5I6KA

Crystal structure of copper nitrite reductase at 100k after 0.69 mgy
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
total genus 94
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6kA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6kA02
1BQ5A 1AIZA 1SHWA 2DWTA 3NSCA 1PLCA 2DY2A 1J9RA 3X1BA 4GXFA 4YSTA 3NP4A 4GP4B 3DIVA 4BXSV 2OV0A 3FQYA 4BWTA 1BAWA 2DWSA 2VSMB 5TK4A 2XX1A 3H4FA 3S3CB 2Y69B 1AACA 1QNIA 4NAJA 4HAKA 4W9ZA 2I7SA 3T71A 3NT0A 3TU6A 3WKPA 2FT7A 3DTUB 3FYIB 1ET5A 2DYSB 2TSBA 5B3SB 3EH5B 3FT0A 1L9TA 3NJHA 3ZBMA 1JZIA 3QJTB 3EH4B 2NRDA 4DP8X 1SHXA 1IBZA 1OE2A 2UX7A 3UACA 1L9QA 2PP8A 1SFDA 3BVDB 5I6NA 3AZUA 4A2GA 2XXFA 3OMAB 4DP6X 1BXUA 1ASOA 2GHZA 3QJSB 2XV3A 1GS8A 4HIPA 4P5RA 3NJKA 3GXUB 1KBVA 4YSPA 4DPCX 4ZK8A 5AZUA 1W6WA 1OE3A 1WS7A 2VW7A 7PAZA 8PAZA 2DV6A 4KNUA 1NIEA 4YVUA 1FA4A 2PPEA 3EHBB 4PAZA 5I6KA 3FU9A 1AS7A 2GSMB 3X1FA 1CYXA 1JVOA 2QDVA 1MG3C 4YL4A 5LDUA 3T6VA 4E9VA 2BP0A 1KCBA 1NZRA 2Q5BA 1PAZA 1NDTA 2VN3A 3G5WA 2UX6A 1ADWA 1R1CA 2UXVA 5E9NA 3FU8A 5PAZA 1PCSA 2BW4A 2CUAA 2J55A 1OV8A 3PAZA 4HHWA 2BWDA 5D4HA 1CURA 2JKWA 4HHGA 1GS7A 4JHVA 3ABGA 2GBAA 4E9RA 5D4JA 3SBPA 4HCGA 4AKQA 4YSRA 2XYBA 2PP9A 5IY5B 1TEFA 1SJMA 5TK2A 2BP8A 1V10A 4K9JA 2IDUA 2FQFA 4AI7A 5I5JA 1JZGA 4DPBX 1AZNA 1ASQA 5PCYA 2QT6A 1GS6X 2EIJB 1I53A 3JTBA 1E67A 2BP0B 1UATA 2P80A 3NYKA 3UGEA 2JFCA 4L0PB 2FTAA 1PZCA 1PLAA 2IWFA 2VW6A 2PP7A 3FSWA 3IN0A 4YVNA 1KGYE 3FU7A 3X1GA 3X1NA 4RH4A 1W6LA 4W1TA 3N55A 1NIAA 1X9UA 2YAMA 1WAEA 1XB6A 1ZDSA 3UADA 5F7BA 2BP8B 2ZOOA 5B1JA 1AS6A 2HZHA 4KO5A 5I5IA 3KW7A 2VSKB 1BQKA 1L9OA 4YSAA 1HAUA 3T6XA 2AFNA 6PCYA 2PLTA 4M3HA 4AKOA 1SDDB 1JXDA 3NJNA 1AAJA 3NJFA 1NPNA 2GC7C 4DP0X 1SF5A 2HXAA 1KYAA 4DP5X 3PPSA 1EZLA 1SNRA 1M57B 1J5CA 1MZZA 1PMYA 2BZ7A 4G7RB 3FU7B 3TBCA 2HX9A 3IBOA 4KNTA 2Y1AA 3WNJA 1JVLA 2IDQA 2AANA 1PZAA 2XUWA 2HX7A 3WKQA 6PAZA 1PF3A 2YXWA 3FPYA 1RZQA 2IH9A 1AOZA 3AY2A 1NWPA 3FYEB 2WSDA 1AZCA 3QJVB 2H3XC 2XXGA 4UAHA 4FAAB 4DPAX 1AANA 3CG8A 5B1AB 3ABLB 4YSQA 1OE1A 1JZEA 2UXTA 2ZWNA 1SF3A 4E9QA 2E86A 4KO9A 1J9TA 4BDVA 4E9YA 2AVFA 1B3IA 4E9WA 1GY2A 4KOCA 1ET7A 1EHKB 3SBQA 3HEIB 2R7EA 4TXVB 4KOBA 3QJUB 1BYOA 3NSDA 2GI0A 3ZX1A 2PPAA 4NB7A 1HFUA 1OCCB 2PCFA 4BK5C 5B7MA 1URIA 5AKRA 3MX0B 2CBPA 3CZUB 1XMEB 3EF4A 1WA0X 1NTDA 3QQXA 4CSPA 1OCRB 2J57A 2FT6A 2UXFA 3NJGA 1W8EA 2VM3A 1BEXA 1AG6A 3NSFA 5FC9A 1RCYA 3S8GB 4G7QB 3WI9A 4EF3A 4ENZA 4BDVB 1XB8A 2AZAA 3UABA 1ZIAA 5I5MA 1BXVA 2GIMA 4A2FA 3IE9A 2HX8A 2X87A 2R7EB 1NIBA 3NJJA 4A2HA 4NERA 1ID2A 1E30A 4A67A 4HCIA 2JXMA 2VW4A 1KDJA 2YARA 4YSDA 2H5UA 2ZONA 3SBRA 3PXLA 4P5SA 2N0MA 3ASOB 1IUZA 1GR7A 2CCWA 1F56A 4F2EA 2BWIA 4BWUA 2H47C 1MG2C 1A65A 4N8UA 4Q8BA 3OM3B 3S3DB 2YXVA 3TBBA 3ABMB 1SDDA 3ERXA 4FA7B 3QPKA 3SQRA 2PCYA 2HLEB 3OD3A 1CYWA 3H4HA 4BXVA 1A3ZA 1IBYA 2ZXWB 2IWKA 1BYPA 2BZCA 4UANA 3D12B 2BO0A 5B7EA 2DYRB 5I26A 3FPXA 1A4BA 3V9EA 5A7EA 1DYZA 1QHQA 2XVBA 3NJMA 1ZIBA 3WG7B 1TEGA 2P80D 5F7AA 3QJRB 2WO3B 3S8FB 1A4AA 1IC0A 1ZPUA 4AKPA 1JXGA 3C75A 1L9RA 1J9QA 5I6PA 2YAQA 3AG2B 3FSAA 3PCYA 1WS8A 3FS9A 1NIFA 4E9TA 1WA2X 5B1BB 5EHFA 1GY1A 1WA1X 3EH3B 4MFHA 4E9SA 3WNIA 2HRGA 3JT2A 1PZBA 4E9XA 3FQ2A 1JZHA 3AG4B 4HZ1A 3V9CA 2VM4A 1M56B 1RKRA 2YAHA 3X1EA 4AX3A 2IDTA 5B7FA 1KBWA 3PLYA 4DP4X 3TA4D 2IH8A 1OCZB 4PCYA 1E5YA 1ILUA 3T6WA 2IAAC 2B3IA 4DP7X 2AZUA 5I28A 3GYRA 7PCYA 1E5ZA 1M9WA 2I7OA 2QDWA 4A2EA 2A3TA 1ZDQA 4X4KA 3GDCA 1NINA 2W8CA 1E65A 2MTAA 4CSZA 1MZYA 4AZUA 2QPDB 1PNDA 2QPEB 3DKHA 1OF0A 4G72B 5I6OA 2YAOA 2UXGA 3NJIA 3CVBA 3FSVA 2XU9A 3HB3B 3MBWB 4F2FA 1OOWA 2CJ3A 1JXFA 1A8ZA 1CUOA 4YSSA 1TKWA 2FWLB 3ZIYA 2OCCB 3KW8A 4BWWA 4WKXA 3RYMA 3OQRA 1YLBB 2J5WA 1BXAA 5B1JC 2RACA 2B08A 4A2DA 1AZRA 1NPJA 2X88A 2XWZA 1L9PA 2XV2A 4HCFA 1X9RA 4GYBA 2GC4C 3AG1B 4YSCA 3AG3B 1QLEB 3X2QB 5D4IA 1IKOP 1SFHA 2CAKA 3PAVA 1OCOB 3T6ZA 1NIDA 4JKNA 1AZBA 2WO2B 1V55B 2BHFA 3OMNB 2CALA 3AW5A 1XB3A 3H56A 1V54B 2YAEA 1AZUA 4GY4A 1T5KA 1RZPA 4KO6A 4N4YB 1PY0A 3NP3A 1KV7A 1N68A 1J5DA 1PLBA 3BQVA 1A4CA 2MRYA 2EILB 2W88A 1JZFA 1CC3A 2OJ1A 1J9SA 2FQGA 2LLNA 2XX0A 5B1KA 2FJSA 1FFTB 2J56A 3IEAA 2FNWA 3CVDA 3WIAA 3OMIB 1GW0A 1ET8A 1GYCA 3FSZA 4UF7C 1AS8A 1JERA 3T9WA 2FQEA 4G71B 5ANHA 3UAEA 4KO7A 4G7SB 1L9SA 2XV0A 1BQRA 3NJLA 1JZJA 3UAAA 4DP1X 4DP9X 4A68A 4YSEA 2I85A 2Q9OA 3CDZA 1TU2A 2EINB 2YAFA 4QKTA 4QLWA 1HAWA 1DZ0A 2VMJA 3U25A 4Q89A 1JOIA 1ZV2A 2PPCA 3QJQB 3S3BB 2PPDA 2PPFA 4YSOA 2IDSA 2YQBA 1NWOA 3FQ1A 4A66A 3L45A 1VLXA 2HRHA 2IWEA 4DP2X 1N70A 1ILSA 4KNSA 1AQ8A 1KDIA 5I6LA 3ZDWA 1AR1B 4YSUA 2GB2A 4HALA 1ASPA 4WTQA 3IN2A 4JHUA 2EIKB 2FT8A 2BW5A 4G70B 3ASNB 4M4RB 1ETJA 3N2JA 1KCWA 3NSYA 2TSAA 4GP5B 1NICA 2YAPA 1PNCA 3TASA 1FWXA 3CVCA 2IDFA 9PCYA 1MDAA 4F7KA 3PAUA 2FQDA 3CDZB 5I6MA 2EIMB 1GSKA 2XLLA 1AG0A 3ABKB 4GP8B 5AFAA
chains in the Genus database with same CATH superfamily
