4A2FA

Coriolopsis gallica laccase collected at 12.65 kev
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
496
structure length
495
Chain Sequence
AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPNDPHASLYDVDDDSTVITLADWYHLAAKVGAPVPTADATLINGLGRSAATLAADLAVITVTKGKRYRFRLVSLSCDPNYTFSIDGHSLTVIEADSVNLKPHTVDSLQIFAAQRYSFVLNADQDVDNYWIRALPNSGTQNFAGGTNSAILRYGAAPVEPTTSQTPSTNPLVESALTTLKGTAAPGSPTPGGVDLALNMAFGFAGGNFTINGASFTPPTVPVLLQILSGAQSAADLLPAGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHVFAVVRSAGSSTYNYANPVYRDVVSTGAPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPDVAATNPVPQAWSDLCPTYDALSPDDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Changes Caused by Radiation-Induced Reduction and Radiolysis: The Effect of X-Ray Absorbed Dose in a Fungal Multicopper Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords LACCASE
total genus 137
structure length 495
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2fA03
1I53A 3NJNA 1NIBA 2YARA 3NJGA 2IWEA 1OF0A 3RYMA 4BK5C 4A2EA 4E9QA 1JZGA 1OCOB 1ILUA 3FSZA 3X1EA 1IBYA 2CUAA 2PPEA 4BDVA 2E86A 1CYXA 2OV0A 2X88A 1JXDA 1PF3A 3OMIB 9PCYA 2IAAC 3WKQA 5B7FA 1J9QA 4YL4A 5I6LA 2B3IA 2FNWA 2IH8A 1NPNA 2YAEA 1A3ZA 2P80D 1XB3A 3IN0A 1L9QA 2HXAA 4NERA 4DPAX 5B7MA 3ABKB 3FYIB 2W88A 1ZDQA 3MX0B 4HCGA 2XX0A 1JZJA 4FAAB 1FA4A 2BW4A 3AG3B 2EILB 4M4RB 4N8UA 4AI7A 2CAKA 4PCYA 3GXUB 4QLWA 1DYZA 5I6PA 2Q9OA 2R7EA 2UXGA 4MFHA 1PZBA 2AFNA 2GBAA 5B7EA 4HAKA 2VM3A 1WA2X 2XXFA 1EZLA 2DWTA 1SDDB 3FPXA 2DWSA 1BXUA 4HHWA 2BWIA 2HX8A 4X4KA 4BDVB 4HIPA 3T6WA 2BZ7A 3HB3B 2IDSA 1DZ0A 2CJ3A 1JVOA 1W8EA 2MRYA 3PXLA 1AZUA 1RCYA 1SF3A 4UANA 3KW7A 1GR7A 2VW4A 1V10A 2BWDA 4A68A 1PZCA 4DPCX 4E9WA 3EF4A 4WKXA 2FT6A 1RZQA 3IE9A 2VW6A 5B1JC 4E9YA 4YSDA 3AZUA 3UAAA 1GW0A 1V55B 2UX6A 3ABGA 3OD3A 3KW8A 4KO9A 2YXVA 2FQFA 1NWPA 2FT8A 1NIDA 2QDVA 4A2HA 3NSDA 4P5RA 1OE3A 3GYRA 4E9TA 4KO6A 3V9EA 2ZXWB 3PCYA 1AZRA 1SDDA 1J9TA 1L9OA 4E9SA 2PPCA 3CVCA 3MBWB 4FA7B 3FSVA 3ZBMA 3ABMB 2EIJB 1WA1X 3X2QB 4YSAA 1NIEA 2I7SA 2HLEB 1A4BA 4JKNA 4DP4X 3UAEA 1MZZA 4DP8X 1CURA 4NAJA 4M3HA 1PMYA 2GC7C 1WA0X 5EHFA 1QHQA 5E9NA 4HALA 1ZPUA 4HHGA 7PCYA 1J9SA 1KDIA 2YAQA 1SHWA 2HX9A 1E67A 2UXFA 1KCWA 3NSYA 4K9JA 1PNDA 3ERXA 2GHZA 1T5KA 3NYKA 1OE2A 3T6XA 3TASA 1W6LA 2FQDA 3CDZA 2YAOA 3NSCA 2UX7A 2AZAA 3CVBA 3ASOB 2XVBA 1E65A 4DP9X 4Q89A 2Q5BA 3PLYA 3NJJA 3DIVA 2EIMB 2JKWA 2XX1A 5I6OA 1JZIA 3U25A 2BW5A 1NICA 2GI0A 4YSTA 3WG7B 3H4HA 3FS9A 1AZNA 3AG4B 1L9PA 1ZV2A 3FQ1A 5I28A 3QJRB 4DP1X 1A4CA 2VN3A 1MG3C 3NP4A 2GC4C 2J55A 3IBOA 1GSKA 1PZAA 2DYSB 2DYRB 3S3DB 2YAPA 2OJ1A 4DPBX 3FPYA 2PPFA 1WAEA 1BQKA 2IWKA 6PCYA 1GY1A 5I6KA 1BYPA 2PCFA 3EH4B 2PLTA 4G7QB 4DP0X 1TU2A 6PAZA 3NJFA 3NT0A 1GS6X 4G70B 2IWFA 4CSZA 4G7RB 3UADA 1OCZB 2VSMB 1N68A 4NB7A 2QPEB 2Y1AA 2LLNA 3OMNB 4GY4A 1ASQA 1JZEA 2XWZA 3G5WA 3PAVA 4KOBA 3S3CB 3SBRA 1AACA 4DP5X 1FFTB 4N4YB 5F7BA 3UGEA 4WTQA 2BO0A 2R7EB 3NJLA 1SNRA 1A8ZA 4P5SA 1AZBA 2X87A 4YSPA 4GXFA 1CUOA 2BP8A 5AZUA 4JHVA 1E5YA 2VW7A 1BQRA 1TKWA 2XXGA 3S3BB 1BQ5A 2N0MA 5PCYA 2GIMA 2PP9A 1PAZA 5D4JA 4F7KA 1URIA 4PAZA 1VLXA 3L45A 5LDUA 1SJMA 1ID2A 2WSDA 2EIKB 2GB2A 2CBPA 1AQ8A 3QQXA 1ET5A 5B1BB 1WS7A 2CALA 3BQVA 1NPJA 3NJMA 4G71B 1RKRA 1MZYA 1SFHA 4BWUA 4GP8B 2JFCA 2W8CA 2ZWNA 4A2DA 2IDQA 3WI9A 4G7SB 3S8GB 3WNIA 3H4FA 1BXVA 3FQ2A 3NSFA 3TU6A 1AS8A 1PCSA 2XYBA 3NP3A 3PPSA 4KNTA 1M57B 2I85A 1OCRB 1SFDA 2J57A 4YSSA 1BYOA 3TA4D 1CYWA 3CG8A 1NIAA 3FU7B 4QKTA 5B3SB 3QJVB 3V9CA 1IKOP 5B1AB 1PLCA 3BVDB 2BP8B 1GY2A 1PLBA 2FQGA 2J56A 2PCYA 4HZ1A 3HEIB 1AS6A 1NIFA 4A67A 3T6VA 4AZUA 1A65A 1YLBB 3NJIA 3UACA 3QPKA 1AS7A 1JOIA 1OE1A 1HAUA 2RACA 2QDWA 5PAZA 3ZX1A 4YSRA 1PNCA 2IDUA 5I6NA 1R1CA 3JTBA 1JZFA 1KBVA 1ADWA 2QPDB 4GP5B 5I5IA 3AG2B 3IN2A 4DP7X 4AX3A 3S8FB 1OV8A 1SF5A 2BZCA 2FJSA 2HZHA 3CDZB 3AG1B 5F7AA 1E30A 1ASOA 2DY2A 7PAZA 3SBQA 1AIZA 1ZDSA 2FWLB 4BWWA 2YAFA 2IDFA 1KGYE 2XLLA 2EINB 1XB8A 2TSBA 3T71A 4F2FA 1IUZA 1XB6A 1NTDA 3QJUB 3DTUB 3X1BA 4A2GA 4KNSA 4BXSV 1A4AA 2UXTA 4ZK8A 2VMJA 2PP8A 4E9VA 5B1JA 2H3XC 2PPAA 3N2JA 1GYCA 2BHFA 5B1KA 3OQRA 2TSAA 2WO2B 2OCCB 2HRHA 2P80A 1AG0A 2YXWA 2PP7A 4F2EA 4TXVB 1ILSA 4YSUA 4EF3A 1AANA 3ZDWA 1W6WA 2XV3A 3QJQB 1AOZA 5I6MA 2DV6A 5D4IA 1E5ZA 1JZHA 5AFAA 1L9SA 3FQYA 2QT6A 2IH9A 2XUWA 4ENZA 1GS8A 4GP4B 1ETJA 4W9ZA 2I7OA 4BWTA 1GS7A 2VM4A 5A7EA 2HX7A 1AG6A 5IY5B 3EH5B 1IBZA 4HCIA 2HRGA 1IC0A 4W1TA 5ANHA 4AKPA 4L0PB 1NZRA 2H5UA 3T9WA 4DP2X 2ZONA 4UAHA 4UF7C 5TK4A 3QJSB 5D4HA 1QLEB 1BEXA 1BXAA 3QJTB 2XV0A 1JXGA 4E9RA 4KOCA 1NINA 4DP6X 3FSWA 1KYAA 2YAHA 1N70A 3AY2A 2IDTA 3D12B 1L9TA 1ET8A 3UABA 4YSCA 2CCWA 1F56A 1PY0A 3PAUA 3WNJA 1X9UA 3CVDA 1J9RA 4YSQA 3FYEB 2BP0A 5I5JA 3FU7A 3TBBA 3X1GA 1V54B 3ASNB 3EHBB 3SQRA 4A66A 3C75A 1RZPA 1PLAA 2A3TA 1XMEB 3TBCA 1UATA 1ZIBA 1HFUA 5AKRA 4JHUA 3NJKA 1TEFA 1MDAA 1JERA 3JT2A 2PPDA 3ZIYA 3GDCA 2XV2A 4RH4A 4HCFA 1JXFA 4YSOA 1SHXA 2B08A 3FU9A 3PAZA 2WO3B 3OM3B 4BXVA 3CZUB 5I26A 4YSEA 2YQBA 1EHKB 4YVUA 1X9RA 4KO5A 1ET7A 2UXVA 3FU8A 2FQEA 4AKQA 5TK2A 3NJHA 1FWXA 1B3IA 1J5CA 2FT7A 3X1NA 5I5MA 3H56A 4KNUA 2AVFA 3OMAB 1M9WA 3IEAA 4E9XA 1OCCB 4CSPA 4A2FA 2Y69B 3ABLB 1KBWA 1ZIAA 3SBPA 1AR1B 1OOWA 3EH3B 2FTAA 4AKOA 3WIAA 1BAWA 2GSMB 1AZCA 2ZOOA 1KDJA 1WS8A 2BP0B 2NRDA 1J5DA 3N55A 1QNIA 4KO7A 1KV7A 1ASPA 1NWOA 4G72B 1L9RA 1NDTA 2XU9A 3AW5A 3WKPA 2J5WA 1JVLA 2H47C 2YAMA 2MTAA 3DKHA 2AZUA 4YVNA 8PAZA 2JXMA 3FSAA 2VSKB 3FT0A 1CC3A 1HAWA 3X1FA 3T6ZA 4Q8BA 1MG2C 1TEGA 1AAJA 1KCBA 1M56B 4GYBA 2AANA 5FC9A
