4FQHA

Crystal structure of fab cr9114
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
224
structure length
224
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKSSGGTSNNYAISWVRQAPGQGLDWMGGISPIFGSTAYAQKFQGRVTISADIFSNTAYMELNSLTSEDTAVYFCARHGNYYYYSGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords antibody CR9114 heavy chain
total genus 43
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqhA01
2NR6D 3OKMB 3DURB 3RPIA 3OKMA 3FFCD 3ZDYF 1CXHA 2W9LA 2QSVA 3NFPA 1JF1B 2B4CL 1JF1A 5T33H 4G3YL 3BJLA 3N1PC 5KOVC 4F2MA 2XWJA 3K2MC 4N9OB 4OB5H 2ADIA 4XAKE 5F9OH 2FO4A 3FRPG 4RFEA 2D7TH 2BHUA 1Q0XL 2EECA 3IU3B 1S7RA 2A9ML 2VUYA 2Q7YB 3O3UN 4XXDA 3MRMB 4EXPX 4DKDC 3BW9A 4M00A 3FCTA 3V4UH 1IM9D 3CVIL 1I8IB 2UY6A 4I77H 1U8KA 2FJHA 3MRJA 4PGBB 4ZO8A 2MCPH 2VL4A 3DVNA 4NZUH 2VITB 4OGXL 1CFSA 1FVCB 2VDOL 4CMHB 1JTPA 3JWOL 1YN7B 3QIWC 2QSCL 4Y4KC 5D71H 4YEFA 2DQUH 2QQKL 1KB9K 1EZVX 2H2PC 4WGVB 2IGFL 1KLGB 4B41A 2HG5A 1CQKA 1KLGA 4PRHE 4U1GB 4JANB 1QZ1A 5C0EB 5IGXH 4FFVC 1CU4L 2J12B 4M48H 4IMKC 4KK6C 4O02H 3LZFL 2PW2B 4ESKA 1WBZA 1FC2D 1FO0B 2FJFB 43CAB 5KSUB 2OL3B 1HINL 3GGWA 5KSUA 2XKNA 4GS7B 1EV2E 4XGZB 2P7TA 4U33A 4JJ5A 1CD1B 1WWCA 4JFZL 1FJ1A 5L88L 2XQBL 1TQCC 3IDNA 3MRCA 4IRSB 5F96H 3G6JA 4X6DF 4S1DD 1KJ2H 4Q0XH 2NX5B 5EC2A 5T3ZL 1NFKA 4X5XB 5SWZD 1A1MB 1A1MA 4CADA 3S96A 3HE7B 5LWYL 3ZKQD 4H8WL 5T1LD 3RUGF 3MUZ1 5HTSA 4XMKH 2IPUG 3WIHA 4D9QD 2DYPD 25C8L 1KB5A 4GOSA 1BFOA 2EDEA 4PG9A 4LSTH 2YHGA 5EZLB 5CGYC 3U7YL 4MB3A 5BS0A 2OQJA 5IB5B 4P57B 3CFEA 3WHE1 2X5PA 5HI3D 5DRWB 4HUWB 2FL5B 3H9SE 4RFNC 4JHAH 1FGVH 1WFUA 2E9JA 3KWWB 5FM5O 3TNNB 4AH2B 1MFEH 1D5IH 4GAFB 2V5MA 5GIRB 1QVOA 1PBYA 3RU8H 1KTDA 4MZ3A 1NMBL 5D1QC 1OGAB 5BVPH 4I3GA 2JLLA 1YEFH 2FD6L 4QWWC 4LEXH 1GHFL 3ARDD 3CUPB 4RCAA 3RKDD 1JYWA 2CJUH 5IIEB 4HJJH 3T0AA 3HC3H 5DJ2B 2XOTA 2NZ9C 4EXKA 3WMSA 3CVHB 1K4DB 4U0QB 4DVBB 3QHZL 1NCNA 5E2UH 5J56B 4UINH 3U0PA 1KTLB 3BP6A 3KPSE 3BP6B 1VERA 4M1DL 3DGCR 5CILL 5FUOL 3RJDA 2X4QA 1K4CB 4GW5B 1CL7L 2OP4H 5HD8D 1P4LB 1X5XA 5IFHL 4HPOL 1B2WH 1JF5A 2XNAA 3HNSH 4OUOA 5J1TC 3WFCH 2XNAB 4WI3A 5JOPE 4JGJA 3EDFA 2VLJE 3Q2CA 3W0WD 3NAAH 3FOMA 5GZOD 2FEEI 1GGIH 4KJWD 3VCLB 5DD5L 3IRPX 4OCYH 2Y25A 2R2BB 5CEYB 1RUAL 3B83A 1NCCL 1OD9A 1IQWL 1RJLB 1T1ZB 3ECBA 4HT1L 3WLWC 1KNOA 3FO2A 1DUYB 3MQIA 3RVVC 1AGEA 1X4XA 5IW3A 2LTQC 4NHCL 2WIMA 2R9HD 2HJKB 2WIIB 1F4AA 3BO8A 1DQML 5HDQH 4M3JA 3VXSE 3VWJC 4RGMB 3HFMH 4NZRL 4P3DA 3F7QA 4XP6L 3NACL 5MEPB 2EE3A 4KROC 3TYGL 2UUDH 3D3VB 4I4WA 2EDKA 3WFEL 5SWZE 4HG4J 4XPAH 1ZHNB 1R5WA 1D5MA 3WL9A 3OXRB 5F71A 3OGCA 5JR1H 3MRHA 3O6LL 5KS9A 4ELMA 5ISZD 1S7TB 3C6SB 4XNYL 2NY0C 5BW7A 1JGUH 4LLUA 3MFFB 4RWYH 3VG0L 3TEUA 3MRLA 2DIJA 1G6RH 1UZ6E 3VI4E 1U8IB 1BZ9A 2AJVH 5F72S 1WBXB 5ISZA 1AD9A 5DI8A 5CIPB 1NJ9B 1OGTB 3AS1A 4PGEB 5FHBL 2BOCA 1R0AH 4LPXA 4CJ0A 2BFVL 1QA9A 1QRNA 2A83A 4F3FB 4MNQB 4PJ7A 5I1HH 3VFSA 3FQXB 1UM5L 3IXAB 3BH9A 4MJ4A 4XVSH 2F53E 4WHTB 2F54A 3V8CA 4P59L 1HHGA 3UEZA 2ORBH 1V05A 2P8MA 5E6ID 5D1QA 1RUKL 3EGSA 3OQ3B 4L3ED 3UO1H 1FZMB 4HJJL 4MA1B 4YHLL 4LF3A 5IROA 4JPKH 4LF3B 1DUZB 3UBXI 4RX4A 5JLZA 4BUHA 1GHFH 4RMQA 5JHDA 2ESVE 4Y4FD 4OZGE 4KDWA 2PCPB 1CDYA 5E8DL 2DWEB 4KTDH 3RIFK 5HVHC 2VXSH 3QFJE 5HHMB 2NY1B 1JPGA 4GXVH 1G7JB 3V0VB 1WAAF 3ZMRA 3ULUL 4RAUA 1GAFH 4AG4L 4JHWL 1XF3B 4J12A 3LKNA 1FGVL 3IAPA 4U1NA 1CXKA 1MNUH 3N1FC 1BJMA 4OSUL 5CINH 1T4KB 2DLTA 3L3DA 4OQTL 4ORZC 1XR8A 5CJOL 3L3DB 1EMTL 5IQ7H 1S7WB 1B3JA 4MDIB 2VDPL 5J3HC 4GMSL 3VXRA 2BY0A 4OZFB 3SGEH 1TCRB 4JFHD 3TA3B 2GK2A 3MJ8B 5I1KH 4NBZB 4L8CB 1A6AB 4GRLA 3RHWK 4JFYB 1Y6KR 5DR5H 1BVKA 4NYLA 4OLYL 3GMMB 1S5IH 1ZV5A 5LXGH 2YSSB 4GKZB 1DLHB 5TJWK 4OLZL 5EZOH 1V7NL 1U92B 2D0GA 3LQAC 4XCNB 3SBWA 2PO6D 3UJJH 4PPTA 2MPAH 1NBZB 2V2WA 3TPUB 4LCCB 4J8RA 4MX7B 1H15A 3BD4A 1KLFA 1JWMA 4EKXA 1UZ8A 4FXLA 1P2CA 4XZUA 1ZT4B 3MV11 2V9QA 3FAWA 3EYQD 5HDQL 3CXHJ 2VITA 1A7NL 1LEGA 1F02I 1AXSA 4FNLH 3OZ9H 4KTEL 5E94B 1KEGH 3IJSA 3PWNA 3BPCA 1V7MH 1FIEA 1AFVH 3UTQB 4X7SH 4EI6A 1MCEA 2FIKB 4GAYB 2NTFB 2V5SA 2R15A 4WWKA 4IIQA 4WUUA 3LS5L 1N6UA 1GVIA 4XX1E 4IIQB 1ZEAH 5ADPL 5F9JB 4CDGC 3NAAL 1YEKH 3ULVH 6FABH 3NBNA 4N1EA 3KJ6L 1OTUC 3MJ6A 4X80H 4A6YB 4LMQE 5B8CA 3H3PH 3QEGL 4NT6A 1OAKL 4BYHA 5FKAA 4P4KB 2H8PA 4JJ5B 4NCC1 3MGOB 5D1ZB 1U3HB 3E6FB 4YHIA 1KB5L 2EC9U 1SYVB 1JFQL 4YFDB 4D0CB 2XI9A 1MHPH 4ISVA 4F57L 2E6PA 4PJCF 1QBMH 5FYJE 4Z8FH 4LAQL 3PJSA 3KYAA 5EBMB 4U6YB 4DTGH 4N8VG 4OD1L 4JAMA 2Z0BA 1IM3B 4Z7NE 3JZ7A 3VXOA 2D9QB 3DX6B 4X7CC 5GSVB 5BXFB 4JM2F 1IC5H 4G3YH 4HGKC 5IKCB 1NBYB 1ES0A 3X13B 4H1LA 3SOBH 1KCSL 3O6KL 4L5FH 5ESAB 1AC0A 3BQUB 5DJZA 1Q1JH 4DKEL 4YHKH 3U48A 4WWKC 1QHPA 2CK2A 3U7AA 2YK1L 3B4NA 3KPRB 3JTTA 3H0TB 4YZFE 3RU8L 4AH2A 1HXMB 3WFDL 2QQLL 4XI5D 3IFOA 2EDDA 4J3OC 4ZS6C 1FG9C 2G5BB 3IVKB 3AMKA 2YPLA 1WZMA 1YMMA 3DVFA 1JNLH 2CUHA 4KY1H 4P9MH 4AT6B 4JKPH 2GJZB 1NUDA 3IS0X 3C6LD 4LNRB 1FYHB 3OJDB 5MENE 2DIAA 5I17A 5TDPA 1T0MA 1KENH 3QNXA 1GGCL 5CMAA 2VE6B 5FYLH 3NCFB 4ODHL 2X7LB 3O6MH 3QCVH 2KDGA 2ATPA 4QTIH 5B4MC 