4LF3B

Inhibitory mechanism of an allosteric antibody targeting the glucagon receptor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
231
structure length
231
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVMWYDGSNKDYVDSVKGRFTISRDNSKNTLYLQMNRLRAEDTAVYYCAREKDHYDILTGYNYYYGLDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
publication title Inhibitory mechanism of an allosteric antibody targeting the glucagon receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 231
sequence length 231
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lf3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lf3B01
4PJ8B 1NGXA 2CKBL 1WZ1L 4N5EC 2ESVE 5C2BL 3ARFA 1WBZA 3CDFA 3PGDA 3QPXH 4W81A 3UX9B 5HI4C 2V17L 2XNAA 2CDGB 3QNXB 2GJZA 1DL7H 4HPYH 5A1AA 4XVJH 3ILPA 3ULUD 3QUKB 3P30H 1PAMA 4F58L 5DWUL 4K3DH 4FQIH 4Q7DA 2A6JA 1K4DA 4XVSH 2IPUG 1BZ7B 4H1LA 2R15A 4WTZG 1FO0A 3QPQD 4FQCH 1JHTA 3I02B 1GPOL 2EXYD 3WIHH 4YDJA 1FLTX 4PY8I 3F5WA 4ODHL 1K9TA 2P42B 4IHOB 2GT9A 2DQIL 5EWIH 3LQZB 4N0CD 2ED9A 2V9QA 1EAPA 1FFOB 3DX8A 3VWJD 1HXYB 4X99B 1BLNA 5DS8A 5DLMH 3U9PH 3V7MA 2BMKA 5FGCE 5HVWA 1JWSA 2CLVA 1QFHA 4AL8L 5K33A 5D1ZD 1T1ZA 4Z7QF 5CKAA 1YJDL 1BJ1H 2NX5D 4Z7VF 2OSLA 3OJDB 1NCDH 4R96A 4YLQT 4M8QB 3MRPA 5HPMB 5F7YC 1TJGH 3VJ6B 3JV4A 1CXKA 2NY6B 1S5HA 3OR7A 3HMXA 3ULVL 4G42B 4WFED 4RFOH 2CIKA 3DX6A 1P4LA 35C8L 3L6FA 4JANB 4XP9L 1T89C 2OTWB 3PABA 4DGYL 2XA8H 4NWTH 4I0PA 4ZAKA 3T0EC 1T20A 1KENH 3UCRA 1MCKA 3VA2C 1N5AA 1WIUA 3CNKA 1YNTA 5B38B 2QEJA 1QR4A 4O5LH 4FQXA 4U1GC 2ZUTA 5H94A 1UVQA 3RY4A 3DSFH 1PG7H 4OCRH 3CDGA 5B8CC 1F97A 4JKWA 3WUWA 2BVPA 1IQDB 1A21A 5KVDL 3VGBA 1WC7A 4GBXA 5BZDA 3P11H 1A14L 2EC8A 2ITDB 2X9WA 5EOTA 1YN7A 3IU4H 