1YEJH 4X5RA 2BJML 3OMZA 3MZTA 4Q56A 3BO8B 4F1ZA 4ONOA 3GMNA 1LQSR 2W95A 1JI1A 1U8IA 4NHCH 4PJXF 3BIKB 4OQTH 4B53A 4JM2F 4TRPL 3QDME 2VITA 3G5ZA 1KCVL 4IJ3C 4AGLA 5EBGA 1NCAL 3BGMB 4N28A 1HKFA 2E56A 4M6ML 4MJ6B 1PSKL 1LLAA 3FB8A 1YEDA 1IGJB 2EKSA 2BXYA 3BPCA 4F27A 1FORH 1L9TA 2VZTA 2XBZA 3TV8A 4AUJA 5KJRH 5CN3A 3P11L 1JMXA 4B9IA 1SHXA 4IRSC 1EBAA 3CFJA 4XC1L 4LLDA 1A9EB 1W9XA 1YMMB 3IU4H 1BD2D 4KQ4L 1PY4A 3L5XH 4Y89A 2B9AA 3OTTA 4A7QA 3CFUA 1T7VA 1KNOA 2XACC 3AU1B 3L08A 1JF1A 3OKMB 3RI5K 1QI4A 2YKLL 1GS8A 1DQQB 4HIPA 1R3HA 4F7MB 4KH2A 1NFIB 3DHPA 2VLRE 4PYGA 1GC1H 5C0AA 4BQ9A 4YFLF 5FGBA 2IH1B 5DVMA 3QHTC 4WO0A 4C59B 4JVPA 2PWHA 3DJTA 1R5IA 2V8MA 1KG0A 3NJVA 3A67H 4YLCA 2ZNXA 1UCBL 5IHZB 4PJAE 1CYXA 4D0DA 1G6RB 4FYSA 4K3JH 3MYZA 3HI6H 4ANXA 3TPUB 4Z7VA 3LB6C 4LK4A 5DO2C 2EYSA 2I60H 2XPYA 1NCIA 4LEOA 3ES6A 3KYNB 1S8DA 1CB4A 5ECGA 7FABL 5HVWA 2AJ3A 1K6QH 1QSFB 4S2SB 4HHGA 1DO6A 5I76A 4PBXA 4JHVA 2E76C 1RZFH 3LZOA 1ZTXE 1WT5C 3X12A 4QT5A 3SBPA 2OK0L 4NC0B 4JJ5A 3NUKA 1SJMA 2AQQA 3DYPA 4O02B 3BIAX 5SWZD 1FGNL 3DGGA 4HKJA 5F7WC 4TULH 2VKXA 1B2YA 3SDAA 1MPAL 4CN6A 4HJ0D 2Z91B 4XPTL 4NDMB 2K7QA 3P73B 4OGQC 3LEVH 2VISB 4G8FA 3UX9B 2WY3B 1BECA 1IIKA 4M7KH 4X7TB 5MERB 1F6FB 4LCCA 3QXDA 2HVKA 4ALAL 4Q4EA 5DVKA 1PZCA 3BEWB 2R51A 4PJ5D 1T2JA 1OSPL 4JLRA 2EXSA 1XBDA 2VW6A 3ESPA 4F93B 4MVBC 5D2LF 4M00A 4ZUWB 2YUXA 1AKPA 2BCKB 4NHUB 3A5VA 2CJSA 2FYYB 4XPHH 1NGXA 2YN3A 2F53D 3OAUH 3VYOA 1BFOB 1XB6A 1I1AB 1YYCA 2OS7A 2LTQC 4ZMTA 1O6VA 5EU6E 5GGTL 5J11B 5CEYB 3SDXF 4R4ND 4ES8A 1KGCD 3GSNL 3C6EA 5KOVC 3RURA 2VDQH 4MXWH 3CH1B 3I6GB 4AQEA 1KY7A 2WUCL 3A4AA 5D70L 1XO8A 5GS2H 5MEPA 1ZD6A 5EA0H 1CIUA 2DM4A 1DVFB 1VRSA 1J86A 1TPXB 4F20A 4PGDA 4DGYL 1OXYA 3BW9A 5JDSA 3DSFL 2YKKA 4LCIL 4Q6YA 1AP2B 1I8IB 4NRXB 1A1NB 2VDPB 3HE7C 5I1HL 2A0LC 1V3JA 1TZHA 1TJGH 4GS7B 4IOFD 4J3SA 4LHUG 2OQJA 1BAFL 4QTFA 1AQDB 3GPEA 4I3SL 4J5VA 4OLXL 2WNKA 1PDKA 3W0WB 5FECA 5BJTA 4N2NA 4J3XA 1D9KA 1KV3A 3FOLB 5KYXB 2G3MA 4PV9A 3TYFB 2IGFH 3L3DA 2V7HB 1E50A 3OKDB 5CZXD 3QJUB 5D9SB 5FO7A 5KN5B 5EC1B 1ECYA 2PPAA 4KZ0A 3OB8A 1CO1A 1K4CA 1YAZA 3CSPA 5E0FA 5EF0A 4MBRA 4OZFA 3VXTB 4XHQA 2C1PB 5KVGL 3D85D 4FHJA 3RZCC 3TBSB 1J9CT 3EF4A 4TUKH 3O3AA 1NMCC 1NLBL 1G7QB 1CGSH 2X1PA 3IXTB 1D5ZA 2QSTA 4PJFE 4F8OA 3JVGC 4GAYB 2GJ6E 3OPZH 4YBHA 4KRPD 5M95B 4I1RA 3L5JA 3AS2A 4DNLA 1NA8A 1BEXA 2AV7A 1YEFL 1YJDH 3CIAA 1YNTB 3NPSC 3GB7A 4EN3B 3IETB 2NUPB 4WDIB 4AOFA 4X8JB 1NCNA 3HG4A 3S6CA 1URZA 5GRVK 3BDYH 3KPQB 3WUWB 2W9DH 1JTPA 5AAWA 4YHOL 3RVXD 4A67A 1ED3A 4P4RB 5CSBA 2WJ5A 2MHAA 3LRHA 3Q6FA 3TNMA 2GBVA 4JZJA 4RLDA 5FYJD 4Y1AE 1LEKA 1MLCB 1REIA 1X5HA 3LKQB 2H47C 3KPMB 4AV4A 5JIQA 2H0FA 4R7NA 1OSYA 3GSNA 3WKYA 4AG4H 5DJ0B 2PW2A 2QMKA 3NZ8B 2EICA 2ZCKH 5CBEB 4OJFL 4FA7B 3LMJH 5DWPA 2EE6A 2HLEB 1JP5A 2QGBA 3ET9F 5GS1C 4GMSL 4G9FB 3NCJH 4H13C 1E6JL 3QXTA 2WTRA 5F1KC 5HHMD 1YYLL 1FL3A 3PJSB 5T8IA 4KAQH 5I0YA 3PWJA 2OP4L 3OX8B 3WLWD 2Y5EA 4A6YB 1LVEA 1TQWA 2XJLA 3FTGB 1CL7L 4H40A 3U1QA 4W9FC 2ERJC 1T80A 3FQ4A 3VNZA 3I2CL 4K8RL 1JXGA 3RX7A 4BE5A 4ZNEE 3FS9A 2ADJB 2Y4SA 3VFWB 3FHQA 1RIVH 3P4MB 4P23C 5D7JA 4QRSB 1LHZA 1S9VA 2DWDB 4G6MH 4ODSL 5D1QE 5D7HA 4Z6AT 4NWTL 1S9KC 2AQTA 3E1ZA 1DLFL 4ORGA 3ZK0A 2WWKT 2WNWA 1A7QH 5EU5B 4E9SA 3LKOB 4RFNB 4PJDF 4JPSA 5M94B 5JOPD 1JFQL 5BVJA 3FQ2A 4MYWB 2BS9A 4KJQC 3ZE0B 4XPGH 2E7MA 1NDMA 4X83A 4ANUA 3N1QC 1N10A 4FQPA 4DVRH 4EMZA 4KHXL 4OCSH 1HL8A 2HB0A 4KDVA 3EJUA 5I1IH 1OCZB 2EDMA 2IALA 2FH6A 2R4SH 5KS9E 5FW8A 3V52H 4DP7X 2CM5A 1QSVA 1M9WA 3CZJA 5E6IA 15C8H 5GSVB 3RL2B 2O6EA 5HYSG 1DEEB 1R3IH 2BOCB 2IV9A 4U0QB 1BAGA 3S88L 3GHEH 4JREB 4PB0L 3HB3B 1ND0B 3MUZ1 1TVBB 5HHVL 2PYFA 4X6DB 4XWOC 3V4PA 3LZLA 4OLEA 3VD2A 4Y2NA 3NGBB 2ZKHH 3KCPB 1OAXH 3VFSA 2XN9E 1LWHA 3O6FB 2NYYD 4PJGF 1QBMH 2NX5B 3OKKA 3L3GA 2UZXA 5ICXB 3GI9L 3STLB 3MZGB 3OHXC 4GSDL 1UM6H 3U2IA 2R2HA 3KLAA 4M7JL 3QZBA 1CU4H 3S4SG 3UTZB 2XV2A 1E9PB 1X9RA 2PTTB 4QRUB 4I5BA 4HQQH 4YSCA 3AG3B 3BP7B 3HFMH 5IEKA 4F33A 5LCVA 2CGRL 2J6EA 1T7WA 1H0DB 2YR3A 3TWYA 3HE6A 1NIDA 2VXUL 3FH5A 1LILA 3GLDA 4HIIB 4NZTL 3SE8L 5IHWA 1A5FH 4ISVA 4EBQH 2DLTA 1PLGH 4KY1H 1F90H 1MNUL 3MO1B 4OZ4B 2OCFD 3AM8C 1DFBL 4AIZA 1J1PH 4K15A 4ZD3L 1F86A 4U0RB 4C58B 2G3NA 4LVOC 3U2SA 3RWHB 1IM9A 3Q43A 1PY0A 4WFGD 1KV7A 1UD2A 2MRYA 1G6RL 1NM9A 1SHMA 2JSFA 4N3TA 4S0HA 2PW1B 3GXDA 3RQ3A 3HI1A 1CFSA 2X4SB 3KWTA 3UGUA 2HKAA 3IDGB 2BPBA 1WBXA 4X6CA 3RUGA 5DUPH 5FA4A 3UCQA 2VLLA 1LEIA 5AZEH 1L0YA 1D7CA 2Y2TA 3CVDA 3L2MA 4KJYB 3ZE1B 4YDLC 4JKWA 4NQEA 3KHQA 4IOIA 3RWDA 3QIWB 4LMQE 4N22A 4QF1B 1GYCA 3BPNC 1FRGH 1F6AB 3LN4B 5I66B 5AKVA 4NO0A 4OM0L 4HIXH 5LN8A 2E5EA 5L0QC 4AJYV 1BVZA 4DFHA 3IPEA 3SO3B 3ZHNA 2FRGP 1QO3A 5E8DH 1A02N 4GW5B 4ZPTA 2ZKMX 4BZ2H 4Q2ZA 1H8SA 3H55A 4H0HB 4XE0A 3LHPL 1KIRB 4X5WB 3ZUNC 5FGBC 1IBBA 5DJ2B 4P2OD 4PVMA 3O8XA 3GKWH 4YGVB 2O5NA 2YBGA 2P45B 3TFBA 1MIEH 5EC2B 2XTJC 4PTUB 2WHVA 4YSOA 5IMOA 1FIGH 2FO4A 2NYKA 3EZ8A 4Y9CA 1JWSB 2QHRL 3ARED 5F72S 2XJKA 3MROB 3E8UL 1IMHC 3BO8A 1BBDL 3FXIC 4I18C 2R29A 5SWZE 2UWEE 1JZDC 4IMLB 4ZX6A 2APBA 3BIKA 3IN2A 3D2UB 1QMUA 3ZU8A 1EEZB 3S36H 3BGMA 3BSZA 1XGUB 4XBEL 4FL4B 1KCWA 1X7SA 1JGDB 2P7TB 3NSYA 4MJ6A 3MJWA 5IEHB 