chains in the Genus database with same CATH superfamily
4MAUH 3HG5A 3US0A 2WUBL 5I19L 4D0DA 4OZHF 3FFDB 4WI3A 4X5RA 1PL3A 4NN5C 1DUZA 5DD0H 5LAXB 4JR9L 4L4TB 2P9RA 4GRLC 4FXGA 5D6CA 2A9BA 4XXWA 5C8JB 4Q9RL 5SX4H 4JHWH 3K91A 2XKUA 3P77B 2FBJL 1JYXA 4F57H 3BUTA 4WGVB 1O6SB 4CA4A 4K3HA 9PCYA 5H35A 1DDTA 4TSCL 4N2EA 5TDNA 3CK0L 4DKFL 4GLRH 1IBBA 1H8SA 1NKRA 2YOCA 2G4EA 2E0PA 4Y9FA 5F9WC 4AJWA 1QSEB 1QWUA 4X8JA 1I8LC 1BV8A 2YAEA 4ODTH 3MRHB 2C1OB 1BF5A 3NGBC 3N43F 3ZN6A 3PWJB 4PV9B 2G60H 2CBTA 2XA8L 3HE7D 3HS9A 4XXCC 5BQDA 4Z7QB 4P2OC 4DUVA 2E5EA 3C87A 3TJEH 1AGBA 4M7LT 5CGBA 4MJIA 1G1OA 1KTLA 5F96H 1GGYA 1VADA 4NKOA 4AYFB 1O9ZA 4W9GC 5BVJA 4DKTA 2DWXA 3VXUA 4HWZB 4IGBA 3UPRB 4Z3EA 2Q3AA 3TH4T 4EXPX 3KPRE 2ED8A 4FTVB 4ZUTB 4LCCB 1OWRM 1E27A 2GBAA 5IB2A 1TQBB 1MRCH 4DJMA 15C8H 5BV7L 2P8PB 2XXFA 2VDLL 3TC9A 1TKWB 2EC9T 3D6GA 4KTEH 4OD1L 5CZVL 1RJZB 3RA7L 3RWHA 4RGMB 4AEFA 1WYJA 1KNOB 4QEGA 3IDNB 5B4MD 3MGOB 2MRYA 5E2WH 4WVRA 3BVTA 4LRIC 3V5DB 3DDGA 1T5XA 2R2EB 4R7DA 3RWIA 1NA8A 5GS0H 4DPCX 4WDIA 4WWNA 2VQTA 3CFDB 1LNUB 3IE9A 1HQRB 4O2CB 2ZX6A 1XCTA 4LCUA 4E9YA 4WNQB 5GS0L 2X7LA 2VXQA 1ZJBA 3ABGA 4HJ0D 3VFSB 5HHOE 3TV8A 3TTYA 2EKSA 1YEWA 2W59A 3IJEB 1RPUA 1YN7B 2K45A 1X5FA 3HCVB 4QRTB 4N26A 3U36B 5DO2C 5DQDH 1MFCH 3CFEB 5I74C 5AAWA 1U92B 2MQ0A 1DVQA 3IDXL 3H42H 4K8RH 5DT1H 4M1CC 3TZVC 4I0PC 1XFPA 5EOCL 3MR9B 2BVEA 3FFOA 1XXDC 2PR4H 4J28A 1CICC 3HG1B 3VH8G 3FO1B 1KJ3H 2BSCA 1BVZA 1XGTB 4XMPH 4YSAA 3U7WL 4ANVA 2BSRB 2O5NA 2EE9A 3FUJA 5D6DA 5FCSH 4DP8X 2OI9C 2ROYA 2AK4E 4CRPA 2X9XA 5E9NA 4HALA 4MMYB 4Y7OC 4NN7C 1U6AH 1FFQA 2WN3A 4RA3A 4J6RL 4TPRL 1CIUA 1E67A 2EVFA 1PNDA 3BDYL 2J7LA 3HKFA 3INUH 4OAWB 3A6CH 2FQDA 2ERJB 2PXYA 5JYLA 1QSFB 3ASOB 4ZG1A 5C0AA 3VXQA 5DGRA 2NY7H 3NJJA 4N1HB 2YPVA 5GGSY 5I6OA 3RPBA 2EE3A 4YHIB 3WG7B 4KNQA 1I7UB 3M46A 3DGCR 2RB8A 2R4SH 3FQ1A 1G7IB 4FG6D 3CFCH 4IBWA 5CSZB 1OK8A 3LQZA 4ZMLA 2VQ1A 3W2DL 2LU7A 2RAMA 5J12C 4JDTL 2J44A 1FO0B 5L2KB 2DL2A 3BE1H 4F7TB 4YEFA 5E2TH 2VABA 3FPYA 1U8KB 3C60B 1MCOL 3EYUL 3GXPA 1WBZA 1ROCA 4Z77A 4U7KA 2N7SA 3MLWL 2XYCA 4HIHB 2ZWZA 1HWGB 4HJJL 5GSRB 5LGJA 2VSMB 3ULUH 4NB7A 4ODVL 4PY7A 1E4XL 2Y1AA 2W07B 3FQRA 2CDFA 4YZFE 4HUKB 5AQ0A 4P5SA 3RL2B 4I3GA 2XIBA 2DQTH 3D4ZA 2K0RA 4HQQH 1E5YA 4PREA 1BQRA 3EJZD 1HKLH 4RRPA 3LS5H 3UERA 4ZXBD 4WK0B 2H0JA 4P0DA 4P4KC 5ABZA 5IB2B 4FQIH 4PRDA 1CFQB 3DPBA 4KVNH 3MROB 1BJMA 5BZXA 4W6XB 3BCDA 2X4QB 1EV2E 3MZTA 1LO2H 4M7JL 2E4TA 4ZX5A 4ZTOL 3P4MB 4PRNA 1YNTA 4AGNA 4CC4C 3GHBL 1E42A 4MA1B 3F7RA 3U9PH 1SPDA 4ODXB 1MCWM 3ESUF 4N2OA 2CR3A 3RDTB 4NSKB 2HKAA 2XA3A 1KELL 3DX9A 3MRQB 3QHTC 1LO0L 4NUMA 1FN4A 4R7DB 4IOFD 2LU4A 2JFCA 3RWIB 2CPCA 3T8MA 2IDQA 2VM9A 4G7SB 3QQ9C 1X5GA 5LCVA 5GGRA 3WLBB 2J1YA 2KLSA 2EUZA 3FQ2A 2F68X 3L3IA 2C5DC 2WSPA 1GKEA 3PPSA 1TZ8A 4B5ZA 3ZIMA 4KI5C 5E8PA 4I8DA 4FFZH 3KBHE 3CPLA 2BH0A 1MFEL 2E7HA 5DJYA 4PV1C 2AQTA 2KC0A 2ZOLA 5F89A 4YC2C 1KGXA 1IBGH 3MREA 1SOQA 3THML 3FRPG 4NQDB 1KN2H 3COOA 1JP5A 2H45A 2HSIA 2BP8B 2O93L 1A6TB 1TQCB 1WFOA 3G5YB 2ZXEB 5GJTH 1DFBH 4N1EA 4P3DA 5F3FA 5IW6B 4X0KA 1CGSH 3D4CA 5MENE 4ZFGL 2A74C 2IANB 3THMH 3MUY1 4PR5B 3BZFB 2MOVA 3MLZL 4OCSL 3VYOA 1MJ8H 4RWYL 2GBUA 1N5AA 4LPXA 1LL1A 3MBEB 3KJ6H 4JPIA 2B2XL 3JTBA 4XN5A 3W82A 1PBYA 1MAKA 1A7RL 4LSDA 1T7VA 5EO0A 4AQ8A 3VFOB 1VGKB 1NFIA 5TGBB 4BFOA 2HZHA 5DJ2A 1IEBA 1KTLB 1P4UA 2EE6A 1F86A 3BKML 4IJ3C 2I9TB 5D1XC 1LDSA 5EZJA 1AIZA 4I0PB 3L3JA 1ZDSA 1GOGA 2BM3A 2FO4B 2NSQA 1W2KT 3SDAD 4PCKA 3L9RB 3UTPE 1E27B 3L7FA 2EINB 1OAYH 2NDFA 2VT0A 2X2UA 4EZJA 1IUZA 1H3PL 5CILL 2B1OA 3S96A 4HK0B 3X1BA 4XWGH 2CLRB 4MASA 1J8HB 2PXYC 4IBLT 1W16A 4YUEL 3WJJA 3H2WA 3P9WB 4DCQA 4X4MA 1K8IA 1WAAA 2VDMB 5DURD 1D5MB 3KPNA 3DURA 3RL1B 1ML0A 4EZMA 3WKNA 5F7WC 1A7PL 2X4NB 1CLZH 3MCG1 1S7UB 1ZHBA 3QZWB 5LAXA 4M8RA 4P5TD 3BUIA 4PVLA 1Y07A 4WW2A 5J13C 2BX5A 3B2DC 3HAEG 3CZJA 1YQ2A 4XPTL 3E2HC 1KXQE 1UH3A 2WC7A 1O9WA 4FCHA 5CLZA 4PJXA 4GMTH 5I6MA 1DBAL 2PWEA 3N91A 2ICWI 1L9SA 3BSGA 2QQQA 4J8RA 5I82A 4HJSA 1RURL 1GS7A 3MLXL 3NESA 3ZDYF 5C3TA 1VFMA 5HGDA 1XXFC 1RSFA 3QZOA 4AGQA 5J12B 2PUQT 5CZKA 2MPAL 4MS6A 3JZYA 1JFQL 5I8CB 3U1QA 3S8WA 2RH0A 2HRGA 2R2BB 2Q8BH 2GBTA 4UQ9A 4Z0XB 5T1MA 3VSTA 4KC3B 1R5VA 2BVPB 3O0LA 3CVHA 3W2DH 4RGNC 4Z7AA 1BXAA 3Q3GA 2YUXA 4Y16A 3S97C 4NZJA 3GMNA 3LEXB 4PLKD 4Z18A 1HEZB 4A7VA 1N70A 4NFCA 4N3UA 4NXKA 3C5JA 4YDKL 1M6OA 4GW1B 3KPRA 3P4OB 2FWOA 3EFFA 3MV7D 3WNNA 4KK6D 5MI0C 3QUXC 1TLKA 2FDBP 1JYVA 1A3QA 3QEQB 5GQBA 1T04A 5IBUG 3QORA 3B7SA 3SPCA 3FU7A 5KW9L 4ABUA 4A66A 3O4LB 1P5UB 3RGVA 3X3GL 1Y0LB 4WHTA 5F71A 4NS0A 4UNTA 2MPAH 3G5ZB 4ERSL 3BP6A 3OKKB 3L1FA 5E1GA 3HNTH 1SEBB 1QRND 1ZIBA 4WGKA 5D2NE 1TU2B 3PL6A 4NEHB 1E9PA 1N6UA 5GS3A 3RVTC 2VLLB 