4MJIE 3LEXA 4LHUA 1A3RL 3QB7C 5EU6B 1VENA 4WHCA 1ZSDB 4JM4L 3KG5A 3RL2A 3FQWA 4J8RA 4UU9A 2RIKA 1FNAA 4NRXB 3K4ZA 2HVJB 1YEEH 2IPTL 4K7PX 2Y4SA 1XGTA 1U8JA 1GZQA 2N56A 1I9JL 5J13B 1E28B 4J23A 4HAGA 1CZ8L 1G9NL 2F54A 4M03A 1DFBL 1YEJL 3RDTC 5L88H 4TVSa 2Y7QB 4X0KA 1RMFH 4P9HL 3U4BH 1A9BB 4LRNH 5BS0E 4WUUB 5I8EB 1CT8A 3CFKA 4IOIA 3TO4C 4IIQA 1HKLL 4CBPA 2VL5B 2X9XA 1JFQH 4KKBC 2GTWA 1OD9A 2LAGB 1FIEA 2VH5H 4ODTH 2J7LA 4QOKA 3LS5H 4HHAA 4WV1C 1AY1L 5M7QA 1EHLH 1ZHLA 2A9NL 3HZYB 4KI5E 2DM7A 4LLDB 3T1FB 4NOBA 3FRPA 1NGQH 1MJUL 4NZDA 5FF6B 3PP4L 4Q0XL 3CFIC 3I50H 1MCHA 1VDGA 4TNVF 5FYKE 1P4BH 4PY8J 5JIHA 4HG4K 3IDIA 4XB8A 3B83A 1P6FA 1JNLL 4Q6IA 5FA4A 3BE1L 4PRBA 3I3DA 1AGFA 3N1QC 5A2IH 5D6CB 3ARGC 1B6UA 1WT5C 4ERSH 1OARL 2D7TL 3GI9L 4NKMA 1KTLA 4V1DE 5IBLC 4Q9RH 2DQUL 1IM9A 2QSCH 4H5SA 3QWOB 4LPCA 1IKFH 4XBGA 1OTSC 3PQYB 2FB4H 2PO6C 2R2EA 3HCVB 5KS9B 5DTFB 3OKLB 2WLZA 4UTBH 1C7TA 1RPQA 3O2WL 5EU6D 3KDMA 4MDJA 3GI8L 1OTTD 3G5XA 2ARJA 4I2XB 1MHPL 1J11A 2QR0A 4FN0A 2Q86A 4APQB 4FFVC 2YPLE 3N0PB 2ESVB 4U6HA 2WZPD 3GSRB 4J1UA 2PR4L 5HBBA 3C8KA 3CFBA 3I75A 1D3CA 4MAYD 3E2HC 4YK4B 5JMRA 3EFFA 3HZVA 1I85A 4LCIL 4XXCA 1KV3A 4AK1A 2JE8A 3ELAT 3LIZL 1KJVA 5HYEA 3VXTA 4M7KL 3QQ9D 4CMMA 2HRPH 4P5KB 2DWEA 2HP4A 2LAAA 3MR9A 2FX8L 3WNPA 1LVEA 4WUUD 2WUCH 2EEBA 43CAA 2GUOA 4HWZB 1UKTA 4HMEA 4NM8L 4S11A 4LOUC 2X2YA 5I0DA 1G0DA 4XMKL 4F37F 1DLFH 1TETH 5F21B 1A1MA 3VMNA 3EIFA 1J1XL 1MWAL 5EIQA 1JZ8A 3MLXH 4HWEL 3SDAB 3BPNB 4K3JH 3Q3GB 5MEQB 1ZE3C 5C0RL 3FL7A 3I2CL 1QPPA 4QWWD 2YC1A 1A4KA 3RHWF 4HQQL 1U8PA 3KPRA 3N06B 3L3KA 3B9KC 5FGCB 3NMEA 1FYTE 2R2CA 3OKMA 2UUDH 4P2RE 5C0GB 3FQNB 4RNRB 3LN4B 2OK0L 1INEL 1JF1A 3UTTE 5IGXL 1OAYL 1CFSB 3L1OL 1UZ8B 