3UYPA 1MVUA 2B1HH 2ENYA 4LARL 2D2OA 5CJBA 3VXUB 5D8JH 1G7LB 1RIUL 3LCYA 4JR9H 2IAMD 1DJSA 3F12A 5C09A 5KW9L 2J3SA 2ADJA 3C5ZB 3SKMA 1BBDH 2MFNA 2VLRB 4KVCH 2GHWB 4TRPL 4DCQA 1Z5LB 3K81A 5I1AB 2XTJC 1QO3A 3OPZH 1OQXA 3I3DA 1DFBL 4TSCL 2EC9T 1AGBB 4Z8FL 2HLFC 3TZVA 3M8OL 1QFWH 3F58L 4H1LG 3LOWA 4HHAB 3H42L 4P5MB 1HKLH 4XH2A 5GGSB 1A3QA 1GZQB 3IFPA 4Y1AD 3ESVF 4PJEF 4RMWA 3VCLA 3OBAA 4YPGA 4QT5A 3LKQA 3QEHB 2VISB 3CH1A 2D7OA 4N8VA 3QEGH 3MRDA 1XIWB 3O2WL 3MUHL 1C16A 4KGLA 2EYRA 3VMOA 4LSPL 1WCQA 2EDQA 4J23A 5IVZA 1J05A 3T65A 1NLBH 3OAYH 1NUNB 2AEIT 1FBIH 1P6FA 3VXMB 2H45A 1Q9WA 2E9WA 3PV6B 2WWMC 4WI7A 1LP9A 5CJQL 1UM6L 3HLAA 1SJHB 2EH7H 3INUH 3LN9A 4JY6A 4CVZA 4NIKB 1ZANL 1JPST 1WFOA 3T1FB 4NQDD 4U3CA 4A6YH 1HYSC 4IMLB 5F7UA 3D85B 1LILA 4IDJH 3KLHD 1MI5E 4DZ8B 2DKSA 4GSDH 1DQJB 4PJ9D 2VQTA 3FL7A 1E4JA 5TE7L 1CXEA 3DO7A 1JGLL 1EEUA 3HC4L 3V5KA 1JNHA 4OFVA 4D8PB 3BD3A 4H26A 1E28A 1F11B 3MLTA 3DETC 4U6HA 1JZ8A 4HS8H 2NY2D 5SWZA 5SV3A 5A3IC 3ARWA 1Q0YH 2P45B 1NEZG 3G6JF 1LK2A 4BFIB 1R5VA 5IM7B 4ELME 4LEOA 1KENL 1FCCA 2BXZA 2X05A 4RNRA 5C0IB 4P9HC 3VXRE 4APQB 5T1LA 1RAMA 4OCWH 3GKZA 5CINL 3U4EB 4LU5H 4P9HH 2BMKB 3BGAA 1JYNA 4JM2A 1QRNE 3V8OA 3GI9H 2F9BT 2P43B 3T0EB 4I9WD 1EDQA 4YZFF 3FONA 5TDOA 3LEXA 5HVGB 4NQUA 2OTPA 2DLEA 5F89B 1Z9LA 3DV6A 2KZ1B 3ESUF 4M1CC 4U1KB 2R23B 3ZHKA 5M95B 1SVZA 4DK3A 2IPUK 4XPHL 3O3AA 1G9MH 4Y2DC 1SJXA 4WHYG 1XGUB 5GGVL 3KPLA 5C0CB 3PE9A 5I1CL 3BPOB 1A3LH 1PZ5A 4Z7VA 4FQ2H 4C57C 2CRYA 4D94A 5C6TH 4OLEA 3W9EA 3PIQA 3TBWA 5C8JA 3KPNA 4UAOB 3MRQB 3P30L 5EOTB 4JVWA 1PYWA 4FXGB 4WNQB 5J13C 3WFHB 1ZVSB 4L3AA 4Q9BA 3U36A 3EDKA 4MD4B 2Y9RT 4M93C 3DJ9A 3TN0B 4QRUA 1MJ8L 4KROD 2ZUTA 3ET9F 1CGTA 5AYQA 3I6GB 4IOIB 1UWGH 4F7TB 3N1GC 4IOIA 5E94A 3VRJB 1QLEH 1UG9A 1K8DA 4WU7B 4XVJH 2KZWA 3FTGA 3TCXA 1ZEAL 1E6JL 2V17H 4YDJB 3ARVA 4X98B 3NCJH 4YDJA 4KKAC 4V1DA 4ZUSB 3G6DH 1QYGL 2EDBA 2X10A 4R4BA 4HUVB 5E4IA 5CP7B 5HPOA 5IFAH 1CTNA 5L2KB 3CIQA 2ZZUT 4U6XB 5L2KA 2VOTA 1PKQE 4DUXA 3PNWB 1MLCA 4MWFA 1VEPA 4X7TA 1FVEB 3EFDL 3CFDB 3V6FA 1TZHA 3VH8A 1T89A 3ZDZF 3VH8B 4LGRB 3ZTJG 5JO5B 2RFXB 1MEXH 5TFSH 4ZFOL 2XZQL 4M7KL 1I3GL 5EWIH 2G2RA 1JTTA 2G2RB 4PD4J 5KJRH 1NBVL 1N0LA 5C07A 2HT4C 4ONHA 1D5ZA 1AGCA 3HC0A 3O2DL 2X4NA 4NQCB 1QSFD 2OP4L 5C0AD 3BMWA 2VIRA 3KVQA 2W0KA 3KPRE 3IDIB 2YMXH 4ZOEA 1RY7B 5BV7C 4JB9L 4KMTH 4GRLC 3SJVE 5F7FA 1I8IA 3LQAH 5JMOC 4HGMA 1TMCB 3WN5C 5D6CA 1QR1B 3S96B 4KK8D 5DJZB 2C3XA 2NY6B 5DYOB 2L0DA 5E2TL 1HOCB 2Y6SD 1ZE3C 1QACA 1UCTA 3ULSB 4AY0A 3OKDA 3QIWB 1KELL 3G5ZA 3MBEB 2X4SB 4HCRL 2I25N 4XPHH 3F7YA 3E6HA 4CMMB 4GRMA 5F7EH 4NQXA 4MNQD 3UJIL 4F9PC 2G75A 4HJGA 5GGRY 1A7OL 1F3JA 4FQIL 3V7MA 2I5YL 3ROLA 3UPAA 2CK0L 3P73A 1CE1L 3VDBA 3GGWB 1RFDL 5GS0H 3SKNA 5DUML 3UTSD 3AB0C 4XCFL 3H9SB 3I75B 3IFLH 4PIRF 4N0UB 3TO2A 1JMZA 3ILPB 3LKPB 2F5BH 3BPNC 2R56H 1ULVA 1II4E 2CLRB 2C7UB 1K85A 5F21B 5GGUA 2ILLA 4K94H 4R0LA 3GZKA 4PRHA 5HHNB 2YR3A 2KKQA 5F1IA 5C86A 5KSAB 1XGQB 3GBML 3KYKH 3SDDA 2HFFB 4OUUB 3LIZL 2C4FU 4KJPC 4JRXD 4F7CA 3RPKA 3CPLA 5IMMA 4WO4D 3MGAA 3CPLB 1H3VA 2CSPA 1JE6A 2NY1D 3H9HA 5E00B 5EZLA 1ZGLA 1FL5A 4V1DD 5CUSH 5JDSA 3BKCH 4NZTL 2VL5A 3IFPB 4Z7WA 5K59F 1L9NA 3UTTB 1OAZH 4NKQB 4PLKD 2NY4B 4NKOA 5EPMA 1NAKL 1QD0A 4NKOB 5EPMB 5KVMC 5DTFB 4XPBL 4NN7B 5JUEH 1SM3L 4X9HA 1KIRB 5C09E 1WFNA 4DGIL 1I8MB 3L3IB 4N8CH 4OT1H 3GMPB 3VFOB 2Y7QB 4AQOA 1UA6L 3QZWB 3RDTA 2HH0L 4FA8A 4QHKI 5T5NG 1MIEH 1H3TA 3C9NA 4GUPB 4W6XB 2QADD 2EYSB 1A1NA 3NCJL 4KRNA 1U9KA 1K5NB 3TO4C 4OCYL 3SE9L 4JFEE 1FBIL 4OJFH 1NFDA 3P9MA 2H1PL 1HXYA 2J88L 3MJ9L 3UPCA 4X6EB 3QUMA 4J1UA 4LP4A 1ZTXL 4NDMB 5I8EA 1ZLWH 5I71C 4R7NA 2W9EL 2VZTA 4OZ4A 2V7HA 3C6LC 4ZFGH 1MHHA 1OAYH 4X6CF 1RHHA 4HIHB 4R9HA 4DKFL 2BJMH 2ZOKA 5DRNB 4I77L 1IGYA 3N85L 2D03H 4HWBL 5JIIA 3SKOB 1HKLL 3DRTA 3FQRB 3ABZA 1Q0XH 4H26B 3ES6B 5CKAA 5C0FA 5ALBL 4PGDB 2FHBA 5I9QB 3VG9B 3P4OB 3GUTA 1IM9B 3M17B 1DLFH 1RUPH 5DURB 4YK4B 2B4CH 3CFBB 4MJ6A 1R5VB 3DIFA 1F4XH 1SMAA 3PDDA 2BP3A 4NPYB 5TGBB 2DQDH 2JJTC 5TQ0L 4U7MA 4K7PX 2DTMH 3KLSA 4EQ2A 3FRPA 4G9DB 4X9GA 3U4EA 2FBJH 1QLRB 1YYML 4JM2B 1FZMA 3VGEA 3TBSA 5IFAL 3W0WE 4NC1C 1EPFA 3DROB 5DRXB 1I1FB 4ZQKB 1CCZA 1LE5B 1A7QL 2F8XC 5C0RH 4HX1B 2ZUQC 4PJCB 3TBYB 5CP3A 1P9MC 3DX9B 1RMFH 4BZ2H 2K1MA 4XNZB 5IG7B 4YBHA 5FCSH 4YGVB 1MHCA 4ZFZA 3QIUD 2NQCA 2NY3C 3RBSA 4L3CA 1LO2H 4ENEC 4DK6A 1T20B 3AB0B 1HQRB 3BVNB 2DKMA 5C08E 3EHBC 3SKJH 1AIFB 1JK8A 4GAGL 2R1XB 1MCIA 4F58H 3EJJX 1BP3B 3U0WH 4P3WA 2R4RL 5SWQA 2Z31A 3GRWH 3P0YH 3LRSB 2H26A 2HFEB 3W39B 1RZIA 1A5FH 3TCLB 3QIUB 3ZSSA 1VFBA 3VXSA 2W0PA 2KBGA 5IVXB 4ZSOA 3TN0C 4XBEL 4YDVA 4QNPF 4YXHL 4YDKH 1CG9A 1UKTA 5FM5M 1QLFA 3QQ3B 1NCUA 1P7QB 2YS4A 1M4KA 1B4RA 3WLBA 1S7RB 1N5AA 5FYJL 4MXQC 4M6OL 4MCZA 5JHDB 4BUGA 2Q86B 1H15B 5CAYB 5DUPH 1Z0NA 1IQDB 5ISZE 4Z5RA 4LVNC 4Z5RB 2D4FA 3FN0L 2YD6A 3T3MF 5F9AC 4IRZH 3TIEB 5HYFA 1MOEA 4IDLA 2BVYA 1PLGL 2Z92A 2CKBL 5E2VH 3GI8H 3GFUA 3MJ9H 1D6VL 3IB4A 1WZLA 2FIKA 4GAYA 3RFZC 1AHWB 5L9DL 3HPLA 4L4VB 2YUXA 5KVDH 1J5OH 1L0YA 4IRSC 1DCLA 1UM4H 