU9A 4M3HA 1GY2A 1ILUA 4BDVA 3TU6A 5I5MA 3T71A 1J9SA 1HFUA 1QLEB 4DPCX 1J5CA 7PCYA 4PCYA 3C75A 2IAAC 3FQ2A 2QPEB 1KDJA 2XU9A 4N4YB 3GYRA 1SDDA 4KO7A 2GSMB 2BZCA 3AG2B 2DV6A 1L9SA 3AG4B 3AG1B 3UABA 1GW0A 1NIDA 4KNSA 4DP1X 3FQYA 1PNCA 4A2EA 2IDFA 1AZBA 4K9JA 1YLBB 3QJRB 1SJMA 5B1JC 5I6PA 1PY0A 2UXFA 4EF3A 2EIKB 3UAAA 3SBPA 2JXMA 5A7EA 1KBWA 5D4IA 1XMEB 5ANHA 5I26A 4E9TA 1GS8A 5D4JA 4YSTA 4AKPA 3FQ1A 2W8CA 2VM3A 1OV8A 2XXFA 3QJUB 2JFCA 4ZK8A 2CBPA 5I6OA 1NINA 1NIEA 2GIMA 2BWDA 2BWIA 2VSKB 5AFAA 2XV0A 4A66A 3HEIB 2FNWA 1UATA 1EHKB 4KOCA 2E86A 1AS6A 2IWEA 1A4CA 1OCZB 3S8FB 2Q5BA 2FQDA 4KOBA 1M56B 1JZIA 1GSKA 3QJTB 3WNJA 2PPCA 3S3BB 4KNUA 1L9PA 1IBZA 1XB8A 1GS6X 1W8EA 4AX3A 3S8GB 3X1GA 2CCWA 3FU7A 3TASA 2P80D 2PLTA 1M57B 3AZUA 1AZNA 4E9RA 1FFTB 1PF3A 2JKWA 2CUAA 3FPYA 1PZBA 4P5SA 1ZDQA 1ILSA 3QQXA 1ID2A 1ZV2A 2ZONA 2QDVA 4DP2X 1GS7A 2H3XC 2IDSA 1IBYA 1QNIA 4P5RA 4YSSA 4KO6A 2ZOOA 2HX7A 4RH4A 3V9EA 5I5IA 4F7KA 4F2FA 1KV7A 3EF4A 1AOZA 3NT0A 1NPJA 4YSPA 4BK5C 3EHBB 1TEFA 2PP9A 2YAHA 3JTBA 3T6WA 1KCWA 2XX0A 1JOIA 2IH9A 5PAZA 1URIA 2VW7A 3N2JA 2LLNA 2AVFA 2W88A 2IDUA 2VSMB 5I6KA 1VLXA 4E9VA 3NYKA 4GP4B 2AZAA 3N55A 5F7BA 5PCYA 1FWXA 5D4HA 2XXGA 3PAVA 2FQEA 4G7QB 4HCFA 4G70B 3SBRA 3WKQA 1ASPA 1ET8A 2XLLA 4AI7A 2HRGA 2YAPA 3EH4B 2HX9A 4HZ1A 3WG7B 4YSQA 2BW5A 4HALA 3T6VA 2B3IA 1KGYE 2GI0A 1BQRA 4YSRA 2J5WA 1AZUA 1KBVA 1I53A 4CSZA 2J56A 2UX6A 3L45A 3WI9A 4GP8B 4A2HA 4BWTA 2R7EB 3EH5B 4Q8BA 3H56A 3X1FA 1TU2A 3OMNB 2CALA 1A3ZA 3T9WA 4BWUA 2A3TA 1GR7A 3ABKB 3ASOB 1NIAA 2AZUA 3IE9A 1NIBA 1L9OA 4DP9X 3CVCA 2FT6A 1SNRA 2J55A 2IWKA 1MG2C 2YAMA 7PAZA 5B1AB 3NJGA 2RACA 1RCYA 1B3IA 1GY1A 2YXVA 2XV3A 1X9UA 4YVNA 4UAHA 1X9RA 1OCRB 4UANA 2GBAA 3ABGA 2PP7A 1CUOA 2PPDA 2PCYA 4A2GA 2DWSA 4YSDA 4YSOA 1WS7A 4UF7C 2GC7C 3NJHA 1CYWA 1OCOB 1KYAA 1PAZA 1NWOA 2FWLB 4YSUA 1RKRA 1AS7A 3CVDA 3H4FA 2H5UA 3CG8A 1NICA 5LDUA 2BP8B 1E65A 1AZCA 3OMIB 4W1TA 2WSDA 1JERA 1BXVA 1ET5A 1ETJA 1NWPA 2IH8A 3SBQA 2YXWA 2CAKA 1RZPA 1BXAA 3AY2A 1WS8A 1GYCA 1A4AA 3MBWB 2BP0B 1JZGA 3V9CA 1QHQA 1KDIA 4BDVB 2J57A 1N70A 3DTUB 5B7FA 4MFHA 5I28A 3OD3A 1V10A 4PAZA 3ABLB 2ZWNA 2UXTA 9PCYA 5IY5B 1E5ZA 3UADA 3H4HA 2QPDB 3DKHA 4JHVA 1OE2A 3FYEB 1NTDA 4DP5X 1ASQA 1FA4A 1BQKA 2XX1A 4JKNA 1E5YA 6PAZA 1IUZA 1PCSA 2MTAA 2NRDA 1NIFA 2AFNA 3NSDA 4W9ZA 1E67A 1JXDA 1TEGA 3OMAB 4BXVA 2QDWA 1E30A 2MRYA 1SFHA 2VN3A 3ZIYA 4A2DA 3FSVA 4BXSV 4A67A 1XB6A 1OF0A 4DP8X 1PZCA 2HZHA 1KCBA 2UX7A 3AW5A 3ZDWA 3ZBMA 4A68A 1XB3A 5I6MA 3CVBA 1PLBA 2X87A 4GY4A 3RYMA 4KO5A 3TBCA 5TK2A 1BEXA 2WO2B 1WA1X 1NDTA 4DP6X 2OJ1A 3JT2A 4M4RB 2R7EA 1R1CA
chains in the Genus database with same CATH superfamily
3WSQL 2BVPB 5JHMA 1RZFL 4S1RH 4ANWA 2WKOF 5DUJA 1JCVA 5AB0A 1IL1B 3QBTB 4N2CA 3VNYA 2WVVA 2N1TE 4I77H 4IRZL 1QTSA 1TLKA 1FGVH 4Y19A 4A7GA 1BMGA 4AQEA 4XX1E 4NZ8A 3WJMB 4BFRA 5GS0D 2R1XA 2VXTL 3OXSA 1WCBA 4C55A 3FULA 2WM0A 1J86A 1JGVL 5L4FA 2PTUA 5FO7A 3MRMA 5DVLA 1XCXA 4FZEH 4YZFF 3ZZLA 2F7IA 4PBXA 2YRBA 2J8UB 4AK2A 3PGFH 2G9KA 2FQGA 5KSUA 3H3PL 4JO3L 3DXAE 1AANA 3SE8L 2VERN 4P4KC 5DJZA 1UZ8B 3QYNA 3BJLA 3GXDA 4WSKA 4PJCA 1B6DA 3AM8C 4ZFZB 3T2OA 2MCG1 3KEDA 2NY3C 4FQIH 3RJDA 5L4JA 2DLFH 3QEQD 3F7YB 5DQDL 5C6TL 3F7RA 4XP6L 4AM0Q 5DHYA 2P24B 1KULA 1ZKAA 3JTSA 5E8NB 1MHEB 4YHKL 4H26A 2XWDA 4M43L 2O61B 1QWHA 3VW3L 2N59A 3OZ9H 4GKZA 5FFOA 4A37A 5BZXA 4LLDA 1IM3D 5IVZB 3FRPG 4XVTH 5K1NA 1YNKL 4P99A 4GQZA 1S7VA 1LO0L 4LVNC 4WFFE 3P30L 4I0CC 2GK0A 4ELMF 5EWIH 4DKFH 1O7SA 1U8JB 4R8WH 2HH0L 2W5PA 1NCIA 5I1LB 2QZQA 3F58H 5I2IA 1F56A 1AOHA 4IIQB 4ZW5A 5EO0A 2AANA 3BT2L 2GJ6A 1NKGA 1RIUL 1OPOA 3X3FL 2X4PB 5EPMA 2BLFA 1TYEB 4DCQB 2W1NA 4P07A 3WIHH 5K93A 4LARL 4L4VE 3ZRCC 1BQSA 1AH1A 4MNHB 2AEQH 4QRTA 1F3DJ 4H1LG 4KROB 3VXOA 2O6EA 5DJ2A 4JRFA 4R83A 1IKFH 2X4RB 3BUPA 1MJUH 3ZHNA 1WRFA 2WWOA 5D6CB 4ZAKC 4BELD 4X5QA 2PTVA 2HKFL 2HLAB 4ZJ9A 3IJSA 1DQTA 2R2HB 3L4TA 2K9FB 4K7PY 2WXQA 3T3ME 5HYJA 2A6KA 3PGCB 3JT0A 1UVQB 2EEFA 4PJ9D 5E99L 3FTXA 5C8JB 1ETZA 2IOIA 1DEEA 1S78D 3GI9L 1BLIA 43CAA 1UG9A 3QJFA 3FO2B 2EE6A 5DQJB 5HDBE 4BFJA 1FDLH 5BRZD 3VB9A 1JFQH 4DETA 1KJ3L 5CFAA 1NFKA 4G8FA 2OTUB 4GFXA 5ESVA 4DUXA 1XF2B 5IROC 2CO6B 1SDYA 5FYLH 4FP8L 5IFAH 1JHLL 1JGDA 1RFDL 3IN2A 3X11B 5CN1A 3MLTA 3AS0A 1MZYA 1I7TA 3ML8A 1AG6A 32C2A 3QE5A 4I4WA 3EUUA 2K6ZA 2NNAA 3GMNA 4MX7B 2AXWA 3UTTA 2H6UA 5DUBB 1PL3A 1RJCA 2E8YA 4XHJC 1N8OE 1TQBB 2P26A 3IU3A 2G5BB 2WZPA 3TFKD 3BP4A 1CF1A 1E5UI 2J5LB 4WNQB 4XMWA 5FHBH 3LS5L 4ZW3A 4JBSA 1KBKA 5BUAA 1BSIA 3U9UA 2ZAHA 3D69A 2ZCKH 1JAEA 1DUZB 5GGQH 4FI8A 4WUKL 5HYSG 1P4LA 2N0KA 4OTXL 2TSAA 1A14H 1VFAB 3QFJD 4N1CA 5ICYA 2IPTL 3K6NA 3QNFA 3CE1A 3EGSB 2F74B 2DM4A 4E9XA 3FQWB 3AUWB 4DKEL 4L3EE 3TEUA 1CL7H 3BUIA 5ANMB 1TF4A 1F4HA 4ZOEA 4I18B 4KRNA 