5I6KA

Crystal structure of copper nitrite reductase at 100k after 0.69 mgy
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 94
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6kA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6kA02
4YL4A 3S3DB 1GS6X 1ET8A 1PNCA 2VMJA 4F2FA 2XV3A 1RZPA 2PP7A 1NINA 3CDZB 2PLTA 4GY4A 5F7AA 3IE9A 1NPJA 1RCYA 4YSDA 1L9RA 1WA0X 1NIFA 3KW8A 3T6ZA 4YSSA 3JTBA 1SHXA 3HB3B 3ZBMA 2N0MA 2IDQA 2AANA 4YSRA 3TBCA 2LLNA 2BZ7A 4NB7A 1AS6A 3PAZA 2XVBA 1W6WA 3ABGA 1KGYE 1SDDB 1W8EA 3NJIA 1HAWA 1TEFA 3BVDB 4HIPA 4KO7A 1AIZA 3T6XA 2EILB 2PP9A 3N55A 4HHWA 4A67A 5A7EA 5PCYA 4M3HA 2UXVA 2CALA 3ABLB 4Q8BA 2VM3A 3CVCA 1MG2C 2I7SA 1BAWA 3TASA 1A4BA 3FSVA 1V10A 4A2FA 2GB2A 1JXGA 5I28A 3H4HA 2P80D 4UF7C 2PPFA 3AG1B 3OMIB 3ABMB 1PNDA 2WO2B 3NJNA 3WG7B 2EINB 2J55A 3NJMA 1YLBB 3NP4A 2XU9A 1GS8A 1ZIBA 2PPCA 4DP1X 1AAJA 1ZDQA 3D12B 1R1CA 2GC4C 4E9QA 3PLYA 4JHVA 2HZHA 5D4IA 1PAZA 3X1FA 1WS8A 1NDTA 3FSAA 4YSAA 2JKWA 3X1GA 4KNUA 1MDAA 2PCFA 4GYBA 1KCWA 4N4YB 3FU7B 1KYAA 3ZX1A 2PPDA 2FQEA 4MFHA 1AZBA 1SNRA 4BXVA 6PCYA 2XV2A 2PPAA 1WS7A 4DP4X 1PLBA 2RACA 1FA4A 1ET5A 5IY5B 1QNIA 2FQDA 4WTQA 2WO3B 2OV0A 4E9TA 2BP0A 1PZBA 1NIEA 1J9RA 1OE3A 1KDJA 2EIMB 5B1AB 2H3XC 4DPBX 4YSOA 1FWXA 1IKOP 1NZRA 2QPDB 3QJTB 1ILSA 1PZCA 2XV0A 4BDVA 1KCBA 1HAUA 1PY0A 2R7EA 1CC3A 3HEIB 4HCFA 2A3TA 5B1JA 2IDUA 2VW6A 2PCYA 2QPEB 4ENZA 2NRDA 2AZUA 1JZEA 2IWKA 2GHZA 4HAKA 3PAVA 3T6WA 4P5RA 2B3IA 2VSKB 4YSUA 4UANA 3U25A 1AR1B 5B1KA 1PMYA 1AZNA 2VW4A 5I6PA 5B7EA 5AZUA 3TA4D 1AQ8A 4YVUA 4HHGA 4FAAB 4Q89A 2VM4A 2Q5BA 2Y1AA 4F2EA 1SJMA 2FJSA 2ZXWB 2X88A 5I5MA 1EHKB 2YARA 3FSZA 1AS8A 1J5DA 5PAZA 2BP8A 5AFAA 1URIA 1OE2A 2DWTA 3AZUA 5I6NA 1NIAA 1ID2A 3QJQB 3NJFA 3FQYA 4AI7A 4A2GA 4FA7B 4A2HA 3SQRA 2BP0B 4G70B 2XUWA 1MG3C 2I7OA 3UAAA 4AX3A 4E9WA 1WA1X 1JZJA 3UADA 1A65A 1QHQA 4DP2X 2FT8A 4KOBA 1NIDA 2XX1A 3UGEA 2IDTA 1A3ZA 4BDVB 1JXFA 1BXVA 3NP3A 4HZ1A 3OMNB 1AZCA 1MZYA 1WA2X 3PXLA 1N68A 2FT7A 4BK5C 4BWTA 2BWIA 3L45A 4E9YA 2DV6A 1NTDA 2UX6A 3H56A 3OMAB 2EIJB 2XWZA 2VW7A 1E5ZA 2GC7C 3WKPA 3PPSA 3RYMA 2HX8A 1L9SA 5B7MA 1ZV2A 3AG4B 2YAPA 3DKHA 1ASPA 1JVLA 1OE1A 3WKQA 4G7QB 4AZUA 1A8ZA 2YAQA 4RH4A 1RZQA 3SBQA 1A4CA 4YVNA 1QLEB 3ABKB 2IWFA 2W88A 4KOCA 1KDIA 2QDVA 4HCIA 3EF4A 4E9VA 2BW5A 2IH8A 1DYZA 2YAOA 1W6LA 4DP9X 3CVBA 4ZK8A 4QKTA 1X9UA 2FTAA 1JXDA 2BP8B 1ILUA 2YAMA 3QJUB 4YSTA 2VN3A 3IN0A 2QDWA 4F7KA 1JERA 2JFCA 4CSZA 2HLEB 3OM3B 3WI9A 2BO0A 1AG6A 3X1BA 3S8FB 4G7RB 2AVFA 2PP8A 2QT6A 4KO5A 1OOWA 3NSDA 3TU6A 2Y69B 4PAZA 4KNSA 3JT2A 3FQ1A 1SF5A 4UAHA 1AACA 5E9NA 2XYBA 3NJGA 1FFTB 3NSCA 1M9WA 3FS9A 4YSQA 4W1TA 1SFDA 5B1BB 6PAZA 1AZUA 2BHFA 1SHWA 2UXTA 4DP8X 3GDCA 1NICA 2OJ1A 1OV8A 3N2JA 4DP0X 5I5IA 2HX9A 2UXGA 4AKOA 1TU2A 1M57B 2MRYA 2FQGA 3WIAA 3NJKA 2IDFA 1ASOA 3PCYA 2OCCB 4KO9A 3WNJA 1BEXA 3X1EA 2H5UA 4P5SA 4JKNA 3FQ2A 3V9EA 4KNTA 3QJRB 1ZIAA 1RKRA 3S8GB 1JZGA 5D4HA 2HRHA 3AG3B 1J5CA 1PLCA 2ZONA 3UABA 1AANA 4W9ZA 2CAKA 2GSMB 2X87A 1T5KA 1X9RA 5I6OA 3GYRA 1XB8A 1BQKA 1XMEB 4GXFA 1L9PA 5F7BA 1IC0A 4K9JA 5EHFA 2YXVA 4YSEA 1F56A 2FWLB 3OD3A 2HRGA 2GBAA 4QLWA 2BWDA 1ASQA 3CG8A 1ADWA 3EH5B 1KV7A 3IEAA 1XB3A 3S3BB 3NSYA 4N8UA 1GY2A 4NERA 4DP5X 1E5YA 5ANHA 1ETJA 3NJHA 5TK4A 3T9WA 5TK2A 4AKQA 1PCSA 2FT6A 4E9SA 3ZIYA 3FU8A 4WKXA 3QJVB 1AOZA 3FPYA 4A2DA 3UAEA 4GP5B 1B3IA 1UATA 1SF3A 1NIBA 3PAUA 2R7EB 1GSKA 7PCYA 3DTUB 4E9RA 2FQFA 3NT0A 5D4JA 1JVOA 4HALA 3X1NA 4BWUA 1KBVA 1V55B 5I26A 2VSMB 2UX7A 3EH3B 1GW0A 1IBZA 3IN2A 1A4AA 2XXGA 1EZLA 1XB6A 3OQRA 1JZFA 4G72B 4JHUA 5B3SB 2DWSA 1HFUA 3DIVA 2BZCA 2AZAA 2EIKB 1MZZA 4YSCA 2PPEA 3FU9A 3X2QB 3MBWB 5FC9A 4DP6X 2J57A 1E65A 7PAZA 3FU7A 4YSPA 2ZWNA 1BQ5A 1DZ0A 9PCYA 3TBBA 5B1JC 3V9CA 2IAAC 1J9TA 3SBRA 5I6LA 1GR7A 1J9SA 4EF3A 1E30A 1JOIA 2JXMA 1IUZA 3FPXA 2HXAA 5I6KA 3ERXA 3SBPA 2Q9OA 3QPKA 5B7FA 1L9OA 3QJSB 4BXSV 1IBYA 3MX0B 4DP7X 2GIMA 1ET7A 2TSBA 1SFHA 3QQXA 1TEGA 2BW4A 1KBWA 1ZDSA 2TSAA 1ZPUA 5AKRA 1OF0A 3C75A 1NPNA 2WSDA 2YAFA 1GY1A 3H4FA 1CUOA 2AFNA 3EH4B 2B08A 2J5WA 3FYEB 4KO6A 3IBOA 4DPCX 4TXVB 1OCRB 2XX0A 3CZUB 4GP8B 1PF3A 3NJJA 3ASOB 4G7SB 4GP4B 2CCWA 1NWOA 4HCGA 1J9QA 4AKPA 1L9QA 1AG0A 1V54B 4L0PB 2CBPA 2W8CA 2XXFA 1GYCA 4A66A 2YAHA 2J56A 3BQVA 2HX7A 1L9TA 3EHBB 4E9XA 3G5WA 2P80A 1E67A 1PZAA 1TKWA 3KW7A 3CVDA 5I5JA 3AW5A 4M4RB 1BXUA 1PLAA 1M56B 2H47C 3FSWA 3CDZA 1CYWA 1JZHA 3ASNB 2CJ3A 1OCOB 1BXAA 2UXFA 1NWPA 4X4KA 2DYSB 2IDSA 2XLLA 2YXWA 1JZIA 4NAJA 2DYRB 2E86A 1N70A 3T71A 8PAZA 1CURA 3ZDWA 3FT0A 1CYXA 1WAEA 2DY2A 1OCZB 2IH9A 3T6VA 4A68A 2YQBA 2IWEA 5LDUA 4CSPA 1I53A 1AS7A 1GS7A 3NYKA 1BYOA 3GXUB 2GI0A 2YAEA 1SDDA 1BQRA 3NSFA 3S3CB 2I85A 2MTAA 4A2EA 2FNWA 3AY2A 3AG2B 2ZOOA 1BYPA 1VLXA 4G71B 1AZRA 3WNIA 3NJLA 1OCCB 3UACA 4PCYA 5I6MA 4DPAX 4BWWA 2CUAA 3FYIB
chains in the Genus database with same CATH superfamily
