4A2FA

Coriolopsis gallica laccase collected at 12.65 kev
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
496
structure length
495
Chain Sequence
b'AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPNDPHASLYDVDDDSTVITLADWYHLAAKVGAPVPTADATLINGLGRSAATLAADLAVITVTKGKRYRFRLVSLSCDPNYTFSIDGHSLTVIEADSVNLKPHTVDSLQIFAAQRYSFVLNADQDVDNYWIRALPNSGTQNFAGGTNSAILRYGAAPVEPTTSQTPSTNPLVESALTTLKGTAAPGSPTPGGVDLALNMAFGFAGGNFTINGASFTPPTVPVLLQILSGAQSAADLLPAGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHVFAVVRSAGSSTYNYANPVYRDVVSTGAPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPDVAATNPVPQAWSDLCPTYDALSPDDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE
publication title Structural Changes Caused by Radiation-Induced Reduction and Radiolysis: The Effect of X-Ray Absorbed Dose in a Fungal Multicopper Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 137
structure length 495
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA03
2N0MA 3SBPA 4E9WA 1OE2A 1NPJA 1R1CA 1RKRA 3FSZA 2TSAA 3HEIB 4NAJA 1FA4A 2J5WA 5PAZA 3IE9A 4YSPA 4ENZA 7PCYA 1BQKA 2IWKA 3X1EA 2HX7A 2NRDA 3DTUB 3CZUB 2IWEA 4A2FA 3QJRB 4JHUA 4TXVB 2CBPA 4YSUA 1BAWA 3CVBA 1ZIAA 1ID2A 1OCCB 3S3CB 1AZBA 4HCIA 3D12B 2EIMB 2UX6A 1NIFA 4W9ZA 2ZXWB 4BDVB 2QPDB 4E9VA 4DP9X 4CSPA 4CSZA 4GP4B 2IH8A 3EH3B 1MG3C 3NT0A 2P80D 2PPDA 1CYWA 3X1BA 1W6LA 3C75A 2IWFA 4A68A 1J9QA 3FYEB 3WNIA 3JTBA 4GP5B 5D4HA 1A8ZA 1JXDA 4E9RA 2XXFA 1SFDA 2XV0A 1IKOP 1IUZA 2MRYA 2YAMA 4YSDA 2PCFA 3EH4B 2PP7A 1CYXA 4DP2X 2IDSA 2VW7A 4KO7A 1ZPUA 4YSTA 3CDZB 1J5CA 1NPNA 1PZCA 1JERA 2BZ7A 3CDZA 2LLNA 1XB6A 4PAZA 5I5IA 2ZONA 2FNWA 4E9XA 2FTAA 2OV0A 1AG0A 3ERXA 3AG1B 1KCWA 3T6VA 1GYCA 2BW5A 2GBAA 3FSWA 3ABKB 3ZBMA 7PAZA 3OMNB 6PCYA 1PLCA 3X2QB 5I28A 5I6MA 2HLEB 2UXGA 3FQ2A 2YAFA 4GXFA 3NJJA 4DP5X 1AIZA 1ILUA 2JKWA 3ZIYA 4F2FA 4GY4A 1TU2A 1WA1X 2HRHA 5I6PA 3PXLA 5B3SB 4HCFA 5B1BB 3WIAA 2J56A 2I85A 5E9NA 4E9SA 1BYOA 1SNRA 3V9CA 5I6NA 4RH4A 1WA2X 3DIVA 1DZ0A 4QKTA 1L9TA 4DP6X 2QT6A 3NJKA 4G7SB 3H56A 1PNDA 4KNUA 4AZUA 2FWLB 1NDTA 2YQBA 4E9TA 2P80A 1JZFA 1CUOA 3T9WA 1SDDA 1XB3A 3NSFA 1PMYA 2EIJB 3CVDA 4QLWA 4KOBA 1KDJA 4BWUA 2FJSA 5ANHA 2QDVA 2FT7A 2DV6A 4YSSA 4DPAX 2VW4A 3PAVA 4ZK8A 2Q5BA 1JXFA 2PP9A 3FSAA 1ET5A 1QNIA 1ADWA 2CALA 3HB3B 5B7EA 3U25A 2FQEA 5F7BA 4JKNA 1HAUA 2XLLA 1TKWA 1J9TA 1WS8A 1L9PA 3QJQB 3OM3B 4E9YA 3UADA 1AACA 3T71A 3AZUA 2X88A 3OQRA 5IY5B 1M56B 4AX3A 1KBVA 1OF0A 5I6KA 4DP7X 3S8FB 5A7EA 4F2EA 5B1JC 4YSQA 2BWIA 4KNTA 1NICA 4YSOA 3RYMA 1L9QA 2BZCA 2UXVA 3WKQA 3H4FA 2QPEB 3PAUA 1ZDSA 4HIPA 4A2HA 1KBWA 2QDWA 3OD3A 4DPBX 1OE1A 1JZEA 1MZZA 1BQRA 3NP4A 1GS8A 3S3DB 3ABLB 1GR7A 3SBRA 2JFCA 3X1GA 4N8UA 5I6OA 1JOIA 4HHGA 3L45A 3T6ZA 3FPYA 4NERA 2R7EA 1AS8A 2BWDA 4W1TA 3FQYA 2PP8A 4YSCA 4YSRA 3FYIB 1ASOA 1TEFA 2IAAC 2OCCB 1J9SA 3TA4D 1E5ZA 2VMJA 1QHQA 4DP4X 1BEXA 1BYPA 1SF5A 2DWSA 1L9SA 1SHWA 1GS6X 2IDUA 2PPAA 2IDFA 4YVNA 4Q8BA 2CJ3A 4E9QA 2AFNA 3NSYA 4PCYA 3NJNA 1RZPA 2FQFA 2PLTA 5B1KA 3NSCA 3CVCA 1CC3A 1EZLA 3WG7B 1PZAA 3OMAB 2BW4A 3ABMB 3IEAA 3UAAA 3NJLA 4AKPA 2RACA 3BQVA 2GC7C 1NTDA 3SBQA 3TU6A 1N68A 4YL4A 4NB7A 1KGYE 2YAHA 3FU8A 3EF4A 5I5MA 3ZDWA 2B08A 1MDAA 3ASNB 4DP1X 3FU7A 2EILB 2YAEA 2PPFA 3UACA 1NWOA 3QJUB 2BO0A 1AZUA 5B1JA 1ZIBA 1JZIA 3G5WA 4DP0X 3JT2A 3T6XA 1ZDQA 1MG2C 1AS6A 1KCBA 1OV8A 2W8CA 1AS7A 3AG4B 3QJSB 3NJHA 1ASPA 2VN3A 3FQ1A 2HX9A 3N2JA 4KNSA 4YVUA 3FPXA 4AKQA 4L0PB 3MX0B 1SDDB 8PAZA 2DY2A 2HX8A 3GXUB 5D4JA 4P5SA 3TASA 1BQ5A 1AG6A 3PPSA 2VM3A 2XV2A 3S3BB 1ILSA 4DPCX 4Q89A 1L9RA 3GYRA 2DWTA 4UANA 4KO6A 1M57B 4JHVA 1V10A 2FQGA 3UABA 2GC4C 3SQRA 3ZX1A 1IBYA 5PCYA 1JVOA 3NYKA 1ASQA 4DP8X 1J9RA 3X1FA 4YSEA 2W88A 1NZRA 2VSKB 3PAZA 2YAPA 1TEGA 1FFTB 1KV7A 2DYSB 2YAQA 1SHXA 4KO9A 1GW0A 2AANA 5AKRA 3WKPA 4A67A 2CAKA 4UF7C 2BP8B 1KYAA 4KO5A 4HAKA 4M3HA 3H4HA 4N4YB 2OJ1A 3FS9A 2BP8A 1XB8A 3AY2A 2AZUA 2BP0A 3QPKA 5B7FA 1OCZB 6PAZA 1PNCA 2XWZA 3QJTB 4BK5C 1OOWA 2UXFA 2VW6A 4P5RA 4BXSV 2XX1A 2R7EB 4G7RB 1NIAA 1JZJA 1PY0A 3EH5B 3NJMA 4K9JA 4HCGA 2BHFA 2XVBA 1E67A 3NSDA 2B3IA 2WSDA 1A3ZA 3NJGA 2FT8A 1KDIA 2H47C 9PCYA 2FT6A 2VSMB 5TK4A 3FT0A 2A3TA 1OCOB 2YARA 2FQDA 4HALA 1AANA 1GY2A 3IN0A 1AZCA 2IDTA 1PAZA 4BWTA 1JXGA 2XX0A 4M4RB 1HFUA 3NJFA 2H5UA 2E86A 1X9UA 1AZNA 1BXVA 2DYRB 2H3XC 3KW8A 3IN2A 4BDVA 1FWXA 1URIA 1RZQA 2XV3A 3QQXA 1RCYA 2XU9A 1M9WA 1ZV2A 1BXAA 2EIKB 5AZUA 1EHKB 4HHWA 5D4IA 2GSMB 4AI7A 4KOCA 4BXVA 4GP8B 1SJMA 2HXAA 2IH9A 3OMIB 3FU7B 2XXGA 2GB2A 4FA7B 3T6WA 1GS7A 1NINA 1NIBA 4G71B 3PCYA 3PLYA 4A2GA 4YSAA 1XMEB 1SF3A 2HZHA 1GSKA 1DYZA 1WA0X 4EF3A 1ET7A 2ZWNA 1JVLA 1OE3A 1PCSA 3ABGA 3QJVB 2PCYA 3ASOB 3FU9A 5I26A 4WKXA 1AOZA 3AG2B 4G72B 5TK2A 5FC9A 1A65A 3UGEA 2PPCA 2Q9OA 4AKOA 4GYBA 4A2EA 2X87A 1NWPA 2YXWA 1JZHA 3X1NA 1IC0A 1V55B 1JZGA 2Y1AA 1MZYA 1WAEA 2XYBA 5I6LA 3KW7A 3EHBB 1CURA 2YXVA 3TBBA 2AVFA 1BXUA 1I53A 1L9OA 1V54B 2XUWA 1J5DA 3GDCA 3MBWB 4G7QB 3FSVA 3IBOA 2J55A 1VLXA 3WI9A 2WO3B 1PLAA 1QLEB 4MFHA 2UXTA 1E30A 4FAAB 3DKHA 1PZBA 5LDUA 4WTQA 2CUAA 1AQ8A 5B1AB 1NIDA 1PLBA 2J57A 5EHFA 2JXMA 2MTAA 3UAEA 2YAOA 1ET8A 3S8GB 5I5JA 1E5YA 4BWWA 4A66A 2AZAA 2CCWA 1WS7A 2Y69B 1YLBB 2I7OA 1X9RA 1PF3A 4A2DA 2IDQA 3AG3B 3V9EA 2TSBA 5B7MA 1W8EA 1UATA 1F56A 2EINB 3WNJA 1AR1B 2GI0A 2VM4A 1IBZA 1ETJA 1T5KA 5F7AA 1W6WA 3BVDB 3CG8A 4G70B 5AFAA 3TBCA 1N70A 3AW5A 4HZ1A 3N55A 2BP0B 2GIMA 1SFHA 4X4KA 2ZOOA 2WO2B 2GHZA 4UAHA 1HAWA 2HRGA 1AAJA 4F7KA 3NP3A 2UX7A 1GY1A 2I7SA 3NJIA 1A4CA 1AZRA 1A4BA 1A4AA 1OCRB 1E65A 1NIEA 2PPEA 1B3IA