4L0PB 4OFDA 2MCPH 1WBXA 3DX6A 3WHXB 5I1GL 2EIJB 2NNCA 1JNLL 4HAFA 5FA3B 3A6OA 1MW3A 1DDTA 3BMVA 4JO4L 3T65B 5BXFA 5EZLB 5GJTH 1MJJB 1TNNA 4KKLC 2GSIA 3EH3B 3HHRB 3WN6A 2VZOA 1M7IA 3TNMA 5F6IB 3FT3A 1CTOA 4FOMA 4OKDA 1TTBA 5AZUA 1BD2A 4LCWB 5FGBA 1MCHA 4JG1H 2ZUTA 1FZKA 1KNOB 4XTRD 2ZKWA 2ZOLB 4HJ1A 1U2YA 1YDPA 1BZDA 4GNKB 2ITCB 2WJ5A 1E4KA 1DTUA 4AH2B 1QLEB 3WEXA 1KUMA 5A6MA 3CH1B 4PCYA 1IAOA 3VXNA 4JG0L 5D96B 2Y07H 4N4YB 4WO0A 4KZDL 1ZHKB 4I9XA 4UT6H 2HFGH 5T1MA 1HHIA 2O4EA 2X4SB 3DTDA 3AGWA 4Y1SA 1HHHB 3IDNB 3NEEA 2F8VA 3MRHB 4L3CB 2C9SA 4OH2A 1NIDA 3IBEA 3MRDA 2J73A 3RWHB 4P2RE 1OK8A 1MAMH 1WWBX 2XN1A 3P4LA 2JB6A 5I6PA 1JPEA 1PY0A 2QVKA 2RFXB 3TO2A 5C1MB 5E5LA 2WB7A 4UNIA 1PY4A 3OGCA 4CUCA 4GKOA 3D08A 5FW8A 1XT5A 4HEME 3VD0A 2SEBA 3H9SD 3EYVA 4ZUTA 5DS8A 5DJCA 1NCWL 3RKPA 2A83A 1I8KB 2YSTA 1A25A 2X05A 1OLZA 3BEWB 4S2SA 4F33B 4N8VA 1G43A 3W38A 2BWIA 2X0VA 3DIFA 4PS4L 3BH8A 2OYKA 5DEFB 4FNPA 5I0VA 2FNWA 2VDNB 3FN0L 3OKEA 1RSYA 2AQ3A 1PLGH 3MTRA 4J12A 1A4JB 4JFYA 1SQMA 1TJMA 4OT1L 5DEGA 3H8NA 4BIKA 3BPCB 3UAFA 1PFCA 3U7WL 4F57L 2XKNA 2AXFA 4KOBA 4IRZA 4RA3A 3VMOA 1B90A 1OAZH 2XN9E 3T0DA 3I6SA 3L9EA 1CGUA 4KKBC 3ZW3A 1VFBA 3WFBH 2WVUA 3CBKB 3NFSL 2WK2A 4ZUUA 4IIQC 4TUJA 2VLMD 3C08H 3CX5J 3Q8CA 4AV5A 5IFJA 3IFNL 3FU7A 5KG9B 4XNUH 3CHRA 4IMKA 1AE6L 2X6BA 3ZN6A 1CLYL 3IJYA 4LB8A 5BJTB 1J5HA 4B9KC 2BP5M 3QEGL 2X1XR 5I18L 2FO1A 4X6EA 1VPOH 4KROC 5K9OA 3GUTA 1ZV2A 2ZONA 2QDVA 3QUZD 5FFLA 4I9WD 1F6AA 3O8XB 1UGNA 4ODTL 1ZT1A 3K71B 5T1LA 5KSVA 4ZNEE 4JFXB 2ATPA 4D0CA 1I3UA 3PGDB 1OZTG 4LHJB 4NQXA 3WEOA 2LFEA 2VMFA 2X6AA 4S10A 3WELA 4L4TB 4NFDA 4WKZA 2B39A 3QI9B 1XCQA 4RWYH 4UILH 4GW4B 3IGLA 4ERSH 1MFCL 2BS8A 2DTMH 1WHPA 2DLTA 4W6XB 2VLLA 5DD3L 4ZZKA 2VDKB 5C97A 3EJZD 2VSCA 1JPST 1YMME 4NENA 4M9PA 4QYOA 2EDNA 2P8MB 1JF1A 2FEDC 2FX8L 2Y7LA 4KXAA 5F7BA 3TIDB 4UYQA 3ZDYE 4F8QA 5IV2A 1X4ZA 3R7QA 1X5JA 2JWYA 5JYLA 4JPVL 3ET9F 1PD0A 2JJSA 5HJ3A 2ICES 3QZLA 3WG7B 1QFUL 5E5UB 5DHEA 5EIVA 4BKTC 3DVGB 1BQRA 2HG5A 2K7PA 5EU6A 3D2UA 3L45A 1TQBC 4BFOA 5B39B 1BG1A 4GP8B 1FORH 1WQVT 3QDJD 1QEWA 5C07B 2B3RA 2J5LC 3MV7A 2LU7A 1T3FA 2EE0A 4Q8BA 2VO5A 1UWXK 4W6WB 3RL2A 4U4IA 1A3ZA 1HXYB 4GOSA 5B22A 4K7FA 4BWUA 1JTOA 3GSQB 3T0BA 4UU9A 1B0IA 5IZ7A 3AADB 3BDXA 5JW3L 1RZKH 4LLVB 3QIWA 5DHXB 3HCVA 2CK2A 4HFWB 5DK0B 3UEQA 3Q2NA 2V7NA 1I9IH 4NJAH 1E8XA 1ERNA 1FUNA 1E27A 1AFVL 4KKCC 4UUJB 3V10A 4MS8D 2OCJA 4FERA 4QXTB 2E0PA 3RNQB 3NRQA 1Q8MA 1QO3A 2YMTA 4I18C 3F5WB 4HKXA 2PP7A 2LT9A 4NWTH 1KCSL 4ODWB 4AYID 4X6FB 4TULL 4YSOA 4Y5YB 4ZO8A 2VLJB 3QDGE 4FQLH 3V5HB 4RIRB 1YECL 1OAYH 2ZCLL 3SJVB 1MELA 2XSKA 3C9NB 5EIIB 4Y1TA 1A7QL 3CVDA 1UC6A 2NX5E 5GGUA 5GRJH 2GABA 2VQUA 3REWB 1MOEA 5F6IC 1NDGA 2YXWA 2H6OA 4JKPL 5KYXB 3BYTA 2FH8A 4P4KA 3NOIA 1MRDH 3HZ3A 4W4OC 5ICZA 1NCUA 4M48L 2BSTB 3GXMA 2J8UF 4V1DE 4LPUA 3MBWB 1JZGA 4PB9H 5CSZA 3GQFA 4D2NA 3IKCB 3KLHC 2X4QB 4KMTL 3MNVA 4O2EB 5E4AA 1EJOL 5D96C 3ZIMA 1EMTL 1TDQA 5LQBL 4U3XA 9PCYA 1ESOA 4LCUB 3IDJB 3T8XB 4PP2B 3H42H 3FYEB 3PQYE 2NY4D 4HHAA 1RUQL 1MJ8H 4EZMA 4XNZB 2GJRA 3PWUA 4ZTEA 1H3VA 1J0KA 5D7LE 1RLBA 3DTXB 4PRHB 3D05A 2ZOKA 2XZZA 2VN3A 1FVDA 2NZ1A 1IQWH 3MRFB 4KX9A 3V5DA 3WKNA 2OK0H 5INCA 2C9VA 1VF5C 1OF0A 4K8RC 3K1KC 4NGHL 4Y19E 2KMWA 1PG7L 2JVUA 2VZVA 4XNYL 3BPLB 4YO0A 5IQLA 1BEXA 1AGBA 5JZ7C 1C5BL 2XZAL 2YPVL 1WZ1L 5H37A 4GMTL 3MRQA 4HFUH 3M46A 4NO5B 1HTYA 1EZUA 3MOQA 2VC2H 4H40A 1RVFL 3L17A 3HE6A 4JRXD 4OBRA 3OMZA 3B9DA 4GEJA 1T0NB 1GGYA 4PJCE 5TDOB 3GJEB 3WN5B 1E43A 4QRUB 5ADOL 5EU7E 2EVHA 3BH9A 1A1NA 5MENB 2WOYA 4HQQL 3D48R 3AG3B 1KTDB 5IROA 5CEXA 3VAEA 4GLRH 3A3YB 5DMJB 2BS71 1JZ4A 3QO1B 4F2MA 1JZFA 4ZD3H 3RA7H 3V0WH 3FB7B 3FBQA 3GGWB 2BZ7A 3QRBA 1IMHC 4DP7X 3CFJA 3MVSA 5I6LA 1KB5B 5JUEH 2XOTA 3SE6A 4PV9A 4OY9A 3O8XC 1HE7A 4P06A 4WEBH 4ELKA 4PGBB 4RMTA 2GJ6E 2HXAA 3FHQA 4N26A 4X5WB 5HI4D 5L2KD 2LU3A 2UXGA 3DOIA 4RZCB 3AUVA 1UD3A 1U8PB 4NUGL 2R0ZH 1X5AA 4JX0A 4F80A 2DI8A 2IIJA 2P5WA 1HL5A 1JIBA 3K72A 1CDCA 4X6CB 1GGTA 2PR4L 1F11B 3TF7C 5DR5H 4U6YA 3S3CB 2F19H 3K6IA 3QI9C 3PXLA 4BD4A 2BS9A 2WO3B 2QZ5A 1IC4H 5CD5D 1EZLA 1WITA 4UM8B 5C0IB 3G5VA 3GINA 1PZDA 2GEEA 5AENA 1FRGH 4WV1B 4P59H 4PS3A 5KYNA 4X9YA 2PPAA 3N1GC 4LK4A 1NMAL 4KWUA 4LLWB 1TKWB 1T03H 3U82B 3CFKB 5HYJE 4E5XG 2PO6C 3TL5A 2FJFB 4QAWA 2FEEL 2GY7B 1WJ3A 4UTAL 4AM0B 2IDQA 2C1OB 1V8HA 1CT8B 1GMEA 3HZVB 2XVBA 4NN7B 1JN6B 1OOWA 3MLYL 4YDJB 5BS0B 3FSZA 1MNUL 3U46B 5C08B 5KSBB 5CM1A 4ZQKB 3OPZH 5AAWC 5FO8B 1IVLA 1KLUA 3WHE1 3FFDA 4DVBA 3BVDB 1YY9C 4MAYD 2OKMA 5KBPA 5FLUA 5IVNA 4L8DA 4X4XB 1JZHA 1SDDB 1A7OH 4KK8D 2DM7A 4JL2A 4L8SB 1JNJA 1FNEB 2UVFA 4Y7OC 3UTTE 4A38A 2QSTA 4G5ZL 5FIEA 3EFDL 4QMEA 3VFNB 2VDNL 2BVPA 4XCNB 3CCHB 1ZD6A 5I1KH 4H8PA 3HS0B 1IL1A 2EDWA 1KMGA 3WL9B 4EE2A 