2H0PA 1KJMB 3GQFA 3P0VL 1FAKT 3SY0A 1T1WA 3THMH 1WEJL 4W4OA 3KPRB 1P7QA 2DQDL 4DETA 3PQYD 5GJSH 1CFSA 2PW2B 2XA8H 3CDZB 2CHWA 4ZUSA 5EBLB 1DSFH 4GXUM 3FB6B 2HLAA 5A6IA 4AMWA 4U3SA 4PV8A 1OB1B 2N7BA 3C09B 3KYNB 4J3OF 1KZQA 3MRGB 3WIHH 1FCCA 3OKDB 2FNBA 5C0JB 5JXEA 1G7MA 3FAWA 4NQED 3UMNA 5CP7B 1KCLA 1U33A 2I32A 1JGDA 3HFFA 4J3OG 1FPTL 3ALWA 3O8XB 3OF6D 3U0WH 1SQ2N 2I5YL 2VAAA 4EOWL 2OXHB 5EN3A 4HUXA 4AW4A 2HJFA 3MRRA 3DBXB 3VVWA 4Z18A 4I5BA 3BW9B 4J12A 3VAEA 2X6CA 1UURA 4JVWA 3N40F 1I75A 5HJBA 4HUUA 3CMOL 1EEQA 5LAXA 5A7EA 4HHWA 3NPZB 5HDRA 5LNEA 5IB5B 3ZQXA 3U0TA 1BFSA 5GZNC 3C9NA 5IB4B 3OZLA 4UINH 1D5XA 1VKXB 1Z1WA 2ZOKA 4R96A 5KSBB 3BSGA 4BBWA 2V7NB 2Y7SA 1KLGA 1RSFA 2H32A 1HHGA 5BOJA 4YDKH 2W07A 4GMSH 5IEKA 1Q0EA 2X3CA 4OZHF 4F9LA 4ZODA 4J8RB 4YO0B 5C7ZA 3AG1B 5LJYH 4FX5A 1GA2A 5DEGA 5DRZA 2IH1B 2HCZX 4EIUA 1TG8A 1BX2B 3FCSB 1I9RH 2B14A 2EDNA 1QSED 4QRTB 4JFWA 3KLDA 1VFBA 2L4OA 2O5NA 4WHYH 5IOKA 32C2B 1UH4A 5D1XB 1S8DA 2P28B 3ARXA 1HL8A 2NLJA 5G5DA 1KCWA 1BCIA 3WEXA 2JJVA 4JFFD 1A6PA 2R69H 3HR5B 1BAFL 3NZ8A 4NCC2 3TA3D 3ULUF 3OGCA 2EH8H 4Q9RH 3SYPA 4IKLA 5DYFA 1A9VA 1WHPA 3L1GA 1N5AA 4A7GF 4Y1AE 3GSUB 1U3HA 1MFAL 1VFMA 2BLFA 3LH9A 3UGUA 1SLUA 1PIGA 1U3ZA 2GT9B 5C0GA 4OTXH 4QJ5B 4JHAL 4M43H 3ARFA 1PX3A 4YSOA 4Z7WA 3QJTB 5G2NA 2R0ZH 2ZOTA 2AK4E 3GSNA 3QRGH 5ESQA 5DGQA 5ALCH 1LO4L 5KJ4A 1QZNA 5EU6E 4A55A 3HRZA 1QLRB 3GZOA 1N6UA 4MA1B 5LXVA 4DCQB 2ICCA 5I6PA 1QUPA 3K7UA 3EDFA 1T6VN 1HINH 4LRIA 4ZAKA 3F7VB 4G8GE 1AQ8A 3OKEB 1PJ9A 3L1FA 2WMPA 2GAZA 4D9RE 2WP3O 3CFJA 1EAPA 2VJ0A 4HFUH 4ZUUA 3MUZ1 3HI5L 3Q8CA 2JE8A 4Q0XH 4CSTA 4KTYA 4U2ZA 2MOGA 4TOYL 2WM0A 3IJYB 3OAUH 1M42A 1QEWA 3CX5K 1T2QL 4AZ8A 1GYVA 1NM9A 4PFEA 5KN5B 4BZYA 1FZJB 3NOIA 2Z31D 5E7BA 5T1MB 4MD0A 3VG9C 3IJ9A 4NLAA 3CQQA 1KJ3H 3BVWA 5KYUA 1BREA 1FHNA 1OANA 4JFDB 4TVPH 5E1IA 2KUTA 4A2GA 1A3RL 4YQXH 1BQHG 2C8NA 1KCSL 4UMGA 3VXUD 3F3HA 2N01B 3JTSB 4YDJB 3RX8A 3QXAA 1RZIB 2FH6A 1PDKA 2F5BH 3MMEA 5C6TH 5FO8B 4M6OH 3VRLE 5LHDA 2P46B 2K4AA 2OP4H 5AW8B 4BFBD 3OB8A 2OMTA 1J1XH 43CAA 3GSNL 4LO9A 4N0FA 3K3QA 2X4SB 4FHKA 2I9LA 3TEWA 4O51A 1CGVA 1GAFL 4JANB 1F4AA 4OBSA 5I17B 3F5WA 1O6SB 2FX9L 4NN7C 4S1SH 1CGSL 5IFHL 3AG4B 4QRAA 1J8KA 4LARL 2FGWL 2G75A 1FH5H 1G7PA 3BWUF 1A8ZA 4WW2F 4AZUA 2Y4SA 1JDCA 4GRLD 2HRLA 2HFEB 3LV3A 1ZA3A 2DTSA 3ARGC 1Q0YL 4MS8D 4OCNC 4X9FA 1A4JB 1XV8A 3GSVB 3NCJL 5KW9L 1U8IB 3DUHA 1P53A 1MEXL 2OQJA 2ZP0T 2Z7YA 1NEPA 1X9UA 4N8VB 3N44F 3IMUA 4P2RA 1MFCH 3VB8A 1X5YA 4MD5B 3EYVB 3QH3A 1IGFL 1R3LA 2OMNA 1KCVL 4QRRB 3RVUD 2OK0H 3O2VH 3VDCA 3KPPA 1DVZA 1M1XB 3GZPA 2BIQA 3TZVC 3BPLC 4HVBA 2NY6D 1RZKC 3DX9B 1AACA 2WKGA 4ODTH 4P2CG 1XBRA 2G5BA 4HH8A 5AW5B 5DMIH 1HXMA 3EYQD 35C8L 1EAQA 2PO6B 5D55A 4W4OC 1BMZA 4OZHA 5J1AA 4NUGL 1WD9A 3FU6A 5JYLA 5E6RB 1YMMD 2WAHA 3GM8A 4DW2H 5IVZA 2UXGA 4Y2DB 3VGDA 1GKEA 2P24A 2MCPH 3RKPA 1NMAH 2DQGL 5EZIH 5HJ3B 4YHNA 3CPUA 2WLZA 2DMBA 2VERN 1CGXA 2KPNA 2PR4H 3PCYA 4QXTB 2CNZA 2GY5A 3SJVE 5E6SB 3VFTB 1JMZA 2YPVA 3R06A 2Z65C 3QUZA 3FQXB 4P5SA 4Z23A 4NJ9H 1I8UA 2FEJA 2MPAL 3GMQB 2ZSVB 4DN4H 3H3PH 4KNTA 5IG7B 3VXSE 3QUHA 1A6WH 5LGJB 1RKRA 4N0YL 1WAAE 2HG0A 3EO9H 4ELDA 1PLCA 3HPLB 1NC4D 1Z7JA 3W82A 3KJ4C 4UZSA 3ZTJG 5EUOF 1XF3B 5ACLA 4Y4KC 4S10A 4FFYL 4Z7NE 1IAKB 3O9WD 3V6ZA 1KV3A 1L9PA 3APDA 4PJDF 5E2WL 4BIKA 5ADOH 2CJSA 3KE0A 4FQJL 4NZRH 4UBDC 3ZT6A 1E28A 1T0PB 2CHZA 2RQ8A 3N04A 3MJGX 1BG9A 1OALA 2ZKXA 3D06A 3OD3A 4G8GA 5ID0A 4ZPTB 3O2WL 1N7MH 4HMDA 3S9DB 1NLBH 1E9QB 3AU1A 4F9LC 4L8DA 1BZDA 4P59H 1KV7A 5FF6B 3CCHA 1EHLL 4OZGB 3DPDA 4J3UA 1WBZB 3OJ2C 4NUJB 2VITB 2WKOA 1A7NL 4NQDB 2CO7B 2AQQA 1Z32X 4NGHL 5EN2A 4XN5A 5B38G 3VFVB 1DVSA 5ICXB 1OQXA 1P7KB 3HHSA 4ZW8A 4KK9D 4PRHA 1SF3A 2YPVL 1UT1A 2PWGA 2X9YA 3FU0A 1RK7A 4DUVA 1FHGA 2Y5QA 3CFDA 2DQJL 3K1DA 1OAYH 1WITA 4JFZH 3TBTB 3S2AA 2F8XC 3D87B 4HUKB 4E9RA 1DN2A 4JPIA 3UBFA 5DJDB 2MJWA 1BQHA 4LXFA 2UX7A 4HDIB 2EVGA 4X5XB 5EO1A 1U3HC 3MA7A 2AK1H 2ALWA 2CKBH 1XB6A 2XXGA 3E6HB 4GPVA 4ENED 3MLWL 3JV6B 4K94H 3X14A 4G82A 2WQ8A 1U8LA 3QAZB 1QYGH 4I18B 4K71B 1TQWA 4M1DL 3BRGC 5T1LB 3ARFC 3HI1B 4XTRD 5L88L 3GFUA 3QEQB 2E6JA 3PL6A 4EIZC 2I60L 2QFRA 2R1XA 4FTVD 4YDMA 1U3NA 3EUDA 1WCBA 5JW5B 4QY8B 1PD1A 1HHJB 4U0RC 1GGIL 3M17A 4G8AC 5EC1A 1QSFD 3CHRA 4DQOL 3FHEA 5HXMA 4M56A 1QATA 5AKVA 3HRZC 4PTUB 4WU5A 2QZQA 2SODB 2ZQKA 3CFBB 4RGND 4LRIC 4S1QL 1ED3A 1GZQB 3QEUA 3SPVA 2ZF9A 4WK4B 4F57L 3BUYB 4WW2A 1YPZE 2ATKB 3MJ8A 1DQML 1IGIH 1FG2B 4S0HA 3HFML 1ORSA 1NPNA 1O7SA 3E80A 4NIKB 5DXWA 3HC4H 4LCCB 5GS0L 2B1OA 1S7WA 3EH4B 2HH0H 1AQHA 2J5WA 2CKBB 2XZQH 3ESNA 3NZUA 3ZW3A 1JP5A 1YO4A 2QSCH 3RB7A 4Z77A 4NN6B 4CL7A 2A6DB 4K5MA 3GIZH 1UQSA 4AV4A 1AZVA 5AALA 3KGTA 4N2NA 2F7RA 2Q7NA 3ARVA 3NRFA 4M02A 2EIZA 1F2QA 1ZGLB 5LB1A 5CSZA 5CBEA 4AQEA 2Y1YA 3B9KD 3CNKA 2Q7YA 5JOFA 3G5WA 3VWJB 5ITBH 1JZ4A 2VIRA 1XO8A 4GXVL 5LCVA 2HPTA 2D7TL 3GPEA 2DWEB 5I82A 4M4RB 3BIKB 5I0YA 1CU4L 3OZ9H 4PGBB 2R59A 5INCA 4XHQA 4M8VA 5GSVB 1UWGL 1CYWA 2XKUA 1SBBA 1DLHB 1RVFH 3BAYA 4LQFL 2FJFB 3TBSB 1BXAA 5B21A 2GJRA 3H6JA 2IDSA 2MTPA 2CBTA 4GAGH 4BH8B 4R84A 4X9GA 6FABL 4AGMA 4XN8A 1BD2D 2WUBH 1YEWA 3B37A 2YBRA 4K8RL 3DVGA 3FFDB 1H8NA 4J3OC 5GIRB 1N10A 4WFGD 3BCFA 2WZPD 