4XPFL 2X2HA 4KVCL 4ELDA 1YEDB 2ATPB 2WP3O 2X4RA 3GMRB 4UZSA 1MEXL 4JQIH 3OLGA 5T5NG 3ZR6A 4XXCA 1HSAB 1T1ZA 3DHUA 5FA4B 5EULV 5ESAB 5IM7A 4GAYB 4ZSOB 4UYPA 5T5FL 3NZHL 1HXMA 1MRCL 2CRZA 2FD6H 4NN6C 4XCFH 3EG9A 3NJHA 2ENYA 4XNUL 3LZRA 1Y7VA 2AKRA 3LN5A 4YHLL 3K72B 1BW8A 4HUWB 1EEUA 1JNNL 3CC1A 1JN6A 2AVFA 2WBXA 4GOSA 5IMMB 3RIFK 5T5FH 2JKJA 4RMTA 1CFBA 1JPSL 4X7TA 4ZO9A 1YMMB 3TVMB 4TLTA 2O6EA 5E7BA 1UEYA 1YEFL 3CHPA 3L3JB 3ARFC 4XXWC 3K6SB 1PFOA 2NPLX 3EO0B 4ZMZA 2F54B 3T77A 4OM1H 3ZTCC 5C0JB 4G1EA 3SPVB 1KDJA 2HT3C 1WFIA 1S7RA 3V4UL 5E0QA 1OT1A 5F21B 1MFEH 3KWUA 1NWOA 2HVBA 1U30A 4M7JH 5DI8B 2OM5A 1RERA 2X4NA 3D9AH 3DUUB 3HVNA 4M6OL 3DPDA 3RDJA 4WV1C 2ZAGA 1GZHA 3IFPA 5MERA 1G7JA 1PYWA 3HR6A 4X7SL 3MRNA 4BRVA 4K23H 5SV4A 1E3FA 4HUWA 2J8OA 4MJ4A 1AAJA 5SX5H 4QHKJ 4H8WL 4KXZH 3ARGB 1YN6B 4XVOA 1SDYA 1F8TH 2CUHA 4P9HC 4AJVA 1DJXA 3KCPA 5T1KA 1CO1A 5TF1H 1C5DB 4ZS6D 5I1CL 5JHMA 1CR9L 2P49B 1EWHA 2P26A 4PSPA 1XGRA 3DV4A 3QZPA 3KZ8A 3UTQB 3EOBA 2Z9TA 3DXAD 3JV6B 2OTPA 3V6OC 4IDJH 2NTFA 3RVWC 5C6WH 3FB8B 4P4KA 5F89B 1WAPA 4NO0B 1WZLA 1HEZA 4QAWA 3V55A 5B7MA 3HI6H 4G8AC 5I15H 2CUMA 4Y16B 5E2TL 5EU4A 1K4CB 3MLRL 3DSNA 4CVXB 4LKXA 4JR9H 3O9WD 3OKOB 3OXSB 4ORGB 4BZYA 2J6WA 4G8FB 4YX2H 4GPVA 3MRJA 4PJ8D 4QLWA 2MHAB 5ICZA 1UA6H 2EABA 2G4GA 4Z78A 5K59F 2Q9OA 2FWOB 2R7EA 2OZ4H 5BRZB 4O9HL 4YK4B 1HH6A 1HHKB 1EHLH 2EUVA 1WZ1L 1FZKA 3BH9B 1WA2X 4M6NH 4D3CL 5KJRL 2CH8A 3AC0A 5I1IL 1TO4A 3BAEH 5C08E 4NYLA 2OZ4L 1AI1L 3N1QC 1X5KA 3UYPA 4FNRA 5C0CB 3BPLC 1KEML 2ORBL 4TNVF 1ZLUH 1DZ0A 3ESVF 2BINA 1AR2A 1W8EA 3B9DA 1UCTA 4X8CA 2FB4L 2NCEA 4KUCF 4NDMA 2VLLA 4HVBA 2EUWA 4LPUA 3MOAL 1JCVA 4GQQA 1V10A 3NCFB 2VISA 2OL3A 3BP6B 4WTWA 5AOMA 3OHXA 4A68A 4EUPG 4Y4KC 3HBGA 2MQCA 4ZXBA 5GGQH 5ACZB 1KEGH 2BFVH 1N6QH 1F18A 1UWGL 2UZYA 3QUGA 4I1NB 3RUGF 3DX9B 1F11B 1W0YT 3FT4A 3N40F 4HKXB 4GSQA 1U8QB 4JCMA 43C9A 3MV9A 4YAQA 4APQB 4PJCF 2YMTA 1OGTB 4J3XA 1MHPL 4G9FD 4QR7A 3QT2A 4UTAA 5KSAA 4M02A 3VXRD 5IV2B 1DO6A 1ETZA 2WXOA 5E1AB 2P43B 1HDMB 3A4DA 3QIUB 4G7YL 3O81A 4HKBB 3D85D 4HS6A 4JRYD 3TO4A 3ZTEA 1A7NH 3VXQB 2XQYK 3GSQA 1NCUA 2E9BA 1NFDF 2ITDB 3V9EA 4O02H 4AGLA 2Q10A 3WUWG 3BH8A 1KIUB 1TT6A 4U6XB 1RH8A 3NPSB 1G7IA 5DMKB 4AT6A 2R1XA 4GRWB 1I7UA 5IUSA 1YYMH 3VGFA 5C0RH 1FDLL 1U58B 1MW3A 3HC4H 1IFRA 3D85A 3IK2A 4JG1H 1OM3H 1ZANL 5B4MC 3N85H 3AM8A 1BCIA 1JPGA 2J1XA 1N9PA 4J12A 4TRPL 3ZTJH 4EI5C 4Y5YB 4F1ZA 1HYSD 4DP4X 1Z9NA 4UQ2A 1N5YL 4XBEH 3DSFH 4ONGH 3PU7A 2P5PA 5KVDL 5EHFA 5E4EC 1J5OL 5JXAH 2YPVH 3L17A 1U3NA 1YNLL 4AENA 4OGAC 2ZCZA 4Z7VA 3K71A 3FOMA 4L3CB 5I23A 2YKKA 1XBRA 1Q9KB 1QO3B 4TOYL 4F93B 1DLHB 4MXQC 4XMLH 2AZAA 4ZFGH 1MKFA 4U0QB 4Q89A 3UAJD 3JWNG 5SWQA 1T7ZA 2FEEI 1TLMA 4XZ4A 2CKBB 2EIMB 2I27N 1TZHB 3GGWA 3ARDB 2VDMH 4Y8AA 5IMOB 2BY1A 1P1ZB 3LKPA 1AC0A 1AXSB 3KLSA 1KT2B 4UNVA 2O1AA 3Q1SH 3RWDA 1A4CA 3TEWA 2E56A 4JDZA 4OH2A 4XP9L 4CADA 2FZ3A 3V5HA 1O7SA 4GG6E 4B9IA 5FO7A 3W38A 2M26A 1JD7A 2DYRB 5T5NF 2OPCA 3WUWB 4IBZA 1AQHA 4LRIA 3D9AL 2VJXA 4P99A 1YEJH 4N8CH 5EG6C 4JJHA 1EJFA 1MRFL 2NZ9D 4J8QA 3SKJL 5A2BA 5EF0A 1QFWL 4MQ7A 2YXMA 2PLTA 4EUPA 1CD9B 1MCIA 4TVUA 3AS3A 3FL7A 1UM5L 5D1ZB 2WKGA 4L1LA 3LKSA 4Y1AA 3RB7A 4CSZA 4IBTA 1MJUL 3VUAA 6FABL 3HMXH 1F3JB 1KLUA 4F80A 1QR1A 3FTXA 4NPJA 2BVUA 3DJTA 4G5ZH 3WKYA 2YSSB 4IGBC 4ZUTA 2NUTA 5IJVA 3O2WL 1YA5A 5DEFA 4FQXD 2XN9B 4OGXH 2JNZA 3GXFA 5C9KA 3WJLA 3IDJB 4WW2F 2AJUL 4GXFA 4I5BA 3CDGB 4M29A 3QQ4A 3WTTA 5CJ5A 1DVFA 3VD0A 3NABL 4OW6A 3F5WA 1M4KA 1PZSA 3CZNA 2Z1PA 5HYQB 5IP4A 3VVVA 5D4JA 4UQ3A 1XGPB 1VLXA 3L45A 3WEMA 2R2EA 1D7CA 5D7IF 3MLYH 1GL4B 1HYSC 1O7DE 4Q0XL 1QG3A 2J6EA 5D7JC 1OSPH 3S37H 3LPOA 5GS1B 2JCCA 4PTTB 4XBMA 1Q0YL 4NXSA 4OB5H 4MAUL 2Q8BL 1WFJA 4OJAA 1VRSA 5DJDA 5EIIA 5IR1A 1DBJL 2W8CA 1KEGL 3QI9D 5CD5C 1L0YA 4GH7B 3WS3A 4EJ1C 2ZE0A 1YEIH 2OXHB 1CFTB 1U8KA 4ZFFA 5HHVH 3GSQB 1E6OH 3MNVA 4HUCA 5A2CA 3NSFA 3TU6A 4PS7A 4AEHL 3NP3A 3CE1A 3F7YB 1N7MH 1M57B 2VLRB 2FATL 3GMPB 3MQIA 2VDQB 3P9MB 5DMKA 4CC1A 1TTAA 4L4JA 4UT7H 5JIHA 2BVQB 4NM4H 2JKLA 4MAZA 1HH9A 4FFTA 4QOKB 4WFFE 3LRLA 1JHLL 4MX7A 3VGGA 4GRWE 3CFKA 1YPZA 3ZE2F 4OQTL 4Y19E 2CPUA 2H26B 1S7WB 2XETA 2YD5A 2AXFB 1BGXH 4HZ1A 4Y5YA 2IWGA 2CBQA 4TKWA 5CEXA 2WYZA 2HLAB 3B7TA 3HEIB 4I2XE 4JG1L 2FGZA 2WNXA 4JRFA 1O6VA 2VYRE 2CIKB 3FTSA 3MV7E 3NJIA 3BEWA 5KSBB 3NAAH 4X80H 4P2RE 4OI9A 2J73A 1HAUA 4ZPVA 4YHKL 4PV9A 2BY0A 2YK1H 4X6DA 4CU6A 3U79A 5A6LA 1JZFA 1Q1JL 2ZKXA 1NGPL 2QSTA 3MJ6A 3LEYL 1OZUA 1ZA3B 1JNHB 2GCYA 1NFAA 2BHZA 2YD1A 3I6KA 4S10A 4AX3A 3HI1A 1I1AD 5DQ9B 3F65A 1LWJA 2BP3A 1ZK9A 3QC6X 1R4XA 3SYCA 3VXMA 3MRJB 3ZTNL 1INEH 2KZKA 5HGAA 1ADQH 4R8WL 5BPPA 5EF2A 2XKNB 4JZJC 1FF5A 4GMSL 1U3HB 4X6CF 5TTRA 2TSBA 1ZE3C 5IKCB 1F97A 3CHRA 3MV8A 1GSMA 5ILTL 1JPEA 1SUHA 5EEYA 2XG5B 4RVBA 3D3VE 4EBQH 5JW4N 1HZKA 3CSYB 4JZNB 2XVKA 4LVOC 1UB6B 3V5HB 2YMOA 4WNQA 1JTTA 2HLFC 1RMFL 1TPXC 4J3VA 3TWYA 4PRID 1H6UA 3OTTA 2HH0L 4PCSA 1DQJA 2L7JA 1KGIA 3BMVA 5DEFB 2EDQA 1AG0A 5KJ4A 2YXWA 2NUTB 3IT8D 1SXCA 3MCYA 4JFFE 4PD4K 4PLOB 4F2EA 5IJVB 1MFBH 1XSIA 4X0NA 1OAJA 4QRBA 3LQMA 5HHQA 4LCUB 1F3JA 1KLUB 2XV3A 4XWOD 3RX9A 5IJDC 