4HIIA 2Z93B 3KPMA 3TVMC 4MDIA 4S11A 3NFPB 4S0SD 4F33A 3MJ8A 4L8CA 4WWID 4PJFA 3MV8B 1BFTA 3VFGL 1UQSB 3GMMA 1YDPB 4V1DE 1UQSA 1SM3H 2P24B 5DD1L 1CK0L 9CGTA 4XCEA 5ACMA 5D7KD 1K3ZA 4A2MA 3GSXB 2XN9A 2W65B 4O58H 4S1RH 2XN9B 5AWNH 5CUSL 3JWOC 3ZHDA 2ERJC 4PP1D 1NC4A 5D5MB 1KPRB 2C1OA 4OKVB 1RZ7L 4HC1H 4Z7OE 1S9VB 3AS0A 1KIPB 1UJ3C 4JQIL 3WUWG 3GHBL 4K7FB 3IJYA 2Z8WC 5ILTH 2VUOA 3QCVL 1BQHB 4LSQL 1I3UA 2VWEC 5J3HD 1ZS8A 1HE7A 1EFXB 4JFPB 4YNYB 2HMIC 4LRIC 4DGVL 5CSZA 4Q9QL 2C3VB 1XGYH 3TJHC 4ERSL 2XY2A 4FFWD 2JJVA 3JVGC 2VDKH 4FQQA 3Q3GA 5EU5A 3QUMH 1CE1H 3HI5H 2XT1B 3KLHC 1G7HB 3U0TA 4R7DA 3D6GA 3IF1B 1ED3B 4QGTA 1A7OH 4FQIH 1OF2A 4KJYB 5DWUL 4PJXE 1YA5A 4ZTPL 5J13B 5I2IA 3VXSD 4N0UA 3TO2B 3G6JB 1IEBB 1YNTA 2DTSA 4U1HA 4UMGA 1IC7L 1F4XL 3MCG1 4RWHA 1O7SA 4Q6IB 3VG9C 4OLVH 1KLUB 3AS2A 3RWCB 4N90E 4YDKL 3ARDA 4DEPC 5SWQB 1GGYA 5E5MB 4Y16C 2DI9A 1ZLVH 3DVIA 3SDAD 3WFBL 4PR5A 2XXCB 3AC0A 3QDHA 4JZJA 5GRVK 3RWJB 3A6BL 1RIUH 3ZKXC 4G6KH 3S35L 5IMOA 3SE8L 2VL5B 3SPVB 1VB9A 4XAWH 5BOPA 4JPIB 4NOBA 3BYYA 2BSTB 4F8TA 1F00I 1OVZA 4LSSL 3DBXB 4DQOH 3UMTA 3VFRA 1T1XA 4PUBH 1QNZL 3GMPA 4L29A 4UNTA 3NABH 4X4XA 1X5YA 1XGPB 1WC7A 2VDQH 3L1OH 4K94C 3S3PA 5MERA 2UWEF 3R8BB 1LO5B 5DJAA 1M7DB 4PBVC 3PHQA 1MIEL 2YPKB 1W72B 2AK4A 1A9BA 4IIQC 3PWVA 4J4PA 2QQQA 1HN1A 4WCYH 5TF0A 1OLZA 4PJEA 4HIJA 3BHBB 3NIFE 3B6SB 1MVUB 5DQ9A 1Z6JT 4GXUM 1RULH 3RDTD 2IH1A 4YHNB 5A1AA 1I8KB 1D5MB 1MCLA 4YIQA 5HDBE 2UZYB 1PEWA 1PQZA 4RA0C 5I1AA 1GH7A 1WUNT 2XTJB 4UU9A 1S9WA 3MRLB 4MXVF 3LIZH 4HXBL 1RIVL 1BVLB 3MLZH 1TVDA 4LRIA 2A6KA 5C07D 5I1KL 5KANI 4QXTB 7FABL 32C2B 2X9YA 2EDWA 1C7TA 3SEPA 4HHAA 1T3FA 3DHMA 1QSFA 2A74A 3B9KB 4J3UA 2VZVA 1PEZA 3KAAA 4PJCE 5IK3B 3DPBA 3PHOB 2W1NA 2QLVB 3R0MA 3WCYA 4YXKL 1T1YA 5FYKL 4W6WB 5J6HA 1W0YT 4NQTA 3HMXH 2YPVL 2BHYA 4YXLL 3SCMC 4NQCD 4WU5A 3L6FB 2B1AH 5AUMB 5C0AB 5I1JH 4UQ2B 1IAIH 2F19H 3IDJB 3IDJA 4KRLB 5HVFB 4HPYH 1R5WB 1NMBH 5J8OA 3SGJA 5C9KA 5GRVL 2FEDC 3T2NH 4I3RL 1NLDH 3CLFL 3LEYH 2OR7A 5I76A 4M9OA 1AD9B 1ONQB 4QOKD 5DI8B 5IVXE 1X5GA 3UAJD 4FFWC 5E9DE 4LVHB 4U1KA 1OSPL 3BWAB 5K9JL 1WVZA 4LLDA 5E8NA 3H6JA 2H26B 2ZCKL 3U7YH 3JVGA 2N1KA 2KQMA 3ZTNL 4JRYA 4YEEA 5C0GB 3OX8B 1J1PL 3DOSA 3BH9B 3PDOA 2HVJB 1P7HL 4NNPH 5JZ7D 4RDQG 1S5IL 1XF2B 3UAJC 3UTZB 5I1DA 4L9DA 1I7UA 1JWSA 4QF1A 1XF2A 1GRWA 1EO8L 5DR5L 3HB3C 5HPMB 5IMLA 4XP1L 2FWOA 2J5LC 4ODUA 1KCVL 4J4PC 5C2BL 3QHTC 4YFLI 4UQ3A 1EH9A 4HUNB 5IEKB 1AXTH 3VGBA 5E08L 5D7JC 4UUJB 3FB7B 3C5JB 5GISH 1LO2L 1QBAA 2EIEA 3DARA 5TFSL 2FX7L 5HGHB 3AFLA 4H25B 2CDFA 5BRZE 3KLAB 3QXUA 1KG0B 4C83B 4J4PD 3ZE1F 2MCG1 1HDMB 5CEXB 3TIEA 1I7RA 5IR1A 5GRUL 3IKCB 1HI6B 3GSUB 1H3XA 5E99L 2HRPH 3V5DA 3BGMA 1GOHA 4TVSa 4ONFL 1K8DB 3LKNB 2ZJSH 4PRAA 4HJ0C 3QEUA 5C3LD 5I0ZA 4F80A 3DXAE 4WEMB 4V1DB 4EVNB 1U3HC 1U0QA 1CGWA 3SQBA 2Z4QB 4OV6F 1KJVA 3QBTB 2NYYC 4YXLH 1A7PL 4BSWB 1OARH 1KJVB 4BSWA 4KRPB 5KVEL 3VXRB 4WUUD 4ZUWB 5D7IA 5IT2L 1DLFL 3EOBA 3REVA 4YHML 2VN4A 4KK5D 3HNSL 3EOBB 3REVB 3MMEB 2X4PA 4Z7VB 3PG2A 4I5BB 1B2WL 2JJSA 2X4PB 3BZEB 2R1YA 4LCYA 3QIBC 5D7KE 1YQ2A 3PIQB 3BIBX 1KEMH 3BUYB 3O2DA 1T1WA 3ULVD 3QQ9D 4Y2DA 4TQEL 5LAXA 2BRRH 1S78D 5CILH 3L3HA 1Z9SA 5FYJH 2C4FT 5DJ8B 2VQ1A 1RIVH 5DJ8A 2XWBA 1U8QA 4UINL 4LDEB 2Q6WB 4UI2A 4W4OC 4ZMAT 4PJXA 4B50A 1LNUA 5K9QI 1MFCH 1QBLL 1SJEA 3WFZA 2ADGA 4ZDHB 4OV5B 4I18C 4CW1B 1T7VA 3SGJC 4KKCC 2A9NH 3GRWL 4QHMB 5D8JL 3Q6FB 1EK3A 5F3HB 2C3VA 1CFSB 3Q6FA 4RGNE 1CTOA 5F3HA 2AEQH 3JBG7 2HH0H 1P4BH 1RJZB 2ITCB 3QQ4B 4PJBA 4F9LC 3QIWA 1NFDF 1I1YA 3OKDB 3QEQD 3ALXA 3CJJA 4OFKA 3SE4C 1GGCH 4U6VL 4FQLL 5AZEH 4PRPD 1GGTA 5JUEL 4FMKA 1IQWH 5DRZA 2HN7A 3BI9X 2LVEA 2NNAA 4GBXA 3QIUC 4BQCA 1JTOA 3MNWB 4GMTH 1Y6NR 3N1QC 5I2IB 4YHIB 3QWQB 2LABA 5JO5A 2ED9A 5DD0L 4PRHD 5E08H 5I66B 3PHSA 2HKFL 1F6AA 2NZ9D 5FYLE 1P53A 1TVHA 4LSSH 1VGKB 4ZOCA 2NX5D 1X7QA 4LSQH 5F3BB 1VGKA 1YJDH 2AEQL 5D7LA 4IRSA 4KI1A 3DHJA 2K7QA 3ILPA 1J1PH 2OJZH 2VIRB 5C08B 4WV1A 3VXPA 4P5TB 1MRDH 5E24E 4R8WH 2YXFA 5HXMA 1Z5LA 1H3WM 2UY7A 3KPRD 5E7FA 5T3XE 2XQBH 2IAMA 2UV3A 1XGQA 4KUCF 5GS0L 4K8RD 5B3JF 2Q8AL 4OAWB 4M43H 2BVOB 1U8HA 2BVOA 4IDJL 2QQNH 1G7IB 3GJEA 2GITB 4I3SH 1GL4B 3VD5A 3C8KB 2AV7B 1A2YA 4NSKA 2EC8A 2F19L 2DQFA 3N85H 4PTUA 2EIZA 4LP5A 4N0FB 3NN8A 4HWZB 3O45B 5GGSY 5KOMC 1J8HE 5I8CB 4JFQB 2DQUL 4DZBA 2Y7QA 3D5OF 3FHAA 3GI9L 5I16B 2X7LA 5JA8B 3S9DB 2VDKL 4OJFL 4PB0H 4AMKH 4ERSH 3H9SA 1KFAH 4EDWH 3RNKB 1XF1A 5SX4I 3CVIH 3EO0A 3MRFA 2UWEE 2VN7A 1I8KA 3I6LD 3CC5B 3KPPB 3SKMB 5B22A 1T2JA 2YD9A 2OR8A 4H8WH 4OLUL 3QJFB 3MV9B 3BE1L 1ETZA 2FO1A 1U8OA 1NBVH 4QXUL 1DQQA 2Q1EA 2F5AL 3SDDB 1U8LA 1FN4A 1HNGA 3BP4B 3GIVA 1BD2D 4OTXL 3QG7H 1TVBA 1Y0LB 3QA3B 2AK4E 3MA7B 4P2RB 3HA0A 1JGLH 4QXTA 4D9LL 5IOPB 4LBEA 1OP9A 5JDSB 5DJDB 3UJTH 2DB8A 4YUEH 3GIZL 3OL2A 1NCWL 3P0YL 3SE4A 5EZOL 4JO4H 3CAFA 3UC0H 1JZ7A 1LDPH 1FFNB 4RRPA 4JFDB 1BHGA 5E9DA 4BFIA 4KUZL 3F6LA 1PDKA 1T1YB 3RWGA 1BJ8A 5CBAB 5FK9A 2P4AB 2X2YA 3QXTA 2FLRT 1JGVL 5C0AA 2V17L 4X8JA 2A38A 5BCAA 1MCNA 3VGDA 5C0BB 3UBXB 1NPUA 5IWLC 4KPHH 3VGGA 