5T3ZD 4LOEA 5I30H 4R0LA 2XTSA 2K78A 4JR9L 5F3HA 3QWRA 4CA4A 2OLDA 2XVKA 1XGTA 4UNVA 2OMVA 3FU5A 2AJ3A 1SHMA 1HSAB 1RURH 4U1HA 2MMXA 5ES4B 4BH7B 2LTQC 2AJSH 1GW6A 4IBYA 5EUOA 2FSDA 1MNUH 3GI9H 4ANKA 5DVPA 3D39E 4MJIE 2ZUWA 1QPPA 3TIDA 2MEJB 3RWHA 3WIFB 1BZEA 4XPAL 1I7RA 2OR9H 1KYOK 1A1OB 2D7PA 15C8H 1DQVA 1QKZL 1T22B 1CFQA 1C5BH 3C5ZC 2WYZA 5LCVL 2XV3A 1CICD 2ED6A 2HJLA 4NI6A 4QHPA 5AL0A 3BGMA 2WLNA 3ULVL 2RA1A 1LDSA 3GHEL 4GSUA 5E1HB 1LGVA 4M6AA 3GS0A 2R0WH 1I9IH 1NPJA 5E4EC 1RCYA 1WVZA 5B38A 1L9RA 3V0IA 2IXQB 1CLZH 3LMJH 4Y0GA 4OD1L 3QDMD 4Q52A 1G9HA 4X0NA 3GKWH 4RDBA 5C2BL 3FQNB 4JDZB 4N2EA 2ARJQ 1R47A 4HWBH 1A2YA 2AEQH 4U4IA 2DBLH 3QUZC 2LLNA 5IJVB 1TQVA 2WCGA 5JHDB 1LP9A 3TCXA 2XC8A 2ZJSL 3D09A 4OGQC 1BIIB 4RA0C 5DJ6B 3ULUC 4JO4L 4NDMA 5DJ2B 1W8EA 2AXFA 3BKYH 1HQRB 4FYQA 5K39A 3KNBA 5C08B 6CGTA 2ROXA 4HFWA 3GBDA 1A14H 1DBAH 4FF9A 4EDWH 4FYSA 3VH8G 3C2SA 2X89A 3IKCB 4PB9H 3EGDA 2X4RB 2TRHA 1AXTL 4JY6B 5E2JA 2Y25A 2Y7QA 4P48A 4PJ7E 3BPCA 3U36A 5JIQA 5FUZL 2P80D 2Y9RT 1HHHA 2OCFD 2QHLA 3QPXH 3E2HB 5CHNA 1G7QB 3SCMC 3OPZH 1TITA 5GZOD 5E1GA 3OHXA 4FG6C 3MRFB 4KRLB 4W9FC 1YA5A 4KZ0A 2W92A 1UB6B 3MJ7A 3RWFA 2CXKA 3VXMD 1U6AL 2YFNA 3Q48A 3Q6FA 1EDQA 3QI9C 4UV4L 2K6ZA 1MW1A 2PCFA 4B9YA 3EO0B 4UCFA 3SYOA 2WZ5A 3ARWA 3D69A 1KTLB 1D2PA 4PPTA 5DLMH 5AOZA 1O7VA 2PPDA 1UT9A 3NCFB 2QGCA 2XV2A 5AVVB 4HPOL 3V2AR 4AJVA 3LEYL 1M6UA 5I1HH 1JHLH 1ET5A 2O6DA 2F18A 2FJGB 4ATWA 4CSSA 2F6AA 1TFHA 3S4SG 3VFNA 5EU4A 1A21A 3LDBC 2YWZA 4XCNB 3DETD 1Z5LA 2YSSB 5K59F 3KR3H 4PS8A 1GRWA 1UXSB 2DW5A 1D9KB 4XNUH 1E90A 1IBBA 1KENL 3D1MC 1JNHB 2EO7A 4PWGA 3SQOL 5L6YL 1EEYB 3PL6C 3L9RB 4YHIA 3VNZA 2XWTA 2Q8AL 2NRDA 1JZEA 2IANA 2BVTA 2QLVB 2HTLC 4RLDA 1XH3B 2PYFB 3MROB 3STZA 4U1MB 1DSYA 3TH3T 3T2LA 3LXAA 4UI2A 4TVUA 3BP4B 3H7BA 3GZKA 2IVFC 4P5MB 1FH2A 3ULSA 4BINA 1A9BA 4XCCL 4P3CH 1IKFL 2WUCH 2AKRA 4BHUA 2O5YL 4GO6B 3VRIB 4PSPA 1JWSB 4H8WH 5FDWB 4WW2C 4WGVB 1NGQL 4K8RC 1VF5C 3IVKA 3IDGA 4HWEL 3O45A 3FSZA 1MIEL 1GIGL 2C4FT 3P30L 4OCYL 4KTGA 3QP3A 5T5FH 5D93B 1OARL 4MJIA 4MD4A 2O6EA 1OE2A 2OYLA 2JCCF 1NIAA 3EJRA 4ODSL 5KS9F 3MDJA 4NJAL 4OF3A 1Z9SB 1C16B 4M7KH 1KFAL 3MRJB 1J0YA 4NQVB 1MCNA 3P11H 4KJQC 1WA1X 3QULB 4ZTPH 5TE7H 5I18H 2RMNA 3AXLB 3KH4A 4RZKA 1Q9OA 1HKLH 3VWKC 3O6ML 1TYRA 4IKIA 4NM4L 1TTFA 3DX8A 3MRCB 3QVAA 2BNQE 4KZEL 3S5ZA 4JFEB 1KYFA 1DJZA 3CXDL 2Y24A 3WKPA 5IB1B 3POCA 4LPXA 4PJ5E 5C0IA 3HMWL 3Q13A 4UT9L 3WKQA 25C8L 4G7QB 3ZDZB 4ZMYA 4Z7UA 4N9GA 1J8SA 3C6LC 3OG6B 4OLEA 1F4XL 4FQLH 1H9VA 2IWFA 1D7DA 1CXHA 4P8QA 1NLDL 3B9EA 1MKFA 3TN0A 2FIRT 4X6DB 5IOPB 5C3IA 4M5YL 5DWUH 1M7UA 4ZK8A 2HRPL 4Z3TA 4OGAD 2ZCLL 5E6IB 3F7RA 3OAYK 4NAMA 1O7DC 4BSJA 1M7IA 4R0LC 2OSLB 4F7KA 2E6QA 1URZA 2WBJA 2V8LA 3HC0A 4JB9H 5GRJL 4TQ8A 4UIMB 4JPVL 3QDGD 5FA3A 2X7LA 1FG9C 2FHFA 2J20A 4S2SB 1FV1A 2VABA 2VN7A 5HGAB 2LU4A 2V3EA 2A5UA 1A4KB 2A6KA 3G9AB 4AY0A 5EWIL 2CSPA 4LPYA 1B0WA 1CPUA 3E3QC 3SDAA 1JGLL 3QQDA 4PTTB 1T1ZB 2FD6L 3VYNA 4XNMA 5E51A 3CFKA 1I8IA 4AYFA 1IBGL 1BVNT 4GEIA 4PRPE 3SO3B 3ZYJA 2WN3A 1S9WB 1BAGA 1F6AB 2UWEF 2A83B 4W9CC 5D1ZA 3QUML 1IC1A 2WD0A 3SGJA 4AL8L 1EFXA 5E1AA 3LQAH 5J9PA 4GBXA 3D3VA 4RX4A 3X1EA 2XVLA 4GRMA 2XNAA 4OF5A 1DQIA 4WI6A 2BMKA 4X5QA 2XTJE 4QPEA 5BW7A 3VD4A 4XPGH 5C0AB 3QJRB 2ZX8A 2DRUA 3R18A 1BM3L 5F1NB 1T7WA 3S4SA 3VTAA 4NXKA 4KKLC 5D2NB 1FDLL 1CS6A 1AHMA 3QRBA 1ZK9A 1PKOA 5HPMA 4WNSA 1UZ8B 1E5CA 1B0IA 4H1LG 4W9HC 3WLWD 2YJLA 1MQ8A 3FO9A 3D4YA 3VDAA 2DYPA 1YMHA 4EVNB 3FHAA 4XNBA 1BV8A 1FIEA 4ODXA 4L9LC 2UVEA 3VI4E 2YXVA 1XGQB 3NIGF 2Z92A 3V6OA 4O58L 4ERSL 4Z8FL 3G6JF 5EORL 5E6UB 4HGKC 4NNPL 4BCZA 2IQAA 3EJPA 1QLEH 3HUJF 4ILDA 5BVPL 3MV9A 5BV7H 1XB3A 3US1A 3CZKA 5I1EL 3O4LE 1XSIA 5H2BA 1S9VB 2HKHH 3VGBA 2FJHB 4JPWL 4XZUB 4B7LA 5J3HD 2Q10A 1DQJA 2G4EA 2PF6A 2R51A 1G1OA 3D18B 3MACL 2P52A 4QYOA 3OHXC 4K0OA 4LP4A 2L7QA 1U8QB 2X9XA 4DKTA 4HULB 4GIPD 2XT1B 3PAUA 1QFWL 4YHKL 5L0QB 5IEHB 3H42H 2EEBA 1HT6A 7PCYA 3SQBA 5ISZA 4KH2A 4UNIA 2KHAA 4QXGH 2X6BA 4C83A 3X1NA 2OX5A 1M6OB 4KKCD 4W9IC 4ANWA 5M95B 4L2LA 3A6OA 2JCCA 3OKNB 1G9EA 1CGTA 2BNQA 4R8WL 1HFUA 4WFHD 5FYKU 3U2SA 4LEOA 4H8UA 4PJ5A 2W9EH 4OD3H 4OLUH 5BV7B 2YC1A 4PJCB 1GGUA 5J13B 1BQ5A 4MQXC 2VXQH 5CILH 3U0PB 1SEQL 4D9LH 3SE6A 2ORBL 1FNSL 1CIUA 2BCMA 4HWZA 4EF3A 2APFA 3I2CH 4I3GA 3EYOB 2XWBA 2Y36L 3FPXA 4M5ZL 1MI5D 3REWB 1OD7A 3E9TA 1FN4B 3GGWB 1G9MH 2BP5M 3QFGA 2OYPA 4QRPB 4LPVA 3VXNB 4FFWC 4NHCH 1OSPL 3V0WL 5CAYB 1WZMA 1JHKH 4G80B 1UA3A 4DVRH 1B6UA 3UBGA 3IDNB 3L3OA 1D5IL 1ZPUA 4N2GA 4NZUH 1HYSC 4P2AA 1EPFA 1M4KA 1XSKA 3FH5A 4CVZA 5FA4B 3RTQD 4ZOAA 2V2WB 1ADQH 1EGJH 1A6TB 3IBOA 3IETA 1IJ9A 3QZPA 4RMTA 3V79C 3T0VA 2F53D 2B1AL 4S1DC 4ZYKB 1Q9WB 2HMID 4CRPA 1PF3A 3ZOAA 1FNHA 4HCGA 2EECA 4WSGA 1LK2A 2MQCA 2Q3AA 4JHBA 3FTZA 3LRHA 3QQ4A 4LVEA 4QOKE 1MHEB 5INDA 2F1AA 4WJG3 2Y7OA 1SM3L 4I0PB 1JNLL 2AF2A 1JMXA 2BXZA 2F58L 1DJSA 3HB3D 3OGOE 4KUZH 2C3XA 3FFOA 3O3DB 3K0WA 4ONHB 4QRFA 5TF0A 1IQDA 5I8CA 1OKEA 2DL9A 4OJYA 3BP7B 4AE1A 1J9CT 1MJJA 3PNWA 4KXZH 1U92B 4MXVE 4X6FB 