4FQHA

Crystal structure of fab cr9114
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
224
structure length
224
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKSSGGTSNNYAISWVRQAPGQGLDWMGGISPIFGSTAYAQKFQGRVTISADIFSNTAYMELNSLTSEDTAVYFCARHGNYYYYSGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody CR9114 heavy chain
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqhA01
3HUJE 4LARL 3VGFA 1NUDA 3B6SB 1F90L 5E5UB 5M95B 5C0JA 5D7KD 5IHUH 1J12A 1J0YA 3WO3B 1FLRH 1NBQA 2FD6L 1GC1H 4HG4J 1EO8H 4MSWB 5IP4A 3OB8A 5HD8D 4UBDD 5D7KE 1FNEA 4WW2C 4HZLA 3CVIL 2F74B 4J1UA 4NUJA 3DRTB 1U41A 1MHHB 5A2IH 4M6OH 1B0WA 1RZFH 4XRCB 5HDQL 4AL8H 4YQXL 2DTSA 5B38A 2R0ZH 4MAUH 3HZVB 4MVBD 1NGZB 2XV6B 5HDBF 5I16A 4H1LG 1LK2B 3ES6A 3UEZA 3S5LG 4C83A 3CLEH 1BQHA 4FFVD 4Q0XH 4ZO7A 3NGBB 5DR5H 1BFOA 3JUZA 2VXVH 3BXNB 4HFUH 4L9LA 1FIGL 4PGEA 2GSGA 1KOAA 3F7QA 4FQIH 1FZOA 3IDGA 1FL5A 4X6DB 1DQMH 5JLZA 4KMLB 4Y5XC 3F58L 1KLGB 3ULVF 3FO2B 4YBHA 5IB5A 4JFZH 4M6NH 2ZCKH 3VJ6B 4KJPC 1HYSC 4KVCL 2G5BA 2AQ2A 4FQ1L 3HE7C 4YLQT 5JW4R 3VXRA 1ZGLP 5JDSB 4PUBL 4TUOA 2BSRB 3HB3D 3R4DA 4IHOB 3L5XL 4GLRH 2WBWB 3TN0C 2P5WD 1WT5A 4NN5C 5FO9B 4Z7UE 2O5ZH 2VZVA 1HINL 4X7SH 1UM4H 5ISZA 2D7QA 1OF2A 4JM4L 4AQ1B 1OCWL 4AQOA 1K4DA 4P2OC 1UZ6F 3MJ9A 4KK6D 3IU4L 1IEAA 5EO9B 5E6IB 3QFDB 5GS1B 3LPWA 1YNKL 3CFBB 3KDMB 4BA8A 2R4SL 3V52L 1MCPH 1OWWA 5EU4A 3OXRA 5SV4A 1AC0A 2QR0A 3EUUA 3HKFA 2A73A 1FSKB 4XPHL 4FZEL 2R2EA 4IDLA 3UDWC 4PB9L 1RHFA 4BZ1H 5CBAA 4GLRI 5FYKD 4M9OA 3FT2A 1BAFH 2NY4D 5KSBF 3HG1A 3IDMB 5BOPA 2VDOH 4PTUA 5FYKE 2ATKA 4PJBB 2KH2B 1MQ8A 2UZXB 2DF3A 1WTLA 2R2BA 5F88A 1IQWH 4O58L 4QTIL 4XVSL 2IADA 5C08B 5C09D 1DUZA 5EOQH 5MI0B 2NXYD 1DQDL 3V7AG 4ZXBB 4WU5B 5D1QA 1J9CT 2HTLD 3W0WD 1NC4B 2EKJA 2Q6WB 4UQ2A 5C09E 4NP4L 2AK4B 4I0PB 4A2MA 1S7TB 2DMCA 2VKXA 1FHGA 2XQYG 3W0WE 4MNHB 1Z2KA 1A1MA 1N3NB 4E42B 1TMCB 4JO4L 4JY4B 3GMPA 4CU7A 2DDQL 4KVNH 1JNJA 1NCWL 4PJAB 3HZKA 4X5WA 1XIWD 1CVRA 2X4UB 3RI5F 5IUSA 4UILH 4MX7A 1M05B 1Z5LA 1JZ2A 3VDAA 4CDHA 2OQJB 2X89A 1KT2B 4LSPH 1BX2B 4YPGA 3MUGB 4MD5A 4P4KC 5T3ZE 3U36A 3RVWD 1WCBA 4YDJA 1HXMA 3NAAL 4FQJH 5FCUH 1U8PA 3BQUD 3GMQA 3QHTC 1I3GH 4JDZB 3HPLA 5EBWA 4ZOCA 5GRXG 4TSAH 1HI6B 3TP4A 1YNTA 3KPRD 1P53A 2Q8BH 1DR9A 3DO7A 3RX5A 5EG6C 2DAVA 43C9B 2WV3A 3U4BL 3IJHA 3I2CL 1JZ5A 5D2NA 2FEEI 3REVB 2DQEL 1MCOH 2EE3A 3P77B 3ZKXC 3ZYJA 5AZEH 1FO0L 2IJ0C 3MFGB 2V2XA 3L3GB 4OGAD 1S7XA 3VRJB 4M1DL 5DA0B 4Y1AA 1NFIA 3BOVA 1QLEH 2X42A 4M7LT 3MNZA 4Z5RA 3D87B 3QQ4B 3L1OL 2R39A 1VGEL 2CDGB 2V17L 1F4HA 1FVCA 2GJ6B 4LKCB 2X70B 1VFMA 5FF6A 4FABL 4FFWC 3WV0A 2AKRB 4BH8A 3MV7A 1NUGA 3DVNA 4WDIB 2NXZC 2O5XL 3C60A 1J5OH 2F5BL 1F2QA 1SJHA 5C3TA 1TITA 3V6BR 2R0LL 1N4XL 4CAGA 5B22A 5DVNA 4RGND 5KSVB 3BIAX 1VB9A 2VYRE 1A1NB 3G04A 1Z9LA 3EOTH 1JF5A 2IPTL 4RGNE 3IJSA 5HY9A 4P23A 1PKQE 2VLKD 2VXQL 5F7WC 5B39B 4AEHH 1K8DB 5DQDL 5HGHA 1WBYB 3GMOB 3L9RB 3DJ9A 5FECB 5J0BA 5E70A 1AXTL 3I6KA 3SOBL 4KQ3L 4X6CF 4IOIA 4YJZL 4WGWB 2Z8VC 4MQ7A 4U1JA 4O2CA 1ED3A 1DBAL 1M6OB 3LN5B 3TO4D 4K23H 3WEXA 2M2DA 5JW4Q 4NWUL 4DN3L 1RJCA 3C5ZD 4LVHB 4L9LC 3GUTB 5EU5B 2WIIB 4WO4D 4LEOB 2BY3A 4G8IA 5DD6A 5KVMC 3Q5YA 3TV3L 2DJ4A 5JW4N 1HHKB 1ZEAL 2VDRL 5IBTL 4BK4A 4RFNC 5HHMD 1ZANH 4NQTA 3PQYB 1X3DA 1WWCA 5HYSG 5IEKA 3K8MA 2BNUB 5IW1A 1CGSL 2IALB 4XZUA 3CFEA 5HHME 2VOTA 4Q9RL 3K3QA 4FQQA 1AJ7H 3KHOA 3I6LD 1ZV5A 2APTA 4HKZB 1IGFL 1QPPA 3GSRA 4GXVL 4NFBA 4ODTH 1DVFD 1C12A 4HCRH 1QR1B 4OT1L 3VFOA 5B3NA 3QBTB 3LKQB 3DV6A 4MAYA 2E5EA 2NY2D 2H2SD 3N9GH 4K7PY 3HMWH 4GRWF 3FQUA 1U8IA 1R3LA 3AS0A 1BD2D 3KAAA 4W81A 4Z7QE 5HVHB 4P2RD 1G7HA 5C0EB 5DT1H 3UPRB 2BOBA 1BD2E 3K74B 2WQRA 1XR9B 2VZUA 4HF5L 5IVXE 5ICYB 1U8KA 3RVVD 4JG0L 4P2RE 1OSZB 4RMSA 1OAQH 1U95A 3TNMA 4MA1B 3M07A 4Z7WF 1RI8A 1WIUA 1AFVL 1R5IB 4KK5C 5DWUL 3SDAD 5AWNL 5HHPB 2HKHH 1U3JA 3HZMA 1NJ9A 4GKNA 2BVYA 1T3FB 4I5BA 2H32H 4LVOB 5HYIA 4TSCL 4WW2F 4PJ9D 4FHBD 3D48R 1S7WB 3DVIA 2VN4A 5GISH 3DXAA 1BP3B 2NW2B 3TVMB 5IT2L 4NC1C 3L5WB 1S7SA 2HTKC 4LNRB 3QXWA 5ACLA 1BOYA 4N9OB 3WS6A 3OAUL 3K2MC 2PO6D 2I5YH 5D1QC 2IGFH 3FQWA 4FXLA 5ITBL 4EN3A 4ODWA 4I2XA 1ZHBB 1MF2H 4NKDA 3T3ME 5D7JD 4XPFH 1UB6B 2NY1B 1F97A 2J8UA 4MXWH 5DI8B 5ADOH 1J1OH 4MNGE 2BVOA 5BO1L 3GHBH 2H2PD 5K9QI 3GJEA 3CZFA 1F4AA 2DLGA 3X13A 3U7WL 3MACH 4WI8A 3T2NH 2EIZB 3WNKA 5FA3B 1NEZA 3T1WA 5L6YL 1J1XH 4QHUA 2ICWA 4XXCC 1NUNB 1HILB 4I0CC 4JFOB 1OD9A 4NO5A 3QPQC 9CGTA 5F7LB 4OZIA 3K8LA 5CSZB 1RIHL 8FABA 4GSDL 1JI2A 2C9AA 3X12B 4NQDA 3ZE2F 1YEHH 4MA3B 2GEEA 1A6TA 5J1AA 5MERA 1VEMA 2DQTL 2CLZA 5ENWB 2CO7B 3H9HB 4XAKD 3IJYB 3QG7L 1U3HA 2EXYC 1IM3B 3TBVB 1J11A 1FYTD 1MELA 4XAKE 2KPNA 3U6RB 3GSXA 3MYJB 5GZNC 2DKSA 3QDJA 5HDBE 5TF1H 3DROA 5F3HA 5H35A 3O2DH 3RGHA 1MSPA 3V0VA 2YBRB 4DKFL 1AC6A 1CICC 2AJSH 4TTDC 4OKVA 3BDYH 3AM8A 3ULVD 3NIGE 4XCNA 5D7LB 5ESQB 1T22B 3MGOA 3CFJA 4ZUUB 3O6KL 2QHRL 1NGPL 3QUXB 4LLWB 3WHE0 5BZDB 2G60L 1GGYA 1PEZA 3ULVE 5BS0B 5I1GL 4ZUTA 1IC7H 5GZOC 3SO3B 4P23C 2EECA 3QZWA 3KPLB 1KJVA 3HAEB 4FP8H 1KXTB 4J8RB 1Q38A 3FQXA 5I1HL 