4K7PL 1NFDB 1KJMA 1U42A 3PQYB 4PRBB 3K7UA 5AZEL 4OZFG 4QRRD 3OTTA 4DQOL 5C6WH 2E7LC 2R2HA 5FO9A 4PJCA 3BWUC 1B0RA 1RZJC 2JJWA 4Z77A 2YK1H 4O2CB 2YD2A 1ZGLP 1U95B 1WWBX 4HIHA 5JDJA 4QRRB 3TFKC 1OL0A 3OXRA 2DTML 1VESA 3A6BH 4NRZB 3QWRD 4LLDB 5E8NB 3DO7B 5HHXH 4NRZA 1IGJA 2EO9A 2QQNL 2ARJB 3HMXL 4OLXH 3QIBD 3ARZA 4G8EB 4FQ2L 2QL1A 5KSVA 2ZNXA 1NFDE 5FXCH 2LAGB 4KVCL 1NANH 1AO7A 4L9LA 4FQPA 1MJJB 3VFTB 3FQXA 4WW2C 2OCFD 3LS4L 4JR9L 4WHDA 2YMXL 1L7TH 5DK2A 3QDJE 4LCIH 4F58L 1CT8B 4MA7L 4MA1C 2HT4D 1XGRA 1LO3H 2ZG1A 5IWLA 5DRXA 1LE5A 3EOAB 3GJFB 4HULB 1IC1A 3O4LB 1N5AB 15C8L 4M4RA 3D0VA 1ZLUK 3S4SA 2IMMA 3QQ9C 3ISWA 3KGRA 1M7IA 1J0HA 4CGTA 4N5EC 3TYFB 3LQMA 2VLJA 5JOFB 1CVRA 5FGBC 1J1OL 2SEBB 4BQBA 3VFNA 3O3AB 1DEEB 2Y06L 1XGUA 1KXVC 2GSGA 1EAJA 4QTHA 4KUZH 2A73A 4G7YH 1NAML 3FQUA 3P11H 4HS6B 4PRDB 4CBPA 2YUZA 5C70A 1D5XB 2R2EA 2AK4D 3DTXA 3T0ED 3GSRB 3MROA 5F93C 1NCWH 1WIPA 1A6VH 2Z31B 4R4FH 4MLSA 4NM8H 4WDIA 5E56A 1DZBA 2CDEB 5HD8C 3E3QE 4KI5F 3RVXD 4PJBE 3J8F7 1EBAA 1JHTB 3IETA 4IHOA 5FEBA 4IHOB 4ELKB 3P77B 4NKIL 1ZMYA 2JIXA 4XP1H 1FZKA 5I6XC 4UV4L 4MA7H 3N0PB 1F4WL 4OQ1A 3GSXA 5J1SC 4K94L 1I1CA 1EHLH 5I9QC 1WIUA 4LLQB 4JQVA 2IANE 2OK0L 3G08A 3LS4H 2PYEA 4R0LC 1GOFA 1DVFC 3WIFB 5K9JH 3IJYB 3PL6C 1FVCA 3U6RB 1EFQA 4MA8L 2EDJA 1TFHA 2UVEA 3CLFH 1I7ZA 1R6VA 3BYTA 3GM0A 4MNGA 4AEEA 3O2WH 2CXKA 3WNPA 4HKJB 3FO1A 2EEBA 5ADPH 2I9TA 1NCTA 1AP2A 3QWRA 5B39B 1AGFA 4G43B 1WZ1L 4M1CD 2WSKA 3QIBA 3BPNB 3E8UL 5B21A 1AFVL 5FA4B 1FRGH 1I1RA 1XR9B 2IANB 1BQSA 1CICA 3LDBB 3SDAB 2WBJA 3P73B 1XGTA 1MF2H 2DLHA 2BSSA 4M7LT 2DM7A 5D9SA 3SDAA 5HBBA 2OL3A 1MFAH 3L5HA 4JO1L 3P9LB 2FCBA 1U3HA 1H0DA 1KT2A 3LKRB 1FJ1B 5ESQA 3BRDA 4W4OA 3T04D 1G6RB 3TO4D 2J8UB 2FHCA 1BD2E 1MIMH 5HVHB 3QO0A 3L5XH 4P48A 3PJSB 1HHJB 1IAMA 1LP9F 3KPQA 3DX6A 4D0DB 2YD8A 2KUTA 2VXUH 4MLIA 4NO5B 4LHJB 4JO2L 4D3CL 3DI2B 4TPRH 4RZCB 2OMBA 4NQED 5EC1A 1DANT 3G6AA 3VGHA 5ESAA 1TCMA 4K23L 3BQUC 4JFXB 4M3KB 1BQUA 2A6DB 5DS8B 4G5ZL 4XHJC 3ARYA 1UXWA 4DOHB 2FH6A 3EDDA 4PBXA 1HXMA 3QFDB 2FYYA 2LU3A 4KKLD 2K7PA 2VKWA 4POYA 3FN3A 1OF2B 2MJWA 4KJYA 4W6YB 1IBGH 3VJ6A 4ODSH 3S6CA 1L6XA 2BSRA 3TNMA 4H20L 4FMFA 2C26A 3OJDA 2C7UA 1U8MA 2FGZA 3MRRA 5JW5A 5GGUB 4YXKH 1QPPA 2CKBH 5LGHH 1P69B 4OD1H 4RSVA 1T0PB 4X6BB 3VRLE 1URLA 3AAZB 2R0KL 3MRNA 1ETZB 3FN0H 2GSIA 5ERWA 5BZDA 2F53A 4LOUC 3FKUS 2J4WH 4NWTL 3PL6A 5HY9A 3WD5H 3JTSA 4GW5A 4J3SA 5IW1A 2X4QB 5EH1A 4M1DH 4XRCB 3W81A 4QRPA 2EH8L 1Y18A 4HUXB 4HUXA 1C7SA 3IDXL 4JZJC 3BRGC 2O61A 2K9UA 4W4NA 1DVFA 1C08B 2OI9C 2B5IC 5I1CH 3HE6C 1TNNA 1BPVA 4HKXB 4M7KH 5DC4B 1NGZA 4YAQB 1EUTA 5B38A 3VWJA 4E0RA 3FOLA 2J7LA 1OP5H 3TYGH 1A6VL 4R4FL 1B6UA 1KN2H 4ZFFA 3S34L 1MCPL 1N7ML 1PY9A 1T1ZA 4MJIA 1LQSR 2FHFA 3DXAA 3OF6A 2ZUWA 3O3EA 4PRIB 2C3GA 4X6EA 4QYOB 3QSKB 1LE9B 1D5BA 4HZLA 4F15B 5ESVA 1AQDB 2V7HB 3KDMB 3BKYL 3CNKA 5DZOA 5E9DD 4PRID 4Z77B 5TH2B 4OFYA 3RUGA 2VMFA 3QULB 5GHWL 2FX7H 2CO6B 3U46B 3S36H 1L7IH 3OGCB 3Q48A 4BZ2L 5HYJA 3R1GH 2E8YA 1QEWA 2GUOB 2HRLA 4PJ7E 1X5KA 1KCVH 1S7TA 1EEZB 2AI0H 1BZ9B 3HG1A 4PY7A 1INDL 1OGTA 1NJ9A 4XHJD 3SGDH 4Q6IC 3GUTB 5ISZB 4NQEE 1T04B 3OB8A 2ZPKL 4XVUD 5I73B 1LHZA 3MZGB 3HG1D 4JQIH 3ARBD 1RK1A 4LVOB 1YY8B 3EZ8A 4YUEL 4BZ1L 4O2FA 4P2OB 4LK4A 4WHTA 1UACL 4OSUH 4CN6A 5D93C 3JV4B 3CSYB 5DK2B 1SBBA 1CICC 2J6EA 1I7UB 1JWSB 3EGSB 4S0TD 4KMLB 1JHKH 4FXKA 3V52H 4EIZC 2NXYC 1PFCA 2ZUVA 3O8XA 3D0VB 3KPOB 4E41B 3MNVA 4JRXB 2DWEA 5IVXF 1BIIA 3ARSA 2MQ0A 5E8DH 4ACPA 2EH7L 3INUL 2RBLA 5I71B 3CD4A 4C83A 4MD0A 1HDMA 5CEXA 4E9LA 2IGFH 3VFNB 1ZAGA 1MCKA 3RZCC 1FL3A 3BGMB 2P5EA 5IBLD 5KANG 2ORBL 3LQZB 4K7PH 2IFGA 4U1NB 3LQZA 2EIDA 3PGDB 4LU5L 4P2QB 4TULL 1AKJB 1CFQA 4I0PB 2VDRL 2YRLA 2Z4QA 5E0QA 5C3TA 1M71A 3RPIB 3KPLB 4MAYD 3ZE0F 5HSFA 2E7HA 2LFGA 1R0AL 5DJCA 1YNKL 1HHHA 1UA6H 3EYUL 4LGPB 4HV8B 3PDOB 1Q0YL 4G9FE 5T1DH 2DQEL 3S5LG 4I5BA 4XMLL 2OSLB 5J06A 2NY5H 4POZD 3KPNB 4G80A 5D7JA 1BOGB 3OKYA 1F3DH 4MD4A 5CZXD 3BKCL 1ZHBB 5ADOL 2V2WB 1VHPA 3TPUA 5DXWA 1OAUH 4NKDA 4J3TA 5JW3H 2XV6B 3U0WL 2ZPKH 1R5IB 1BEYH 3O2VH 1YMME 4JKWA 3VU2A 3P11L 3QUZD 4Y4KA 3VI3F 4FHBD 2E3VA 2GK0B 2OTWB 4NUJA 2HKFH 2GK0A 2EDNA 5DURD 1AHWA 3R1GL 4G6FD 5CJOH 3VDAA 1PVHA 1SMOA 3FQWB 1L7IL 1A4JA 4TULH 2VDQL 4IMKA 8FABB 4F15C 3NABL 2W92A 4NGHL 2PYFA 5E2WL 43C9B 5CP7A 2WAHA 4WFGE 5E8OA 1UWGL 5D4QA 5D7IB 4UDTB 4ODVH 3B43A 4FQLH 4ZTOL 5GQBA 4JM2D 4HIEB 2CMRH 4ZNCD 1CXFA 1I75A 1YYMH 5GGQL 1X5FA 4CNIA 4GKSB 3SE8H 3MNWA 4CNIB 1KCSH 3NCYS 3Q1SH 2J8UA 2NY4C 2D9CA 2VTFA 3UCRA 4PJAE 2JCCF 5T3XD 4Y4HD 5KTEL 4PV8A 4PV8B 4FOMA 1RUPL 3L7FB 1VEOA 2D31B 5F3BA 1AGCB 2VABB 1D3CA 1IM3A 1YY9D 4E41D 4HXAL 2YD4A 4JZOB 1G7PA 2MNUA 4ZS7L 2CIIA 4JZOA 2BVTA 3O9WB 5EOQH 4OIBA 2UVFA 1MRDL 5BS0B 3FO9A 4KI5D 4TQEH 3UBXG 4N5UA 1CYGA 4HF5L 3TBTA 1YJDC 1YC8A 3G5YA 3G5YB 3O9WD 4JRYD 5KG9A 4TSAL 3TNNA 2W60A 1JVKA 5J1AB 1JHLL 1S5HB 3MR9B 1OT2A 1MFBH 1BREA 4BKLB 2JCCB 4X7FC 3CU1A 4ZYKA 4NQXB 4WW1A 5GHWH 1I9IL 4LFHG 4JPWL 2EEAA 2BSRB 4OZIE 3K80A 2DDQH 2YPKA 2WWKO 4I9WE 3SO3C 1J7VR 1SHMA 2WBKA 