3UC0H 4ABWA 3L5WB 4PP2A 1KIPA 1OTTD 1URLA 1IAIH 3ZRCC 1OAXL 5D1QD 4FGMA 1R75A 3PU7A 1ZHKB 2CJ3A 2ADJA 4KK5C 2K4WA 1ACXA 2UXFA 4X4KA 4QTIL 2AI0L 3DDFA 1X5IA 1BEYH 3CFEA 3D0VB 3NCYS 2UWEA 5HI5C 1D3CA 3PXHA 2BVUA 4CVXB 5C07B 3RY5A 3GI8L 3ZE1E 5K33A 5I2IB 1XTMA 1ZHNB 1SMDA 4JKMA 2WLYA 4FQCH 1E9PA 2LT9A 1VERA 4QF1A 3TN0C 4MLSA 2KERA 2A6IB 2XQYK 3GRWH 1QABA 3GMLB 4D7BA 1HKFA 3VI4A 4H1LA 3ILQD 3TWYA 1SDDA 3UO1H 4IRSB 3LRGA 2QGBA 4HZAA 3T3MF 2FBOJ 3L3KB 1QSVA 5BO1H 1I9EA 4OCXL 1NGZA 1AZRA 4U6HA 1AR2A 2R2HA 5LO7A 2JMRA 1BQUA 1ROWA 3HRPA 4EEEA 5IGXH 2GSGB 5IMLA 4H26B 2EE0A 5SWZA 1NOAA 1PEWA 5EZLA 2G2RA 3P40A 3ZL4H 3SDAC 3K1KC 4OFIA 2YGQA 2ZUYA 3ZKQD 4AWJC 4DESA 2Y22A 3QNYA 1J1OH 3WMPA 5F7AA 5IM7B 1HEHC 3HZYA 2VR3A 1HDMB 4MXWL 4EKXA 2QADD 2NMSA 1YQ2A 3C8KA 1WDAA 3GPSA 3MODH 4KROC 4YGVB 3RPIB 4OD2A 5E94A 2J8OA 5LQBL 5EO9A 4IKJA 1I31A 5HD8D 4S1RH 5D1ZC 5MENE 3SGJC 1HHIA 2GBUA 2PMZA 3U46B 4MX7A 5EU7E 5C0EB 4KRPC 3VTMA 4KI5D 1FLTX 2B59B 3ZR6A 5KVEH 2WQWA 2BOLA 1RIVH 1MIMH 4GBXC 5M7QA 1AMYA 3GHPA 4XP4L 2P8MB 1BZ9B 4NQXB 1FZMB 1EAJA 1T0MA 2Z64C 4K9EL 1NFDE 5DVOA 5BZZA 4MMXA 4LCYA 3UJTL 5HHMD 2CUMA 4JAMB 4FQQA 5DQ9B 1B90A 5KYYB 4W6WB 3QHZH 3H9SB 5F3BA 4EZMA 2FK9A 4DGVH 3W39B 4BFKA 3UAJA 1KPRB 2GSIB 4RGMB 3PDGA 4YX2L 3ZHFA 2UXVA 2E75C 4RSVA 1BJ1J 5GJTL 1HCZA 1T1YB 2LW3A 3ZZSA 3SPIA 3V6OC 3BVUA 2CIIA 3B5GA 4ZW3A 4PJHE 1KB9J 5DURD 3UTZA 4V11A 1OT2A 1KN4H 2P8LB 4ZUTA 3TURA 4H4NA 1ZLUH 3F7QA 4X8JA 1ONQB 1OPGL 4UUJA 3MLTB 1S7XB 2Z4QA 1BLNB 2LABA 4IDJL 4NKMB 1GMEA 3JV4A 4KQ3H 5F71A 5D96B 4N0UE 2EDBA 1F97A 3PABA 4XRCB 5D4IA 4K3JL 1PAZA 2YLKA 3MNVA 2EACA 3N1FC 3NEOA 4IDLA 3T0EB 1NCOA 5DQJA 2Z8RA 3X1GA 1MWAH 4EZLA 3D8MA 4X99A 1GCYA 3X11A 4WW1B 4HU2A 5KOVC 1FF5A 1KLFA 3IMBA 2DBJA 2VZ3A 2NW3B 1NJ9B 3BKMH 4QOKA 3ZT7A 6PCYA 1KYUA 3IGAA 1NH6A 3C87A 1E40A 3D52A 1UJ3B 1U91A 4QR7A 3MCG1 4AOFA 1LNUA 2DLFL 1KDJA 3G08B 3L48A 8CGTA 3QNFA 3NRQA 2XZAL 2X70A 5T33H 4PUBL 4PJAE 4LIQE 4ONGH 4HG4J 2BNRB 3CFCL 2R56H 4P4KA 5CWSA 5DUMH 5J06A 2Q3ZA 3D85A 3QJHA 3LXCA 2MPVA 3TPUA 4KQ4L 1PYWB 4NUPA 1Z3GH 2VW6A 2OCJA 4C56B 4G9FE 4D0CA 4OLZL 4ADIA 2DM7A 1MREH 1RXLA 2WXOA 2WXHA 3O6KH 1E2WA 3QCVL 5C3TA 4P2OB 3AU0A 1BVOA 1DQQA 1ZS8A 5TDNA 1N8ZA 3VXRD 1KG0B 4XPTL 5GQBA 3TJEH 3RAJH 1E4XL 1QWUA 3OV6A 1BBJB 4PP1C 3P9LB 2IAMB 4Y2LA 5J1SC 1WFNA 4OUOA 4JO2L 4GXUN 1IM9B 3KLAB 4F2EA 3F7YA 1TQBC 3Q2LA 2BNUA 4KMTH 1LDPH 3CXHK 4AIZA 3AWFA 3B2VL 1XF4A 3VXTA 4JRYD 3L3OC 3HBPA 4Y2NA 2B4CC 2P5WB 4OV5B 1YSOA 2X4OA 3LN5B 1QPKA 1X5ZA 4JS7A 2X10A 2WBXA 3MRPB 1DN0B 4QDGA 2X4NA 1U58A 4MA8L 3PFUA 3CXFA 3BT2L 4OGXL 3QEHB 3QIWD 1A6UL 3NJFA 4HJJH 4F37K 2CQVA 1NSNH 4TN9A 5L9DL 1BHGA 2EKSB 2BP0B 4LSUH 1HESA 5FHAL 4EXPX 4OZIF 3AMKA 1OAUH 3FTUA 2F74B 3P9MB 3FB8A 3HMXL 4RBPH 2VXUH 3GMRA 3EXLA 1HXYA 1S3KL 5ECGA 4DK5A 4YZWA 2AW2A 2W60B 3ZLQC 2NY5H 4N0CC 3N06B 1GVIA 4IS6B 2E47A 3HC3H 1TDQA 3H56A 3H9HA 4FLRA 5ESVA 4IHOA 2CPUA 1BJ1H 4JE4B 4LHUD 2KKQA 4TLUA 3LS4H 5T5NF 2P26A 2XTJC 3VJ6A 1KGCD 4KKBC 2EUWA 5DD5H 3FBQA 1U8HA 5EA0H 1TVBB 2VKXA 2QL1A 3HG1B 4YVNA 2VH5H 3IWUA 5CLWA 5IMMB 5JR1H 1GXEA 4KK8C 1KBPA 3HZKB 1FRGH 4IRJB 4F2MA 2QFPA 4OLXL 1B0GB 2K1MA 4K7FB 4RCAA 1DBMH 2DQEH 2XRAH 4JM2B 1VHPA 1MJ7L 2Z91B 3FT2B 3O3EB 4OKDA 5DFVD 1JXDA 4K9EC 2CBOA 3KYMA 4R4FL 1LQSR 1YJDC 5EF0A 5K69A 2PWEA 1J5OL 3FH7A 4HF5L 1AG6A 5LNDA 2WB7A 4FNLL 4DEUA 1DSWA 1UH3A 4NT6A 4PJHA 4WI4A 4WK2B 2ZG1A 4P06A 4HIXL 4XI5D 3EG9B 4GKZB 1OGAE 2CJUH 1FNFA 1B0RA 4L37B 1F58L 1SMOA 3VFUA 5SWSB 2BC4A 1EXHA 3BWSA 3FQ1A 1WHOA 3BN9D 5EU5B 4XMTA 5I1AA 2DF3A 5TDPB 4ZMTA 2BVPA 1GTNA 3PQYB 1TQCC 3N6YA 5CJQH 4EI5A 4NO3B 4FNTA 3QFDA 2OMWA 3MO1A 4P23B 2RBLA 5FK9B 4P5KA 2KZWA 2FYYB 1ETZB 3DVFA 4QGYA 3SE9L 3IMTA 5FKAA 3SKMB 3S3JA 5F9OH 5DS1A 2WINB 3SDXB 4OZFH 3OJDA 4LCWE 1IE5A 4OF0A 3WJMA 2FAUA 3NCWA 1NAMA 4X4ZA 4UT6A 2QBWA 2XN9E 1N18A 3SKJL 4HLZH 1BEXA 3LEXB 3LH2L 2FWSA 4HWUA 4QAWA 3FQ2A 2FIKA 4OIBA 3WNMA 4HPHA 1PIFA 5FAAA 2HWZL 1FZKA 4ODHL 1BFTA 3S0PA 4NENA 1A47A 1NCCL 4LVOC 4PY7A 4UDUA 2CHDA 1UOWA 4UU9A 1RPQA 3WTXA 4N2CA 4MMZA 4PJAA 4FKHA 4MMXC 3BAWA 5CU5A 4ESKA 1KELH 2GSMB 4IHBA 4R26H 2IF7A 3TBWA 3H9YA 5DUBA 4G9FA 5E4IA 5EEYA 4E41D 3QJZA 4HBCH 5IVXB 3UAJC 2J71A 2O5ZH 3U4BL 2DQUH 3TO4B 3T2NH 1G0XA 4JHZA 1ZXQA 4F5CE 4JMXA 3DWTA 5ILTL 1LD9A 3V4VH 3ILEA 4QLWA 5DRXB 2NY0D 3JQOB 3PIQB 4HHAB 3IFPB 2XZZA 1ADWA 3N1QC 3WE1A 4XVSL 4OZFB 2FATL 5DJCA 3NPSC 4DP5X 1LTXA 1E27A 4UTBA 1AQKH 4L1BA 4GH7B 4G6ML 4OM1H 1XH0A 3KPNB 1JAEA 2ZTBA 2IADB 3M7FB 1ES0A 2CU9A 5HSFA 5DS8A 1CCZA 3DO7A 2HVJA 2YPLB 3NIDB 2R8SH 3PHAA 3QQ9D 2NTFA 4KPHL 4B50A 1KBKA 4G5AA 4UT6L 4KJYA 1NGPH 3QYCA 1QFUL 3EYUH 1W9XA 1J11A 3ATBA 3PDOA 5JA9A 1IRAY 2YZ8A 3T2QA 4JN1H 1UA7A 3EAKA 3QWOB 3V5HA 4F7MA 1KB3A 1W80A 5GGQH 4LIQL 5I26A 5LGKA 3U1SL 4TLKA 3VFRB 5J1TC 1E8YA 5AVWB 1D5MB 4GO9A 4LCUB 4JHUA 4ZMVA 2NSXA 5B3SB 3HNTH 5DJZB 3WN5B 4PRBB 1TEYA 4GQ9L 2BS9A 3V4VB 1HE8A 4PG2A 3RWDB 1YVLA 3SGDH 5KEZA 3ZO0A 1UA6H 4MCNA 1RZJC 3I02A 4DP6X 3ZXAC 3HE6D 3O2DA 4P4KC 3ZJAA 4ZOCA 3N85L 2XSKA 