chains in the Genus database with same CATH superfamily
4FJ6A 1R5VA 4PLJC 4X7DC 4PBXA 4HP5A 2HFFA 1RJZB 1RKRA 2B9AA 2J5WA 2A9NH 2FH8A 3BZ5A 3V4VL 4XPBL 4XPGL 3O3AA 3MV7A 5C9JA 1AP2A 4A2FA 2NY3B 4JPSA 4UQBA 4KH9A 3ZE0E 5HYQA 1K4DB 1TTFA 5JQHC 4V11A 5G55A 1IGTB 5LHDA 4KKLC 4OGAD 3RVVD 1XH3A 4HCIA 4J3VA 2G30A 1TXKA 5E03A 1G0YR 2AQ3A 3QQ4B 4R5XA 1SZNA 2VLME 3IFLL 4HWBH 3L3DA 4R2GB 2E7HA 2OMWA 2P80D 1IBHA 2QQNH 2XOTA 4OBRA 5I0VA 2DPKA 1VFMA 1JPSL 1W6LA 4JFXA 3WEMA 3KPLA 5C0CD 3FT3B 3FYEB 1A8ZA 3TOPA 1LWJA 4JVUA 4FLHA 1P1ZB 2ENYA 4LARH 4YSTA 1TZGL 5J12B 4HUWA 5FKPA 2DI8A 4QO1A 5FGCE 3D06A 2MQ0A 2XY1A 2YD4A 1SJEB 4KJPC 4GKNA 5K9JH 2NQ3A 5F9JB 3DIFB 3B56A 3M46A 3VXPB 3O81A 4XNQA 1N3NB 3J2PA 5EG6C 4PV8B 2A1WH 3SYCA 1DN2A 5HHVH 4JDZA 1HH9B 4F7MB 2E6PA 3RILA 4DEPC 3BHBA 1I3UA 1XGYL 3FBQA 5KSVB 1C7TA 3IMBA 4XE5B 3AS3A 4Y9BA 3RI5F 4ICWA 3QXTA 3SBWC 1F8TL 3CSTA 3LRSB 4XCCL 5IG7B 4WU5A 5KYUB 5H2BA 4L8BA 1I1RA 3QUYB 2FHCA 2LV4A 4N6RA 5T1DL 4E9SA 3QWOB 5DVOA 3EAKA 4EI5D 2GKIA 2FWSA 3SGKA 3RWEB 5D2LA 1RUQH 2Y24A 3NGBB 4JR9L 5CO1A 4Z9KB 1CIUA 4EDXB 3MV9B 4QJ3B 4MJ4A 2LT9A 1OGAD 2VL4A 1JZFA 1YEGH 4FQ2L 4OLXH 4WHCA 4HT1L 1XB3A 2VC2B 3LKOA 4HD9A 4O2FA 4LLVA 2X89A 2K3HA 1YEKL 3B2VH 3N1MC 4X8CA 1RZ8A 3AUVA 3V52L 1FNLA 2A9NL 1T80A 5DS1A 4BWUA 2HPOA 4G5AA 4BZ1A 2B5IB 1WEJH 1S78D 2GBVA 2EE6A 2P48B 4JQVA 4UU9B 5EZOL 3T0EC 4ZK8A 3MO1A 5DHVA 3V6OA 5D7JA 4QRQB 1EPFA 1IAMA 2NXZB 4KUZL 2PP9A 3FC8A 2X3BA 3HB3B 5E8OA 3U25A 2C1PA 2JJUA 4AYBA 1D6VL 1HAUA 2Q7NA 3S4SG 1J9TA 4I7ZC 3LIZA 3SDAA 4CVUA 4TULL 2OFQA 3B2PA 1P6WA 3FL7A 4NHUB 3P9LB 2AQ2A 3MI6A 2ICEB 4ZYKB 4JFUA 1DQLL 1Z7JA 2V9QA 3N85H 4DP7X 1LQSR 4F2EA 3B6SB 2P5EB 4UB0H 2JIXB 3ATEA 1NICA 4J6RH 3OXRA 4MNGA 1J0IA 3ETSA 2BIHA 4KTDL 4KROC 5KVEH 2AK4D 3V0VA 5J89A 1OE1A 2ADIA 2DTSA 3VXQA 1JTOA 2Z34A 3O45A 1GRWA 3DX2A 3US9A 4BZ1L 4LARL 3QXAA 5K9QG 2DLTA 4LVHB 4QHKJ 3CFBA 3SKNA 3UTQB 5I17A 3MV9E 3L3OA 4QD2E 5K9JL 1E4JA 2EO1A 3ECQA 1RLWA 3QIUC 4FADA 2A1WL 4JRYA 2XIDA 2IIJA 1ZCRA 2NW3B 1ZS8A 1J9SA 3AMKA 5EPMA 4H8WH 4PREB 3LIZL 3GBNH 3MJ7B 2XWBA 4JKKA 3L48A 4DKEL 3O3BA 3RUGB 2QQKH 3WHE0 2NYYD 4N86A 4U6XB 5T3XL 4Z3FA 4Y4KC 4QTFA 3VFSB 4KZEH 2EEFA 3COOA 1KPRA 5ETUB 1TZ8A 4KQ4H 4HEMA 1IGJA 1DVUA 3QUXC 5E1HB 4NO3B 1X9LA 2Q2LA 3AABA 3CFIC 3U6RA 2R9HC 2VWEE 2ZX9A 3T8XB 4AGNA 1C8QA 2Q76A 3TO2B 3ZMEA 1HXMB 5IMLB 2GC7C 4UT9A 5I8KL 5IB5A 3OAZK 2PYED 1J5IA 2Q8AH 3ZU8A 4YEEA 1D5IL 4XMKL 5DEFB 1YEGL 3VSUA 4X50A 4M61A 2P5EE 3AREC 3A6CH 3FTGB 5DJDB 4NI6A 3BMVA 4Z23A 2V2WA 5B38G 5AOMA 3B2VL 5FXCH 5AW7B 2PMZA 4KGLA 5F7EH 3H54A 5E9DB 3SKJH 4J3BA 4YDKH 3UMNA 2TAAA 3ZL4L 4ANKA 4V1DD 1OAKL 3X11A 3B3BA 2YD1A 1F02I 1I7ZB 1IC4H 4MNHB 3TIDB 4H2AA 2IXQB 1KBKA 3S36X 4KRPC 1JCVA 3PGDA 5DURB 1LEKA 3RWDB 1NA8A 1XBRA 1DQQA 1E8YA 2W8CA 5E1QA 5LGYA 4R5VA 1VDGA 4U1JB 5IFJA 2VQTA 2AJUH 4TVUA 3H9YA 3CH1B 1YMMD 3UEQA 4Y4FB 3SDXA 3ASWA 4AKQA 4XMVA 5F0JB 5K9QI 2Z8SA 4LEOA 2D3LA 3N85L 5D2NB 3RUGE 2Y7MA 4Q9BA 5LN4A 4UB0L 2YD6A 2IH3B 1MOEA 3ARBA 4GXUN 4J6RL 2CD0A 3PWVB 3REVA 2B4CH 3D05A 3VX0A 1XFPA 4CC4A 4WI8A 1AGFB 5FM4A 2E75C 4JGMA 5JDJA 3PDOA 5E6IB 4PD4J 2KZWA 4XMZA 1XV8A 4XCYB 3DUSA 4LLMA 4N2LA 4C56A 3QJOA 1G94A 1U8MB 1ORSA 3UZQA 5CN1A 3Q48A 3OLDA 3B9KB 3HZYA 4TNVK 1N59B 2WM0A 3CFKA 5AENA 3CLFL 2F9BT 1M7UA 4XNMA 4NNPH 1T5WB 4QCIB 4ZXBD 3C2SA 4XNYH 2WIMA 3ARDB 4HUXA 3O4OB 2A9CA 1B4LA 4FEIA 3MBEA 1QSFD 4PR5A 2QQKL 3TH4T 2C9SA 3FN3A 1KTBA 2EDQA 3L5WB 2Y22A 3AS1A 5E9DE 4ZDHB 4ELDA 3AS0A 2NY5C 5CD3A 2N7BA 5CGYD 6PAZA 1ZSHA 1INQB 3NK4A 5HDLA 4NZTH 2L7JA 2RBLA 3BKMH 4HJGA 3OF6D 1X7QB 4KQ4L 3R8QA 4X9IA 4MNQD 1K2DA 3EJPA 1MIMH 1PU0A 3VD0A 1KXQA 2DIEA 2V3EA 4GT7A 5A2KH 4BE6A 3I9GH 5GRXG 3F7YB 3VGAB 4MMXC 1PY0A 2ZWZA 1XF3A 1W0YT 3GO1H 5IMOA 3DV4A 1IVTA 3STZB 4LU5L 2Q8AL 5I0DA 2NY0C 3B83A 2Y2WA 1ZA6A 4M4PA 4HJJL 3ZQWA 2NY4D 3SO3B 5D2NE 5KYYB 4PIBA 4R4BB 2EIBA 1X4YA 3QEQB 5IROD 3A6CL 2QADC 4NO0D 3EXLA 1HZHH 2JI1A 3U6XA 5F7EL 1F3JA 2JK5A 4YL9A 3SKJL 3SCMC 4BWTA 5DK0B 1ZTXE 3KYKH 3S5ZA 3ES6B 4JFFD 1S7TA 3V7MA 1IC4L 1O75A 2PWHA 3LDBC 4GKSA 3V0EA 2WBXA 5JPMA 3TO4D 4PYHA 4O9HH 4C8XA 1NM9A 3LNDA 4ZMZA 5ACZA 4ZI8A 3GSQA 3HN5A 5FW6A 4IMKC 3TJHD 1H3PL 3QQXA 1RCYA 2CDFB 2R1WA 5B38A 1M9WA 3MRPB 1MCIA 1TZAA 1MAML 1HHGA 2WKGA 5LAXA 4RMVA 4Q6IA 4HUUA 3IXTB 3DVNB 3MLXH 1F90H 5GGSB 1I3RB 3MRJB 1I9EA 4XPHH 3MUUA 3GMQA 3LVEA 3MUGB 4HIJA 4JGUA 4P2QD 3HZ3A 1WWCA 3WLWC 1BHGA 1QSEE 4OT1H 3CFJB 1XMEB 1U9KA 2B4CL 1BZOA 2X2JA 1EGJH 1HJCA 1YDPA 2IBGA 1JVLA 3C6LA 4J3UA 4GMTH 5C07B 5F8QC 3N41F 3LAFA 2RA1A 3W0WB 1VEOA 2PPCA 3SQOH 3QNXB 1WAPA 3GDBA 3BEVB 4AENA 4K3EL 4LCCA 4NC1C 4CA4A 4JDVA 2DI9A 3E1ZA 5L4MA 4X80H 1XCQA 5F89A 5CSZA 1ITCA 5F2FA 4NNPL 4G6KH 3TYFB 4XNYL 3O8XB 4PJ7B 