4BE6A 4E9SA 3SDDD 1OT1A 3PP4L 4OZHB 4YSCA 4F2EA 3QDMD 3T1FB 1N2RB 2I7SA 3O81A 1D5IH 1AZZC 3LN9A 4Y5YC 1Y1DA 2CD0A 2YA1A 1QLFB 4LP5A 1H0DA 5BO0D 1QFWL 4WK2B 8FABA 1NBZB 2Z4TA 3AMKA 3LNHA 1UXLA 5F7AA 2RIKA 1I3GL 2CWRA 3B7TA 1JXFA 5ALBH 5FM4A 5B3JE 1QZNA 2KDYA 3JWNC 4R84A 1FAIL 2AQTA 4DAGL 3WAJA 3WYRA 5F96H 1UZ8A 2CKBB 5LNGA 3NSCA 4ZFZA 4WJ5B 6PCYA 4EI5A 1ZPUA 4M5YL 2WV3A 3CDYA 3F7YA 1I4FB 4XCFH 2C4XA 3ZL1A 2P24A 4MCMA 5E8NA 4HEPG 4J2XA 5I8EB 4XPBL 4FYRA 1WICA 2QVFB 1P1ZB 3AQXA 1HSAB 5FUCC 4P46D 2DMHA 2X1WL 3IWVA 5IVZA 4BWWA 1BD2E 4RA0C 2TSBA 5EBWB 1I8MB 1MPAH 4NI6A 4DZ8B 4TPRH 1U8JA 3Q9QA 4FABH 5AW3B 5I1LA 4AL8L 1ZGLB 1P4IH 4IIQA 3VSQA 5AZEL 2R83A 2FD6H 3A4FA 4RBPK 3OV6A 4MJJA 4PLNC 2ZT9C 3WIFB 4DCQA 3L5HA 1A64A 2RCSH 3D51A 3ULUD 4MNHA 1Z6JT 2K1MA 2WYIA 1NGYB 3EW3B 1MIEL 3ARUA 4YZFE 3QIBB 1EGJA 4WI0B 2HKHH 2HTLD 2X4RA 3ZSSA 5DWUH 4N0YL 5L6YH 3GUFA 5IEKB 3OM3B 3TA3D 3NABH 1O0VA 2HFTA 4KRPB 2G4EA 1L0QA 5D6CA 3LZFH 5EZIL 2YD3A 1G7JB 2HLAA 1J5CA 2R2HA 2VMCA 4I13B 4IRSB 4NXSA 3WXVL 1ZT4B 3HLAB 5K9JL 3TEWA 3FQ2A 3NDZE 3F01A 1UVQA 3OG6B 1FN4B 4JN1H 5C8JA 3ELQA 3ZYIA 2VLRB 3L4XA 2EIZB 3CUPB 3WN5C 3W9EB 2BHYA 3FO2A 5FWQA 3QUHA 4JRYB 1P5UA 1SVBA 4XPTL 3UJTL 1TXKA 5I15H 4HWUA 4NUMA 1UACL 1QRNB 5K9QG 3Q7JA 2ZCZA 1UA3A 2OTUA 1XF2A 5I30H 5AOZA 2OX5B 3L6FA 1T7YA 3VRLE 3BEVB 4ELME 2IQAB 2R15A 3X11A 2JXMA 1H19A 4N6RA 4U2YA 2G60L 2VZ1A 4LSDA 5BMFH 3F12B 4CRPA 5I8OH 4AKPA 4MX7A 1E0OB 1SQ2N 4JFPB 1KEGH 1F8TH 5BOPA 2EP6A 2WQ8A 2GIMA 1MCWW 1YEIH 2YPVA 1VGEL 2X1OA 3A6CL 2IG2H 3BO8B 2VXVL 3RRQA 3KL0A 2G5BA 3SPIA 2W0LA 3QWQB 3UJJH 4WNQA 4A66A 2JKLA 3L7EB 2NZ9D 3JQOB 5E2WL 2FBJH 2IPUK 5EEYA 1YEKH 1DUZA 1SGKA 4MDJB 4EUPG 3MA9L 2FQDA 2JTYA 3GC3A 5HGDB 1LNUB 2ZP9A 1VFAA 4R4BB 4ES8A 5CGYC 2PPCA 5AD0B 5ESQA 4OGYH 5EUKB 1CVSC 3EGSA 3OLGA 3UIYA 3FQWA 4BCYA 1IBBA 5EOTB 5ANMA 2XJKA 1MY7A 3A6BH 4I18A 4PJDB 3S8WA 3F2LA 4OU3A 1PF3A 2CDEB 4OD1L 1QFHA 1NLBH 4X99B 1E4XH 3RBGA 3T65A 1MF2H 3MJ9L 5EZLA 4RGNB 3OC8A 5AKSA 1MJJA 4LL1A 2ADJB 1LXMA 3OJVC 2RTTA 1CGVA 3WGUB 2P3YA 2BOCB 4DNLA 3E6FB 2J6EH 2IQ9L 2AJZB 4D9LH 4LCWA 4U3SA 2DWXA 2NXZD 1KNOA 1K4DA 2XFXB 2ZOLA 2LR4A 2R4RL 3PF2A 4L8SC 3L5XL 5KUMA 1FNSL 4GAJH 3N42B 3DMMD 4QRAA 5CIPH 5E2VH 5EU6E 2WXFA 3HS0C 3WNPA 1GKOA 2DM3A 3BQUD 3MV7E 3O3UN 1SEQL 4XVSL 4KXZI 1ZHKA 2A6IB 2X09A 5CLZA 4KTYA 1U2CA 1HHHA 3IDNA 5HDQH 2YQ3A 2Q8BH 3MRHA 4L3CA 4UTAA 1ZRUA 2D9QB 4UT9L 5EUOB 3RWHA 5JOPD 2RA1A 3TNNA 1AGDB 2WCSA 1CLVA 1C5DB 1N9PA 5JDSB 4ETQB 2RFXA 1AZUA 1KBVA 2AJVL 3QG7H 2L8AA 3ULUH 1A0QH 1FFNB 1H3GA 1T0OA 4LDLB 4Y4FB 2DQTH 2CALA 1F4WL 1LMKA 4HOXA 4BK8A 4LESA 4XOBA 2EDEA 4F33A 1X5MA 5KZCD 2M26A 2BC4B 2OMVB 5DEFA 4Z76B 4ZX6A 2FX7L 1AD9A 2YAMA 1I9RL 2MWCA 4RSVA 3IPEA 2RACA 4IBSA 3KWWB 5DMGC 3BPCA 4N90D 1A66A 1X9UA 4GQ9H 1CFQB 5FV2A 4LMQE 2ZYHA 2PN5A 4G80B 1BYNA 5DGRA 4FLSA 2E7MA 1SJEB 3WIIL 4HUUB 3M6DA 2B9AA 4CU7A 2J8HA 2NR6C 3ZT6A 3QEHB 1D3CA 2JLLA 3ZK0A 3EKCA 4DGVL 3ESMA 4W1TA 5BJTA 3U36A 4LGPB 2E5EA 4LLYA 3B5GA 1DSWA 4Z95L 1OP5K 3GKWH 3QIBC 4Z8FH 4L23A 4J3UA 3AT0A 3QNZB 5AVWB 2YD8A 4J4PD 2C4FU 4OLXL 5I17B 3M88A 1HJCA 4K3GA 3K71A 2ENPA 2BP0B 4KRPC 5HHOB 1KIUB 2CSPA 3CSTA 1OB1B 1N70A 4G7YH 5L88L 4IRSC 5E9DB 4DWHA 4LASH 3PGDA 3QCTL 2QKSA 5GZOC 3MOBH 2EKSB 4KY1L 5FKPB 5BV7H 3BCFA 2ESVB 3CN0A 4YGAB 5CJQL 3S35L 3N9GH 5KS9A 4AYBA 1NGZA 1NTDA 1ZHLA 5CXPA 3QI9A 1BQKA 2XX1A 5FM8A 4LHUG 2QQKL 2PW1B 4GW4A 1U58B 4X6CF 4WZ9A 2X4NB 25C8L 2VNCA 2P8MA 4A2DA 1CD1B 3N1QC 4FA6A 5JHBA 2B15A 4LOEA 2ZUQB 2ETWA 2QADD 5AW7B 3ZDWA 4XPFL 2I9LB 1RZ8A 1RUPH 4IBTA 4UOZA 4JZOA 3RYMA 1F4YH 2K4AA 2JTDA 4LEEA 5B39A 2CO2A 3G6AB 4ONFH 1X5GA 3D52A 3LQMA 2N01B 5IQNA 4F2ME 3AVEA 2Z91A 5F0JB 2NY0B 1HOCB 1R0AL 4FFZH 1RL1A 1HXYA 3D0VB 3ZKQD 1FFOB 4N20A 1FCCA 2GQHA 3ARBB 3GSQA 3R1GH 4BHUI 1X7QB 2XTJD 3QJSB 1V54B 2IDTA 4P3WA 4X0NA 2LTQB 4JQXC 1EUUA 4HFWA 5DK0A 2OP4H 1FO0L 2D0HA 2EDTA 2EXYC 1WFTA 1PD1A 4QXTA 3NAAL 3RNQA 5MHSD 3AITA 4WHYG 1RU9L 4ZSOB 1HYSD 4NC2B 3P4OA 1X5XA 2Z31A 4MRBA 4ODWA 4X7TA 3VTTA 3S6CA 3V5HA 2I60H 3KW7A 4RIRA 5FC9A 3TXAA 2HVKB 3B1TA 3PDOB 4OZHF 4TLSA 3C9NA 4U0QB 5EIIA 4RGNC 1OB0A 4JREB 3IU4L 3UP1A 3UZVB 1LDSA 3NQIA 3MACL 3B1UA 1KY7A 5KYXA 4IJTA 5FUZL 1H6EA 1S7QB 2B08A 5HHXL 2XNAB 1QBLH 2BSTA 2AV1A 1OXYA 4RDBA 4XBPB 4YNYA 5F7DB 4LGSB 4HUXA 1A6VL 3MBWA 3IE4A 4I48B 3D0LB 3IKCA 4TN9A 2X4QA 5DTFA 1ZWIB 3K4AA 4H88L 2VITB 3WUWG 1ED3B 2ADYA 2GHWB 1AIFB 1JD9A 2F5BL 1CTNA 1GGBH 4I0PB 1UWEH 4HUCA 3VWJB 3EJRA 2WLMA 1TSRA 2Z64C 1T1XA 1EERB 2DJMA 2VLKB 3IDJA 4Z7UB 3T8XA 2BJMH 4PJIB 5E1GA 1VFMA 4R26H 5I19L 3KBHE 1MLCA 4IBLT 4BCXA 4ENEC 4G83A 5DD5L 2ZKHL 5KYUB 1LK3H 4AG4H 3HG4A 4ZW6A 2Y1AA 1RHHB 1UXSA 3DTXA 1DLHB 2GSGA 4PRHA 3L1FA 2FL5B 3MLSL 3MRFA 3MJ9A 2EEBA 1F2QA 1CF8L 4N2EA 4XNXH 