3CLEH 3OKOB 4NHUB 4OGZA 4QWWD 4TULH 3BGAA 4ZD3H 2ADFL 2H2SD 3STLB 1R5WB 3QZWB 4M7LH 4AJ0A 5D7IA 1Q8MA 2VL5B 2Y2WA 4K3GA 3DLQR 4FHBD 4UTBL 3NJVA 3KXFE 3FB7B 4HGWB 3C5XA 3C08L 2WLLB 3VQLA 2UZYA 3LIZA 3INOA 3KWTA 3QQXA 3B1TA 3QIUA 1KBWA 2VLRD 4YUEH 4KVNH 1WFIA 3H54A 4RFOH 4ZDHB 3SHSA 3L4CA 3Q5TA 3FQTB 4HX1B 1L3WA 3GTVA 3O6LL 2BVOA 2AFNA 3G3LA 4HIIB 3UYPA 3MA9H 3FRPB 3CZUB 1NGXB 1MVFA 2MQ0A 2ODHA 3DMMA 4P3DA 3SDCD 4Z3EA 1RUMH 3UTTA 1IC7L 1DDHB 3IJSA 4DVBB 4GP4B 4UDTA 4DK6A 1KEGL 4L4JA 1TNNA 5KJ7E 2PETA 2X40A 2VLJA 2Q6WA 4U1JB 2KLRA 2D4DA 1GYCA 1MFVA 3HNVL 3W0WD 1INEL 4NYLA 1BG1A 5KYWB 4QRUA 4PV9B 1OTSC 5JHAA 4LRNL 4Z7VB 1VZGA 1AI1H 4QXUH 1NL0L 5TF1L 2JK5A 4TSCH 3O2DL 1HCFX 1E67A 3S35X 4AQ8A 4LCWA 3OAZK 4KKZA 5DJ0B 3IT8D 4B27A 1EBAA 4H0IA 1XIWD 1VADA 2EUXA 1XAUA 1BVKA 1BXUA 2FDBP 2APVA 2XN9A 1UVQB 2WZAA 4JFXB 4LSSH 4LNVA 1NEZG 2C9AA 3B3IA 4Q4IA 2NXZD 3AJ7A 3LRSB 4M62L 3TNNB 1YY9C 2XN2A 3KPSB 3LS5H 3NSJA 5J12C 1CF8H 2NNAB 4FNUA 4NP9A 4FG2A 4U7SA 1NBYB 4YWGH 1SXBA 3ZMEA 3CVIH 3LIZL 4MA7L 1G7IA 3HS9A 4Z95H 2YEZA 1B4JH 1BDYA 3VI3F 1WISA 3MBED 4YFEA 1DANT 2DTMH 3K8MA 1I53A 3KPQB 4HA1A 3KJ6L 1RZFL 1Q9KB 1AO7B 2XIDA 2QEJA 3L3JB 1HCVA 4YHZH 3WELA 1DFXA 5CF3A 5IKCB 4LL4A 2MTAA 3EOAA 5DSCB 1S6NA 3AY2A 4FI7A 1Z9MA 4CGTA 1G0DA 1NKRA 5F0JB 3NJLA 4NZTL 1RMFH 4TUKH 3ZE0E 1L7IL 1CF1A 3HTLX 4M3KB 3LXUX 4AT6A 2CO4A 4ZMAT 3CC5B 1AY1H 2IBGA 3VXOA 4G8IB 3SGEH 4OKVA 3UZQB 1E3ZA 3GLAA 3IDMB 1DEEB 4B97A 1SBSH 4XHJC 5F21B 3MRKB 4NN7B 4Z7AA 3QDJD 2NY7L 1U8CA 1XR8B 4HV8A 4GY4A 4EI5C 4ZNCD 1EERB 4BE5A 1NBVH 2X1WL 3QIBA 4MCZA 1VGEH 3JWNG 1J05B 4DTGL 4MAYC 3RIFF 1EK3A 1NDGA 3I3BA 1RLBA 2X2UA 4I2XA 4RIRB 3ARGB 2EDXA 5T1KA 2YA2A 2P5EB 1AJ7L 5D7LE 5T3XD 4IU2A 3TBVB 3S96A 2NY2D 3MLZL 5IBUB 3T8XB 1LILA 1I7ZB 5CLYA 3QJOA 3W81A 3IFOA 4XGZB 4PJIE 5IMOB 3FTVA 1FVDB 2B39A 1AKJB 2MNWA 4DO4A 4POZC 5HDBE 5DJXA 3PAZA 2A73B 2Q86A 4LHJB 1AP2A 2MNUA 3BZ4A 2QHRL 3P0YL 3VW3L 1UWFA 3NMEA 1KNOA 3RVWD 4J6RL 3T1FB 2ENYA 3TZVB 3BPLB 4LSTL 4Y16C 2CALA 4U6HB 1R5IA 5A2JH 3KXFA 3WYRA 1FNAA 1A4BA 1I8AA 4LKXA 5I66B 4IU3B 3JWOL 1T1WB 3EADA 4FERA 1OPOA 5BNXD 1M3IA 4JGNA 2D8KA 5KSVA 4JFQB 5HJDA 5EV7A 5IBTH 1CFSB 1CR9H 2Q2EB 3ARBA 2YOAA 3VFWA 2CMRH 1KXVA 1Q1JH 3BEVB 4U3SB 1WAAF 5AAMA 4PV8B 5I8OH 5I1DA 3NSXA 2JELH 3D12B 1JV5A 1QNZL 4WEMB 3PLYA 4PD4J 4JHVA 1HK6A 1OAZL 2W0FB 3BH8B 5FO2A 4WWNA 4KNUA 1KB5A 4JCMA 1ZTXE 2ED7A 1KYAA 4MNGE 1TTGA 2NW2B 5KVDE 3FQ4A 1ZJAA 4CU6A 4WI8A 2VAAB 4FQ1L 5FWRA 5C0CB 1K5NA 5HBBA 5EG6C 2EE9A 4HUXB 2HJFB 3MRRB 4Y4KB 4KGJA 3KBEA 3APNA 4H20H 5HI4D 3P4OA 1COBA 3BZFB 4HUUB 4GQPH 4AEFA 5LAXB 4YPJA 2HUEA 3KPRE 5F7EH 2AMUA 2ZKWA 5C92A 3OTTA 5GSRA 4OI7A 1FO0H 4PJEF 1ZK5A 1NZRA 4IBSA 2ZOKB 1WBXA 2VQ1B 4ZPVA 4PG2C 1W2KT 2APBA 1KLGB 1KCUL 3QO1A 4IGBA 5JW4Q 5IEKB 2DAVA 4YHPA 1AE6H 4EKJA 4ICWA 4Z7OB 5C3LD 4XE0A 4NI3A 4ALAL 4NM8L 5DEGB 1NEZA 3A6CH 2VDML 3Q8BA 3EOTH 4ONFH 1P7QD 1KBGH 2Q7AA 1U0QA 3ARYA 3LKRA 4MZ2A 2WW8A 3BLPX 3PV7A 1ZT1A 5C09A 5AZUA 3T4YA 2F0CA 1R5VA 1CDUA 2A9NL 3A3YB 2QV2A 4KDWA 4F8QA 4LSPH 4JVUA 1S8DB 5DZPA 3ZDXB 1SJMA 1MCJA 1MVUA 3F00A 4FEMA 1X5JA 2WK2A 2W9DL 5K9QI 2FX8L 3SOBL 3QIUC 1EHKB 5I5MA 3NZ8B 1DBKL 5JXED 3P77A 4KITB 3VI3A 4YDIL 1A25A 1MHPL 2X6UA 5AFAA 2JKLA 1ID2A 1NBZA 1U3HB 2J73A 5C0DA 3ZL2A 1FO0B 2QQKL 1INDL 3LEVL 3RDJA 1G9NL 4AQ1A 3AADB 3DMMC 2AEWA 2XUWA 5C0GB 5KSBE 5DJYA 2J2ZB 1BOGB 3ARFB 1R34A 5AAPA 2VJ8A 1MCOL 1TTCA 4G3YL 1NIDA 4WFFD 4XMLH 1JPGA 1CD1A 4N2DA 1ZEAL 3QPQC 4HZ1A 4YBQD 1XGYL 5ESQB 5F70A 4BWTA 2DQCH 4AQ8C 1T1XA 2VLLA 3W38A 3GS7A 2AXWA 1XH1A 3HRZB 5CCHE 1F3DJ 4FNPA 1IGCL 5D1XE 4BFGA 2MNJB 3BKJH 5I1LA 4DPRA 3LZRA 4BFOA 4PWKA 5EBWB 2AQ2A 4CN4A 3LNDA 3CX5J 2DDQL 3RZCB 3CFJB 1A4CA 1IBHA 1M7XA 5BQ7B 4MAUL 4F7TB 2VC2H 4ZUUB 4DFHA 4EN3D 3BKCH 1U8MA 4GKSA 4LSVL 1IM3A 1S7UA 1N5YL 4AZ8B 2EIDA 2OTWB 2VQUA 3IU4L 3NACH 2HJKA 3H0TB 1P7HL 2FTAA 1X5KA 4J3OH 2G4GA 4MD0B 2NYYD 3L3DA 4WO0A 3EFFA 2MOVA 2YXFA 4YHML 3FH8A 4G11A 4P5TD 3RUGB 4WHYG 1FZOA 4JQIA 1JWUB 2EO1A 5KJRH 3MMEB 3UG5A 3F7LA 1WIPA 3QA3B 1G94A 2X4QA 5EZJA 2H8PA 2P5PA 5AZ2L 2P44B 4PAZA 5ID1A 1H3PH 3GB7A 3EFDH 4Q2ZA 3P3RA 1K4CA 2ITDA 4XB8A 5IUCA 1CICB 3KCWA 2AJVL 2F19H 2WXRA 3NJGA 2EDJA 2X4TB 3CSTA 4O51B 3S34L 3SEPA 3ARDA 3F5WB 2ESVD 4B41A 2GUOA 1IFHH 1PSKH 3AVEA 12E8H 1N59A 3RI5K 1DLFL 1IX2A 4MNGA 2G75B 5D4QA 4F7EA 1A1NB 3CK0L 3QIBC 4QHKI 4GO8A 5E2VL 1FNGA 2K3HA 1PJWA 2BDNH 3DX2A 3LV3B 3M07A 4LAQH 1UENA 1ZA3B 2IDFA 4ZAKD 4JG5A 3UYRL 4ADJA 5JIMA 1NCDL 4UNTA 4XAWH 5E08L 1DBJH 4QRSA 4BK5A 1FL5B 2FZ3B 2OMXA 3O3BB 4AMKH 2DIAA 3A22A 4ZX5A 1KJMA 1L0YA 3N0AA 3L4XA 4MGXA 3D05A 2OQJB 1RU9H 1Y6NR 4CDHA 4OT1L 4NFCA 4JKPH 4EBQL 3DGGB 4P2RB 4RZCA 3DOIA 2Q1EA 1R3LB 1T66D 1UOKA 5EBLA 3VGHA 3A67H 4ODWA 3FB6A 4UYPA 3LZQA 4JQIL 3ULUH 1A66A 5F9DC 1F86A 3FSOA 3KYKH 4GXFA 2CRMA 1OB1A 4GJTB 4NKDB 3E8UL 3ZMRA 3AY4A 4L4TB 1VAHA 2IV9A 3WFDH 7CGTA 3H85A 2B7DT 4NNYB 4Q9QH 4PJEA 1KIQB 2J7LA 3C5ZB 5TH2B 4AYEC 2G5BB 5F97E 4BGLA 1MF2H 3NFSH 1HXMB 3N1MC 1UCBH 4QHMB 5TE4L 4OZHB 4ALAC 5J1AB 