3QEQE 2HKFH 3IFPB 1RXLA 5TE6H 3KGTA 4NQXA 3OBAA 4U1NB 4UQ3A 4M48H 2JSFA 5C3LD 4KK5D 1RU9H 1MXGA 4FMKA 4NN6B 3L5XH 1DQJB 6FABH 1YUKB 2WTRB 3FAXA 4KUCF 1ESOA 3BKML 3HE7B 4IRJC 5C0ND 2VKWA 5IP4A 3D69A 3VXOA 2AW2A 1TJMA 4X5PA 3GSUA 4OLVH 1N2RA 2X40A 3IKCA 2JTDA 1OKEA 3MRQB 4PJHA 4YDIH 5EIIG 4O2CA 3SN6N 4AC2A 2ZKWA 3M7OA 4CMMA 3O3EA 5GS0H 2BOBB 2PF6A 2NSXA 5DD3H 1T6VN 1UA7A 4UYQA 3V4PB 1OB1A 1V7MH 2CK0H 4DESA 3F6IA 4Y5XC 1RIHL 1BZ7A 3VXRE 4XMTA 3EJTA 1U8PB 4NZDA 3S2CA 5HHMD 3N55A 1EGJA 4PU2A 1TG8A 4I48B 3KYKL 1A6VH 4WUKH 4MA1B 4M02A 1ZLUK 2E76C 3RI5K 3HFFA 3KVDD 4POZD 1OGTA 5C07E 1AGBB 4H8WC 3W0WE 1TNNA 3GXFA 4N8VA 3BP6A 2VDLB 1VFOA 2EXSA 3GJFK 5EEXA 3LS4H 3ZE2B 2UWEA 4PS3A 2BSSB 4JG9A 1WFUA 4PJ9B 3HE6B 3NH7H 5IIEB 3H9HB 1J88A 5E1AB 3WFHA 3MLXL 4PJ7E 3VXNB 4YSPA 1RUKL 4XPHL 3LN9A 1M7IB 5SX4H 3N1FC 3ILPB 4J7RA 5CUSL 3AQXA 2OMXA 1S9VB 4MTMA 4OCYL 2NZIA 2IBBA 4PEEA 5MEOB 2XWRA 4GS7C 5DDHB 3VRIA 1L6XA 5ANMB 3ARYA 3VSVA 1BVNT 4EXKA 2BCKA 2OMYA 1EGJL 2EACA 2ADGB 2XI9A 3EYVB 3E80A 4P4KD 2YEZA 4XNDA 2EIMB 2UX6A 2I9LB 4X7SH 1IKNC 4APQC 5T1LA 4E5XB 3SQOL 3GI8H 5E8DL 3BRDA 5KEZA 4X5QA 4XP1L 4LAJH 4BQ8A 5JIQA 1HK6A 5J6HA 4PJ5D 4YXHL 5FYLE 1DJWA 4HZLB 4H20L 3GXNA 3C75A 1AGCA 1KPVB 1RK1A 1TYRA 3IU3A 4G6KL 1NCDH 1J8HB 1EJOH 3K8KA 4TUUA 3KXFD 4M48L 3RX9A 2PP7A 3CCHB 2ROYA 3AS2A 3ARTA 4UV7H 4PTUA 4JZOB 5SV4A 4J5VA 4GSUA 3IK2A 5ACMA 2HT4D 4DK5A 4YHOH 1M3JA 3K6OA 5FK9A 4L1TA 3CDZA 4FXLA 2X70B 2WWMC 2AV1A 3QNYB 4RIRB 5I5IA 1JK8A 4XVJH 5K33A 3I50L 4EZMA 1YQVH 3BP7B 3ZZSA 4LNVA 1YY8B 1P5VA 2BW5A 2WXHA 4PRPA 3ZE2E 2F5BL 2WGXA 3C09B 3KWWA 2IV8A 4PH8A 3BW9A 2FO4B 4XO8A 1V7ML 5KS9B 2OULB 3NJJA 4BZ2H 1XCWA 1HT6A 3CFEA 4JPKL 5E2WH 3ZT7A 4M7ZB 4F33B 4RZCA 1MDTA 5FUCE 1TU2A 2XWTB 5GSRB 1ZJAA 5TQ2L 4PJDF 4BUQA 1FFQA 1M4KA 1OTUC 2K6ZA 5ANME 1Z9SA 5IHWA 2ITDB 2M1KA 1R3LA 2ATKA 2ZJSH 2VR9A 2V7HA 5FAAA 5K9KB 4LLWB 3WN5B 4MLIA 4IM8A 4G1MB 3R4RA 3B3IA 4N2DA 4AZUA 4DVBB 1QA9B 5CLZA 1R3JB 5EO0B 2Z7UA 3U1PA 1INDH 3LS4L 1BZ9B 2ZP0T 4FN0A 2FATH 3UTOA 4FNTA 2X9WA 4M6AA 3PP4H 1J1OL 2X4TB 4G1EB 4NQDD 3K0WA 3KYMA 3GMNB 5AKTA 4AIOA 3IFNH 5BMFH 4Z7UF 2MOGA 3VWJC 3WS3B 3ZSSA 3VXSB 4UOW0 1UKTA 3DSNA 5J1AA 3K7UA 5LGHL 2X44D 4PJEB 4FNSA 5KZCD 1OK0A 1SN2A 3QUZA 1D3CA 1Q9KB 5J3HC 3QR1A 5IQLA 2Y06H 5TH2B 2AABH 3OG4B 4UV4H 3GRGA 3E1F1 3QI9C 1TLKA 4AXWB 3LRKA 4FFWC 1WS8A 1OAUL 4X7SL 4J2XA 1B0WA 4K8RD 3GI8L 3GXDA 4WUUB 4LLYA 1LNUB 4JFHE 5FA3B 1SDAB 3TWCH 5BZXA 4JS7A 1A47A 1ZLEA 2CH8A 2WNKA 2I24N 5DJ2B 5KS9E 1NCDL 3HI5H 5IV2A 5E7FA 1C5DB 4R7VA 1T6BX 2F53B 2R83A 4A2HA 3JWOL 5FYJE 1OW0A 1MZZA 4TQHA 3EJUA 3FAWA 3VXUD 3ZO9A 2KZKA 4ODTH 1A66A 4X7EC 5I6OA 4LKCB 1YMHB 2YZ1A 2YPVH 2Z31C 3HPLB 4NERA 1AS8A 1UD8A 4ONOA 4DCQB 4UM9A 2VISA 1PFOA 2RGSA 5DO8A 4OCLC 1YQVL 2EE2A 1I7RB 2VOTA 1RL1A 2OCCB 1NCUA 1I1AA 3MLSH 5EEWA 1GGIL 2VMJA 5CEZD 5E6ZA 5C3TA 1NCOA 4NQSA 5F93C 5K93A 5A6IA 3ZHFA 4FS0A 1EDHA 4MAYA 5L8JB 5KUKA 1FSKB 3BQUC 3DVFA 2NCEA 3L7FA 2PCFB 3QVAA 3ROOB 1JS4A 4PJEE 5D1ZI 1QBBA 3ZDZF 5ERWA 2J8OA 1HILB 2L7UA 3HPJB 1DQMH 3HS0A 1IJ9A 3VA6A 5MENB 5I30H 4MJ6B 3HUJE 1PQZB 1DQDH 1UH3A 4P23D 2AHIA 3OJ2C 4XVSH 4L8SB 2XTJC 1KFAH 3P4NA 2NTFB 4J8RA 2VXSL 3V6ZA 4TQ8A 1FZKB 2RACA 4XBGB 4G8FA 5E1GA 3BAXA 4WUUE 5F97E 4TVPH 1U8OA 2L8AA 4ZS6C 4FZ8L 1BVLA 3N9GH 2FATL 3D7PA 4MCYB 43CAA 5LQBH 4ADGA 3PRZA 3PP4L 1MI5A 1ZT1B 1UWGH 4FTVD 4MJIB 1S4IA 3IFNL 2L7EA 4HC1H 3QWQB 5BMFL 1XO8A 2ZTBA 1QOKA 3JTSB 2F53E 1B9KA 4QUOA 2TRYA 5D93B 5DMKB 3MREB 4PG9A 4DP0X 3AT8A 3F5WB 3K72B 1EEYB 4B9YA 1UD6A 3L2LA 4YR6A 4M03A 4GSQA 2KHAA 4LIQH 3B1UA 3KHOA 1U93B 2Y06L 2AABL 2J71A 4UV4L 2YQGA 3MLYH 1I85C 4PGBB 4JZNA 3SJVD 2WVVB 3MV8D 3N2JA 2Z9TA 3I85A 1UOKA 1J7VR 2CZNA 3KH3A 1SXZA 3ARGD 3EYUH 1U36A 2PUQT 1DQKA 2C5DC 4PY7B 5JIHA 5DJXB 3ROLA 4WO4A 4NDMB 3FK3A 2H41A 1HX0A 3PG2A 5D7LA 3M86A 5DR5L 1JAEA 4L37B 5K1JA 1UH2A 3EKCA 4B97A 5JORB 2ZXBA 3KL3A 5IB1A 1WUZA 4WTWA 4LASH 1D9KA 1FC2D 3BH8B 3DX7A 3OZKA 3FFOA 4CDHA 4HKXB 4KTEL 2GC4C 3U6XS 5EBGA 4ODTL 3DYMA 3PGCA 2X4OB 1JRHH 4HJSA 5IJKA 3APCA 4GAAA 4R2GC 3TNNA 1WZMA 4WWKD 3ULSA 1PKQB 3APMA 1VZGA 1HL9A 5CP7A 1FH5L 3PAZA 4G9FB 3D50A 3AADB 4PJIF 4JRXD 4FQHA 4QRTA 1RK0B 3MLSL 1LO3L 5E8EA 3T77B 4A67A 2A73B 3TN0C 4AL8H 3WY1A 2J8UF 1JRHI 5C0AD 5DUMH 3P40A 1JFQH 4MJIE 5JW4R 3E9UA 4BFOA 1YEJH 3F12B 4RGNB 2BP0A 4OZHE 3ULVE 5F7HA 1OCZB 5CZKA 3TGXA 2Z91B 4N6QA 4OLYH 3LEVH 4RFOH 3TZVB 5AAMC 4LSSH 4U1SA 4WHDA 5AYUH 5I30L 1WFMA 1DQDL 2G9HA 1A6UH 2X1OA 5C0BA 2WBJA 1AGDA 1KFAL 1KFGA 2I32A 3G5YB 3T04D 1TMCB 3FQTA 2BHFA 4WFGE 2IOOA 4UQ2B 4CADA 2FT8A 2DWEB 2H47C 4OUUB 3IS0X 5I2IA 2X4QA 4GI8A 3D87B 2VE6B 1NOLA 4TSAL 5DSCA 4Z78A 4L9DA 3DI2B 3G7TA 5LQBL 4RMRA 4R90H 2E7DA 2MOVA 3T4AB 3FKUS 3TXAA 5FYKL 1EXGA 3TF7C 1FVCB 4XTRD 1ZJBA 1AIFB 5E70A 1AZCA 1DDTA 5F96L 2DQJH 3NGBC 1R33A 1KIPB 1JXGA 4GUCA 1O9VA 4OZGA 5F1OB 1HHIA 2X4PB 1EA9C 1HSAA 3SPGA 3G6JB 3UP1A 4NM4H 1SOXA 3QJHB 3BN9C 4LHUD 2IGFH 5HBBA 2HSIA 2SEBB 1R5WB 4LIQL 1EDQA 3HS8A 3UAJD 1MCJA 1PKQE 2BVYA 1W72H 3EGXA 3ZXAC 4FKHA 4JVPA 2FIKB 2EVIA 1M05B 1H8NA 1CJYA 3RAJH 3CZNA 4XVUC 1B0RA 5DZAA 4HK0B 4KOCA 1UD3A 1SJMA 4F7CA 