1NPNA 3HZYB 5EO9B 1CK0L 3FUNA 4QHLB 4WFGE 4Y4FC 1T2XA 2ZXCA 2E7BA 4Q9RH 1BHGA 1WAEA 1ZLEA 4M8RA 1BFOB 3HUJB 2JCCB 1Z9OA 4PJHB 4WHYH 2W0FA 2QSCL 3TBSB 2QR0A 2EDJA 4PVNA 4PJ7B 4NO5A 1KWGA 4HKBB 1FNLA 1XCTB 4FXLA 2AEWA 4NQCA 1JZ6A 2E6PA 4QEGA 2WD0A 3FTYA 3KEHA 4M7KL 3X2QB 3NZHH 5L7XL 5KUKA 5DURB 4NM4H 1AO7A 1T0NA 3RVUC 5AKVA 2XZQL 4OCSL 5TDOA 1A02N 1CG9B 4OJEH 4QRUA 3FQXB 4ELDA 3SE4C 5ISZB 2QSQA 4UT9A 3CZFB 2WXOA 1IEBB 2OCFD 2AAAA 3ML9A 1NUFA 4OFPA 4QLWA 1EDQA 1KTDA 1QUNB 4GIPD 2WAHA 2D4DA 3QO1A 5T1DH 1DEDA 4ZOBA 4Z3FA 4RMVA 4RAVA 3T2PA 5K9KA 3GGWA 1JS4A 4U3HA 1OHZA 2VDQL 4XMTA 2D8KA 5D55A 1PEZA 2F5AL 2XWBB 1OO2A 1HK6A 2EECA 4PGBA 4X5WA 1DFBH 4CN6A 3QCVL 1UXWB 4RZCA 3MBXH 3GB7B 3QR0A 3UGEA 3GSWB 4IS6B 3P3TA 1U8PA 2G4GA 4QF1B 4JM2B 3E1ZA 3P73B 3NSFA 1LDPL 2XY1A 4ABQA 1UH3A 3FU8A 1F11A 5DLML 3V6OA 1E8YA 2VW4A 2QPSA 1K5NB 1GAFL 1A6ZB 1JK8A 5FYJL 4CJ0A 1KTJA 1RPUA 3FS9A 1EK3A 1AC0A 2VGLM 5C0IA 4PJBB 3LRKA 4QRPA 5HDRA 1IILE 4WV1A 4OJCA 1IGYA 3LN5B 1U8NA 1TKWA 2CXGA 4MHHI 1T04B 1L9TA 4PV8A 5TE6L 3M86A 1MCOH 2FJFA 3KGUA 2NLJB 3O45B 3DURB 5SX5H 3ZTNL 3EYSH 4AM0A 1S3RA 3RFRA 4BV1A 1SN0A 2EYTB 3V0VB 1SF5A 2C1OA 4OI9A 3S37L 1CT8A 1WEJH 3BGMA 3HZVA 4PJDF 4IEFA 4YFEA 1JN6A 4UBDD 1OTUD 4YDJA 5BS0A 1Q0EA 4DGYH 1YYCA 3PFQA 3C6LD 4O58L 5KSBA 4ZQKA 4UIMB 4V2CB 5EEUA 1J9CT 4DPCX 2NY0C 2CKNA 3GNML 5JHLL 1YHPA 3ARBC 3KL5A 3MTXA 4X4XA 2V9RA 3HNSH 1SDDA 1FFPA 1OP3K 1FQ9C 3VUAA 4HF5H 3DDGA 1FNEA 2LTQC 3JVGC 2PWFA 1IM3B 3VRJB 5HPMB 4WK0B 1MLBB 2VXSL 3CCHA 3NCJH 3O6KL 1J1PH 4JAMA 5DA0B 3ZJAA 1A6UH 1HDMB 3HS0A 3KPQB 1MCSA 4MMZA 1MI5D 5LBVA 1FH5L 1T80A 3WL9A 4FQJL 3BI9X 3FDWA 4FYSA 3N42F 4OZHA 3ZE2B 1N2RA 4M6OL 5ALCL 2GI7A 4YX2H 4C56A 1KBWA 2OL3L 4EIBA 3HR6A 1E3FA 1T21B 3QQ3B 1NBZA 2OTWB 4L1SA 5BQ7A 3E2HC 4JREC 5A2LH 5ELIA 1HCZA 5JXED 4JLRA 5BUPA 3P2TA 5ANME 1ZLWH 1QLRB 4MQXD 5EUOF 3OAUL 2H8PA 4GT7A 3DO3A 1MCKA 3ELAT 3HC2A 1BBDH 4QRBA 1LEKB 1FYTD 2OI9B 3CZNA 1J5IA 3K2IA 3MGTB 1QR4A 2CKBA 4WJ5A 2AI0L 4LVEA 2IWEA 2BNRD 4M6MH 3S8FB 2Z34A 5M95B 1E4XI 1I4FA 1FC2D 5AKTA 4QHKI 5KBNC 1EFQA 2J1YA 4PJ9B 4G42A 3FT1A 4ZO9A 5JIIA 1G0DA 1WO2A 4NM8L 4H25B 1FO0A 4I0PC 4MJID 3VWJC 4NO2B 1P1ZA 1H3TA 1HSAA 1NCBL 1Z7JA 5KJ7E 1U8LB 2P46B 2CIKA 4UQ2B 4JFSA 2PF6A 3I3EA 1MRCH 4LCWE 3GHBH 1H3PL 5GHWH 3TASA 3ZTEA 1J1OH 5BRZB 5EBWA 1I8MA 4QRRA 3QJHB 1TFHA 2QVTA 2WSPA 1OPGH 4DZ8A 1BIIB 3U0TB 1PZBA 2EXTA 4WI9A 3UYPB 4MXQD 5JPNA 1ZGLA 3S96B 3VSUA 3MRKA 4DP2X 1GS7A 2NR6A 3WIFA 1IBYA 1QNIA 5BVPL 1RERA 1Q9LB 4M9OA 5LAXB 5A2KH 3UPRB 1MFAL 2CPCA 2YD7A 1B0GB 2JI3A 2R0WL 3PP3H 4PLJD 3AS1A 4WW2A 5T1KB 5LHDA 5I5IA 1XR9B 3QIBA 2I07B 2WZ0A 2O6DA 3K2UL 3S3SA 3MRIB 5IEKA 1BQUA 4YWGL 3EHBB 1TEFA 3MC0A 2XA8L 4R7XA 3MRRB 4PY8I 1G7JA 2J71A 4IRSA 5FA4A 3INOA 2OMWB 2LLNA 3T77B 2AVFA 1ZT4A 3HLAA 4R0LB 3CMOL 1X6NA 1NSNL 1DBBH 2XRAH 3QFJB 1B9ZA 5DJAB 2AJXH 3OKLB 1R3JB 3ABZA 1OM9A 2VLRA 2EIZA 3D6GA 4KTEH 4S1RL 2P49B 3CUPA 1ZA6B 4OZFH 3W9EA 2MKWA 5G55A 1TOXA 4NHUB 4JRYA 4XMVA 1N8ZB 3DWTA 2P42B 1TYRA 3HFFA 3I74A 3SGEI 4C57C 5FHAH 1JV5B 4I77L 5F97E 5T33H 4Z7QB 5F88A 1FGVL 3QNYB 3VI4A 3BEVA 2AERT 2IQAA 2W65B 3HMWL 1XGRA 4R9HA 1T7XA 2WCPA 4RRPA 3WI9A 2BX5A 4PMFA 3RPBA 4FYTA 1FFQA 4P5MB 3MDJA 2IADB 1P6AB 3NZUA 4FKEA 3F12A 4M8VA 3U4BH 4FZEL 2GY5A 5IFHH 5JPMB 1ZEAH 4JFPA 3RVWC 5L8KB 3PGFL 4DQOH 3UOAB 3BO8A 3I6LD 3APCA 1J88A 2DB8A 2OXGB 4BM7A 1JYNA 3L7EA 1EQWA 2LLGA 4K3JH 4JM2C 1NAMB 2ZUSA 5DC2A 7PAZA 4FQIL 4BFBD 4XO9A 1RCYA 1GY1A 1KB9K 2YXVA 4MDJA 2XV3A 3LDBC 4OGXH 2WLLB 5HGDA 4LSUH 4WEMB 3OZ9L 4R4BA 3GFUA 5C0GA 3ECBB 4A2GA 2HN7B 2F7PA 5EUKA 1VAHA 4XVTL 1EAPB 4B97A 2J1XA 2QVIA 5EOTA 1PAZA 4YQXH 5GS0C 5EWIL 4DKFL 1NPUA 3L5JA 4R8WL 4LOUD 3WHE0 2BP8B 2VZ3A 3F58L 1KTKE 2W38A 3IFLH 4M03A 2WSDA 2CDEA 4L4TE 4LEXH 3SBQA 1JNNH 2A0LC 3T2NH 3QARA 2F7OA 5ESAB 3K80A 2K6YA 2WINB 4OFQA 2UZYB 4PRPD 3WIHL 4X99A 5T3XE 2F2HA 4LP8A 3H9SB 2C3VB 2ADJA 1QHQA 2AEQL 2WPGA 3BWAB 2ADIB 2N56A 3FB6B 1IKFL 4BQ8A 1PG7X 1AGEB 3E6FA 1WFOA 4L48A 4X9GA 2ENSA 1MJUL 3FCUB 3FXIC 4Z0BH 3N06B 5B8CB 1HVXA 2XFXA 5GQBA 3UADA 1EHLH 1X9LA 7CGTA 4NX0A 5DJXB 2H0FA 3FTSA 3T8MA 2MTAA 3ARRA 5C07E 3QJXA 2VL4A 4WFHD 3HJ0A 3P3UA 4AV4A 3MI6A 2A6IA 4ZS7H 1MFUA 1YUHA 4G8GD 4KITB 1FDLL 3ULVD 1JFQL 4HWNA 3ALPA 3B2VH 4Z1PA 2EUXA 3NRFA 2OSXA 5FYLL 4M00A 3WCYA 4APXB 4G1MA 1AGDA 3ILDA 2PYED 3CVBA 1PLBA 5JDSA 1T2QH 5CD3A 2OM5A 3EADA 1DUYB 3CGTA 2VXQL 1KC5H 4M4RB 2OI9C 4Y4FA 4RDQG 1R1CA 3MLZH 1W16A 4DN4H 5JHLA 3RPIA 1TZHB 1I1FA 3AB0B 2VLJE 3BVVA 4G7VH 3WOVA 1OSPH 3SJVE 4M1GH 4MXVF 4PJ9C 5E8PA 4Z76A 1WG3A 2ZCKL 3HUJF 2JCCF 3ZR6A 5GGQL 2EINB 3JWNE 4FHBD 1UYWH 4OSUH 3KWWA 5TDNB 2FLMA 1S78C 1CDJA 5FEBA 2C26A 3S5LB 3PHOB 3MXWH 2X2HA 1A14L 1UB6A 4PJ7F 4IRJD 1CFQA 1M6OA 1BVNT 4ODHH 1XSKA 2OL3A 1AJ7H 2AKRB 