1YMHB 4JLRA 1JZHA 1R9FA 2XWCA 4MNHB 3VSUA 3C6SB 5I17A 1MI5D 4FJZA 2IQAB 2R0ZH 5FO2A 3Q2CA 3CDGA 4GSXA 1QWHA 1MIEL 4HCIA 3GMMB 3PGFH 5BOZG 4P23A 4Z3HA 1FORH 3V8OA 1EFXD 3FO1A 3LSOB 4LKCB 1MCCA 3LRKA 5IMKA 1RIUH 4POUB 4XBEL 3FT1A 1QLRB 5DR5L 2F5AL 1CVSC 1VESA 4HWBL 4N25A 4WWKB 5J3HD 4JRXB 2G0LA 5D1QC 3RVUC 3D12B 1HILB 1L9TA 4AMKH 1OAXH 1WT5C 1QUPA 1UASA 4C8XA 5FO8A 3UABA 3K5RA 5CEYB 2JH2A 3L54A 4EIBA 2NT1A 2PO6D 3ET9F 3HPJB 3T8XA 4ELMA 4LL9A 3S3SA 1QO3A 4JL1A 2X4UB 3TBTA 3N3EA 1BAFH 1GKOA 4NN7B 4O5LL 3ASNB 3ZZSA 2DTML 4JFZH 1DDHA 4FG6C 1J8KA 4Q6YA 1IGFH 1URLA 4OI7A 1A9EA 1NMBL 4XAWH 1NGQH 2AV1A 2EIEA 4PP1C 1QR4A 3IDMA 3QQDB 2CO2A 3CXHK 2IGFL 4XVTL 3WTSA 1KPRA 1EEZB 4L9DA 3QHZH 4MX7B 3NFPA 2BERA 1XDTT 1CXKA 3EHBC 3TYGL 3DOSA 3REVA 4L4TA 1CFNA 3WN5B 1F11A 3FT4B 4MCMA 4F8TA 4ZSOE 3ARFD 4FG2A 2A73A 3SDDB 5DWPA 3ISWA 1CDYA 1FSKB 1PQZB 4L1HA 1ETZB 5JHDD 4G80A 4PLNC 1IGTA 3AT0A 3UO1L 1P9MA 3MVSA 4EI6B 1KFAH 5I5MA 3FB5A 4LLVB 4XVUD 4B5EA 2Q2EB 1M9WA 4E9XA 1YEEH 3EBGA 3IYLW 4LPTA 1G9MH 2ZXCA 1DBJH 5CIPA 5BRQA 3GMLA 4JFFD 2Y69B 3QNZB 3CH1A 4YE4H 1Q9OA 5IG7B 1RK7A 3PWUB 2P46B 1BAWA 3LH9A 2FJHA 4JNXA 4HCRL 1NC2B 4OT1L 1ICTA 3INUL 3SO3C 4FQJH 4ODUA 3O4LE 2MNWA 5E5MA 5K9QI 1IFHL 1NFDA 1ASPA 1FGNH 2NR6D 3AW5A 1BD2A 3N1PC 3DBXA 4JKLA 4EN3A 1FCCA 1RUML 3OKMA 3QO0B 4GSDL 5FOJA 3LNEA 3GTTA 5FYJD 3CTTA 1K4CA 3LEVH 5T3XH 1DVFC 2AJXH 2J1WA 3VXMD 1CC3A 3ULUC 4HZLB 3BIBX 4L8BA 4GI6A 4Q8BA 1TVBA 2VDPH 3T1FA 4B9KC 4NM8L 1F90L 3HUJA 3MRDA 3SHSA 3B9KB 3F58H 2Z3FA 3BP7B 3L3KA 3CFBA 1IU1A 3RNQA 5IVXF 4EDXB 3ALPA 1IAMA 4OUUB 5AUMB 1ZT1A 2Z4QB 3FN0H 1VACB 3NJVA 5K33A 2AERT 5JW3L 3ZKMC 2NNAB 3O9WB 4ZRGA 4F7PB 2ADYA 2JQMA 1I8KA 1P84K 3WHXB 1B4JL 1PF3A 5HHOD 1DHKA 2EC9U 2EDNA 1UJTA 1IB5A 4P5MA 1BZ7B 4YGVA 5B7FA 2WXIA 1P9MC 3AFLA 5KBMA 4C4KO 5DJXB 5JA9A 1A6UH 4YR6A 1J0HA 5G5DB 1CN4A 1FNGB 2A83B 4J3OF 3B7UX 2V3DA 1JHKL 3CC5A 1O6TA 2F8OA 2IVFC 3PG2A 1CK0L 4LIQE 3I6GA 2BSSA 4M4PA 5JQHC 3JWNH 2JKIS 2IDCA 3E6HA 4AI7A 3GXUB 3NA9L 2FR4A 3EJYD 1IEBB 3MI6A 2KLTA 1TNMA 4AVJA 2DQHL 1EK3A 3KPOA 4GUOA 5J89A 2X89D 4M3JA 5EO0B 4X7CC 3T0AA 2R83A 2VKXA 2Z8RA 3IF1A 1HS6A 5B7EA 3G5ZA 3AY4C 3Q8FA 1QPXA 3Q9PA 2G0KA 5GRUL 4MGXA 2BZ7A 1YRKA 3B2VL 1XTMA 5JNYA 1HJBC 1H8NA 1MCHA 3RAJH 1BLIA 1IBDA 1NKGA 3WS6C 1SF3A 4FQ2H 1DE4B 2QADB 5I0XA 3F7PC 4JFQB 4Y2NA 1VA9A 3HG3A 2GJ6D 1CK0H 1E43A 1MI5A 5ADOL 1RULH 1DUYA 1QFUL 5IZ7A 1Q94B 5JPMC 5DC9B 5SWZD 5DRZB 3SDYL 1FL5A 3U7AA 4M03A 4P23C 2ARJB 2H6UA 3VXOB 3DETD 3PE9A 4Z7UB 4U0RB 3H7LA 4A6YB 4JQIA 4ZUWB 3LKQA 5DZVA 5FYJL 3BUBA 2Z7YA 4NO0D 5AZEL 2Y2WA 4M5SA 4JHAL 2HKHL 4K7PH 4OLVL 4K4KA 4QJ4B 5FGRA 1I82A 4KZEL 2PF6A 1DJSA 5GGQL 4PJXB 4HX1A 5ECGA 1ZSDA 1J12A 1R75A 1BD2B 3B1UA 3K2UH 5CNHA 4GIOA 1YYCA 4W4NA 2NY6D 2UZIL 2AI0L 3QUKB 3WCYA 1A4BA 2R9HD 5K69A 1BMGA 1XL6A 3ZT7A 2DJ4A 4NBZB 4ZAKC 1WISA 1AIFA 3V0FA 4X9BA 2WN2A 3MJ9L 1ZPUA 2VZ3A 7PCYA 3D5OF 5IIEB 2BSED 2ZYRA 1X5XA 5CS7A 1KULA 3OAWA 1KCWA 1WIOA 3D50A 4TNVK 3NYKA 1RD6A 1A8JH 1RUMH 1W6LA 2EH8H 2YAOA 4JDEB 4K3DL 3CXFA 4L05A 4ZMTA 4XPAL 1E65A 1FYTA 3QFDA 3QEUA 5CGMA 3PF2A 1JNHA 2I07B 5CGTA 3SODB 1JZIA 2K1MA 5D96B 3MU3A 2NNAA 4F7PA 4L8BB 2VUYA 5IEHA 5AUMA 1H3TA 3EYFA 3TJPA 1BGXL 2EP6A 2DQEL 2ZPKL 1PS3A 2DN7A 3FFCE 3OPZL 1ZGLP 1CFVH 1LO2L 3HG1E 4ZTOH 2J20A 3W9DB 1MCQA 1CLZL 2WPGA 3DJZA 2AQNA 1LDPL 3NAAL 1JAEA 3X3GH 3DVNA 3GPEA 3QJFB 1VFOA 5F9AC 3ARSA 1MFAH 1F58L 3OX8A 4NUGL 1I1YA 4AJYV 4DGYL 3H3PL 4OKVA 1T0NB 3VWJB 6PAZA 2X5PA 3KHQA 1IKNC 1VEOA 1NGXB 4F8LA 5FF6B 3NRPA 4ELKB 2I60H 1V7NL 2QPEB 2XBTA 4G6FD 1DSFH 4QRPA 2ZG2A 3WKML 1N18A 3G5WA 4GG6F 3MUZ1 4ETYA 4DP5X 4GBXA 4Y5VC 3N41B 3D3VA 4PSRA 3CN4A 4GINA 5GS2D 1CFTA 2NQ3A 3M8OH 1P53A 5I0YA 2ITEA 3FULA 5F7NC 5F93C 4FMVA 5LDSA 1SEQL 1DBBL 2F7OA 3EFDH 4FNSA 4GEJA 5IGXH 4YHNA 4QOKA 5A2LH 5L7XL 2BVQA 4FERA 2QGBA 1QSFD 1HEJC 2GTWA 1NCHA 3KE0A 3V0EA 2CJUH 3WY1A 5CMAA 4UUJA 3ROOB 1A6TA 1S4IA 3QYCA 2B1HL 1DVTA 2F6AA 2JLPA 3AU1B 3EO0A 4S1DC 1TZGL 4FTDA 2QQLH 1NPJA 3RPKA 3S5ZA 1M7IA 5CILH 5HJ3B 3BN3B 4F33A 1SFHA 1U8OB 3WELA 1E4HA 3W1ZA 5DGQA 4EN3D 2VN7A 2O30A 5HY9A 4U6TA 2Z35B 3VD3A 1NJ9A 2F53E 3GSWA 5D7JA 2OMZA 4TNGA 1U8JB 4YXLL 4PJFA 2GCYB 3MCKB 5DZOA 3RHWF 3OKNB 2VXVH 1VFBB 3PWPB 4EN2A 2XYBA 4FQXC 1Q9WB 4UQDA 3KWWB 3A6CL 1OCRB 3NQKA 1KLFB 3DMMC 2XQYA 3TNNB 2V7HA 4G6ML 3I9IA 4YMPA 4HDIA 1GA2A 4QYOA 1IKOP 4UOQA 5I0DA 1ZLDA 1W0VA 1EHXA 4PW9A 3V0IA 3VFWB 1T5WB 4I5BB 2J21A 2FQGA 3KHOA 1UM5H 4HF5L 2X4QA 3QFJD 2D0HA 3MV8B 4P4RB 5KAQF 1T4KB 2UWEF 3PL6C 2CXKA 3W11C 4HH9B 2HB0A 1CIDA 5F44A 4IIZA 4WO0A 4Y5XC 4HD9A 3BQUD 5HY9B 2DLFL 2R15A 4GFXA 2V9QA 3L4WA 4LLMA 5CN2A 4KBPA 3G5VB 3IRCA 3QIWD 4IRJD 3EO1B 1WQVT 1U0QA 3FO0H 2JJVA 1MCRA 4YBHA 4BEIA 2KHAA 4XCCH 5I5IA 2A9NH 2J8UA 3BT2L 1R6VA 4NZUL 2EXWD 4MCNA 3QP3A 4ZDHA 1KV3A 3IDGB 3WEAA 1HINL 1XWVA 3GMLB 5IWLA 3NSJA 1PGRB 4FXKC 2X1OA 3EGDB 3POHA 4LLYA 4JFXB 1MFVA 2FWLB 3BVNB 3U6RA 5E94A 3WFBL 1EAPB 4D9LH 5E00B 4WDIB 3GBDA 4P4RA 2OP4L 3GZOA 4U3HA 1EO5A 4ETQB 4IOIA 3LQAL 1CLOH 1ECYA 2GVYA 5IQLA 1YUHB 5K9JL 2MQ3A 3UJJH 3KMDA 4U1HB 3KH3A 2EVIA 2Q8AH 3FAWA 2YD0A 2ISDA 1AZZC 4JFOB 1AD9B 