2YA2A 5DSCA 4Y4FD 3OKYA 4OF8A 4PYGA 3DUUA 2FEEL 4KHTL 4XTRD 1BVLB 2IBZX 1C5BH 4XCFH 5I1IL 1GZQA 1YEIL 5FO8B 3ARBD 5KVEH 3BP4A 4F7PA 3D85D 3VFSA 1MNUH 3CPLA 4M4PA 4XNUH 1UYWH 2NY6C 5HHOA 4QRSB 1JPSL 4J3OC 1FFOA 1UZ6E 2XZAH 1ZA6B 4OV5B 3HNVH 3O2WL 4PJDF 2W9DL 5DZOA 2XQBL 4YAQB 4GW4A 5DJ6B 3WKMH 2W1NA 3D2UD 1IJ9A 4P3DA 4W6YB 1BEYH 4X4XA 4TQEL 4UT9L 4M7KL 1DN0A 1YA5A 4NN6C 4OLYL 4R97B 5CGYC 1F8TH 1WF5A 5IW6B 4KK8D 4KI1A 4MQTB 4JPKH 1FQ9C 4WFFE 5F1NB 1H0DA 3EFDH 2BRQA 2JJVA 3RPIA 5KSBE 2FECI 3TPUA 1A64A 3IRZA 4J3SA 1H5BB 4ZUVA 4G42A 1RZJL 4Z77B 1I1AD 3PNWA 1JYNA 3OKOB 5IVZB 3HRZA 3P30H 5ESVB 4LLMA 4O2EA 4WTZG 4BZYA 3PXJA 2COQA 4ZQKA 4AIOA 3MJ9H 2B2XL 3U9UA 4LCWD 4YHKL 1JGEB 4LLQB 5DJ2B 1QFWI 3N0PB 5E9DB 2ADIB 3HS0A 3A6OA 1NEUA 4PRAB 3L5IA 1K2DA 2BY1A 3MPCA 4YBQD 1KNOA 3RWCA 2M8XA 3WHE1 2X4TB 3L3IB 1AGCA 1ACYH 2ADJA 1AI1L 3OQ3B 1XR8A 2ZJSH 3ZKMD 5FDYA 1JGVL 3CVHH 3WJLA 1YEFH 3JTTA 2HFFA 4KKBC 5C3LD 3QUYA 4MGXA 1LQSR 5DJDB 1YECL 4JHZA 3NGBC 5I76B 1YN7A 2NTFA 1N0XH 3HC3H 5DDHA 4BQCA 4K8RL 2EDWA 4OD1H 4YHNA 4QWWD 5TJWK 3ZL4H 1UH4A 2YD1A 1PY4A 1T6VN 1T1ZA 5F21B 4BFIB 1IC4L 4H25A 1KFAH 4OZHA 5FHAL 3STLA 2J4WL 4WFHE 5IROA 5ADPH 3VXUA 4Z7VF 2P5EA 1DEDA 5C71A 1A4KA 4OCYH 2EDFA 1CN4A 2PR4H 1FZMA 1X5XA 4IOFC 4XVJH 3H0TB 5IF0A 2R4RL 2V9QA 3MMEA 1TJGH 3HI1B 4PJEF 2CJUH 3R1GH 2A6KA 1QSEE 2YPLB 5MP6H 2W0FA 3SKMA 4ODXB 5ILTH 4WEBH 1KJMA 4YE4L 2YMXH 3MRPB 1YQVL 15C8H 3T77A 3QJHA 2CD0A 4LHUA 4PTTA 3T0EA 5FUZH 3T0WA 4R7NA 1M7IB 4PJ7B 5E6IC 5GS1C 1JGLH 2HVJA 4F15B 4QY8B 1N59A 2P8LB 1BZ9B 4JN1H 4XPTH 1UWGL 5GGQH 3S37L 3MGTB 3V4PL 5EOCJ 1R5WB 5E8OB 4EI5B 4R96B 1FSKC 2YUWA 1U3HC 2XWJB 3MCG1 3NFSH 4I9WD 3RTQA 3KS0J 5KG9A 5E8DH 3IU3A 3ARQA 3PXHA 3PP4H 4FQ2L 3V0WL 1A7QL 4HKJB 2MPAH 5K9KA 2F19L 4MD4B 4HLJA 1NLBH 3GSUB 4I9WE 3K46A 4PY7A 3UTQA 4IEFB 4X6CE 4UMGA 1RJZB 4M61B 3V4VL 3MLTB 2B0SL 4RFEB 4YWGH 5GSVB 2NQCA 5IKCA 4X7TA 1HIMH 3O4LB 1KYOK 1NANH 2AABL 3MJ7B 5I8OL 3ULUF 3DYOA 1FC1A 1SYSA 4PG2A 4JDVA 2BCKB 3PGFH 1L7IL 2CK2A 2ZG3A 4WU7A 1S78C 2Y06L 2ZWLT 4XP4H 1VKXA 2VLJA 2NX5B 2PKDA 4CMMB 1LDPL 4NJAH 4I0PC 2IPUG 3EJYC 3DI3B 5KJRH 2QEJA 3P73A 4JDTH 2AJVH 4UDUB 4UDTA 3VD7A 3TH4T 3NPSB 3CNKA 1MHCA 5C0BD 1GGCH 5EUOB 4JY6B 1RPQA 3IFLL 4DKEL 1PZ5A 5DEFA 1T4KA 3RZCB 4YFEA 4QTHB 5C0BE 4Z18A 2EXWC 4CU8A 1L7TL 4OLXL 1A8JH 4J3WA 3TO2B 3LEXB 3UBXB 1E4XH 1TTGA 3MBXH 3T4YB 1F3RB 2MQ0A 4YK4B 4OUOA 1G0YR 4P46B 3E6HA 2V5SA 1A0QL 3K8KA 4TNVK 2DIAA 4PGCB 2PCPB 1A9EB 2IPKA 4N0CD 5CEZH 1MIML 2EE9A 4X0KA 4HLZH 1MLCB 1I1YA 3LIZH 1F42A 3S4SB 3ME0A 5CBEB 3VRLF 5F96H 2I25N 4UT6L 2DQJH 3ARXA 1MRCL 2ZUYA 4F7MA 3MV9A 2BHUA 3RL1B 3T0AA 2FR4A 1X9QA 2IG2L 1MUJB 1WBZB 3DIFA 5JZ7C 4HBCH 3QO0A 4KZEL 1NCAL 1YMMB 4HWZB 5L9DH 2O61B 5IJVA 4PV8A 3CU1A 5J7CC 2LU3A 3GIVA 1RSFA 2FLRT 1FNSH 5BV7B 3HFMH 5C0AD 4OIIH 5C6PB 5IR1A 1R5VA 2X41A 4M48H 5FFLA 2QKIA 3RDTB 1A7NL 1HSAB 5D2LB 4G5ZH 5C0AE 1UA6L 1LE5B 2VJXA 3PP3H 2Z35B 4LOUC 2R29L 5C07A 1KIRA 2CDFA 3THMH 1RFDL 2PN5A 4NQSA 4G6KH 3RBSA 4XWGH 5DRXB 5JOFA 3JWOC 1VADA 2HAZA 4LLDB 1MCKA 5I8CB 4KJPD 2OSLA 3O3DA 1VEOA 1MAJA 3HE7D 5F7UA 2D4DA 5DHYB 2VE6B 4NGHL 4PV9A 4KMTL 4EUPA 4YDKL 2BNQE 1ZHLB 5MHSD 4JPWH 5F9JA 2AW2A 1C5DA 1BVZA 1N5YH 2WM0A 2D7PA 2ESVB 2WAHA 2Y23A 2IFFL 4LAQH 4GAGL 2C1OB 4ZO9A 2N7BA 5HGBA 2UWEF 3VFTA 4P2OD 1BFSA 2QHLA 1QP1A 4JANA 4DW2L 5C1MB 4C4KO 2FECL 3RUGA 4EXKA 4DGYH 4JQXA 5EN2B 5DZNA 2G75B 4JY5L 5IROC 3DBXB 12E8H 1F4YL 2AK1H 3WL9A 3ZE2E 4F2MA 4HXAL 4HUUA 4NUGH 2QSTA 3GI8L 1U58A 1XGPA 3PDDA 1BJ1H 2BK8A 3MFFA 1R0AH 4JO2L 1HCFX 1OPGL 4GH7B 5F7EL 2E8ZA 5DVKA 2WUCH 2J88L 4AENA 3K80A 5J9PB 4XGZA 1JV5A 3OKKB 1CXIA 5HVHC 5EC1A 4U31A 2AJYL 1S5HA 3P11L 1CFBA 4NM4H 4ZUSB 5EFIA 3C8KB 1MQKH 4HJJH 1KELH 3WFDL 3SDYH 2J8OA 3QRGL 2HWZL 4PBWD 5EA0H 2NMSA 1I7TB 1OAZH 1TVHB 2EDHA 5FO7A 4WUUA 1AQKL 1B2WL 1IGCH 5FKPA 3KR3L 5T1LA 2XRAL 3PHOA 4HXBL 3ARGA 4PYHA 4LVOC 5ESAA 5EZOH 1TCRA 1U8NA 2APBA 3QYCA 5I1JH 2YRPA 1DEEA 3CX5J 4JRYD 3CFCL 4TSBH 1PW3A 2ICWI 4P4KD 3QDGE 4YH6A 4C55A 2ADGB 2R2HA 5D72L 1I1FA 4C54A 3I9GL 4HBQA 3IS1X 4ETQB 4PG2C 1JUFA 2IF7A 1IAOA 3KXFA 1DQLH 2OR9L 5IBLD 2FSEA 3VFPB 2GTZB 3VGHA 1JTPA 1AIFB 4JR9H 4PJDE 3PHQA 1DANU 4NKOA 5GIRA 1LK3L 4L3CA 4OGYH 4Z8FL 4XNMB 3MRMA 4KTDH 4X6DF 5I1DA 2GAZA 2NY1C 5ALBH 5EO0B 4CDGC 3WHXB 1AGBB 1Q72H 1OTUC 4XVUD 5E5RB 3F62A 4H1LA 3MRBA 1AXSA 4AEIH 5DMKB 3BP7B 3S5LA 5C9JB 2AXFB 1JF1A 3K2UH 4XB7A 2V6HA 4TTGA 1WEJH 1JZ6A 1UVQB 4L4VB 2BNRA 4QRUA 1LEKA 4KTEL 1RZGA 5CP3A 3QQ3A 4KI5C 3TM6A 3E8UH 4PFEA 4U4BA 2B4CL 5LGHH 3I02B 3NCBB 2NXZD 5HYQA 1RIUL 1KTKE 2NYYD 2PYFB 1F4WL 3DURB 2DQCL 3OKLA 4PRDB 5JUEH 2F5AH 1T20B 3BUYA 2AJUH 1X5JA 3SY0A 4U6YA 3V8OA 5LGJA 1W8OA 1FVEB 3VGGA 1CDHA 3D39A 1H15A 1KPVB 4OI8A 4QYOB 1VPOL 2C7UA 2P47B 5CIPB 4GW5B 3A6CL 4OLVL 2X9XA 3FAXA 4PGBB 1MHPL 4JM2A 4PRNB 1NGWB 1QQDB 3LKPB 2WBKA 4PRHA 1XH3B 4ZAKD 4PJBF 2OZ4A 3TCLA 3H3BC 2CRMA 4LSUH 3SCMA 2RB8A 4UIMB 2OJZH 3L3DB 4Y16A 1KB9J 3PV7A 4RQQA 5TQ0H 3SGJC 4JFEE 4QXWA 3OR7A 3T3PF 3SO3C 4Z7VE 4IRSD 4J12A 3WIIH 5DMYA 5FYKL 1UQSB 