3LZQA 2AEIT 4G80A 5IB5B 3CSYA 1EAJA 1SJEA 3BZFB 3TWCH 3C5ZA 4HUUA 1UUSA 3UTPE 4LRNH 3GWJA 3D3VA 4HBCH 1CD0A 3U7YH 3K46A 1XZWA 2FJHB 5FUCE 5K69A 2P9RA 4AUYA 1KGXA 4N8CH 4XE5B 1KB3A 4LOFA 5GJTL 3QNZA 4I2XB 3TFKC 4KDTC 3QDJB 4KI1A 4ZDHA 4G72B 4F20A 3EHBC 3RHWF 2BP0A 4PRHE 4AEIH 5HHOA 1KIUA 1U92B 3QHZH 1OB1A 4OLWH 5GJSH 3FSAA 2KUTA 4JG1L 2ED7A 5TQ0H 5EZJB 5FKPA 2EKSA 1AIZA 4IHOB 4R0LC 2ESVA 1EO8H 5I8KH 4AITA 5BZDB 4XMPH 5GGSY 4H0LC 2Q76A 2YIHA 4WSGA 3JBG7 4I87A 1Y7VA 2Y07L 2ZG1A 4EDXB 3HI1B 2O5NA 4UT6L 4HP5A 1IGTB 4OJFH 2HFGL 1FHGA 5CZVH 3UJIH 3QRFM 1HEZB 2X4NA 3IXTB 15C8H 4PY7B 4R97B 3OAYK 1CD1A 4N8UA 1AO7E 1WZLA 2YEZA 1MZZA 1RJYB 4PJBF 3WFHA 1MAML 1S7XB 2WLNA 5DA4A 5JPMC 1AZVA 2I9LA 2V9TA 2J21A 3QFGA 3GMQB 5AOJA 5MENE 3Q05A 1DZBA 3G6AA 1MREH 1U3NA 2WCGA 1EX0A 4XTRC 4UQDA 3UMTA 2EO9A 1HOCA 4IIZA 4E9YA 4BFGA 2R69H 3T6QC 3FRUA 3JVFC 1RZKC 3ARBA 1X7QA 2MNUA 4IQHA 4JGJA 4PBDA 1QR1B 1PLGL 1TVBB 3RIFK 4IBQA 4Q89A 4UMGA 2IMNA 3H1ZA 4FRWA 4B6ZA 3V7MA 2MMXA 1K4CA 1OAZL 1BMZA 2Z4QB 2NY4B 5JW5B 4F1ZA 4WRLA 2A77H 3WFBL 5I71B 4NJ9H 4YHZH 3ULVH 5A2AA 3VO0A 4GYBA 2ZAIA 3V6OE 3C08L 2H41A 4GIAA 3WO3B 1NBYA 4XNUL 1DN0B 4HK3J 2IAMA 2HVKA 1JUFB 3ZE2F 3ZKNC 1F18A 4FXKB 4LSTH 1ZSHA 2CGRL 2WIIB 1AVAA 3JV0A 4KX8A 4OM1H 3UZVA 3WBDA 1VPOL 1YC7A 3E80A 5C6WH 3NTCH 2C7FA 1JZEA 1QSED 1UA6H 1INDH 4FNQA 1S7QA 5E1AA 2BIHA 4FE9A 5F7UA 2XNAA 5AVQB 4FFTA 4TNFA 3CPLB 2TRHA 1MVUB 2EIMB 1OKEA 3VD5A 5D1ZD 4ANUA 4I48A 4JRXB 3D0LA 5D2LB 4RDQF 5BS0E 1YPZB 3PIQB 1ZWIA 3VX0A 1AIFA 2CJ3A 2VUKA 5C08E 1I75A 5KSBE 4ZODA 1QATA 4I0PA 1ADWA 1A6WL 2D7NA 4GAGH 1G7MB 5DZ9A 1QWNA 1Z5LB 1A9BB 4Z7UA 2Q7AA 4RWYL 2BOBB 3R7RA 3TEYA 1UHVA 3QZPA 4UILL 4PJIA 3QQ4B 3RDTD 4F7PB 1PNDA 2DTML 4N1HB 2ITFA 5D1XA 4ISVB 4XN7A 3DVFA 4MZIA 3FKUS 2NXYD 5KYUA 3PUUA 1RHHA 4L9DA 5CEZH 1TETH 2X4UB 4LLUB 5M7QA 1QWUA 3WIHA 2FL5A 3G5XB 4FNUA 5EA0H 1Z2KA 3L1OH 5EO9A 1QW8A 5CFHA 4OZHE 5CKAA 1QRKA 1BOGA 4QHLA 3KM1A 4EO5A 3LEYH 5T3ZD 3KHOA 4XVUD 2DKUA 2JKSA 5JIKA 3ARED 1BFOA 3AB0C 2H7WA 4PJHA 2JCCA 1DQIA 1IGJB 4DJMA 1FORL 3TBSA 5CBAB 2V33A 3VTAA 2V5SA 3CFQA 3FOLB 4NNPH 4PJ7A 1G0YR 3IM1A 3MRGA 4HKBA 1U6AH 1XCTA 4WI3A 3GMMB 4NDMB 3BWZA 5CR8A 5EF1A 3TBVB 1AKPA 3O2VH 3FQYA 1F2XK 1PNCA 4JDVB 2J88H 3P2BA 1ECYA 1RZKL 4CBZA 1SJMA 1AHWB 3GXIA 3W57A 3IDMB 3VFSA 4EF3A 5HHQB 1I9IL 3II1A 4NQDD 2G2PA 1CG9A 3EJZC 1CICD 4QT5A 1SJHB 2C3XA 3WNOA 5ISZA 2Y7SA 3CZFA 4HUMB 4U6XB 2GIYA 4AGMA 1XAKA 4UCFA 4WDIA 3U83A 4NWTL 1MAKA 1NINA 3B9VA 2CCVA 1Q90A 2VXQA 4OV6F 3N43F 3QYMA 4FZ8H 4Z7QF 3KJ6H 4QRRE 2IF7A 1U8HB 5MP6H 3ZMEA 1E4JA 1PZUB 5GRJL 2XWBA 3B2MA 1T5WB 3CH8A 4UTBH 4X98B 4QRFA 5T8IA 5DT1H 3F7PC 4ZMTA 3DX9A 1A4KA 4MCNA 3F8UB 1UXWA 3P3YA 4MAYB 1MRDL 2ZXEB 1I8LC 3GSWA 4IS6A 2HRLA 4GG6A 3S3BB 4JM2A 3P73A 1ZTXH 4FLHA 2WBXA 2YHGA 4PB9L 1E90A 3FO9A 5IKCB 3ECQA 3OLEA 5E5RB 3X1GA 3KYOB 2PLTA 1KCRH 3AZUA 4MS8C 3VFVB 1JRHH 4NOFA 1K5NA 4R5VA 4EI6A 1N0XH 1A6ZA 3W5MA 1BJ1H 3LRLA 3SDDB 2Y7QB 2KC0A 4URTB 3FONA 3H42L 3GK8H 3CNKA 3X3GH 1MCWM 3LN5A 3FO1B 4R97C 4L1LA 3V0HA 2ZIDA 1T04A 1A7PH 1W9XA 5F0LB 4AGPA 3JV6B 3G08A 2XFGB 5FECB 2NLJA 3O45A 1XEDA 2VLRE 3DURA 5JNYB 4Q9BA 4YDZA 2EYTA 4BQBA 1IQWL 2OK0L 3V0VA 4JRYE 5KYYB 1S9VB 3CZSA 1T0MA 3MRNB 1JMZA 2O72A 3NT0A 1QRNE 1JD7A 4BK5C 4NQEA 2Y5TB 2ISDA 3SDYH 4FD0A 2NCMA 4U1LB 3VI4E 3JTBA 3T6WA 3FU0A 4XAKE 4S0SD 2BHUA 5PAZA 3QEQA 4DOHB 3OHMB 4YJZL 2NT1A 4HFUL 2R8SH 4GXUN 4XVOA 2VC2L 5D70L 2DWEB 2H3KA 1IBDA 3F7VB 3IJHB 3S36H 1O6SA 5I0ZA 3J7HA 3EUDA 3GMOB 1IM3A 3IDIB 4P46B 3U30B 3VRJA 3HZKB 5HPMA 3B5HA 4UT6A 3SBRA 1QNZH 1ASPA 1HDMA 2DN7A 3G5YA 2NY4C 3F7QA 1UFUA 4HIHB 3MU3A 4QKXB 4Z3IA 2XWRA 3V7AG 5FW7A 5I71C 4DVRH 4ZX4A 4H20H 4OCMC 5TPWH 3SPHA 1P1VA 2GI0A 4ZFQA 1IVTA 5F1KC 2DWDB 1MIMH 3WS6A 5IF0B 1CS6A 5CMAB 1BDYA 1T21A 3QQ3A 4GSDH 1KBGH 3HG5A 2FX9L 3EH5B 4XBEH 3PHSA 3QXDA 4ZD3L 3RA7L 3V0WL 4HLEA 2EVGA 3ABKB 4H8VA 2JIXD 4CSTA 5JUEL 1QLRA 1E3ZA 2ZXDA 3QUXB 5T3ZH 1HWWA 4PJDE 5FYKE 1EWHA 3WGVB 5IESH 4KKPA 1L0PA 1N64H 1JHKH 2IWKA 5K5YA 3TA3B 3MGTA 4WEBL 5A16B 2QGBA 4FTVD 5E1IA 4NFBA 4K55A 2R0ZL 4RGNE 1NM9A 4QOKD 4PJ9A 1Y6MR 4XN9A 1NUNB 4GMSH 2CQVA 3FTGB 4YZWA 4NO2A 5DR5L 5DUPH 2F19L 2K9UA 2KL6A 1U8LA 1OCOB 3JWOC 4OFVA 4UQ2A 1RKRA 5BRZA 2VDLH 1IC4L 4I88A 3CG8A 4Q56A 2D3VA 1FE8H 3RWDB 1G6RH 2QSVA 5AB2A 3QJHA 1IQDA 3ENEA 1FRGL 4P59L 1BIIA 5DJ0B 4FLRA 3UXFA 3MCKA 3OZKA 1JYXA 1T03L 3UYPA 2OQJB 5FYJE 4HLZH 3ATEA 3S96A 3L95B 2AABH 2BVOB 2TRYA 1EXHA 3V9CA 4OGAD 5FCSH 2DBJA 5LAXA 5FR3A 3UPRA 2MSPA 1B0GA 4E68A 2JQZA 4XN2A 1XR9A 2JB5H 2IALB 2I07A 2E27H 3GJFH 5TF1H 4JFHD 3OPZL 4KDTA 3MRIA 3VFWB 4HJTA 2EQDA 4P2OB 2EO1A 3DKHA 2F6AA 5BV7B 3BWUC 2J3SA 1CGSH 1L3WA 3X13B 4MNGA 3LPPA 2BVEA 3V8OA 1GYVA 2OMWA 3CC5B 1A7OL 4QD2E 4WVRA 3T77A 4MB5A 1PKOA 