2WZAA 4KXAA 1AD0A 1OAQL 2NXZC 3QIWB 2I26N 3GJFA 4RGNE 2E8YA 2VWEC 4HGWA 3HNSH 4HJ0C 2ODHA 4LMQI 1OGSA 3EF7A 2C3VA 4P3DA 1GJIA 4LT7A 2YSSA 3P9MB 1C5BH 3IRCA 2CLVA 2J6WA 4HWEL 4MS6A 3MRIB 1LQBC 4LKXA 1JRHL 1BX2B 1THAA 1HCVA 5HI4D 5JOFA 2IANE 3L08A 5IW6B 1JZGA 1NEZB 3MTRA 2UVEA 2WW8A 5DFTA 3NIGE 4U4BA 3FT4A 4FLSA 3TEXA 3RGBA 2N01B 3D39B 5DUML 1JFQL 4PV1C 3WTVA 4L3EB 3O2WH 4LL9A 5DGQA 1YEJL 1BG9A 2DQGH 5SWZA 3V7AE 1XSIA 4OLYL 3G6JE 4RFOL 5DK3A 1CF8L 3BPCB 3L1OH 4IGBA 4L3CB 4HIEB 1T4KA 5AYUL 3S8GB 5I5JA 1E5YA 4R7LA 1W72A 2NY3D 4A66A 1TZHB 3DGGA 5ICXA 1YLBB 5TGBB 3X14B 1QKZL 3TCXA 3PQYA 2C34A 3OR6A 1EXUB 2WAHA 4AQOA 1G84A 5I1DA 1NOAA 2R2HB 1F11A 2G5UA 5DO2C 2W0KA 1M42A 1FYTD 1UJ3B 3ELAT 4RNRB 2XZAH 4Q0XH 5EFIA 1CR9H 3BAWA 4ZTEA 5TDPA 5DMYA 4G70B 2EXYD 3HW7A 3QORB 4V2BA 1ZVNA 1E2WA 4X7TB 1WBZB 2XTSA 4FJZA 2YBRB 2DQJL 3QUMH 4IEFA 2QZ5A 4UAHA 3P2TA 3ZYIA 4JFOA 4BH8B 3KNBA 2WANA 4X6EB 4RFEB 3QDJA 3ZE0F 2OMZB 1ED3A 4NM4L 4ATWA 3WNLA 3VFUA 2OMUB 2IGFL 3Q6FA 1XD1A 4M5YL 3K2UH 3D3VB 4KJYA 5MP6H 1HVXA 4MQXD 4B60A 4ZTOH 2WXJA 4IKJA 4Y1AD 1W72L 2Y6SC 1OAJA 1S2EA 2BIMA 4GBXC 3TV3L 3G08A 5I75C 1YNTB 2XKNA 3IDGA 3M17B 2G3XA 1UB6B 3AGWA 4I18A 3UXFA 4F8LA 1S7SA 3MYZA 4XO5A 1ZS2A 3E8UL 5FA4B 4Q74A 1KXVC 4QOKB 2M8XA 2TSAA 3HEIB 4NAJA 4PGCB 5BJTA 2OR8A 2GSIA 2HVJB 3D39E 4R6UA 2PCXA 4KHXL 1IGYB 4ZW3A 4L3EE 4WNQA 3MOBH 3T65A 2NLJB 3BYYA 2ZAHA 3D25B 1T1WA 2C3XA 3FQWA 5DEGA 2WCGA 5D1XB 3C5SB 3FTWA 2KH2B 3QBTB 3DUUA 5DVKA 3NQKA 3QUYD 2HTKC 4HSAC 3D12B 5ALCL 1T6WA 2VR5A 3GS4A 4YH6A 2QELA 2J73A 3SPVA 2FHFA 1DJZA 3FB6A 4BFJA 4EIBA 1SXAA 2V2TA 5DD6A 1MAJA 3P77B 1JK9B 3MV9D 4BFGA 2KPNA 2Y2TA 3X1BA 4EQ3A 1OK8A 1KCRH 1XZ0A 5EO9B 4UM8A 1HEJC 2H32B 3KGRA 1F0LA 4OLEA 2FLMA 3TT3H 3NCJH 2C3HA 2WLYA 3O2WL 5D1QB 4P5MB 5JHDB 3N42B 1TLMA 4NSKA 2DQGL 4WWOA 3H42L 1OAYH 4M9OA 4ZMOA 4MSWA 3WHXA 1FZJA 4WFED 4E68A 1HYSC 3D3VE 3PV7A 3MRGA 2FNWA 5DHYA 1I31A 4AQAA 3AITA 4PWKA 3ALXA 1MY5A 2ZX5A 1OCWH 1NBQA 4X6CB 4YBLC 1JNHA 2GBAA 2NY6D 3LRMA 5F6IC 5IFAH 1CICB 2HCZX 3OHXC 1OQOA 4P57B 1JJUA 2FR4A 2XZAL 4QOKE 3TM6A 1CL7H 1CFQA 1CR9L 1QI5A 4AQEB 1NKGA 4GKOA 4M29A 3RGVD 1HINH 4NC2B 3TIEB 3MA7A 2HFEB 4UZSA 2BSRB 3DHUA 5HYSA 2JIXD 4IBLT 5FOBA 4D9RE 4AT6A 3QUML 4WFFD 5JPNC 3HCVA 6CGTA 3WIAA 5D1XE 4MMZB 5GRZA 5E9NA 1Q94A 5LBSA 2GITA 2ATAA 4PJFF 3VM5A 4BD4A 4Z0BH 3EOTH 5GS1B 3CSBA 2DJMA 3L2NA 1MLBB 3DRQA 3NVQA 5AVXB 1JZ7A 2ZX7A 3H9ZA 4Z7NB 4ZTOL 4AL8C 2AJVH 4E9TA 1IE5A 5B22A 2APSA 2AMGA 3R0MA 2ADJA 1QBMH 1XF1A 1F4AA 3FONA 3APDA 3VMOA 4KOBA 5ICZB 4XN8A 3Q06A 2WXMA 1GGTA 4WNJA 1G5GA 1KG0B 1UB5A 3JWNG 2VW4A 2P52A 5JHDE 4LSVH 5FGBC 4TOYL 3DDGA 3D18B 4BM7A 3DETC 3QFJD 5IT2H 4G6ML 1ADWA 3HI6H 4XO9A 5GGRB 5B7EA 5CCKL 5JNYB 3QZWB 3KPOB 4AE1A 5C0JA 5LBSL 1QBAA 3OAYH 1BWWA 1NCCH 2VJ0A 1A22B 5BS0B 4RX4A 4X6CE 4F8PA 1KTRL 2CO1A 2WLIA 4Q56A 5GGVL 4KZ0A 1AQDB 4G6AC 1SGKA 4Y19D 4XGZA 4NFDA 3RWFB 5IBTL 4KNTA 3WOVA 1KCRL 4AIZA 2AQTA 4YHYC 4EN3B 3QQ9D 4OKVB 1QEWA 5CIPH 4DGIH 3FRPG 5L9DH 4J3OD 4OGAC 1H5BB 3BLBA 3HI1A 2Z6FA 2ZE0A 3K5RA 5I9QB 3VXMB 5JW5B 5E9DD 1GL4B 4P46B 4N8UA 3JZ7A 1JF1B 1I8MA 1OAYL 5HVHC 3TVMC 3WLBA 2X9XA 4ZMNA 1P5UA 3NFNA 1S9WA 3O8XC 1T0NA 3A5VA 3WXVH 2K1MA 4Y4HD 1QHQA 3IGAA 2VO5A 4KY1H 4HDIA 2LTQB 3L9BA 4BGDA 1CDHA 2KQMA 3QZOA 4Y4FD 3GMLB 3EGSA 5HPOA 5H4ZA 3JWNH 4U1IA 4Y2NA 1HINL 4E9QA 2GT9A 3F7KA 5EDSA 3V0GA 2CMRH 1E4WL 3Q1EA 2Z93A 3LKPB 3MLPA 1ERNA 2Q3ZA 3FQNB 2LE9A 2DLEA 2F7PA 5BW7C 2DD8H 4HWZB 1EFQA 4JL2A 4ZUTA 3KBFA 3GSWA 3NAAH 2VRQA 4AKPA 5E6ID 4NO5B 5DZPA 3WNNA 3RIFF 5BS0E 1X6NA 2E4TA 4YDJB 5I1AB 1MRDH 4O02B 1MJUL 4PV9B 5CEYB 2VLJA 4JUTA 3VJ6A 2ARJB 2YAHA 3BRFA 3LD8B 4FYSA 1QBML 1KT2B 2CRYA 3FO2B 3RUGF 2C9VA 2E7CA 4MA1C 1K4CA 2GY5A 5G5DB 1FNEA 3ARDD 4X0KB 4LZKA 5CLTA 3GMPA 2NNRA 5K1NA 2NY1C 3PWJA 1JZ2A 4G5ZH 4QHKI 4U1GB 1THCA 3JT2A 1YN7A 4LSVL 5I1GH 4NIKB 1ZDQA 5HGHA 1DBBH 5INCB 3QRGL 5HPMA 1WC7A 5IT2L 2Q3AA 3DOSA 1H3UA 2IVFC 3HE6C 3QJSB 1IBBA 4KHTH 4C4BA 1NCCL 5FCUH 3L2MA 1INEH 1SXBA 1ECYA 5LCVA 2QFPA 1S78C 2HX8A 2CJTA 4NQEB 1OSYA 1WAAE 4ZAKB 4OLWH 3NCXA 3P3TA 3QIUA 5AD0B 1ZGLB 4NKMA 3AXIA 4GXVH 2XV2A 5JIPA 2ZOUA 2DQCL 1C08A 3LKSB 1KJ3L 1BJ1J 2P42B 4DGIL 4UANA 3MLRH 4H8PA 2Y5EA 4Z7AA 4DAGL 4NZUH 4TPRH 1F1AA 2EYTB 2ZICA 3D85D 1PYWA 1ASQA 1N64L 3BAEL 2XQYG 5CKGA 5ILTH 2E74C 3O0LA 3QUXA 5A2IH 1LE9B 5JW4Q 1KN2H 4QXTB 1N6QL 3ZQ9A 5IKCA 1KV7A 2ZSVB 4NKOA 2DYSB 5AZEH 4HJ1A 3WXVL 4UAOC 3BT2H 5I0ZA 3V5DB 4KY1L 1D2PA 2F7QA 1A3QA 4YO0A 3H4HA 3PWPB 1J48A 4N4YB 1K3ZA 1FF5A 4XRCB 5LCVL 5ISZA 5TDOB 3SGEI 3UP6A 2XCMC 3FTXA 4HUMB 4PW9A 3T8VA 4XMLL 2CMRL 2R2CA 2AVGA 3WKNA 2OLDA 4BK5C 3EOAB 3AB0C 1PEWA 1G1YA 2H4EA 3AFLA 3DO4A 3GSOA 3PL6B 4CC0A 5A43C 1BD2A 3RL2A 4P5RA 4F37K 4DUWA 1DUYA 2XX1A 4DVRH 5KVDE 2EKSB 3U46B 1NCAH 3PV6B 4AV5A 3NAAL 5CGBA 1GIGH 4XNZB 4XWOD 4NM8H 1QR4A 4Q7DA 5EUKB 3W0WD 1MRDL 4P9HH 2CKBA 2F1EA 3RNKA 3S98A 2VLKD 1IM3B 1KIUA 3BXNB 2E6QA 4XBPA 2DQIH 1AR2A 5E2UH 5JMOC 4PRBA 3ARFB 1QNZH 5JDSB 3D2UB 5AKVA 3ZKQD 1G9EA 2JKSA 4L29A 3D6GA 2KLTA 4QXVA 4G5ZL 1FL5A 3HC3H 3TCLA 1CDYA 3KL0A 2BSBA 1EJFA 4S10A 2OW6A 1OSZB 4NX0A 4YOKA 3VI3B 1JI1A 3TBWA 