4HKBB 5DHYA 1UKQA 4PV9B 2AEPH 3QEQA 2GTZB 5HHNA 4M7JH 4YBLB 4U1IB 5IFAL 4HS6B 3PQYD 5CJXA 5E08H 4R8WH 3AREA 3L3GA 4NN5C 5DJXA 4NQDE 4O4YH 5F8RC 5FOJA 1IC5L 5D7JB 4LLYB 4APQD 3T0AA 1I8MB 1T5WA 4LVHB 4HUVA 2FECL 2GAZA 2ESVD 5L7XL 3HUJE 2IAMA 4K7PL 4OQ1A 3RPIB 5IF0B 4POZD 5E5MB 3O2VL 4BFIB 1D9KC 3EJZC 4GRLB 5ITBH 3BIBX 3MJ7B 1NBYB 5F1IA 1HEZA 2OZ4H 1NCAH 3QP3A 5GSRA 2FECI 4JHWL 4N0YL 3W2DL 4IOFD 4UUJA 4YAQA 1I8LA 3WHXA 3WSQL 1G9MC 5KANI 1KCUL 1XGRA 2QV2A 1T21A 3HZMB 1I1YB 4F7MA 4GUPA 3IDYC 2VLME 5GRJH 1JNNH 1FL3A 4OZHE 4Y5YB 4HIXH 4U0RB 4EN3B 4MQXD 4JFOA 1CL7H 2NCMA 1VFAA 3CMGA 4Z76A 2VITB 1JYVA 3HA0A 4FP8H 5BOZG 4TSAH 4DKFH 4R4BA 5J0BA 2LU3A 2EDYA 2MMXA 2X1OA 1C5BH 2EDFA 1VEPA 2WM0A 3UTSA 2PW1A 3L3OA 3TJEL 3SDAD 1JTTA 4TOYH 4XCCL 1OM3H 4JZJA 2KBGA 3C5JB 1ZLSH 4NDMA 1Q9KB 2BSRA 3QIBB 3P3YA 3OXRA 5JHDE 5HHVL 5D5MF 3DUSA 5A2LH 3F7YB 3UZVB 3MRNA 2QHRH 5BS0B 4G5ZH 1NGPH 4PJBA 4IRSA 1AR1C 1AQDA 2APWA 3G08B 3VFUA 4U31A 1BJ8A 1CGXA 5GGSY 3RPKA 2EDNA 2AKRB 4KI5F 2GJ6E 5DMGC 4YZFF 2C7UA 3ESUF 2ITCA 4HS3B 3BWAA 5GQBA 3WEXB 3KPMB 1FH5H 1FL5A 3LN9A 3M17A 4AIZA 5A2KH 1ORSB 1FE8H 5IEKA 3IDNA 1F3RB 4HJGB 1A22B 4QY8A 2ZCHL 4X4YB 1U8OB 5HY9B 4OJFL 3SDYL 4BQCA 3QDHA 5D7JD 2ERJC 5TDOB 1DN2A 5H8DA 2DBJA 2EDJA 1EHAA 3EYVB 4XT1C 2VDPL 4X6DE 4V1DB 5FK9A 2JJUA 5IR1A 1QRKA 1I1RA 1FORH 5I73C 1H3VA 1MI5E 5CIPB 2R0LH 2MCPL 2FRGP 4JHAH 3AC0A 4OQTA 4GRLD 3TIEA 4KQ3L 3SN6N 2VMFA 4MJID 2N7BA 5FO9A 1NBVL 3SGDH 4NO0A 4QNPE 4RMVA 3WD5H 5DMIH 2QQQA 3C6LC 2V5YA 2H32H 4XNUH 4LVNC 5EOCL 1FLRL 1WQVT 3H3KA 3EFDL 1AO7A 1EZVX 3MCLL 4K8RC 1CDJA 1NANH 4EN3D 5TDPA 1IGFL 1BP3B 1RI8A 2YPLB 1IAOB 3O81A 5F8QC 1PYWA 3QXDB 1G7HA 1YQVH 2DJ4A 3HNVH 4OLUL 3VGDA 1ZA3B 5GXBB 2CXGA 1CD1A 