1IGJA 2DLGA 2QQKL 3S37L 5I1EL 5T1LD 2D9QB 1SXAA 2CMRL 2Z31D 4F15C 3LKPB 4I9WE 3QRGL 3GWJA 4AQOA 4G11A 1A9EA 1YMMA 2QSQA 1MFCL 4PRIE 5FS5A 4KMLB 1JF5A 4XGZB 4P2YA 4Z7WE 1U36A 3AU1A 2DY2A 4MAUH 3SYOA 2N01B 3OKMA 4QXUH 2F9BT 4LCCC 4ZUVB 4BV1A 1J10A 2F19L 3T2OA 1DQQA 3NP4A 2BVTA 2P8MB 2UZIH 4GSQA 4HEPG 4BFBD 2H32H 4F7MA 2FHBA 5JXEC 5EF2A 1NFIA 3C5ZA 1A4JB 1OARL 4CSTA 3QVAA 2IH1A 2VDPL 2XWCA 5IMMB 1JL8A 1TCMA 2L7UA 5DVNA 2R23B 1CLVA 1MUJB 4PI0A 5IHZA 3IMUA 5BMFH 3NIDB 1G6RA 4YC2B 8FABB 3TPUA 3ZTEA 5FYKD 1GGTA 3MFFB 2OCJA 4NQCB 2X89D 1DDHB 4JHWL 4WI7A 1HEHC 3KYNA 3AZUA 4GRWF 5AKSA 5DFWH 3GS7A 1QSFA 1BXUA 1B6UA 4M6OH 4S2SA 2GHZA 5LXGL 1TZGL 1AHWC 2XV3A 3R06B 4GBXB 4HXAH 5L4IA 4XCCL 1GYVA 4ZOAA 4XNYH 3MOAL 2E7LA 4O02A 1OE3A 2ADYA 5FM5M 8PAZA 3G6JE 2C9QA 1HZKA 3WIHA 2W38A 2K3HA 2WP3T 2Z91A 4NDMA 5E5RB 4XCFH 2VISA 1C16B 4Z7AA 4DQOL 4QTIL 4I1PA 3D33A 1P7KB 3P77B 3CK0H 4X7TA 4ZUUB 3KBFA 5GPRA 5MERA 3AWGA 1Y7VA 5IR1B 5T1DH 3BEWA 4NBYB 3H6AA 2QHLA 4W9KC 5J6GB 2BW4A 4ZUWA 3ARGC 5EN3A 4PCTA 1TNMA 2EDYA 4H8WL 2BCKA 4NHUA 4YK4B 2FYYA 4D2NA 5D4JA 3E1F1 2RCSH 5T1MB 5DZLA 5TE4L 1BFOA 1I1AA 1U91A 1U6AH 1Q9WB 2DWXA 3L9EA 3ZE2B 1GPOL 1MHCB 4H8QA 4NZDA 1X5ZA 4FFZH 4U1SB 2NCEA 1N7ML 2ESVD 2H2SD 3D5OF 2GSIB 5CEYA 1E4WL 4MLIA 3T0ED 3D51A 1CXLA 2YHGA 3CH1A 3I6GA 4LEXH 2X40A 1E67A 4YHYC 4BCYA 4FQLH 1E4XH 4ZAKD 4KWUA 3SGDI 2VZUA 4L0PB 4XBGA 4PW3A 1UG9A 4J3WA 2FEDC 3V0AC 3VXSB 4OI7A 1DVFA 1D6VH 4ALAC 5TPWL 1HESA 3ARZA 1FH2A 2NCMA 4BINA 1O7VA 3CSBA 2BFGA 1YNKL 2NY5L 1F5WA 5DS2A 5JR1L 1AP2A 1I8IA 4IDLA 4NRXA 3CN3A 1A1NA 3PJLA 4BFKA 5JYMA 5KVEL 5AAWC 1KTJA 3Q0HA 1KTBA 2O5ZH 5DZAA 3O6KL 1PS3A 1D5IL 1HU8A 5JLZB 4LSDA 1AQDA 1TVDA 2HJKB 5J12C 5HHME 3I3DA 3B9EA 4HISA 4FZ8H 4ODVL 3T6XA 2V0AA 3W0WA 1KENH 2H0JA 1A7NL 2J1ZA 3Q1SL 4L5FE 2F5AL 4N5EC 3MODL 5EPMB 4QDGA 2Q0ZX 2QADD 5K5YA 3FOLA 5KYXA 3V6ZB 4DTGL 3V0EA 1MI5E 1WC7B 2IG2L 3QG6B 4DOHB 4JFFD 4DP5X 3TIEA 2V7HA 5D9SA 5KN5A 1QPKA 2NY6C 4XNAA 3SE4A 5EC1A 2BZ7A 3BKYL 4HGWB 2WXQA 3VXTA 3E9UA 2C1PA 3IMBA 3U9PH 3TBSA 1YEKL 4JPWL 1WV7T 4POYA 4G8GD 4OY9A 4QKXB 1TLMA 3IJYB 4XO4A 1G7QA 2QV2A 3RY5A 3IXTA 4LOUD 4X7SH 2IJ0C 4GAYA 1V3KA 3MACH 2WSDA 5E70A 3SBWA 4AQAB 3DV6B 4PP2B 3CG8A 4OCRH 2CK0H 4WO4B 1YNTA 3RZWA 3H7BB 4EN3A 2QVMA 1HILB 2P5EB 3MNDA 3IETA 4WDIA 2ADGB 3AQYA 4P2AA 4X8JA 5AVTB 4LSUH 1KBBA 3FUJA 2FD6L 4MZ3A 4N0UB 4DK5A 1BYOA 3O4OC 1ZV5A 4U1MB 3KPQA 4NBXB 3WUWA 1L9MA 4DKEH 4P4RA 5K9JL 1IC4H 5ADPL 3K3QA 2HUEA 3F84A 1WH0A 1ODUA 3MRQB 2WZPD 4MJHA 1MLCA 4PWIA 4I0PD 4Y19D 3LKQA 3OWEA 3KPMA 1NCGA 5DJ0A 4KTDH 3KR3L 2GKIA 2J43A 3CQFA 3PS6A 5I73B 1FAKT 3NZ8A 4KKNA 5DMJB 3VXQB 1OAYL 1CR9H 3LJ3A 4KKQA 3B2UC 5DHVH 4IGBC 2JKIS 5CBEA 4ONFH 4R5TA 4HG4K 2WTOA 2AZAA 1ZIAA 4FG4A 1RZ8B 1BXVA 4G8AC 4G9FA 4YUEH 4BYHA 3PJSA 3V4VL 3KPSD 3M17B 5BNXD 4NEHB 1E30A 3OX8A 2EYTB 2NY0B 2OLDA 5CJBA 4A6YA 3ZMRA 3T0VA 3FTGA 1MCFA 3L1OL 3SBRA 4QCIB 3PXLA 1UA6H 4ZFOB 2N0MA 1Z9OA 1IUZA 1FVEB 4KVNH 5FV2A 1B88A 2ADJA 4XN7A 3B5TA 3RDTB 3HG1B 3RIFK 3VFWA 3P4MA 4QRSA 2DWDA 4GT7A 1N8OE 1W80A 2E3VA 4XMVA 4HUUB 1TFHA 4FYRA 4QXGL 5EU5A 2XA3A 3LKOA 1OSEA 1IGCL 3JSSA 4G7VH 1KJ2B 3KBHE 1UACH 2VXQH 2JJVA 4R8WH 3BWSA 4UANA 3HRZC 3FB5B 2F7RA 4PG2C 4UM9D 1O7DE 2PWGA 4YXHL 2OSWA 1FNGB 3HZYB 32C2A 4WCYL 4CU7A 4Q9RL 1EDYA 2IAMB 2VR9A 5KW9L 2K7PA 4OJCA 4NO3B 1ZPUA 5FHBH 2WLMA 3VGEA 2ENQA 5GSVA 3RL2A 1T03H 4K8RC 3D39D 1BJ1J 1BOYA 1DEEA 1UUSA 1ERNA 1PU0A 2BOCA 3TOPA 4PJFF 4OZGE 2A9BA 4G3YL 1HT6A 4LIQL 4Y4HA 4AIXA 4K7FB 4QGYA 1GHFH 3EYSH 1ND0A 3BRFA 3L7FA 1TVBA 2VDLH 2NY7L 4X6DA 3AT8A 4LQFH 4JQIA 4EIBA 3KCPA 1YPZE 2BFVH 4HX1A 5IB1B 4APXB 3O6FA 5CP7B 2F7QA 2IV8A 3BRDA 2IC2A 2N59A 2WXMA 5C0BD 4X98B 4J2XA 2NX5A 1X6LA 3LRSB 5ICXA 2AZUA 3IF1B 5EZLB 2Q87A 1BJ1H 1TQBC 3MRHB 2F1EA 3LNIA 3UTZA 5C97A 4DW2L 4NQDB 3MV8B 1E9PA 2Q2EB 2A9AA 3PWPA 2PTTA 4QRUA 1XCQB 4X6FB 2BINA 3BP7A 1FH5L 1NBZB 3TT1L 3KHOA 1SMOA 3DKHA 4FKEA 3V5HA 4JFDB 4WI5A 3SE3C 1H0DA 1S7WB 1RPKA 2GIXA 5L88L 3VD1A 4HIIA 5D5MA 1B2WL 1RIUL 1AFVH 1G4RA 4QRRD 3GSXB 1Q0YH 3MO1A 5E6UB 3SODB 1FCCA 4X6BB 4BIKA 3VYPA 5LJYH 4LOFA 3RWHA 3QPQD 2DMCA 3BYYA 4YO0B 1NUGA 5JNYB 5BS0D 4KJPC 1BPLB 3KPOB 1FP5A 2ISDA 2V2TB 3MVSA 3U7AA 1RAMA 4OCYL 2PW1A 1SM3L 3EJJX 1XZWA 1LTXA 2X4SA 2YEQA 3VFGL 4JGNA 2BVOB 1QNZL 5CILH 3EJRA 3O2VL 1UWGL 4KJYA 4L0ZA 5EULV 3TV3L 3QR0A 1UWEH 3X2QB 2WXLA 3HAEG 2Q7YB 2CAKA 2VKWA 1H5BC 3QIWA 2E59A 2HRPH 4TPRH 4MRCA 2PYEB 2WCPA 4QF1A 2EO1A 3LN4A 5I66A 1V55B 4JG1L 1TNNA 5E2JA 2HT4C 4IBLT 1NBYA 3CVHB 1TQSA 3SDDD 5CBAB 2Y7SA 1TKWB 4FI6A 5F9WB 2EXYD 4GW5A 1R0AH 2B2XL 3WEBA 4X5WA 1KIRA 3BPOB 3QWNA 4EUPG 3GRBA 5DJ2A 4OF5A 2LABA 4YGVA 1OP3H 1ZXQA 2FJHB 3CZLA 1EX0A 5EC2A 4PTUA 1UB6A 2E0PA 2Y07H 1V7NL 1JWSA 1QFHA 4F7TB 3BRGC 1MAMH 3MROA 4AEHL 5HYIA 4X50A 4KTEL 4IMLA 4HPYL 2WXFA 1JXJA 3P2DA 4Z3FA 3EOTH 3D2UA 1EEZA 4LSSH 1VACB 4F91B 1XGUA 3NFSH 1PKQB 2MJWA 3IFOB 3VFRB 1JGDA 2P7TA 4JEGB 5IEHA 4WK0B 4HEMA 5ITFB 5DJ8B 2E7LC 2LHAA 4DP9X 1IC7L 4Y5YB 4NQSB 4YSEA 3ESVF 2I85A 2DKUA 4Z76B 3LKPA 5T33L 