3FT2B 4PPTA 4AJYV 4P3CL 1N18A 4JFTA 2B0SH 4KHTL 3UZEA 3IGKA 5FCUL 4UIMB 2KT6A 1BXAA 1FAIH 1KTDB 1INEL 1LTXA 2QGEA 5DJ0A 1L0YA 1DUZA 1EEZB 3KYOA 4PJ8A 1M3IA 1FYHB 1WG3A 2IH9A 1CLZH 2GB2A 3PWPE 2QVIA 3HNVL 1CB4A 1L6PA 5HI3D 3STLA 5CGMA 4PJDA 1U3NA 4N3UA 3E6FB 3ULUE 4YSAA 3SE3C 2DH3A 1DQVA 2BVOA 1MVFA 5KSBB 3RKDD 1I8KA 2EQDA 3APFA 3MLRL 5C9KA 1PCSA 4P2RD 3QJVB 2F7RA 3LN4B 4K7PY 2LU3A 2QTVA 5I8OH 3AACA 3FUHA 4LOUD 3ARPA 3CZSA 1XGQA 3UGEA 4Z1PA 2VDNH 4JFDB 4PRNB 4DSYA 1MVUB 4MMYB 5EZLA 3LS5L 2ZF8A 4EQ2A 3QJXA 4BUHA 4GI6A 3BVVA 3OKNA 4WJKB 4C83A 3QFDA 4MMXA 5AZEL 5ID1B 5IEKB 3BT2L 3IDJB 3AWFA 4PRAB 3Q6GL 3L9YA 2BS71 1NMBH 1D5RA 2ESVB 2ZCZA 2OCFD 4TVSa 1IIKA 2D0HA 2UXTA 3BIKA 1LHZA 1G7PB 2WXOA 2XQYA 3ZE1B 3MC0A 2MTAA 4AJVA 1FV1B 3P30H 1U91B 3BUYB 2BDNH 5KYWB 3CQFA 3L81A 3IKKA 4LLAA 5DJCB 3SCMA 3TL5A 3VI3E 1MFDL 4OZFG 2P44B 1A9VA 4ZXBC 4PRIB 4I0PA 5FM5O 1H0DB 4L1LA 5K39A 1NJ9A 5GZOC 3MNZB 2YMXH 1AE6H 5T5FA 5D7SH 1RSFA 1NBZB 1C1EL 1G1CA 1WWBX 4NM8L 1CIDA 1TF4A 2YUVA 4TUJA 5EOTB 1F56A 4P9HL 3KXFA 3ISRA 1P84J 4OGZA 4MCMA 3GBDA 4XCNB 3CUPB 2I27N 3BVDB 4LB8A 1QBLL 1A21A 1HSBA 4PJXF 2DQIL 5E2UL 1D6EA 1KTKE 2HLAA 3EDEA 1QNZL 4NQVB 3A24A 1JWSA 3FFDB 2NPLX 2W07B 1J8HD 1FBIH 4OM0H 1JTTA 1W0WB 4OVVA 5JXEA 1XEDA 4B0MB 2YFOA 5KSBE 3GHEL 3GM8A 1AAJA 3MVSA 3MOQA 1V3LA 3O3DA 3HC3L 4H4NA 4P2OD 2V6HA 1A4CA 1K5NB 3BGFC 5IHZB 1A1NB 4NRZA 5GRUL 5HHQB 2M2DA 2NY4C 3LH2H 4JFDE 2NXYC 3KPSA 1HH6A 3E38A 5IROC 4YGVB 4I5BA 2NSMA 2B0SL 2GPZA 4YDMA 5CJXA 4HK3N 4QTIH 3JWNC 2Q86A 1FAIL 2MQ3A 2F6AA 2R0KH 4JM2A 5T5FL 3WIFA 3EFOB 2G0KA 4AZ8B 3CHRA 3RA7H 3MCKA 1PSKH 2AJ3B 2ESVE 5K59E 1D5XA 4HJEA 3SPCA 2OR9L 2R56H 7PCYA 1VADB 3TO4C 2H6PB 2MHAA 5E4EB 5T5NG 1QASA 3BVTA 5JR1H 1X5YA 3WE1A 5GRJH 4MS8D 2AQRA 3EDJA 3ZE1E 1YYML 5J11B 5EIVA 4PGEA 3HC2A 3U0TA 3GBLA 3TJHC 1OCCB 3TLRA 5C86A 2EH8H 5L8LB 4ZFOA 4NWUL 4XXWC 1S7RA 5I8OL 4PRIE 3WNKA 5KBNC 4R96A 3U9UA 1PJWA 1C16A 3L3DB 4IRJA 1Z9NA 2CQVA 1R34A 4PWGA 4S1DD 5SWSB 3FH5A 3S35H 3IMVA 4IW4C 2NX5D 2PWGA 3ORJA 4QEGA 3MXWH 3NIDB 4WAFA 2SODB 1J8SA 1PZ2A 5ADOH 5FECB 1VAHA 1NMBL 2BY3A 3WEBA 4WQOA 2YGNA 1G7LA 3K6IA 4WI9A 4Q9CA 2G2RA 2VDKB 2JI3A 3GSVB 5D7KE 1K6QL 2A6DA 1PL3A 1T3FB 3IS1X 3DXAE 4K5PA 4MA7H 4Y5XA 3SGJA 3VXSD 2A83A 3B1TA 5F9OH 5BRZE 4XXDA 3CD4A 3IJSB 7CGTA 2YK1H 3OLEA 1C9SA 3P30L 1GZHA 1T22B 1QRNE 2BDNL 4C58B 3WKYA 4XNQB 1EJ6A 5JW4M 1RPKA 5CLXA 2WN2A 3GHPA 1JV2B 4NXKA 4AJWA 2YWYA 4ZFOL 1AE6L 4XOBA 3T3ME 4XN9A 4PSRA 3RPKA 5FYJU 2X0VA 1F6AB 2WVSA 1E4XH 5HDBB 4S0HA 4RMTA 1MY7A 1S7VB 2HLFD 4N0CC 5I1IL 5C0NC 4NQCB 1KXHA 4URTB 3RTQD 4GY4A 3SKMA 4EKXA 2QGBA 4OZFA 4PRHD 2BIOA 1FBIL 2GJJA 2EO7A 1AQMA 1U8NA 2HJLB 2I85A 1U2HA 1MQ8A 2W9DH 1QLRB 1X5AA 2B2XL 2VDQH 1UWEL 4IRZA 1NGYB 3O9WB 3HC0B 3AAZA 1BM7A 3EFDH 4GI9A 3H56A 2VXQH 3J27A 2ZUYA 4ZODA 3LY6A 4HU2A 5IEHA 5MI0C 3LH2L 1HXKA 3EGDA 4PJIA 5HGDA 2X4RA 1JGVL 2OSYA 5SWSE 2JKNA 4O2FB 3LEXB 2BFVH 4QTIL 5DQ9A 2J8UA 1RZ8B 4APQA 3NIDE 1NLDH 2YHGA 3GSNH 3KVQA 4WFHD 4TLKA 1QQDA 4H2CA 1SOSA 4LP8A 3CDCA 1KDJA 2VMEA 1PSKL 1TQVA 4ZUSB 3RIFK 4YXLL 5ANHA 3BD5A 3MO1B 4LPTA 4POZC 2HJKA 3OPZH 1UOVA 4OFQA 4N0FA 2DZEA 3KZ8A 4ZT1A 1DO5A 4H8VA 4KMTL 1U6AH 4JFEB 1E28A 3ECBB 2EH8L 4LHUG 1AZVA 3SDAB 4Q97A 5EZIH 1WGOA 2EYSA 5E2VH 4D0BB 5MEND 1MCRA 1I82A 2A6KB 3LKQA 4IRZL 3ZYZA 4HKZB 1FFOB 1KCLA 1S8DA 1GCYA 1CFNA 3CWGA 4OLZH 3DYOA 1RZGA 4XVTH 3JWDH 3MJ6A 3O2VH 4MNGB 1HJBC 1GTFA 1CXFA 1XXFC 4ELMA 5J6GA 4Z7WA 3CXDL 3JV4B 1T1ZB 5HDBE 3STBA 2HT2D 1YN6B 2GTZA 3JZYA 4NQCE 4D8PB 4EZLA 1KBWA 1O7SA 5BV7H 3Q5OA 1JYXA 4M7KL 3QXAB 5BQ7A 5J6SA 3GZKA 3FB7B 5L2KB 4G43A 3CFBB 3L4CA 2YK1L 3LPFA 1GPOH 3ZYJA 3HUJF 3RZCD 4HS3A 2A6IB 4KKNA 2D3JA 3ILQD 2EXTA 5DK2A 1JWMA 4OU3A 3GSNA 3D4YA 5GHWH 3ZDXF 1A2YA 1LO0L 1UADC 2DWSA 3N43F 4UILH 3T2QA 3X3GH 3NOIA 2A9BA 3HVNA 4XP5H 5I74B 4JG0H 2CBOA 1DBJL 3D9AH 4N2NA 4M7JL 1KPRB 2CHNA 3M8OH 1JDCA 2B1OA 1IGJB 1S9XA 2GAZB 2PLTA 3BVXA 1TVBB 5CR8A 2BFGA 5ECJE 4ELKB 2PXYD 3VG0H 3VWJA 3IMTA 4PN6A 4H0HB 2W9DL 1NGZA 4JFEE 3GINA 5TDNA 4W9CC 1M2VA 3EFDL 4JRXA 2H45A 1I3VA 3GTVA 3JXAA 2VXQL 3MUY1 5IB5B 3WHE1 1LEIA 1K8IA 2DMHA 2V2XA 5TQ0H 1Q9LA 4FE9A 5JOPD 3QI9A 4LESA 4W6XB 1O5DT 2D73A 1TYJA 2BFVL 3QO0A 4AH2A 1OXYA 4G9FD 5AW0B 5BO0D 4JE0A 2ZYIA 5J9PB 1NLDL 1WIPA 1FZOA 3GSNL 2EILB 32C2B 4MDRA 5CR1A 2YRLA 3I6LD 1QO3B 2BO0A 1CGYA 1UD2A 1G4RA 1VSCA 3KVPA 4FG0A 3FUDA 1I1FA 4FC3E 1LEKB 1S7QB 5L2KE 1DQQB 2W5PA 2VRKA 4N9OB 2RMNA 4RMWA 2J1YA 3TZVD 4HUVB 3BAYA 1VACA 1CE1H 2GK0A 3DROA 1BF2A 4GFTB 3X3FH 5E2VL 4H26A 3SDXB 4N8PA 4RRPG 4B9ZA 4YVUA 2QKIC 2Z31A 2X6BA 1SDDB 5DVLA 4XB3A 5F21B 4WV1A 4OLZL 4X4XA 2DMKA 4JL1A 4XVTL 3JWDL 3ATAA 1OHZA 1EUUA 3OL2A 3QO1B 3MBWA 3DURA 1P7KB 2KQNA 4HOXA 2QHLA 1NGWA 3H7BA 4Q89A 5G4OA 4E42B 3W9DB 5BV7L 1K85A 2RCSL 4AOFA 4L8CA 3MACH 4JZJC 2DWTA 4OZHF 1JWUB 3BZFA 3BO8B 2BZDA 2I07A 3BQUA 2AERT 3IF1A 4K8RC 2IPUK 1TO5A 4C56B 2WZ6A 2XQBH 1NCBL 3L6FA 4L4TB 2X4NA 4MD5A 1H6EA 3LV3A 2B20A 1ID5I 4N2HA 3CFKB 2A5UA 4Y16B 5HI5D 3GEFA 4TSBH 1GZQA 4HJIA 2Y6TE 5CNHA 2JNZA 5DC0A 4DW2H 1JUFB 3OKLB 4PR5B 1IGCL 5SWQA 4PWFA 5EN2B 5LNGA 3MRNA 3KR3H 4ONHA 2DTML 5GHWL 