3SE4A 4E36A 1UOKA 1VDGA 1FVCA 4JCLA 1EVUA 3LPWA 2Y1YA 5DJ8B 1N6QL 1IAOB 4K71B 4CGUB 1WT5A 4JRYA 3UP1A 5IEKB 1E4KA 2H0PA 5D1QA 1JK8B 1W6WA 3MR9A 1JHLH 2OYPA 1A4JA 4I18C 5TQ2H 4X6EA 2MCG1 2XOTA 3MV9D 3ZQXA 4X6DB 4A04A 3FB7B 1KB3A 2VO8A 3MRBB 3MRGA 3SQBB 1OGSA 5GRWA 3JTSA 3KYMB 5GGSA 1KBGH 5EBLA 2JB5H 1KIUA 1UACL 3Q13A 5FYJE 3HUJF 5IB4A 2WKOF 1FPTL 1MCLA 5C97A 5GS1A 1IC0A 5DUJA 3S48A 4FYRA 1N8OE 2ZD0A 4AEIH 4AKPA 4CILA 1GC1C 4OD3H 3TPUA 5EFIB 3DX6B 3ML8A 4DGVL 2XJLA 3FOMB 3BQUC 3MBXH 4U1GC 4YXHL 3IFLL 5TK4A 5DYOA 5IR1B 5C0AE 3SGDH 4CVZB 5EA0L 1UCBH 5TDOB 2YJQA 4N2GA 5GGVH 1JXGA 4HLZH 2WOBA 3T0EC 3FSWA 1RUKH 3ISRA 4LRNH 4FL4B 4OBSA 4FZEL 1I3GH 3V4VL 1WWAX 2VLMD 4YSCA 4JRXE 3MC0A 1F56A 4Y2DD 4YSQA 2IXQB 3ZMEA 1MJJA 3FCSA 3GNML 3F6IA 4HWUA 4LARH 4ZOAA 2B2XH 3L5WB 2GUOB 5AZ2L 3LQZB 1MHCA 5INDA 3T0XA 3GBNL 4WKZA 4Y4HD 1RZPA 1JSYA 5AVQB 5HGHB 5MEOB 2P8PA 2HRLA 1VFUA 3X13B 4LCWE 1A1MB 1AHKA 3DX7A 2E74C 5IFJA 4QLRA 4W9KC 4NFDA 3TP4A 4Y19D 2DD8H 4JO2L 1CGVA 3LVEA 5I1CH 1V3MA 4FQQA 4O58L 4GRMB 3SDXF 3GM8A 4WHYG 2CK2A 5FKPB 4LFHD 4KY2A 4PD4J 1S9VA 1F6AA 3OJ2C 2HCZX 4XTRD 1JZ8A 5JDSA 1YPZF 4Y4HC 1TR7A 4YVUA 3G5VA 3S4SG 1R34A 1JG9A 2V9RA 3DRTA 4MDJA 3SKJH 1TMCB 2VSDA 3ZE1E 2WXRA 4E41A 5TD4A 4DNLA 1T2JA 2C9UA 4KPHH 1OD7A 3C08H 4XO5A 5D8JH 3E9TA 4JFXA 4LQFL 4MNQB 4FQ1L 3OR7A 3LV3A 4AQAB 3ILQD 2LTQC 2WXNA 4Z7QF 1TYJA 2VMDA 3ENEA 5FM8A 2AJUH 2O5ZL 3DROA 4I3SL 5LKNA 3M07A 2K6ZA 3F6LA 2ZOOA 4U1MB 2VQ4A 3PWVA 2ZUXA 1T0OA 4WY7L 1B6UA 3O3AB 4NAQA 3T4YA 3VGHA 1T0MB 4KGLA 2GW5A 4OF7A 3UEZA 1S3RA 3BGMB 3SGEI 3AT9A 2QVFB 1QBMH 3VXUE 3A22A 4PM1A 4Y16D 4OCXH 3GS0A 1WITA 4XC3L 3MUUA 2DQUL 3VRJA 3IMTA 4NHUB 4B0MM 4CAGA 1P2CA 5JPNB 4I4WA 3T0BA 4LNVA 3CZFA 3T6ZA 1DEEB 3F7LA 4P3CH 2WXMA 3GSOA 3H0TA 4FNUA 2R0WL 3BZEA 4CVWA 3SSGA 3QDGE 4PJGA 2MTPA 4R26L 2P5WE 4JFDE 1HH9B 5EOQH 4FCAA 1ZD6A 3ARFA 4E9QA 3CU1A 5ADPH 4ISVB 2CGZA 3EYFB 1SOSA 1J10A 5L0QC 1ZLEA 4NRYB 3HZVB 3C9NA 4UZUA 1M71B 2H0FA 4DO4A 1T1XB 4KKCC 1S7SB 3EYUH 5DK0A 5C08D 2J5LC 5I6LA 3G6JF 2XA8H 4NHCH 3UC0L 2XNAA 4JJ5B 1SLUA 1TTGA 4PGBA 3JV4A 4ONFH 1HVXA 1I4FB 1HN1A 4XX5A 5D2NA 5A2KH 4L3AA 1M3JA 3Q6GL 4U1JB 2X0UA 2B5IC 3ILDA 4N8UA 3R19A 3X12A 5JHLH 1L6XA 3S0PA 2V0AA 3KPSB 1D7DA 3D85B 4MFHA 2WQVA 3KPRD 1YNKL 5A6MA 2GJ6B 1E2WA 5E8EA 5BQ7A 4M61A 3KAAA 3OAZK 1PYWB 3X3FH 5TH2A 1LDPH 4X4KA 2C26A 1HNYA 4M6NL 4D3CH 4KKAC 5IVXA 1NUNB 3SDAC 5LBGA 4PJ9C 4JPKH 1DFXA 2W60A 3FT2A 4JO5A 5F1KC 1I1AA 2PWHA 4WU5B 3W3BA 2DJSA 4F5CA 2AXGB 3L4VA 4RMRA 4MBRA 2NTFB 1L0XA 3LH8A 3MRPA 3MJWA 1C8QA 1D6EB 2A0LD 2XQ0A 1LK3H 1RZJL 1C5DA 1GOFA 3T3PF 1FL3A 1E5AA 1PIGA 3B43A 4N0CD 2AV7B 2EDOA 3OC8A 3AZUA 3KWWA 4ZMYA 4A2LA 3WBDA 2JTYA 5J9PA 3SDXA 4OD3L 2FJFA 3CX2A 5JOEA 5KSBE 2FT8A 4HJIA 4RAVA 4KZCA 5KZCB 1S7XA 1H5BB 2FECL 3QRLA 5BS0A 4FHKA 3VQLA 2X6MA 3SOBL 4ZO7A 3L4UA 4UTBH 4UDTA 3WMSA 1Z5LA 2H1PH 4X99A 2DDQH 2Z31A 1CI5A 3LKPB 1QSVA 3BI9X 3L6FA 4UMGA 3STZB 4KVPA 4E9SA 4X7FC 3MBWB 3ZKSD 1ZXQA 4QOKE 5I0WA 2EIJB 4B3EA 3V5DA 1KCRH 1Z0MA 4HJGB 4PVNA 3AM8C 2EXTA 1JMZA 4LSQH 5IFJB 2GSGB 5E9DD 5DO2D 5CGYC 5IK3A 2GC7C 4MMZB 3N1FC 2HJLB 4JRXA 2X3CA 4PI2A 3PNWA 4PEEA 4RFEA 4EVNA 4JKWA 1WP6A 4E5XB 1JGEA 3PGDA 4DQOH 3GSNH 1MVUB 3CFNA 5I1JH 1G7HA 2H8PA 1HCYA 4IK7A 3I9GL 3TO4C 3U46A 2CXGA 5H2BA 3DIVA 5FM5O 2AEOA 2BWQA 4HFUH 3ESOA 1KG0B 1Z6JT 1FV1B 4QJ5B 5KYNA 2V2XA 1LO4H 4W9LC 4M9PA 2RD0A 1RK1A 3BH8B 4X83A 1Z3GL 3QFGA 3SZKC 2P8LA 2X4OB 4ZTEA 4ZXBC 4FQ2L 2EVJA 3VXSB 4TTGA 3FFCD 1D6VH 3DMMA 2W0PA 3QDME 4XN7A 1UENA 3P2BA 3KNBB 4NQDD 2DYSB 3Q2VA 3L5HA 2EUXA 4YFEA 4DPBX 1V3KA 2P47B 2NY6B 2UWEE 1XH3A 2ZUVA 4Q9BA 2AJSL 1E6JL 6PCYA 3FO0L 1D6VL 4FI8A 4WSJA 5ESAA 5IM7B 4PRHA 3F01A 5FGCE 1PU0A 2CNZA 3MXVH 3GO1H 2FUQA 2WGXA 3F64A 3D33A 3I6LD 5HDLA 1VAHA 4MHHG 1BQHB 5GS2H 3QR1A 2IG2H 4JANA 4L0ZA 1U8HB 1TQVA 2DBLL 3EUDA 4X4ZA 4LDEB 2YD4A 4TUJA 1T6BX 3WO4C 3KPOB 4HFUL 1EJOL 2JI2A 3IMBA 5T1KD 5FGCB 1T03L 3KPSA 1BOGA 4Q6IB 2EQDA 3C60C 1QZNA 2BP8A 1UD5A 1LHZA 1JD9A 2YRPA 4NP9A 2VZVA 2DPKA 4PJDE 3HLAB 3QXDB 4X7TB 5PCYA 3AWEA 3C8DA 5CIPB 3N44B 1WCBB 3S35L 3VWKD 1RIVH 1X4YA 1Z5YD 2FYYB 1MLBA 3T6QC 4BQBA 3V7MA 4NBYB 2QTEA 4HYTB 1IRAY 4V33A 1PG7H 1KENL 5B39G 3UG5A 2ZYSA 1J8HD 1NCJA 1L7TH 1OAZH 4LDOB 3VWJD 4UINL 4NM8H 3C6EA 1ED3A 4E42B 4BWUA 1JNLL 5HGBB 1MRDH 3FDWA 3P30H 4O2EA 3GSXB 1LGVA 1LK3L 4KUCD 4X7EC 3QO0A 4KJPC 5BS0B 2YGPA 3H4FA 3RL2A 4PRAB 4XVJL 1UKQA 5EBWB 2YBRA 4EE2A 3VO0A 1P2CB 3K6OA 1I9RH 1GZHC 4PGDA 4C57C 2CDEA 4JY4A 4QRPD 2GFBA 4HXBL 3VG0H 3MV01 4NENA 4RCAA 3VB8A 4PRIB 3FU7B 2ICWJ 1NCNA 2Y5QA 4FQJL 1A1NA 2JQZA 5B1AB 1AQKL 3M1BA 2GJJA 4GXVH 5L2JB 4ZUVB 2J72A 5C08A 4Y4FA 1MLCB 3QXVA 1AFVL 2ZCLH 4ZW7A 2ED9A 4MQSB 4E5XA 3MGTB 3RDTA 2YEQA 2AJYH 3NCBB 4ZW8A 1JOIA 2RACA 2DIBA 3HB3C 1RXLA 3ATAA 4JFYB 1CI3M 4I3RL 4C56A 3VH8A 3AQDA 2LT9A 3L3IB 5GZOD 1BECA 2MJWA 3QJXA 1H3WM 5JHLL 4DP7X 5FUCE 3ZR5A 1FZOA 3FTVA 4G8IB 1RU9H 2IPUK 1J0ZA 4RMQA 2F61A 1HZHH 2EO7A 3VFTB 4JQVC 1G6RL 3MLPA 1HCVA 1ASOA 2HRPH 3AAZA 3MRBA 3MRGB 3F3HA 2X0VA 1G0DA 3GIVB 4KAQL 4JRXD 2FJGA 1KGYE 1TQSA 2VXUH 2F2HA 3S34H 3G5YA 4EMZA 5I16B 1IGCH 3P0GB 2AXFA 4Y9EA 