5JXAH 5F9OH 2XRAL 3EO9H 4RGNE 3MNZB 1N6VA 3U0WH 2D7NA 5K9OA 3LKNB 2PN5A 2V6HA 4KJQD 4MNQA 1URLA 5BS0D 3ARUA 5DXWA 3TVMB 2Q76A 5D72H 4NKOB 2NW3B 3L3HB 5AD0B 4DEPC 4G80A 4M7LT 1LO4L 2KDGA 4MLSA 3AAZA 2DIJA 2J5LC 2R0KL 4Z78A 4KI5D 4P46A 1F13A 3T4YA 3T8XA 5EBWA 2WBJC 5DF0A 4D0CB 4KQ4L 3ZL4H 1LO5A 4HUXB 5H35A 5D2NC 1LP9A 3LEYL 4X5WB 3SDCC 5IM7A 1GOGA 2JK5B 2FZ3A 5FYKD 4OCSL 1UYWH 1FYTB 1SBSL 2X4RB 3CLFH 4Z7UE 3UDWC 3WO3B 4P2RB 3WFEH 3B43A 3UTTB 4V1DD 3VXRA 5IWLC 2I07A 2IGFL 1ED3B 3C60C 4H8WL 1F42A 1JV5A 4KI1A 3ARRA 4KHTH 1QEWB 1JGLL 4UQ2B 5E2TL 4KZDH 4U6YB 2H9GB 1YYLL 2Y07L 2F9BT 1IAKA 5DRXB 5D2LA 2VDRL 4KAQL 1VGKA 2PTUA 3FMGH 2W9EL 4NQDB 3GHEL 1NC4A 3QUXB 5I17B 2YPLD 4ODXB 4GKZB 1SVZA 3HUJB 3QYCA 3EW3B 3A6BH 3S34L 3KS0H 2FBJH 5CCKH 4DZBB 2L7JA 3C2AL 3OHXA 1PEWA 3QDGA 2GQHA 1BVKA 2IH1B 3T77A 1UWXH 1W72A 1F11B 3K3QA 5MEOA 5I1HH 2ZZUT 4HFUL 1NPUA 4MQ7B 4JKPL 4U1KB 4OZIA 2VE6A 2AJUL 5GGRA 1EK3A 3CH8A 2UUDK 2H1PL 3TVMD 1KJ3H 4OZHB 4O58L 2N7AA 1CGSH 4P9ML 3NN8B 3QIWC 4XTRC 1VA9A 1RUAL 1M7IA 2YMXH 4DTGH 5IHUH 2A6IB 4OSUH 1IAIM 4L4JA 4U1SA 3DGGB 4E41A 3RWEB 4XAWL 3O6KH 4DGVH 4HUWB 2VDKH 1MAML 3BW9B 1DBAH 3ARBC 3MODL 2J88L 4NSKA 5JHDB 1I1AA 4YHZL 1GGCL 5EOCJ 2B5IB 4LSPL 3EYOB 1F3JB 3KNBB 3JVGA 4MYWB 1ZLWK 1AGDB 1FYTD 4LRIA 5FO7B 4P2RD 4BQ9A 3QZWG 2FL5B 3H9HA 1VEOA 3UTTD 3BPCA 1UQSA 2CDFA 2GJ6B 4JFZH 4UILL 4CGTA 4TN9A 4PLNC 2Y72A 3OQ3B 5C8JB 3PV6B 2DQTL 3A67L 1DBJL 3SCMC 2HKHH 2BOBB 2Y5TB 4BQ6A 3BGAA 5BOPA 1D5BB 2J4WH 3MYJA 2NY0C 4L4TA 1N7ML 4KTDH 2KH2B 3E6HA 3F8UB 1UB5A 4WJ5A 4NNYB 1FGNL 4NQDD 1KCSH 2F58H 3QH3A 2ENYA 2Q6WA 3O8XA 5E2UH 5JXED 3QUXD 1IM3B 4X6DF 5AUMB 3Q5YA 3Q6GL 5EZJA 5TGBA 1KXTB 4X6DB 1QSVA 3P0GB 2EDQA 4YXKL 3TFKC 4M62H 