5I1KH 1AE6H 3FQRB 1A6UH 3JWOH 2HH0H 4HUVA 1JFQH 2DKMA 4X7EC 3IDJA 4PJAF 2O5YL 4KDTC 4OLWL 3ZT7A 4H8WL 3TWCL 5T1KD 2Q7YB 4PJEE 3U7YH 3MXVH 4APQB 32C2A 4C4KT 1JGUL 1D9KB 3NIFF 4J3XA 3BAEH 4MDJB 3MLZH 1EERB 1HZHH 3RGVD 4Y2OA 4HK3N 5GRWA 1JPTL 3M8OL 4JQXC 3DMMA 1TZHB 3GKWH 5ISZE 3PL6A 3QIBB 4YHOH 3TH3T 5CZXD 4D3CL 5IGXL 4HGKC 1KIPB 5HI4C 4WI4A 3MBEA 4UU9B 5I18L 4QHKJ 2A9NH 1I9JL 2VDKH 5FAAA 3O45A 3MLWH 4CVUA 1PGRB 4ZMAT 4ZS6C 5IK3A 4G6FD 3CGTA 3R06B 1E27B 2EDTA 2EH8H 3OPZL 4Z78B 3AY4C 4M43L 4R3SA 4DCQA 3QIUD 4PJ5D 3DX9B 3CUPA 4NDMB 4TUKH 1XCQA 1I3RA 1RHHA 4HH9B 1H5BC 2HTKD 3ULUD 3P9WB 2XTJB 1EEQA 4PJ5E 3CSYA 1MCBA 5A2KH 1LVEA 4NQCD 1T5XA 3TBSA 4NC1E 2IQ9H 4LCCA 4I4WA 4S1DD 3ULUE 2D3VA 1JCKA 5DMJB 1CR9L 1EAJA 2OL3L 2YXMA 2ATPB 3KPPA 3DARA 4NQCE 3DOSA 3D9AH 2EKSA 4DGVH 4UV4L 1RULL 3H3PH 2GT9B 1DQTA 3C08H 1IGML 1T1XA 4ZOEA 3ZYOA 2MFNA 4GMSL 1BIHA 2DYPB 4N0UB 1P69B 2CGRH 3VRIB 1H3TA 4UTBH 3SQBA 3VFWB 4DGIH 3INUH 2ZNXA 1ZLUK 5MEPA 3MRIA 5F1IA 3GZKA 4QHLB 3WFCH 3DX8B 2Y36L 5FUOH 5EO1B 2CPCA 3F7VA 3RNQB 5F7DB 5K33A 5KVGH 3NZHL 3TNNA 3AXLA 4XMKH 4R9HA 4I3SL 3MCLH 4FQHB 1S9VA 4IRSA 1QACA 4MB3A 2CKBA 4M7JL 2OTUA 4HS6A 4G3YL 1NDMA 1Q9OB 3X3GL 5MENA 5IIEA 2NLJB 2GCYA 2XNAA 4KZDL 1UWEH 2QTEA 3PWLA 1Y18A 3OZ9L 1UB5A 5FA4B 1A7RH 4CJ1A 3WUWA 3EYQC 4NRXB 4HIEA 5AUMB 2EXYD 2ADFL 2E6QA 4KUZL 1I7ZB 3VI3F 3LRSB 2OXGA 4G8GB 3ZDXF 1YEJH 4YXLH 2GKIA 1X5IA 3U0PA 2VDPH 1GGBL 4PD4K 5HYSA 1CICD 4M1CD 2QQLL 5IWLA 1BFVH 2BSTA 3MV7E 5A1AA 4ZDHA 2HG5A 1J8HB 5DJ0A 4F15C 1KBGL 1GIGL 3N06B 5EB9A 2IH3B 1GZPB 3TIEA 1CT8A 4EI5C 4HMEA 1FV1A 3LV3B 5D5MB 2IMNA 3LQMA 1DBBH 1XGTB 5JNYB 5HBBA 4BUGA 3S7GA 2X4QA 2P44B 1HK6A 1A5FL 4KTYA 4HK0A 1VERA 2X4NA 3PWUB 5CJ8A 1NAKL 4PJXB 4JM2C 3H9SD 4F37K 1RUKH 5DJAA 5IESL 2AI0H 4NKMA 1YYMH 2E7MA 1SEBB 4H5SA 5CEZD 4Z0BH 4Y16C 4PS4H 5J6GB 5DJCA 1INEL 2UWEE 3DGGB 3CZJA 1HE7A 3UYRL 4V1DA 2D0GA 3AS3A 5CEZE 4OM0L 4UUJA 1TFHA 3QEQA 1KCVH 3KPNA 2AV7B 5DC4B 4N0YL 2EYRB 4KRPC 1W72B 2VR4A 5L2KB 1SY6A 5D4QA 1NL0L 1OAKL 3H7BA 3UJIL 3NACH 4QNPF 2ZOLB 3B2UC 1ERNA 1PLGH 4FQCH 3NPSC 2HRPL 5CHNA 1ZS8A 4H20H 4Y4KA 3HAEH 3DUSB 1CD1A 4S2SA 3OXSA 3SKOA 4BKLB 3TFKC 3LN9A 4ODUA 3V5KA 5C86A 1VENA 3MRQB 1P4IH 4KMQA 5F9AC 4HIIB 4YK4C 1B0GB 4R8WL 4P46C 3DMMC 2ICEA 5MEOA 3O8XB 3PL6C 4LPXA 1GJIA 1T03L 4W4OA 1J0ZA 5CJXA 1EBAA 4HV8A 4HGWA 35C8L 5L7XH 1QBMH 4GKZA 4H88H 1EDQA 1VFAA 4ZUWB 4D9LL 3RWEB 2W60A 1ZA3B 3KHQA 3EO0B 3E2HC 5TE7L 3KLAA 1P7KA 2AEPH 3S35X 5LGKA 5E2TL 4LASL 1GGUA 1J1PL 1JF6A 1NKRA 5J1SC 4DAGL 3MUY1 1YN6A 2WP3O 2ZUQC 1LDSA 2GUOB 3GRWL 3HC4H 1S7UA 1UCTA 3R0NA 1FDLH 3A0OA 3BZFA 3CXDL 5GSRA 1KENL 1HQRA 4ONGH 4JZNA 1EGJA 5DJYA 1G6RA 1G84A 4XP1H 2XOTA 1UACL 3LB6C 4FQPA 3MLXH 4O2FB 1OHQA 1OSPL 2WUBL 2UZIL 3GI9H 2R0WL 1NMAL 3MOBL 3EOAB 4J2XA 2D7TH 2BFVH 4X6DE 1XGQA 4M6MH 4LPYA 3VA2C 3BZEA 3I75A 1J05A 1L9MA 3VI4F 5E8PA 5KS9B 1N64L 2YD6A 4K3EL 4F7EA 5HHNA 3FRUA 5ICXB 2CUMA 3OX8A 1YEDB 1IGJB 5ETUB 2VABB 5CEXA 4OIAA 5C0RL 4MXQC 3ZE0F 2FX8L 4IRJA 2R56L 4ZSOB 5IG7A 5B4MC 3CDGB 3H9YA 2YPVH 4MJ5A 4POYA 3L3HA 1IGTA 5CGMA 3ULVL 2M1KA 4FXGA 1U8MA 2DLFL 5E99L 5A16B 1S9WB 5E6ID 2H41A 3QUZB 2AGJH 4PGJA 4R90H 5FHBH 5I2IB 2JB5H 3RY4A 4FS0A 2D31B 4KPHH 2DLHA 4NQDE 2VUYA 4ZFOB 2WBJA 4NQEB 1GAFH 1HXYB 2NZ9C 3TBWB 4LLVA 5CINH 4HC1A 3WS3B 4NPYA 4R4BA 3BPNB 2MCG1 1F2XK 2UVFA 5JMOC 1CGYA 5B8CB 2R15A 1JRHH 4EDWH 3LQAL 1AXIB 4Q2ZB 4RAUA 3BWAB 5GS3A 2VDNL 5CILH 1OGAA 2CXKA 1KCRH 2ZOKB 1N6UA 5KSAB 3EYFB 5I0DA 3D6GA 1MCJA 4LFHD 2OTWB 5GXBB 5IWLC 4YC2B 4OZGB 2NW3A 4MS8D 1Q0XH 4EXPX 1RMFL 4PJBE 4OJFH 5C08D 3NPZB 4YHIB 25C8L 2WANA 4GXUM 4ZXBD 3ZT6A 1H8NA 5HI5D 1NC4D 4GQ9L 4OCSH 5C08E 2FZ3B 5C0DB 2DI7A 2AK4D 2R1YA 3ZTJH 4I0PD 2FWOB 5B3JF 4N9GA 4IMLB 3T3PE 4MAUL 4DKAA 3B8YA 3L3JA 2AK4E 2V7HA 3RI5K 2JKXA 4ZPTA 1JE6A 3CLEL 3HUJB 4BELD 4OSUL 1LO5B 1G7JA 3QXAA 1NFKA 4HHAA 1J0HA 4PJAE 4K7PX 4U1SB 4WTZA 5A2FA 4Z76A 5CKAA 4LEXL 4PY8J 3TEUA 1AY1H 1DQML 5JXAH 3NIFE 5DD1H 1LP9B 4IRZH 4N8VA 2OZ4H 2PTTB 4K2UL 4JFZL 4MDIA 2ZCKL 2Q86B 5DQJB 1QRKA 4KHXL 1ZE3C 4NM8H 4TULH 4Q9QL 1IE5A 1KJ2A 3QDMB 5BQ7B 5DJXA 4AG4H 3JZ7A 2BVPB 4G8FA 5F6HI 4WI6A 5HYJA 4Y4KC 3VXMA 1CFTB 3JWNC 2YSSB 4KXZH 1RD6A 2OMNA 3ZKND 5EU3A 5CD3A 4HEME 5ID0A 3MRKB 3WUZA 4A2LA 3RRQA 5CMAB 2EH7L 3QWRA 2WWMC 4WHYH 2OJEB 3KYNB 4YNYB 4OCRH 3U0TA 1EHNA 2GJ6D 3ZKQD 2VDLL 3WIFB 1D5XA 4W4OC 3JV0A 3V7MA 5CJXC 5BVPH 4JJ5B 3TJEH 4ZFFB 2ENYA 1EFQA 4OQTH 3S88H 4WW1B 2FHCA 3LEYH 4LOUD 5DMGC 4LMQE 3WFHB 1T1YB 1XCTB 1TLKA 3U1SH 1SEQL 1ZHKB 4BZ1L 4EVNA 2XKUA 2Y25A 2DIJA 2H1PH 3MRNB 1JL8A 2WP3T 1BAFL 1YYLL 3QEUA 5ALCH 1SM3H 1VA9A 4FTVB 1DCLA 3VFNB 1AHWA 2AQ3A 4MCYB 4CVXA 1CF8L 4XX1G 1PG7L 4A6YB 3JTSB 4JHAH 3KPSA 1K3ZA 3JUYA 4JKPL 5TPWL 4EQ3A 4KRMB 1PFCA 3BMVA 2X09A 1ITCA 2UYLA 1T0MB 3BN3B 1BREA 3VXQB 3C09B 3M1BB 5HTSA 1XF2B 3SDDA 2DJSA 3JV6A 3CXHJ 5EIIA 4GT7A 4KGJA 4WUKH 4PJHA 4P5TA 2ORBH 3TZVA 3QQNA 3PQYD 3O6FA 4U1GB 3T8XA 1DUYB 1MFDH 4QOKA 1CG9A 5HJ3A 2HFGH 4LLYA 3PQYE 3QI9B 3KLDA 5IQ9A 5E4EC 3VXUE 1F13A 4OCLC 4LSPL 2A6JA 3B3IB 1JPGA 