1UWEH 3POHA 1IEHA 4N8UA 2YQ3A 4FZ8H 3DBXA 4KI1A 1T2JA 5F7DA 4G6AC 5ANHA 3T65A 1PVHA 3BW9A 2CD0A 1RUPH 2PWFA 4E9LA 2IG2H 3DTXA 3SZ6A 3F58L 3S37X 1MCBA 4IQHA 4TVPE 3STBA 3UPRB 5AAMC 5IB5A 1T5WB 4FQXD 4X7SH 1YN7B 2VJXA 4JY4A 3NCYP 1VKXA 5E9DE 1FGVL 3R06B 3DK2A 3O4OC 3QUZB 4M48L 4L1SA 4QRRE 1QASA 2DQIH 4AG4H 1GSKA 3DX4A 4AIOA 4YO0A 5ALBL 2VDQL 5I1CL 5I74C 4HXBL 1NCTA 2J1YA 2EDEA 1BX2A 2QQNH 4WUKL 4PJ7F 3ZTDC 1GW0A 3FJTA 3V6ZB 1SZNA 3L8QA 1T21B 4PCTA 3TCTA 2VXTH 4P57B 1NC2D 4PIBA 2EIKB 4UM9A 5D1XA 4YSCA 2PPEA 4OLYL 4XWOC 1UACH 3ZE2F 2EDFA 3IFNH 4TS6A 5ID0B 4YSPA 3HR5A 3RVVD 4IGBC 1A02N 3BI9X 2CDFA 2WTOA 2C7UB 5ITFB 1PLGL 2R0KH 3SBRA 3AU1B 4JRFA 4BQ8A 1P4IL 4WSKA 3ML9A 3SCMB 3CCHB 2AJZB 2DMHA 3GSUA 3PWPB 1OF2B 2VAJA 1EO8H 2PTVA 3T2PA 4P49A 4YHLL 4NWTL 1AOHA 1X5HA 1E7UA 3KWWA 5HI3C 4AENB 3QI9B 2YIHA 3THML 3Q06A 3LRMA 2AGJH 3VMNA 4PRHB 1AHKA 4W9EC 3U30C 2J6WA 5ACMA 5GJSL 4Y1AD 4Y5YA 2OMUB 3TT3H 3CFDB 3ARTA 1DSFL 5AVTB 1BF8A 4Z9KB 5GRYA 3VA6A 1IJNA 1BQHB 1QLRA 5CLTA 1WFUA 4DCQA 5EO1B 5ICZB 5CXPA 3WIHL 1L5GA 1NWOA 2AK4D 2DMKA 3BP5B 3QXTA 4AQ1C 3F7VA 3KDMA 3MYZA 3OKEA 1U8LB 1CLVA 3TM6A 2R69A 2G9HA 2HTKC 2GJPA 2JB6B 4KJWC 5FX3A 4WO4D 3U0WL 3FTGA 2J56A 3WY4A 2YGNA 5EU6D 4KMQA 1ZLWH 4BQBA 2HX7A 4OZGE 2R1XB 3IJYA 2Y07H 1WCBB 5KN5A 4J4PD 4OI8A 1HNYA 4NQDE 3MKKA 1FZJA 3KW7A 4G8GD 1CVRA 1TTRA 1CXLA 5T1MA 2G3XA 1GZPB 4N5EC 4D9RD 5ANMA 2H47C 4KKAC 2HAZA 4JFDA 4W6YB 5IJKA 1E2VA 3JWNC 4B7IA 4UINL 1NFIA 1OCOB 4YDJA 4DEWA 5I75B 3LKNB 3RGHA 1RZIA 3PNRB 4FG6D 4OU3A 3SPVB 1BQLL 1JRHI 4YDKL 4A6YH 4WW2B 6TAAA 2XHNA 4NZJA 4AYSA 1DDTA 3CGTA 3ZDWA 3ZKNC 2CBMA 4V1DB 1B9ZA 2ZXGA 1HILB 1I9RL 1S7WB 2X4SA 3HE7A 5LDUA 2KLTA 2OXGA 1NUFA 5GS0D 3FCBA 1GS7A 2M2DA 4LLDA 3NYKA 3X3FH 2DMCA 1BYOA 4BSVB 4Z77B 1NBCA 1T83C 3FN3A 3N44B 5AWNH 1J18A 3QEQE 3S3CB 3I9PA 3RGVD 3FO0H 1UQSB 4D94A 4BFIB 2YO3A 1YYLH 4CKVX 4QEGA 3MLYH 2P43B 4HIQA 4KK6C 2R69L 5HHPA 1PL3A 3WN6A 1LWRA 4H2AA 2HLFD 5I6MA 3VWKB 2IFGA 4LT7A 1H3VA 3U1PA 5LUMA 2EH8L 4Q9RL 2GJ6A 1VACA 2LU3A 1WICA 3GSVA 4HW6A 2YWYA 4I89A 4YL4A 3CHQA 5F6HI 2WGXA 1U8IA 3PL6D 1ZLDA 5BVJA 2KH2B 2CLVB 4N8VA 4PJGF 4OTXL 4C4UA 3ARDC 4FQIH 4M43L 4MD5A 5CSBA 4HJEA 1WBYB 2OM5A 4KVCH 5AW0B 3ZY7A 2DJMA 2DEYX 4DKDC 5DUJA 3C6LB 1YEDA 2R0ZL 1FNEA 3LSOA 4H0GA 4AYID 2DI8A 1YG9A 3QRGL 2F2HA 3ZZQA 1HJCA 1B3JA 2YD4A 3FO1A 1PQZA 3MNZA 3SKUD 2I24N 5ALCL 3PUUA 2PW1A 4JCLA 5F9JA 1PZDA 4P46B 1D7FA 4DAGH 5HYJB 3TONA 3E1ZA 4MASA 2EJ1A 3ESMA 4GEJA 4JW3A 4YJZL 2OULB 3BDBA 1SUJA 1DVUA 3GLEA 5F3HB 3MV8A 5JDJA 4NB7A 1HINL 1O6VA 2E7DA 5D9SA 1LO5A 2AJ3B 5HHVL 2ADIA 2HG5A 3CBKB 4P2QA 5A16A 4HFUL 5EUOB 5LGHH 5CMAB 4J5VA 1N6QH 2LVCA 4Q0XL 4TNGA 1NMBH 4AM0B 3OAUL 1ZVSA 1S9KC 5H4ZA 4KJQD 3K71A 3CLFH 3DIFB 5FW6A 4GMTH 3TIDB 3C09C 1UOLA 3VFTA 4PJDB 4XX1E 2VM3A 2FWUA 2HUHA 3AY4C 1NCWH 1L0XA 3GMQA 1CFQB 1P9MA 2GB2A 1KJ3L 4QRQA 3DPBB 5LGJA 4TVPL 2HJLB 3LYRA 1GC1H 4YQXL 3BGMB 3HPLA 1R3JA 3EJZC 1PNDA 2OSXA 3KL0A 3NCBB 3MYJB 1A22B 5C6TL 2F5BL 1N0XH 3ULVD 3SJVD 4M6OL 4N0RA 2IQ9H 3H55A 5GRUH 3VQMA 3BAIA 3GWJA 1KGUA 1IAKA 5F6IB 3KPLB 7FABH 1TJMA 1F4HA 1BECA 3CZGA 1J1XL 3UBHA 3WKNA 1OOAA 2V17H 3VXSD 2MQ3A 1UZ6F 2ZAHA 1OT1A 4WI9A 5F7HA 1A2YB 1MDAA 4TSBH 4XMXA 2XOTA 4NUQA 4S1SL 4D8OA 5D5ME 4PJ8A 1LP9B 1E9QA 2PPAA 4TV3A 1WS7A 4BM7A 5C70A 4V2CB 1FH5L 1T7VA 3Q5YA 3JZYA 4NDMB 2AXFB 4HPYH 5FIEA 5K39B 5FCSH 4BK8A 1OLZA 1WBZA 1EDYA 3EDJA 1PZBA 4AYDC 4HFWB 3ZT5A 4NQDA 2Y1ZA 5A40E 3ZL1A 1KJ2A 4L9LB 2KLSA 3I3EA 1FWXA 4GIAA 3EFOA 2QPDB 3EGDB 2KS0A 2Y7QB 4FFZL 5FUCC 5J89A 1MFCL 3U36B 2IDUA 2OTUA 1BYNA 5BXFA 3TBTA 2WWKO 4H8QA 3N42F 1GYAA 4N25A 1HHHB 1G87A 1XVSA 5DJDA 3R7QA 3T6WA 2OK0L 1MI5B 2V5MA 4LMQI 1KY7A 3FRUB 4HDIA 5E99H 4YSUA 2BINA 3U25A 1ITCA 4X5XA 1AZNA 5B1KA 5ADPH 5EDSA 1E4WH 2IBBA 3IMWA 3QE5A 4XX5A 4I18A 2VDKH 4ODTL 4RESB 2MQGA 2Q5BA 5JHDE 2GK0A 2F5AH 3RWFB 5DMIL 3HI1A 1M2OA 2DH2A 3FFCB 1YC7A 5CGBA 4NIYE 2PCFB 3IXAA 3D69B 5C08E 1FYTE 1GH7A 5IJBC 2CCVA 2R27A 4Y5YC 4DW2L 3DHUA 4HJ0D 3UC2A 3WO3B 2NTSP 3ETBF 1X4ZA 2MCPL 3T08A 1I1AA 1IGYA 1NMAL 4KKLD 3L4UA 5F7YC 4UV7L 3VFNB 1WUNT 5EU4B 1QBBA 2PR4L 3IDXH 4PRAB 1MG3C 4GRWF 2ZXCA 4ZMWA 4TVSa 4NJ9L 2CA4A 1GZQA 2XFGB 3DX6B 3VFSA 4DN4L 1JZJA 3BUYA 3H3PL 1A6WL 5F7KC 1S2EA 5D2LF 1JYXA 1FG2A 2NNCA 4NQCA 2VYRE 1LLAA 2NR6D 1VEPA 2C4FU 3PXLA 4LCCA 3F7KA 3Q43A 4R7NA 3ZSTA 1A5FH 1E5BA 2IANB 5SX4I 3VM7A 4J23A 3QEGH 3GJFK 4KDTC 4MCYB 3STZB 2VDKB 1KWKA 5DZLA 4Q9BA 4FMFA 4PJGA 5ADOL 5EIVA 4PS7A 4PRIB 4NZRL 3H7BB 5IJKC 1G7JA 1A9BB 2UZPA 4CBPA 4RMUA 5F1IB 3NQKA 1E2ZA 5E95B 2AKRB 4QNPE 1TIUA 1BJMA 4JFTA 3WHXA 1N7ML 1MRCH 1ZGLA 3DDGA 1NLBL 2W88A 1ZT4B 2FYVA 4KOCA 4P59L 1CL7I 2H1PH 1T80A 4TTDC 4HCIA 3KWUA 3RP1A 3O45B 3IVKB 3I9AA 1X44A 2J5LC 4JDVA 3HE7C 3VO0A 3Q2CA 5E1QA 4M4RA 3BIKA 4P0DA 4ELMF 5HHOA 4JHWH 5GSVA 3U2JA 1DLHA 3II3A 3TBSA 4G7RB 5G4MA 1NMCC 5HVHB 1Y1UA 4Q58C 4BH8A 3U2IA 4AGLA 3ESUF 2PN5A 4JFZL 1NGYA 1OAYL 3BISA 1X5MA 4NQQA 4HUVB 3EOYG 2WNWA 3RLSA 5A43C 5K5YA 3PJNA 3CSFA 4PW4A 3HCVB 1VIWA 3C8DA 4OBRA 2Z1PA 5FM5M 