5I6KA

Crystal structure of copper nitrite reductase at 100k after 0.69 mgy
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
334
structure length
334
Chain Sequence
b'VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 94
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6kA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6kA02
1MZYA 2ZONA 4QKTA 1PNCA 4DP1X 4DP2X 2BO0A 5IY5B 2FT6A 3H4HA 2E86A 2PPFA 2YAHA 4HIPA 2XUWA 2DWTA 2MRYA 1AZRA 4NB7A 4DPBX 3X1FA 4E9SA 3UADA 4BDVA 1ASQA 3S3DB 3PPSA 1L9TA 2BP0A 3L45A 2BZ7A 2VW4A 3DIVA 1L9PA 4AI7A 2NRDA 3NJHA 1KV7A 1NZRA 1SHWA 2EIJB 1B3IA 1YLBB 3SQRA 5D4HA 1AS7A 1L9SA 1T5KA 1OE2A 4N4YB 2PPDA 3FS9A 3X1BA 3T71A 4G7SB 3QQXA 3HB3B 4F7KA 1JZFA 3PXLA 4M4RB 4UAHA 2H5UA 3EH4B 3CG8A 4JHUA 1BQKA 2AZAA 3DKHA 3NT0A 1AANA 3T6WA 1L9RA 1QNIA 2IDTA 4K9JA 4WTQA 3S3BB 1J9RA 1E67A 1NWPA 2VM3A 2XU9A 3FSVA 4KNTA 4UF7C 2CALA 1PZBA 4DP5X 3ZX1A 1ZDQA 3QJRB 2IDSA 3NP4A 3X1EA 4A2GA 3JT2A 4G70B 3MBWB 1E5YA 1ZV2A 5I6MA 1GYCA 3KW8A 3V9CA 1N68A 4AKQA 1V54B 1HAUA 2X87A 3AY2A 4NAJA 3FU8A 2IH8A 3ZIYA 2B08A 2AANA 3FSAA 4PAZA 2CCWA 1JZGA 4DPAX 3FU7B 2FTAA 4BXVA 2IH9A 4G72B 2XWZA 2YXVA 2YAOA 4HCIA 1NIAA 2P80D 4X4KA 2H3XC 1A4BA 4GP4B 1R1CA 3JTBA 1J9TA 1TEFA 4W9ZA 2X88A 3NJMA 4BK5C 1PNDA 2HLEB 1HAWA 4HCFA 1JERA 1IBZA 1A8ZA 3NSYA 3N2JA 3FYIB 3FU9A 4KO5A 1L9OA 3PAUA 1I53A 4KO6A 2EIKB 1AG0A 4FA7B 4N8UA 3FSWA 2AZUA 1JXDA 3WI9A 3X1NA 1KCWA 4G7QB 1J9QA 4KNSA 2J55A 1RZQA 2FQEA 3WNIA 1BYOA 2OCCB 2YAEA 1KGYE 2QPEB 3FPXA 1RCYA 1JVLA 4A66A 3SBRA 1ZIAA 1EHKB 1PF3A 5D4JA 1ASOA 2CBPA 2EIMB 1AOZA 1NIDA 3ABKB 2I7SA 2PLTA 1ILSA 4F2FA 2AFNA 4KNUA 1NIBA 2N0MA 5F7BA 1JOIA 2XV2A 1ASPA 5E9NA 1DYZA 3G5WA 3NYKA 6PAZA 4E9YA 3ASNB 4EF3A 2R7EB 3IBOA 3NP3A 3ABLB 1WA2X 1WAEA 1NWOA 4ZK8A 4YVUA 2UX7A 2FQDA 3T6XA 4DPCX 1ILUA 1NIFA 1AZNA 2Q5BA 2XYBA 2P80A 1PZCA 2BW5A 1FFTB 2LLNA 4CSPA 1PCSA 1ETJA 4P5RA 3X2QB 5B3SB 1W6LA 3KW7A 1DZ0A 2AVFA 1AAJA 1AS6A 4PCYA 3H4FA 3SBQA 3ZBMA 2FT7A 2GI0A 4FAAB 2VW6A 3ZDWA 3S3CB 1KDJA 4YSSA 4CSZA 2IWFA 1M56B 2FJSA 2A3TA 3QJQB 3FQYA 3AG1B 4YSTA 3CDZB 5FC9A 1SNRA 1XB8A 1A3ZA 3GYRA 4A67A 2I85A 1F56A 3OMIB 3NSCA 3H56A 3DTUB 3GDCA 2DWSA 1AIZA 3TBCA 5B1JA 4L0PB 1OCRB 5PAZA 2J56A 2HX9A 3NJNA 1A4AA 1BYPA 1RZPA 4F2EA 2WO2B 4BXSV 2I7OA 5B1JC 2YAQA 3QJTB 1W8EA 2BHFA 2CJ3A 2HRGA 2VMJA 2XLLA 5LDUA 5I26A 6PCYA 5B1KA 4YVNA 1OCCB 2YAFA 1GR7A 3FPYA 3S8FB 2RACA 5F7AA 2Y1AA 7PAZA 3NJGA 2GIMA 9PCYA 2YARA 3AZUA 2PP9A 5TK4A 1M9WA 1PLCA 4HALA 3WKPA 3IN2A 1GSKA 4QLWA 2PP8A 1E30A 5I6PA 4DP0X 1IC0A 2IWEA 2JKWA 3IN0A 2OJ1A 4E9XA 4A2FA 1SFHA 2MTAA 4BWTA 2BP8B 2QPDB 3NJLA 1VLXA 3EHBB 5ANHA 2IDQA 5B1AB 3AG2B 4UANA 1FA4A 3RYMA 4KO7A 1FWXA 2GSMB 1NTDA 4DP8X 1TEGA 1GY2A 1J5CA 2XX1A 1A65A 1JZJA 3UAEA 1NIEA 1SDDB 4GYBA 4E9WA 2FT8A 1BQRA 3WNJA 5AZUA 1ADWA 3AG4B 5PCYA 1X9RA 2HZHA 3FU7A 2DYRB 3MX0B 2HX7A 1OCOB 1L9QA 1MDAA 1SF5A 5I5IA 1M57B 3CVCA 4WKXA 1NPJA 3NSFA 2UXGA 2WO3B 1IKOP 1KDIA 4JKNA 3N55A 1ET5A 1NICA 2FNWA 3NJIA 1GY1A 1RKRA 4YSDA 1BXUA 4GXFA 4DP7X 4NERA 4TXVB 3CVBA 4A68A 3FSZA 1OF0A 3OMAB 2DY2A 7PCYA 2HX8A 4GP5B 3NSDA 1BQ5A 2PP7A 1CYWA 1BEXA 2XXGA 3WG7B 4BDVB 4YSRA 2BP0B 4AZUA 1XB6A 2YAPA 1JVOA 3NJKA 1AR1B 1XB3A 4YSAA 2GC4C 1NPNA 1OV8A 4AKOA 2XX0A 4BWUA 4G7RB 3BQVA 1KBWA 2ZOOA 1BXAA 1GS7A 4YL4A 4A2HA 4YSOA 3U25A 1MG2C 5I5JA 1AACA 1XMEB 3OM3B 4GY4A 4A2DA 2JXMA 2XVBA 3EF4A 3FYEB 1JZEA 2FWLB 3OMNB 3D12B 2R7EA 1JZHA 3ABGA 2GB2A 1WA1X 2YXWA 1PLBA 1W6WA 1ET8A 4G71B 4E9QA 3BVDB 2IDUA 2BWIA 2GBAA 2VM4A 1OCZB 1PY0A 2EINB 3C75A 3GXUB 5TK2A 1CC3A 2BWDA 3OD3A 3PAVA 3NJFA 5I5MA 1NINA 3CVDA 4HAKA 1PMYA 2QDWA 1OE1A 4HHGA 1ET7A 4DP6X 2Y69B 3ABMB 1PLAA 2J57A 4RH4A 2GHZA 1ZIBA 1AS8A 3NJJA 3TA4D 5I6OA 1N70A 2VSMB 2XV3A 3TBBA 1CUOA 1SHXA 2PCYA 3CZUB 3CDZA 1URIA 2ZXWB 3AW5A 4E9VA 5A7EA 3TU6A 3T6VA 2UXVA 2W8CA 1SFDA 2HRHA 5EHFA 5B7EA 4DP4X 3T6ZA 2TSBA 5B7FA 1JXFA 1MG3C 1WS8A 1QLEB 4E9RA 5B1BB 4DP9X 3V9EA 4BWWA 5I6LA 3WIAA 3FQ1A 2IWKA 1AQ8A 3UAAA 1X9UA 1AZUA 1KYAA 2DYSB 4P5SA 2HXAA 2PPAA 3ASOB 5AKRA 5I28A 2VSKB 3FT0A 4KOCA 1KCBA 2OV0A 3AG3B 2CAKA 2UXTA 1WA0X 4KOBA 1PAZA 5AFAA 2TSAA 3EH5B 1IUZA 1NDTA 3IEAA 3TASA 4KO9A 2XV0A 3PCYA 3QPKA 3UACA 1V55B 8PAZA 3FQ2A 2UXFA 1ZPUA 4W1TA 3S8GB 1JZIA 2IDFA 3UGEA 3PLYA 2YQBA 1AZBA 3QJSB 1OOWA 2FQFA 2PCFA 4Q89A 1WS7A 2GC7C 1QHQA 1E65A 3HEIB 4YSPA 2BP8A 2CUAA 1GS6X 3WKQA 1UATA 1AZCA 1AG6A 1SF3A 1GW0A 1HFUA 3T9WA 4ENZA 2QT6A 1KBVA 1GS8A 1A4CA 3QJVB 1J9SA 1TKWA 2ZWNA 4HHWA 4HZ1A 3ERXA 1EZLA 5D4IA 1V10A 5I6NA 1SJMA 3UABA 4E9TA 4Q8BA 2DV6A 2W88A 4M3HA 4MFHA 2Q9OA 1J5DA 1SDDA 4YSEA 1IBYA 2JFCA 3OQRA 3EH3B 2BW4A 5B7MA 1MZZA 4YSQA 3PAZA 2YAMA 1CURA 1ZDSA 2VW7A 2UX6A 2FQGA 3X1GA 3IE9A 5I6KA 4A2EA 4AKPA 3QJUB 2VN3A 4YSCA 1BAWA 4GP8B 2J5WA 3SBPA 4JHVA 1TU2A 2PPEA 2QDVA 4YSUA 1CYXA 1OE3A 2EILB 1JXGA 2IAAC 2XXFA 4AX3A 2BZCA 2PPCA 2WSDA 1E5ZA 1PZAA 2H47C 1ID2A 4HCGA 2B3IA 1BXVA
chains in the Genus database with same CATH superfamily