1MI5B 43C9B 4WNQB 3CC5B 3D0LA 3KPOB 5DR5H 3NIGE 3BQUA 4Z0XA 3V8OA 1GGUA 5IOPB 4NPYA 5DUPH 1CG9A 3M1BA 2HJFB 3RA7L 3AY4A 4IMKC 5DEZA 1RAMA 4WHYG 2IANB 3CX5K 5EBLA 2X70A 1DBML 1K8IB 1KB5B 5JR1L 1BIHA 5AZEL 2BC4A 3MA7A 3QUYA 3QFJA 1JZ2A 4FQJL 1FNEB 1G7JA 1EEYA 1I3RB 2JJVA 1U91B 4JFYB 5C07A 5K9JH 1JYNA 3G9AB 1QD0A 5FYKL 1P4IH 3NH7L 1NFIA 3P73A 1J12A 1OQOA 1CYGA 3PXHA 4BK4A 4LFHD 4RGNB 4F7PA 1KELH 1H3TA 5GISH 5JHDD 3U0TB 3BRGC 2OL3A 5DJ2A 2F8XC 2CXKA 4F15C 4K7PY 3INUL 4ELKA 3CSGA 5B39G 3FOMA 4KHXH 2HTLD 1XZ0A 1AH1A 1S7TA 3SY0B 4XNZC 5J12B 3L95A 5SV4A 4BZ2L 2DLHA 2HA1A 2D7PA 3IAQA 2GJ6D 3B9AA 3BD4A 2I5YH 3WS6C 3BKCL 1AHWC 2P4AB 1S7UA 2AABH 3NIDE 4U1HB 2HT4C 4R4ND 1YEDB 2KPNA 3AGVA 3TZVB 1T5XB 3DNKA 4LDEB 3TYGL 4NFDA 1N59B 3UMTA 2XWTB 4YHYB 5HDBE 4JCMA 1L9MA 4Z7UF 1GGTA 4J3XA 2J8UA 4DFIA 4WW2C 4Z7UB 2X4UA 4GFTB 3U30C 5I66B 3MGOA 1CIUA 4JFDA 3V5HB 1ZT4A 4AT6B 2ADGB 1B4JL 3TBWA 1ZLUH 1BVLB 5CGYC 2XZAH 3PV7A 1MCPL 4TVPE 1MI5D 1F8TL 4OCNC 2HLFC 5IESL 5E2VL 4YUEH 1KB9K 2BSSA 4GLRH 5J6GB 3MOBL 5GGTA 4JPIB 1LEIB 2CKNA 4A6YL 2ICES 5KG9A 1A7OH 4TUKL 3L5WA 5C0AE 2DN7A 2WINA 5E00A 4WO4C 1KJ2H 3TNNA 4RCAA 4PJXA 4LLMA 2FH6A 5I1JL 1UJ3C 4FFYH 1OLZA 1ZEAH 2FJHB 5GS2D 4YE4L 1K8DA 1ZHNB 4DN3L 3JBG7 3HAEA 12E8H 3GSOB 1I1FA 3PGCA 3LMJL 4G6KL 1RIVH 1UADC 3CSPA 1AJ7H 1H3PH 3BSZL 2LABA 4O2FB 5HI3C 2ZG3A 1Z5LA 3MLTA 2R1YB 5C9JB 1T03H 4HZAA 4TSCL 2VSCA 4RGND 4XNMA 2IF7A 4JRXA 1CS6A 1CE6B 2GSGB 5TFSL 3RIFK 3CVHB 4YHIB 1MLBB 5ENWB 4F8QA 3KJ4C 4NNPH 4PJ9C 4QHLA 4KZEH 5FYJU 2YD6A 3BXNB 4HZLA 2EO1A 1B2WH 2FATL 3JXAA 1QFOA 1U3ZA 3H9SE 2R2HB 2W0KA 2GITA 3HC4H 4NKQB 3QRGL 4QTIH 2GCYA 5DFVD 4JM2C 1QA9A 5LVEA 4KH2A 1B0WA 2BSTB 3B3IB 4HIIB 4JN2A 4L8SB 1QUNA 3TZVD 5I18L 