2Q3XA 4JRXB 4N2KA 5I9QC 2CKBL 1JDAA 6PAZA 3U79A 4K94L 1AZUA 1J8HB 4X6BA 1YY8B 1QYGL 1RFDH 3LNGA 4BH7A 3D07A 3DGDA 5AAWC 1J1PH 4ZUVB 4JZJA 2DLIA 1KF9B 1FVEA 2CXGA 3CHSA 1IFRA 3X13B 3SE8H 2CO6A 4BFRA 4TRPH 3TN0B 3I3DA 3WNJA 3P3TA 1INQA 1T22A 2R2BA 3N41B 3DYMA 5DZ9A 1ND0B 4LLVA 3D39D 2VMDA 3RL1A 2EDOA 4KC3B 4MJID 3HC0B 5DD0H 4YHYC 4S1DD 4X6EB 1MFUA 5FA3B 3LPFA 3VH8B 4LGRB 1FV1B 1IGIL 2JI1A 5ETUB 1TZ8A 5JZ7C 3MOBH 4GW4B 3MAWA 3MXWH 4JFEE 3HC4L 1FL3A 3FQNA 4ZFGL 2XZQL 4K73A 3GEFA 4C59B 4QO1B 5CJXA 1F56A 2QSCL 4NO5A 3SDAB 3ZRSA 5IJVA 3ZDZE 3GIZL 5I15H 4Y8DC 1P9MC 4XXCA 3V0DA 2Z93A 4Y9FA 1JHTB 4OGYH 3KCPA 4AYFB 3C60B 4HSCX 2EKJA 4KROB 1BIIA 1Z9NA 3N5AA 4L23A 5DJ6A 4OFPA 5DJ2A 5C08A 3SYCA 1HQRA 3ZGHA 3T9WA 2ZXBA 3QK0A 4DKFH 4AKQA 4X6DE 4KK5D 2VE6A 3W5NA 1EFXB 2OSWA 4WKXA 4KRPB 2CR6A 5HI5D 4P07A 5ITBL 4FXKB 2YRLA 5J9PB 3IKCA 3MFFA 4GBXB 3D3VB 3DUUA 4GRMB 2X4RA 3K72A 1MH5A 1CTNA 2X4PA 2PXYB 4GFTB 4RNRA 5LAPA 1BJ8A 2NY1C 1I3UA 4TNVF 4HU8A 1RVFL 3BJ91 5AW9B 1BMWA 1B4TA 1EQWA 3CC1A 4PJ8C 4RRPM 2RGSA 1XEDA 3S4SB 4FA7B 2P7TA 2OFQA 3AGVA 4GAGL 5IJCC 4CUCA 3FOMA 5IQ7H 4I9WE 5HPMB 2UY6A 2WUBL 2F15A 3EH3B 5KYXA 3IN2A 2WBJD 3FO9B 4HWBA 1U93A 3IFLH 4GAYA 2DWSA 4XN2A 3MRFA 1OAKH 1CTMA 4UTCA 1YMHB 1CG9A 4EI0A 4L05A 2FO4A 4H2CA 4ODXB 4UT7L 2KDGA 4ZW5A 2Z92B 4RRPG 4WGKA 5E6ZA 3SDDB 3A4AA 4CNIB 5I30L 3EJQA 5DVMA 1KTLA 4OIFA 2IQAB 2D3JA 1RURL 3V9CA 5CSGA 3GJFA 4WUUB 2AJSL 3MV9B 1J0KA 2JXMA 4TSAH 1MNUL 3GI9L 2L04A 3QORD 4PWJA 5JW4R 1IEAB 5FFLA 5HYIA 3OKMB 3DROB 4YDNA 5D72H 4XCNA 5FPIA 1F2XK 2OR9L 4ATTA 4QYOB 5C0AE 4UOZA 1E7VA 4AQAB 15C8L 1EO7A 5D1ZD 1DVYA 1C5BL 1T04A 1D9KA 1VJSA 2COQA 1JNHA 5ECJE 2XYCA 3A4DA 1TLKA 1EEYA 3BVNA 3L9RA 4RX4D 5GHWH 3RHWF 1I9IL 3E9UA 3GBMH 5ISZB 3EYFB 1HWHB 1CLZL 4C83B 2OX5B 3LMJL 1OCRB 4IOSD 5AKTA 2XX0A 3MROA 4U1MA 5ABAA 3RVTC 1OZTG 1I1AC 2DJSA 2JCCB 3GKWL 1K6QH 5KS9B 3BRDA 4NOBA 1UHVA 4HWBL 1R0AH 2AEQL 4YGAB 4PBVC 5I6XB 2DBLL 3OAWA 5KANI 2R39A 1Z66A 4NRYB 1NCUA 3RWCB 2DYPD 1JK9A 5FDWA 1BXXA 2YC1B 1FLRH 2ZCHH 3GXNA 2P9RA 3RKDC 3WMQA 1C12B 1PZAA 2Y1VA 1OK8A 3BKYL 4AVIA 1A6AA 4HWZB 4JG0H 3EOBA 4LCCC 3CVDA 2XCMC 4QTHA 3ISYA 3AW5A 1A14L 3LAFA 2N56A 1DBAL 4WFEE 4K94C 1T0OA 4EDWL 3QXDB 1S78C 1Z9SA 3P2BA 3MUY1 5CUSH 4PB9L 1NCAH 4NQVA 3FZUC 4NAJA 3QULA 4IBVA 3LZFH 2BSDA 1CURA 2EUVA 1OCZB 1UB5B 3QPXL 2P42B 3BQUA 1JXKA 5CKAA 4IOFD 1X5XA 5IESH 1MUJB 3OPZL 2HFTA 2IOMA 2N7SA 1YEHH 3UIYA 3TFKD 5IB1A 4RETB 1BZ7A 4NXSA 1IE4A 2PYEA 1YJDH 4OB5H 4PJCE 1LK2B 1JGVH 1VLXA 1CTOA 3WY1A 5INDB 2BNQD 1MAKA 5DLML 4ABUA 5T5FA 4MJ6B 1WLHA 3R0MA 5IVNA 5I1HL 1JHLL 3MN8A 4X6DA 5I8CB 4PJ5D 4QRPE 3T3PB 4R97B 1E5UI 5FW7A 1ZE3C 3GSWA 3VSUA 2ZE0A 1JFHA 4RISL 4JCWA 1KIPB 2J6EH 2GEQA 2OSLA 1W15A 2D03H 3E7JA 3KR3L 5FM5O 2YD9A 2X42A 2X12A 4XNUL 1OL0A 1IB5A 2W65A 2E3VA 4G5ZH 2X0WA 1NIFA 4S2SA 4G7VH 5DMKA 3U4EB 1KPUB 2UWEB 3FTXA 1KXQA 1OQOA 3AC0A 4WY7H 4JZJC 5HGAA 4MDJB 1Z9OA 3S5YA 3ZBMA 1RD6A 1SXNA 3AS2A 1A4KA 4B6ZA 1IQWH 4X4MA 5ACZA 4PLNC 3NZHH 4G6KH 1QRNB 3F12B 1YEEH 4H1LB 1SDDB 2WUCL 3CZFB 1KOAA 2Y72A 1S9WA 5AD0B 4KY2A 1F6AA 3L4YA 2NZIA 4HIPA 1ACCA 1SY6L 4H8WL 1AR1D 1NGZB 2ID5A 3R4RA 2NY3D 4NCDA 3N55A 1YEFL 4JBSA 4RRPA 5BS0A 5FYJH 3QHTC 3NN8B 5F1SA 5T5FL 1A3QA 1OLLA 1VFAA 1WIOA 5FYLH 2J21A 5EC2A 3OKYA 4ES9A 4PRPD 5IMLB 1ZSDA 1NCGA 5SWZB 5CJXC 5EZLB 1TQCB 1XXFC 5C0AA 2NQ3A 1AD9B 3G6JB 4M7KL 2EIEA 1ODUA 3EBAA 2YD2A 2TAAA 5D2NA 3HUJB 4HKXA 4Y7MA 1UM4L 3P11L 4N68A 5C07E 3HZYB 4JE0A 4D9QE 4ZTPL 3V7AG 5TE7L 5I18L 1UZ8A 5E8EB 4E36A 1GS8A 1F4YH 5E94B 5EO9B 1UD8A 2XTJD 1AAJA 1HKLL 3BGFB 2EDDA 1C08A 4MX7B 3WFBH 3FSAA 1GMIA 2JKWA 2EZ0D 1K8IB 4GYBA 2ZD0A 1C9SA 4WTZG 3CH1B 4LVOB 4APQC 5CP3H 3K8KA 1T0MB 3T5WA 2ZX7A 4MMXB 4LCYB 2WWMD 2BSEA 4L4VB 2VZUA 4AGQA 2R0LH 3K4ZA 2WLJA 1S9VA 1JCVA 4FQLL 3A24A 3FKUS 4WTQA 2FJHA 4XZUA 1VPOH 5IBLD 2GPZA 3CDCA 1XGZA 3GINA 3V5DA 4DPBX 4MNQA 3VGFA 5DWUL 1U8QA 5DK3A 3SDYH 1TMQA 4LASH 1CGUA 3EGXA 3O4LD 1KCBA 1T03L 3RWIA 3ILPB 2CIIB 1RZJH 4JB9L 4WDIB 2JB5H 3NPSB 2BFGA 3UTZB 1TTUA 1ORQA 4JY5H 1AH1A 5L2KA 4UUJB 2VB5A 4DEPB 3OKNA 3OXSA 1CD0A 2KZBA 4JL2A 3PABB 2VM4A 4YDLB 4NKIH 3MNVB 5AB0A 1HZHH 4GIOA 2DD8H 5DQJB 1ZLEA 1D9KC 1F3RB 3QCUH 2ICWB 4G1EB 1DUZA 4PJCA 2H0JA 5KBNC 4JZNA 2YARA 3H9SE 3U0PA 1G1CA 1KLFB 2EEFA 1CE1H 3GDBA 5JA8B 1HYRC 3EBHA 4BFJA 2BVQA 1URIA 4PLKD 5IK3A 3SDCB 3EYOA 4HS3A 5CJOH 4TM9A 3LQAL 2Q76B 1LNUB 3GGWA 5DK2B 3BUIA 1G7HA 4AX3A 2X70B 4G80A 1IVLA 1MCDA 4XPGL 4XVUC 4YZFF 3UAJD 2N4IA 5I8KH 4YFDB 3IDNA 3UGEA 1YC8A 1IARB 2LAAA 2VERA 3FN0H 3NTCH 4XWGH 2MWCA 2JIXB 4H88L 5FA4A 3N40P 2V2WA 4AQOA 4D0CB 4Z5RB 2Y5EA 2UX6A 3QUKA 3HI6H 1A6TA 3OMAB 1KLUB 5D93C 1DQQB 2VW7A 4NC1E 2DJ4A 1ZS8B 5TDNB 1TYJA 3T0EE 5G55A 4XPBH 5B7MA 4XCFH 1F8TH 3OWRA 5DHYB 3CXHJ 1OE1A 1MRDH 1OW0A 1QTYT 1MLBB 2H3KA 5GS2H 2PCXA 5KSAA 2ZPKH 2VXQA 3QGVA 3F7YB 1QLEL 5JDSA 1WV7T 3G5YB 3K4DA 3KBFA 3ATDA 3VXTB 3HJ0A 3VSTA 3O3DA 4Q6IC 5BV7L 4ONHA 2QSVA 1ZRUA 5T3XH 5HGDA 1XWVA 2X4OB 2HKHL 3BQUC 4MA3B 5FW8A 1ZLUK 1U92A 4O9HH 4B95C 3V4UH 5A2BA 