5DHVH 1MZYA 2OP4H 3TIEB 5JR1H 4FQJL 4DP2X 4XXCC 1WV7T 4GS7B 3H4HA 4WJ5B 1AMYA 1T83A 2J6EH 4F7PA 4XWOC 1OAZL 1MWOA 4MAUL 4XHQA 5D7JA 4U1HB 4QDGA 1QSZA 1UM5L 1JN6A 3ZTJG 5CD5D 3HC4H 3TBVA 1B2YA 1YEJL 6CGTA 2GSIB 3UYOD 2X89A 3RB5A 2E4FA 1IGTA 3ULUD 3B2VL 3JWNE 3LEXB 2AEQL 1FNEB 5FDWB 4N4YB 4XMWA 5ABAA 2PPDA 3X1BA 5LBSA 5L2KB 4G7SB 3QQXA 4Y1TA 4YMPA 5G2NA 5EOQH 4G8GD 4LL4A 3KYNA 4N8VG 5D9SB 4HIQA 4POZC 1JI1A 1WD9A 3CXHJ 1HX0A 1KELH 4N87A 4YBLC 3U7AA 1F2QA 4G9FA 1H3WM 3S3BB 2YD3A 1QTPA 2BVTA 3MLWH 4NPJA 2ZKWA 3FSVA 3KPSD 3WAKA 3WTSA 1RHHA 1OSPL 4ZUTB 2FWOA 4A2GA 3GKWH 1E5YA 3D3VB 3C5SB 3F2LA 3VXSE 2BS9A 2IOIA 3KYMA 3BPOB 4PJFA 4JZJB 2XXCB 8CGTA 1ZPLA 5L8JB 1BZ9B 2WAQA 3QO1B 4YHKH 4K2UH 4LLAA 4FFZH 3S3JA 2AANA 2HT3D 3BRFA 5HGDB 1U4EA 1QABA 1YEKH 1H6TA 3L1FA 4MJ6A 4P07A 3L3KA 3UX9B 3T0EE 4WHYG 3GSXB 3UPRA 4F8OA 4JG0L 1QWHA 3JV6A 3W57A 4O4YH 1XF3B 3BAYA 5J13B 4ELMB 3NEXA 1MCQA 4XTRD 1XTMA 3DX8B 1G7JA 4YHNA 3CLFH 4W9ZA 5GGTL 2WYHA 5FM5M 3RNKB 1A3RL 4IEFB 3SGKC 1S46A 3DJRA 4UM9D 2ZX7A 1OTTD 2BNRB 4YDMA 1X5GA 4GKNB 3VRLE 4P59L 4MAYD 2H3KA 4XI5C 1RUKL 2G60H 4ZI8A 1FO0L 3ZZLA 4B9YA 4Z7OF 3QIUB 4KUCD 2NR6C 4NN5C 2KQNA 3MRGA 4N1EA 2P45B 4N5EC 3RX7A 4B3VA 4HK0B 4CJ0A 4N26A 3OZ9H 5EBWB 1VAHA 3BEVA 3AQYA 3G6JF 4OSUL 2J55A 4PS8A 1C16B 4GSUA 4GSDL 1BM3L 2SEBB 4U3SB 4HHAB 5FUCE 5BVPL 1G94A 3GO1H 4GRWF 1TJXA 3ZDXB 4DZ8B 4DIXA 4X6DA 5DK2A 1Q9WB 2F53E 3ABKB 5FYLE 4PJ7E 4Z78B 2CO3A 1T5WA 3LJ3A 3ZKXC 1FI8C 1KF9B 2VLRA 2OFQA 2W0FA 1OLZA 2WV3A 3MCYA 4GW5B 4JPWH 5DD3H 1IGJA 3PDOB 4Z7QF 1EGJA 5T5FL 4WY7L 5D1QB 2F1BA 2PETA 2O4EA 3N1QC 1NFAA 3UEQA 1CYGA 2EDQA 2BW5A 1NEZA 2VXSL 4B9PA 1KLUB 4OGXH 4DGIH 1UOLA 2JE8A 5DMKB 5HPOA 1D5ZA 5LBSL 2E9IA 3QWOA 4EI5C 4HLZH 2WQRA 2Z64C 3E6HB 1OCWL 3QUKB 1RL1A 2JLPA 2CO6A 2IWFA 1E3FA 1PEZA 3HE7C 1GOHA 1V7ML 4W68A 2QPSA 4GQQA 5F1IA 4JKLA 2R9HD 2JWYA 2A1WH 4ZTOH 4OFYD 1R5VA 4ZFOB 3KNBA 1T22A 5BS0B 4GBXD 1Z9OA 4IS6B 4BM7A 3UG5A 5D96C 3REWA 1CLVA 5CN2A 3A4EA 4MNGE 5J1TC 4LLDA 3TS8A 1MW3A 3QNYB 3B2UC 3QRLA 1OCRB 3OLDA 2BNQB 3MN8A 3VFNA 2EDDA 3PV6B 1AHWB 4I3SH 3KGRA 1ESOA 4JFDB 4QRBA 5F7EL 1UXSB 3VD5A 5T8IA 1C7TA 4MXWH 3TIEA 4MMXB 2WAHA 3S34H 1U8NB 4WJ5A 2I7OA 4PB9L 5IJBC 2K8QA 5TQ0L 3WXWL 1IB5A 3OLGA 2E8YA 1F3DJ 4R4FH 5ID1A 4U1HA 1DQMH 1KIRA 3B9VA 3AMLA 1EDYA 2OXHA 2VM9A 4AY0A 1GR7A 2Y22A 4AGQA 1NCWH 3ZHDA 2I25N 5F7AA 2GSIA 5EEXA 3NJGA 3OHXC 5FGBC 2NY4B 5HDBF 4X7TB 2PP9A 4XN1A 2OZ4H 3LEXA 3SJVE 1ACCA 3D30A 1FNEA 5FDWA 2NCMA 2W95A 5L2KA 1LYQA 2EAEA 3T3MF 4U4IA 3BDYL 4F8QA 4C55A 1PLGH 5D9SA 4L1HA 5BO1H 2G2NA 3RKDC 1NGXB 1S6NA 4P8QA 4M5SA 3X13B 3HZKB 4FQHB 4LHJB 4AV0A 2BVUA 3QB7C 4BE5A 2B9AA 5J0BA 2RHEA 5AL8A 4KXCA 1UB6B 3I2CL 4NI3A 4EDXA 3V4UL 3C5SA 3HRZC 4KGJA 1F8TL 4A7SA 1OTUD 2DMHA 1BZ9A 3TFKC 3QO1A 3VD2A 4DWHA 1BQRA 4S1QH 3VSVA 2WWNA 4HJEA 1E40A 2Q86B 1MCOL 4NUGL 5HGDA 2RH0A 4RGND 2AK4E 2VNCA 4TSCL 1OZTG 3GBLA 4EUPA 5FECB 3CLEH 3GSXA 2K8MA 4P2CG 1T7WA 1JTTA 3V4LA 1W91A 2BVQB 3QCVH 5E1QA 1JF6A 2AMUA 2XQBH 3B56A 1YEGH 4AQ1B 5AOZA 3TT1L 3V6BR 1EGJL 1XF3A 2VLJD 3I6LE 4JHAH 4BIKA 4ELMA 1E6JL 2WO3B 4UU9B 4YDKH 1IKOP 2GPZA 1OD9A 1XCQB 3VXSB 2DYPB 3DX8A 3LQMA 4LLYB 2ZOUA 3GJFK 3RNKA 5EG6C 2WGXA 4IEFA 4FMFA 5C1MB 1USQA 5GXBB 2ORBH 5AB9A 1EJ6A 1B3JA 1RKRA 4WI4A 2FBJL 4IDJL 4OM1H 1PJWA 2IBBA 3IJEB 4A68A 1IBDA 5DT1H 2CRZA 4FJYA 3GEWB 3OMAB 3AUWB 5K39B 1G0DA 2EJ1A 2XN0A 3IDMB 4MZIA 5D7EA 3T0EB 4Y4HA 4LVNB 3KLHC 3T3PF 3L4CA 2FX8L 3WG7B 1A1MB 3QIUA 5CF3A 4WI8A 3TC9A 1U2CA 5IB1B 4LT7A 1UA7A 3JWOC 4HK0A 4RMWA 2PNDA 1OV8A 3BP5A 5HHOD 2D0FA 2N7SA 5EBWA 2AXGB 4KRPD 3IDJB 3COOA 1A66A 2PWFA 3P4NB 3KLKA 1C16A 5DQJB 3CK0H 1M1XA 3KPRE 2F8IA 2SEBA 1H8OA 5SWZE 4HHAA 4E0RB 5IGXL 3D08A 2O5YL 2DH2A 4D7BA 2ZKMX 1SLXA 1JHKH 3JWOH 4DZ8A 4M7LL 1Q9WA 4HX1B 2ZP9A 4X7EC 5FYKH 3IFLH 4DO6A 3RZCD 2E7HA 4Z78A 4R4BB 1PPIA 5H35B 3ECUA 1HYRC 4I5BB 4WCYL 3SCMC 1EFXB 4AQ8A 4PLJD 2WWMD 5AVZB 3FB5A 3D12B 3D0VB 4GW5A 3PDOA 1PLBA 4WW2C 4E9QA 3KLQA 4NM8L 5D1QA 2RA1A 3FZUC 3RTQC 5I66B 1GL4B 3OD3A 4KKBC 4EIZC 4OI9A 1IZJA 3CVDA 2OL3B 3WDJA 3A6BL 1KLUA 3B9KD 1E8ZA 5DMKA 4DQOL 3WKMH 1S7VB 2P24B 3ABMB 1KPRB 2F53B 1OWWA 2ZQKA 1B0RB 5CO1A 3E6HA 2M83A 3QUKA 2AAAA 4IGBB 1XIWD 3LB6C 4HBQA 4YZFE 1OP3H 5CD3B 2PCYA 3NABL 3OL2A 3BIKB 4P3WA 5MI0B 3RVUC 3AXHA 1PD0A 4E9VA 5BS0A 1G6RB 1K9TA 3H9SD 3KG5A 4IS6A 3V79C 5ISZD 5DWUL 2NDFA 4PJCF 3QNYA 4LVOC 5F6HJ 4NZJA 4NPYB 2BNQA 3PV6A 2HT4C 2ZUVA 4JFDA 3EGXB 4M03A 4PJIF 1UXSA 5I8OH 5IMKB 4FTVD 1MF2L 4ZFGH 1INEL 4MMXA 4FRWA 2AQQA 2ZG2A 3KLSA 1U8NA 2E6PA 5LO7A 1I7UB 4MAUH 4ABUA 3ATEA 3G04B 4KOCA 4DO5A 5D72L 5DQ9B 2DKSA 4GIPD 4ZMOA 4LAJH 3IGAB 3II1A 4MNGB 3F7PC 5T3XH 3FB8B 1WUZA 5CJXC 2X2HA 5I5RA 2XZZA 5I19H 4X7TA 5LGHL 2AEQH 2XBDA 5EOCJ 2L04A 3WHXB 3DXAE 3C9NB 4HIXL 4RA3A 3DV6B 3LPPA 1Z3GL 1OKEA 4J3WA 3B9DA 4WO4C 2CRYA 3GXDA 2H32H 2IALB 5D7IF 3GNMH 2WXOA 5AKVA 3HOGA 5C0ND 3SQOL 3RILA 4JRYA 3STZB 3SY0B 4HUVB 1AZCA 2UY6B 4NLHA 4Y8AA 5C07D 3V52H 5CJQL 5EORL 3X13A 2YA2A 2YPVA 4JGUA 1FYTD 3HZKA 4FQHA 1BVOA 1OSPH 4I0CC 1KJ2B 3SJVB 2ENQA 4Y9EA 1WQVT 1UB6A 4UCFA 2EABA 4PREB 1AGCB 2W88A 1SQMA 3EHBC 1G4RA 3W2DL 2BP3A 