4BQ6A 4N8CH 3WNNA 4IS6B 4R0LB 5LWYL 1G9MC 3OKDA 5FCUL 3WLWD 4IRJC 5AZ2L 5DHVB 3VI3E 4JG1H 5EUOF 2DBJA 1I3GL 3WLBA 4TSAL 1IT9H 3ZDXE 1V3MA 2EO1A 3TBTA 3R0MA 1A4JA 4APQC 2JELL 1MJ7H 3T04D 4FXKB 5IMMA 1WFUA 1KPUA 1D9KC 1IAIM 3NFNB 1NSNH 2CIKB 5HI3D 3PE9A 2QSCH 3RL2B 3X14B 5KW9L 1VGKB 3TYGH 4FFYL 5FDWA 5EU7C 3FOLB 2CKBH 1U91B 5EBLB 2GITB 3FT3A 3RY5A 1QVOB 1JP5A 1H8SA 4OB5L 3ETBF 1NAMB 5CCKL 3O3AA 4RIRA 2H8PA 4EOWL 3F12B 4RMVA 1QLEL 1K9TA 3VWKB 2FJFB 4HX1B 3BP5A 1O7VA 3BP6B 1CDBA 2L0DA 2VR5A 3EHBC 1S9KC 2XWTB 1MRDL 2FJHB 1MJJA 4GO6B 5T33H 3KWWB 5JQ6H 4MJIB 1EHLL 3TVMD 1EX0A 5IV2B 1QKZH 3IFNL 2PNDA 5FV2A 2Y4SA 4YHZL 5C6WH 2I9LB 4FMKA 4D9QD 1BLNB 1P4LB 4OFVA 3GSQA 3MNWB 5EZLA 3GSNB 4OZFB 4WEMB 1P7QB 4OUUB 1NBYA 2UY6A 3EOTL 5H94A 5I1LA 4D9QE 4HKXB 5IMKB 4P59H 3BPCB 4LLAA 3X3FH 4AEHL 1KPRB 3QG6A 4JCMA 5D2LF 2NY1D 1RQ5A 1HWGB 1P1ZA 4DN4H 2Z31B 2VIRA 3GNMH 1OTUD 2V7NA 4QNPE 2FYYA 3JSSA 1HQ4A 2XYCA 3T0BA 1YY8B 1XGYH 5DUMH 5EBMB 5IOPA 1KB5L 2Z8RA 4IM8A 3MV8A 5FUCC 3VFUB 5I73C 3RP1A 1SJVA 2VC2L 3MRCB 4YIQB 1XGRB 1ZANL 4JZJB 1JTOA 3QNXA 2IAMD 1AGFB 5I15L 3MRFB 1UM6L 4ODBD 3HA0A 3ECBB 5FGCE 4PRIB 4LF3A 3QXDB 2VXUH 5DTFB 4KI5E 1AKJB 3C6LB 5I8EA 1PYWB 1QO3A 1WAAF 5HGGS 5H37G 5INCA 5KTEL 1MFEL 5CSGA 1WTGT 1JWMA 3N9GL 1SY6H 4L4JA 1I9RL 4DTGH 4WNQA 3RWJB 3SKJL 1MHEB 4PLJC 1RK0A 1C7TA 5DQ9B 1FL3B 3VH8A 5K9OB 4JFQA 3FT4B 2WLYA 3UPRA 1WWAX 2GJZA 3R8QA 5E2VH 4LSRH 3O11B 4C56A 3MRJA 3ESUF 1Z9OA 4J4PC 1WZLA 2DM7A 4JFXA 3FFCA 4HPOL 2IFGA 4X6BB 5D9SA 1IM9A 3IDXL 4PRPB 2F58H 4KROB 5E8NA 3G5VA 3Q6GH 3PWJA 5D7LD 3VXTA 2GK2A 1X5LA 5C0GA 5GGTH 3QULA 3QUXD 1CDYA 2JIXB 3X17A 2DQGL 4E5XA 1ZVHA 1FLTX 2XN9B 4U1MA 1XF4A 5BS0D 5GISL 3QCVL 5D7LE 5C07E 3UTPE 2DQFB 2JTDA 1K8IB 2RGSA 3RNKB 3GSOB 4ODVL 3VI4E 5BS0E 3BGMB 3BVNB 4WHTA 7FABH 4KWUA 1DQQB 1T7VA 3VXSA 5IHZA 4PR5B 2YPKA 3K4DA 3KYMB 2OK0H 1IZKA 2CLRB 3UO1L 4M5ZH 4OI7A 5FEBA 3ZE0E 4H0IA 2IGFL 5LCVL 1MI5B 4KQ4H 3ARDB 5CIPH 4XNZC 1MRFH 4X6FA 4JVPA 3SDDC 1MF2L 3V4UH 3FAWA 4GBXB 4Q9CA 1YEGH 2OMBA 1EGJH 4P5TC 2ITCB 5DMIH 3TZVC 1G6RH 1MCEA 3P3YA 4G6ML 3ARFA 3BKMH 5E56A 4NJ9H 3ARUA 4OTXH 1TVDA 2VISA 5GRJL 3V6OA 3TA3B 1CXFA 1IAKA 1AD0B 1H8OA 2Q87A 4M8QB 4X80H 3LRGA 3UJJH 2VSCA 1QA9A 3OGCB 1LE9A 1AGEA 2H3NB 3D18B 2IAMA 1VFBA 1WV7T 4NSKA 2GTWA 5HVWA 3PDGA 4UT7H 5CLWA 3AREA 2B7DT 3C5SB 4JLRA 1BJMA 2EDYA 4PGDA 5D93B 3OKEA 3S97C 4NRYA 4WI3A 2CMRL 1BGXL 2XZZA 1CDUA 4DFIA 4MLSA 4ZS7H 1ZVSA 4KKAD 3VFGL 1JWUA 4RMUA 5E9DD 3TJHC 1T0NB 4HIHB 5AD0B 4U1IA 5B3JE 1IFHH 4B7LA 4WUUE 2JLLA 5E9DE 2PXYA 4B41A 4DZ8A 2PYED 1KN4L 4Y4HB 1EMTH 1WBXB 2Y07H 3O2DL 2EE6A 1I3UA 3BI9X 3F7YB 1QBLL 2HJLA 4H0HB 2GK0B 2KUTA 3BDYL 3QEGH 2A83B 1LEGB 3GMNA 3CK0H 5DRNA 3PGDA 3I6GA 5F7MC 4JFDB 1SJEA 1CLOL 4XBGA 3VXPA 1QTYT 5GGVL 1ZWIB 1LNUA 5IM7A 4WFGD 2OX5A 3PWVA 3VA6A 1T5WA 2JJTC 3IS0X 1UC6A 3UTTB 1K5NA 4K94C 1B0RB 4XVTH 2CR6A 3IDNB 4IIQB 4RRPA 3WCYA 4S1QH 4J3TA 3MJ8A 2J3SA 4XCFL 1ZLSH 4ELKA 1EPFA 4J7RA 5ICZB 5KVEL 2C5DC 3P0GB 5EUKB 4NZTH 1MNUL 4TRPL 3P9MB 3ILPB 3AB0B 3FO9B 3TH2T 5TFSH 4BSJA 2C3XA 2L4OA 3FB6A 2YPLD 4OBRA 3NCFB 1DP0A 2DOCA 5CWSB 4UINH 3OAZH 1IL1B 2YPLE 4HIXH 2V9TA 2Z0BA 4KDWA 4NHUA 5JA9A 1CXKA 3QNZA 3IFPA 3SDCB 2YD7A 3WN5B 2VB5A 1QLRA 3B9KA 2VLRB 1HOCA 1W0WB 3C6SA 3U4AA 1BVKA 4EI5D 3HNSH 4JPKL 3VFRB 4OD3L 5GS0C 2WWKT 4XBPB 4ZOAA 4F3FA 3VFMA 5BXFA 3VFVB 2C3WA 2NY0C 3WD5H 5B8CC 2RJMA 2FJGA 4O02H 1RK1B 4Y8AA 5E5MB 4U1HA 5T1MB 3HR6A 5IFHH 1I8MA 5CJOL 3SGEH 3A67H 1A3LH 3B5HA 3TBYB 3BT2L 4ORGB 3ZHKA 5KSAC 3QIWA 4AT6B 1U8HA 4CMHC 2DL9A 4YC2C 4U0RB 3O4LD 1V7NH 3BFOA 2PYEA 1KN2L 4GAJL 4X8JB 1IZJA 1WZ1L 3O4LE 4ZO8A 5D7IA 5ITFA 2NX5D 3C2AH 1JK8B 5CJQL 4U33A 4JRWA 1DN2A 3WXWH 1ACYL 2A77H 2NX5E 2ZJSL 4X5XA 3CVHL 4QCIB 5GGUA 1FGVH 5FK9B 3I50H 5HHXH 3RWIB 3RZCD 3G5ZB 1I4FA 2JCCB 1N0XL 3HC3L 5SWZA 3ULUL 3LKOA 3BKJH 5EOTA 5EUOE 2Z8WC 1CXLA 4P2QA 4OD1L 3RVTC 1KF9B 4I8DA 4P46D 1FIEA 4MLIA 2Y7QB 3AUVA 3AS2A 3ARFC 5AYUL 2QQKL 2VH5L 1LMKA 5I74B 1WFNA 2E8YA 4MA8H 2JB6A 3V6OC 2PR4L 3N1GC 4XVJL 3QFJB 1RZIA 1MPAH 4R26L 4GJTB 4JPIB 2X05A 3BKYL 4ZTOL 3L7FB 5ERWA 3FMGL 5H8DA 5E00B 3ULSB 2VXTL 2A74A 4H26A 5ID1A 1FZJB 1WWBX 4QRQA 1AO7B 5FB8A 4U1KB 3MRHA 4FQLH 1EUTA 5I1EH 5MP6L 1Q8MA 1BZ7B 3K4ZA 1EA9C 2YMXL 2D03L 4LNVA 5JPNB 1T7YA 3H6JA 1YMMD 1WK0A 2C3VB 2M26A 4I48B 4ISVB 1NGYA 3IDUA 1VESA 3ARPA 4JFYA 4HAFA 5IB3B 4XPTL 1QEWB 1YMME 5KAQG 5JMRA 4O5LL 3RDTD 3G5XB 2CQVA 4PP2A 4RGOH 1A22B 3MR9B 3LB6D 3IGAA 3LN4B 5F1SA 4DVRL 3W39B 1DE4B 2HT4C 4HUWA 4CADA 3RWHB 2OS7A 2ARJA 5HVGB 3IDIA 1BM3H 1C5CH 1O7SA 1QSEB 2AAVA 4LCUA 2PXYC 5D2LE 5J1TC 1NLBL 2IBZY 2NPLX 4ZTPL 4EI6A 3P4NA 5DXWA 1J10A 2VDQH 3FB8B 1I7UA 5D5MF 1UJTA 1IGYB 2Z92B 4I77H 2W65B 1JHKL 2DQHH 3CC5B 2LVEA 1HIML 3IETB 5TE6L 1MLBA 4MXQD 5DEGB 3P9LA 5EU6B 3ZKSD 1KIUA 4PJXF 3C09C 3HZYA 1LO4H 2B1HL 1AR1C 2ESVD 3FOMA 1K3IA 2EDBA 4NJAL 1CXHA 3CLFH 4JHBA 5T5NG 2DIBA 3FONA 1A1OA 3G6JA 4OLUL 5KJRL 3ZSTA 1XGUB 2ESVE 3DTXA 4PJ8A 1LD9A 2DQDH 3SE8L 1KLUA 4L29B 5JORB 3RY6A 1WAAE 1DBJH 1ZT4B 4LBEB 5EOCH 2XZQL 2NZ9D 4NKIH 