1LMKA 2N56A 3VGAC 3EYSL 4HWNA 2ATPB 1LDPL 2VLME 1RURL 4TNVF 4Y16D 5DJ6A 2OR9H 1QPXA 4DVRH 1FG2A 2FIRT 4PR5B 3V4VL 4UT7H 3QWOB 3UJTL 3RKDC 5D7IF 3AS3A 4K8RH 4R3SA 2CUMA 3PL6B 5HY9B 2H32B 4MQXC 1IAIM 5FO7B 5TE7H 5BO1H 2IAMB 4C4KO 1ZSDB 4D3CH 2DBLH 1CK0H 2X4TB 1MPAL 1UYWL 3LRHA 4M7JH 4HPOH 4LCCC 3VXNA 1DSFL 1CGYA 1RUQH 5FYKU 3F7PC 4QCIB 5IMMB 4OBRA 4NNPL 4RGOL 4M61B 1Z3GL 2RCSL 1GZQA 2VDPH 3FOMB 5D2NB 5GGSA 2L7JA 4DFIA 4E0RB 5CJQH 2BJML 4PTUB 2WP3T 2G5RA 2XPGA 3ZDXF 1OSPH 5INDB 3SDAC 3L3GB 1UENA 5EU6A 5GRXG 2VR9A 4JFDA 5D72L 2BVPB 2CDGA 5E2VL 2NY7H 1FYTA 3MXVL 1L0QA 3RX8A 5BQ7B 2VDOH 4AM0B 1IKFH 1T7XA 3SE9H 3MXWL 1AI1H 2YD5A 1FRGL 3I2CH 3S97C 5C92A 1NFIA 3DSFH 4GRLD 1VKXA 2P5WB 1RZJH 4AYFA 3BMVA 2DLGA 1BAFL 5MEOA 4YIQB 5E6ZA 1KULA 4HCRH 1YC7A 5DC0A 4J3XA 5ICXB 4GRWF 1P4IH 3QJFA 4DUWA 3L3KA 2R1WA 3VXQB 3QEQA 3QUXA 5M94B 2WBJD 4IBLT 4TYUA 2AEWA 4P9HL 3JXAA 4QHUA 1IE5A 3AU1A 3W5MA 1IGJB 1BVZA 3EDJA 4U49A 2VAAA 3D25B 4EN3B 3TH2T 3B9KA 2BFVH 5BV7L 35C8L 3IDYC 2AAVA 3UTZA 5LXGL 5FDWA 5FDWB 3OAYK 5D1QB 4HG4K 1ITCA 4UIKL 4UT6H 4ZODA 1NDMB 4YQXH 5K9OB 4QRTA 1OAQH 5JR1L 5C0IA 4JRXA 5HYSB 4NQEA 1EXUB 5H37H 1LGVA 2XKSA 3TT3H 4JLRA 3PV7A 4GSDL 3LHPH 4UTBL 4OGZA 1RU9L 3K3QA 2X89D 4YDLB 1I3RA 3ARGA 3CZJA 1OPGH 5CJXC 3GO1H 1Q94A 1E4XH 4A6YL 3X11B 1FNSH 2MSPA 5F89A 3UTPE 3S34H 1Q1JL 1NUGA 2JKXA 1NCCH 2LAAA 1YZZA 3O6KH 4L5FL 1AY1H 3GM8A 2FBOJ 2CGRL 1XR8B 5F70A 4AJ0A 4ZOBA 1M71B 2APXA 3OX8A 5E1AB 3MACL 2NY7L 3MXVH 1IZJA 1UXSA 4V2BA 2Q20A 4JFEB 4JN2A 4NNYB 2P42B 2GYSA 5KSVB 3LRSA 1DQLH 5ANMB 1JZ6A 1CDJA 4W68A 5FB8A 2P44B 4HAGA 5JOEA 4LLYA 5F1NA 3FRUA 1CL7H 2Z91B 1KB5H 3U36B 2DQTH 3G9AB 1BZ7A 4AEIH 4MHHG 4LCCA 1EHLL 4ZSOB 1RPQA 5TDNA 4NKDB 3UP1A 2LTQB 1CE6A 2AJVL 2JIXB 1QSEE 1DSFH 3MLZL 4JGMA 4UV4H 1OOAA 4NKIH 1XCTA 4DJMA 5L6YH 1HI6A 5IMKA 1AQKL 2YC1B 2CJUL 3FCTB 2YC1A 3OKOB 1OTTC 2PYEB 4PRAB 4DWHA 3RGVC 1DE4A 1F3RB 3NFNB 3OB0H 4FFYH 4KZDL 2B1HL 1DEEA 4CVXB 3QDGA 4Z0XB 4OZGB 1S9YB 1N26A 4GAGH 4A2LA 2X1OA 3QUXD 4X6FB 4NC0B 3NGBC 2WUBH 1K8IB 4UTBH 1I1AD 2R1YB 1NMCC 2IWGA 4NZDA 3C5ZC 3WE6B 1KIQB 1G1YA 4K07A 4HIIB 1BBJB 2PW2A 4P5TC 4UAOC 3BZ4A 4AK1A 2V6HA 5HHOE 5CGYD 4XHQA 1AXTL 4X7DC 3RIAF 4YQXL 4TPRL 5BMFH 4XTRC 2BSSB 4YO0A 4XT1C 1KC5L 2O93L 1IJ9A 3E3QC 3VXOB 4WJ5B 2AXFB 4C56A 4OI8A 4U1LB 4G8IB 5JW4M 5KBNC 1EMTH 1Q9LB 3MV8E 1RZ7H 4HC1L 4X5XA 5D7LD 3U9UB 4LSRL 3G08B 2F5BL 4MQTB 4D9RE 5HHVL 4QWWD 3ARBA 3RVWC 4HUMB 4EJ1C 3SDCC 2GI7A 1R3JA 3REWA 4R26H 3REWB 3WNNA 2ID5A 1MFAL 2JB6B 1P4IL 2HTKD 1GIGL 1W72H 2FZ3B 1MFDL 2FZ3A 1EGJA 3UX9B 1ZANH 4O02L 5F1KC 3GMOA 4HGWB 1YMMB 1CU4H 1UM4L 4TTGA 2VDNH 3NN8B 2M26A 2CLZA 1P7KA 3GMNA 5FUZL 4M6AA 3QP3A 2CMRL 2YPVH 1FZOA 4LNRA 2ARWA 2HTKC 4P23B 2O5ZH 5GIRA 4WUUE 1T0MB 5CLTA 2IANA 5INCA 5FO8A 2QQKH 5DDHA 3L7EA 4WFHD 4KJPD 5I16A 1ZXQA 2V2TB 3OHXA 4NGHH 4KPHL 1OGAA 4OI9A 3GSVA 8CGTA 2MCPL 3U1SL 5JOPD 1IEBA 1YNTB 3MLPA 3VFMA 1B0GA 3D1MC 1QFUH 1B0GB 5EU6E 2BNRE 4LSTL 4Q6YA 3CC5A 3KPPA 2E5EA 4P2QD 2VLKE 1U2HA 5JIKA 2K3TA 2R29H 3ARPA 3UC0L 2HFFA 4OUUA 3UDWA 3RNQB 5BO1L 1JZ5A 4MB4A 3STLA 1KB5B 5T33L 1CFNA 1S7UA 3HPJA 4LBEB 3JTSB 3HC4H 1WBYA 3G6AB 2YRZA 4U0RC 3GSNB 4YX2H 3TVMD 3CFEB 1P4LA 4LKCA 3V4VH 4FQJH 4MAYB 1A7RL 5GS2H 4QXUH 3L3JB 4Y88A 3QEQE 5INDA 3WO4B 3I3BA 1BX2B 1C5CH 3VFGH 5EU6B 4HMCA 5BRZD 4OLYH 2CIKB 3SE3C 1AJ7L 5DUBA 3QUYC 4NO2B 5MHSE 5IBTH 1LEIB 1FFOB 1EZVY 3KS0H 3C9NB 4GMSH 4GUPA 1WC7B 3GMQB 2DMBA 3HI1B 3GSNL 1QFUL 2YEZB 3UYOD 1FAIH 2FECI 2RHEA 1A21A 1G7MB 3UBXA 1XMWA 2OJEB 4UBDC 5KZCD 1PJ9A 1QNZH 1MFBL 1SEBA 15C8H 4LSPH 3TH3T 2R2HB 5FO9B 4OGXH 5A2KH 1W0WA 1W0WB 1HIML 5FUZH 5BZDB 4I18A 3IU4H 1R24B 5IHBA 4PRIE 3L5WB 2CKBA 3RY6C 5T3ZD 1ZOXA 5EOQL 4X0KB 3AU1B 5C6PB 4ELMB 2H41A 4X0KA 3P30H 1RUML 1ZA6B 1H8SA 4KHXL 5EIIB 3G6JE 5I1LB 1QBLH 3GJFK 5CIPA 5CLWA 2PTUA 1EUUA 4MQ7A 4XB7A 3M17A 4Y4HA 4ZAKB 4O5LL 3SQOL 3Q0HA 1OY3B 2DLFH 1FDLH 5EZJB 3RA7L 1XF5B 2BNRD 1NAMB 2IALB 4BA8A 5C08D 5IVNA 3IDMB 2R0ZH 3CFCH 3MBXL 4G6AC 2R39A 5H8DA 2NLJA 5L2KD 4QTIL 3QG6A 1OAKH 1KNOB 3FO2B 1TIUA 2OX5A 4LPWA 4WFHE 3WO3B 4YFEA 1J8HD 1TLKA 2XICA 1J1XL 4PRBA 1Q9OB 5HGAB 2IPTL 4YHMH 5A2LH 4HKZA 4MCYB 4WENB 4X80L 4P3DB 2H1PH 1NCDH 3NPZB 5E2WH 5BOZG 3TBYA 4MHHI 5IG7A 1AXIB 1I8LC 3DX9A 4KY1L 1S7VB 4PJFE 3QULA 2Z31C 4Y19E 2V7NB 4MD0B 3MO1B 4DW2H 3QYCA 1FNEB 1I1AC 1S7XB 5HYQA 1YPZF 2VLJD 1A7QH 4JZNA 1JCKA 4R97C 4LLUB 1AJ7H 4L8BB 2N4IA 1U8IA 4YHPB 4ZSOE 1C1EH 3KS0J 4HT1H 4NNYA 1IVLA 4YHPA 5FYKD 1QYGH 1T04A 1U8JB 4JO4L 5D2LB 4MAUH 3S5LA 2OMNA 1HSBA 2HMID 1RK1B 3BDBA 2B2XL 2F54D 1E6JH 5CBEB 4EDXB 3UDWC 4HCRA 1IGFH 3BEWA 2DM2A 4XMPH 3QG7L 5IVXA 2Y1VA 5C2BH 1HHGB 2R69L 4K71B 3GRWA 2OSLA 2F5AH 5D2LF 3OXSA 4RFEB 5HYSG 3DLQR 2YPLE 4HWEH 4UQ3B 1MJ8H 3D39A 1JJUA 1ROWA 4HLZH 5D7JB 5EFIA 1M6OA 3BESR 3WD5L 1PKQB 1KEML 4FFZH 3K2UH 4K3JL 1N64L 1R5IA 4N90D 1JV5B 1SY6A 1CDHA 3NCBB 1BMGA 4WTXA 4QTHB 4IOFC 1NLDL 1DBAL 1BD2B 4HKJA 5K9QG 2OTWA 4NUJB 4UT9H 4NZUL 4IRZL 4X9FA 4WTZA 5C0EA 1AY1L 3BIKA 4L4TD 3DURA 3PXJA 3V4UL 4NP4L 1XCQA 2COQA 1QFWL 4OZHB 1VFOA 