2AF2A 3DYOA 2Q86A 1EEYB 3ASWA 1UWGL 3TO2A 4G80B 3EJZC 3S3PA 5J1AB 3PGFL 5FECA 1H6EA 4JG0H 4JRFA 3RFZC 2BVQA 4AQ1A 3STBA 1T2JA 2OSWA 3TOPA 4UU9A 2W65B 1FUNA 3NCCB 1AOHA 5HDLA 2GTZB 1XCQA 1SM3H 3AITA 3I6KB 2DYPA 4FFWC 4LLYA 4O2FA 3VXSA 5JPNC 1TTGA 4JRXE 3R0MA 1L4IA 5BZXA 2AVGA 2V5TA 4N9OB 4A7QA 1B0IA 3R4DA 3TCTA 4P59H 1A22B 3IJEA 3Q6GL 4WRLA 1PNCA 5K39A 3GSNB 2JCCF 1VGKB 1DQLL 1Z9PA 2AK4B 2FT6A 5GZND 3IDMA 1RUKH 4PGJA 1DBML 2OCFD 3T0EA 3CFQA 2Y24A 4JFVA 1FO0H 25C8H 2WKOF 1E27B 2DLIA 4O9HL 5HP5A 4E9SA 4J7RA 4XPTL 1A1MA 4XH2B 3B2DC 1JK9B 4Y4KB 2CCLA 4ZFOL 1UH3A 4HT1L 2RAMA 1Q0XL 2QSCL 5MEOB 5IB1A 4B0MB 3QUXB 1UKSA 2AXGA 1T83C 4ZZFA 1BM3H 5FUOL 2VWEE 3P4NA 5D4QA 5DQJA 5BOJA 2HH0L 3EOYG 5D7JC 1LLAA 1WWWX 3J27A 5ECGA 1AKPA 2MIZA 3HB3B 3RL2A 2BDNL 4HX1A 1T80A 4FYRA 2Q7YA 2IJ0C 2EE6A 5LWYH 4R4BA 5H35A 5F9OL 4WUKH 2KL6A 4I5BA 2EIDA 1EFXA 3GI9L 3AU1B 3VTTA 4E41E 3D0VA 5T5FH 4K9JA 5FM4A 4BD4A 3LSOB 1E67A 2PTUA 1KN2L 1G4MA 2NQDA 4XNUL 2CALA 3CVIH 3CFUA 5I66A 3NCJL 4QXTB 4Y5VB 2H0PA 3BVVA 4FNUA 3KPRB 4G70B 5SWZB 1PFCA 2YD1A 2OL3A 1KSRA 1LP9B 2A6IB 1AFVH 5EU4B 5LBSH 1S7VA 5DHMC 5GS2H 2P24A 1KPRA 2F5BL 4JO5A 4JANB 1WE5A 1XDTT 2F53A 3J7HA 5D7KE 5JLZB 1RUPL 2HLFC 3RVWD 4ZQTA 4OZIE 3OKKB 4M8QB 5CD3A 4PWGA 4Q7DA 2ZXDA 3BIKA 2XWZA 1E3ZA 3IVKB 3CHRA 4X4KA 1JDAA 2YPVL 3LD8C 3FO9B 5C8JB 2H1PL 2WD0A 4YDLB 1SEBB 1EO8L 3ZTDC 4NPYA 2WYIA 1A4JB 4S0SD 1XH2A 5AVWB 5IMKA 2Y36H 4Z7UE 1NCTA 4UUJB 2YPLE 1YEDB 1D7FA 4XNAA 4JW3A 4PB9H 4XWGL 3BMWA 4RMQA 3NCFB 4PRIE 5FO9B 1ETZB 5LNEA 4HW6A 3WE6B 2VZ1A 1I7UA 4BHUI 3G04A 4P23D 1AGBB 5DQ9A 4K7PY 4F92B 2XZCH 3ARQA 1E0OB 4FLRA 2FBRA 2VAJA 4MNGA 4S1DC 1Q8MA 3FB8A 3X1NA 1XAKA 4UZSA 3ESMA 3HFML 2HLAB 1MCDA 4XO5A 4RVBA 2WZPD 5C0RL 2ZG3A 2MNJB 1EAPB 2FQEA 3WHXA 3C9NA 1W15A 3DV6A 1LO0H 3M17B 1ZK5A 4LCIH 2NYYC 3QORD 1N26A 5DLMH 5T5NG 2IALA 2NSXA 4UAOB 2PLTA 3ECBB 5HHPA 5EEVA 1C12B 3CUPB 1JRHL 3MUY1 3SY0A 4HUVA 2LU4A 4IBVA 3QIBD 1UM6H 5FWQA 3BI9X 3S5LG 4H26B 2VQUA 3MA7B 3DLQR 4KI5F 1WWAX 1DJZA 3PY9A 1NWOA 4PRAA 4Z7VF 5EBLA 5C2BL 1KJ2A 2YD8A 2G3XA 3DXAB 1EMTH 2XYBA 2P80A 1NUGA 1AGCA 1FFTB 1URZA 4PREA 3ISWA 4UDUB 4OLZH 3MZGB 4PIRF 3H4FA 2I9LB 4FAAB 4QMEA 3EOBB 1EEYA 4YSSA 4B41A 2YEZB 4AUYA 3ULUE 4G80A 4HIJB 5J1AA 4P5MB 3WFZA 5ABDE 4DK3A 2J5LC 2B1HL 3IMRA 1JPSL 3S3SA 1A3ZA 4A67A 2R0LH 2EVIA 1EGJH 4OJDH 3UO8B 4G8GE 4YFLF 2W65A 2HFFB 2GTZA 3WNPA 2ZCLL 5F3HA 3I6KA 1CI3M 5HI4D 1J87A 3IDYB 3FOLB 3M88A 3QAZC 4QXVA 5JMOC 4CAGA 2OL3L 3S5ZA 1B0GB 1UEMA 2FBJH 1T66D 3R06B 3WGVB 4IDJH 4JL2A 4ELDA 3KPSE 1BDYA 3OAUH 5JA8B 1OY3B 3NDZE 1VGKA 2AK4A 1MCWM 4CSSA 1UGNA 5A2FA 1QHPA 4LLWB 1F6FB 1M9SA 1UJTA 4KBPA 3U4EB 1EQWA 1U30A 4HULB 1E27A 1FG2B 2HSIA 4XH2A 1JK9A 1T2QL 4Y4KA 4YX2H 5I9QB 4NAMA 3FPYA 1OB0A 1G6RL 5MEOA 4KZEL 1MI5B 3MJWA 4CDHA 3QUXA 4PV1C 4GS7C 5G4OA 3HR5B 4ES8A 3S88H 3BP7B 1FBIL 3Q2NA 3V0AC 3HKFA 2MPVA 4LP8A 1GA2A 1U3HA 4XPBL 4RIRB 2FATH 2AEIT 1I3GL 4XXWA 4P2RD 3OKNB 1J8RA 2YMOA 3VW3L 3GZPA 5HDQH 4M7LH 1BOYA 2NY1B 3VH8B 2OMYB 4KDTA 1OTSC 2EDKA 4I13B 1SFHA 5HY9B 1CU4L 3HG0A 1RZKL 4YE0A 5AZEH 3QCUL 2OW7A 4ZPVB 1F1DA 3AU1A 1UD8A 35C8L 4WGKA 4IBWA 4NM8H 4KH2A 3LSOA 4AVKA 1ZAGA 1QBLL 4FP8L 5JOEA 1U3JA 2VUOA 3I02B 3OR7B 4JM2B 3L5WB 3QUHA 4QXTA 3NSXA 4Y5VA 2L7UA 3LMJL 4X42A 5CIPB 5SWZA 3FU3A 3A6BH 3SDAB 1J5CA 1A65A 4NXKA 4DQOH 5DK0B 1PKQE 1AZVA 1LP9A 1SDDB 2A6IA 3ZQWA 5EU4A 5KBPA 4PJEB 4ZO9A 3N44B 2BY3A 1GGCL 2UZIL 4JANA 4YK4B 4OGZA 5IW1A 3WTUA 2R83A 1ADWA 2HKHH 2LW3A 5T33L 4ZPTB 4I8DA 3NABH 4MA8L 2Z65C 3OKKA 4M8QA 3REVB 2H3NB 1YQ2A 4I77L 1E5AA 3BPOC 4JZJC 4E41B 1YJDL 3L5HA 5HJ3B 4G6KL 4U3XA 3IVKA 1MJ7L 3DMMD 2BVYA 1QUNB 1NPJA 3FO9A 1KYOK 4G43B 1L7TH 3PP3H 5KYYB 2Y3AA 5C8JA 2NNRA 3WNKA 1KJ2L 2X40A 3CHXA 1HL8A 1KFAL 1SEBA 3LN5B 5E2VH 1A4JA 5B3JE 4IU2B 1FZJA 2A74B 3K74B 5J13C 2Y7QB 3DX0A 3FSZA 3BUQA 1YEDA 3QJXA 4HXAL 4UUJA 1NGPH 4OZIB 5IMOA 4OIAA 2A77L 4TTDD 3DJSA 3G6AB 1ETZA 4LSSH 3WE6A 1U8OB 4UQEA 3MR9B 1LDSA 3PIQB 1AGBA 4AUJA 4G9DB 1UWFA 3MCG1 2XVGA 1R19A 4U1LB 4LEXL 4AGNA 4EJ1C 1JGEB 1NPNA 5IESL 5DD1L 1RZJL 1OWRM 2HLAA 4BWUA 4Z3TA 1Q1JH 2WBKA 2J4WH 3P3RA 4Z3JA 1EAPA 1EV2E 4WSKA 2WQAA 2HJKB 3H85A 1BXAA 1EHNA 3QIUC 1JG9A 2G0LA 2YPLB 2HPTA 3M17A 5H4ZA 2NSQA 4XO3A 1WRFA 3GSNL 2OYKA 4BA0A 3QEGL 5AQ0A 43CAA 4N2NA 3ECBA 4BQ9A 3SQOH 2EVFA 2FLBT 1JGUH 5CSZB 1C12A 3CUPA 5CJQH 1S4IA 4QRRD 5DUJA 4Z95H 3DARA 3KJ6L 3BVDB 3QR2A 3MA7A 1QP1A 3MC0A 3F04A 3FFOA 2ZNXA 1RZGB 5D1XA 1OXYA 2QADB 3ULVE 2NNCA 3DXAA 3MLUL 4AQ8C 2BVEA 4UDUA 4Z3EA 3W2DH 4DETA 4HG4J 1ZIBA 5IQOA 2I9LA 4A04A 5D1QC 3HHMA 3EOBA 4NOBA 1KNOB 2YEZA 3PGFH 3MGOB 4HIJA 1PZSA 3CZUB 4MJHA 4PGDA 2APWA 1ZVYA 5IQ9B 3IXTB 4KKNA 1F6AA 2FO4B 2V6HA 4J27A 4RMVA 3BGFB 5B7EA 1K72A 2HFFA 1K8IB 3FOLA 2UYLB 1MVUB 5I6LA 3FQ1A 1B0GA 3R06A 1D7BA 3QDJD 2DICA 5GIRB 1I82A 3GF8A 4HAFA 5CZVL 1FDLL 3ASOB 5D8JL 1NMCB 1SJXA 4NWUL 4FTDA 3DJ9A 1S3KL 5CUSH 5C08D 3C2AL 4WK2B 4LLWA 5C0BD 3U4EA 4O9HH 4AITA 2EUZA 4XPTH 3TO4D 1I1YB 1E9QB 3QG7H 1AHWC 1ZGLM 2DMBA 4HT1H 1KCUL 1Q0XH 2QSCH 4AEHH 4NZTL 3APDA 