2AMUA 4GKZB 2BNQD 1QTSA 1P6AB 2FAUA 3FHAA 3MFGB 4FP8L 4U3SB 1SY6H 4XGZA 5HDQH 3TF4A 2DQTL 2J88H 5KJ7E 1T4WA 4B7LA 3GSOA 3TJEL 4ZUVA 2QBWA 5HYEA 1HKLH 1MFEL 2P8MA 4AK1A 2ESVE 4WHCA 1MCEA 2MQ0A 1IM3B 4DKTA 1U3ZA 2B5IB 1A4JA 1DL7H 3B3IB 4HUWB 1A3QA 5IHUL 1RD6A 5IMMA 3LRMA 3CX5J 4NN7B 1ZVSB 2AV1B 1QRNB 2J4WL 1L6ZA 2R23A 1B9ZA 1BM3L 1MUJA 2CO7B 2LAAA 5CU5A 4F7KA 5LGHL 2L7EA 5EORL 3CVIL 3MV9B 3MLZH 8FABA 2EIMB 3H7LA 1HHIB 3MFFA 4NQCA 5D2NC 5EF3A 1DDHA 1NUDA 5JDJA 4O9HH 4LESA 4PV1C 1A25A 2B3RA 3NSCA 2L4OA 3Q8BA 4G6AD 1UADC 3NCWA 4A7SA 3VD4A 3SKJL 3VU1A 3R06A 1EUTA 4GBXA 1IEBB 3S0PA 1BAWA 4LHUB 3L5IA 3SD5A 1NKGA 2D7NA 1QNIA 4MS8C 1A2YB 3B2XA 5GZOA 3NRFA 1WICA 4IRJB 3NCYP 3TA3D 5J89A 2ZG2A 3BH4A 3QRBA 4PR5A 1HL5A 2WVTA 3DK0A 4X5PA 3FT0A 3NCCB 1C16A 3C6LC 1P7KA 2WOBA 3P77A 5HDBE 4ZUUA 3CBJB 3HPJB 5GRUH 3UACA 3LZRA 3MMEB 5IR1A 3GS4A 2DQDL 5DDHB 4LDEB 4MAYD 4X5LA 1N12A 1ZT4B 3CBKB 1EHLL 1HL4A 5J6GA 3WLBA 4K3DL 3PNRB 2KPNA 3U46B 3GMMB 2FB4H 4A38A 4UQIM 3KG5A 5GS2D 1KB9J 3SE4C 5T1MA 1QUPA 2HN7A 4KITB 2BJMH 2Y9RT 5AZUA 1Q9WA 3RHWK 2DV6A 1MHCA 5JA8B 1G5AA 4U1SA 4B5ZA 1MRDL 1N67A 4TRPH 2GSIA 1KCVH 2VL5A 3VFMA 1NCAH 1WCQA 2YRLA 2YPVA 4M6MH 1PSKH 4PSPA 3UTTB 1O5DT 1MCKA 3G5WA 4JKMA 3ZDYE 4CUCA 1T5WB 4N8VG 1DANT 3VXSA 1TZAA 3D48R 3GRWL 4ZZKA 3P11H 1N8ZB 4Z7WF 1K2DB 3CZKA 4XC1H 2R8SL 4HJUA 4KQ4H 4NQXA 4E9RA 4HS6B 1JCKA 4H8WC 4AYGA 5JW4M 1FG9C 4MXVE 4DFIA 5H2BB 4BZ1L 3JBG7 4ZFOL 4NYLB 5JLZA 2HJKA 1AZNA 3DDGA 3QIUB 4PJIF 1NSNL 1SLXA 1E27B 3KPSE 5T3XL 4ELKB 4P46B 4FNRA 3RVTC 3SPVB 2X6VA 4PGCB 1ZVHA 3DX6A 2A5UA 3EJQA 4PVLA 3V6ZA 2WKGA 3L4CA 1ZLWK 2ZOWA 1WC7A 2VLME 3QG6A 1K4DB 1UCBH 3QEQB 4UTAA 3QUXD 1NGYB 4IOSD 4Z77B 1E2WA 3IK2A 3GK8L 3U4BL 3WJJC 3D0VA 4DF9A 5B3JE 4V1DB 2JCCB 2NY5C 3IJYA 7FABH 2CA3A 3P0YL 4JG9A 2BP8B 2HT2D 3G6JF 4AQAA 3DV6A 4PP2A 1MCLA 2VDOB 2OK0H 3ARFD 4X9FA 2HKHL 4OZHB 4WO4A 2BVUA 5C1MB 2LV4A 4AKOA 4NZ8A 1AAJA 3H7BA 1FGNH 3G5YB 5I18L 4XT1C 1HILA 2P5EA 1DQJB 2YD5A 2ADGA 1MPAH 2ZXCA 4UZUA 4XPTH 4WNSA 5KSUA 3W11D 4N0UA 2PUQT 2V3FA 1EZUA 4IBWA 2WZ6A 4TSAL 1P9MA 4U1MA 5EH1A 5JUEL 2VR6A 5C2BL 3DO4A 2ZKXA 1SOQA 3AAZB 4U1GB 4ALAH 5HYSB 1XR8B 3WKQA 3MRQA 4ZODA 1GZQB 4WNQA 4C83A 5IM7B 1OSPH 2VZVA 3SN6N 4W70A 3KD4A 4F8QA 4K0OA 4XNBA 5DHYB 3VMNA 2UV3A 4WI3A 2VH5L 1AGCB 3QHZL 1AZCA 2GW5A 1U9KA 2D7TL 1EGJL 2XXGA 4PWHA 1DVTA 4DPAX 1Z1WA 2WWNA 1J1OH 2D31B 4QOKD 2WV3A 4CDHA 1SF3A 3N42F 2E86A 3Q5YA 1F02I 1I9EA 2P8LB 4M02A 1RZ8A 3GEWB 4FQIL 5GGTH 5HI3C 1OB1A 4OSUL 3ZYOA 2NXZD 1RUQL 3GRWA 3QI9B 1D5RA 4FKHA 4JREC 4CC4A 1RUKL 1Z3RA 3FT3B 1FSKB 3GSNH 2V5MA 2OMZA 3HB3C 4JZNB 3M17A 1SXBA 1C12B 2IANB 1UQSB 2EYTA 1WUZA 2WUCH 1DJXA 1OCCB 2M83A 3AABA 1X4XA 3NGBC 4KJWC 4HWUA 5D70H 5EB9A 5F6HI 1YEEL 2Z9TA 3S5LG 2Z92B 3S4SB 3TLRA 4U1KB 2B16A 4QCIA 1JZ3A 3ESOA 5FX3A 4IKKA 5E8PB 4ZFOA 1WA0X 3BP5B 1FVEA 3D52A 3JZYA 4DGYH 3RDTA 3HG1A 2ZX5A 3RGVC 5HY9B 3W3BA 3DSFH 4LCIH 4LLQB 1OTUD 4HUUA 1J1XL 3NSFA 5I1HH 4ZUSB 3MGOB 4NN6C 4FE9A 2AI0H 1FLRL 1I8UA 1PIFA 2WLJA 1EJFA 3COOA 1KJ2A 2BY0A 1BAFH 4EI5C 1UC6A 1WFIA 1VEMA 4I3SH 5IV2B 2WBXA 1E5UI 1XEDA 3FB5A 4CC0A 1CIDA 4OLXH 4ENEC 3HKZA 1CE6B 1FNGA 3HZYA 5ABZA 2VW4A 2Z1PA 2IAMA 2YARA 4NAMA 4YSDA 5IHBA 1BPVA 4NO3A 2F18A 3PFQA 1GR7A 2CCWA 4LKCB 5C71A 4C8XA 4JDTL 1VPOL 5DFAA 1K5WA 4QI3A 2PWFA 5JPNC 5KVGH 2EDRA 3MCYA 4HUKB 5F1SA 2YXVA 3T2PA 4WEMB 5IJVB 5DJYA 1NLBH 2MKLC 2Y1YA 4TLSA 1CLZL 4YMPA 2C4FT 5F3HB 4MXQC 4XPBL 1CYWA 1J0KA 3HMWL 2VXVH 4ELDA 2XQBL 5BRZD 1OWWA 5I24A 1PZSA 1YEFH 3KS0J 3NIFB 4APXA 5CP7A 4PJCB 3U2JA 5I26A 5AVSB 1R75A 3RL1B 4X98A 1HHGA 3DETD 1M7DA 3LRSA 2K3TA 1SJHB 4B0MM 3C12A 2FLBT 3IF1A 5DJCB 5EZLA 1Z32X 5AW9B 3MRHA 5K9QG 1VEPA 3E8VA 1A0QL 1DR9A 4EAEA 1PD6A 4W9GC 3ZQXA 1PW3A 3MV8A 4YHOH 4XO3A 1UGNA 1XCQA 4X6FA 5E1QA 4DETA 5D7LD 1CN4A 3ILQD 2HG5B 3RUGE 1NBZA 4JFDA 4H8PA 4KV5F 1S7WA 3BN9C 4NQEE 4L3CB 3KS0H 3LS5L 1QYGH 3EYQC 3JT2A 2B39A 2ROXA 4F57L 4L1SA 3GSXA 3F7RA 2IGLA 2VABB 3S2AA 1J8KA 4X6BA 4OJFH 3P2TA 1FZMA 4DP4X 5SWSD 3TFKC 5JNYA 2IBZX 3OZKA 4YO0A 4GMSH 1AXSB 3T6WA 2IAAC 1BM7A 4U7KA 2PXYC 1E6JH 4HJ1A 3DECA 3NIGE 3KPOA 1UM4L 1KXVA 1YYLH 4GRLB 2V2TA 4D9QE 2A3TA 1IL1B 1I1RA 2OP4H 3VFPB 1VIWA 2F54B 2BVOA 2ZCHL 2BIPA 3VWKB 1CL7H 4DGWC 3MLUL 1UZ6F 1UOVA 3I2CH 4K8RH 2F6AA 2Q7YA 4UV7L 4RMSA 1TT6A 3WO3B 3QARA 4KC3B 3IDYB 1JVKA 4XAWL 4HC1L 1NMAL 2PYEA 3VUAA 4Z76A 4UOW0 3UYRL 4ODSH 5JW5B 3CVHA 4NWTH 5HHOD 2HT3C 5CBAA 1DLFH 4OIFA 1TKWA 2Z8SA 4HGMA 1RSFA 2APVA 4JPKL 1JFQH 1TJMA 3O4LB 1MCNA 4W4OA 4GIAA 2IMNA 4EVNB 1I75A 3VRLF 4I13B 2FJHA 1FAIL 1VSCA 1R24B 4KHXH 4U1NB 4B5EA 1MELA 1NPJA 4KXZI 2YRPA 4C56E 1YMME 4F7TA 2WAQA 4KDTA 3ROOB 3S36X 5H8DA 5I82A 5I30L 4OZGF 4GUCA 3PAVA 5AAMC 1CE1L 2O6DA 2IOMA 3WL9B 3BGAA 2PMZA 1VACA 1PKQA 1XB3A 3S88H 2HFFB 3BESR 3IFOA 5CU9A 1YPZF 2BNRB 1I7RB 1AZUA 2D4DA 2E6PA 3UTSD 4PB0H 4D7PA 2O93L 5ITFA 5DJ8A 2Y22A 3NFNB 1KEGL 2C9VA 4Y5YA 4NQSA 5GZOC 4JFEB 3FQWB 4ESKA 2OXHB 2WGNB 1WISA 2WM0A 3KNBB 1J5DA 4OCXL 3SGDH 3BSZH 3UMNA 4H2AA 4U3SA 5G55A 4NIYE 3GI9H 5LQBL 2HVJB 