3VD3A 1KELH 3P4LA 1IEAB 3RGVA 3AROA 1I85C 3NPSB 5FYKH 4IRJA 1QSED 4M7ZB 4YBLB 1JYXA 3P9LA 5DFWH 4QHNA 3LKOB 5E2TH 3BD5A 2PUQT 4XCNA 3RHWF 1BOGA 1BBDL 4TRPH 5M7QA 4L4TB 1D9KA 4JB9H 4KMTL 1MREH 4ZUUA 1NC4B 1LVEA 4L3EE 4PJ5A 3RWIA 1PD6A 4Q9CA 4ZUUB 1J10A 4O4YH 4UIKH 1OGAE 3CDFA 4OZFH 1FH5L 4JDTL 3RVVD 1CDUA 1B4JH 2Z8VC 1RZGB 5EC1B 3DYMA 1I3GH 2C4XA 4BZYA 4P57A 1CQYA 4XPAL 5DRWA 5E2JA 3ORJA 1NMAH 3D9AH 3HI6H 4NQVB 1MNUL 4P49A 5KG9B 2ZCHH 1P7KB 1I3VA 1MCDA 2ESVA 5I19L 1HINH 2X4UA 3KYMB 1FVDA 5FDYA 3X17A 3KYMA 4L3EB 3VW3H 2JCCA 1QRND 1H8NA 3BEVA 3WN5B 4R7DB 3MODH 2EXWC 5ITBH 4OD3L 2IFFL 5F7EL 4HDIB 3DNKA 2DWDB 1U58A 3EO1A 4LCWE 2ICEA 1BFSA 5IIEA 1XZ0A 1A6ZB 2B4CC 4K3HA 1QFPA 5D71L 4MB5A 3WFCL 5DHVH 4JAMB 5C9JB 4TVPH 3AAZA 3IDXH 5JW4R 4TTDD 1H3GA 3N50A 5HHOB 3QDME 3DRQA 2WLYA 3QDJB 3UTSB 1MHPL 4F57H 4TUOA 1NEUA 2FB4L 2CIIB 3S35H 3HKFA 2VLRA 1QBBA 1A6PA 2ENSA 3AXLA 5GSRB 1G0XA 3O3DB 2J4WL 3MJGX 1Z3GH 4NWTH 3O3DA 2NXYB 4QRPB 4Z7UA 2WW8A 4ZUTB 1RUQL 3OKEA 2GTWA 2HKHH 5MHSD 2W9EH 2VZOA 2QADB 4K8RC 4FQXD 4QRPD 3ILQD 5IT2H 1G7QA 3HC3L 4BSVB 3UYRL 3VWJB 1XGPA 1AC6A 4KUCD 4HMDA 3EYOB 3HZYA 1U3ZA 5J9PA 3DUUB 3LS5H 2NW3A 3TA3D 1H5BB 4AT6A 5DJYB 3EFDH 2GCYB 4R2GD 1U93B 3UTTD 4ZTPH 3RGVD 2MQ3A 2BNQE 2DL2A 3T08A 1W72A 3LSOB 4OT1L 2APWA 3CX5J 1NDGA 1AQDA 1N4XH 3FMGL 4XNQA 5CEZL 1AH1A 1FHGA 1A22B 3KHOA 3BHBA 4JHBA 3C5SB 5I19H 3U79A 1PG7X 2J6EH 4JY6B 4P9ML 4P5KA 4CAGA 4CVZB 1RZKC 4HFUH 3B9KD 4XVJL 3ULUE 5HYJB 2DI8A 4YJZL 3FB5A 3QQNA 5E4EC 1S9WB 3MFFA 1DBKH 4UT6L 1EEZA 3M45A 4OLZH 5HYJD 1D7FA 4PY7B 2VXUL 4RMTA 3VXQA 3QUXB 4CN4A 4EI5D 1X5LA 4XAWL 3A6OA 3FQNA 3HZMB 1MI5D 5BV7H 1UB6A 3HCVA 4O4YL 2IJ0C 3T77B 4P4KD 1JRHI 1T66D 2H2SC 1HH6B 3FB6A 5KSBE 2CLVA 1IC5L 3RX7A 2JB5L 1KACB 1BLNA 3CMOL 5IHUH 1XF4A 3UZEA 3ZE2E 3L95B 1DUYA 4NCDA 3ELAT 1F6LL 5DVNA 2F8VA 2HP4A 5DEFB 4G6ML 4QYOA 3K1KC 1OCWL 5J6HB 1I1FA 1SYSA 2FEDD 4ZQKA 5D1ZC 12E8H 1QBML 5CS7A 2XTJE 4E41A 3A6CH 4NC1E 3HZKB 2FX9H 5GZND 4PBWD 1IAIL 1AGDB 5F6HI 1CS6A 3RVTD 3D48R 5KVDL 3HZVA 2DRUA 4KDTA 4RAUB 4MNQE 4Q97A 1NLBL 4KK5C 3QNYA 1NC2D 3RZWA 3SCMA 3JWOH 5KAQF 4MA8H 2AXGA 4XBGB 1B9ZA 4GG8B 4MAYC 1MUJA 4P4RB 3UTOA 1CI5A 1YMHB 2WWKT 1TCRA 2YN3A 3NCEB 1EJOH 1VFBB 7FABH 5I8KH 4XVUC 3KXFD 5EORH 1PZ5B 4FQXB 3SY0B 3UPRB 5F44A 3MLYL 1CDCA 1ACZA 5ILTL 1G6RL 2I9LA 3QFJA 3MV7A 3GHBH 1JGUL 1QLFB 3T0XA 4NBXB 4JHZA 5JPNA 3O41B 1P7QA 3FRUB 2O26U 3GIZH 5F6HJ 3MGTB 4RNRB 2P8PA 3VGFA 5AEAA 3FB7A 1ACYH 3KLAA 5ACZA 4RGMC 3VFWA 4WI5A 5J57B 3LN4B 1TETH 3OAUH 1V7NH 3ZYIA 4AL8H 4F7MB 5DD1H 2NY5L 3V0VA 4F7MA 3TVMA 3BPLC 1RURH 3OJ2C 1NGXA 2JE8A 3O6ML 1NAMH 3ARGB 1I1AA 3KJ4B 2HYMA 3Q5OA 5DEGB 4UOW1 1A0QH 5F7DB 3RWHA 4XNXL 1A4KA 3AREC 3AMLA 5HGDB 1I8LA 3UXFA 3C2SA 3D39D 3PGFL 4EVNA 1J1OH 4MVBC 2FJGB 3U30C 1J5OL 1DL7H 2R23A 4JPVH 4R96B 3BIKB 4XWOC 2E27L 4KJWC 3CX2A 1GC1H 4M5ZL 3KYOB 2XKUA 5C0CA 5B8CB 5C0RL 3JWNC 4NFCA 3SJVA 1EO7A 1DLHA 2CD0A 3V6FB 3ZYZA 3NPSC 3WS3B 4TSAH 3ARTA 4P4KA 4QHNB 3IKKA 1U92A 2EXYC 5EOTA 2VXSL 5A16A 4H5SA 3CFCL 3MBXH 5GRJL 2A9MH 4GFTB 3ZDYE 4L4TA 1SY6H 2C1OB 2Y5TB 4LPUA 1KIPA 1MAKA 1P2CB 4XZUB 1P1ZA 3BAEL 4Y8AA 1G9EA 4RGND 3HC0B 3CXHK 1KCUH 2PXYD 1N3NA 5D6DA 1MQ8A 3EDEA 1NBYA 2Z8RA 4IRJD 4LAQH 3BPCB 4JY4A 4EI6B 3TWCL 4JQVC 4R6UA 4ONOA 3FTGB 3MPCA 2FD6H 4G42A 4POUB 1DE4B 5HGBB 3ARBB 5IBUB 5HGBA 5D6CB 4Y2OA 2OJZL 4BFGA 4QHMA 3JV5A 2AJ3B 3KPTA 5F9JA 4ZNEA 1QFOA 1LO4H 1YN7A 4R4BB 2VXQH 5BZWA 3WXVL 3EHBD 5C71A 4MNGB 2P8LA 4KQ3H 3PNWA 4ELMF 1MFEL 5HYJE 4YR6B 5B39A 3KJ6H 1XFPA 2XA8L 1KF9B 4OFPA 4PJ8D 3GMOB 3L5IA 4HMEA 1JI2A 1ITBB 3BZ4B 4OCWL 4WO4C 4ONGH 25C8H 4P23A 4BK4A 2WBJB 2ICEB 4U6VH 4MD5B 4NHCH 2V2TA 4PY8J 3TO4B 1A7NH 1C5CL 2FBJL 1YY9C 1K6QH 2ZKHL 4HH8A 5T1MB 4P5TA 4XC1L 3LB6D 4FQJL 5D1XD 2DLIA 4MJ5B 3U9UA 1UH4A 1FORH 5D1QD 4GH7B 4PGCA 5IMOB 1QR1A 5GS2D 1R3HA 3UJJL 1HWHB 3B9VA 4LGSB 5JXED 5KN5B 4CRPA 3JTTB 1KJ3H 3U4AA 5IFHH 2PR4H 3MOBH 5J0BA 3WUZA 1U8HB 1S5HA 4OCXL 5T1KD 2BCKA 4KI5E 4W70A 2AV7A 1Q8MA 2YPLB 1VPOH 4QT5B 1UXWB 4CVWA 2QKIB 2G9HB 2EYTB 3E2HB 4AMKL 1IGTB 1PG7H 1IGTA 4S10A 4P3CL 2QSCH 4JFQA 3GI8L 3DUSB 4JRWA 5DDHB 4GXUN 4S1SH 2C1PA 1WSST 1I4FB 1YEKL 3ULVL 1JIBA 4JFFB 4P2RD 1MCSA 4ZUVA 3QPXH 1LP9B 3C5SA 5D96B 3KXFE 4G9FA 2HAZA 5DUPL 1MY5A 3RWDB 2EDFA 3QCTH 2CLRA 3TF7C 5EN2A 1A7BA 4HH9B 3QUMB 4J1UB 3LVEA 5CZVH 3QUYD 3MV9A 1QO3B 4KHTL 4LSVH 5GRUH 5TPWL 4YHLH 4JKKA 4LKXB 4TSCH 4XPBH 3TIDA 1N59A 5DF0A 3JWDL 1KB9J 1TVBB 4XXCA 3MC0A 3GIVB 2IC2A 4QCIA 1QSVA 3D87B 3L3OA 1S9KC 4XVSL 1GGBL 3H9HB 1OD7A 1J0ZA 1U91A 1U8PB 2NY1C 1E28B 1F11A 4MMZC 4U0RB 4MGXA 3STZA 1Y18B 4EBQH 2GIYA 5BVJB 1HZHL 3ARGC 1EO8H 4PB9H 1BLNB 5BS0E 4BH8A 5FYLL 4ZXBC 2DMKA 3RBGA 3RWGB 5IM7A 3BDYH 4YWGH 3NTCH 4NO2A 5BQ7A 1J11A 3I02A 4C55A 3ZTNH 2W9DL 4NPYA 5TGBA 1KSRA 3B2VH 4Y5YA 5ETUA 3LEVL 4ZFFB 4X8JB 4N9GA 3BKML 2R4SL 5J4MA 1AGEB 4HKBA 4P2CG 3NACH 2FGWL 4FZ8H 3LY6A 3P9MB 3BKYH 4R90L 4JO1H 4Y5XC 1YNLH 5ICXA 3T2NL 4OLWL 5GRZA 1N8ZA 3IDGB 4O2EB 3L3KB 2ESVD 4GAJH 1JRHH 2HVKA 1CGSH 1T0NA 4P23C 5H35B 2GFBA 4OZHE 2GT9A 1T0NB 