3F83A 3OGOE 5I17B 4G8GB 1J7VR 3B2MA 4RGNE 1II4E 3BSHA 1MI5A 4MMXC 1MQKL 5K9OB 3HR5A 4KK6D 4KO9A 3BP7A 3V0VB 5I1EL 3WTVA 4I18A 5JPMB 3K7UA 3KPSB 1Y6KR 4RIRA 1P7QA 3OKNA 1WEJL 2VLJE 4I0KA 3EG9B 4XVTL 3C6EA 5AAWC 3VH8A 4B9ZA 2LVEA 1AR1D 4TM9A 1E65A 5CJOL 5I1GL 3EDFA 5HY9A 4M6OH 3GI9H 5CBEB 3WKQA 3ZE0E 1GJUA 3NIGB 4ZPVA 2AJSH 4X5PA 3OB0K 1Z9LA 3FRPG 3NCJH 5DMIL 2JQAA 3QJVB 2AXWA 3DETC 3I02A 1F1AA 3OR7A 1CFMA 4JM2A 3L5WA 5CIPA 1M7UA 2GUOB 3U2JA 1SJMA 4E9TA 1A6AB 3SDAA 4ERSL 5C6WH 4MFHA 4R7DB 1SDDA 4XP5H 3FL7A 4HDIB 3EUDA 3OQRA 4PJEA 4ZS7L 5HHOE 2YAMA 3L4WA 1ZDSA 2VW7A 4ZPTA 4X6CE 3JWNC 3A23A 4AKPA 4UM9B 2Q2EB 4WWPA 4Z7WA 5AYTA 2H3NA 3LHAA 3REVA 3ULAB 3IFPB 5I1IH 3MLVL 4LKCA 4E41A 5HJ3A 4HOXA 2YPVH 3ET9F 4MAYB 4N22A 1CZ8H 4HIIB 4FNRA 1T7YA 3FBKA 1QUNA 3JWDL 5BUAA 4KTDH 1X3DA 4G43A 1FLTX 5KYYA 2XPZA 2FSEB 3NFNB 1EO8H 1F90H 5FF6B 2PPCA 3LN5A 1XGYL 4PG9B 3VX0A 1PZAA 3QI9D 3R1GL 4FQXB 1N0XH 4IU2A 4FQ2H 4AQ1C 2FYVA 2BY2A 1HIMH 3V6ZB 3MACH 4LCCB 4X4MA 2Y7QA 4XWGH 4OZIA 3OF6A 1J12A 3MV7B 2YRPA 3G6AA 2H6UA 3CSYB 1KGJA 1U8OA 2WNKA 2V3EA 3CZEA 3MR9A 5EZIL 3PIQA 4TL5A 1KACB 3ZKMC 1XBRA 3KBFA 3K6SB 5JOFA 4G9DA 2XFGB 1T0PB 1UZ8B 4A7TA 1UD3A 4U1LA 2EEBA 1IVTA 1AXSB 1YC7A 3NJHA 1K5NB 1KV7A 3EJJX 4LL1A 4OJFL 5LCVA 2EO7A 2IGTA 3T0EC 1TYEB 1NGQL 5TE6L 2H0EA 1AS7A 1X7QB 2HJKA 2JQMA 1ZTMA 3QXTA 3H9SE 2YPLA 3QC6X 3CQPA 4WV1C 2G3ZA 3DPDA 4ETQB 5ISZE 2UVFA 4CNIB 4GG6F 1GGBL 5CSZA 1FE8L 1NLDL 2WUCL 1XBDA 4JHUA 4KKZA 2JJTC 1AANA 1TCMA 1MH5B 2X09A 4RMUA 5A2IH 4FJZA 3EBIA 4FTVE 4UTCA 1N5AB 4JJ5B 5DHYA 2V7NB 2H2PC 4PSRA 5KUMA 3VQ2C 2I07B 2P42B 3F05A 5FUZH 2F61A 3MV9B 1RZGA 4EZMA 2O72A 5LQBL 4TNGA 2CPCA 1TZHA 1KEML 3QUYB 4N3TA 4GBXB 2D9CA 3K4DA 5I0DA 4EO5A 1LEGB 2WQ8A 1Z0MA 2HFGL 2IH8A 3WDIA 4F2ME 2O6DA 2N1KA 2C9PA 2VN6A 4NRZB 3TZVD 3VI4E 2PXYC 3BSZA 1VESA 5F1NB 1KNOA 1CPUA 5B39B 2CG9X 3MGOA 2W0PA 4GXUN 2B1HH 5FUCC 1JPSH 2GSGB 3ARUA 3PHAA 5IMMB 5IQ9A 5TE4L 2YAOA 1MCPH 2FO4A 5E99H 1H3UA 4B96A 2P52A 2YA0A 1IAIL 5EN3A 5F7LB 2IAMD 4QRQB 1KBPA 4RRPG 4PW4A 4F5CE 2ZCLH 2EECA 4IGBC 2J1KA 1T04B 1KYFA 1K8IA 4OJCA 2R8SL 1M42A 2UYLA 5HI3C 5C07E 1QA9B 4G8AC 4LNRB 2DQDL 1DDTA 1GYUA 4Q2ZB 3P2DA 5MI0C 1FYTE 2DZEA 5GIRA 2FEEI 4DUVA 5FYLH 5E6SB 1D6VL 4BFRA 2Z7ZA 3Q48A 5E6ID 4Y2LA 3HBGA 1L5GB 5F9JB 4IM8A 1UH4A 1VFAB 3HNSL 4NBXB 4KY1H 3T2LA 4ZOAA 2P8LB 1I1YA 1E9QA 1T2QH 1CICD 2EDOA 5JQ6L 3S35X 1XF1A 2APVA 1QFOA 1G6RH 4XE5B 4KZEH 4PS7A 5I17A 1JWMA 2B5IB 5K9OA 4QCIB 3WI9A 1FBIH 4G7QB 3V0VA 3VTAA 1RZKC 2YZ1A 3C6LD 1J8SA 4XPBH 1I3GH 3KPSA 5DLLA 2PW2B 5E2WH 2VDLB 5D2LF 2QHRH 3EG9A 4QPEA 2R29H 3KVDD 1PF3A 3MBED 3OSKA 4N0UB 5MEND 3OR6B 1DP0A 3G3LA 1CU4H 1TF4A 1RZKH 4P4KD 4LPVA 3QCUH 4PRBB 3QARA 2XV2A 5TD4A 5CBEA 4P9HL 2FX7L 3ZN6A 4C83B 3RHWF 2Y1VA 1KGWA 4RGNB 3ES6B 1F0LA 1U8CB 1WSST 3TV3L 1TPXB 1I8LC 3QSKB 1WAEA 2QPUA 4L3EB 4ADIA 2BIPA 1HSBB 2IPUG 4NQDD 1QSFD 4W93A 2GUOA 2C4XA 4NQTA 4X5QA 5LCVL 1JGDB 5HSFA 1A6AA 3LKQB 1TOXA 1YJDC 4R7DA 2XWRA 4NC1E 5E8OB 3VNYA 2VLJB 4HDIA 1GGCH 2UZIH 2D7QA 4LASL 3DX1A 4M3KB 1ZA6B 1KXQE 4KVNH 1MCRA 2CE6A 5T33H 5C0CD 1NC2D 3M1BB 5I0ZA 1KDJA 4MA8H 2OK0L 4CSZA 1U2YA 5MP6H 2ZUYA 3APMA 2EH8H 1TQUA 4HAGA 3GGWB 4UM9A 3ZE0B 3BUPA 1YJDH 1J0KA 3EFFB 2BLFA 1L6XA 4HIIA 3F58L 3DTUB 5FV1L 4RGMB 4EI0A 1I8MB 1UTDA 3QDGD 1KFAH 2FSEA 3NFNA 5FF6A 3O2VL 5IJKC 2XICA 4L0PB 5CR8A 1KB5B 4CADB 4XNQA 4FQXA 4GH7B 1UGKA 1UD4A 3V6ZA 4KRPB 4LCCA 3QWNA 1FGNL 2WXMA 4GO8A 4X6CB 1NKGA 1RZJC 3BSZL 3MV7A 2R2EB 3KCPB 3MMEA 5E6ZA 4WW2F 4R7XA 3CSYA 4BE6A 2OXGB 1UZ6E 2EC8A 1ED3B 3QZBA 4GUQA 3K6SA 5EIIB 3EJYC 1UZ8A 1KCVH 3NK3A 2X6CA 3FUKA 4H8WH 4RETB 1AXSA 3BAJA 1K5NA 4L8DB 1EK3A 1FL6B 1NCHA 4KK9D 5DJ6B 4BSJA 4GXUM 4W70A 1X7QA 3K5SA 4N2GA 1GSKA 3IMTA 4Y4KC 2PP8A 5CU9A 4OCSL 3GSNH 4YZWA 4ETQA 4CNIA 5TTRA 1HHHB 3IN0A 1G0YR 3B9KB 5KBMA 3FQNB 2YO3A 5TQ2L 4YHMH 1S9WA 2VDMH 4PGBA 1HL4A 4OZFB 3ZRCC 4C4KT 4B9GA 4L8CB 5FHBL 4JJ5A 2V7NA 1XIWB 2C9VA 1AR2A 2I07A 4KDTC 2K3HA 4K3EH 1BAFH 3MV9A 3BPNB 4OFYA 2IANB 4WGWB 3T2NL 3QUYA 1T3FB 3PP4L 2P1YA 4GBXA 3L3DB 1LEGA 3LCYA 2C9XA 2X0UA 2Z0UA 1J11A 5CS7A 4BQ6A 1NSNH 3LRSB 3NOIA 3RVVC 4NRZA 5F1NA 4FNQA 2WXJA 4TNEA 1X9RA 4Y5VC 5B39A 4HS6B 1HWGB 4HUUB 2MFNA 4HK3N 2GSGA 3FFCB 4NCDA 5IMMA 5KSVB 4ONGH 3A4DA 3RTLA 2ZWSA 1QD0A 4K7PX 1UVQB 4Z8FL 3GTVA 1S7QB 5IFAL 4NQCA 4QRQA 3NSFA 5HDRA 4S1SH 2VT0A 4J3XA 4ZNEA 1IC5L 1T04A 1XO8A 3E6FA 4GW1B 1IBHA 3MNDA 3QEQD 4APXB 2EDJA 1QA9A 1ZLUH 4M1GL 4LNRA 4Q2ZA 5CZVH 3HS9A 1FDLH 3BOVA 4WWKD 3VI4B 4X4ZA 4NWUH 1S3KH 3C2AH 3K5RA 5I8KL 3HC0A 1L5GA 5F9JA 2F2HA 5EU7E 1ZGLP 5DJ2B 4YDLC 1CN4A 2P8LA 3VXPB 2XKSA 3NRFA 4NZTH 5LN4A 4QY8B 1LXMA 1A7RL 1T0OA 3BKML 2D2CC 4H13C 3UYRH 1BF5A 3WN5B 4QCIA 3GXFA 3KEDA 1WO2A 2Q8AL 1SBBA 4HWBH 5I1EH 5C07B 3LQZB 2A9DA 1U0QA 1JP5A 4MHHI 5DYOB 5KSBB 4FZ8L 2EE2A 4Y4FB 4XVTH 2PW2A 1FIGH 3EAKA 3L3JB 2OTUB 1JPGB 2V3DA 3GQFA 3GXIA 3ZDZE 4N0UA 1L7IL 3LRKA 1XGZA 3OR6A 3N1GC 3N06B 5I1GH 2YJQA 1F3JB 3SQBB 5IMLA 1CI5A 4HUKB 4PRBA 4M48L 4Y2DB 5AYQA 1CFTA 3JT0A 4RMBA 2XG5B 3UFIA 2Z91B 4C83A 1IMHC 