4GSDH 5IQNA 3U0PA 5TE7L 1TQCC 1GW0A 2CDFB 2B14A 4JM2B 3FK3A 2H1PL 1IM3A 4KTGA 5LBSL 1ET8A 3EYVB 4WJ5B 3ZT7A 3B3IA 3FSZA 4HUWA 5C6TL 1OW0A 1EFXD 3QC5X 5JHBA 2CGRH 3MN8A 4NQTA 4NCDA 1ZVSA 2AV1A 1QRNA 2I69A 3CMOL 3ZJAA 1ES0B 2VXUH 3BI9X 2CO7A 4NZTH 3SE8H 3K6IA 1V3MA 4UAOB 3MLWL 2I26N 3MV9A 3DO3A 4PUBL 1MNUH 5AW8B 1HHIA 4JFQB 1DFBH 5I8EB 5HGBA 1F41A 5D72L 4ZD3H 4KZEL 4A39A 2IBZY 2BZDA 1J0JA 4NM4L 5C09B 5A16B 4LAQL 4OF7A 2IWEA 4Y4FA 3BDXA 4ZQKB 5DEJA 4F5CA 2Q86B 5EEUA 3DJ9A 1GIGL 3FN0L 1G6RH 1OF2B 3AB0B 4U1HB 5FWQA 4IKJA 3F3HA 4WTQA 2HYMA 3KLQA 5C7ZA 2FT8A 3WKNA 1UH4A 4LHUA 2MKWA 2XOTA 3VU2A 4D0CB 2IF7A 4IRSD 1A2YA 2HH0L 3IU3B 3N2JA 2WLKA 1C7SA 4GP5B 3LKRB 3Q5TA 4XMPL 3US0A 4IU3A 2RQEA 3W37A 3O9WB 1T1ZB 1SVZA 3N0AA 4ZXBB 3Q3GB 4YXLL 1I4FB 4OCMC 3QXVA 4LL1A 3ZVVA 2VOTA 2YLHA 4YHLL 3HPJA 3MMEA 3BVDB 4UT6L 5DDHA 2YD7A 3LHPH 4JRXD 1ZT4A 2GY7B 5IJKA 3U48A 5D6CB 3LPWA 4WGWB 2VZOA 3U46A 4UQAA 3GMMA 2AITA 2XKUA 5MHSE 3UG4A 1GH7A 1NCJA 1QABA 5CLZA 2ZXAA 2QHRH 2NT1A 3S3CB 1IC5L 3E8UH 3LB6D 4TMPA 2JKRM 3CN0A 5I1KL 2HJLB 2XWBB 4DHLA 1FV1B 2C9RA 1C1EL 1M7IB 4UT7L 2GK0B 4QY8B 4XBEH 1UXSA 2Z34A 4DP8X 4LDCA 3W0WE 3UTTA 5JPMB 3HUJE 3S37H 2QQKH 2BVPB 5I1EH 1DVSA 2PP8A 1OIOA 1T5WA 3H9SE 2CMRH 3RTQA 3TCXA 1DQIA 1N8ZA 3KH3A 1K2DA 1J87A 3QRGH 1ASOA 5LBSA 3QJSB 3JWNE 3ETBJ 1JYNA 2XIIA 1MFCH 4HS6A 2FECL 5ISZD 5C9KA 3BD3A 4FFVC 1KXQA 3ZDZF 1BZ8A 4QOKE 5H2BA 3RFZC 1A1OB 1J8RA 3DVNB 4WEBL 4JB9L 2F19H 1K85A 3SDXB 3EHBB 1WITA 3NRPA 3QIUA 4PHXA 1JPTL 1E27A 1OARH 4MVBD 1HSBA 1ZJBA 4ELKA 4G2AA 4P46A 1TJHL 4L3EB 3SPVA 2VDPH 1H3XA 1TTRA 4PGCA 1ZLVH 4RBPH 1KCBA 2DMKA 3BZDA 1X4YA 2M2DA 1K4DA 5LN4A 3QEQA 1NGYA 4Y5XC 3MA7A 5IESL 4LF3B 2OZ4L 4JUTA 5TF1L 3HVNA 2WQXA 4ECNA 2JKWA 4YZWA 2APXA 3V6OC 3HG0A 1GKOA 4JHWH 4OTXL 3EOBB 4V1DA 3BX7C 2JCCA 1OP5H 3RKPA 1PFOA 2BVYA 4DN4L 1DO5A 2NY0C 3I75A 4FGMA 5LXGH 2BP8A 4G6FD 4NC1E 3D05A 1TZGH 2BS8A 1KT2B 1CGXA 2IDUA 4K55A 4XCCH 5E2UL 5MP6L 3MOAH 2AXWA 1HL9A 3VVVA 3QNFA 5E6RB 5MENB 3FBKA 3G5YA 2BP0B 3CDGB 5JHMA 1WF5A 1ZLUH 4G9FE 2VDML 2A0LD 2AK4E 2EDLA 2WBJB 4DQOH 1XWVA 3I85A 4QTIH 1LMIA 4DCQA 2UUDH 2V2WB 1WBZA 3UAFA 3IJHB 1UD5A 3AAZA 4QJ5B 3BVTA 5HYSA 1W6LA 4ACPA 4D8OA 6CGTA 1XR8A 4ZFGL 2EVIA 1GZQA 5E00B 5IM7A 4ZOCA 4N25A 4IDJL 4O58L 4Y2OB 3WNMA 4XCNA 5DHYA 4H8WH 1AGCA 4QRFA 5BRZE 1NFDA 5H35B 5CLWA 4HPHA 4MQ7B 2JELL 2D31A 4TF4A 1U8KA 5TE4H 1PGRB 5EZPA 4TUOB 4MDRA 1KB3A 3PL6C 1GPOH 3F05A 2WPGA 2P8LA 1S7VB 2AVGA 2NXYC 3RZCD 1WBYB 1SEBB 1E40A 1N7MH 1YUHB 3AXIA 3QI9A 1E4WH 1PG7X 1R6VA 3FZUC 4IBZA 4N6RB 3FT3A 1M57B 4JZNA 3ZDYF 1C12A 2IANA 2NSMA 3MRIB 1SOSA 1MWAB 1UQSA 3IXAB 2NY4B 5D7LE 3S4SA 3WEXB 3BQUC 5A2JH 5AUMB 2Z92A 3MBXL 1JVLA 4U1KA 4WSGA 2VQTA 1AE6L 5E8PA 3BP5A 3DUUB 5TPWH 1ADQL 2IH9A 5TJWK 4HHAB 2ZAIA 1E7VA 3ZSSA 4MXVF 3NABL 3EG9B 4FZEL 5K1VA 4PI2A 5HY9A 1YNKH 2NY5H 3ATAA 4N90D 4PRPE 4KI1A 5EV7A 5JR1H 2YD4A 3ARBC 1BZEA 5KVEH 2NYZA 4OF0A 4Y16B 4ZUSA 3MGOA 4BHUA 1A6TB 4KO9A 3O6KH 5KZCD 4KOCA 4R0LB 5IV2A 2DI8A 3JV0A 4ODVH 4JRWA 5JO5B 1A7NH 3Q1SH 5C7XL 2F5AH 1CE6A 3MODH 5C08A 3OF6A 2EH7L 4K5MA 3T1FB 4LRIC 2VO5A 4DTGH 5E08L 2IG2H 1BX2B 1JAEA 3FRPG 5E9DB 3W56A 5DD6B 2DZEA 2VM9A 5KBLA 2N7AA 2P5WE 5B3JF 4CILA 3BKYH 1F97A 4LKCA 5G4NA 3HAEB 2CRMA 2ZZUT 3PWPE 4L0YA 3LZNA 5F97E 1YEKH 2PABA 3IRZA 4JPWH 5IJVA 4XI5C 3KEDA 2ZWSA 3A0OA 2GPZA 5F3HA 4IS6B 1CK0L 2HTLC 1QFPA 1XGRB 2G4EA 4EF3A 5HHNB 4G42B 4BDVB 3CHXA 4RA0C 3B1TA 3ISRA 2D0GA 5D5ME 1I3VA 1OGPA 2VLJD 4EUPB 4ABUA 1Q0XL 3H42L 2FLMA 2AGJL 4PJCA 5CSZB 2ITCB 1ROCA 1JWMB 3RL1A 4PJ9C 4P23D 2DICA 1SJHA 1SYSA 5DJCA 5F9WC 2FD6H 3QUML 1M05B 3ASOB 3CAFA 1ZKAA 4R2GB 4W4OC 1N26A 1QSEB 4KJQD 4LVHB 1TMCB 3APDA 2OYPA 5ADPH 1JFHA 2HG5A 5L2KD 2Z3FA 3TBBA 1EO7A 1J18A 4L05A 2ZOTA 3UTSE 2DIEA 1Y6MR 3ZSTA 3HC2A 4L3CA 4UNUA 5FF6A 3UL4A 3KR3H 2R1YB 4ZZFA 2IADB 1E2VA 3QIBB 4RGNC 1OAYH 1S2EA 2MCAA 3TO4C 4PJGB 2N1TE 2BO0A 2DYRB 4LLWB 5J6SA 4DO5A 1Z0MA 3K6OA 2V5SA 2VL4A 3GTTA 5F3BB 2JJUA 2ZT9C 3C87A 3QFJD 1A6ZB 3QUZC 4XXDB 2P80D 1I3RB 4I0KA 2R4RL 4GRLA 2KUTA 3V4VH 4AJWA 2GCYB 5E7BA 1IL1A 2A83B 3HG3A 3H1ZA 2MFNA 3VFPA 2F54A 4FULA 1BJ8A 4XWOD 1CD1B 2IBGA 4TNEA 4E36A 5A7BA 3OJVC 4ELMF 4HEPA 4CMMB 4UI2A 3A24A 3ECBB 4FXGB 3L1OH 2QKIB 3L6FB 1USQA 4PLJC 1QFWI 2FECI 3FUDA 2YA0A 1PY9A 4PRHD 3VXRB 2MOQA 3VO0A 4MMXB 5JW5A 3AG4B 1U2HA 2J1KA 3NCEB 4IIQB 2VM4A 4JO4L 4QXGH 4AX3A 5IQMA 3Q13A 5B7FA 4HAGA 5I1LB 5D7IE 2IH8A 4AQ8C 2CIIB 2HTKD 3DHJA 3O4LA 1FO0L 4FN0A 2P26A 4JO1L 4EVNA 3KBPA 4ZOEA 4BHUI 3WO4B 1UOKA 4NN7C 2YLKA 5ESAB 2JIXB 4QR7A 2R69A 1R24A 4U1NA 3QXWA 4HUXB 5GGVL 4YXHH 3DX7B 4WCYH 4Q9RH 2W8CA 2X2IA 4FQJL 4P3DB 1U92B 5HXMA 1I82A 5KW9H 3ROOA 1WZAA 4APQB 2V33A 1EQWA 4L37B 4XN1A 3LIZL 5FYLL 1P4IL 2NPLX 2WMPB 4GPVA 4WJKB 5EN2B 4CU8A 3WL9A 4OB5L 4FTVB 1G6VK 4G3YH 3LEXB 4JJHA 4LIQH 4K7PX 4DWHA 1A8ZA 2HFFA 2JLLA 3HR5B 4ZTPH 1INQB 3FF7A 5EU3B 2BNRA 1I7RA 1F45A 4BWWA 1NEPA 1A7RL 2MCMA 2NY7H 3NFNA 3ISYA 4IRJC 4ZMAT 4C47A 4JFEA 3FQWA 2OXHA 3KNBA 4KK6C 2XDHA 3SO5A 5JHLL 3KLDA 4LCYB 2E7BA 4YJZL 