4X5LA 5ESAA 3T2QA 4NUJA 5F7DB 3FT2B 2D9CA 4EVNB 1MHCB 1UA6L 1T2QL 2AJYH 3VXUE 4NN6C 2GIYA 3BZEB 4AH2A 5CFHA 3NPZB 1G9MH 5ILTH 1TQCB 3SQBA 4MA3A 1R5WB 1K5NB 5BMFL 3PWLB 2A1WL 4L29A 1HHJB 5DD3H 3UJTH 2LFGA 3OKDA 3OPZL 2Y25A 4V2BA 3RVXD 3LB6D 2W9DH 2JIXD 4KJYA 7FABH 4XZUA 5MHSE 1UWXK 2H26B 3ETBF 3U36A 1F4XL 4JLRA 4OD3L 2W9LA 3EHBC 3AU1B 3O3BA 3WS3A 5JPNA 1BZ9B 4PJ7A 4OCXH 3CFEA 3DWTA 5IB1B 3VFGH 4H26A 1DDHB 3S37H 4DUWA 4XHQA 1UM6H 3QI9A 1GXEA 3OL2A 3ARWA 3G6DH 1JPGA 4FXLA 3QXAA 1TXKA 3RBGA 3LSOB 3BPLB 3ZE1E 4JREB 2EKSB 1R3IL 1Q9WA 3V6ZB 1C5DB 5ICYA 2JJSA 3FO1B 4KROB 4ZXBC 2E7CA 4KTEL 4TULH 1CF8L 1HH6B 2C1PA 4HUNB 3IS0X 3P9LA 4HK3N 5DRZB 3BEVB 4ZTOL 5D71L 2YKLH 4HIEA 4RMUA 1NAMA 1YUHA 1RZFL 2OMBA 3MRHB 2DICA 1OAKL 3MNVA 3QA3A 2PYFA 3MUGB 3DBXA 4DK3A 3O3AB 1P7KB 2NTFA 1U9KA 4JB9H 3L5XL 1TPXB 2DQDH 3BH8A 3S8WA 4NCC1 3MLVL 4OFYD 1S7XA 2EZ0D 3D0VA 2ED7A 5IK3B 4LARL 4MDIA 4OZFG 4U7KA 4J3TA 5JQ6H 5C0EA 4X80H 5MI0C 1CU4H 1S9XA 4OCMC 4HIJA 4K8RH 1Q94B 2KZWA 1IGTB 5T5FL 2F5AH 4F7CB 3IYLW 4MD4B 2J3SA 2LV4A 3BUYA 1NDMB 3BKML 5DJYB 2CUHA 3CZFA 4RWHA 3F12A 4AY0A 3WUZA 4WHDA 4HF5L 1DQLL 1TCMA 4ZOEA 4BKLB 1ACZA 3ZDXF 5GGVH 5HDBF 1OQXA 4YDLB 3VFPA 5LJYH 1SVCP 2R0WL 3MBEC 5FAAA 1KB5L 5ANMA 1MHEA 2LU7A 3L7FB 4L3CB 5HJ3B 4IRJB 4UQ3B 5HI5D 1MNUH 1YA5A 5LBSL 1DSFL 1S78C 3FONA 1UC6A 5HYJE 3ZTNL 3GMPA 1A6WL 3MJ9H 2YUXA 5GRVK 1ZTXL 4PV8B 1KPRA 3SOBH 4KXZI 4KKAC 4UNTA 4LSVH 2NLJB 1T1WA 1FAKT 3R06A 1CLCA 4XBEH 3Q2CA 3GMRB 3WFBL 4PJIA 3GGWB 5L2KE 3ESVF 5C0AB 5DJ8A 1N0LA 3J8F7 3QPXL 2WWMD 3LKOA 2BVOB 2IALA 4YHMH 4NOFA 1DBKH 4ELMA 1DL7L 3DV4B 3FN3A 4ODVH 4HPYL 4OF5A 1J86A 4XVJL 3SE4A 3GSWB 3HR5A 3S6CA 3P30L 4Z7WF 3H0TA 1W0VA 1BBJB 3FQTB 3HE6A 1A1OA 3U83A 5EUKB 