4ZT1A 3D2UB 2PO6B 4QNPE 1IGJB 2YMXH 4FOMA 1FL6B 1OP9A 3RQ3A 3RWGA 1Y6NR 2CKBH 4QRQB 5HI4D 1WTLA 3APCA 3FC8A 1NAKL 4ENED 5J4MA 3RGVC 4X5PA 4LGPB 1ZWIA 2VRQA 4FNPA 4U1LA 4I18A 2WO2B 2HRHA 4PJDF 4Z1PA 4RRPM 3AXIA 3GLZA 3OLEA 5CEYA 3IGLA 2W0FA 1KN2L 1VGKA 1E28B 2QKIC 2QV2A 5B38G 4G6MH 4RAUB 3ATDA 4K3JH 2LFGA 5IROD 4JM0A 4N2HA 4ALAH 4I3SH 3QDMA 2IAMA 4G9FA 4I0PA 4N87A 4PJGF 2JV6A 4JG0H 5E6RB 2K70A 2ZXAA 1ESOA 3NDYE 1T22A 1TJXA 2P1YA 4S0HA 4RZCA 1I9IL 4N8PA 5AAWC 3LPPA 4HS3B 1B4LA 2HT2D 2JF1A 2IBZY 3EYSH 4HFWB 4NLAA 1F4YL 1MIMH 3PGCB 5JPMB 4GUPB 3FQNA 1AXTH 4XGZA 3RKDC 4F7MA 3QR0A 4HMEA 2NY6C 4OZIF 3APFA 1BLNA 1QMUA 2DLFH 2FBJH 4H0HB 4Y9CA 1TEYA 3ARBB 3EYSL 4OAWA 3FW6A 2A77L 3A67L 3QQ3A 1V3JA 3SJVB 2ZONA 4PRDB 5AKVA 3AQYA 1AE6L 1F45A 1XR9B 1Q9KA 3KWXA 4J27A 1FYTE 4JCWA 1XGQB 4N0CC 4NSKA 3Q2WA 3ZE2B 3QIWB 1ORQA 4OFKA 4KOCA 4J3SA 2NCMA 3AY2A 3DX3A 2AK4A 1OOAA 2H32B 3MTRA 3HPLA 3Q1EA 5LGYA 2D7TL 1FZMB 5HVWA 4NQED 5JYMA 3VXUB 3TT1H 2DM7A 2AJVL 2YS4A 5FYKD 1P7QD 5T33L 3SPGA 4M7LL 5E99H 3SDAA 3MGOA 1N0LA 5T3ZH 1S2EA 2ENSA 2GEEA 4GRLD 4KV5E 3FUDA 4RGNB 4QHPA 1OK0A 1R3HB 3P3UA 5CFHA 4NO3A 5EN2B 1NMAL 4Y5XA 2YUWA 3IAPA 3EJCA 2JJWA 2VZSA 3LJ3A 4MQ7B 5FUZH 4OFDA 3CFMA 4H25B 4Z77B 3VXRB 5CR1A 4BIKA 3JVFC 5CWSB 3GDCA 1D2OA 1ONQA 2C1PA 5FO7B 1UB5B 1JXFA 4G8EB 4QF1B 4TVSa 3CZUB 1FGVH 3ILEA 4N90D 2Z6FA 5LVEA 3HE7C 2A99A 4NC0B 1KF9B 5DMJB 5KOVC 2WLHA 3WHE0 5MEQA 3CK0H 2Q20A 4KJQC 1ZHKB 2PCFB 4G59C 1NLBL 3ZSSA 5TK2A 1FWXA 5C7ZA 2Y5TA 3P3RA 3RJDA 1J5CA 3CFQA 3DJSA 3QXAB 1RMFH 5IGXL 5JTWA 2ATAA 1KLGA 2VXSL 3W11D 2JB5L 5HYQA 4K9EC 2VDOL 4P06A 3MRMB 1J8HE 1KTDB 1IC7L 3TV3H 3BKCH 3VFRA 3KPLA 5BZDA 2MCAA 4IRJC 3ECBA 3I3EA 3WIAA 4L3EE 4MMYA 3VD7A 4M5ZL 4ATWA 1UB5A 4XCNA 1XGTA 4QAMB 1LP9B 3AS1A 5DJAB 2PTVA 2ZZUT 2BNRD 2WWNA 3HG1A 4R4ND 5ICZB 2GG1A 4OSUL 4M1GH 1J5HA 5KVFL 3TVMC 5MEOA 2MTAA 4QKXB 4S1QH 3E8UL 2DIJA 4J3BA 2MKWA 1ZWIB 3EYQD 4NPYA 4GKSA 5SX4I 2VZTA 3KPMA 4TULH 1OAUH 4R90L 5I76A 2NY2B 1DVXA 3STLA 2EYTA 3KL5A 5C71A 1TEGA 4N2KA 1RULL 1EAOA 2V17H 3NEXA 5IW1A 2VLKB 4OZFA 4AYFA 5BVJB 3EUUA 2VQ1B 3D52A 2X6BA 2IANE 1ACCA 1KXVC 5MENB 3FF8A 3I2CH 5EIQA 3AROA 1MUJA 3MV8E 4RISH 3X1EA 5A2AA 3SKMB 3UYOD 3P9MA 3QDJE 1P1ZA 4PRPE 1R3IL 3NIDF 3DA0A 3OMIB 4MD0B 5L4MA 4FQCH 5D70H 3NZ8A 1P4LB 1XCXA 2JI1A 3MLVL 2Y23A 4QHLB 2OL3L 4XVSH 1JWSA 3LMJL 4IRZH 4YIQA 5I73C 5EUKB 2ED6A 3PV7A 4KKLC 1KGCE 5DTFA 1JWMB 5JHLA 4LMQI 1ZA6A 3QWOB 2YPLD 1X6NA 4TLUA 4DPAX 1OPGL 1EGJH 3OKLB 5BUPA 1KGWA 5FXCH 2XACC 3VDBA 3RFZA 2DLIA 2WWOA 4LDLB 5D1ZA 2BW4A 4HH9A 1RI8A 2F53B 3U7WH 3PDOA 1C12B 4U0RC 5JLZA 2DQCL 2EYSA 2R56L 1OLLA 3CIQA 3U7YH 4UIKL 4X6BA 1FNHA 1NAKH 1RVFH 3IDYB 3H9SE 4NQCE 2MKLC 3WTUA 3PHOA 3CN0A 4C4KT 3UC0H 4R7VA 3TT1L 1QUNB 1PPIA 4HIPA 3OJDA 1B88A 2XY1A 4BGDA 4B9FA 1L5GB 3RUGB 3VI3E 4ZAKA 4WEMB 3F04A 1ONQB 1UT1A 2C1PB 3L3OC 3MCLL 1MQKH 1AHWB 2DKMA 1OSZB 1Z32X 3FT9A 4Y2DC 5BZWA 4CN6A 4QJ3B 1AGDB 1JF5A 1LJMA 1GR7A 1HCFX 2ODHA 4LP4A 4HUVB 2COVD 3WOVA 4F58H 4QGYA 3PUUA 2X2IA 4ZFZA 4MJJA 2QSQA 4PB9H 1RZQA 5F1NA 5D7IE 1ED3B 4WTZG 5T1LD 2KDYA 3BQUA 4K5LA 4WUUA 1GTNA 2X4RB 4X6BB 4HUXB 4FTVA 2HPTA 4AL8C 1C16A 1EERB 3QNYA 4XNXL 4OGYH 2EJ1A 3M6DA 3NZHH 3HFMH 4P5RA 2MEJB 2D3JA 2E4FA 4MAYD 3G6JB 2JVUA 4K3JL 3WFZA 2JKRM 3PCYA 1RJLA 1S7VA 2Q6WB 3V52H 2BIHA 5AOIA 1XD1A 3HNSL 4FMKA 3FQUB 1CB4A 1KCLA 2QGDA 3EJJX 2OKMA 3MOBL 4MS8D 4OLUL 2BXZA 3RY5A 2W95A 1E4KC 1WHPA 3ABMB 1TTCA 4B3VA 5M94B 1A3RH 5GGVL 5I8OH 2KQMA 3O6FB 5AW5B 5C09B 2OXGA 1MZZA 4NUJA 5AVRB 4OZIB 2E8YA 4NAJA 2F54A 2BIPA 1CFSA 1J9SA 1TNNA 2Z31C 2A9MH 4XVJH 1EJ6A 3JWNC 2CIKA 2UXFA 4K9JA 1FZOB 3AY4A 1IJNA 2Z92A 4MS8C 3QIBD 2PYEB 3BWZA 4TVPH 3CVBA 2FSDA 2XKSA 4F9LC 1GCFA 1M7XA 3OG4B 5MHSD 1VENA 2NW3B 3CLEH 1PZUB 4Y5YC 2IF7A 3GJFK 2XCMC 1XGYH 3L3GB 5AOLA 4YBQC 4YSTA 5I76B 2OMYB 2ZUSA 3VGEA 4GMSH 1AZNA 1TZIA 3BVVA 3QRGH 3KCPB 1FH2A 1OM3L 4URTB 3EJTA 1R3KB 2BPBA 4MNGA 2JI3A 4K8RD 2F54D 1YN6A 4KJYA 1GSKA 3V4LA 2X6VA 2XZAL 1MH5B 3GBNH 3QUMB 2EYRB 3C5ZC 2FYYA 3ZTDC 5I6KA 5FOBB 1T1WB 5J6HA 2CO6B 5DSCB 1QSZA 5DURB 1J1XL 1XF3A 3G6JE 4U1IB 4QY8A 1GS6X 2B7DT 2I24N 4X9IA 4Y1AD 4YHZH 3RL1A 5I24A 1I3GL 5ICYA 4WU7B 3KDPB 4X42A 4E41E 3OMNB 4WJ5B 4N2LA 3S3CB 1THAA 1JPTL 3TEYA 5CP7B 1BZ9A 1KCSL 4WTQA 5TE4L 3L1EA 3UTTE 3CMOH 2M83A 5C1MB 2R69A 1P69B 2WBJB 3RZCC 5ISZD 2AQ1A 5IMLA 4APXA 3QE5A 3EADA 1I1FB 1ZHKA 4FYQA 4IOSA 1O5DT 4WNSA 1DZBA 3T77B 4DGIH 2WANA 1ZXKA 2VW7A 5F7EH 1W72A 1TKWA 4TQEL 2O26U 3ILQC 3GB7A 1T22B 4O4YH 1BQ5A 1SN2A 5C0EB 5IHUL 2UVFA 1PAZA 2OX5A 1FHNA 5GRJH 4F7KA 1R5VB 2BVPA 1I8LA 1QA9B 2NY1D 3K3QA 3AWFA 3T09A 1ND0A 2V3EA 3RUGE 3C09C 1YQVH 3H53A 4BA8A 1T5WA 1RZGB 2D03H 4ABQA 5LUMA 3T8VA 2F5AH 5I8CA 5FGBA 3RWFB 2OR8A 3TF7C 2BY2A 1LP9F 2WCSA 3CSBA 4IBSA 3VWKA 3MYZA 4G71B 1KBBA 5HHMB 4NBXB 1A14L 1A4KA 1XH0A 4GG8A 4DKEL 5FIEA 3EOAB 3M86A 2PYEE 4HIJB 2DEYX 4KGJA 2BVYA 2WTPA 3ILPB 4X7SH 2A77H 3A67H 3NN8A 3O11B 4HPOH 3WI9A 2XXMB 3QJFA 1JV2B 4P5TC 4UTAL 4C4BA 4EO5A 3C5ZA 1FZMA 2X38A 5TFSH 4IRSA 1B90A 1F4YH 1MIML 3H0TB 4YAQB 1YUKB 4ES8A 2GBVA 1M9SA 1G6RA 3L13A 3ESPA 3GKZA 2Q1EA 1Y0LA 2YWZA 3HAEA 