3ULVF 1DN0A 2ZOKB 1MCPH 1CF8L 2E6JA 2VR4A 4Q2ZA 2XZCL 1BM3L 3VFPA 4I48B 4Z76A 4ZS6D 1MCCA 3MRHB 5KS9B 3CU7A 3ULVC 5HYQB 3GEWB 1OB1B 2DBJA 3R06B 4WI6A 4JRYB 3KPSA 4M8QA 3HG1B 4G8EA 3EJZC 4PGDA 4XP5L 1MFCL 2HVJA 2DYPB 1WBXA 3RUGE 4Y5VB 3KLDA 5LQBH 3SY0A 3C8HA 1MAJA 3CFJB 4KVNL 1QRNB 2EH8H 3CMGA 3MRQA 4NZJA 4HK3N 4MNQA 4PJ7B 1JNJA 2XQYG 3DIFB 3HUJA 3T0EE 5HDLA 5KVGH 2BRRL 4UNUA 2PXYC 1BGXH 5EO0B 2D03L 2F54B 2VXVH 2PETA 2CDFB 3VXTB 2OYPA 3MLSH 1FP5A 3TBSB 4LLAA 1HILB 1YMMD 4JG0L 1X6NA 1MJUL 1Q72H 3O8XB 4F7TA 1TJHH 3LEXB 1BWMA 1M6OB 6FABL 3QR2A 4OD2A 3VXRD 5JW4N 3EYFA 5JOFA 5EU7E 1PSKH 3QUYB 4NM8L 4ETQA 1RULL 5E1HB 4ETQB 3CGTA 3I9GH 3MCKA 4ODXA 4X7SL 4Z0XA 3QUXC 4HS6A 4ZUWA 1XF3A 4FNLL 1CL7I 5E99H 5A3ID 4U05A 4QGYA 4ODWA 1A02N 3QDJD 2Y06H 4JFEA 3HPLB 4EUPH 4MVBD 1JNNH 4JCLA 3WS3A 4LPTA 4JREC 2I60H 4H1LH 5A2FA 2HFEA 1XCQB 5CBEA 3IDYB 3QH3B 1FV1B 1A9EA 3WFHA 1QLEL 4OFYD 5EDXA 1JHTA 2BY2A 3L3HB 4PUBL 5ENWA 1S9XB 2IPKB 3TZVD 2IPKA 4I2XA 2X9WA 4PP2A 3MRMA 5IP4A 1F45A 3JV6B 4KV5F 3ZKMD 4MNGE 4EI5A 5DVKA 4HUUA 1CN4A 3ROOA 4EI5B 3KR3L 1PKQA 3HMWH 1U8KB 4GLRH 4YHZH 4XWGH 3NFNA 1TZIA 5EU3B 5L88H 1AXSB 1BECA 4HUVA 1YNLL 1A3LL 1E6OL 1U6AH 2DJ4A 1I1YB 1MF2L 5D5ME 4OLVL 1MCFA 1QFHA 4MWFB 3BKMH 5FKPB 2HG5B 3G04A 5AD0B 4QXWA 3EW3B 3G04B 3U4BL 2HN7B 1AE6H 1JPFA 2ATKA 1ERNA 1JPFB 4KTDL 1RZJL 1JGDA 1KXQE 3ARED 4FS0A 3BDYL 4UDTA 3VXUE 3VMNA 2BZDA 1CICB 3QXWA 3ROLB 4JPKL 2WBJC 4XVTL 3CK0H 4OGAC 1EA9C 5DC9B 4XGZA 1EHXA 5CJXA 4OCNC 1Z0MA 4P46B 1MVFA 3HHRB 5GS1C 4WJ5A 3GKWL 5IUSA 3RWFB 1NSNH 2BERA 3IDNB 3MRCB 5LBSH 1P5UA 5A2IH 4GW1A 1HYSD 3LQAL 4WV1B 3I6KB 4D0CA 3EOTH 1D9KB 2WP3O 4LASH 1HHJA 4MS8D 5AYUH 1SBSH 2ICWI 4PRHB 4K3EL 5DLMH 5HHNA 3O2DH 4NFDA 4RMRA 4E42A 3MUJA 3DUHA 5FF6B 3KXFA 3RNQA 4BH7B 5IHZA 3S37H 4GJTB 1G7PB 1RZGA 1CIUA 4M1GH 1JUFA 2XZQH 2OQJB 5IB5A 4P5TD 3DMMB 4M02A 1V3KA 4KRPC 2XXMB 4WI2A 4OF6A 5DVLA 3KWWA 4OCSH 4OTXH 2H6PB 2YXMA 2ZSWA 3DX8A 1IGCH 5TE4L 3QI9A 2V5RA 3FO0L 3MLWH 3DX8B 3OKKA 3OR6B 5A40E 3LN5B 3BE1H 4JFED 3S4SG 1QR4A 3H3KA 4L3EA 4PJ5E 2VLKB 3OR7B 3DUSA 3GMQA 2QHLA 5KSAC 2I24N 3QHFH 2DDQL 2LVCA 4M48L 5IROC 4DGYH 4ZUVB 1E27B 3QDMD 4HDIA 4FABL 4RMSA 3VD4A 3IXTB 3TNMB 1CR9H 5I17B 3EO1B 4X6DA 3ZKND 3FT4B 4MA3B 5FOBA 1VGEH 4ZO6A 4X6CE 4QRSB 5EU4B 4AIXA 4QNPE 3RWCA 3WIHH 5DK0A 4MDJB 2ZWLT 3HRZB 1RZFH 3G9VA 3TIDB 1S7SB 5KAQG 2F58H 1B0WA 1OM3L 1FN4B 4MXWH 1G0YR 3UTSA 3X12B 3L5WA 5IB4B 4P2RA 2W0FB 5T5FL 1NGYA 3P0VL 2AVGA 3AXLB 3M8OH 5GSRA 5SWSD 4HFWA 5CJ8A 4J6RL 3V0WL 4CU8A 5DO2C 1TTGA 3WDJA 2XZAL 2YKLL 3FFCB 4AENA 2RGSA 3WFBH 5I1LA 2NR6C 4NC2B 4JM2C 3T0EC 3D3VE 1G0DA 5IQ9B 4AEHL 3MYJA 1MCHA 4JO3L 4JDVA 1OTUD 5DJXB 1DVFB 5KTEH 4GW4A 5IB3A 3P4MB 1ZVHA 1F8TL 1NAMA 5KW9H 2PO6A 1YPZA 2WUCH 3IDMA 4JM4H 5SX4H 2AK1L 3ZT6A 1YEFL 4YLQT 5DJYA 3MRDB 1M7DA 2AJSH 4Y1AB 4KKBD 1XF4B 3M07A 4LMQI 4HKBB 1TTUA 3DXAB 2WK2A 4IRJC 1KCLA 1LE9A 4RGNB 5J7CC 4RRPG 5HYEA 5D5MF 4LSUH 1KPUA 2ZUSA 3B6SA 1J8HA 3MRBB 1T5WA 2APVA 4YGVA 4ZFZB 4X9IA 2AABL 1A6WH 3FZUC 3MO1A 3VD7A 4DGVH 3SN6N 3FQRA 2XRAH 4IS6A 1BFVH 5GS1A 4DZ8A 2R1WB 1MCBA 2UWEA 2DYPA 1KN4L 3EFFB 1C5BL 4F7PA 4WFFD 1P4BL 4XWOD 5EBLA 1SY6L 4V2CB 3RL2B 1YEGL 3BQUD 4HEME 4YHKL 2VZSA 4PJGA 5EOCH 3W9DA 5IEHA 3ULVE 3WDHA 32C2A 4KI5C 2YWYA 1AR2A 1T3FB 3ZO0A 5C0JB 3SOBL 2IALA 3D18B 4PGZA 2Z35A 3WIHL 1R3LB 3CCHA 5EUOF 4ZXBA 1FCGA 3MRGB 1NBQA 4TVPD 5ALBH 5AAMA 2ZCLH 1I9EA 4OCRH 5DMGD 3WLBB 5T1DL 4GRWH 4AIOA 3B3IB 3MTRA 3L6FA 5AUMA 3KPOA 2Q86A 5ACZB 4HWBH 3PP4L 2VDRH 3TYFA 4Y4FA 5C0CD 5D2LE 3ZKXB 4CKVX 3TVMB 4Y16B 5DMGC 4PLOB 4K9EC 5LGJB 3V5DB 1DN2A 4RQQA 4AL8L 1CDIA 1WTLA 1PLGH 5EU6D 4WHYH 5BRZB 2EKSA 4O51A 4X8XA 4X5LA 5I76B 1ONQA 3GSWB 5JHLL 4RAVB 5SWSA 5I8OL 4WDIB 3NOIA 2EDOA 1WT5A 3QIUA 1P5VA 3BN9C 3F58H 2NY6C 4H8WC 3I50L 1HHIA 3VE0A 1FLTX 4I13B 4Z0BL 4G7VH 1VFAA 4NYLB 3IETB 2P46B 3BEWB 4XP9L 3K46A 2D7TL 4ELKA 1T6VN 1LK3L 5HHPB 2YSSA 4GKZA 5I8KL 1DFBH 2EICA 1RUKH 4YPJA 2FR4B 3ARXA 1PG7W 3BOVA 3SDXB 3VFVB 1DBJL 2HTLC 3DMMC 5GJTH 4Y2DB 2LU4A 3MGTA 2VAJA 4XXDB 1TJIH 2Z31D 1NUFA 3VWKD 1S9VA 5I1HL 1IT9H 3STBA 4XC3H 1JZ2A 1B90A 2VQ1B 2FJHB 2OI9B 4PGBA 2R4RH 5FHBH 4KJQD 1LEGB 5FV1L 4Z18A 4XBPA 1N3NB 3BT2H 2HT2C 1LO0H 3VG0H 3A67H 4RWYL 4N0RA 4PJ8A 5DEGA 3TJEL 1H5BC 2V5TA 1V8HA 4XNYH 1N2RB 2Y07H 3CDGB 3O6LH 2NTFA 3CDGA 4YHOH 3BH8B 4OQTH 3FQTA 1UH3A 3BH8A 8FABA 1R3KA 1JNLL 4Y89A 1A4JB 3QNZA 2BXYA 2A77H 1ZLWK 4G6FB 4ORGB 2GEEA 1EAPA 4XP6H 4PJ9B 4JHWH 1REIA 5FCUL 3V6OE 4PJFB 2GJ6B 2EE2A 2QQLH 5C0BD 1G7HA 3H7BA 4PJAA 1NGWB 4BK5A 2P24A 1VADB 3IF1A 3BKJL 4CU7A 2BVEA 3RDTC 3MRPA 1KT2B 1UADC 3MGOA 2W65A 4U1HB 2ITDB 2X41A 1SYVA 3MA9L 4LOUD 3NZHH 2RB8A 5I1JL 3KYNA 5EC2B 1X6LA 4YO0B 2ZUYA 4DUVA 1CBVH 4U3XA 3KG5A 1ADQL 3MNZB 3V6ZA 5ID1B 1CDGA 5HI5D 4D0DA 3DYPA 4JRYE 3FB8B 3HR6A 5IKCA 1CGUA 1GOGA 4X6DE 2XG5A 4JFDE 4W81A 5CSZB 3ARBC 4JFXA 1R3HB 2Y36L 3WSQH 1HOCA 2VYRE 2GTWB 5HI4D 1OAYL 3T8XA 1MWAH 2ITCA 4OZIA 3S3JA 1ZA3B 3O11A 1RJYA 3OR6A 1UKQA 4B7LA 1MELA 1RJYB 3EJYD 2FYYB 2XZZA 1DDHB 1KPVA 4Q74A 2IG2H 4WW1B 3KNBB 