3OMAB 3QFJA 3OKLA 1R3JA 3QNXB 1AHWC 5E7BA 4WTZG 2RD0A 3V95A 3GMLA 4BFKA 3ZIYA 3THMH 2QPFA 4ANXA 5I1KL 1PZCA 3F6JA 5B4MD 4NHUA 1N8ZA 2R9HC 3OWEA 1JV5A 4XO8A 4A68A 3QNYA 2DJ4A 1D5IL 2VDRH 5BW7C 2P44B 3UBHA 2O93L 2WN3A 1H8LA 4JG9A 5DZLA 5AG8A 2JSFA 4L8BB 3V4PH 1HWHB 4IBWA 2N4IA 1OCWL 4P5MA 2IADA 3MSPA 5JPMA 5ALBL 5J1AB 4LP4A 5J3HC 3GSXB 3TTYA 1LO4H 1GVIA 3BD5A 4JKWA 4KJWD 3SKUD 3PDGA 4ZOAA 2KZKA 5F96L 1OSZB 3D3VE 4MAYC 4BA8A 2NXZB 3IBOA 1IX2A 2L7JA 2OXGA 3D34A 4APQD 5C92A 4KK8C 1CR9H 1Z5HA 2L7QA 1ADQH 4XCFL 3DMMB 4LL9A 5E24E 4YPJA 5D7JD 3SDXF 4FA7B 2JNZA 3PPSA 4D9QD 3S4SB 4ICWA 1G1OA 3LNGA 2VWEC 3ECBA 3SDDC 2HN7A 5I1DA 3QPKA 2VR7A 5HHOE 4P5TD 1EAPA 3GHEH 3DYMA 5DJ6B 3ESUF 1FL6B 2R4SH 3KPSD 5E9DE 4GUOA 3HBQA 4HH9B 4NXKA 2NYZA 4O2CB 3QAZB 2ESVE 1MPAL 1BZ9B 1R46A 1YO4A 4MA8H 4P2CG 4TPRL 4FABL 2BP8A 3HE6D 4J39A 1P4IL 3UDWC 5D5MB 2FD6L 5ESAA 1ET7A 4W6YB 1NOLA 3RQ3A 4W9HC 5CLYA 1MUJB 2DKMA 2WINA 2UZYA 2WVTA 1C5CH 4Y8DC 2RCSL 3L8QA 4OM0H 4PJ5A 5F9JB 3CPUA 2C3VA 3H9SA 4AQ8C 3ZXAC 3BWAA 2HKHL 3EJCA 3FB6A 3UBFA 2XQYG 1WUNT 1AGEA 5DWUL 2G75B 2WQVA 4KXBA 5L6YL 3NABL 4ZZFA 1ACXA 2CA4A 4WTQA 2VTFA 3LZFL 5B8CA 2DQDH 4AZUA 2EDMA 1MWAH 4CC1A 4DW2H 3NSJA 5DJXA 3U1SH 3M1OA 4P46C 3E1F1 4JN1L 3CBJB 4LFHD 1MG3C 2F0CA 1R24A 3KLAB 5FM5O 1LE5B 5D2LF 3TS8A 1YPZF 1CPUA 2VKXA 3V4VB 2VISB 5I15L 1HAUA 3F00A 6FABH 2P5WD 3JWDC 4U33A 1IAII 5I30L 5HYIA 3D5OF 4PRNA 1K2DA 3T4YB 1KFAH 2X9YA 4APXA 2OMYB 1HL9A 3SDCD 4X5RA 2ZWZA 2UWEB 2BMKA 3LVEA 4ONOA 4HVBA 1VEPA 2XDHA 1T5KA 5BMFL 4LGRB 3QUXC 4MBRA 4OCRH 4ZSOE 2HTLC 5I8OL 3QUZA 4CVZB 2X1PA 1QVOB 2APTA 4Y9BA 1JZ7A 1KEGL 1F8TL 5EBLB 1WH0A 1XGYH 3BAYA 1YEIL 3U2SB 3MO1A 3TIEA 2FR4B 1TZHA 2C8NA 2IG2L 2KI6A 2PWGA 4K3EH 5FGSA 3UJJL 2DDQH 2IH3B 3IETB 1N67A 4F24A 5HSFA 5J6GB 5BO1H 1IC5L 2X28A 1QYGH 2FBJL 4CN4A 2V2TB 1XCWA 3AACA 1YEKL 2E7LA 5TDNA 1M71A 4JCLA 3RVTC 1GCYA 1RMFH 3S5LA 1HL4A 1I7UB 1WGOA 3FCBA 4XC3H 2CHWA 4HUKB 1ZSDB 3BWUF 3ZKMD 4OGYL 1BZ7A 4I3SH 3OR7B 4HH8A 4JANB 1IKOP 4BZ2H 1YCSA 5IIEB 4HGMA 1TTFA 3KH4A 3E8VA 5D8JH 2AKRA 1VRSA 2A2QT 5IB5A 3A6BL 3BZFA 1TTUA 1B4RA 1SFDA 4Q14A 1ND0A 4LSPH 2FSEB 4HWZB 1FCGA 4BKSC 4UZSA 2QADB 2WANA 4XT1C 4PV1C 1PSKH 2FJHA 4JHBA 4Z7UE 2VLKE 3AXIA 4LBEB 2VMEA 5HJDA 3ZO9A 1QABA 1AC6A 4PJIE 2WXRA 4BHUA 1TCRB 5ADPH 2OTPA 1GL4B 1NLBL 1E4XL 4WUUD 5D1XE 1MF2L 3ZOAA 3HLKA 2CH8A 1HAWA 4I2XA 5MERA 2VH5H 2WMPA 1XBRA 3QDJA 3KCPB 4JFFB 3A5VA 4OKVB 4P2OC 4PB0H 4S1DD 2NZ9C 5BV7C 4QXGH 4KKNA 4HUVA 2J6EL 1U92A 5TD4A 3EFFB 1E7UA 4U3CA 1BVLB 1YQ2A 1BGXH 3CN1A 4U6TA 4D9LL 3OSVA 3QP3A 3UAEA 1I8LA 2ED6A 3Q44A 3NZ8B 5EZJA 1IIIA 1FL3B 4B5ZA 3WS3A 3Q5YA 1EXUB 4N0UA 1NCAH 4MXVE 1F4AA 1X5ZA 2GG1A 3BT0A 4J27A 4P05A 5HDOA 5E2VL 2WKGA 2EDDA 4PJHE 2JCCE 5TK4A 3AS3A 2YO3A 3DV6B 4IMLB 4MBOA 2OZ4H 1QQDA 3ZTJG 1F58H 4EDXA 3HI1A 3DLQR 2IBZX 1IGTA 4PJ7E 1Z3GH 4QGTA 4A7QA 3QZWG 1HEZA 3H7BB 4JDZA 3IXTA 5KEZA 5HDQL 2CBQA 1FJ1A 4OLZH 4BZ1H 1OK0A 1IGIH 2BY3A 2CGYA 1CGYA 3FQRB 5GS2D 1S5IH 2XPZA 3U0WH 1RJYA 1GY2A 4BDVA 5EZPA 3K6OA 3FQNB 5I5MA 4Z78A 2YLKA 5GGSB 1INQB 5ISZE 3QG7L 1PZ3A 3ULUL 5FYLE 1A0QL 1JPSH 2XU9A 4Q0XH 2J6WA 1RIHH 5F8QC 2DQTL 2VQ4A 4O9HL 3QORD 2NXZC 4X9FA 3CAFA 5E9AA 4EZKA 1BV8A 2YA0A 2IJ0C 1DBKH 5TQ2H 1YEGH 3ZL2A 4ADJA 1G9NH 2BNUB 2NYKA 5CCJA 1H3UA 3B3IB 1QR1A 4HOWA 3OKNA 1TVBA 1COBA 2KYIA 4PBVC 3FUFA 1YYLH 4G8IA 4MQ7B 4FNRA 5ANHA 4GQ9L 2MQGA 3QJZA 1G7IB 3CFIC 2FATH 4RCAA 5D4JA 2Y2TA 4PJEF 5JW5A 3QAZC 4J7RA 1RZJC 2B20A 3GZOA 5IHUH 3KGTA 4AJYV 4XBMA 3FU6A 4X80L 1WBYB 4JFUA 4POUB 2PTTB 1DJXA 1DN0A 3SY0A 5EOQH 1JUFA 4FXKA 4XNAA 3G6JA 2WIIA 4PJBE 1AS6A 2XKUA 2PCPB 4JDEB 1JL8A 3MLUH 3GKWL 4Z8FL 4K15A 4MJHA 2FSDA 5EFIB 1KPVA 2GJZB 1LEGB 4FHJA 2LQRA 4I3RH 2CA3A 5ACZB 1EZVX 3CPLA 3TJHD 4G7YL 3G3LA 1MVUA 4LASL 3DRTB 3MOBL 4JRXA 5D2LA 5BV7L 1YPZA 3PIQA 2D2CC 3IMSA 5HHNA 3N9GL 3TH3T 1RP8A 4R4FH 2PKDA 3FMGH 3IS1X 2CUAA 3O6FD 3SIKA 4B3VA 3EBIA 1G7MA 1Z5LA 3GZKA 3ZYOA 1A7NH 2ZPKH 3QQXA 3CQQA 2BOBA 3QEQE 4GFTB 3STZB 3QQ4A 3T0VA 5JDJA 2APSA 5D1ZI 3WNNA 4ISVA 4NAQA 4Y4HD 3QS2A 3WMPA 4OF7A 3V9EA 2CUHA 2X4UA 2YUVA 4LLUA 4F3FB 5KAQF 1TJXA 3GLAA 3G5XA 4KFMA 3CXHK 4OD2B 3L4CA 3QWRD 1M2VB 4L4VB 3KDMB 2VRQA 1KTLB 1N5AB 1JMXA 1USZA 1RUPL 1IJNA 1WE5A 4J4PC 3CN4A 3ZE2E 5J4MA 1XDTT 2GFBA 3EZ8A 1NDMA 2BDNH 3PU7A 1F4YL 5IOKA 4TSBH 4MNQD 5KN5B 1KT2B 3L5IA 4AW4A 1QUPA 1W72H 1WHOA 2BFGA 1IGJA 5L2KA 4ONFL 4YLQT 5CBAA 3NYKA 3EDJA 2FYYB 5GRUL 1NEUA 3N55A 3L3OA 4FFZL 4GXVH 2AXHA 4NDMA 4OB5H 3UTSA 3R1GL 3TBVA 3TWYA 5CU9A 4V33A 2X7LB 1LQSR 2OMZA 4XB7A 5F6HJ 4P9MH 4JDVA 4XO5A 5DFAA 4OZFB 3HNTH 1FGNH 1L9MA 1O9WA 4PWKA 1E9PB 1AHWA 4WU7B 3IDMA 2GKIA 5AVSB 1MSPA 5HHQA 2OP4L 3N44F 5DQ9B 3BFOA 5LXGL 3W37A 1SJHA 4PCTA 4TSCH 1JBJA 1A3RH 1N7ML 4UZUA 4HDIB 3H56A 4PLKD 3TTSA 