1BFVL 5IHZB 3ABGA 3QR0A 3ES6A 4U1GB 1U8CA 1RPKA 1OCZB 4UQBA 2P49B 4L3EA 4UAOC 1HSBA 2WY3B 2NW3B 3AJ7A 4ERSH 1JGDA 3HN3A 5HGHB 4HAKA 3LKQA 3GSOB 4ZS7H 3L4UA 4X80L 4PN6A 5E8OA 2VLJA 2YRLA 2TRYA 1WBXA 2GHZA 3I74A 4EN3C 1ZA6A 3JWDC 4IBUA 3M1BA 4J4PA 4YNYB 5KYWB 1TMQA 4ZFQA 5HPMB 3GBDA 2GY7B 2WWKO 3EFFA 1TQVA 4P2RE 4TS6A 5JNYB 4UQCA 4XBGB 3JWDH 5A6LA 1KXVA 2ZX5A 3RX9A 4YLBA 2YBGA 2CO2A 4YXKL 1I8MA 5EHFA 1FZOB 1WTGT 3O11B 3LN9A 4CADA 1KB5A 3PQYD 2HTLC 2XOTA 2ADJA 1AZUA 3MQIA 5GSVB 1NAMB 2F1EA 4X6CA 4P5KB 1BIIB 3TV8A 1OAQH 2R2EA 3KCPA 3IDYC 3H3BC 2OXGA 5DEJA 2V9UA 5F44A 1Z5YD 3FO0H 2NMSA 2OV0A 3AG3B 3NA4A 3O4OC 5EIIA 2YRZA 4KNQA 3UMTA 5F7NC 2IV8A 2ENJA 3K91A 2TSAA 3IDIB 4OJFH 3ULVL 3D06A 2XV0A 4JVWA 4L8DA 3V2AR 1FL6A 3BUTA 5DJ6A 2WNWA 2ZAHA 2WWOA 2NY0C 4PJXB 1K6QL 2UXFA 5I9QC 1F58H 3HS0C 3CWGA 3EKCA 3MV8A 1GGBH 1HHHA 2QVKA 4NIKB 1HOEA 4JFOB 3B9KA 4HC1H 1XX9C 3BMVA 3FQNA 5CN1A 1Y1UA 4NZRH 4OZFA 1XV8A 1AG6A 1DQQB 2EIZB 3MLZL 2WMPB 2A73B 3JSSA 4J3TA 4XVSH 4L8CA 1IE4A 1F4WH 3VWJB 2R23B 2OW6A 5DGRA 1KEMH 1V10A 4ODUB 2QVMA 4PW9A 2IANA 2HTKC 5CEZD 3MBXL 2CD0A 3LKNB 1T3FA 4KGLA 5I82A 1QACA 4JO3H 5GRWA 4LOVA 4DF9A 2Y9RT 4FQ1H 2VDLL 4ZNCD 1MZZA 3LRSA 1I9EA 3GUFA 4ZAKB 5GS0C 3T8VA 2ATPB 4JM2C 4DVRH 2Z1PA 2VWEC 1U6AL 3JXAA 3G08B 1QPKA 3DVFA 2ICWI 4HS6A 4KJQD 4R5XA 3SDAC 4HUUA 3FFCA 5JHLA 5KSVA 4R7NA 2A9MH 2NY7L 2DOCA 1IAIH 1UVQA 4JHVA 2PPEA 4YK4C 1S7QA 5GS0H 3WCYA 3IAQA 3LZNA 1CYXA 1UWYA 1IGYA 1JNJA 4XMZA 4TSAL 4DERA 1GTFA 1D2OA 4HKBB 2R8SH 1YYMH 2IAAC 4QHPA 2DQDH 4APXA 2ICES 4QRRE 4PJ8D 3LZFL 1OT2A 3SDDA 4DN4H 1AHKA 1R17A 4N2BA 1BQUA 4R6UA 2HMID 1OM9A 2VITB 3U0TB 3H8NA 2BSSB 4MQSB 3ALXA 4PTUB 3HNSH 4KU1A 1E4KA 1U3YA 4GQRA 3MRCB 3MRMB 5DJ2A 5JQ6H 2B0SH 1TZGH 5I71B 3ALWA 4YDNA 2GJPA 3VXPA 3TJHD 3QJOA 3O3BB 3QORB 4QY8A 2A74C 1VGEH 4F5CA 4FLHA 1JZ3A 4RSYA 2J8UE 2EDMA 3WN5A 5E7FA 5EOCH 3NG5A 1PD1A 5J7CC 1NZRA 4LNVA 4RESB 3LQZA 5C07A 3QIBB 5DYOA 4P9HC 5KSBA 4OGYL 3SQRA 1KB5L 1FCCA 4Y4FA 4MZRA 3RWCB 2X28A 3RFRA 2BZDA 2VDQB 5C7XL 2OTUA 1JPGA 2P5ED 5G4NA 4NT6B 2K7PA 2XDHA 1IC7L 1F3JA 3EH4B 3GSQB 3SQBA 2X6AA 4ODXB 4P9HH 2AZAA 4P3DB 4Y2DA 4QJ3B 1WJ3A 2XG5A 3QDJE 4AVJA 2Z91A 1MIML 1NOAA 5IHZA 4LSVL 1N6QL 4LK4A 1H15B 1D5XB 5LAXB 1CLZL 5DFTA 3NCEB 5C08E 5LCVH 4I89A 5E6YA 5C0BE 1FLRL 2Y07L 3X1EA 2NW3A 2A4ZA 2P26A 3MBWB 5HGHA 2CXKA 4MS8C 1AGEA 1V54B 3HZYB 3ILPB 1AHMA 1I4FB 2OK0H 5D1ZI 1FGVL 2L7EA 3F7VB 5KYWA 1UACL 2QADC 4NSKB 5HPMA 3AADB 4Z18A 1XGPB 2YJLA 4P2OD 3CH8A 5GZNA 4XBGA 1Q1PA 5I15L 3PWVB 1FFOB 4NKIL 3CCHB 1JNNL 2E7BA 4M1DL 1J9TA 4U1MB 3O2VH 3VM5A 2Y1ZA 3O11A 1H3PL 1YG9A 5IBUG 4BK5C 2PR9A 3ROLB 1JERA 5GSVA 2AKRB 1NAMA 3BGFC 3Q6FB 4AGMA 4GMSL 2JIXD 3D4ZA 2ARWA 2J21A 4P5KA 1BIIA 3HMXH 5ACLA 3WSQL 4K3GA 1CQKA 1XH0A 2HUEA 3QHFH 4M62L 4U1SB 5A2AA 2XACC 4P2RB 4U31A 4G6FD 5D6CA 5JHLL 1EZSA 3ARDB 4D0BB 3P3UA 1UJ3B 4QTIL 4WENB 3IT8D 1YNKL 3GPEA 1OT1A 1URLA 5D1ZD 4IDLA 2P43B 4WLCA 3D85D 1BG1A 2Q3ZA 4OCRL 3ZRFC 3IDXH 1NEUA 4KXZI 2OCCB 1WZMA 7TAAA 4PJXA 3V4PB 1L0PA 3VDCA 1WIPA 4J2QA 1MW0A 2NZ9D 4J3VA 4ZOBA 5E4EB 1WIUA 3T65B 3ULUH 3RX8A 3QDMD 2EKSB 3LZRA 3B3IA 4MMZA 1JOIA 2LAAA 5JPMC 4HJGB 3RVXD 1ZWIB 1DQQA 2EIZA 2WMPA 2A73A 2B3RA 4NDMB 1ZS2A 1UA6L 3NP3A 4JVUA 4M5YH 5DO2D 5IJVB 3VWJA 4DOHE 2R23A 4R4NC 5DF0A 4M8UA 3T2NH 1RLBA 4ODUA 2B77A 4JDEB 3LKNA 4FL4B 3DMMB 2Y4SA 2HT3C 3G6JE 3TNNB 3JV5A 1AS6A 1HT6A 1RJZB 3MNMA 5CMAB 3SDCA 4JY5L 4MA3B 5DFWH 4AMWA 1CF8H 4UINL 1BX2B 4ZAKA 5D93B 1BJ1J 3CD4A 1DLHB 3BVXA 3G08A 2FZ3B 4OD1H 3MTXA 2DKUA 5AVRB 1ZGLB 1PSKL 2NT0A 5I24A 2DTMH 5FC9A 1SVBA 5EV7A 7FABH 1IKNA 2YQGA 5CAYB 5IFAH 4ZW7A 4XTRC 3M1CA 4QXUL 1YDPA 1W9XA 1ICTA 4Z7QE 2VRKA 4HKBA 1INDL 2MHAB 5B1JA 1PGRB 4N2DA 4QNPE 4JUTA 5B4MD 5KTEL 2HRLA 4EDWL 4MAYC 1E8XA 1MCJA 5CGBA 1JBJA 4JFZL 3U0TA 4M7KH 2NY6B 4H8VA 2BSSA 3UXFA 2WZPA 5JA9A 4PTUA 1KYOJ 3DIDA 3DBXB 2ED9A 4UT9H 3ZDXF 1BREA 3IJYB 2CJ3A 3BT2L 3MRMA 4UB0L 4GKLA 1J1OL 4FQXC 3O3BA 3TIDB 1A6VH 3FTWA 4JFQB 2OZNA 4I0PA 3ZRSA 5BW7A 2Q8AH 1Q9LB 5J1SC 4AG4L 4U7KA 2DWYA 1FHGA 3O0RL 5DFAA 3OLIA 1ZJBA 5I1LB 1SJVA 3QIBA 4IBLT 2WCPA 5IW6B 1LNUB 4OVVA 3RWCA 2ARJQ 3WKPA 4RZCB 4H1LB 4UV4H 5KANG 4OUUB 1U8KB 4K3JL 4YPGB 3KH4A 1NAML 3IWVA 4NT6A 5DDHB 2VC2B 4Q52A 4A2FA 3GSQA 1ZCRA 1IGFH 4ODXA 3GMOB 4P3DA 3NJLA 4FLOA 2NW2B 4BZ1H 4NP4L 2ZUXA 5AW3B 1WAAF 2M1KA 3AG2B 4GW4B 1YC8A 4N8VB 4MB3A 2J8UB 3II2A 5K69A 2PO6D 1H15A 1D5XA 5LAXA 2EADA 3K0YA 4OZHF 4BV1A 1DVUA 1GY2A 3MBWA 5LDSA 3KL3A 3ARFD 3HCVA 1NFDF 3LS4L 1G9ML 2D73A 3ILPA 1SMOA 5AOMA 1I4FA 1E90A 3MFGB 4CMHB 1U41A 4GAJH 2OSYA 3F7VA 2R9HC 3UC0L 2AI0H 5JO5B 4NSKA 3OGCB 3QUYC 2X4UB 4GBXC 4RMSA 1XGPA 1AVAA 2DJUA 2NY2D 2XSKA 5FWRA 5I5IA 5IFHL 2LGNA 3PWVA 4NPKA 4DHLA 3LRMA 1FFOA 5C08B 3CCHA 5MENE 5C0BB 3ZL2A 1PU0A 2VH5H 3KS0H 3TO4B 1SBSL 1SGKA 1T1ZB 1G43A 1PX4A 5C0GB 3NFPB 1UXMA 1U9KA 1NCDL 2FNWA 2VAAB 3MA9H 3ROLA 2AKRA 2ISDA 4WO0A 3NCYP 4NQDE 1QSFE 2Q7NA 3ULVC 2DY2A 2IIJA 3L1OH 4XPFL 1KLGB 1YECH 2LV4A 4P2RA 4ZUUB 4FULA 1R5IB 3ARDA 1T6VN 5C0CE 1AR1B 1UJ3A 3ZXAC 4G6JL 4JBSA 2XX0A 