3IVKA 4OM0L 5HJ3B 3SBWC 2QBWA 3RL1B 4LEXL 1WZKA 3VA6A 3RL1A 4N0FA 2GJZA 2WLZA 3SGDI 5FAAA 1HQ4B 5J6GA 1WV7T 4EOWL 5I66A 3BGFB 4WVRA 4ONFH 3GBNL 5CMAB 3NH7L 3PWVB 1KEGL 1FZJB 2UZIL 3RQ3A 5I73C 3G5XB 2B0SL 2G60L 4XNQB 4DGIH 2E9IA 1FSKB 1P84J 2D0HA 1YPZE 5EUOE 2F15A 3I85A 4LASL 4BQ9A 3VA2C 1OAZL 3QDJA 1T2QL 3EO0B 3MRFB 3CSGA 5KSAD 3L1OL 2NY4D 4G8GD 4OZGF 1FFQA 5KVFH 2DI7A 1W2KT 3FT2B 1H3PH 5F7MC 2PNDA 3DSNA 4H0HB 4XMKL 4JPIA 1ZSDA 4PYHA 5AG9A 3N06B 2AJUL 3ZDZE 4WWKD 3HPJB 1MH5A 2DM3A 2FATL 1FL5B 3B5TA 3BN9D 4LNVA 4KK6D 5DHYA 1C8PA 3L5XL 4Z7WB 3EYOA 3C8KA 1JWUA 2ADFL 5T3ZH 1CDBA 1MI5A 5E8PA 4G8GB 4GAJL 1JRHL 1SQ2N 2ZSVB 1H5BA 1KIRA 1LO5A 5DJAB 5BJTA 1RJLA 4U1SB 3L95A 1DBMH 3QHZH 2CDGB 4JDZA 5JXAL 1YEJL 5E9DB 4I1NB 4L4VE 5DEFA 5CBAA 4HZLB 2GAZB 3D69B 3BO8B 3D9AL 2W07A 2E7CA 5IHLB 5ALCL 3BJ91 4HAFA 4NJAL 1N6QH 2P5WA 1YECH 4PJGF 1MRFH 2OZ4H 3LV3B 3RTQD 5JNYB 1WGOA 2X4OB 1MAMH 4LQFL 3WXWL 2V5YA 1FH5H 1RZKH 4FQ1H 4IS6B 1J0YA 3QNYB 5D93B 3AUVA 1RHHB 4LKXA 1BVLA 1U8LB 5C0BE 2GT9B 1R24A 4KQ4H 3PUCA 5C7XH 3HZMA 1N5YL 1U3JA 3RY6A 5IEHB 5ELIA 4PFEA 2R2CA 4LDOB 1CLZL 4ZAKD 5IESL 2MWCA 3QIWD 3MLRH 1IGML 1HHKB 3QUZB 3TT1L 3VH8G 3CSYA 1YEDB 2L7UA 1C5DA 2BNRB 2FH8A 3QFJB 1QOKA 5CGTA 4ZXBB 4N0YL 5CGMA 1XF5A 3FJTA 4ODTL 1TITA 1YEIH 3I9GL 1MJJA 4QRPE 4Z9KB 3VFTA 4EOWH 1NDMA 5IEKA 3QISA 1A64A 3K4DA 2EE6A 1X5IA 2FX8H 1PSKL 4MMXC 4WUKL 2IBGA 4O58L 3WFEH 3OB0K 1EXUA 5GS3A 4U1IA 1I9JL 4Y4FB 2Q8BH 5JORB 5L8LB 3HFML 2AQ3A 2APTA 1T83A 3TV3H 5F7DA 3RWHB 3OJVC 3X11A 2MTPA 2DQJL 2HVKB 3NIGF 3WSQL 5FGRA 2X42A 4HBCL 3G6DL 4D9RD 2V7NA 2SEBA 1UM6H 1FLRL 3O4OB 4OF8A 2QSQA 1RD6A 2BX5A 4DKAA 1U36A 1UB5A 4ODBD 1HQRA 4ZPVB 5DT1L 1K9TA 3KYOA 1ND0A 4CJ1A 3GSOA 3QDMA 1YN6B 1JYVA 1KJ3L 2BC4A 4J7RA 3VE0B 1ZGLM 3GSOB 3QDMB 5DJCB 4C56E 4KWUA 2KQNA 4JVUA 4QF1B 5HPMA 3MV7B 3TGXA 1F4YH 4LLYB 1J0KA 5F1NB 1XH3B 4IJ3B 5FB8B 3AY4C 1A9EB 1L7TL 3RI5K 2P8PB 1FL6B 1NBZA 2XZCH 4MJ2A 1DBBH 2ZKHH 2A1WH 3U83A 4N5ED 3P77A 1CE6B 1C5BH 4QRUB 4YC2B 3OXSB 2FO4B 4RFOL 3I6GA 1RSFA 5H2BA 2O5YH 4YXHH 2BVQB 3AM8A 3IJHB 5HHQB 2CPCA 3SDDD 2ADGB 4WU7A 3S88L 5MEQA 1UJ3A 2AERT 4HUUB 1IFHL 1A5FL 4WO4A 4L9LC 3EYFB 3O6FB 3W0WA 5C07E 5GJSH 2EDRA 3WIIL 2VH5L 3FQWA 2R8SL 4XPFL 5D70L 3QNZB 1IGIH 3QQ4A 4PJIA 5DMKB 5D96C 1BD2A 4PJ9A 1ZT1B 3SJVB 5DZNA 5MENA 1GC1C 1ZT1A 1NEZA 2GY5A 1D5IL 3QUML 1TZHB 4YK4C 5E95B 1FVEA 5DSCA 4P2YA 5B39G 1XGYL 4XAKD 2YA0A 1V3JA 3BIAX 3RA7H 3WNOA 2IBZY 1Q38A 4TUKH 3TFKD 1DQDL 2FJFA 4PJHA 4Y19A 4Z7NF 5HDBF 1WQVT 1RK0B 4JQXA 3QT2A 4XCCH 3AGVA 2VABA 4PP2B 4J6RH 3V0WH 5BS0D 3RWFA 2AJYL 2R0LL 3QCTL 4HW6A 5L2KE 3C09B 3JV6A 4G8IA 4UIMB 3RWIB 5TE6L 1MWAA 3ARDC 2WANA 3ROOB 4KC3B 1OM3H 4CW1A 3QRGL 1F4YL 3ARFC 3FO9B 4CADB 1HCFX 3ALPA 1R3JB 3KPQB 4ZD3H 3BDXA 3VD9A 5GXBB 3KXFB 3MOQA 3DETD 4PJBB 2IADA 4MSWA 2AS5M 1UCBH 1RHFA 2HA1A 4NN5C 1LDSA 2YA1A 4M5YL 2G5BA 3I3EA 4ZYKB 3F5WA 5LG1A 4AIZB 1JGDB 4DKFH 2ESVB 5IBTL 2MHAB 5ICZA 2YBRA 5JIPA 1T7ZA 1GSMA 4WEUD 4UOW0 1B6DA 5KS9F 1QKZL 1QFWI 3R0NA 2Y6SC 2DN7A 3TO4A 1OAXH 4M7LH 3AM8C 1PAMA 2XYCA 3GHEH 5L7XL 1U58B 1MLBA 3IXTA 1G7LA 3LKPA 4IOSD 2QHRH 2EE9A 3QWOA 4Q6IA 4WFEE 1FFRA 4HH9A 4I3SL 4OGYH 1FE8H 3CVHA 3HE7A 5D2NE 4M43L 1KTLA 4E42B 5EORL 2HLAB 2B8OT 2NW2B 1ZLVK 5L8JB 1TQCB 4OAWA 2F53B 4XBEH 3SKUD 3RWJA 4P4KC 4TUOB 4RISH 1WBYB 2BCKB 5TQ2L 1TJGH 5I30L 2AEPH 1ZLSL 3SPVA 1F90H 2V9RA 3PWJB 3C5ZD 3FFCA 4PJ9C 4AENB 4LSUL 1JF6A 2P5EE 2H6PA 3EJYC 2ZSVA 3MUY1 4LLWA 4PV9A 5DTFA 3WUWB 1C12A 2AV1A 5L0QC 5I8CA 1C12B 4ODHH 1KBGH 3WXVH 5DUBB 1A6UH 5DJ0A 5GRWA 1MCWM 2YD3A 3RDTB 4MS8C 5IW6B 4XPFH 3FOLB 5MERB 3LB6C 1MRFL 5C0CE 2AK1H 3HG1E 4JKPL 5J11C 2VDLL 3T3PF 4RFNB 2YEZA 1WEJH 3ULUF 1OTTD 4Y1AA 1CVSC 1EEYA 3S88H 1HXYB 2AK4B 3CH8A 3FT4A 5FOBB 5FFLA 3T1FA 1U8MB 2JELH 1CZ8H 4K3GA 3D85A 5FECB 4DAGL 1K4DA 4ZD3L 3OSKA 3KDMA 3PQYD 1MHHB 5F97E 1DTUA 4UTAH 5IJVA 1T5WB 1DN0B 4ETYA 5IB2A 3UJIH 3TN0D 3L3OB 1ORQA 1KCRL 1CFVH 2AP2A 5GRJH 4OM1L 2Z9TA 3DRTB 4WI8A 5FYJU 2IEPA 3QO1A 3EO9H 5GS1B 2VDMH 4M8QB 4NQDB 4XCCL 3LD8C 4NQDA 3C60B 4XPTL 4M62H 2QTEA 4O00A 2J8OA 2DQHH 3GK8L 5SWZB 3CFJA 4NN7C 1KCKA 3W82A 4NN6C 4OFDA 4F9PA 4L9LB 1YY8A 1SEQH 3I02B 3VFSB 5JPMB 1PKOA 2GJJA 4NWUL 1OTSD 5ETUB 1OP5K 2EZ0D 3LDBC 5HI5C 2NLJB 2P8MB 5FGCE 3S7GA 5JQ6H 4Y4HC 3HNTL 3PGCB 4QOKA 4PJ7F 5KJRL 5IB1B 3MLWL 5DD3H 4QOKB 5ESVB 4EN3C 4RGNC 1ZTXH 5HGAA 2VLLB 1I9JH 4HX1A 2I26N 1J8HB 1U95A 3RUGB 5TF1L 3D3VA 2GJ6E 5CZXC 3DV6B 3U46A 5E8EB 4LIQH 3UYRH 3V4PL 5FIEA 4P46D 2ARJA 4JG0H 4E41E 1ND0B 5E1AA 3OZ9L 5SX5H 2HRPL 1V3MA 4K9EL 4ODWB 3MLYH 5FV2A 2X1QA 5LCVH 2JJUA 4UILL 5I1GH 3TT1H 2KH2B 3C09C 4DN4H 2EO1A 2H32H 4PGEA 5EBLB 5EO9B 2O5XH 1CWVA 4ZAKC 1KYOK 4PS4L 2I07B 1WAAA 1MUJB 1XH3A 2CDEA 5DQDL 1O5DT 1BF8A 4YHYC 4GBXC 4WY7L 5LBSL 4WNQA 4KXZH 1BZ7B 2MPAL 5GISL 4C4KT 3B8YA 4CU6A 5I1DB 3THML 3T2PA 3K8KA 3VXTA 2D0FA 2R0WL 3O8XD 4HEPG 2FWOB 4ODUB 1JPSL 3BZFB 5FM4A 3V95A 2GW5A 4LVHC 2IF7A 5E5RB 4Q58C 1G9NH 1QQDA 2YD7A 3GMLB 5DT1H 4KAQL 5EFIB 2CGRH 1CXIA 1PY4A 5HHMD 5IMKB 4XP4L 3BXNB 3VRJA 3JSSA 5FOJA 1YECL