2JELH 2O61B 4EOWL 1MPAL 1JZ6A 3FFDA 4FI7A 5T33H 3GMRA 3DVGB 1CBVL 5EO9A 5HHPA 3T3MB 5GRVL 3UDWC 2CBOA 1PLBA 3QDJB 2QEJA 5C09A 1QFWI 1ZLSL 4L9LB 2G2RB 2QMKA 1P84J 1UM4L 3I3DA 3P2TA 4OZGE 4Z7NF 3UL4A 1YLBB 1FN4B 1U93A 3G6DL 3K0WA 3GMOA 3IJHA 2K8MA 4UM8A 4APQD 5JXAL 1WFNA 2J5LB 1I7ZB 4HQQL 1KTJA 3AUVA 5F0MB 3W39A 1ZTXH 2EDLA 2EEFA 1K5NA 5F72S 3SDDC 3LN5B 2EDBA 4NQXA 5F9WB 3ZU8A 4DHLA 2G3XA 3EG9B 2XC8A 2SEBA 2WSKA 5ACLA 3O2DL 4HGKC 3FONA 1LK2A 4B50A 2VLJA 3G04A 1E7UA 4F15B 1N3NB 3NFNB 4Y4HA 2X4SA 3NPSC 2Z8SA 2Q87A 4N9GB 1FBIL 1ZS2A 3BESR 2VMEA 2YAFA 1UZ8A 1EMTL 4K9EL 1J7VR 1EXGA 2ESVA 3UCRA 2BSTB 1NCAL 4KWUA 5EBWA 4LU5H 3Q8BA 1OT4A 1ZE3H 3QUMA 1IAKA 1K3IA 2FB4H 2FH8A 5DJZA 4WU5A 2XJKA 1J1OH 5I8KL 1S78C 3FB6B 2PP8A 3IJHB 3KPPB 2WQXA 5ILTH 4PW4A 1J86A 4J7RA 5AG9A 4XN4A 1R46A 1H9VA 2P80A 1IVTA 1KCKA 5L2KD 2SEBB 1OB1A 2FEDC 2PP7A 4QHNB 3BKCL 5LBVA 2CHNA 3C5JB 5CJQH 3DXAA 3BD3A 3FOLA 1L6PA 3U4BH 1R3JA 2OMWB 4UT6H 5EPMB 3L16A 3U1SH 4IDLA 3WNPA 4X99B 4X5WB 1AG6A 3CPUA 4XNZB 3RURA 2W65B 1L0PA 2GIXA 2HVJB 5ESQA 5FS5A 3T08A 3VFVB 4G82A 1MCFA 4L0PB 3CDFA 4ZMWA 4ORGA 4GS7B 4PBVC 3LXUX 4FC3E 4ZAKD 3O4OC 5L6YL 1E8WA 4QXTB 4Z7WA 5D1ZC 5KS9E 4WAFA 3IFOA 5E1IA 3WL9A 3K8KA 1DQQB 4GG8B 2Y7QA 1OSPL 4D9QE 1YYLL 3RGVD 1FVEA 4X6FB 4DP6X 3PJLA 5EUOA 1PZ5B 1XQ4A 1DJGA 3DI2B 4J1UA 2CGYA 3ETBF 4L3FA 2XFXA 1CL7I 2BNRA 3HG1D 2CCWA 3LS4L 5FCUH 4BJLA 5CM1A 4JRYB 3GSNB 3C5XA 3OAUH 3BPNC 3CLEL 4U4BA 4PJEB 5CZRA 2QGEA 2ADFL 3F7KA 2HFEB 3QXUA 2PYEA 1OKEA 3ILPA 2V33A 1LP9E 5D1ZD 4PJAA 3VXSA 4N0FA 1JZ7A 1UT9A 5IBLC 2OMUA 3IRZA 1OQXA 4BCYA 3V79C 3OKMB 2HG5A 3LOWA 1OEZW 1VPOL 1OGAD 1FV1A 2APBA 2BDNH 3GMPA 3MKGA 1UH4A 3MRLB 4KJPD 3B2UD 2JK5B 3D2UD 1TEFA 5E5LA 4QTHA 2EDWA 1AGEA 2BIQA 1TVBB 3BZEB 4PIRF 2XWJA 5EIVA 3HC0A 3NACL 4R4BA 4RGOH 2D31B 3V4VA 1O0VA 2QVIA 1G6VK 4JFSA 4P3CL 4YFLF 4QRSB 1BPVA 4PJ9D 4C59B 4LLQB 3NCJL 4FP8L 3LN4A 4UZGA 3HNVL 3RTQD 1YEEL 5HP5A 2BOCB 2NY4D 4UNUA 3FMGL 2UUDK 5JQIB 2MMXA 4PJ7B 1DEEA 4QRPE 1EA9C 2EECA 1UWXH 4G5AA 2VR3A 5F70A 3TYFA 1F4XL 1NSNL 1K6QH 4U1NB 2RQ8A 3K8MA 4QRUB 3ULVD 3PXHA 2I26N 4CGTA 2FO4A 4RA0C 5EDXA 4XNQB 3BPOB 1RJLB 2ZAIA 3B3BA 5L0QB 4GW4A 3POCA 1PKQE 1U36A 4QCIA 4HETA 5DJ2B 3VWKC 2AAVA 5ID1A 4IRSD 3ATBA 2GABA 5BOJA 5JXEC 5KVEH 3DTXB 4RGNE 1KB9K 2YRBA 5IHBA 3IBEA 1HHGA 5CIPH 1BQSA 3N55A 3KLHC 4HLJA 5FO9B 3NGBB 3ULVF 1NDTA 4B6ZA 4BUQA 4D0CB 5E2WL 5KVGH 1ZGLB 2FL5B 3O8XD 1W0WA 3WDHA 2O5XH 4HIIA 1SQMA 3FJTA 1BIHA 3HNVH 1MCPH 3JXAA 4P2OB 3QZMA 4ZZKA 3REVB 3WN5A 3QWOA 4TRPH 5DJ6B 1KJVB 3BUQA 4EN3C 1IM3A 3EZJB 3VFGH 2YSTA 2X6CA 1NBYA 1JNJA 1D3CA 2W9LA 1MG2C 2B4CH 1FH5L 3UYRL 2EYSB 1AYRA 1P0SE 1EZSA 1KELH 2VB5A 1I1AB 1S7UA 1OF0A 4NIYE 5DD5L 4BE5A 4Z7VF 1PVHA 4OLZL 3ETSA 1ILUA 4LDCA 3WD5H 1GIGL 2PPEA 4M43H 3V7AE 4HEPA 4XNMB 4KVNL 3GLDA 3QPQD 3E6FA 1UD3A 2QR0A 1SJHA 2VDKB 2ZSWA 3OSVA 5AW3B 3ULUL 1F1AA 3KPSD 1XCWA 1QI3A 1F4WH 2VL5B 5I1HL 1BFOB 3BSHA 4TNFA 3KH4A 4FZ8H 2IQAA 4LVOB 1CS6A 1MHHA 1IKFH 3V6FB 3WN6A 3QISA 1L9QA 4BH8A 1TJHL 3ABKB 1XAKA 3UZVB 5CU5A 4AVIA 1A6AB 2CM5A 2ZSVA 1QYGL 1FA4A 1VEMA 1JDCA 5IMKB 5JORA 4Q52A 4KXCA 4NN6B 5EC1B 2VN5A 4QXWA 5EZLA 2QHRH 1USZA 4GBXC 4Y5VA 1VERA 3AS2A 4LE8A 4PRBB 3D3VB 4X8XA 3UBFA 5L7XH 2JXMB 4TVPD 4LGSB 4G8GA 5GHWL 1IKNA 5IT2H 4IHBA 1IQWH 5EC2B 2HG5B 3PQYD 5BVPL 3DYMA 2DMCA 2XDHA 3GS7A 3MBEC 2HJKB 4MZRA 5F9JB 4FYSA 2CJ3A 4ZTPH 4DN4L 4E9LA 2QTVA 2PW1B 1A7QL 1M1XA 1U6AL 3RIKA 1WC7B 2FX7L 3O4OB 4Q56A 1AO7E 4ZMVA 5MEQB 5FPIA 3MX0A 4H1LA 5D1XB 3NSXA 1YJDC 2IH3A 5HHNB 2DB8A 1CTMA 1ZTMA 4GSUA 5KWYC 3KWVA 2NY7L 4ODHH 4PTTA 5D1QB 1S7QA 4LSSH 1HE7A 4P2RB 4G6FB 2YXVA 5DWUL 5GGRB 3CN3A 3MNVB 4DW2L 3MV7B 2LHAA 3WIHL 4FQXB 1MFCL 1WZAA 2OSXA 5EC2A 4PS3A 2R2CA 3CCHA 3KYMA 1JFHA 1DQDL 1M7UA 2QQNH 3ULVE 3LDBB 2UWEB 2Y9RT 1NDMB 2IBGA 2LAAA 1NCGA 3ISYA 3DX6A 4FA7B 4UV4L 3WFHA 1WA1X 3RVVD 1NIEA 3FHAA 1L9NA 3JTTA 2I7SA 2PTTB 5EU6B 1JMXA 2JCCF 5KSAD 2JLLA 3IPEA 5IB4B 4WUUE 5K9OB 3ME0A 2EH8L 2ZXGA 3L2NA 4PRPA 1HNGA 1CG9A 3FQNB 3MTXA 2ZYIA 3AGWA 3O8XB 3BVWA 3OLDA 2F19L 3DGGB 2OA9A 5DQJB 4PVBA 4ZMOA 5DJ6A 3QQ3B 4RBPH 2A9NL 3MRKB 3NIFE 1OVZA 1OP3H 2CE6A 2GHZA 3ARBA 5DC2A 3CDZA 3BOVA 2WLJA 4UIMA 1K3ZA 2FL5A 1S8DB 4S1SL 3ZGHA 4WFHE 1OGAE 4N6RA 4PB0L 3VTMA 2JKWA 3HVDA 3FQRB 4FNLH 3X13A 3JWDH 2DYPD 2UWEA 1A0QH 4ORZC 1YZZA 2R0LL 3OKEB 5D1ZI 4JFUA 4N0YH 1WWWX 3UTPD 1Q0XH 4XP4L 3UTTD 2QPSA 5HJ3A 4ADGA 2VNCA 4M7ZC 3TA3A 4NQCA 5EUKA 2GC4C 2Z0UA 4HUUA 1PZAA 4TVPE 3GIZL 3WY3A 5CP3A 1RUAL 1WPCA 1KTKE 2HUHA 4G7QB 3E6FB 6CGTA 4L4VB 5EV7A 3RGHA 2MFNA 3HJEA 4YDKH 1JK9A 4DKFH 3SZ6A 3D0AA 2VE6A 1JZEA 2XWZA 3MJ9A 1WAAE 2TAAA 2R7EB 5K1JA 5BRZA 3WYRA 4DVBB 4YL9A 4X7DC 1DBKL 1I8IB 1QSED 3LNGA 4PWEA 5E9DB 2Y5TB 2G60L 3H54A 4R5VA 4FDWA 1E4JA 2EDRA 1EGJA 2VJ0A 4G8FA 4JGMA 4JHVA 1RJZA 4JFVA 5C0RL 1D5ZB 5D7SH 3UYPB 3EGSB 4NQTA 5I19H 3LS5L 4UQAA 3KD4A 4NYLB 3GDBA 5GRXG 1U41A 1LO3L 2AEPH 1QVOB 2XN1A 4GEIA 4X6EB 3GINA 3MGTA 5E6UB 4PRBA 3OB8A 1GGUA 2WQSA 1BFVL 3BH9A 4M9OA 4PMFA 4DF9A 1AFVH 3QNFA 1GVIA 4HHAB 1NGYA 1PKOA 4G42B 3TBYB 2K9UA 3DVNB 1J87A 4C56B 3DUSA 1MEXH 4JQIL 3O0RH 3QQXA 4PGCA 5B1BB 3ECBB 1GMIA 