3ETTA 5BZWB 1DJSA 2BSCA 3U7YL 4NNXB 5D5ME 1K6QH 1DBJL 1KXHA 3BN9D 3L3OB 3AQDA 3HTLX 3NH7L 3V0WL 3GRGA 4UI2A 1THAA 1Y18B 2B5IC 3QXDB 3T65A 3QDGE 2EKSA 4HEME 1EDHA 3J2PA 1C7SA 1D7CA 2VJXA 1MG2C 3MRNB 3NUKA 2BY1A 2P7TB 4ZOCA 2IGFL 2OTPA 3I9AA 4HJGA 5F8RC 1VCBC 2ADGB 4F33B 1ZWIA 1ROCA 1HOCB 2Y7OA 4NCC2 2FH6A 5H4YA 4NDMA 5E08H 4WEBL 1A6UL 2BJMH 5IJVA 4HIHB 3D0AA 2CWRA 1OTUC 4QIRA 1CC3A 2BWDA 2XY1A 5AVYB 4LO9A 4JDEA 3K6IA 5IOPB 4PU2A 4PWFA 2CHDA 1IU1A 2D03L 3TNNA 2Y06L 2J57A 1RJZA 4RGNC 3RX5A 3FJTA 3NJJA 2VDQL 4MA3A 3C60B 1TPXC 5AOKA 1OK8A 1BX2A 2LLGA 4D0CB 1DLHA 3MPCA 3QI9B 4NBZB 5TDNB 3CFBB 2FZ3A 2C9RA 1MFAL 5DHEA 3I3BA 1ZGLA 3RWGB 2BNUB 3DYPA 3MRJB 2JJSA 4F20A 2NNAB 2WXLA 1E50A 3N9GH 4TUKH 5L4MA 4AYDC 4DOHB 4XP9L 1H0DB 2W8CA 2UXVA 4TSAH 4P05A 4XN9A 2HRHA 3KHOA 3Q8BA 3JWNG 5B7FA 3LZFH 5BQDA 3G6JB 5ERWB 2WXQA 2AXJA 3QUMH 1I3UA 3BQUD 4HKJB 3IETB 2COVD 3U0WL 1KXVC 4IU3B 3K2UH 4GRWB 3SODB 4RGMC 2KQMA 4MVBD 1U95B 3QWQB 3GS4A 1VPOL 5I28A 1QEWB 3VRLF 3H6JA 3DBXA 4KZDL 1OF2B 2X9WA 3IJYA 5AW6B 4AM0B 4GQ9L 4RFEB 1N67A 4GI9A 4PVLA 1MCIA 3TIDA 5CJBA 1XXFC 3MYJB 4JFQA 4KRPC 1Q9LA 4Z7QB 4Y2NA 3IEAA 3AS0A 4UNTA 1NBVH 1NOFA 3CN4A 1E43A 5I1LA 4AJVA 1KB5H 4H5SB 1EUTA 4RGOH 5IW6A 3WU1A 4PWJA 4RZCA 5C7XH 3PHQB 4H1LA 3U4KA 1J18A 2P48B 5I1DB 4OUUA 1HCVA 4YPGA 1TTUA 2WXRA 1IC7H 3KHQA 4LQFH 5DDHA 3SOBL 5JYMA 3QEQE 3CFJB 3D50A 3P0YH 2WWMC 4NEHB 3HEIB 4PLJC 1MFDL 3L9RB 2CUAA 4I1NB 3GMOA 4PJ7F 4JGJA 1QFWI 4IMKA 1VDGA 1YMMD 2NW2A 1MIMH 4PGZA 3TZVB 4GW4A 4N8VA 2J8UA 4FQLL 2KBGA 1GCFA 4XC3L 3PWJB 1FLRH 4XN7A 2F54B 3B9KC 4WWOA 5FW7A 3O2WL 1HZHH 4Q8BA 4ONFL 3W1ZA 4M3HA 3VFMB 4ODSL 3ZYIA 3EJCA 2IAMB 3V4PL 2JFCA 3EH3B 2ZUQB 1XIWC 1FGVH 2VDRB 3S6CA 5HHNA 4AJ0A 1UACH 2HFEB 1TSRA 4HYTB 4PMEA 5JO5A 3F3HA 1J0ZA 2ODIA 4AM0Q 3BPNC 5FYJD 3OGCA 4OZFH 2J12B 4LZKA 3EGDB 1JNNH 2VQ4A 3HPLB 1DN2A 1L3WA 5C08A 1YAIA 2X10A 5C0BA 2BIHA 4KDVA 5JZ7D 2QDVA 4R0LB 3S5YA 1QZ1A 3GMPB 1T1ZA 5J6HB 5C0GA 4MA7L 3NFPA 3VFSA 4BBWA 2O93L 5TPWL 1BXVA 4ACTA 2VAAA 5JYLA 2DI7A 2VKWA 3O6FD 4OJYA 8FABB 4GMSH 4KVCL 4FA6A 2J88L 3JVGC 2MKWA 3C6LB 3DOIA 3LKPB 3T3MB 1TETH 4WHTB 1KLGA 2N7BA 2VN4A 1TQSA 4ZUUA 3ZMNA 3MBEB 4DW2H 5MENB 3E2HB 3GIVB 3K6FA 4XB3A 5IB2B 3KR3L 4D0DB 4X0KB 1YNKH 3K0WA 3V0DA 3ECQA 2V9RA 2VW4A 3UZVA 1E4KC 2FWSA 3K46A 1BEYL 1UEYA 1QO3A 1VFOA 1T03L 3VQLA 5BZWA 2Z31D 5GRUL 5C09D 3WEXB 2C3WA 4NNXA 4ACPA 4RRPM 1OAXH 3L3OA 1QPPA 3ORJA 5KVGE 4NQDB 3QXDA 1Y18A 3ZMEA 3WN5C 4ISVB 5C0NC 1F4YH 3MRNA 4UAHA 2ICWJ 2P7TA 3JVFC 1A25A 2FGWL 3PQYE 5CGTA 1MHHB 5IWLA 3EFDL 4GAFB 3T6WA 4F33A 2ADGA 3L3HA 3DGGA 5C0CB 1HOCA 4YDVB 4JCLA 4KK5D 1UA6H 1EWHA 3BAKA 3ILQD 4LE8A 2DLHA 3G7TA 2E8ZA 2MJWA 5DUBB 2LOEA 2E9BA 4HIHA 2FSDA 2NSMA 3ZO0A 1W16A 4PTTB 3LZOA 4Y2DC 3P02A 3K8MA 3VDAA 2HJFB 2CRMA 5GQBA 3U1SL 4ZT1A 1PYWB 2QTVA 4OAWB 4UINH 3QDGB 4U1GC 1OALA 3C60A 4OIBA 1JZGA 3POHA 2X7LB 3WXVL 2RIKA 1BFTA 2VC2L 1MJUL 2YEVB 1PSKH 3CFBA 3H9ZA 3QI9A 4UILL 4X8XA 3O81A 3ZKSD 3EJQA 3L7EB 2YXVA 2BNUA 1ZHBB 3MRJA 3QHTC 3RWGA 3T3PB 5JIDA 2NNAA 3GHEL 1PD6A 3C8HA 5BQ7B 1BZEA 4NO2A 1H0DA 3HVNA 3TN0D 2CHXA 1GIGL 4FX5A 5CN3A 1V7NH 3VX1A 5CZXD 4IHOA 1KOAA 3G6JA 4EDWH 4JZOB 5ERWA 3VGEA 4DEUA 2DQIL 2ITFA 3MLTB 5GZNC 2ZX9A 3IETA 4HKJA 4JFZH 4M93B 4PHXA 3S35L 1OHZA 1S2EA 1IBZA 4IU3A 4HS3B 4UNUA 1KY7A 3KWWB 4WJKB 3OJDB 1QEWA 4JFFA 4ODBD 5CEZE 1LO3L 1OF2A 2C3XA 4NC1C 5E1IA 4AM0A 3U4BL 2X9XA 1CBJA 4RFEA 1FORL 5D71L 1MFEH 1U8HB 4N2OA 5EIQA 3MYJA 3ZDYE 1C5BL 1U4FA 4AG4H 2AJVL 2EE3A 2V2WB 3RJOA 5JIQA 1LWJA 2Z4QB 1WZLA 2RQ8A 5C9JB 5HXMA 3OZLA 3WMSA 4H5SA 1SXSA 3LEYL 5BOPA 5K9QI 1BYOA 4K5OA 1DLFL 1N9PA 3PHQA 4K3JH 5J12B 1BZOA 5EWIH 5I1DA 3LH2L 4RWHA 3DA0A 4AV4A 1S9YA 4PJ6A 4NQVA 1AOZA 5F8QC 2QLVB 3FB6A 4DEWA 3CFJA 2J2ZB 1NIBA 1UB5B 2JXMB 4HP5A 5AW0B 1G9MC 3I6SA 4TPRH 4E9YA 3TZVA 5DI8B 2VE6B 1GSMA 2CK2A 1N8ZB 2VUKA 5AENA 4S0HA 3PWJA 4OD2B 5GJSH 3I3DA 2F54A 1N0LB 5DQDH 3MLPA 2DM4A 1AZNA 4KJYB 4RWYH 2WXPA 2MQ0A 3VFMA 5SWSD 1SMDA 2IAMA 3S36H 1ZANL 4FQCL 1OPOA 3JYCA 3RVWC 4G1MB 4CU8A 1FIEA 2X5PA 3ZDWA 4W9IC 4GAGH 2HFEA 2R0KL 1NGWA 1B90A 2VB5A 1FPTL 1A1NB 2E9JA 2MQGA 3C08H 4UT7H 4DTGL 1HKLL 4YZFF 1RXLA 5IFHH 5C92A 2P5EE 4UDTB 3HPLA 4YC2B 2C26A 2C9UA 4PJDF 3H56A 4ZAKC 1YHPA 1SBSH 3LKSB 4TUJB 1DL7L 2OQJB 3ARVA 4R0LA 4AWJC 3GMPA 2YGQA 4IRZA 4U6VH 5J6HA 1NCDH 3AQZA 1OARL 1BBDH 2X6BA 1NH6A 2R27A 3OQ3B 4QD2E 4TVPD 3SKJL 3TF7C 8FABA 1JXJA 3RUGE 4L4JA 1BHGA 3RU8L 4JNXA 3C6LA 2C4FU 5GRXG 4P23C 4BXSV 3W38A 5B1JC 4LGSB 3ZTNH 5D7IB 2CK0L 4PS4H 4HBCL 1VZHA 5LDUA 3SPIA 4PB0L 1DVSA 1TG8A 4OLWL 3GIVA 4JZNB 5IB2A 4HWUA 1A14L 1X9QA 4D0DA 4X0KA 4G6JH 3D9AH 2M26A 4RZKA 2Y5EA 1N5YH 4HLEA 3WHE1 4QXGH 5I71C 2IOOA 1HI6B 4R90H 3WEXA 3V0WH 4GUOA 3R0NA 4QLWA 3QORC 2X4OB 2DH3A 2ED6A 4JR9H 1Z9SB 4P4RB 1Q72L 2OKMA 4L8BB 2VR7A 1UQSB 4NQDA 4UNIA 3BZFB 1BSIA 4PMFA 5BW7C 4ISVA 2JKWA 3OKLB 3RKPA 2PCFB 3GBML 3GK8L 4GRMB 4MX7B 2CGZA 1MW1A 2W5PA 1AIFB 3QIBC 1MHHA 2X3AA 4QRUB 3MJ9A 3CH1B 4JO1L 4YDVA 1WHPA 4FEIA 5GHWH 5M94B 3RYMA 4WEBH 2VIRB 3UOAB 1A6UH 3UBXI 4O51B 