1F4YL 4EO5A 4NJAL 1EHNA 5F8RC 5HYJB 4U2YA 2HVJA 3FAXA 2I07B 3VX1A 1E8YA 5IROC 1EZVX 3F01A 4PJXA 2CDFA 3OSKA 3ESNA 1E0OB 4JM2A 4M7LL 1OCOB 1LWJA 2W07B 4P2RD 5FWRA 3DSNB 3EUDA 4V33A 5C0AD 3WNKA 3ZL2A 4XN8A 4DW2H 1AZBA 3EYVA 4MNQB 4WJ5A 3ARDB 4N1CA 3MRBB 3BAEL 1FH5H 3TT1H 4FCHA 4RRPM 2PCPA 1D5BB 1ZANL 1GAFL 5L88H 1ES0A 1QBAA 1R5VB 2VCOA 1JGIA 1X7TA 2AW2A 1A66A 4FLHA 3VD0A 1RIUH 1HNGA 3GQFA 1G87A 1DJZA 4N8VB 4JFQA 4LO9A 1KGWA 3LPOA 3VTAA 1F42A 4GO9A 5ISZE 1TO4A 5C09A 3GF8A 2LLNA 1B3JA 3BVWA 1ZA3B 1SXCA 4ZQKA 2Q86A 4RRPG 3WIAA 1OF2A 4U1HA 4OCYH 5EUKB 1SM3H 2FEEI 3VFGH 1RJZB 3ZN6A 1QNZH 3O2VH 2OKMA 1UWGH 3EBHA 3BUYB 4D0CA 5CKGA 2X3CA 3IU3A 3D4ZA 1NL0L 3GXPA 1U3HB 4LASL 4K94L 3O9WA 1T1ZA 4JG1H 1LL1A 3MLSL 4DP1X 4ZXBA 3Q3GA 4MD5B 1I4FA 2E27L 3OAZK 2FYVA 2IOIA 1QAWA 4LE8A 3QCVL 4NGHL 4H25B 5KOMC 1UENA 4JCWA 3Q2WA 1UJTA 2OAAA 5IHHA 5JXED 3QIUC 1XR9B 2KKQA 2PPFA 2B2XH 2JQMA 3ILPB 3ZTJG 2YQBA 1NAML 4GRWB 4P46C 2GJPA 3VMPA 1QZNA 3L3JB 4J6RL 1MFBL 2D2CC 1NEZG 2YN5A 3LIZA 5D6CA 2WLZA 3VXSE 3OJMB 2ICCA 5I6LA 2FBRA 3DDFA 3G6DH 1V7NH 4N87A 2BW5A 2I27N 3DLQR 4GW4B 1VERA 4QRTB 2R15A 4AEHH 2DMBA 3C8HA 3BXNB 3K71B 4KTEH 2JNZA 4HPYH 5DEFB 2HJLA 5DUBB 1E43A 2XWBA 2YD2A 1FV1A 3HS0C 2P52A 4UNIA 4K7PY 2HMIC 3ESUF 5E2WL 2GK0A 2CA4A 4QY8A 2Q10A 5IJDC 3OC8A 5K39A 1OGSA 4FQXC 3CDZB 2Q20A 3KJ6L 1CFVH 5JPMA 1F13A 2BVPA 3QCUL 5EOQL 4XOBA 1AG0A 1MXDA 1H6TA 1CICB 3ABKB 5INCB 1IC7H 5D2LA 3F64A 2DWTA 3D0LB 1F6LL 3F5WB 1JK8B 1T20B 4X7CC 4GXFA 4YSTA 1NFAA 2VLKD 1IRAY 1KZYA 4FP8H 1GOGA 1V27A 4QRQB 2GYSA 2DQTH 5EEYA 2Z7WA 3T0BA 2HSIA 4HU8A 3VQ2C 1A1OA 1IQDB 2I7SA 2P4AB 2YMTA 3DVNA 3TJEH 2NY1C 3US9A 5AD0B 4U1GC 4S0SD 4AYEC 1AQHA 3DTUB 1MFEH 3SDXA 2VQ1B 4UQDA 2CKBA 3THML 1LO5A 3K46A 2YQ3A 3GSQB 1CDYA 1ZJAA 1JYVA 5IHUH 3Q06A 3K6DA 4L3EA 5JORB 1KTLB 4JM4L 4TVPL 3DYMA 1T04B 3RU8L 2J4WH 3EDKA 2YS4A 2EDNA 3U4EA 2XQYG 4UYPA 5LGHH 5EORH 2CXKA 3CVIH 4LF3A 3F00A 4PB9L 4OZIE 4LNVA 2DDQL 1AVAA 3V9FA 3VQLA 5K59F 3EOBA 2AEQL 4XR8C 5GIRB 4GO8A 5E5LA 5EBLA 2DW5A 1G7HB 4FEIA 4YLQT 2BM3A 4RSVA 5F89B 1G7MB 2JK5B 1VJSA 1JPST 1KT2A 1RV6X 2PO6C 3OGCB 4GNKB 3SKJH 3VFOB 5FPIA 2FEDD 4NT6B 1HIML 3CFEB 5I9QB 3M8OL 3K80A 1QW9A 2EDDA 2N0KA 2EKJA 2X6BA 2J1XA 3BHBB 4YL4A 5MENA 2BP0A 1XZ0B 3CDGA 3B8SA 3UBFA 3L4XA 2ZCZA 4B41A 4Y9EA 4PD4J 1JSYA 3WBDA 1BREA 5ERWB 2WBJA 2X05A 3ZZSA 2LFGA 4YBLB 2V2WA 3ECWA 3IJHA 3DMMB 5D1XC 3VFUA 1I31A 4TSBL 5G5DB 4M9OA 2DQDH 4PPTA 2VRQA 5FO2A 5E00A 1EHLH 3RB5A 4ATWA 2K4WA 2XYBA 4Y2OA 4KK8C 3GI8L 4N5ED 4MDIB 3DBXB 1Z3GL 4G7YL 1IAIM 4NFDA 1PQZB 1XD1A 4FF9A 3R8BB 43C9B 2KYIA 2VDKL 3GNML 3HG1E 4PTTB 2NY6D 1N64L 4MQ7A 1KTKE 1GS6X 1MAKA 1WUNT 3NJXA 2EIJB 4TUOA 3B9AA 1N6QL 1UWXK 2VAJA 4LGSB 1S7VA 2FHCA 1JYXA 1M53A 1MRDH 1WBYA 3CUPA 1JHKL 1SEBA 3TN0C 3LD8B 1YUHA 2D7OA 1RJCA 3HUJF 4N6RA 2J2ZB 1AXTL 2Y0SA 5FUZL 3STZB 3FT4A 3AWEA 1F4AA 2F8OA 1RUML 3MRIA 1MWAA 3CFTA 3IXAA 4IHBA 5EU4B 1FF5A 4KTYA 5JIIA 1KGYE 3VDBA 3WEXA 5FR3A 4MA1B 5AUMA 1OAQL 4N8CL 1W2KT 5KVFE 4YHML 3HW7A 1BQSA 2NW2B 2QMJA 3F7KA 3DUUA 3CHPA 3GRWH 4AMWA 4KKCC 4XPFL 1WAEA 1ZDSA 2FSDA 3EG9A 5CCHE 3QDJD 3FCTB 2R8SH 1IT9L 3R7QA 1I8AA 4FMVA 4DUVA 4N1HB 2WN2A 3OJ2C 4ILDA 4B0MB 1NH6A 5FFGA 4G1MB 4RVBA 1EHAA 3SDCB 4BZ1H 5IG7B 5DEZA 1GYAA 4U4IA 2VXTH 5D55A 2H45A 4HLZG 1YC7A 3D18B 1AR1C 1FQ9C 2OTPA 1NSNH 3L1GA 4R0LA 5JO5A 4PLOB 3QEHB 5HGDB 4QEGA 4F9PA 4UOJA 3FU7B 3T1FA 5AW3B 1BX2A 3B2UD 5E9DA 4IGBD 5DD6A 1I3GL 5B8CB 2HWZL 5I74C 4P06A 1AOZA 3GK8H 3HAEA 3U4BH 3ZZ1A 5D96C 3FYEB 3MV8E 3T0WA 1IKFL 4GRLC 4QD2E 1IVLA 3H9HB 4JQVA 1QHPA 4P2QD 4PJDA 3P0YH 4OAWB 3VWKC 4JRFA 4G42A 4BDVA 5IB3A 3CHRA 2Y5QA 2LGNA 2X4NB 4MB3A 3IDYC 2HKHH 2QQNL 4EUPA 2NY3B 3BFQG 5CSZA 4BE6A 1JWMA 5DQDL 5I18H 4B9PA 4UQBA 1JXKA 3GUTB 4KKAC 2L8AA 4HOXA 1ZHBB 2AJXL 1MFVA 1C5BL 1M05A 3MR9A 2ZP0T 3GTVA 1TJIL 3N44F 4TSAH 2OFQA 3IGUA 5C07D 4CSPA 5C2BH 1N19A 1QSEA 1OCRB 1X3DA 5JUEH 3O41B 4PJFB 3SPIA 5C0JB 2GJ6B 1I8MB 2ZCLL 2IEPA 3SGEI 2IH3B 3HLAB 2VM3A 4N86A 5ETUB 5CXPA 1R4XA 3LN5A 2VH5H 3CXDL 2PYEE 3QHZH 4TS6A 2D7TH 1EGJH 4NI3A 2ICEB 2IADA 1QPXA 2HX8A 3Q8AA 3QIBA 3SPHA 3CLWA 3U30B 3FN9A 4PJGA 4QO1B 2B1HL 3DVFA 4K8RD 4LLWA 1IE4A 4NERA 2GVYA 5F3BA 2QEJA 3PHAA 5IBLC 2O26U 1TF4A 1A6ZA 4FQIH 3WHXB 4XXDA 4OSUH 3GBLA 4IK6A 1I3RA 1RUQH 4U7SA 3WU1A 1KJVB 3N50A 1IGML 1RUKH 4TLUA 1N2RB 2GCYA 2E8YA 2A83A 4MGXA 2VMCA 4KBPA 1J48A 4JHAL 4POZC 4LQ1A 1YEEH 3QW9A 3ECBA 5GSRB 2QKIA 2XTJE 3L6FA 4GB9A 3K81A 1XGZA 3MJ9L 3LZPA 2ED7A 5DA4A 4FXKB 3VXRA 2F68X 3H4HA 4E5XG 1ETZB 4IIQA 1IBYA 2VR7A 4RZKA 4LU5L 2FL5B 1J1XH 4OIAA 2F7IA 3WS3B 1E3ZA 1U8PB 5B7EA 3KLSA 1FLRH 1IGIL 5I1LA 2WIIB 3ZPDA 2CIIA 3N9GL 1AI1L 5ELIA 1QHQA 2VMDA 3K7UA 5EUOF 1B0GB 2I9LB 3ZQ9A 4G9DA 3HJEA 3PXJA 3HS9A 3L3KB 5ESAA 2JIXA 5F7AA 3QGVA 3CHOA 4PN6A 3CX2A 4WUUB 4HUXA 4JRLA 1AGBB 4D8PB 3UEZA 4Q52A 3DX7A 2R0ZL 4S1QL 4P3DA 1QEWB 2X42A 4NHCL 1BZDA 5FUOL 5HJ3B 5C0EB 5D1QB 5C0CE 4APQA 1PZUB 4L37A 2ZOLB 3P3YA 3D50A 4JDTH 1AZZC 2WMPA 3WNIA 5EN2A 1VPOH 5LG6A 1EXHA 4MS6A 4KJPD 3E7JA 4BFFA 3UTPE 