5JIQA 5MI0C 3RKDD 2MIZA 4XVJH 3WFZA 2EEDA 3LXAA 4D7BA 2QADC 3MKGA 5GS2H 3UFIA 5FGCB 2ODHA 3FFOA 5D1QD 5BRZE 5KVEH 2FT6A 3GBNH 1NFIB 1Q9KB 1RPKA 3DC0A 3OR6B 3PFUA 5GRYA 3C6LB 5E94A 1YEEH 3K0WA 1IM9D 1T5WA 2WLYA 4QNPF 4X98A 5FWRA 4XXWC 2IVFC 3PV6B 3ECUA 3U4EB 4K94C 2QQLH 4MAYA 2WWMD 4NKMB 2FUQA 1QBLL 3GO1L 2SODB 2L04A 1TMQA 4ONHA 4CC0A 1CGWA 1UWFA 1DE4B 3ZHKA 5IKCA 2DEYX 3IDXH 3NCEB 5CF3A 2YRPA 4RMRA 3BDBA 1ES0B 4YSUA 3GEWB 3KYOA 1JYVA 3VFVA 2Y5EA 1GGBL 1XGUB 1MI5B 1UWEL 1E65A 1S4IA 5D93B 1A2YB 3IYLW 3UG4A 1HYSC 1BXVA 1AYRA 3N6YA 2BJML 2BSBA 3QDMA 4L1BA 4HPYH 4WI4A 4AYMC 4MNGE 4R26L 4EPSA 3NVQA 3FO1A 2BIOA 2YUZA 4MD4B 1ACZA 3MJ7A 3QFJE 1LK3L 3MZTA 4AG4L 5FECA 2XA3A 1KDIA 3T0WA 3BRFA 4X7SH 4D0DB 2EIBA 3SQBB 3J07A 1NJ9B 5B7FA 5JNYA 3UDWA 3HG0A 4ACTA 5MEOB 2WNWA 1HNGA 4XNXL 2Y2YA 1WT5C 1HL8A 3MRNA 3GXPA 2IGTA 2DEXX 4Z7QE 2Y5TA 4WI7A 1FYTB 3HRZA 1K8DB 4Q9RL 4AQ8A 3CXFA 2VN4A 2CDGB 1KLGB 2J6EA 4U1LA 5D5MF 2X40A 4QHMB 1MQ8A 4JKNA 2BNRB 4NPKA 1P6FA 4HU2A 1MH5B 2Y06H 5HYQB 4N9OB 3UROR 3CFUA 3ZZQA 1SRDA 2VDOB 2DWEA 4MJIB 3F7VA 4XGZB 1C12B 3NZHL 3GMOA 3IDIA 4P46A 5EC1B 1HCVA 3HZKA 4JJOA 4NM4L 5F7KC 2A9DA 2ED9A 3RHWK 5DMYA 4JO2L 2VRKA 1IAMA 5DD0H 5TK2A 2TAAA 4XX1G 5D7HA 5L4IA 1EAOA 2DWDA 1J18A 3U6RA 5C0BD 5CMAA 2DD8H 2JELH 1H15A 3HS9A 2LU4A 2MNWA 4J8RB 5T1DL 2XI9A 4JGUA 1K3IA 1Q9OB 2L4OA 1YNTF 1DN2A 2AK1H 1KACB 5EULV 3H3KA 1E5AA 5E6SB 5JMOC 5JLZB 1OCCB 2CLZB 1PZ5B 3LSOA 1DQMH 3LZOA 3TA3A 2UWEF 4L9LB 5A16A 1BM3H 1DFBL 4MSWB 1HI6B 3TT1H 2ZQKA 4X4MA 3MBXL 2F53D 1FI8C 1OSYA 1VACA 5IMMB 4OF6A 2X10A 3H9SE 4R7NA 5HDLA 1DBJL 4F9PC 1NOFA 3FTGA 4AEFA 4NZJA 4EJ1C 4Y88A 3DHJA 2P5ED 3EYFA 1KBPA 2AQNA 3RWDA 1KGCD 3C2AH 1DVSA 3DHPA 4GO6B 1PEWA 3U2JA 1JTPA 1UOLA 4YBQD 4G7RB 5E6UB 1N68A 1T1WB 5C0NC 1AXTH 1MCOL 5CJBA 4HOMA 4WLCA 3CD4A 2Y7NA 2BVOA 3L2LA 3L3KB 3EYSL 3P0YH 4KQ0A 3WAKA 3WNLA 2UXVA 3LIZH 1NEZB 1XTMA 4UV4H 2VLME 5CWSA 3O41B 4DGYL 2IALA 1M1SA 5A3ID 2AJ3B 4NUQA 4RQQB 4E9WA 5L8LB 1JJUA 2CMRH 3UG5A 5DSCB 3VFWA 2IAND 3CHQA 4NO0A 2YQ2A 3HI5H 2Q6WB 4B50A 2XXCB 3IXAB 3HNSL 3PL6D 3CC5A 3QHTC 1ONQB 4HF5L 4FS0A 4Q58C 3TBBA 4JDTH 4ADGA 1Y07A 4I9WE 5E6YA 4KKZA 1J05B 1NFDB 2IWFA 3QNXA 2COQA 4JO1H 4Y5VB 5J7CC 1KY6A 3NCJL 1A6UL 1U8IB 2HTKC 1TJGH 2FT7A 4HETA 4M29A 4NAJA 4TSAH 4EIGB 4KVPA 2OXHB 2ZYSA 4TV3A 4BBWA 2G3NA 2OULB 2P5PA 4YX2L 1U93B 5DLLA 2H26A 3B6SB 1D7DA 2ZSVB 1DSYA 4DO5A 4L2YA 2PXYD 1QBMH 3CX2A 4PRPB 4KZEH 1OTUC 4LMQI 4A6YH 4H8WH 2AEPH 2P1YA 3C6LC 5J1AA 1E3XA 2MEJB 3GSXA 4QO1B 5E6IA 5IGXH 1BBDL 4JB9H 1OSZA 4FFZA 3LKPB 1T5XB 3MROB 5J12B 3US1A 1WA2X 3MLVH 3BUBA 3VVVA 5C0RH 3IRCA 4F1SA 3DMMA 1CFNB 1IBGH 2EDRA 5E03A 1J1XH 5IJVB 4I2XE 1Q94B 3QDJE 3BQUA 4U2ZA 3S4SA 2X38A 3WIAA 3LQAC 2XICA 3QIUD 4RLDA 1FVEB 1NCNA 4G8GB 1KB9J 2M83A 5DJ6A 4Y4KC 1MRCL 3ZE0B 3GHBL 5GHWL 4HH9A 4NRZB 1J1OL 3C6EA 3BKCH 4O2CA 4XHQA 1H8SA 4YS4A 4XWOD 1OPGL 5JA8B 1BZ9A 3FYIB 4N0UE 5KTEH 3W9DA 1OWRM 4CSPA 2E75C 1KPRB 1U8CB 1XO8A 5D5MA 4JO8A 4CNIB 5JXEC 2X3BA 3PHQA 1GZHC 4OIFA 3NK3A 4CSSA 2OMXB 4FCAA 3HKFA 4MQXC 1NMBH 1I3RA 1CBVH 1EDHA 1YG9A 1UH4A 4YUEH 4GO9A 3GBLA 5F9JA 4HWEH 3CWGA 1WAPA 3T5WA 3HTLX 1OW0C 3FZUD 5J5EA 1QSVA 3MODH 1ZHNA 5I9QC 1G9MH 4OI7A 2KZ1B 5JORB 3RURA 1CC3A 2AF2A 4AKOA 4LAQH 3TVMD 2OCCB 1BQ5A 1UWXH 1OGSA 1VESA 4U6VH 3QFDB 5IQOA 3QUMH 3T1WA 1DBBL 5IQMA 2AJXL 3OKMB 5ENWB 2VB5A 3AJ7A 4X8JA 4KTEL 5AAMC 3KLAA 4KK9D 1LE5A 2ARJQ 2YWYA 5B7EA 5B3NA 4XI5D 2JJVA 4MXQC 5FHAL 5T33L 4HPHA 1OD7A 2O30A 3T4YA 4J6RH 3D8MA 2X6MA 3FT2B 4PLJC 2UWEA 2NSXA 2WVVB 4KFZC 5IB4A 5BUGA 1N0LB 5IFHL 4QRPD 1JWUA 3U4BL 4B7LA 4CVZA 1QVOA 4J4PA 1ZEAL 3O2WH 4FQXD 5EBLA 1GW0A 4DQOL 2R1XB 4L9LC 3U2SA 2FR4A 2B2XH 1XGTB 4JR9H 5DK2B 4NQSB 1B0RB 2ZUYA 2IH3A 3MRMB 4K3JL 3G6JE 3D4ZA 2UXFA 2KZBA 4OBSA 1OAJA 4ORZC 1HHKB 2YPKB 4PG2A 5H4ZA 4M56A 4OGXL 1IBFA 1X7SA 4LSUL 1PGRB 5DJZB 4TMPA 1I7UA 1F1GA 1ZSDA 2XXFA 4CMMB 5FOBB 4U7MA 2KKQA 3A21A 4MAZA 4WWPA 3OR7A 4JANA 5IIEA 3T3MF 5DHYB 3T4AA 5I82A 4U1IB 2WN2A 4JRXE 5D2LE 1OQXA 3FUMA 1YPZE 4YQXL 3LEVH 1PS3A 2XVLA 1ROCA 3F84A 5L2JA 3KG5A 3QQDA 4GKZB 4L1TA 2EC8A 5C7XH 1MY5A 1U8KB 3IFLL 1T83C 3UBXA 1U36A 3FUJA 3BKYH 2R0LH 5GPRA 2IFFH 5HDBF 1A4CA 4LEXL 1JNNL 2HFFB 3T2NL 2XPYA 3HPLA 4FA8A 5F93C 1DVFD 1S7VB 1TCRA 4FKHA 4QY8B 3BUYB 4OZ4B 1NEZG 2YGOA 5I2IB 5DFTA 1LGVA 3A22A 3KCPA 4C56D 1P9MC 4KQ4H 4OKVA 2GJ6B 3GLZA 2NSQA 4XAWH 3EFFA 4Z0BL 5EPMB 4KK5D 5JHDD 2NYYD 4X5XA 3QO0B 3TURA 2A1WH 5C70A 1BF2A 3M17A 3UTOA 1EHLL 4KTGA 1F3RB 2IV9A 2XT1B 1J8SA 1DJHA 1FPTH 1ZVNA 2EDXA 3VXOB 2EUVA 4Y5VC 3C60A 2ZWSA 1VERA 3MGOA 1EBAA 4IMLA 1PKQA 3DV6A 3KM2A 3VG0H 1RIVL 5L2KE 2V5TA 1CFMA 4ZS6D 4GAAA 4UT7H 3IJSB 3LH2H 4ZS7L 1G9EA 3H7BA 4LLAA 5GSVB 3OQ3B 4Q6KA 2HP4A 1D6VH 2C9AA 2QMKA 3B2VL 3WMQA 3FQRA 2R1WB 1EJFA 4PR5B 