5DUBA 1PFOA 2R1XB 5G4MA 5EU7C 2FEDD 2B15A 5AKTA 3D09A 4BQCA 1NTDA 2ZCHL 3BVUA 3CZSA 3MLSL 4PTTA 4AIZB 1KG0B 3IFNH 4JPKH 3O6LH 2VDQH 1NBZB 1PYWA 4RX4A 4OAWA 3QDGA 4PCKA 2MQCA 4K7PL 3BSGA 2JCCB 3PQYB 3MRIB 2X7LA 4PRHD 3GB7B 3E9UA 1MFAH 3RBSA 4C56B 3SHSA 4OB5L 1ZXKA 3ESUF 1F11B 4HJSA 3IF1B 3L7EA 4AQOA 1ZHBA 4NNYB 1A9EB 4XP9H 5BQ7A 4OM0L 3QDME 1M57B 3LN4B 3QP3A 5HI4C 2YGOA 4X8JB 4Y8DC 5DC9B 4JKNA 1KJVB 2FD6L 2B14A 1T66C 5AD0B 2J44A 1UYWL 5I30L 3O6KH 4JZOA 1A3QA 5E1HB 4H8UA 1RZFL 3MLTA 3U0WH 5GS2D 1I3VA 1MJ8H 1A6WL 1UASA 3VM7A 3EBAA 4HS3A 2VDRL 3FH8A 3KWWA 5KVFE 4KZDH 3DRTB 3GJFH 2E6QA 3OJDA 3H7BA 2EUWA 4GQ9H 3EDJA 1R3IH 2IMMA 4QRSB 1BEXA 5AVUB 1MAML 4M6NH 5IUCA 1U8HA 4AZUA 4U49A 4XX5A 3P1VA 2B1AH 2V2WA 2DAVA 4G3YL 3CLWA 2Z4QA 1G7QB 3ZE2E 5C9JA 1P7KB 3H6AA 2W0KA 3QEUA 4TLTA 3BO8B 4JM2F 4J3OC 1IBGL 3ARDC 1Q94B 3GDBA 5BRPA 1SOKA 3CDFA 1UJ3C 4GRLD 1KCRL 4XXDB 1P5VB 2FO1A 5GGVY 1MFDH 2DM2A 2J2ZA 4N8CL 1SEQL 1UB5A 2JXMA 2GABA 3G5VB 4H4NA 2CKBB 3FCGA 2CPUA 4FQLH 3IU3B 4XC3H 5DI8A 1CIDA 2VM4A 3CX2A 4OD2A 3SEPA 2A6JB 3O2WH 2LABA 3IRPX 4FXTA 4OIIL 1NINA 3AQXA 4ODSH 4PJCA 4KJYA 3FTSA 3V4PH 4ODVH 4X9IA 3L95A 4N5UA 2DL9A 4G1MA 4WI6A 3SE9H 2X4RB 3BUIA 2W80C 3QWRD 3V9FA 3VH8G 2VSMB 5E8PB 1MELA 4PJ8B 4YWGH 4MJIB 4KDWA 3OVUB 4NFDA 4BZ2H 3DMMC 1YY9C 3DRQB 3MJ9L 5KW9H 2YN3A 3TLRA 4UDTA 4DNLA 2HA1A 2ZXQA 3V8CA 5LG1A 3LKSA 4TUJA 5D93C 4P57A 1FHNA 2OQJA 3MUJA 3RGVB 1NL0L 3BH9B 1XZWA 3LIZA 5TPWH 4S1RH 3S2AA 1AQ8A 1CDIA 2JJSC 2R4RL 3FW6A 4KVCH 4LPCA 4BUQA 3Q06A 1IEHA 1X9UA 4TTDC 4F3FB 4KHTL 4QXWA 4Z7UF 1WVZA 4LSTL 2RCSL 4NRXB 3ZKND 5D7IA 2IXQB 3M7FB 2C1PB 2P5EB 1GYVA 1RUAH 4JZNA 5AFAA 4O02H 3VU2A 1MN4A 4XNXL 3VVWA 2NY6C 2UZPA 2WIMA 4RFOH 1BEYH 2XKNB 2GTQA 3SDYL 3IXAB 1I9JH 4Z7VB 4K94H 1MFCL 2Y2TA 1HI6A 1E4WH 3QPQD 5E8DH 3RUGB 4XP1L 5IKCA 2X4OA 2XIIA 1Z9SA 4P4RA 4L8BA 3UGEA 4MNQD 3AGVA 1TR7A 3BZFA 2ZJSH 4OBSA 4MRBA 2YMXH 1J0HA 5ETUB 3OKLA 4KTGA 2FQFA 2PCFA 1SOSA 1XVSA 4GRMA 3L81A 4MX7A 3VXUD 3SY6A 4F9PC 3EFDH 1AIFA 1NCCH 4ZW8A 4LRIA 1GS6X 4O2EB 5ALBH 5JXED 3VACA 2JJVA 2F18A 4QRUA 1SF3A 3HG1D 1HFUA 3CH1A 1J10A 5T1MB 2Z8WC 3QC5X 3HS8A 4CVUA 2DL2A 4O51A 4U05A 1MCNA 1G9NL 4NLAA 2J1XA 1WTLA 3HI1B 4P2OB 4AIZA 3MNWB 4LU5H 1KG0A 4IMKC 5DSCB 5HDWA 6FABL 1NBZA 1V05A 3UDWC 5EFIB 4YSQA 1P5UB 3HKZA 4JPVH 1MJUH 4ZW3A 1AO7B 2JCCA 2JI3A 3MRIA 3PQYA 4OFPA 3P9LB 4UMGA 3I9GH 4C56A 2VN3A 2VKXA 1HCZA 3ULUF 3GHBL 3SGJA 1F11A 1OGTB 1BG9A 5T1KB 3IF1A 5DVKA 4NNYA 3N85L 2JK5B 2JIXB 2VR6A 1A9EA 4G8FB 4AIXA 2NXZD 1TU2A 1H5BB 3LN4A 4MD0A 1UURA 2R56H 4N2AA 3S8WA 4GI8A 4X8JA 3NDYE 2X4PB 4GSRA 4LDEB 3ALPA 1U2HA 1AQKL 1KJVA 4LCYB 4JRWA 5AD0A 4JDTL 3OAZK 3S0PA 2DQIH 3HG4A 2BSRB 3QGVA 1RVFH 4G5ZL 3S35H 2F08A 1QUPA 1RK1B 3NTCL 1T1WB 3D85B 3BVNB 2APFA 5KAQG 5GRVL 2APTA 2CO7B 3DRTA 3TO4C 1LE5B 2DLTA 2YAHA 3U4BH 4HIPA 1AZRA 1CQYA 5A3ID 2KI6A 3UADA 3QDMB 1ASQA 3ZTEA 2BSEA 3CFDB 4APQA 4WW1A 4AI7A 1IFHL 1E3XA 1G7QA 2NPLX 1P7KA 2DQGL 3LIZL 4OLUH 3BO8A 2XPGB 5D4HA 2C3GA 1OE2A 3K4ZA 4QTHB 5AVTB 1Q94A 4Z0XB 4OV5B 1HHIB 3BWUC 1AR1C 1ZLWK 4KQ4L 4CKVX 4PJ9D 4XXDA 1P5VA 3WIHH 4QAMB 3VXUE 1JDDA 5DD0L 5HVWA 4AQZA 1BZ8A 5HHVH 2BC4B 1U33A 2R69H 2WNXA 3G5VA 3GWJA 5DUPL 4CN6A 2CKBA 4DSYA 5ENWB 5FS5A 1QI4A 1NMBL 3IU3A 3LNGA 1NWPA 4YOKA 2DWDB 4YHOL 3ZE2B 5JHBA 1EPFA 5L7XL 2A6JA 4DGVL 2C7UB 5IWLC 3RP1A 3W5NA 5A2JH 2VZOA 4UM8B 1ZANH 3US9A 3P9WB 1N64L 2GITB 4F8PA 4KUCF 3T4AB 3IB4A 2X4RA 3IRCA 3SE3A 2GY5A 4D9LL 2R0KH 3RWIB 1IM3B 5E8PA 4RAUB 4PJ8A 1JZ6A 4DTGH 4MJIA 2EDRA 2LR4A 2O6CA 5TGBA 1EAQA 1U93B 2AQTA 5D7LD 3DRQA 1BOGB 1RUML 3PFUA 1BQLL 1QRND 5LGKA 3LQAC 3C60C 3TJEL 1DL7H 1J5OL 5TH2B 4B27A 3ILDA 3L5IA 3FQ4A 1WBZA 2KYIA 1KCSH 1B6DA 3E0GA 3QI9C 3RGVA 3BH9A 1GPOL 3NJMA 1YMME 4B6ZA 4EPSA 4C59B 3PJSB 1RMFH 2C3VB 5DVPA 1NM4A 4TNVK 4AYID 5HYJD 2ZP8A 3RG1C 3NEEA 5KVGL 3LQAH 4WIQA 1WICA 2O6PA 4ABVA 4F3FA 5KS9E 4F8TA 3IU4L 1JTOA 4H88L 3WS6A 2OJZH 1Q9OB 4FXKB 2FH8A 3ARBD 1IT9L 1E4XI 2P8PB 4KO5A 4L3FA 4NRXA 4HBCH 1JPFB 1R3LB 4OR1A 2IXQA 5DHVB 3UIZA 1XCTB 2C1PA 2P5EA 3PRZA 2C7FA 4KPHH 4H0HB 3MJ6A 3CBKB 3O2DL 2X38A 2XKNA 2DBLL 4H40A 1KCWA 1ZEAL 5FYJE 2Y3NA 2JJUA 4Z7VA 1WLHA 4KNSA 1QI3A 12E8H 3Q1SL 2CMRH 2V5SA 5J6GB 1U3NA 1AE6L 4MRCA 1Q72H 2QPEB 4Y2OB 5J56B 1G1KA 3P3TA 1TFHA 2AGJH 1A9VA 2ZTBA 3GBMH 2QSTA 5ETUA 4U0RB 5DJXB 1NIDA 3ARFB 1P7HL 2VL5B 1ZVSB 3FN0L 3NN8B 4F2FA 3HI5H 4O2EA 4OF5A 4JO1H 5FHAL 4I2XE 1Z2KA 1BVKB 2WQWA 5T1MA 5A6IA 1OAUL 3C8KB 3IGKA 1Z1WA 3SOTA 4PWIA 2ZCHH 3MLSH 3HI1A 2FQDA 2Q7AA 2UWEE 4N2KA 4P2OA 3BLKA 1E9OB 3MNWA 5LG6A 2VDPH 5AVQB 2LLNA 2E7DA 5DSCA 5B3SB 3TZVC 4MJJA 4F37K 5EFIA 3SBQA 3N91A 3DV4B 1P5UA 1YRKA 3S3CB 4OFDA 5CEZL 1AO7A 3P9LA 5C09E 3AG1B 4M6ML 4AEEA 1S5HB 1OGTA 1ZJAA 5T1KA 4BKTC 2IAMC 2CKBL 1OOAA 2JIXA 1XMWA 4G8FA 5E0FA 1MLCB 1MUJB 1H5BA 2ZUQC 1F4XL 3NSCA 3PPEA 2X4PA 4UT6A 1HEZB 4FCAA 2B8OT 4LCYA 2Z7WA 5F1OB 2GBTA 2WZAA 5AVXB 1S5IH 2BSRA 1A6WH 1I1AD 1MIEL 4Y16D 1FNSH 2MPAH 1RK1A 3BD4A 3D39B 3F5WA 1T1WA 4OT1L 5GISL 3BVNA 1LK3H 2UZYB 2CO7A 4ICXA 4R0LC 2A38A 2W92A 2WO2B 