1DQTA 2X4NB 2EDYA 3L5WA 2WNGA 4QOKD 2K6WA 3S37H 2XWEA 3ASWA 5AL8A 2HLEB 3MUHL 2BNRE 3PS6A 2BO0A 3RDTA 4L29A 3F6IA 3I84A 3X1BA 3S8FB 1P0SE 5DMGC 4H8WC 4C56E 3RY6A 3T3MB 2V8MA 1FFPB 3H42L 4W9LC 2ED8A 1T20B 1EZSA 1HXYB 5I73C 1ADQA 1EGJA 4X5WB 4N2MA 1QBMH 5I2IA 4QXGL 3UAFA 1SF5A 1ANUA 2G5UA 4HC1A 5DLLA 3HNSH 4P4KD 3D85D 3K8LA 3MOAL 4UYQA 3GMLA 3LXBA 5IROC 1QFOA 3LB6C 3QW9A 2UXTA 2AITA 4F33A 1HVXA 5J12B 3I6KA 2VCOA 3VJ6B 3OC5A 2W9EL 4OD3L 2P5WE 2HT4C 3ETSA 3HLKA 4PCSA 5SWQB 5EEUA 4EJ1C 2VXQL 5CILL 3BD5A 3LNHA 4D9LL 3G04B 3A6BH 1PG7X 3ZKMD 4F2MB 1M1SA 3X17A 3I2CL 2GSGA 3CQPA 3TVMD 3AWEA 1NAMH 3FMGH 5CN1A 3BD4A 5E0QA 3ZE0F 1G9ML 4D3CL 4NHCL 5DTFB 1BZOA 5IM7A 1JHKL 1HDMA 1KWGA 4DVRL 4YGVA 2I5YH 4NT6B 3QHFH 4NZUL 1UJTA 1SXAA 3QNZA 1MFBH 3VGGA 4JL1A 4WEBH 3U46A 5EBMB 5C0EA 3MRMB 5MP6H 4EQ2A 2B59A 2QZ5A 1EGJL 4R5XA 3VFUB 4WQOA 2BC4B 5JW4M 5KBKA 4LLMA 1J0JA 2EYRB 1KTBA 5EZOH 2P8MA 1BZ9A 4NQXA 3NIFF 2BVPB 2EYSA 2IDCA 4JZOB 2CK2A 4OCWH 4JAMA 1YEIH 3HG1E 3QFDB 4FABH 5MEND 5DQ9A 1ZKAA 5D2NC 4MAYB 3NJHA 3H9SA 4RBPK 4CMMB 1XD0A 4LOUD 3DOHA 3OJDB 5FLUA 4KUZL 5HDBF 1NAMB 1R17A 3MLXH 1T4KA 3GMPB 4X6CA 2VRQA 2DEWX 3AUVA 3BP6A 4Y5XA 5F0LB 3ENEA 5IMKB 5KZCB 1TNMA 3UC0L 2FIKB 1IAIL 4XP6H 2H1LM 1FZKB 4NENB 3OLGA 1JZ2A 4UU9B 4UDUB 4YFLI 5I0ZA 5LWYH 3EYSH 4UOW0 2BK8A 2P8LA 1BEYL 3FT1A 2VRAA 2HT3C 1HNFA 4OJDH 1ONQA 3G5VB 3MLTA 5SWSE 1KIRA 1CB4A 4LNRB 5DUBB 3KS0J 3NA9H 4NKMA 3QR0A 2H2PD 2YPKB 3H3BC 4Y16B 1FFOB 4FQCL 1OCWH 1W0VA 1L0PA 5B39B 1FP5A 1XDTT 4H25B 3QFJB 5DVNA 3FU9A 3GRWL 4Y89A 3UFIA 1LD9B 4WW1A 5L0QC 1KGWA 1I1FB 3KLHD 1BMGA 2M8XA 2QVTA 3UO1L 1FQ9C 1S9YA 2BY0A 3SDXE 5KBPA 4PGDA 5HGBA 2I25N 1RAMA 5BO1L 5DJCB 2V2XB 1GJWA 4NRZA 1NEUA 4I0KA 2KZ1B 3DXAA 3H3KA 3C8HA 2Q9OA 2A4EA 2Z35A 3K91A 3QPKA 1ES0B 4U0QB 5I5RA 3G08A 4Y4HA 2DQTH 2HVJB 5IGXL 1EMTH 5CGYC 2NTFB 3ULAB 4LDLB 4KJYB 5F9WB 4GQQA 3ZL4L 1OP4A 2BNRA 2WAQA 1WFOA 3PDOB 2VNCA 5I76B 4OIIH 3IGFA 1J1OL 1P4BH 2YAFA 3CZNA 4FL4B 3L08A 4KJPC 4BZ2H 4C56A 3FQRA 3MODL 3OXRA 3K6FA 3MUJA 4F7MB 4J8QA 5IVXE 1O9WA 4HT1L 2D7MA 2D2CC 4JDTH 3BWZA 4S1RL 4DO6A 1K8DA 4RAUA 1KG0A 1VENA 4DZBA 1MWAA 1UXWA 1L9QA 3P9LA 3PP4H 1K2DA 1RIVL 1MIML 4L3EB 4HLZG 2CBPA 3BUQA 3EIFA 3UP1A 4G9FD 1IM9A 2ZUQC 1Z0NA 2ZUUA 3RIKA 2QTEA 3UTPE 3V0JA 3I02B 3IJHB 5EPMA 3BHBB 5A7BA 4G59C 4PU2A 4OCMC 3PGFH 4OV5A 2FO8A 1EHAA 5F7NC 2QKSA 3QHZL 5TFSH 3TP4A 2YPLE 1LK3H 3NIDE 3B56A 3RVXC 4DGVL 5LBGA 4NO0B 5D7IB 3QEHA 4QXVA 2N1TE 1Q72H 2WSPA 4GG6F 3VXQA 3ARPA 3QR2A 3HZMA 4X9BA 2ERJB 1GAFH 2DYSB 3TOPA 1OW0C 2F74A 5KSAC 2E86A 1DQDH 5DHVH 4FA8A 3QIUB 3ZYOA 2HVBA 1M9SA 3KLSA 1KN4L 2IH9A 4R7DA 4YMPA 3GLDA 3I50H 4IS6A 5C86A 2IWEA 5C7XH 4XVJH 3W11D 1G9MC 1KUMA 3UYPB 3TC9A 1IL1B 1MY7A 1ZT7B 3DMMB 1USZA 4P3DB 4DJMA 2YAEA 2E4FA 3IJSB 2V5YA 3UTTB 1BP3B 4DFIA 3WS6A 1MEXH 4JN2B 3RDTC 1ZMYA 2VZSA 4MRBA 1DVFA 4O02A 2B8OT 4H7VA 2VLJB 3AS0A 5AOJA 2Q6WB 3K2UH 3MC0A 1TVBA 4L8CA 3FUNA 3HG1A 1OCCB 3RY6C 3ZTNL 3P3UA 1GGCH 5IMMA 4FC3E 3BKML 4NYLB 4QRUB 3VD7A 4DPAX 3P3SA 4MVBD 3L81A 2RCSL 4K7FA 1BIHA 2RHEA 4PG9B 1DANU 3FT2A 1PNCA 3BUDA 2VMJA 1HEZA 4JM0A 2YXMA 4FULA 1VADB 4LVHC 2Z7ZA 2ZOWA 1HSBA 3PREA 1OB0A 1T7XA 1ZAGA 3HLAB 1AXSB 1QWHA 1E3FA 1TJHH 3B3IB 4AXWA 5T33L 1CDYA 1C5CL 1E8ZA 5DHVB 3DO3A 1UXMA 4ONGL 1MFEH 3N43F 2R56L 5DUML 5C0ND 1H6FA 3L17A 5CN3A 1H6TA 5CZXC 2VUYA 2DI9A 1Z3GL 2C3VA 2GUYA 4GKZA 1G7IB 1OM9A 5JW3H 2KMWA 1IGTA 5SWSA 3O6KL 3T1WA 4N2AA 3OLEA 5EU5A 5E23A 1DCLA 2EXWC 3TBCA 4I3RH 4KVPA 3TJEL 5TDPA 3RAJL 2VR4A 1O5PA 3PQYA 4F8TA 4K5OA 4F27A 3FTYA 5I1IH 3WKMH 4M4PA 2F1BA 3ABGA 1KGYE 2ZOUA 3ZTCC 1OGAD 2FYYA 2WTRA 4UQBA 2PTTB 1O75A 2X6AA 3EOAB 4Z7VE 3WY2A 3I85A 1HI6A 3CDGB 1LDPL 2CE6A 4KMTL 4N0YH 4XMPH 5E5MA 3SDXA 2VDLH 1ESOA 4OFKA 4HJGA 1E0OB 3LEXA 4XNDA 1LVEA 4OKVB 1KZYA 4MYWB 4CVWA 5T1DH 5HGGS 4HJJL 3KPSE 4LSUL 3TO2B 4LCWD 3DHPA 4JO5A 1OAUL 4ZO8A 3U4AA 5KVGH 3D4ZA 1D5ZB 2VXUL 3QIBB 4MCZB 2XN9D 4NFDA 1ZIBA 2FECL 3FO2A 4I2XB 2NY5L 4FQXB 5T1KB 5HYFA 1YNLH 1CDIA 5IVXA 2FEDC 4IEFB 4G8FA 2CPCA 4IU2B 3S96B 1UD5A 1AO7E 3B6SA 3HJEA 2ZWLT 4Y5XC 4IK6A 3UCQA 4N4YB 1J5HA 3V5KA 3ECQA 4HP5A 3I74A 3IFOB 3VACA 5IP4A 4B9JA 5CGTA 4BXVA 3PIQA 3LS4L 4HHAA 3IFPA 3GXDA 3UPCA 4DP4X 4OZFA 5DJXB 5DD5L 1SN0A 2VDLB 5EA0L 3BZ4B 1VESA 2VH5L 3V0EA 3KPNA 5JR1L 1NKOA 1NIEA 3HC2A 1KNOB 4JX0A 1FRGL 4Z3IA 4JJHA 3RWEA 1NC2B 2YPLA 1YYMH 1DBML 2DQEL 2XRAL 3LNFA 2XVGA 4ONOA 3UO8B 1IKOP 2ZIDA 4N22A 4NC1C 4PJBF 4I1PA 3ZDYE 5AKSA 3LVTA 2OMBA 4JFFA 4HCFA 1CC3A 3TA3A 4EO5A 2X3BA 3EHBC 4IRZH 3QWOA 2D0FA 5DHEA 3HG2A 2CGRH 5L88H 3EDDA 2P5EE 1D5RA 2B3IA 3AM8A 1KJVB 3LN9A 2NXYD 4I0CC 3VFRA 5JOPE 4L2YA 4UANA 1YRKA 2CJUL 4KY1H 4LCUA 1ACYH 5I1DB 1YHPA 5DJZA 1DVTA 3WN5A 5K9KB 4GG6A 1JV5B 5GZNA 2FWOB 4Y4HC 1CGYA 1OP9A 1AGCB 3RWDA 3M45A 5IIEA 4J3WA 3MV11 4HXAH 1WP6A 1E4JA 1KB5B 5CJQL 3FN9A 4EN2A 2OS7A 1KY6A 4DGYH 3MLSH 5LN8A 5I74B 3OKOA 4XNAA 1WTLA 1K5NB 3STLA 1TKWB 1R5WA 3INUH 5GS1A 1F1AA 3CZLA 3NFPA 5F9OL 5I6NA 4IOIA 1S7TA 4N2BA 2VL5A 3T2OA 2QGDA 3P4OB 2R9HC 5FB8B 3GD1C 5C6PB