3VXTA 5F9WC 3U2SB 2X4UB 3X3GL 3S37L 4TTDD 3UPAA 3S8WA 1J86A 1DEEA 3D5OF 4JG0L 3OLGA 3OC5A 4R7NB 4JAMA 2ED7A 1URLA 1ZXQA 4OFKA 2N1KA 2NTSP 1XTMA 2OJEA 2VO8A 5F3HA 4M43H 3VG0L 1QTYT 1EAQA 4B95C 1SMOA 3QJZA 1MRCL 5IWLC 2DYPA 3HMXA 2A9MH 5C0RL 3SDXE 5HVWA 1ZSDB 4F15C 3Q8EA 1SXSA 1EAJA 4PLKD 1D5MB 5EMYA 2VSMB 1DVXA 1QACA 1I85A 1ZE3H 1RJZA 2XKUA 4AGPA 5IJCC 2JK5B 3JUZA 5AWNL 4UWQB 3UTSB 5F7FA 4P23C 1FN4B 1N26A 1E9QB 4JY4B 3SZ6A 2VMFA 4L3ED 1BJ8A 1K4DA 1N67A 2WCPA 2VZUA 3F7LA 3IU4H 4KK8D 4EJ1C 1BXVA 1AC6A 3GPEA 1IGTA 4N2EA 4HGKC 3WTWA 4L4TE 3GSQB 1TUPA 3CDFA 5I8CA 4B41A 5ACLA 4ALAC 1CE1L 2Z35B 3X3FL 4HKJA 3QQ4A 4NUMA 4ZQKB 1TJIL 2PWEA 2CXGA 3ME0A 5A2AA 5IBLD 3HMXL 4ANXA 2X4SB 4ABUA 1WBYA 4BA8A 4YXKL 3EDFA 3FT3A 3PIQB 3NIGF 4WF7A 1UVQB 1PZUB 5H37G 3C6EA 4DEUA 2VC2H 4NENB 1GS7A 4BIKA 3D08A 4R0LB 4NT6A 4OJDH 1TCRB 3BPNB 3ESMA 3TN0A 1KBGH 1P1ZA 3QORD 3HR5A 3MJ9H 3Q2NA 3C6LB 4N3TA 5I19H 3KLHD 1KUMA 4RRPA 1A6ZB 2BHUA 1U58B 3VGDA 1AHWB 3KL5A 3QWRA 1SJEA 2XQBL 3ARGC 5F9JA 3DIFA 4LCCB 3VXPA 1N3NA 3SIKA 4AKOA 4JDVB 4JFYB 3ALPA 3K81A 1R5IB 2XPYA 1X5JA 1YVLA 5CSZB 5TF1L 3SZKC 1HH9A 4PVMA 4EN3C 4F7MA 4JBSA 4GIOA 4QGTA 3KR3L 5I9QC 2A4ZA 2HG0A 1CURA 5AW8B 1A6AB 3U4KA 2AVFA 4OFDA 4WTZG 1I53A 1HEZB 5HDQH 3L5JA 3RVTD 4FA6A 1BBDH 1GW6A 3UTSE 3FHEA 1F2QA 1NAMH 2C9QA 2DDQL 3LRSA 1XHHA 2HFGL 4QOKD 3UTTD 5DJ6B 4DFHA 5IG7A 3FNKA 1LO2L 2IH1B 4J3OG 2IWGA 4OIBA 4WWKC 2J25A 4JN1L 5B1AB 1KGWA 2VAAB 2YAOA 2NZ9D 3VXOB 1I9IH 3RWEA 3WS6A 3C60B 2AS5M 3IKCB 4EDXA 3MV9A 4YHPA 1FCCA 4O2CB 1WUNT 4GPVA 4KJQD 5DUBB 4A2DA 2GBTA 3NQIA 4AYSA 1ZA3B 4OZIB 5IESH 2GI7A 3CN4A 2G9KA 2H9GB 1BZ7B 1AXIB 1K8DA 5H37H 5SX5K 3BZ4B 2AXGB 3CG8A 2O6CA 3AW5A 4M7LH 3CU7A 5EBWA 3T1FB 3FQUA 2L4OA 4QHUB 4L05A 4UU9A 2WO2B 3W39B 4HXAL 3F7VB 1ACXA 1E9OB 1UT2A 1CFBA 2VGLM 4QRQA 1QPXA 1LILA 1E3XA 3MRCB 3NP3A 4ENED 1YYLH 1EUTA 5D1QD 1GY1A 4YZWA 5TPWH 1MWAH 1L7TH 1WZKA 3BP6B 1I7TA 2UWEB 1IC5L 2KUTA 1U3HB 4NHUA 5D5MB 1T5XB 3P9LA 1UM5H 1TJHH 1QFWI 3A47A 3NTCL 2ICEA 2E27H 4J2QA 4A6YB 4XTRC 5HXMA 3KD4A 4ZYKA 5INDB 5M94B 1HZLA 2BNUB 3B6SA 2P5EA 1WZLA 2CBTA 5GJSL 5BPPA 1CICD 3RY6C 3S2AA 3IE9A 4RZKA 3PYCA 3T2NH 4QYAA 5L0QB 4J3OH 2VC2L 3BGAA 3VB8A 2VERA 3MXVH 3QA3B 1M6OB 1XAUA 2HUEA 3QJRB 5FLVA 4QTHB 1H15B 3IXAB 1KBGL 1NFAA 1VERA 1Z5LB 3NN8B 3MMEA 2YEZB 1UGNA 4Y2OB 5I19L 4NKQB 4OGXL 1BMGA 4WY7H 2NUPA 1GSMA 2IGLA 3V8OA 1SVCP 3DHPA 4UMGA 3U30C 3UTQA 2LOEA 4LSQH 4GRLD 4M56A 2JQAA 3CVIH 4YWGH 3C8DA 1M7DB 2W38A 2ZXWB 3LXCA 4BDVB 3RFZB 4X42A 2HN7B 2XVLA 3K2MC 5IVOA 4OZIE 1IBDA 5H37A 2NW3A 2DEWX 4PREA 3MJ7A 4X0NA 4AV0A 2OTUA 1U4FA 4YFLI 2CUIA 3RUGA 3ZKND 1MFBH 5MEQB 4JEGB 3FQ4A 2BSED 1SFDA 3LRLA 1JNNL 1IKOP 1BGXH 4XP4H 1UT9A 1BBDL 1RIUH 2R23A 5BNXD 2BRQA 2CHDA 4AEFA 5ETUA 4NN7C 4ZW7A 1BMWA 1ZPUA 1U42A 3CDZB 2PABA 1VCAA 2AV1B 3GIVA 3KJ4C 5C2BL 1W15A 2FNBA 4WCYH 1ZTXH 1I9IL 1W8OA 2BY2A 2C3GA 3H2WA 4YHIB 2BH0A 1PAMA 2P5WB 4LCWE 4Z7VB 1IQWL 4XPTL 2X6UA 3T8XA 3O6FB 4C4UA 1HXMA 4KZDH 5IMLA 4KI5D 1LVEA 3KWWB 3FSWA 5D5ME 4UTBH 5IESL 5F1NB 3BW9B 4W4OC 2WZPD 5DEFA 1Q0XH 5F1IA 5ES4B 5BS0D 4EDWH 1UQSB 3FQ2A 4WU7B 3CFEB 3FTGA 1NGXB 4MHHI 4GEJA 4XOEA 4BEIA 1IU1A 3QXWA 2EC9U 2J4WL 4BSJA 3KLDA 5E9DA 1KYFA 1Z9SB 3BPOC 2EDEA 1KXVA 2RD0A 3BLKA 1R3LB 1H6TA 4XP6H 4S2SB 4MNHA 2P9RA 3A67L 4LOFA 4XN2A 2IXQA 3F3HA 5EA0H 4IJ3B 3VXMD 1YYLL 3KWUA 3WFEH 3RWDA 1ZHKA 1IQDB 2WXNA 3L3IB 1F3RB 1KJ2A 3L9RA 3KJ6L 1L7TL 2JJTC 3ZUNC 4DGWC 5J4MA 4P46D 3HHMA 3ARZA 5BO1L 1FIGL 4JGNA 5HGBB 2H1PH 3CH1A 5CF3A 1E90A 1CDBA 1NQBA 4X9FA 1UM5L 1TJHL 3ARFC 4OSUL 5D2NA 5BRQA 2EIJB 4F58L 5J1AB 1YEHH 1TPXC 3ZKMC 4PY8J 3FFCD 1WF5A 2GJZB 3PWVA 4TUOB 4X6DF 1AKJD 4N24A 2NMSA 3EBHA 4AQ1B 3P0GB 4KRNA 1J0JA 3MXVL 3IDXL 4BQ6A 3FO1A 4IDJH 2ED6A 3MOAH 1QUPA 2ZCHH 4P3WA 3WKMH 1XR9B 1KBBA 3HRZC 1N4XL 3OR7B 2EVGA 1NMAH 1E42A 1X5MA 5DUJA 1GZPB 2P5WE 4Z7VE 4QLRA 1U8MA 5D70H 1Y07A 4WENB 3B9KA 2C4FU 1N59A 3HG1E 2N3JA 2O5NA 1MFEH 1EAOA 4MJJA 1T5WA 5I6KA 5LNEA 4QCIA 4UTAA 5A7EA 3ARDA 4W93A 1BBJB 3BIAX 4R83A 4AGOA 5BZWB 1L9QA 5D7IB 3L5WA 1PTZA 1MFCH 4HHAB 3B7YA 2J7LA 4G6JH 2ARWA 2XN0A 1BGXL 1EX0A 1QSEA 4HIPA 4PBWD 4ZDHA 3R8BB 4KX8A 5T5NF 4NOBA 1INQA 4NC0B 1BQRA 1RAMA 1LDPL 1OIOA 4M6ML 3RB7A 5CZXD 1VGEH 1ZTXL 2VISB 3VGBA 1P84K 3F7YA 4I77H 1I3GH 1G1OA 4KZDL 4S1SH 1E6OH 3UBXB 4GKZA 3AJ7A 3ZUCA 4EO5A 3STZA 1FNSH 2K9FB 1MSPA 4IK6A 3ZTNH 5KYYA 4EDWL 1GS6X 5E4AA 4R4BA 2D7MA 5J1SC 3QEQA 5E2TH 5I76B 4IJTA 2EDDA 4UTAL 5KJ7E 5BVJB 5CMAB 4NQED 3IBEA 4ZAKD 3C5ZD 4DT2A 2FQFA 3V9FA 4P5TD 3Q5TA 3RDTC 5DK0A 1OP3H 1AFVL 3ES6A 5C7ZA 1TQBC 5DT1H 3UBGA 4NI3A 2NY6C 3LRGA 5EA0L 3KYAA 3SQBB 4B9FA 2B59B 2Y23A 4G8FB 1RUAL 3NJLA 1U8OB 5E99H 4E36A 1NTDA 3A6BH 1MCOH 5ELIA 3WDIA 3C8KB 3GJEB 1N68A 2PN5A 3KWVA 3PJSB 1DCLA 2CDFA 2H1PL 4N87A 4PUBH 3MRPA 4R7XA 4F24A 1ZVHA 1N7ML 1O6SA 2J8HA 4NIYE 5D8JH 1OQXA 4AK1A 3ARVA 3IXTA 3DVNA 3VYOA 3VXRA 5GGSA 3P3RA 1MCWM 4E5XG 1ND0B 3BUPA 3MRJA 4UDUB 2XZCL 4BFFA 2EUXA 1WAAF 4PJBB 4XHJC 5D7IE 3V4PH 3UACA 1CGUA 3MV11 1Z3RA 5GPRA 3TBVB 2Z0BA 1JZ8A 4AE0A 4PG9B 3U7WL 2L04A 3CFJA 1PZSA 1XCTB 3H9SD 2CGRL 3PWPD 4WEEA 3ZGIA 4N26A 4IDJL 5DMGC 3L4ZA 