4LEOB 2WLJA 3LZNA 2YJQA 3FQNA 1T6VN 2WWKO 3QJFB 3FHAA 4DFHA 1KBBA 1T2QL 5CN2A 1KCUH 1INQA 1FH2A 2Y7OA 3WFCH 3MQIA 2FYVA 2YQGA 1KC5L 1HSBA 4KTDH 1WAAF 1VLXA 3MYZA 1N5YH 1QSEB 1TTRA 2AZAA 2QLVB 3MLZL 4X50A 4DN4L 5J12C 1AGFB 1CI3M 2YWZA 4G7VL 4P2YA 4TUOB 1OSPL 5D4HA 3TPUB 3MLTB 32C2B 5D1ZB 1S3KL 2BNUA 4LSVH 4M1GL 4FQ1H 1RPQA 2ZYIA 3IAPA 4MLSA 4HG4J 1TVHA 2YPLA 3GMNB 4ANKA 5KSAD 4Q9QH 3UTTB 1KGYE 3B3IA 1UYWL 4OSUL 4Y2DC 2BHZA 2K3TA 4MQ7A 3QXUA 3MXWL 3VFOB 1A7RL 1AKJD 3IRZA 3RDTB 4HGWB 1G7IA 2WHVA 1ID5I 4HBQA 4B9ZA 4Z3JA 3U9UB 3AABA 4ODHL 1EO7A 5F7NC 3D69B 4YHIB 5C09D 4MLIA 1AJ7L 1GR7A 2NXYB 4AJVA 3UX9B 3OBAA 2NTFA 4MDRA 1U33A 2IH1B 2IGLA 1WBYA 3AWEA 5IBTH 3TWCL 3ZHDA 4LRNL 2PTTA 4HBCL 4RZKA 3U7YL 2VWEE 3VG9B 5D9SB 3ZT7A 4FC3E 3FT4B 4N2AA 3II3A 3L2NA 2YN3A 5CZXD 3SO5A 3OLIA 3QDME 1YRKA 2PCPA 1O9ZA 4JDEA 4N8CL 4R2GB 5J8OA 3AREB 2ATKB 4J6IA 1TQWA 3AWFA 2GJZA 5EFIA 4NP4H 5KANI 1S6NA 3EO1A 2EADA 3IMWA 2DWSA 3GM8A 4FI6A 4AEIL 5ACZA 4J3OD 3QHZL 3ETBJ 4OLWL 5GJSL 1AS7A 3IJ8A 5TQ0L 4YH6A 4OZGB 1NICA 4MTMA 1DO5A 1EO8L 1MDTA 5I8KL 5E95B 4TM9A 4XMPL 3DUUA 3M07A 3TNMB 3PY9A 4F9PA 4MKMA 4K9EH 5I16B 1J0IA 1ZT7A 4X9HA 1BD2B 2KS0A 1E6OH 1CICB 1G6RB 2O1AA 4EZLA 2BPBA 1WS8A 2Y24A 2I5YH 2YFNA 3VGBA 3UJIL 5CZVL 5E4EB 3RWJB 15C8L 2WJ7A 1V10A 5HVHB 1IAOB 1XZ0B 1A47A 3DX0A 1JZ5A 1XAUA 2WBJD 4OD2A 5KVGH 4BUQA 1I1CA 1M2VA 4C4KT 2IOMA 3Q8AA 1KTLA 1N5AA 3MRBB 4RMUA 4H0HB 3TV8A 4OLVH 4P23D 3GJFB 3ZQWA 4DUVA 3U4KA 5KN5A 4DEWA 3MRDB 3OL2A 3D18B 3PJNA 3VA6A 1JXDA 1TNMA 1MREL 3SKNB 2B8OT 2C9QA 1P84K 4HULB 1I85C 2G2RA 3FSVA 4YDKH 1OSEA 2H1XA 1T7WA 3OGCB 2R69L 1C08B 2X7LA 1TTCA 3EYVB 3G6DH 3MOAH 5DS8B 4OZFA 2A83B 1FIEA 4MWFB 5DQ9A 4YDLB 1CWVA 2IO5A 4B7IA 1VZIA 2DBLH 1R19A 2A77L 2FWSA 1NFDF 2VR6A 4NJ9L 4YHZL 4HDIA 2DLIA 4LU5H 3ULVL 5D71H 4S1QL 2OYLA 3OVUB 3SGDI 2AXGB 2UUDK 4EI0A 2JLPA 2PMZA 2CRMA 3KYNB 2PYFA 2Z8WC 4RMWA 4LSTL 3OR6A 3IN0A 1Q9KA 1L7IH 3DVNB 4RBPH 1DYZA 4CGTA 5HGGS 3C6LA 4OM1L 4ZUUB 4FAAB 3RIAF 4TUJB 1CMOA 3B7YA 4PS7A 5KVFE 2ZXQA 3NTCL 1LP9A 3P3SA 3ALXA 3PV6A 3U4EA 3P9LB 2CLVB 1UA6L 1INDL 2ZUUA 1V3MA 3KH3A 4NKMA 1UZ6E 1OE1A 3HG2A 3IJYB 3QHFH 4GEIA 4HJUA 3DX4A 3JV4A 5C6PB 3FT0A 1DE4A 1DL7H 3NJFA 1GA2A 3VGAB 3ILEA 2X6VA 3GUTB 3UAJD 1ES0A 1E6JH 1F6AB 1DQLH 3SOBH 1U41A 3I6KB 5AL0A 1MI5A 4AVKA 4GAGL 4PTUB 3LPOA 3MUUA 1A2YA 4D0CB 1UASA 2CDFB 3KWVA 3TH4T 1UWGH 2L3BA 2E7DA 5BOZG 3LRHA 1OLLA 4MD4A 4MMYB 2CJUH 1KXVA 2OV0A 4M7LH 4PD4K 2J72A 3ZDXB 1N4XL 1TETL 3SQBA 1NJ9A 4H4NA 1R47A 3KBFA 5MEOA 2JIXB 5JXEA 1GZHA 4OLUH 2WLZA 5EA0L 2F8XC 4FCHA 3L1OL 2W92A 1RURH 4MJ2A 2EC9T 3FPXA 4JCWA 3LEYL 1FYTA 1HESA 1K8DA 4F5CA 1AGCB 1ZA3B 1JF1B 5GRWA 3N3EA 1INEH 2FBOJ 4FTVB 1OW0A 3KHQA 3VNZA 2BNRA 4G6JH 4EEEA 4QNPE 5LJYH 3LQZB 1D2OA 2DQFB 3QXVA 1G6VK 2YQBA 1CDUA 4UOW0 1MWAB 5D1ZC 5HJ3B 1MH5A 4NNPL 5HYQA 4L0YA 3LZLA 3NZSA 3ULAB 1FG2B 1U6AL 3MLWH 3B4NA 5GRZA 2W59A 2HG5B 4MJIA 4XGZA 1C12A 4NZFA 3O2VL 1CDGA 4L37B 4CBPA 1FYHB 5EC1A 2J88L 4AV0A 3MV7B 3RDTC 1M4KA 2CBOA 1T3FB 5I6XB 4YVUA 1JI2A 2APXA 4K7FB 3B9KA 2NXYC 3Q8BA 4UU9B 1XSOA 5DZOA 1CURA 2AMGA 2DJSA 1SYVB 1AYOA 3BZEB 3Q8FA 2EZ0D 3HCVB 2XWTA 3VG9C 1KCKA 1QMUA 1E27B 4J8RA 5AG9A 1Q9OA 4CVWA 2FB4L 4XVUC 4FZ8L 1AG0A 1FZOB 4AVIA 4NT6B 4R2GC 4GQRA 1LYQA 1U95B 3AREC 3KJ6L 4JL1A 4L0ZA 2CLZA 2R51A 5MP6L 4HKXB 5LG6A 4LCCA 3CFEA 1KGJA 2YS4A 3DSNB 3EDEA 4UTBL 4E9LA 5JOPE 3D7PA 3LPWA 2AJYL 4L9LA 1EA9C 4GINA 5D5ME 4MSWA 1HI6A 4U1NB 1LD9A 1N59B 2Q86A 3B7RL 3Q6GH 3VDAA 1CLZH 2F7RA 2X0UA 5IMMA 3QDAA 4LPTA 1J8KA 1QASA 1YEDB 4XXCC 5D7KD 5DVPA 4Z7IA 4GSXA 2ZJSH 5LCVH 3CFDB 1KCRL 1KCVH 1CICC 1JRHL 3H2QA 3IGFA 1N0XL 3FH5A 4DPBX 1WP6A 2YAEA 3NCYP 4YL4A 1E8WA 1SVCP 3GK8L 5E4EC 3X3GL 1E4KC 3FN3A 1R3IH 4Z7NB 2FH6A 1J8HD 5HVHC 3MNVB 2Q10A 1A7PL 4NEHB 4N90E 2JKXA 1T1WA 4HIPA 4AEHH 2XQYK 2CLRB 3T3PB 1Z9MA 4PU2A 1T83A 3HN5A 3L3KA 3TYFA 4QCIA 5HI3D 5F7LB 1EANA 3DIDA 3E9TA 3B8YA 2X88A 1CXIA 1NEZA 1EHXA 2AJ3A 2HPOA 3SDYL 5F7HA 2GBUA 5DSCA 4APQB 4I1RA 5AWNH 3INUH 5INCB 2UWEE 4WFED 1FHNA 3IXAA 2R8SL 4P0DA 1YEWA 5D7JB 2APWA 1ONQA 4Q6IB 1LO3H 2X4OA 4MYPA 1F4XH 1ZK5A 2ENQA 1ZXKA 2FIKB 2A38A 1OQOA 3D30A 1AAJA 1NFDA 3S36L 4EOWH 4YO0B 4G9FD 4Y5VA 5C0AD 1AGBB 2CO4A 4P5TB 4YDLC 3O3DB 4N8VG 1U8IA 3KPSB 1F5WA 1Q1JH 3FU9A 4NHCH 4DVRL 4XMKH 2OXHA 4H20L 5TPWL 5JTWA 4JFED 3HE6B 3TJPA 3MJ6A 3LNIA 1MIML 2PABA 4F8PA 2QPEB 3RGVD 2MQ0A 3B6SA 3GYRA 2ZSVA 1BJ8A 1GMIA 3C87A 4GSDL 1KBGL 4FF9A 1X5YA 3AS2A 4XBEL 4WIQA 3LNFA 4BSWB 4JPQA 2M8XA 2QQQA 4DKDC 5AL8A 1CVRA 3D2TA 4IKJA 4AZ8B 1KN2H 3UZEC 4KNSA 2LFGA 3BH9B 4QO1A 3BGAA 5T3ZL 5F2FA 1AQDB 1AZBA 4PJXB 5IESL 1N64L 1OP5H 1JHKL 3N1MC 5B1JC 4OJAA 1T5XA 3MROA 4TQEH 3KYMB 3QQ9D 5I26A 1XXDC 3VGAC 4YEEA 3HHMA 2X2YA 1CFNA 35C8H 1PFOA 3CVHH 4YSTA 5I8CB 4TTDD <