4K94H 4WI2A 1EEUA 1RURH 4NO0A 2V2TA 5FYKU 2A38A 3KS0H 4NO3A 1BECA 1JNHB 2E9WA 4R0LC 2YXFA 4PJIA 1F4XH 5AAWA 3WIHL 5LXGL 3ZLQC 2W0PA 2F53A 5JPMA 3NFPA 1IQDA 2G2RB 1G0XA 5CEZL 1A7OL 5C0IA 5KZCB 4ZD3L 4MQXD 1MJUL 1RUML 3LIZL 1FO0A 3B9EA 3EDKA 3EYVB 4JJHA 4TNWF 3T4AB 3BGFB 4NO2B 4BFEA 2DQJL 1N6QL 3B9KC 3PP3K 5D1XA 3F5WB 5DJ8A 4Q6IB 3DVGB 1JMXA 1ONQB 4QRPA 5I9QB 5JDJA 1U92B 5CD5C 1X7QB 4I18A 1S8DB 5F8RC 1R3KA 1UCBL 3C2SA 4HWBL 4HBCL 3NCMA 1FFPA 2BVQB 3QNYB 4YZFF 3FB7A 4WJ5A 4LCIH 5L9DL 2Z93B 5GS0H 4TPRH 5DD0H 1GGTA 3G9AB 2F54B 4MNQB 4NZUH 1FNSL 4EEEA 3HFML 4JGUA 1FJ1A 1VCAA 4HC1L 1FE8H 1V7ML 4TNVF 1DBKL 1FAIH 4G5ZL 4AMKL 1A7PH 5IMLA 1KG0A 3MNVB 3KYOB 5E08H 3Q3GA 4HS3A 3NABH 1WZMA 4XP9L 4G6KL 1Q9LA 3BIKA 1D5BA 4X98B 1BBJB 2VL5B 2ZPKL 4QGTA 1A9BA 4MA7H 1EXUB 3PWPB 1U8OB 3LSOA 4KJYB 2IEPA 2LAGB 3MRDB 2Z31C 5BRZB 2R1WB 1IMHC 3HPJA 5I1CL 3NTCH 2XPGB 4JREC 3PGCA 1YUHA 3QCUH 5E8EA 1FFQA 1IAIH 1QNZH 2I27N 1B3JA 4AZ8A 3AFLA 1PX4A 1ES0B 1R3IH 1E4WH 3F6LA 4NNYB 5I71C 1I3VA 2D7NA 4RX4A 1H3GA 4XB8A 5KN5A 2WWMD 3CMOH 4L4VD 3GM0A 4DGYL 4JZJC 3NIDE 5LKNA 2AQ1A 3IAPA 1NFDB 4BK5A 4P49A 4L4VE 12E8L 1TJIL 4QRRA 5EPMB 4LCYA 2ZKHL 2J2ZA 4FQXA 3VE0A 2HJKB 1R0AL 1GGIH 1MWAB 3GJFA 4HDIA 5LBSH 4UTAH 4P2YA 3BD3A 3UC0H 3GBNH 2A0LC 4JRXB 4F7TB 5IFJB 2YK1H 3SJVA 5DD5L 4O9HH 4CU6A 1KJ2L 3TN0B 3SO5A 4NN5B 2VLLA 6CGTA 1JN6B 2XTLA 3EGSB 4NM4L 3TYFA 1Z9MA 4D0CB 1MFCL 2J6EL 3CFDA 1HKFA 2X1QA 1EAPB 4KC3B 5D96C 2EIBA 2C3GA 4TUJB 1E4KA 4U6XA 1F3JA 4XWOC 5L2JB 5JXEC 5TGBA 4HJGB 5I17A 3BO8B 1IGCL 3MLVH 3LEVL 4OZGF 2H32B 4L8DB 3U2SA 1MEXH 1I85A 3P40A 2X40A 2Q1EA 1K6QL 4XCEB 2AJXL 2P48B 4HKBB 4Y19A 1LEIB 1QSFA 1F3DJ 1CFSB 1DLFL 3PV6B 3VU2A 1F6AA 1KJ3L 1KEMH 1YMHA 1HKLH 3P4OB 4MD0B 4L3EA 3HMXA 4GMTH 3T08A 3MROB 3FO1A 5KSUA 4JFPB 4NT6B 4P99A 1RZ7H 1M7DB 3D0VA 1OGTA 1DQLL 2Q8AL 2Q3ZA 3HNTL 3RVXD 3HUJF 5D7SH 4A6YH 4WWKA 3GIZH 3ARDC 4G9FA 4N1HB 1D9KD 2XFXA 2E27H 3MO1B 4GBXC 2EIEA 1G7QA 5IW3A 1YY9C 4PJ8C 4XH2A 5C7XH 2E7BA 4J3UA 4ONHB 2EC9U 1S7RB 3QIBD 4PP1C 1OM3L 3HN3A 1QOKA 3RY6C 1LP9F 4ALAH 1ZLWK 3DX7B 1SMAA 3MUZ1 3TA3C 4GG6A 1KSRA 4HD9A 5EU7E 3FQTA 2P8MA 4LLUB 3HI5H 3DSFH 5C2BL 1CLCA 4RAVA 3UTSA 4L4TA 2A6DB 4OFPA 5E1AA 1T04B 4XPAH 3IRPX 3QPXL 1HHGA 3MUJA 3ZHLA 1G7PA 3V6FA 1JMZA 3GHEH 3E8UL 5FOBB 4L8SA 1II4E 5LGHL 4U6TA 1ZKAA 3NH7L 3IKCA 2IQAA 1XF3A 4R7DA 5DHVH 5FCSH 1EFXB 4EDXB 2CIIB 4M62L 2Y5EA 4LSSH 5D93C 2XTJD 1EIBA 1EEZA 1P9MA 3RU8L 2UVEA 3B2VL 2F5AL 3B9AA 4QXGL 2G9HA 4LKXA 1D5MB 2FIKA 4BSWB 3HI6L 1A21A 3QA3B 5TE4L 5J13C 3NN8B 4B7IA 4S1RH 2XTJE 1MVUA 2IANA 5SX4I 2AJZB 3T2OA 1DLHB 3ZKXB 1YPZB 1XF5B 3C9NA 5BW7C 2OYPA 1W0YT 1JIBA 3CCHB 3MRGA 5IB4A 1NAMH 4GRMB 5CP7A 3CJJA 3QUKA 4RNRA 2X1OA 3B5TA 2DYPD 5TDPA 4L8CA 4YFLI 1ROWA 3B9DA 4LARH 5GGSB 1F90H 3KNBB 5D6CB 4AIZB 5CAYB 4LSUL 1RVFL 2FD6H 1KV3A 5C0JB 4D8PA 3KGRA 2UZYB 4O51A 5FUCE 3CVIH 1MCFA 4PJCA 1FNEB 4Y5VA 4HZLB 4HH8A 4J1UB 4NUJB 3ILQC 5HDQH 3H42L 4PBVC 3RHWK 4YQXH 3GSNH 3HLAA 4OZFH 3M17A 4LGPB 3JWOL 3SGDI 3UZVB 4F8QA 5B38B 5C0FA 5GRUH 4X9HA 3KPMA 5I16B 3G6AA 3ES6B 4NQVA 4JAMA 4P3CL 4PLJD 4S10A 2MCPL 5INDA 4C83B 3RAJL 5D1ZA 3U7YL 5I30L 3MXVL 1BQHB 1OVZA 3DSNA 1BFOB 3BAEL 4GXUN 3AB0C 4L9LB 4NFCA 2FATL 4PGEB 2GSGB 4G8GD 1I8KA 3OJ2C 1FZOB 3IDGB 1FL5B 4J4PD 5JLZB 3CU7A 1D5ZA 2SEBA 1QRNA 3LH2L 4G8GE 2IMMA 5IB5B 1T80A 1ZTXL 3IXTA 4KVCH 1ETZA 3SDCC 2VRAA 2D0HA 3IXAA 1J8HD 4PUBH 3QEHA 2G5BB 3OHXA 5GGVY 3VXRB 1UM5L 4TUOB 4JKKA 3MCKA 4XPBL 2DQIH 1FORL 1J8HE 4F58H 1ZLUH 1HINH 2C4FU 2MWCA 4TUKL 1NCBH 1DL7L 4JM4H 4E41A 1CE6A 3A6BL 4F9PC 5D5ME 4PRBA 3REWA 5ISZB 1OF2B 3IU4H 1K4DB 2Z91A 3QXUA 2Z8SA 5B21A 1YNKH 1IEAB 2R4SH 3V52H 3D3VA 3LDBC 2FB4H 2EIDA 3SHSA 3KPSE 4C58B 2HT2C 2XZCL 5F93C 2UY7A 1KULA 5EU4B 1IC5H 3OXRB 4PJXE 3D9AL 1S7QA 1OL0A 3CDFA 5IMOB 2QR0B 3MREA 4FZEH 5C6TL 2A73B 1I85C 5BCAA 4PB9H 1CK0L 2R2EB 4XC1L 2ZCHL 4OCXL 1CFQA 1MH5A 4PJHE 4GG8A 5CBAB 2QQNL 3EIFA 3FT2B 5L2KD 4P5KA 3HG1B 4G6JL 4QOKE 3S34L 4BH7A 4PTUB 2ATKB 4O58H 3Q0HA 4XVSH 5L2KE 1JTTA 2R2BB 5F88B 3JBG7 5F8QC 1ND0A 4D0BA 2IADB 1DUZB 2R1XA 3MCLL 5GJTL 5I75B 3WE6A 5D1QB 6FABH 4NRZA 1MAKA 2X4OA 1F58L 4UQ2B 3AAZA 4JO4H 3IF1A 3BEVA 2DDQH 3O8XD 4FNLL 1A1MB 4HQQL 3GMPB 4ENEC 3LHPL 1TVBA 1UWEL 4N8PA 4X9GA 1HDMA 1INDL 1CTOA 3CDYA 3HZKB 4X5WB 4NZDA 3NVQA 3KPTA 4QHKI 4MX7B 3FJTA 1Z5LB 4Y2DA 1T2QL 4LSQL 4YPGB 4OAWA 4MD5B 3NAAH 1L0QA 2DRUA 2VQ1A 4YO0A 3U36B 4YZFE 1WCBB 4YDJB 1HXMB 3D0LA 1K4CA 1U8PB 3GMQB 4L8SC 1FFRA 5EBWB 3HPLB 4K07A 1YNTB 1ORQA 2PTVA 4YHML 1VFOA 3DO7B 3OKMA 4OF7A 5GGRA 3O3EA 4Y5YA 4GRLA 3MXWH 5EC2A 1C8PA 3EDJA 3VG0L 3IJHB 1H9VA 1OP3K 2DQEH 5D2NB 3BJ91 3MA7A 3VWJA 3SPVA 4DVBA 4LSDA 5ANMA 1N26A 4JFFA 4PLNC 4KKCC 2V2XB 4GW1A 1S7XB 1G1YA 2CSPA 4Y1AB 1NFIB 1HHIA 5HGAA 1VGEH 3SE4C 2ICES 5IQ7H 4X4ME 1TZIA 2V17H 4Z5RB 3MNZB 2XIDA 3N1FC 5SWSD 1NMBL 4DEPB 3EDFA 4FABH 4Z7QF 1FVCB 3GSWA 4ELMA 3S3PA 5FF6B 3LPFA 1S5IL 2F5BH 4BH8B 3MV7B 1XZ0A 1SYVA 3DVNB 5TQ2L 3C60B 2R0LH 4Z0BL 1N4XH 4PS4L 2ZG1A 1SJHB 1F11A 3FZUC 4K3JH 1A7BA 1SMOA 2XY1A 4OKDA 1MCCA 2IPTH 