3AB0C 3LEXA 1I1FB 5D93C 4GW1A 5L6YL 1INQA 5EU3A 1CLZH 5DC4B 1G0DA 2IDTA 3BLPX 4XPBH 4UBDC 3RG1C 3HMWH 4PCYA 2XQBH 4EOWL 3O2WL 2EIBA 4Z7OE 5KS9B 3PV6B 1ETB1 4JFZL 5ID1B 4QTHB 1HE8A 4LCYA 1M7UA 2HT4D 3MKGA 5HYJA 2PNDA 3BEVB 2I07A 4FERA 4CSZA 1HINH 2GTZB 1AGEB 1SMAA 2QVTA 3GHPA 5DJZB 4JBSA 5HPOA 1CQYA 3WS6A 1A0QH 2WLHA 3QDHA 4G72B 4AVIA 1I1CA 2A4EA 2W07A 3DSNA 5LUMA 2FDBP 4MNQA 3WTYA 3MRBA 2A6JA 5K9KB 2Q3XA 3Q01A 3MRKA 2DF3A 2XN9B 3K4DA 3OAYK 1R5VA 3JUZA 3LS5H 3HBGA 4ZTOL 3KVDD 1A7OL 3Q5OA 3VXMA 4F57H 2OMBA 5I75B 2VDNB 4N8VA 3P2BA 4A2DA 4I89A 2X4RB 3QZMA 3TBWB 2D73A 4W9JC 3BD4A 2BC4B 1L9PA 1ZA3A 3GM8A 3K8MA 3MJ9A 2CZNA 1HWWA 1VCBC 1Y6NR 3AG1B 2EDKA 3EDDA 1KLFB 1OGAD 1UM4H 2FX9L 3WTTA 2ATPB 1XCXA 5EUKA 1GGYA 1OO2A 2Z31C 1UEYA 1RJZA 3F7YB 1JJUA 4DQAA 2DS4A 1JNJA 2ZCHH 2ZOKB 3BUYA 3U4KA 3MLUH 3CIQA 1XT5A 3EFOB 3TVMA 2AMGA 2CR0A 4XAWH 2IQ9L 3IMSA 4Z0XB 3FTYA 1U3HA 1RHHB 2YWZA 1NMAH 4HC1H 4M7KL 5FHAL 4QWWC 4N1EA 2D0HA 5D7IF 1A1MA 3UYRH 1NCUA 4H25A 5IWLC 4DO4A 2CO4A 4UUJA 2NOYA 3SKUD 4NN5B 5E7FA 1XR9A 2AEWA 4JPKH 4WU5A 4YDJB 1JIBA 4ZYKB 3L3JA 1R3LB 3GS0A 3LQZB 1CFQB 1EEYB 5I8CA 1FAIH 4J3OC 4A2MA 1WFJA 3UERA 5F0PB 3VFVA 1M1XB 4GW4A 3L5HA 4QRTA 2VJ0A 4HPOL 3BAKA 4TKWA 1KYOJ 1T2XA 3BXNA 3VXOB 5EU7C 2OR9L 3WFZA 3K71A 2CO1A 2FQEA 4EZKA 5I30H 5B4MD 3MXWH 3UAEA 4X0NA 1CE1H 1WYJA 3O3UN 2W60B 2E9BA 4HCRL 4KUZL 4K94C 3Q6GL 4H26A 4QRBA 4BSJA 4I48B 3CDZA 4ZSOE 4PWFA 4QLWA 2DKSA 4H44C 3H8NA 1XBRA 1JOIA 1X7QB 5IREA 3FUNA 1HX0A 1ZSDB 5INCA 3ZKXC 1CICA 1JNHB 25C8L 2QFRA 5C70A 1KEGH 4MS8D 4GQPH 2MPAL 3QEQE 5JQIB 3D0LA 3TBTB 3IFPB 4OCXH 4P9ML 2E9WA 4K23L 3PWNB 3WN5B 1JK8A 1KIQA 1RZ7L 5SWZB 1T20A 3LNGA 4JHUA 3KPRD 2YA1A 3C6LD 3ZRSA 5CSGA 1U8NA 2BHZA 5I0DA 5LQBH 1L6XA 3AY4C 4FJ6A 5TE7H 1IQDA 4TTGA 3X3GL 5AD0A 5KYWB 4NAQA 3AXLB 5I5RA 1NBVL 1AGFB 2VQ1A 4HUVB 3JT0A 2H1PH 3N04A 5LBVA 4G6JH 5LBSH 3GSQA 5F1NB 4PJ5B 5C6TH 1MDAA 1QVOB 2JB5H 3REWB 4AV5A 2NUTB 5JORA 2GITB 3O81A 1KTLA 3EJTA 4B3EA 1UA7A 2AEPL 1TU2B 3BZ4B 3I3BA 1RY7B 1T04A 3CMOH 3QUYA 2ATAA 2VWEE 3KGSA 2ATKB 3PYCA 5DS8B 3TBVB 4YAQB 4PRIB 1H8OA 2F53B 1UKSA 4PUBH 3GM0A 4Z7WB 3QDJE 1J9RA 4Y7OC 5D72H 4GP4B 4LGRB 4N0YL 4NM4H 4EIZC 1DVYA 3LRLA 5GIRA 4LAQH 5TK4A 2Z1KA 3H4FA 1AACA 5CJXA 1G7HA 1GIGH 3WKPA 3QYMA 5F89A 2JK5A 3LYRA 5BV7L 3OGCA 5EEZA 3VFOA 3BSGA 5KVGE 3CFEA 2DYSB 3QE5A 4GUPB 2TSBA 4AVJA 3GSRB 4EN3D 4Y2DC 1NFDE 1QR1B 1OPGL 3BHBA 2HH0H 1JZIA 1XZ0A 4XMPH 4YDVB 2UX7A 2WN3A 5JHDE 1J5HA 3IMVA 4Y16C 5ERWA 4YE0A 4YXLH 4UQ3B 5IFHL 3LIUA 5ENWB 1CZ8L 4GIOA 3RB7A 3B9KB 4PJBF 1VCAA 4Z7UE 3DMMA 4YHLH 1BIHA 3AU0A 3MRPB 4R0LC 1NMBL 5G5DA 5HHPA 3OQ3B 4UT6H 4XNQB 3WMPA 2BVQB 4AVHA 1XV8A 1J0IA 4HBCL 4LB8A 4P2QE 3RVTD 1A6WL 1NUFA 2QADC 4D9RD 1F0LA 4LL4A 3BGFB 3JV6B 4MDIA 3UAJA 3DBXA 3ARTA 1F3JA 2ADIB 2CBQA 7PAZA 5CINL 2YD6A 3G6JB 3V6FB 1ROWA 1URLA 1PQZA 1P2CB 4HD9A 43C9A 3G5XB 4PTTA 2DN7A 3O2DA 1IC5H 2EEFA 3BC9A 3QDAA 3QJOA 4U49A 4XOAA 3P4OB 4P57B 3R4DA 5HHXL 1C1EH 4JQVC 4LOUC 2VR8A 2J2ZA 4UT7H 5BW7C 4Z95L 3STZA 3EBGA 4ZBJA 1O0VA 5E9NA 3ARRA 5AZ2L 1OLZA 4XMZA 5EU4A 1YVLA 1CURA 4KRPB 3VB8A 1KTRL 5C08E 3ME0B 4H0IA 4PS8A 5GQBA 1RJYB 4H20L 2NW2A 3MV7D 4XWGL 4AKQA 1U8CB 3W82A 1BG1A 4H0LC 4I77L 2CDEB 3FCTA 1CLOL 3DX3A 2VR5A 3IFNL 3FO0L 4CJ0A 2XZZA 4G1MA 4GLRI 3N42B 4TLKA 4JRYD 3SDCA 2H2PC 3ZKQD 5IG7A 4WEBH 3D09A 2JKXA 4JB9H 2CO3A 2O5YL 4IRZL 1X9QA 3H0TB 3SY0B 3RKDC 5HPMB 2LW3A 3CSTA 4I0PC 1WD9A 3D18A 3VDCA 3QRFM 1JPTH 3I50L 3PXHA 2ICWB 3I6SA 1TJHH 3NIFE 3QEHA 4QRPA 5HGDA 4DN3L 4XO5A 3FU7A 3B3BA 1CVSC 5B8CA 1WIUA 4F58L 5IESH 5TF1H 2OZ4H 3OWRA 3O0RL 5HI3D 4CKQA 2HZHA 4TSCL 4KO5A 4OTXH 2AHIA 5I5IA 3H9HA 3FL7A 3HB3D 2CRIA 4DN4H 4JPIB 5HHMB 5CLYA 4OAWA 6PCYA 2PLTA 2QKSA 1SDDB 4KJWD 3ULUE 2W5PA 2P9RA 4FXGC 4N68A 4H1LH 3ZKSD 4ZMZA 2YIHA 3O6FD 5IKCB 5E2UH 5MP6H 2X4NA 4L1TA 1MI5B 3MCKB 1CG9B 2YD0A 2NX5D 4NUQA 1M2VB 1XIWC 2EP6A 4O2FB 3RGVD 4MMXC 1VDGA 4IIQC 4PJ7E 2DMHA 3GUTA 3H3KA 2WSKA 4KNTA 1ZHBA 2AANA 2VDMH 1WWWX 3UPCA 2R2CA 3G3LA 1PKOA 4QMEA 1BVNT 4P0DA 5IOPB 3O41A 4PJFA 5C0JA 2GJ6A 1T6VN 1I8MA 3IWVA 4ZFGH 1CD8A 4F7EB 2IH3A 5EEWA 4O58H 4IDJH 4ENED 1OE1A 2JKJA 3T3MF 5ETUA 1Z5YD 3I9IA 4HKZB 4P5MB 2CUIA 4E9QA 3OPUA 4W6XB 2YD1A 2ICEA 5DMIL 2KH2B 5T3ZL 5FOBB 2CK2A 4PRBB 4QO1A 3TS8A 1CGYA 1XSKA 2ZOUA 4OFVA 4FJZA 3WHXA 1KJVA 1KTCA 2AF2A 2CBPA 1N2RA 2VNCA 3BKJL 3NA9L 4UTBL 5E0QA 4MXQD 3RIKA 3BVXA 1NTDA 2ZQKA 3QQXA 1DTUA 2K1MA 3L4UA 5A6MA 3MBXH 5GSRA 4PJ8C 1AE6H 3BVVA 2CJUL 4HIXL 1ADQH 2EIDA 1YY9C 1OTTC 3NABH 4FXKA 4MD4B 4FZEH 2FK9A 4GI8A 2A73A 1NOLA 1ETZA 1JRHI 2EC9T 3HVDA 2OMNA 4BKTC 3LNEA 2FL5A 2J25A 3WS3A 4D0BB 5A3IC 2WIIA 3TX4A 3EOAB 3O11B 3ARDC 1X4ZA 5TGBB 3TEUA 4YBQC 3D87B 5IVXF 4AC4A 1B0GA 4CN4A 2I9LA 3VXUE 1L3NA 5EZJA 3BN9D 2ZE0A 4Q14A 4P5SA 4WUUA 4D8PA 1AGBA 4PJHF 3EYQD 2CE6A 3EZJB 4KKLC 2EH7H 4ZNEA 5E08H 4JDEB 5HJ3A 5C0EA 3U4AA 3D2UD 5E5UB 4UT9L 1GA2A 1ZK5A 3M07A 4E68A 2ZOLA 2HLFD 3ERXA 4PJXE 3TFKD 1I7TB 3ARYA 4J3UA 2PXYD 2WXJA 4AW7A 1I1FA 2ZXWB 1RUPL 1YMHB 4J4PA 4M3JA 2O1AA 3FUFA 3D12B 1CK0H 