2CZNA 3IJ8A 2OULB 3VRLF 4G6KL 4J1UB 5CCJA 4W68A 4X6DF 1TQBC 1ZHNA 5C0BE 4ZQTA 5IW3A 1GRWA 4X9HA 4YDVB 4U49A 2VISB 3NIFB 3TJEL 1WK0A 3CQQA 4GBXB 4JFWA 1XSJA 2VDRB 2VR4A 2XFXB 4JFTA 3E8UH 3H1ZA 5T1KB 5DFVD 5E8NA 3D3VD 2I85A 1SEBA 3WSQH 2J3SA 1YPZE 2EXSA 1A6VH 3BUDA 1F58H 3M1CA 3BX7C 1AVAA 3T2PA 5GGUA 4JREC 2DM4A 3LS4H 5EWIH 3ZYJA 5C3IA 2Y7NA 1HU8A 4K7FA 2N01B 2VAAA 1E3ZA 3BW9B 5B3SB 3D1MC 3QI9C 3O45A 3SN6N 4AXWA 3UFIA 3KLHD 3DX2A 1PLCA 1JPGB 3BVDB 3I9AA 1I1FA 4YXKL 2BZDA 5L8LB 3NIGE 3LD8C 5E56A 1CCZA 2EACA 3I85A 4XP5H 2ITCB 1ZRUA 3QZLA 4YE0A 4L3CA 5SWSE 1RQ5A 5IHHA 2Z65C 2EH7H 4JE4B 1INQA 1J48A 1TJHH 1YNTF 1H3PH 5PAZA 3TZVD 3ZO9A 5HVFB 3QYMA 1WZ1H 5D7LD 1PNCA 1MCOH 5F7YC 5B22A 4JS7A 4XMTA 1OB1B 3D8MA 4GP5B 5D6DC 2EVGA 1X7QA 3K72A 4AV4A 4KZDL 1FC2D 2W0FB 3CQPA 3PL6D 3NABH 3NH7L 4M5YL 5GGVY 2JCWA 4EI6A 3AUWB 4QHNA 3BKMH 4M8QB 3NRQA 3ARDD 1F13A 1A2YB 2FCBA 4HWBH 5EU5A 1E30A 4Y16C 4B53A 1R3JB 2OMWA 3HC3L 4DEUA 1UURA 4J3TA 2BVTA 3T71A 1WO2A 4MXVE 4PRAA 1E8YA 1MY7A 3UMTA 4R7XA 4RDBA 1XB6A 4QTFA 4JPSA 1Q0YH 4AC4A 5AOZA 4HIEB 2H32A 1GGCL 2ORBH 1Z1WA 2O61A 3B6SA 4L8CB 1X5JA 4XBGA 4HIIB 3WEXA 1CF1A 2E75C 3E1ZA 4N0UA 3V7AG 5DK2A 3A21A 3N2JA 4KKZA 3QUZB 1NM4A 1RZ8A 2CHDA 4FLSA 2YEVB 4JVWA 4X4XB 5B1KA 3DIFB 2IAMC 2OL3B 4KRPC 4P07A 1L3NA 4O9HH 4EI5A 1MJ7L 2G2RA 3M7OA 4Y2DB 4KK9C 3P4OA 1NOAA 2N3JA 3KLLA 4MD4A 4QO1A 4RIRB 1AANA 1C7SA 3O2VL 1MHEB 3OMZA 3FQYA 5IQ9A 4PJ9A 4WUUD 2IPTL 4U7MA 3EFOA 2DQGH 2IH9A 2ZCKL 4I0PD 1OP5H 1ZJAA 3O4LA 4F7EB 3CVHH 5EOTA 5KVGL 1JPSH 1AIFB 1UXMA 4MCZB 2A83A 1SMOA 2A6IA 3HR5B 4UDUB 5GSVA 2MNJB 5FR3A 1NLDH 2YZ8A 1GGCH 1KB5B 1PKQA 2UZXB 1CU4L 2H3KA 5T3ZL 5IOPB 1CXHA 1U3JA 3O6LH 3QS2A 1PW3A 4DP2X 1KIPB 1NBVH 3CVIH 2CRYA 5MP6H 5I1LA 4K2UH 4UF7C 4GQ9H 3KBFA 5HDRA 1X5ZA 2ZNWA 3DIFA 3QJTB 4ZW6A 4R4BB 3V0JA 1HOCB 3VM5A 4BKLA 3UXFA 1M7DB 1I8MA 2QV4A 2PO6A 4H8UA 1JHKH 1GZQB 3CBJB 4Z76A 3ZQ9A 3WJMA 2VR9A 3G08A 2BP0A 4FNLL 5EN3A 4N8VA 2I9LB 4D7PA 4F7EA 1CXLA 2YN5A 3EJUA 3RDTC 4GQRA 3SOTA 1H6TA 5LNGA 1QBLH 4A1RA 2H2PC 4MDIA 2OLDA 5TDPA 5I66A 4KVCH 2VWEC 1MDAA 4NPKA 4YHZL 3STBA 1J5OH 4RX4D 4PHXA 1N12A 2WKOA 1SHXA 3G6AB 3FU9A 3EJQA 4JZJA 5LHDA 1INQB 4CKQA 5MEND 4WWKA 4H20L 4MSWB 4PG2C 3SY0A 2DD8L 4JO2H 4PJ7E 1U8CA 1A7QH 4BCXA 4KO5A 1H15B 2HT4D 3QDAA 3D51A 4QY8B 2NY2C 3VFVA 5EIIG 3R1GH 4RX4A 5L4IA 5TGBA 4LEBA 4BH7A 5JQ6H 2FT7A 4GNKB 5C6TH 4WK2B 1T66C 1A6WH 3I6KB 4XNUH 4PJHF 1OAQH 5CP7A 4WTXA 2DMHA 1FP5A 1XF1A 2C9SA 2IO5A 5BXFA 2IOIA 5HI4C 2W9DL 3TBVA 5TE4H 3BH4A 3P0YH 2NY3B 4UDTB 3JQOB 4XMPL 4Z0BH 2FIKB 1ITBB 3TJHC 5IFAH 2V5SA 3L2LA 3ZL2A 3QORD 1S9WA 5DJZB 2BK8A 2CM6A 5DMGD 2E9IA 2IIJA 4HGWA 4MNGE 3OBAA 3P0YL 5I15L 4H1LG 1BVKA 4LASH 3EYOB 3HNTL 4HEMA 5B8CC 3CWGA 4IKJA 4Y8DC 5AYQA 4JRYE 3AQXA 4KUZH 4OM0H 1CLOL 2NNFA 3C8HA 4X9YA 3UCQA 2W9EL 2OSYA 3KBEA 4WWKC 4H0GA 4P9HL 1JBJA 2Z93B 2JIXD 2ZOWA 3H2PA 4PPTA 4WO4A 4GYBA 4PQXA 2HTLC 5I1GH 3TN0B 2CNYA 1GGBH 4NGHL 5DHYB 2AEIT 3OAZH 3V5KA 4C56D 5C0IA 1F8TL 1J11A 4MD5A 4XNAA 2KPWA 4BK5C 1PJ9A 5EZIH 5EOTB 4OGYL 1JTPA 4OD2A 5CLWA 3ATFA 3FHEA 4JZOA 1BG1A 4FJYA 3T3ME 4ZBJA 1XF4A 2IC2A 3QVAA 5SWZE 1J9QA 1ULVA 1NFDB 2CO3A 2JWYA 4P5TB 4BFFA 2B3IA 4LPYA 4P23B 1PG7W 4XB8A 3QSKB 2AQ3A 4PBWD 3HFFA 5F6HJ 3TYGH 5I1IH 3PP4H 4LCVA 1A3ZA 2A0LC 2Z8WC 1II4E 2VLRD 3QZNA 1WDAA 1YY8B 2ZP0T 1F00I 1KBPA 4K07A 3WIFA 3PQYB 1D9KA 3EBAA 5HJGA 4L9LA 3JWDL 1LE5B 2BP5M 1BQUA 2AI0H 3WD5L 1QFWM 5DFVC 3G08B 2NSXA 1IO4C 3LHAA 4FLQA 1T66D 2Y7MA 4LOUD 3V52L 3Q9QA 5CZVH 3WGUB 4FEMA 5AW4B 3MV8D 1SXZA 2WJ5A 2AFNA 2VDNB 5HHME 4IBUA 3QEQD 2GAZB 5K93A 1OB0A 3LH2L 3DO7A 2G75B 2XQBH 4WI9A 5AD0A 1NGWA 5B21A 5C0GA 5DA4A 1N3NA 4KMTL 4H1LH 1KTRL 1U4EA 1BBJA 3QORC 4U1KA 1LK2B 3P3TA 5HDOA 1JWSB 4WQOA 3O6FA 4GRMA 5C2BH 1X3DA 2IPTH 4XP9H 1IBHA 2OTUB 4UTAH 1AMXA 4PWGA 3L9RA 5FM4A 3QUXB 2A4CA 2Y5EA 1E5BA 3DX7B 4XCEA 1GGIH 4LL1A 4AUJA 5JDSB 3O4LD 2HP4A 1CDJA 3EF4A 3P2DA 4J4PD 5B1JC 5BMFL 4KKQA 4DCQB 4R9HA 4N5ED 3GXTA 4LESA 4N20A 3T0VA 1ID5I 2YWYA 5F7DB 2KUTA 2E6JA 3ARYA 5C09D 4NZRH 4PS4L 2J6EL 4EI5D 1BX2A 5JHBA 2OMXB 3B34A 2WZ5A 4MJIE 2NYZA 2ZP8A 1EZUA 3PY9A 4S2SB 3UBHA 2CJTA 1RUKL 1AZRA 3LV3B 3MNDA 4HC1L 1IGYA 3RFZB 1ES0B 2VERN 1AKJA 3FTUA 5JOFB 2BIMA 2XWXA 2WMPA 3ARXA 3QH3A 1NPUA 3VE0B 3FSVA 3HIZA 4HC1A 1CLYL 4MXQD 3MKKA 5HBBA 1ZSHA 1RHFA 5SWZA 1TQCC 1UZGA 2CDFB 3Q8CA 1BOYA 3EXJA 5IHZB 5T1LA 1DJZA 4L8DB 2AV7A 2ZUYA 3CHXA 2ESVE 2FNBA 2R8SH 1REIA 3RNKB 3I02B 4MMXC 4PREB 5DQ9A 5T3ZE 1IL1A 2NQCA 3ERXA 4MHHI 3FT3B 4MWFA 3V6ZB 5IOKA 5ACMA 3L5WA 4GKOA 1D5IL 3IDIB 4OQ1A 2OMTB 3IDUA 4UQCA 4H4NA 5J0BA 3S4SA 4L8SA 4QXUL 3ZKXC 1D7BA 4ONOA 5CCHE 4FABL 4MJ6A 1NICA 1A1MA 3QC5X 4UILL 5CP3H 4MMZC 3S5LA 3TBWA 1E7VA 2NSMA 4F2ME 2XBDA 4XNMA 4B7LA 3MV9B 4AQOA 1Q9LB 4NRXA 1KPVA 2BRRH 4JJOA 5DVLA 1MWAA 3N9GH 3VFPB 3QCUH 4JZNA 3C09B 4U1HA 1SOKA 4PJ5E 4PJXE 1U95B 5JOPD 2ICES 1NGYB 4FQXA 1Q4NX 3FKUS 2P5EA 2IPUG 2XFGB 3B5GA 4NKDA 4RFOH 5DFTA 3HZVA 5HTSA 2M8XA 2CU9A 1CTNA 2AQQA 3A23A 4XO4A 5IF0A 1A6AA 3MACH 3QCVH 4FGMA 1WIPA 1NCOA 2B3RA 4G70B 4IKLA 1PAMA 1WAAF 4N2BA 3UADA 2A74A 1N68A 1I4FA 3RFRA 4KOBA 4LASL 5BS0D 4ZJ9A 2ZKMX