4ZSOE 3G04B 4B5EA 5JHDA 2GSIA 1FC2D 5DQDH 4GKSA 3IJSB 5HY9B 2FDBP 5J56B 4P23B 2E3VA 3NACL 2X7LA 2K7QA 4YHLH 1AXTH 5HGHB 3QUZD 1PLGL 2P42B 3SOBH 1Y0LA 3QUMA 5I1AA 3HE6A 1EZVX 3I6KB 2YEZA 4IOIB 4NWUH 4MQ7B 4U1JB 4NQED 4O2CB 1ED3B 4O4YH 5J3HC 5D1ZC 2F15A 3WEXB 5CFHA 4F37F 3TV3H 1P4IL 4X4YA 1ZEAH 2VDRH 2ZCLL 4NQEE 5IBTH 2W0LA 4Z6AT 4G8IB 4NBZB 5DD6B 3O9WA 3PDOA 2FCBA 4HUXA 2NY6B 1CGSH 5IEKB 2AV1A 3IYLW 5KSAD 4DQOH 5L7XL 5IW1B 4PJGA 4H88L 3TPKA 4XZUB 1IGFH 3CFEB 5K9JL 4P57A 1JNNH 4GXVH 3BGFC 4FQQB 3I3DA 3ROLA 3TT1L 2EDEA 3TT3H 4PJFA 3GSRB 2AEPL 2XWBA 4K7FA 4Q6IC 5F6HJ 1C12B 3VFOB 1H3PL 4NN6B 4HFWA 4EZMA 4P2CG 3DV6B 4MAYB 3STBA 1RZJC 4Q74A 3FQUB 1U8IB 1R3LB 3MOAL 3GJFH 4YDIL 1A2YA 1BBDH 3BH8A 3QISA 1G7HB 1T21A 1FDLL 3ARTA 1CYGA 1BWMA 5TDOA 4JG0H 1I8IA 2BOBB 3G08A 4ONGL 3GBML 1U8KB 4D0DA 4LDLB 1O5DT 1IGIL 5J4MA 1U95B 3TNMB 5DWUH 1BQUA 3MLXL 3HR5A 5TDNA 5BJTA 2D0FA 3MRLA 3VMPA 3WXVL 4AH2A 2PW2A 2ERJC 3KG5A 3SDXA 5SWSA 2D7TL 3HZMB 4XPGL 1CFNA 1UXWA 1NJ9B 3ESVF 4GKNB 4TSCH 1KIQA 4I5BB 3SBWA 3BWUC 2N4IA 5F9OL 1LP9E 4G9DA 3QDMD 3DXAB 2BHYA 3V6OE 5AG8A 4YBLC 4DOHE 4G80A 1S7SB 3QDME 3X11A 1QBAA 4U6HA 3GBLA 4YXHL 3WFEH 1X4ZA 2MKLC 5ITBH 2QQQA 3FQWB 3VDBA 4CN1A 2EO9A 4EN3B 4ODWB 4JQIL 4YEFA 4I2XB 1PSKH 3NIGF 2ZUWA 4P9HH 4NKDB 4RBPK 1L9NA 1JWSA 2YUVA 1OTTC 4WI7A 1L4IA 4AK1A 1RZKL 3U0WL 2FO4A 5FHBL 5BO1H 2J8UB 1Z0NA 5LQBL 2BVOB 1N8ZA 4N5UA 4RFOH 1GAFL 4U6VL 4Y2DC 5K9QG 1ZT7A 2H9GA 3U7WH 2HT4D 5IVNA 3GJEB 2HFTA 3CZFB 2BXYA 5L6YH 3X13B 3CIQA 1JRHL 1NEZB 2ITDA 2DTML 4U3HA 2LFGA 2J7LA 4QHUB 4XHJC 3PF2A 2ICWB 4N0FA 3QWQB 4FTVD 5CILL 3RIAK 2E9IA 5F7FA 5C0CA 4XNQA 1JI1A 1KCRL 1MCIA 4HPYL 3KLSA 4XXDA 1FN4A 4NO5B 5LG1A 4GQPH 4OZIB 4FTVE 4GSDH 4OJFL 1KC5H 2OLDA 8FABB 1Z3GL 5D71L 3UAJC 4PIRF 4NQDB 2DQTH 1NCCH 3FHQA 3VWJC 4OCSL 4XMPL 1A6TB 5J1AB 5JHLL 1CU4H 5MERB 2BZDA 5JQHC 2CLZB 2CLVA 3QG7H 2YC1A 2B39A 2A6IA 4OFYA 2ED8A 1U3HB 4G8EA 4UIKL 4HIJA 1N2RA 2CK0L 1NLDL 4YUEH 2DLEA 4YHPA 5FYJL 4HG4K 2FH6A 3GSXB 3FFDA 3QI9D 4QLRA 3CH1A 4UV7L 3QDJB 2R9HD 1BIIA 3DROB 4FZ8L 5F3HB 5H35B 3RVUC 4DKFH 5J12C 3V0VB 1TNNA 3JV4A 2AJ3A 3WFZA 4CBPA 1H3WM 1X5GA 5IVOA 4OKVB 3O6LL 3K0WA 3O6KH 1NGPH 3T2PA 4IRZL 1QFUL 4K3DL 2G60H 4OGXL 4XCNB 5JW5A 2BC4A 3MGOB 3CFJB 4WHDA 5HYFA 2JCCF 5E0QA 1A6ZA 5I1GH 3IFOA 4BSVA 4ZUTB 1L6XA 2BDNL 3QZWB 1KJVB 5I1HH 3ZMRA 2MTPA 4J6RL 3FQXB 1GOFA 1KEGL 2DLIA 2GJJA 2AEQH 3LKNA 3HE6C 4KHTH 5DSCB 2HMIC 4LQFL 4KJQC 1YEIH 3DUUB 5T3ZD 1HCVA 5CD5D 2DM2A 2DJUA 1GZQB 3VWKD 3BP4B 4F7PB 3NMEA 3VFSB 4D9RD 1JPSH 3CPLB 3BW9A 1RUPL 3DPBA 4JHWL 5HHOB 2NZIA 4LSVL 1CXEA 3EFFA 5BVPL 1FFOB 2W9DH 4MJID 1T66D 4D9RE 1JHTA 4AM0A 43CAA 2X1XR 1EJOL 2NY5L 2V5TA 4ZYKA 1T83A 4GW4B 3EBAA 4MJIE 2ZNWA 4Q9BA 4TQEH 5GPRA 4P3DB 2R23A 3U1SL 3FN0L 3JWDH 4M7KH 4POZC 4Z7UA 4OLYH 4X4XB 1P7QD 2H1PL 4G6AC 3W9DA 1HSBA 1DN0B 1UZ8A 2P5WA 3G5YA 5ALCL 4TOYL 1TDQA 5D7IE 4R2GC 1H0DB 2WLZA 1U6AL 3RPIB 1NGXA 2MHAA 2Z31D 4G7YH 1QLFA 1UXSA 3TPUB 5BZWA 1DSFL 4ZUVB 1M4KA 4G42B 4Q97A 1F6LL 2ICCA 4LPWA 4U1LA 2E9JA 1Q94A 3PNWB 4KKLC 4ZFGL 1Q9KA 3HRZB 4LLMB 4O2EB 1T89C 4YHKH 3GB7A 1EJ6A 3LCYA 4ZQKB 1WUNT 4PY8I 4B0MM 3U9UB 1NGQH 5BV7L 1X5YA 2ORBL 4G43A 3EO1A 3EYUL 4YGVA 5MEQA 4F7CA 4YX2H 4R6UA 1YC8A 1A6VL 3HS0B 3W9EA 3V5HA 2HFGL 3VD3A 3SBWC 3STZA 1K2DB 4PRID 1J8KA 4NNPL 1NCDH 1AKJD 3C6LD 4RWYL 3WNMA 5F7KC 1KNOB 4YR6A 3RWCB 4PRIE 1TZGH 3DYPA 4HK3J 1AGCB 2ADJB 3UMTA 1MCSA 1XR8B 4X9IA 3Q1SL 4LIQL 5C09A 2A0LD 2BRRH 3JTTB 4MJ4A 5E95B 1BPVA 3UPCA 1YECH 2HFFB 3K1DA 5I19H 3W0WA 3PWNA 3QUYB 1YN7B 1NSNL 3V2AR 1G7IA 2NTFB 4WCYL 3FTGA 2QSCL 5DDHB 4WFED 3FCTA 1IC4H 4WHCA 3TYGL 4YHNB 5FHAH 2J4WH 1T1ZB 2W59A 4H25B 1XIWA 1IBGL 2QADB 4OZHB 4WFEE 3STLB 1D6EA 4PRPD 3VXUB 2P5EB 4EBQL 4KROD 5JXED 1A4KB 1FZMB 3NBNA 5IF0B 4PRPE 1ADQL 3MC0A 2JIXD 2BMKA 4LRNL 4RA3A 3TGXA 1FH5L 2XN9D 3MMEB 3BQUA 1UFUA 4W6XB 4YE4H 5T33L 3KPRA 1WT5C 2A6KB 1MWAH 1YQVH 2W0FB 5DLML 2XN9E 3SKMB 2O26U 1KJMB 1SBBA 2OL3A 2CRIA 3T77B 1V8HA 2EYSA 3QJHB 4NNXA 4LHUB 4PTTB 3T0EB 4R7NB 1IAMA 1MI5D 1TNMA 2HVJB 3ARDD 3S37H 3V4PH 2GFBA 5EULV 1N59B 3VGEA 3TLRA 2DD8L 5E2WH 4GBXD 5DO2C 3QJFA 4UNVA 1MI5E 3QQ9D 4FQ2H 1A7QH 3RTQB 4DN4L 5KG9B 3IU3B 2F19H 5HHQA 3G6JE 1KCLA 5LAXA 5K9KB 1OWRM 3TA3D 4QHMA 3V4VH 2P1YA 4PY7B 3UTQB 1FGNH 5DUML 1MVFA 3BD4A 4L3AA 3VD4A 5L88L 5I8OH 5E03A 5IKCB 2ILLA 4X7TB 4K9EL 5HD8C 1PKQA 1L7IH 4UBDC 4LPUA 1SYSB 5GRYA 4JDVB 1OP9A 2Y06H 3ZSSA 5I75C 1T6WA 3HMXL 4PJIE 3N1MC 2I9TA 2FIRT 4WU7B 2Y5TA 5H2BA 1VKXB 2VLJB 2VLKA 2VXUL 2EDDA 5KANG 3DRQA 4XNYL 4MHHG 4MVBC 2DN7A 3P73B 4CGTA 3K81A 2RR3A 1GXEA 1NFDF 3IFLH 4UDTB 3TO4A 4DKEH 1MHCB 4FFVC 3C5ZA 4H0GA 5E94A 2VZTA 4IBLT 4HSQA 1PZ5B 5DEFB 4XI5C 1T4KB 3OAYH 1L7TH 4WO4A 5JO5A 4AYFA 4ZNEE 4IJ3C 3AS1A 1NQBA 3LS5L 1T0PB 2D9CA 2VDML 4Y4HD 3ZTNH 1A0QH 5FGCB 3E6HB 1MIMH 4FA8A 3LKRA 2IPKB 3OMZA 4QHNA 1T83C 4W4NA 4X0KB 4GFTB 3ZO0A 1I1YB 1DVFA 3Q6GL 4UT6H 4JFDD 5GGTL 1MRCH 2OTPA 4MJ6A 5D2NC 1R3HA 5F9WC 5FYLL 5F72S 4F7MB 3MV9B 4NCC2 1P2CA 3ILQD 1BD2A 4JFDE 5IVXA 4YDVA 3DX6A 2W07A 4KV5E 2PF6A 3FHAA 