4WHYG 4OR1A 2PKDA 4OCWL 4XP5L 5KS9A 5TTRA 3PGFL 4WLCA 3PV6A 2WO3B 3H42H 4XOCA 5I8KL 1S78C 2AGJH 4S1RL 1NEZB 4QTHA 5ID1A 1N5AB 4GI9A 4RQQB 2AQRA 4XODA 1WS8A 1E28A 3MLTB 4GSUA 3ALWA 3BEVA 2HT3D 4HIJB 4KK5C 1EWHA 1IAMA 2GTZA 1AGEA 5DJZA 4OZGB 1U95A 3QUMH 5FIEA 5TD4A 4UOZA 4EPSA 2NQCA 1RIHL 3AITA 1EVUA 2VRAA 2KHAA 3NZHL 2HKFL 4XVTL 3BPLB 2HFEB 5K9KA 3OKNB 1G7IB 5DURD 5ANME 1YPZB 2XN9A 2E7CA 4FEMA 3Q2VA 4P4KB 5KVMC 3I6LD 3TA4D 2G2PA 3UJIL 2V2XA 3AREB 2MQCA 4NQCD 1XMWA 3QO0A 2B3IA 4P3CL 7PCYA 4Y4KC 3FFCE 3RWIB 4N9GB 2X4RA 2V17L 3TBWA 1OB0A 4MCMA 1BF2A 5FA3A 2BC4A 3KPRE 5B1CA 3C60C 3K5SA 5KSBE 4OJYA 1TETL 1E65A 1MJ7L 4ADIA 2R4RH 4GBXD 4KXDA 4F7PB 2ATPA 3M86A 3F7YA 2CO6B 2HLAB 5HI4C 5T1LB 3GXNA 5GZOD 3V55A 2ZOKA 1O9VA 2WQWA 4XMKL 2C3VB 5DD3L 4OW6A 5T1KB 5CWSB 4Z0XA 1RHHA 5C9JB 1BD2A 2GUOB 4WKXA 4CC1A 1H6FA 2DLFL 3BIBX 5HVFB 4ERSL 2W59A 2J5WA 4JO4H 2UVEA 4YDJA 1FO0H 2VN7A 4ZYKA 4JO1H 5LNGA 3ZR6A 3IS1X 2WCGA 3LQZA 1CFQA 3CC1A 1EEYA 4BK4A 3WIIL 5D2LE 5IT2L 1PD1A 1D7DA 5GGVH 1M1XA 2DAVA 4FQJH 5DD5L 2BHFA 3VXOA 4Z8FL 3G5ZB 4JO8A 3LIZH 5FYLH 2H0EA 3IDJB 4Y8AA 3IJ8A 2W60A 5H37H 4OB5H 5CGYC 3KAAA 5CJXC 2NZ1A 2WINB 1BLIA 2H3NA 4YXKL 3GBML 4KO6A 4BKLA 1FPTL 4I48A 3SYPA 1HZLA 4HGKC 3E3QC 3DRQB 1D6VL 1N68A 4L3EE 2VN4A 1X7QA 2QSVA 2BS71 4GKSB 1A7RH 1JNHA 2XBTA 1P1VA 2NTFB 3WY3A 1JTTA 2ZAHA 1UM5L 4WHDA 4C4KO 3PWNA 3WN5A 5SWZA 1MW1A 5EIIG 4HIHB 3WN6A 1KNOB 3HC4H 5JHLH 3LPFA 2OSLB 3NCBB 1F4YH 4HUMB 4OLYL 4YBLC 1MCOL 4QHKJ 2EABA 3DMMC 1VB9A 3EO0A 2P42B 3ZR5A 4NX0A 4WI4A 5KYWA 1OOAA 3AXLA 3PP3K 4M7LH 1AGFA 3MV11 4YDMA 4HUVA 2WSPA 4QHNB 4JK0D 3CFBB 5F1NA 5CEZE 4GFTB 4PJ5A 1ODAA 1QVOA 3BAEH 3REWA 2NUTA 1SQMA 2GITA 1TYEB 1TU2A 4C54A 4HWEH 1Z9NA 3BZ4A 5LB1A 1ZANH 1GAFH 3ETSA 1H3PL 4WV1A 2ATKA 5DS8A 3TBVA 3VD3A 4YAQA 4D7BA 3MV7E 4PRIA 4A66A 2EYSB 2F53A 1KYDA 1DBML 3DHUA 4RMRA 5K69A 4Z7WA 1ILSA 1KDIA 3LD8C 3P30L 2SEBB 2XG4B 4YDNA 3OG6B 2ESVB 3A6CL 3T0EB 4G70B 1TOXA 4J3OH 2I9TB 3X12B 2DL9A 4FG6C 1UUNA 1MXGA 2X09A 1OHZA 4MA1C 4JJ5B 1Z9PA 3E6HB 3F83A 4ZAKB 4B9CA 3BH8B 4HKJB 1FWXA 4GUPA 3GSRA 5DZOA 1QR1A 1UKTA 4AWJC 4CVWA 2Z4QA 3PAUA 2C1OB 4JVWA 4KKPA 1NL0H 4LASH 2WGXA 4K94H 4FFVD 3MLSH 3HZKA 4UQ3A 2E27H 5ENWA 3TEXA 1WCBB 3QCVH 4NGHH 3B9KA 1KCUL 4JLRB 4X5QA 3MRPA 3X1BA 4K5NA 3T04D 5EDSA 3NDYE 4XNQA 4FQCL 2BVQA 1NAMH 1YQVL 5D1ZC 2DWSA 4J6RH 4AYMC 1MFBH 2XX1A 3JV6A 1NGXB 5I1JL 2ADIA 2RMNA 1NC2B 3G6JA 3V6FA 3MGTB 3QJHB 3SGEH 2BOBB 1WWCA 1P2CA 2CRYA 2JJSC 5B8CC 3G5XA 5BV7C 3QWQB 1RZIB 4JFFB 2YPLE 3L4VA 4AQ1B 4GI6A 2I5YL 4KY2A 2WXRA 3CFQA 2K6YA 3P4OA 4LMQI 4P57A 5E1AB 1ESOA 1IBZA 4KMTH 4YN3A 1UVQB 1IKNC 5AENA 5E2WH 2NY0D 2YUVA 5MEPB 1IBHA 1H9DA 1IIIA 3KJ6H 3BAJA 4L4TE 4WRLA 5EOQH 3QCUH 1CPUA 3ME0A 2NY3C 2B0SL 4BA0A 3RDTD 3AUVA 1U8CA 1ZY9A 1J0HA 2OL3B 2Y1ZA 3GO1L 2Z8VC 3NFPB 2CDEA 1X44A 4PS4L 4TVUA 4XP9L 1P5UC 5E1GA 1KB5B 2VXQL 4EEEA 4Z9KB 2P47B 4PJDE 3QS2A 2C9UA 4MA3B 5KBDA 3UZEA 3SY0A 3H0TA 2Y36L 2WXOA 5HPMA 3THMH 4XPAH 3AMKA 4MJIE 1PX8A 3NQKA 3ZDYB 2EAEA 4BA8A 5BZXA 3QNZA 2X4QB 2JTYA 4TVPH 4YL9A 1X5IA 1DQDL 2ICEC 3KJ4B 3RU8H 2DKMA 1GS7A 4CMHC 3OKOB 2GBAA 4FYQA 4OZFB 1L0QA 2XQYK 4HCGA 3P9MB 2XXCB 3PL6D 3S7GA 4PB9H 3DRTB 1N0LB 1Q1PA 1IBGL 2DDQH 2NXYD 4TTDD 3O3AB 2EEAA 4K9JA 1OAKL 2A9NL 1FNFA 3FZUD 4HWBL 2FX7L 1U8MA 2AEQH 2ZWYA 4NQQA 2AQ1A 4EIGB 4JPIA 1FZOB 3RJQB 3SE6A 3KPSB 4NUPA 3GKZA 5HVGB 4J3BA 3BQUD 2BRQA 2J8HA 3NK4A 3GB7B 5IKCA 1HIMH 3WDHA 1DJGA 3MCKA 3M8OH 1CG9A 1GYUA 2EVHA 4U1IB 2E74C 1M2VA 3PGCB 4IK7A 3VGBA 4O2FA 3EGXA 4FABL 3VRJB 4HJTA 3ARBD 4LPUA 4Z7UF 4DJMA 1CLCA 4TQEL 2YSSB 4IQHA 3CWGA 3QHFL 4NQDD 4PS7A 3S97C 3UTQA 3VWJB 5CEXB 3CHSA 2MHAB 1C5DB 4L1DA 1LEKB 1MSPA 3BN3B 4JFDD 5B1JA 2P1YA 4OUUB 1NCWL 3QAZB 3OLDA 4TSBH 2ZXGA 4IJTA 4F7EA 2A77L 1BQKA 4JN1L 1DLHA 1HAUA 2GHWB 2CBTA 2ZX6A 2WQAA 3GI8H 2XY2A 4P5MA 1Z3GH 4HKZA 4UM9B 1JXDA 4G7YH 3NJFA 5D1QC 2MCG1 3VXRE 1QWNA 2AAVA 2VDKH 3GNMH 2DQEL 4UQ9A 1A14L 4X7EC 1BFTA 1N64H 5FOBA 3DIFB 3N06B 1AD9B 2EDQA 3TT3L 5F9JB 1MQKL 1N6QH 1MFNA 1PMYA 3D39B 3JV5A 1OK0A 1JHKH 5AOKA 4OBSA 3WAJA 2BDNL 4XI5D 3IBOA 1DQML 1JV2A 2F8IA 3CXHJ 4OD3L 2OI9B 1AXTH 1VHPA 3FU6A 4FFYL 3TBYB 2C7FA 3V8OA 5FUZH 3F2LA 3NH7L 2HTLD 5ACZB 1RUMH 3UBHA 1EA9C 1OAQH 3QDGD 4N8CH 3T4YB 3S98A 4OLUL 4YHMH 4PJ9D 1QQDB 4XPFH 3VGDA 5C0BB 3R0NA 4MD4A 1IT9H 1RH8A 4LAJH 4MASA 4BCZA 2EYRB 2DQFB 4XAKD 1P4UA 4D0BA 4TXVB 4KOBA 1PVHA 4JKPL 1VESA 3O11A 5TGBA 2FIRT 4RFOL 4Y88A 3T3PE 1G0YR 2C3GA 2L0DA 2CG9X 4DK3A 1I85A 3T4AC 2D3LA 2CHNA 4QNPE 1UT1A 4KI5C 2E46A 1HZHL 4RRPA 1HCVA 3T2LA 5LNDA 2ZUUA 2QQQA 3D69B 5I75C 4ELMB 4JNXA 2G0KA 4J39A 2XN0A 5D6DA 2ICWI 4QRRB 2D3JA 3TO4D 5HYJE 3NJGA 1I3GH 2HWZH 1MJ8L 5JYLA 4GG6E 2DEWX 1I7TA 5I1AB 1FC1A 3TONA 1SXNA 4Z3IA 2ID5A 2CGZA 1IKFH 3S3JA 1SHSA 1YMHA 2WAHA 3ZIMA 1IB5A 5CGBA 1EXUB 1VAHA 3V0VB 3FNKA 1MCWM 1D7BA 2OXGB 1T83A 3HR6A 3VXME 5IQ7L 3W1ZA 3AVEA 4EDWL 1E9QB 2QQNH 3OKKB 4PJ7F 3S35X 2UZXB 1NEZA 1N5AA 4GRMB 4ZX3A 4RQQA 2XV6B 5DQDH 1F56A 3CGTA 4N8UA 4HIJA 3RTLA 4OZGA 4NN5C 2AJXH 1WP6A 1C5BH