1HCYA 1CICC 1X5ZA 1KBGL 5B39G 5CCHE 4NAQA 4HOZA 1LE5A 2I9TB 4D2NA 2XRAL 1MAMH 2DQUL 1HH9B 2CR0A 3QDMA 3GM0A 3RGBA 3UTTD 1OCCB 4BRVA 3FN9A 4G3YH 2ZUUA 5CGYD 3C6LC 3L6FB 3CSPA 4FNPA 1ZE3C 1CR9L 2CDEB 2DQFB 2H41A 2JSFA 2CKNA 2ZWKA 3NACH 9PCYA 4YBQD 5DEGB 3DX2A 2AABL 5C0IB 4HU2A 2XPGA 4IKIA 4X5LA 1NC4D 3MBEC 3E2HC 4QTHA 4Z0XA 2X2IA 4OV5A 4DP0X 4KQ3H 5AZ2L 4Z3HA 3DBSA 4K5PA 1HHJB 4OF8A 2XZQL 1ZE3H 1SEQH 2WLIB 4WAFA 1CLYH 2BC4A 2E7CA 2WLMA 1VLXA 2LU7A 4IOSD 3IGUA 2EICA 5ENWA 3ZE0F 5JIHA 1VCAA 2DWDA 4FLQA 1AY1L 4PWHA 1C8PA 4UNVA 3GLDA 4EOWL 3FRUB 4OIIH 3VFPB 1O6SA 2C7UA 3GIZH 4PJ5D 1OP4A 2V2TB 2ITEA 1LWHA 5GGSY 1HVXA 4UM8A 4GYBA 3QA3B 3QBTB 4R7VA 5AVSB 2GITA 3T4AA 5CCKH 4XNZB 1IM3A 1LDPL 1FRGH 5L4IA 5PCYA 4RAUA 4G8EB 3E8UL 4HSQA 5GS1B 3DO7B 3BQUB 3I50L 3TCLA 3KPPB 4JX0A 2B2XL 1BZ7B 4AH2B 1U93A 3BHBB 1BOGA 3APNA 1FVEB 3BP6B 4PBWD 2PCPB 2KPWA 5TH2A 1PY9A 1NL0H 2KZWA 3NRQA 4LEOB 2WKLA 5DJCA 3PHSA 5GGRA 1F4AA 5LHDA 5JW3L 1N6VA 2E4TA 2X1WL 4HWEL 5KEZA 4EI5B 1AGFB 1AXTL 2R4RH 5LB1A 2VGLM 3PJSA 2C3VA 3NJIA 3PE9A 2VJ0A 1GY1A 1QX1A 2ZSVB 3BCDA 2WLLB 4LOUD 3HE7B 1KGCD 1G84A 2VXVL 1A6PA 1Q9OA 4FXKA 4J8QA 4TVUA 1JPFA 1R3LA 5SWSE 4AGLA 2J7LA 5DHVA 3RIAK 1XCTA 5D96B 4LF3B 5I1JL 2LU3A 7CGTA 4M93C 3MOAL 1H8NA 1YNTB 2YAPA 2J6EA 1J05B 3KBPA 4FF9A 4KK9C 3SDYH 1FYHB 4QT5B 1NJ9B 4UT6L 2GBVA 4KHXL 5L6YL 2EDTA 4G7VL 1JV5B 3CXDL 1MFCH 4WZ9A 4XP1H 1S9VB 5DO8A 3HW7A 4XXCA 4F57L 4OLEA 1LMIA 5KS9B 5J6GA 4A2LA 2E56A 3HMWL 1P4BL 1DTUA 4A2HA 1G9NC 4NFCA 1MWAH 1TQCB 3RWEB 1OP9A 2K9FB 4XN8A 5DJXA 1CLOL 5DRWB 3ARFA 4XMTA 3NAAL 2VL5A 1ZVSA 3I9PA 2A7BA 2XQYA 1BWWA 3AWFA 4YFLI 2XVBA 1MCLA 4TVPE 2YK1H 4TNWK 2CLRB 2DLGA 5J12C 2O61B 1BVKA 3NQIA 4P9MH 5EIIG 3RE0A 3C8KA 5IEKB 3L8QA 1ET8A 1COBA 3HNVH 5AW2B 5DJYB 2OMTB 1H6FA 3N3EA 3UROR 1B4JL 1KB9J 4OCXL 2D7MA 6FABH 4Q9RL 1DBAH 4WWNA 1UFUA 4KI1A 1AS8A 4FI6A 5KVFL 3VI4F 1Z6JT 4AJWA 3QJZA 4M29A 3O6FB 3UL4A 1JF5A 2ZYRA 4FFZA 1S5HA 3N85H 4GSXA 4OZFG 4F7TB 1J5IA 3FTGB 5DZAA 3QE5A 4ZS6C 4AL8L 3W3BA 1MLCA 2FJUB 1MUJA 4D7PA 5A7EA 5EPMB 4FS0A 2Z8RA 2UWEB 1HEZA 4QRTB 4W4OC 4DP4X 1BMGA 1T7VA 3BUYA 2WVSA 4H7VA 5B1BB 4G5ZH 2IPUK 1NKOA 4YC2C 5J06A 3V0JA 4HEPA 3D39A 4QOKD 3BH8B 1YY8A 5D2LB 3WELA 4MLSA 2UZYA 1M3JA 2Z31B 3VXRD 5C09B 1XXDC 2YXMA 2I9TA 1OL0A 3MREB 5CJ8A 1NGZB 1O7DE 2IQAB 1HH9A 5DURD 3X3FH 2JKJA 4Y9BA 4HOWA 5IVZA 1IFHH 2JLLA 3L6FA 4PRHE 4PRPD 1KC5L 5GJTL 5LNGA 3JUYA 4KH9A 5FYJU 1FNGB 2R2CA 1TTAA 2DQFA 1QTSA 5DEGA 5C0IA 1V55B 5DGQA 4KQ4H 5KJ7E 2ADFH 1JAEA 1WFOA 5DD0H 1HHJA 4FKHA 4LOEA 2XHNA 3N5AA 2NR6A 3B5HA 2W9EH 3G5ZB 1GW0A 5J4MA 4U6YA 5JR1L 4KVPA 3RHWK 4YHOH 3CFMA 2CR3A 2J6EL 5L7XH 2ZYHA 4FADA 2IBZY 3OB8A 4HHWA 3LTVA 1EANA 3FRUA 3VFPA 3ERXA 1RJCA 2X1OA 1BZQK 2CLVB 3ISRA 3OB0H 4XPHL 1N64H 1Q4NX 4YAQB 3TN0B 4D9LH 5C6PB 5JUEH 5B7MA 1XEUA 3PAZA 4QGTA 4KRNA 1I7TB 2FQGA 3IE9A 5I6KA 4JFPB 4UOJA 4G8EA 5GS1A 2OMXB 4ZMTA 3DO7A 1SDAB 1BAWA 3KPPA 1VENA 3VD0A 1BZ7A 2DRUA 2UY7B 3FU5A 3BHBA 3NZHH 3U0PB 4AH2A 3TJEH 3L2MA 1FVEA 3BP6A 1J5OH 2NUTB 3H0TB 4O00A 5EOQL 3BC9A 2PCPA 1HH6B 3L4ZA 2CJSA 4MDIB 4XRCA 1KIQB 1KELL 4D3CH 5E9DD 2XXFA 4EI5A 1AGFA 3SGJC 5CEXB 3MHZA 4RRPA 5F7HA 2NNXA 2ZSVA 2WLLA 4H88H 2WXNA 3HE7A 5J9PB 3RIFK 2GKIA 3GKWL 3MRRB 3QXAB 3WFDH 5F3BB 1OT4A 2NTFB 4GG6A 1RIUH 2RMNA 3V10A 1GH7A 1CLCA 2TRHA 2V17H 4YHKL 3WL9A 4FFZL 4F7EA 1W0YT 4LF3A 4NRYB 4AUUA 3VDBA 1UZ6F 2BVOB 1FSKB 3VE0B 3O2DH 1YNTA 1YEKL 5E56A 1J05A 4CSTA 1ORQB 2BZ7A 5T1DL 3V6OE 4ONHB 4QT5A 1NJ9A 2KZKA 2XXMB 1G5GA 1JV5A 1ZY9A 3Q1SH 4I4WB 3K72B 3BWSA 4O4YL 5EF2A 5EDSA 1T5KA 5KS9A 4MDJB 2Y5QA 4E9LA 1F1GA 4POUB 4Y1AB 2D4DA 1JGIA 3CLFL 2OZ4A 4X98B 5DRWA 4N2IA 5FOJA 2H9GB 3GTTA 5FHAH 2ENYA 4WVRA 3VXMD 3ECWA 3SKUD 4ZZKA 5JDSB 3THMH 1OAUH 2CLRA 1EXUB 1A6TB 5IEKA 5ILTH 1P1VA 4LEEA 3LPOA 4KNTA 1QASA 2G60L 5DJYA 2X05A 3TCXA 2OMTA 3NCBB 1ZDQA 4J3BA 3UO1H 1A64A 4B97A 1KCKA 1OK0A 2XIDA 3IPBA 4S11A 3EZ8A 4WO4B 1OM3L 1N68A 3UAJD 3V9CA 3WIFB 4JKPH 5I0WA 1LILA 4DCQB 3OZ9L 5INCB 5CEZH 4PAZA 1QQDB 4KJQC 1M7DA 4M6MH 4FMVA 1TO4A 3O6FA 2OBGA 4G72B 4A2MA 5GGUB 3GO1L 4F7TA 1OGAA 3U9PH 1DN0B 4U1JA 4GUPB 4MNQE 3J07A 1CK0H 1OAJA 3SE3C 5EPMA 3KYOB 2AEPH 2UWEA 2WXHA 4QRTA 5KSAD 5EU5B 5F9DC 4PJ8C 2Z92B 4KXDA 5IVXE 5MERB 3UIYA 1RD6A 3VFOB 1TEFA 5JHDA 3KL5A 1D5MB 1G1CA 5EB9A 1MIEH 3HG1E 2HMIC 4XVJH 3WYRA 1PNDA 2VSDA 1HEHC 4GT0A 2HLEB 2P5WB 2ZX8A 4XNBA 4F9LA 2ID5A 3BH8A 5D2LA 3MAWA 1O5DT 3QIWD 5C09A 3RFZB 2D31B 3L1GA 3RGVC 1T1YB 4C4BA 3TJHC 4OGXL 2HWZL 1L9OA 2R2BB 2XRAH 2AQPA 3PAUA 4POZD 2Q8BH 2DQUH 1ND0A 1A4KB 3MREA 5EU6D 2EP6A 2VR5A 3ZO9A 2IQAA 1O0VA 3HG5A 2IDCA 2Q10A 2YC1B 4JL1A 3WNLA 4XHJD 1FO0B 1QSEB 2Z7UA 2NX5D 1SYSB 4PD4K 4MB5A 2A1WL 2VO8A 1FNGA 1J9QA 2AABH 3EZJB 4P5TD 4ZTOL 2WSPA 2OJEA 2EXYD 4A7GA 3L2NA 3E8VA 1F00I 1JVLA 2E74C 1BJ8A 4WJG3 2XZQH 1AKJD 1UH2A 2CBPA 3QNZB 3O9WB 4NQSB 3N43B 2CJTA 1M6UA 5HHMD 5EN2B 4P46D 3ZDZF 4I3SL 4WK0B 2N0MA 3TH2T 1ASPA 3IS1X 5HJGA 3EIFA 4MXWL 1IBBA 3R8BB 3G5ZA 4HK3J 5B1CA 1BVNP 3GLAA 3S34L 4BJLA 1AY1H 1DQJB 4TQHA 3LKRB 1I9IH 4E42B 3T6XA