2FX9H 2IG2H 2FR4B 4P2RA 3ROOA 3HC0A 3UTTD 3DO3A 2A2QT 4KZEH 1NCAH 2YD2A 4KK6C 3DIFB 4QXTA 2FGWL 3QO0B 4DEPC 3DI2B 1QZ1A 4MMXC 4QF1A 3UTTE 1E28A 4M5ZL 4PV8B 5IJVB 3U79A 5GRZA 3GIVB 1PBYA 3PUCA 1MRFL 1LILA 1A7NH 5IR1B 1R5VB 3V4UL 4HLZG 4CRPA 1LHZA 2QKIB 3C60C 4LGRB 1YEGL 3SDAA 1UA6H 5DMIL 1FG2A 5J6HA 1PVHA 2R29H 7CGTA 4RISL 4POUB 3BKML 5C07B 1KIRB 2CDFB 1FP5A 4NQSB 4PJ9A 3T65A 5JOFB 1DANT 3DVFA 2Y6SC 1VADB 4H8WC 4HMCA 3V6ZA 3UJJL 1G7MA 2OSLB 4QRRE 3F6IA 3O3DB 2VLRD 4NGHH 4KMTH 4NYLA 1KTRL 1MFAL 4YDKH 4PV9B 2PO6A 4EUPB 5GS2D 1YNLH 4U7KA 3C5JA 2VLRE 1DBML 1UEYA 1EV2E 5F9JB 1MCHA 4GAGH 1C5DB 2YD5A 4MNGA 2Y72A 2P4AB 5C0ND 4DW2H 5D7JA 5HGBB 5DVMA 2I24N 3VFTB 4JANB 1A14L 5FV1L 2I60L 4JY5H 2AXGA 4GAYA 3RUGB 1XIWC 5IB1A 2HT2D 1F4YH 2P24A 2NY3B 5CZVL 5IHLB 3WL9B 4F2MB 3H2WA 1DJSA 1FNLA 1QFWH 1IFHL 1OPGH 1QBBA 1S9XA 1U58B 1XGPB 3OF6D 4LPCA 5CGTA 1HH9A 3MFFB 2CDEA 5EIQA 3GRWA 4WFFD 4WI9A 1EK3A 2J88H 3BQUC 4IDJL 3ZHDA 1B6UA 4MAYC 2Y07L 1P4BH 5JTWA 2ENSA 3MA9L 4ODSL 4AENB 5LVEA 3BYYA 1YPZF 5EZJA 3OJDA 4XGZB 1JV5B 3U9PH 2P7TA 4Y19E 1OAYL 3P11H 4PLKC 5EC1B 1S5HB 5KOVC 3DETC 4QRTA 3Q6FA 1B4JL 4L5FL 5EFIB 1TJHH 3WFDH 3HRPA 3QRGH 2HWZH 2YKLH 4C59B 2APVA 4OGAC 1ZT1A 2FBJL 2JCCE 3KR3H 5FO7B 1SVCP 3OAZK 4WUUB 2R8SL 4HXBH 3VGAB 1AGDA 1PG7X 1W0VA 3BH9A 2BVTA 1R24A 5FKPB 3EW3B 1FYTA 5T1LB 3PHOB 1YJDL 4XVTL 3ARGB 4ENED 1INQA 4S1QL 5A2LH 5ESAB 1TCRB 1U8NB 3QFJD 5AYQA 2OP4H 3CFCH 3L6FA 2FRGP 1DEEB 5D72H 1VACA 5L0QB 2MMXA 3I9GH 4BQBA 1MY5A 2NY7L 3QFJE 1AO7D 4PG9A 5TFSL 2R2HB 1I1FB 2H26A 5KBNC 4L4TE 1ACZA 4FFZL 5F3BA 1JUFB 3WS6C 2Q76A 1IAOB 1AO7E 3KXFB 2FSEB 4PB0L 2YWZA 4EN3C 2XA3A 1LK3H 1WLHA 4WFHD 4JCLA 4M7ZB 1CWVA 3PHQB 4NKOB 5GIRB 4L3CB 2YD8A 4Y4FA 3MRMB 5I1DB 2GAZB 4M00A 5I6XC 2HN7A 1A6WL 1S9YA 1WC7A 3BHBA 3HNSL 4U3XA 3IB4A 3ARBA 4H1LB 3LAFA 3MRBB 4KKCD 1AD9A 1AXSB 3D85A 3S5LB 1JF1B 2BOCA 3S36H 3WD5L 1QSED 4OLZL 4O02L 4JPVL 5IFHL 1LEKB 2BNRB 4QRUB 3RWGA 1RZGB 3U7AA 4LFHG 2D7MA 3QQ3B 4X6EA 1RIUH 3D2UA 5HYQB 3L95A 3MLUH 2DQCH 1JPFA 4KAQH 3BZ4A 4WRLA 5EU6D 4LDOB 1RJLA 3EJZC 2AXJA 3OKLB 2NY2C 5KSBA 3BUYB 4M7LL 4UNUA 1E6JL 3C2AL 3SY0B 5L8LB 2X4RA 5EU6E 2DBLL 3NCJL 4U6YB 1CBVH 1V3LA 4WV1A 5LGJB 2EDLA 2A77L 4KRNA 1VPOH 1ZHNA 3D39B 3MZTA 1FL6A 1H15B 4OLVH 2C7UB 5HHXL 1I1AA 3T1FA 1D6VL 4Y0GA 3CFIC 4P5MA 5HXMA 2VQUA 3LD8C 4JM2B 1FNGA 4LCWA 2VZSA 1FVDA 1NH6A 4S1SL 3SDAC 4PRHB 2Z9TA 2O93L 3TCLB 5GRVK 1MCRA 3AM8C 4N90D 3SCMB 3V5DA 4Y16B 3HHRB 2N1KA 4PJ9C 4M5YL 1IVLA 4RQQB 4N90E 5HPMA 1QD0A 3UTOA 4OGZA 5KZCD 4TNWK 3OR7B 5DRZA 2V2WA 5EZIH 1Y6KR 5FYKH 5LJYH 4KRPB 4KRLB 4XBEL 3MRRA 2VWEC 3ARYA 1DTUA 1A6AA 1W72L 2DQUL 4OLWH 4FQLL 4HUVB 3GMRA 3OR6A 4H8WH 4LRIA 3IDJB 2X4PA 1FPTL 3GMLA 32C2B 4XAWL 3NCEB 1BWWA 4NZRL 3QUML 4ERSL 1C16A 2LTQC 1RAMA 4CVZA 1TPXC 1MCQA 2F54D 4MNQD 5F70A 5KVDL 3ARVA 4MWFA 1EHXA 5DD3L 4OM1L 3DMMB 2RIKA 1OTSC 3PL6B 2AVGA 2H2PC 1REIA 1QFPA 5SWQA 5I18H 4MNQE 2F54E 2EYTA 1NBZA 4MJ2A 3U83A 2DWEA 3D3VE 2P8PA 3MBEB 3O45B 1C5CL 1BZQK 3E2HB 4E9LA 5IK3B 5IEHA 5DK0A 3AROA 5B39G 3VW3L 4M43H 2VXSL 1S3KL 3LZFL 3BMWA 3PWPD 4XCCL 4ZPVA 4R3SB 4DCQB 3CUPB 1XCQB 1I3RB 2ZUQB 5BRZD 4E0RA 1FCCA 4CNIA 1RHHB 3GK8L 3T09A 3PWPE 1OT1A 1ORSA 3CSYB 2A1WL 1C08A 2H6PA 5BRZE 3QO1A 1GPOL 2X4SB 4BZ2L 1CR9H 1T5XB 2OL3H 4MCZA 3TBSB 2G5RA 4LCCB 4X7DC 2XKNA 2FX7H 4I4WB 3CLFL 4HWEL 4U1NA 3KPPB 4UV4H 4GUPA 5E2JA 2BJML 4X6CA 5I66A 1IKNA 2EKSB 5HDLA 2FEDC 3OG4B 5DRWA 4GMSH 1T1XB 1P6AB 1HH6A 2VN7A 3EOBA 5AEAA 2IH1A 1NFDE 2CRZA 2ZSWA 3KJ4C 1RURL 1MAML 4DWHA 1HYSD 1RZ8A 5MEPB 1ZMYA 2Y36H 2BNQD 2Y9RT 1KTDA 3MRIB 4HUNB 3ULVC 5F1IB 4R4NC 3WO4B 5IB2A 1RU9L 4JRXD 3WJLC 1U3YA 2VL4A 3CFKA 3W82A 5BVJA 3F7VB 2WK2A 3TN0D 3NA9H 3QUYC 3TNNB 3O6MH 4XCYA 4LHUG 3AXLB 1PG7W 4DKDC 1FAKT 4JRXE 4M7JH 2QL1A 1S9VB 2WINA 1AP2A 4IRSB 4G3YH 2CKBB 5CLTA 2OTUB 3AMLA 4HS6B 1QPXA 1NDMB 4Y4FC 3BE1L 3UAJD 2N7AA 2CR3A 5C0BA 2QADC 2PUQT 4KZDH 5MENB 5IIEB 2GCYB 2XNAB 4XTRC 1BHGA 1AQDA 1BOGA 3EJJX 4EQ2A 3PWLB 1Y18B 1U93A 5DC0A 2ADFH 4KUZH 1QFHA 1UB5B 1HHJA 5C8JA 3WUWB 4HIEB 4ZFOL 4LCIL 3BEWA 1CS6A 3FO0L 5DD0L 4CN4A 3EYOA 1NCUA 1UGNA 3E6FA 4JGMA 1GGBH 4Z7WA 4M1GL 2B1AL 5F89A 2VO5A 3RVUD 3U0PB 2QQLH 1P5UA 5HYSB 3DHJA 2A9ML 4I1NB 3KYKH 1T1WA 4ELME 3WDIA 3T0EC 1KCSL 1YEKL 1KBGH 2BSTB 3O0RL 1GIGH 3BRFA 4WW2A 4ZDHB 2HG5B 5DJ0B 1MIEL 3TIEB 1CT8B 3W5NA 1FV1B 2GHWB 1CTNA 4V2BA 3RTQC 1A5FH 1KB5A 2X4QB 1I1AC 2ZSVA 2HMID 3QCUL 2R69L 4HK0B 1NAKH 5C0AA 2IBGA 2X4NB 5IESH 3QDGD 4PPTA 3L3KA 5DJAB 5T3XH 3CSBA 4NKMB 5DA4A 1NCTA 3GMMA 1M71A 3VG9B 4Y5XA 1INEH 4H5SB 3QHZL 4IMKA 3PABA 4X99A 5DJCB 3GO1L 4V1DB 4PREA 1R3JA 1LO0L 1QHOA 4N0YH 4UUJB 1EFXD 3QEQB 5CUSL 1NL0H 3KPNB 4QO1A 1OAKH 2BNQA 5F1OB 3BUTA 3S3JA 3UJIH 3HE7A 3SQOL 3ZKMC 4POZD 2DMKA 2OI9B 1U9KA 3H7BB 4PJGE 3QCTL 1U36A 4G6AD 2J8UF 4LRIC 5CHNB 1ZS8B 3VXNA 2VQTA 4Y4KB 1WZKA 1EEYA 1ZSDA 1CD1B 4S2SB 3OXSB 3SKOB 4P2OA 5JIHA 4ODUB 1YPZE 3V5KB 1KLFA 4G7VH 4C57C 1T03H 2XI9A 2EDQA 5FKAA 1OARH 3FB5A 2ICEB 4KKLD 5MEOB 3S6CA 1KGCD 5DYOA 4FFWD 35C8H 1UKTA 1Q1JL 4QT5A 3SE3A 4HV8B 