5B39B 5D1ZB 3TWYA 4Y5VB 2ZCHL 2DWXA 3VNYA 3WKML 3MDJA 5C07A 1NMAL 3W0WA 5H94B 4IQHA 4NRYB 5T8IA 2ZZUT 2J5LB 3QNXA 2G5RA 1MW2A 4S1RH 1T83C 3QP3A 4IBTA 2VDLH 4MZ2A 3TVMA 4JO2H 4AVHA 4JG5A 5D7LB 3GXUB 4WI2A 3SDCD 3TYFA 3JT0A 3IRZA 3O8XA 3IDYC 4PJ7A 2UZXA 3TPUB 2XETA 4FHKA 3GC3A 4U1NA 1DBMH 5ABZA 1U2CA 4HBQA 1RULH 2ISDA 4J4PC 3GYRA 4U0RC 2VSCA 1DQJA 2WTRA 4GINA 1AO7B 1FVDA 3D2UD 5T1JA 1NFDB 3HE7A 2N1TE 3DBSA 3QHZL 3ZX1A 1IBYA 4E0RB 1JVOA 1VGEL 3VD9A 2VAJA 1KYOK 3EOYG 1AC0A 2JQZA 3NABH 3MRQA 4IOFD 3OSKA 4HIQA 4S1SL 4J12A 3VH8B 2PWDA 3WGUB 3CSPA 2BOBA 5JHMA 1RERA 1IEAA 4L4VB 4J3OC 2VDOB 5KBMA 2AANA 4M8QA 1IE4A 1DBKH 2ZOWA 5HHOD 3UTPD 3V4PA 2I5YH 4AYGA 1OWRM 1U8PA 4I2XE 4PJBE 5C0EA 1E9PB 1V7NH 2PKDA 2BP8A 4D9QE 3HHSB 2AZUA 4OM1H 2D3NA 5T3ZD 1ZK5A 3QE5A 4I48A 1AXSB 4TRPH 4MB3A 5C0BB 5I73C 1BJ1H 4Y4HC 3KHQA 1AGBA 5A1AA 1G9MC 1NCHA 2NNFA 3NJMA 4WGKA 1BZDA 3P3UA 5E99L 1R3HA 1JGUH 2X4QB 3A6BL 1MCOL 1SBBA 3EHBC 2BSSA 3KCWA 4PCTA 5EU6E 3B5HA 4PUBL 4IBSA 4PJ9A 5T1MB 1GC1H 1T0OA 4P07A 3HE6A 5HDOA 3KGSA 5IIEA 3K5SA 3H9HA 3UCRA 5E1AA 1U95B 3Q9QA 3VXNA 1DJXA 3WAKA 1KEMH 3X13B 1HHKB 5FYLL 4ZRGA 4QR7A 4EAEA 3ILPA 3V4PL 5EF2A 1S9VA 3HBGA 1TO4A 1HHIB 5DDHA 1DE4B 2ESVD 1HZKA 5ANMA 5HDRA 5LAPA 3VQLA 2WOYA 1AO7E 3FF7A 4IMLA 2E46A 4N90D 1NFDE 4XR8C 4YK4C 3KG5A 4CNIB 2ADGA 2ZG2A 3DV6B 3EYVA 4OF0A 3CHXA 2EKJA 2I9LA 3EGXB 3ZTCC 4RRPM 2MCAA 4JCMA 3BSHA 5CD5D 2KZBA 1G9NH 4RWYH 4Y2DD 1EXHA 4M7LT 3RVUC 1B0RB 4S1RL 2EIKB 4L4VE 1CGVA 4M6OH 4HZLA 1KF9B 3GK8H 3MGAA 5KAQF 1T20B 5I1JH 1KPVA 1QLFA 1O9ZA 2XWCA 4Z5RB 3MQIA 3Q05A 2HAZA 2XNAB 3FUKA 5BZZA 3L54A 3EYQD 2C3VB 4LNRB 3HG5A 3CCHA 4CU6A 2HFTA 2YSSB 1DVFD 2WV3A 5D6CB 2WVTA 3CMOH 5GGTH 4AEIH 1DYZA 2AQSA 3IVKB 4JZOA 2QPFA 3QDMB 3U7YL 2X70A 4FZEH 1U8JB 3QZNA 2A38A 3QNYA 4K7PX 4RIRA 4XMUA 2P47B 1AXTH 3VI3F 4MDJB 1D7CA 2DBLL 2IAMD 2XA3A 4AIXA 3BP7A 2WAQA 3K4ZA 1YY8A 4LLDB 2ADFH 5GGUB 2EP6A 3FT4B 2BM3A 3WL9A 1OARH 3KW7A 3VFNB 4FABH 1VFAB 3L4XA 2FO4A 2VR4A 2VZTA 4M93C 5KS9A 2I5YL 1V54B 3K46A 1V27A 2ICES 3FSVA 3R7RA 1KGIA 1V7NL 3TFKC 4BKSC 4F33A 4GW5B 5GSRA 1HI6B 2XWTA 5I24A 4OM1L 4ZX5A 1E30A 4XZUB 3U7AA 2O4EA 1GKOA 4B6ZA 5CBAB 3MV7D 3GMMB 4OCNC 2ITDA 3DGGB 5K9KA 5ICXB 5F6HI 3AU1B 5B8CC 4BWWA 1ZVYA 3WN5A 4FXTA 3D1MC 4FDWA 3L13A 4G1MA 5EBMB 1EO8L 1H3VA 1PF3A 4DVBA 1QA9A 2FWOB 1R3JA 5EORH 1N5AA 1F11B 1J1XH 2GUOB 1RMFH 4FP8L 4YAQA 3QQDB 1VCBC 1BZ9A 1T03H 5EFIB 1GC1L 1XGPA 2X4TA 4G1EA 3DHMA 1HOCB 3GMNA 3KLQA 2Y07H 2XBZA 2ERJB 1ZGLP 3WS3A 1HNYA 4HZ1A 5K59F 4PP1D 2VR6A 1JD9A 3DBXB 4UCFA 4PG2C 1P4BH 3WENA 2HG5B 1AY1H 4PJEA 3VNZA 3ZZLA 1BAGA 4NQQA 1Q9KA 2WZ0A 3Q6FB 4XWOC 5KVFE 3RNQB 3HUJA 1OB0A 3D09A 1VEMA 3LZLA 3NJIA 5DHDA 1QLEL 3QDME 2UUDH 5FYJL 3GXIA 5TH2A 1NIEA 1UCTA 4HUKB 5T1KB 3FTVA 2YGQA 4K4KA 4I18B 2ZCLL 4WUUA 1BW8A 2HT3D 1LNUA 5FA3A 2B9BA 4W9KC 5ICYB 1WT5C 4M6OL 4Q9RH 3GK8L 4L9LC 2BVPB 1UEMA 2A0LC 5I1JL 5DJ2A 3UG5A 4ZFFB 4UMSA 1C5DA 2DKMA 2HUHA 2F53A 2NRDA 3Q1SL 4U1LA 2HPTA 4FG2A 2NQDA 5DFVD 5KBPA 4AEIL 1P9MA 4YSUA 3G5XB 4NQCD 3ULVH 3DECA 5FM8A 5EU3A 1YMHA 3FO9A 4LMQE 2OI9B 3HPLA 1JBJA 4FZEL 3CHPA 4W9ZA 4DCQA 2V2TB 1YNKL 5DD6B 5DWUH 1JF6A 1CD8A 4FFVC 1YEEL 4Y89A 1I8UA 2D4FA 2E9GA 3HBPA 5FW7A 5HI3C 2OK0H 1KWKA 4FQXC 4XH2A 4GO6B 4LLUB 3T3MF 2DM4A 1OARL 4FABL 1RUMH 1MIEH 5F0LB 4IRSB 1J9QA 5DD0H 3WNIA 3CSGA 4KPHH 3RKDC 4E9RA 2X89D 2WQAA 2XV0A 3KLKA 4Y5YB 1BQLH 2PCFA 1Z9LA 3ROOA 1J87A 3CFDB 3K8LA 5C0DB 1DSYA 4LOUC 1EAPB 4HS8H 4O5LL 3NACH 1HILA 4KO7A 2E9BA 3HPJA 4V2CB 3VRJA 3VFMB 3WU1A 3S97C 5D7JD 1PQZA 1TQCB 2CDEB 4DKAA 4X4ME 3OJMB 1ZOXA 3H8NA 3KPRB 3AQDA 2NTFA 3V7AG 1FZKA 3QCVL 4NBYB 3DJSA 4XBGA 5GISH 3NJVA 3TNMB 2YRZA 3SDAD 1J1XL 1IMHC 1UUSA 4NKDB 1T03L 2X6AA 1CFQB 1OLZA 3KEHA 4MCYA 4KI1A 2IBZY 5T3XD 3MA7B 4YFDB 1ZT4B 1T0PB 4YHZH 4MJIA 1IB5A 2XKSA 2Y07L 1UZ6E 4AT6B 3ZIYA 2JWYA 2YKLH 4G6FD 5EZPA 4OZHA 5LBVA 2O61B 1P4BL 4J3OF 3MREA 1XGZA 2NY2D 2HMID 1FG9C 2JXMB 4BYHA 3F5WA 3K72A 1EEYA 1GYVA 3REWB 1U93A 1ZEAH 3CFQA 3B2UD 4KNUA 4M8RA 2C9UA 2ENJA 4PGBA 3BE1H 2IQ9H 4TKWA 1OM3H 1X4XA 4YN3A 4PJCE 2WVVA 2HKHH 2ADJB 5IQ7H 1E3FA 4I3RH 1KEGH 3VU1A 5HP5A 1Y6KR 3MV01 4NBXB 1T7ZA 4JRYD 4FQCH 5AOJA 4KK9D 5F7LB 3V10A 2Q0ZX 4KVCH 3WAJA 1PMYA 5DJXA 4DWHA 3W57A 1IEBB 3FW6A 1BOYA 1NBVH 4NDMA 3L4WA 3R1GH 3IAPA 4FQLH 4HCRH 1NEZG 2WXQA 4P2OC 2FJSA 1F58H 2KLRA 4NZRL 1G7JB 4AYEC 3JV0A 2J88L 2Y7LA 2VXTH 3BH8A 4HKXA 2YO3A 5DD1H 4DQOH 2BS8A 4QHMB 4DPRA 3ULVL 1C7SA 3QB7C 2WXRA 2FO8A 3CHSA 2X4OA 3A4EA 4U6YB 2F7OA 3KPRE 1RZKH 2ZUTA 1G1KA 3MBXH 1R17A 1PKQA 3PJNA 4NPJA 5E4IA 3OM3B 4QWWC 1NANH 5C6TH 4HIIB 4XGZB 2HWZL 3ARXA 1E5CA 1RK0A 4NGHH 5EC2A 5HTSA 4FXKC 3T77A 2MCPH 1L7IH 2A73A 4ODXB 1OLLA 4MS8C 4DEPB 5DD0L 2P1YA 3PFQA 3S0PA 3F12A 3BPLC 4JG1H 4CKVX 4P0DA 1NANI 1BQLL 5HD8C 2BOCB 2M26A 1ONQA 2OP4H 2Z91A 2GJ6B 3TZVA 2PO6C 3WUWG 4FG6D 1G9NC 4YNYB 1IAIH 2OKMA 2QGDA 3FPYA 3GWJA 5IB4B 4HWUA 2BWDA 1WVZA 3PFUA 1SY6H 5KOMC 3G5YA 1O6VA 4YSRA 4WEUD 3NCBB 3E9TA 2APVA 3IGLA 1ZHNB 3RIKA 2IANA 2VUKA 2CR0A 1E5ZA 2DWEA 3EYSH 1YEDB 1LK3H 4OUUA 3ARSA 1MCPL 2VE6A 5AYQA 4WSJA 3T4AA 4GG6B 2EXWC 2F54B 4RFNC 3DHJA 1B88A 1CG9B 4JKPH 