4HGWB 3MLVL 4JN2A 4D9LH 3Q5TA 4GKZB 1OQOA 4OZIF 1KGCE 1VFAB 3O3BA 3UDWA 5TE7H 5DFVC 2W60B 1OB1A 3DHMA 3P4MA 5HGDA 2HVKA 5E2TH 4LASH 5DUPL 3KLAB 1J1PH 1P7KB 2D2OA 1ZLWH 1NDGA 5T5FL 3HAEG 1CGXA 1KEML 1HKLL 4HUMB 1FNHA 3MQIA 1ZGLM 1Z9SA 3GRWH 5DK2A 1YN6B 3MJGX 3CXDH 1S7UB 3GGWA 3L5HA 3BZFB 4NQXA 5GSRB 4YPJA 1HQRB 3C8HA 4JZNB 5DJYB 1G6RB 1UACH 2E27L 3BD5A 1HNGA 1OSPH 2WUBH 2UZIH 3N85L 2R0WH 3MOBH 4XNXH 4J3VA 3QXTA 5C7XL 4JFED 1RJYA 3MLYL 3QDGA 5DURB 1XGQB 1JZ8A 1N64H 2FL5A 4JRYA 4K3EH 3BZEB 3I75B 1J05B 3HI5L 5E8PB 4P4KA 4WI5A 5E4EB 4L8BA 4F7EB 5HHNB 3FRUB 3OX8B 4HT1L 5C0RH 3SKNA 3VXRD 1CLYL 5CEXB 1V3JA 4PJDA 3OKNA 3IVKA 2EDJA 4IRJB 5IG7B 4UAOB 3FKUS 5JA8B 1CFVL 3VXRE 3ULVH 4I3RL 4MJ5B 3L3HB 4R4FH 1IGTB 2DLFH 4ZNCD 5ISZD 2BSSA 4FXGB 1H3XA 1U8MB 4ZFZA 4Y8DC 4WY7H 2I07A 1D5IL 2RFXA 2XKSA 4ODHL 4ONFL 4DUXA 5ACMA 3ZYIA 3NCCB 2NY3C 3U46A 5DO2D 3VCLA 5K59F 4KK5D 2WBJB 3O2DA 3DLQR 4LLVB 1NAML 5DHXB 4NPYB 4R4BB 2VITA 5T3ZL 3UROR 5D6DA 5J11C 1G7LA 2VDNH 1HWHB 1NPUA 3HG1D 4N0CC 1CGVA 5F44A 4CW1A 3QXVA 1CZ8L 4RAUB 1OGAB 2RCSH 2HJFA 3QHFL 1RMFH 3HG1E 3NZ8A 4N1CA 4BFBD 3DV4A 5EORH 2NW3B 25C8H 4LSTL 4FG6C 2CUIA 1PQZA 4GQ9H 3UYPA 5D1QD 3WFBL 1CLZH 1JGDA 3KPOA 2R1YB 3GSNL 5CEYA 3VGAC 5ACZA 4K3HA 4Z0XA 2IBBA 4N9GB 3PJSA 5GRUL 2NNAA 3L3JB 3ARGC 2V7HB 3RX7A 1KB9K 4OSUH 1KTLA 3RJDA 4ZPTB 5IBUB 1FFNA 4XI5D 1HHHA 5A40E 1G7JB 4ZAKA 2X89D 2HFEA 3QXAB 4HHAB 1FBIH 4LEXH 5L0QC 4HS8L 4QXUH 4Z76B 4JFEA 4RMQA 1I7RA 1F5WA 4L1HA 3O2VH 5I73B 4Z7VA 4IMKC 4K2UH 2EDRA 2VAAA 4N8VB 4KHXH 4MDIB 3ET9F 3SKUD 3ZTJG 3QPQD 4I13B 4Q9QH 3LQZA 3LY6A 1JPST 1ZGLA 4M7ZC 4RZCA 3Q48A 1KJ2B 4PJEA 1FZKA 3RHWF 5DJXB 4G8FB 3S9DB 1WIOA 4OZHF 3TIDA 5T1KA 5HYJB 1UJ3A 2DQIL 4F58L 3ZZ1A 3VXMB 1HEZA 5D2NE 1A3RL 4KFZC 1NCBL 1U8LA 2P5WE 2EH7H 5EU3B 5CD3B 5ID0B 3RGVA 4Y1AD 3RWFA 3MLRL 3MGAA 3IAGC 2VDLH 5GZND 4UB0H 4Y1AE 2DM3A 1CQKA 2FB4L 3U0TB 1D5XB 5IMOA 5J06A 3SE3C 3MV7D 1IC5L 3C60D 4TTDD 1IARB 3OBAA 4AY0A 3MZGB 1SEQH 4HWNA 2C4XA 4S0TD 4F33A 1YYLH 4EVNB 4ESKA 3CVHA 4RDQF 2HP4A 2Y6SD 3QEUB 3QIUA 1IKFL 4PJ5A 2VKWA 1CF8H 5GZOD 2JK5A 4P23D 1PG7H 2DM4A 3BISA 1AHWB 4CVXB 4P9ML 4UQ3A 4WHYG 4JKPH 5TPWH 4N5EC 4ZOBA 5FYJU 4NWTL 3L3OA 3D69A 3KPSB 4NQCA 4KY1H 4ZODA 1NC2D 2UYLB 3UBXG 6FABL 4XNZB 3N1PC 3BPLC 3SDDB 3JV6B 4OV6F 3SCMC 5EIIB 1OP3H 4PJHB 4P5TB 2NY6D 3TZVB 1N5AA 1CE1L 1YDPA 2X1PA 3DNKA 3O6FB 3T8XB 3QH3A 5EIVA 3S4SG 2Z4QA 4NCDA 1CG9B 4QOKB 1Y6NR 5HJ3B 1Q9WA 4LLYB 5IQ9B 2A6JB 3GSVA 1JPGB 5LWYH 1F6FB 5AZ2H 4XXCA 4DZBA 4MAYD 1KCUL 3OKDB 4OD2A 5IBLC 5GGRY 5CGYD 4HGMA 4NFDA 2JELH 3WLBB 1CCZA 2HLAA 3QP3A 1N7MH 3TBTB 3PIQA 1A4JB 4PLKD 3UTZA 5IMMB 1KPUB 5KW9H 5EWIH 1EO5A 3DETD 4EUPH 3MXWL 3KPRE 3OSKA 4JZOA 3KPQA 1SHMA 2YHGA 4FFYH 3O41A 1WICA 3U4EA 1UH2A 5T1DL 4XVUC 5FDWB 4OB5H 2YS4A 1OAXL 5D70L 5GJSL 3FT3B 5CCKH 1T7ZA 4KI5F 4Y88A 4EOWH 3FQNA 3MBEC 4GRWH 1FRGH 3O3AB 4RIRB 1BQLL 3UYOD 2H8PB 5DS8A 5IQ7L 2C1PA 2AERT 3BP5B 1DFBL 4ONOA 4XMLL 1QYGH 4JO1L 5AG9A 1MRDH 5D6DC 4JEGB 1EHLH 1CICA 1MJJB 3DXAD 1MJ8L 3IFNH 1DQJA 3VXOA 2NYYC 4YHZH 1PDKA 4LU5L 4JO3H 5TH2A 1S7VA 3DXAE 5E6YA 5I8KL 1U8JA 2EICA 1J86A 4K3JL 4KKBD 1RUAL 3GSQB 5EZLB 4LCCC 3LKSA 1NBYB 2MQ3A 3BKCL 5KVFL 4EN3D 1U8QA 5I1LB 5DJZA 5H94B 3AU1A 2YUXA 1IEBA 3HCVA 4YHLL 2EEBA 1LO3L 3ISWA 1JYVA 3S96A 3QG6B 1CDIA 2VLKE 2DWDA 3L7EB 1NC2A 4I2XE 4Q58C 1LO2L 1P1ZB 1MOEA 2VIRB 2PW1A 3WUWG 2V7NB 3H9SA 4O4YL 3WIHA 2ZP0T 2FYYB 1HQ4B 2J8UE 2UWEA 3FRPG 1Q0YH 4IOFD 4ZAKC 1KB5H 3H9ZA 4UOW0 3BSZL 3GJFK 5IOPB 3WO4C 2VC2H 1ZXQA 3MV8B 1CL7L 3MODL 5HYEA 5DUBA 5I15H 1UM6H 3QNXB 1J18A 3D25A 3UZQA 2R0KL 4DQOL 4M4RA 4IRSC 1DDHA 2WMPA 1JNNL 4LF3B 3TESA 3TT3L 5KTEH 2YA0A 1MFEH 3I6LE 4W6WB 5I8EB 3EJZD 4GS7B 4NQDD 1QO3B 4HWBA 4P4RA 4OZIE 3RUGF 3RWDA 5INCB 1I9RH 3I85A 3SKJH 1UJ3C 1HN1A 2GY5A 1JWMB 1SBSL 3KLHC 1NMCC 4OZ4A 1JNLL 4WNQB 4JFHD 1RK0B 4F57L 3VH8B 4JFQB 3RGVC 1U3HD 1BBDL 2F8OA 2GJZB 4NC0B 5T3XD 3Q2CA 4H1LH 2NY0B 4JFHE 1I9IL 2K1MA 4C56B 4HPOH 3MRJB 2F8XC 5CZXC 3QDJD 4GOSA 3B6SA 4JFXB 3FN9A 3IDXH 5T3XE 3FFCB 4YDLB 4UNTA 1OP5H 1CDJA 5D9SB 1VDGA 1IM9B 4RBPH 1L6ZA 3QDJE 5E8NB 4CMHB 5IHUL 4MSWA 3G5VB 1FLRL 4UOJA 5CP3H 4CL7A 4RAHA 3PWJB 1GC1L 2DQGH 1EO8L 2F74A 3VXTB 2FBOJ 5C0GB 3DRTA 1MHHA 3H8NA 3QULB 1G9EA 3QCVH 1S78D 4E5XB 4XRCA 4U1MB 2GQHA 1XF4B 3QIUC 4M6OL 1JHLH 3VD9A 3N1QC 1RZFL 1T7XA 3HZVA 4ODVH 4KH2A 3EJYD 4P3WA 4AL8L 1FG9C 1NGZA 1ZLVK 1SQ2N 3ULUC 2R0ZL 1LK2A 4WHTB 3OWEA 1C1EH 1IILE 3UO1H 3VXSB 5IHZB 4S1DC 3BXNA 5LCVH 2V9RA 2VWEE 2YPKB 3WFEL 4Q0XL 3CSGA 5DR5L 4HFUL 2VXVL 1TCMA 4X6DA 2EXWD 4X6FB 1PSKL 3VG9C 4P9HL 4FQIL 4YGAB 1KLGA 3FO2A 4G6MH 5CZKA 5HHOD 4UOW1 2X44D 4BJLA 1OTSD 5F7NC 3VJ6A 5GRJH 3ARFB 4M6NL 4RFOL 5HHOE 2VISB 3EO9H 1IAKB 3W11C 4DOHB 5A43C 3OL2A 5JDSA 2OI9C 5K59E 2BSRA 4IHOA 4M3KB 4OBSA 1QA9B 1LE9B 1AGEB 2IAMB 2J6EA 1VFBB 5FO9A 1X4YA 4NSKB 3BDBA 2GTWB 2O5ZL 4X7SL 1UM4L 3AREB 5FXCH 5JZ7D 4JLRB 5EO9A 5E6IA 3QFDA 5GS1A 1KC5L 4PGDB 1W2KT 4JVUA 3CFBA 3KDMA 2CMRH 1BGXH 3OKEB 1NCCL 4NRYB 1WWWX 1C7SA 1CU4L 1MCPL 5L8JB 4LAJH 3VFGH 1ZVSB 3P4LA 1JWUB