2J20A 1J8RA 1T66C 2N4IA 1FVCA 4GAYB 3ARBD 3NSYA 1AIFA 3PAYA 1VHPA 3C60C 1KIPA 2YKLL 1MUJB 1NGPH 4NQUA 1RUPH 5C08B 1YEIH 2X4PA 3NSCA 1X9QA 3R0NA 3T0EB 1R46A 4M9PA 5DJZB 2A74C 4KKBC 4CBZA 3EH2A 3Q43A 2BW4A 2VLRB 2ID5A 1R5WA 2SEBA 1T0MA 4OIFA 4XO3A 1EHAA 1ZEAL 4ZO7A 4BELD 4C56D 3BE1L 2IQ9L 1I8LC 4LLQB 5DC2A 1MQKH 4JFPB 1EO7A 2FIKA 2HKHL 3ZJAA 5IQ7L 4I3RL 1KEGL 1M05A 4NB7A 3RTQC 2IOIA 4W81A 4M1CD 1UOLA 1OGPA 5KJ4A 2DB8A 2X10A 3P1VA 3S34H 1K4CB 7FABH 1CCZA 3WJLC 1CZ8H 3MBED 1IC1A 1NBVL 3QIWA 1BQUA 1G6RH 3QC5X 3QRBA 1WCQA 2OL3A 1HKLL 3MJWA 4FQLL 4MCZB 1NPUA 1OZUA 2GJ6E 4KROB 4JFZL 1WC7B 2DKUA 5F44A 4QRRA 2QFRA 3MRIA 1BX2A 2NZ1A 3AG4B 4XAKE 1ZV9A 8FABB 3GIZH 4R7DA 1A8JH 4URKA 3D07A 3CVHB 4LPYA 3WFDH 4RAVA 3G04B 4ZFQA 3RX8A 1QSZA 1OTSD 4BBWA 2OR7A 4NGHL 4YHKH 5I16A 4MRCA 1OTTD 2MPAH 3BAIA 3WEXB 4U6HB 3OZ9H 5FV2A 4GG6E 1L7IL 2F54E 4W9GC 1C08B 3D39A 3JSSA 4PVBA 4ETQA 2QKSA 4L3EA 4GW4B 4YZFF 4JG1L 3OMZA 5E6RB 4N0YH 5C08E 4Y4KB 4HWNA 2KC0A 1WO2A 2AKRB 4KDWA 4L3CA 3T0EE 5BZDB 4HIEA 1F2XK 4K3DH 3PPEA 4WK0B 2VLRE 1TZHA 2KMWA 1MFUA 3HAEB 5TGBA 3EH1A 3X14A 3VFWB 4IYKA 1UM6H 2VSKB 1EXUA 2B1AL 1UOWA 2BVEA 2R2HA 2R1XA 1WICA 3C12A 4TYUA 2YAQA 1SHXA 3EYSL 1UJ3A 4RNRA 4JLRB 1R47A 3PWUA 5ALBH 5KN5B 3TEWA 4PHXA 3CU1A 2OJ1A 1OHQA 3AREB 4X7TA 4M1DL 1DLHB 2AAAA 4OCXH 1YQ2A 2H32H 3NFPA 2YQ2A 5EU7C 1NGPL 3K91A 1BD2B 4X6EA 1RJYA 4HX1B 4RFEA 1XF4B 2OMZA 1RZFH 1EWHA 2ZXCA 4CAGA 2MNJB 3D3VA 3C6LD 4HEPG 4AYFB 1FJ1B 4KRPB 2JCWA 2P4AB 2CKBB 2FUQA 1MQKL 4ANVA 1YNTA 3U2IA 5FM5M 3M17A 3QZWG 1EZVY 2FT6A 4XBPB 4WWPA 4P99A 3GI9H 4NAQA 2W81C 4PJAB 2K9UA 4LSTH 3SYAA 2WWKT 4OD1H 4XO4A 1TDQA 4PRBB 4QOKA 5FA4A 2VH5H 4PGCA 5AW5B 1OZTG 2PXYC 2QKIA 4HPOH 4UUJB 3SSGA 4PGJA 1CZ8L 2DIAA 4F8NA 2ORBL 1PAZA 5IJVB 3DYPA 4ESKA 3TCLB 4FQQB 2NLJA 1J5OL 1SMDA 3D25A 1HQRB 2EUWA 2EDBA 4PGZA 5D1XA 3O11B 1SEQH 3C5SA 3OKKB 2E86A 2CCVA 4G2AA 4HFUL 1ZLVK 3I3EA 2W9EH 3IN2A 3QYNA 2LHAA 2EIZB 1E0OB 3LZFH 4JY5H 5DZ9A 2WQSA 4C54A 2ZWLT 3Q2VA 4QYOB 4LAQH 2XV3A 3P77A 1JK9A 1BQHA 1DUZB 1XGTB 3UTZB 3LYRA 5AQ0A 4MXWH 1L3WA 3A21A 3STLB 5EO9A 4PJDB 3BN3B 4J23A 2H32A 3BP5B 2QQLL 2BVOB 4JO4L 2YGVA 2JKRM 2W9LA 5AVZB 3HR6A 5JHDA 1EO5A 1H9VA 4XN7A 2ZWYA 1NUNB 4BKLB 4HD5A 4N0YL 4YLQT 3TS8A 2AV7A 1FIEA 2GQHA 3BSZH 3P69A 1U8LB 4K3DL 2WC7A 4OV5B 5E7BA 5EZLB 4GYBA 4LHJB 4FNLL 3RURA 2BINA 4X6CA 4KX7A 1UM6L 3HBZA 3L1GA 4GRWF 4C83B 2AAVA 4MMXB 1IC0A 1CICA 4Z7UB 3G5VB 1XL4A 1NM4A 4PJAE 4EIGB 1XGUB 2NY0B 5DJYB 3F01A 2AP2A 3HLAA 1FLRH 2HFEA 2BSRA 2O6DA 3QXUA 2W0PA 2QADB 1GA2A 4OCXL 4JHAH 1SVBA 1RZKC 2DI7A 2OW7A 5HI5C 3C8HA 4MMZA 5D6DC 3ZKSD 1F6FB 1RZFL 3B7TA 2FYYB 1HC1A 5GS1A 5I66B 3ECUA 3LDBB 1MLBA 2ZIDA 3H3KA 5JYMA 1FO0H 3UBHA 4M00A 4TTDC 2I69A 4J39A 3EO0B 3NK3A 1W8EA 5T1LD 3HKZA 2EINB 5GRVL 4WI4A 2R1YB 2GI0A 5J5EA 3GI9L 5C7XH 1AQKH 4OD1L 2WLNA 4TNFA 2VH5L 1GAFH 4HPOL 4D8OA 3SDYH 4HEPA 1TVHB 3FT1A 3GNMH 4H13C 5DRNB 4NKIH 3D18A 4ZFZB 1SEQL 1Y6MR 3VD4A 1MEXH 4M6NL 4ZMWA 1P1VA 1JYNA 1YCSA 4R26L 1SQMA 4PLKC 5JNYA 1JPGB 3QZWA 3FOLB 3LZFL 3TA3C 4JY5L 3S3SA 1FNAA 4KGJA 1HL5A 2CO7A 4K2UH 4MBOA 5TD4A 1UASA 4LAQL 2V9TA 1T7YA 2R0LL 4K07A 1AQDA 3WIFB 4PRPD 2FGWL 4QHNB 1WSST 4Z7UE 5DTFB 5KG9B 3MFFB 5BUGA 5CHNA 4WEBH 4F1ZA 4WI3A 3RWFA 2YA0A 4MXWL 4ODSH 4OQ1A 3ZDZB 1KENH 4EN3A 3M45A 4ENZA 4KK8C 4NN5C 4M5ZL 4OKVA 5E08H 1NUFA 3N3EA 1YY9C 2H7WA 2CCLA 3LZQA 1H5BA 3FQXA 1HN1A 5JW5A 2EDRA 4PGEB 3A6OA 1S9YA 2CBPA 3WIIL 5JZ7C 4QRPB 4MQSB 3RRQA 4HK3J 5IBLC 1CDJA 4F7EB 1JF1A 3BSZL 2BNRE 3QS2A 1NIFA 4E9VA 1A3RH 4IRJB 1DANT 1KY6A 2EAEA 1UA6H 5FLUA 3WTSA 4Y1TA 5FIEA 4ZOBA 1RQ5A 2IH8A 5D5MF 3ZHLA 4W9FC 3PNWA 1WAAA 2AQPA 2ZXEB 3GMLA 1O5PA 1G7LB 3DX4A 5HHPB 2B1HH 4Y5XB 1FLRL 1IEHA 1B4JL 3SE4A 4G80B 4YDLC 4OTXH 4NS0A 4TS6A 5L2JA 3LKPA 3FQNA 1CU4H 3BDYH 4IKKA 4JHZA 3MRMA 4OJYA 4F7PB 1Q0YH 3MCYA 4NUPA 5KOVC 4HWZA 2LLNA 3TH3T 3CFUA 3DRTB 2VDPB 2AJYH 4NO5A 3TJEL 2R0WH 4RDQF 1QZNA 3WMQA 1OAZH 2AGJH 4O02A 4YDJA 5I1AA 5I1LA 5C8JB 4PV9A 3RVTC 4PWHA 5CEYA 3TJPA 4RMUA 4LSRL 1E6JL 4OIIH 7PAZA 3ESNA 1PLCA 3JUYA 3GPSA 3MRBA 3F2LA 1KT2A 4NC1E 4EIZC 5E0FA 4F5CA 5C7XL 3FO2A 3ZDZE 5C09B 1AIZA 1LXMA 4JDTH 4TMPA 4DP5X 2NZ9C 3B9VA 3OGCB 5G5DA 5FCSH 4X0KA 4L4JA 1P4UA 4JVWA 1RHHB 3L4UA 3Q2WA 5FHAH 2FZ3B 2HTLD 2N7AA 3RY6A 4KJQC 4BK4A 2J56A 5FGRA 5IVXF 3K6DA 4QRPE 1RZ7H 3FU6A 4GS7B 5I6NA 3ULUH 4NKIL 1L9TA 3KBHE 1MEXL 1WD8A 3EGDB 4PJIB 4WW2C 2KBGA 2X4RB 3RTLA 1JHLH 1NUDA 5I1EH 3EO1B 4UM9D 4WI7A 1EANA 4K2UL 1PG7W 1TZIB 4APQB 4PSPA 4PW3A 4A04A 1I1AD 1QQDB 2YD3A 2NY7H 3AGVA 4O02L 2DMBA 3OLIA 5F0MB 1ZGLA 4ODSL 1CLYH 3BJLA 2OTPA 5KVEE 1J05B 4MAYD 3ZDYB 2BX5A 1QWNA 5E08L 3OZLA 2ZXGA 2D0FA 3N5AA 4FFYA 1FORL 3QDGB 4PS4H 3V5HA 1KWGA 1H8OA 5FHBH 1UWYA 2P5PA 2EYTA 1TTRA 2DBJA 3FCSB 1WZAA 2AJZB 2YGPA 3QJQB 4EBQL 1A3RL 2AEOA 1S8DB 1MCKA 2B16A 1LE9A 1UA6L 3K8MA 3LX9A 4NJAL 4YUEH 4QXTA 5KVDL 4PTTB 1OF0A 2ZSVA 2AJSH 3VI4F 5JLZB 4NP9A 1KN4L 3V5DA 4YSQA 5D96C 4Z77B 2E9JA 4M62L 4W6YB 1D7DA 1MI5D 3CZKA 3PWPA 5C09E 2VRAA 4NLHA 4W4OA 3O6LH 5TDOA 2FBRA 1IJNA 2B1HL 5FUZH 1JDDA 35C8H 2LAGB 5T3ZH 4EUPB 1FL3B 2IGTA 4GRLC 1CT8B 4OTXL 5F1KC 3NP4A 1MHPL 3EOAA