2HMIC 4XVSL 5ICXA 5ECJE 3U4AA 2B4CC 4PLJD 3W9EA 3DJ9A 1EZVY 2P8LA 4MD0A 4FQCL 4WI3A 1SY6H 5DC4B 5E95B 1WUNT 3WIHL 4TQEH 2GK2A 5AYUH 5JNYA 4ZO9A 4DGIH 5HHXH 1CLYH 4JPWH 5DUBB 2KL6A 5DHVA 1SYVB 2DRUA 2MHAB 4Z7NE 3H9SB 3BVNA 5T1MB 1PQZB 3QISA 3LKRA 5DLML 3SKNA 1PFCA 2XPGA 3THMH 4JG1H 3S4SB 4F33A 3BRDA 3GSXB 4U2ZA 4M1DL 3QQ3A 3HR6A 1C08B 1KFAL 2P24A 5GS1A 3NPSC 4G8GA 1NCDL 5BRZE 1BFSA 1FZMB 4PJHE 1BFTA 2Z93A 1TJGL 4HJ0D 3VXUB 2I60H 4Q9BA 1WTGT 3HPJB 3RJDA 2E27H 2Y36H 2IG2L 2FR4A 2QQNH 4IRJD 3FB5B 2R1WB 2ID5A 3QUZB 5FKAB 4Y16D 1U2HA 5FGRA 1UH4A 3PL6A 4H0GA 1OW0A 2J12B 4RFOL 4R0LC 1CDHA 2VABA 4TVPD 2JB6A 3IETB 3VFRA 4NWTL 5CWSA 1M4KA 4UOW1 3FHQA 1KLGB 1HXMA 4CJ0A 5T1DH 3NCYP 4RFEA 4CMHC 4HCRH 4O5LL 4LHQB 5DK2A 3CVHL 4I1NB 1H8SA 5E8DL 5K93A 5C0AD 3DSFL 4RQQB 1PG7L 4OCRL 2NY2B 2R29L 3BH9A 3MUY1 4CAGA 1EO5A 4HBCH 1NJ9A 5D1XB 4E9LA 1M7XA 1I7ZB 2BHUA 4QF1B 3P11L 4R7DB 3KYOB 3IU4L 3KPLB 3SHSA 3ZE1F 1RHFA 2NW2A 3O3DA 3MV8E 2DI9A 4L9LC 3VH8G 3L3IB 1FVDB 1CGTA 4EEEA 5IMKB 4ZUSB 1DUYA 1ZK9A 1BOGA 3F7VB 3ARFC 5GGSA 5C3TA 1YEEL 3S98A 5L8KB 3DRTB 3HC3H 5L0QB 5E8EA 1IL1A 4Y19E 1F4WH 3BOVA 1B0GA 5E2JA 2FNBA 4KRNA 5L88L 1RZJC 3P4OA 1E4KC 3LN5A 3H9SD 2A83B 3FFCE 4IOSD 1TDQA 1QSZA 4N5UA 4O51A 3PUCA 4Y5VA 4Y4FA 5C6TL 2H32B 1JFQL 3Q0HA 2VH5L 5SWSE 3OMZA 1MHHA 4PTTB 1FL6A 4ODTL 4N0UB 1N26A 3VXUD 3LS5L 1EHLL 3OKYA 5EO1B 3OBAA 1NGQL 1KG0B 1FGVH 4XP4H 4Y5XA 3P4MB 5J56B 3EYFB 3I50L 1FBIH 1KTRL 4WWID 5EU7C 1S7VB 4X83A 3ARDB 3ARXA 2EDTA 3L9RB 5MHSD 2DQCL 3EO1B 5HPOA 5E56A 3MRFA 1UWGH 3S97C 4JFPB 4ERSL 1JRHH 1FZKB 3IVKB 3P0VH 2GK0B 4I4WA 4NQEA 3RZCA 3PDOB 5JW4R 4S1DD 2NY2D 4Q9RL 3VGGA 3RVTC 4E5XB 2QSCL 3GMQB 1BQLH 2BNRE 1IKFL 4ONOA 5CMAA 5D1XD 5EFIA 2E8ZA 3AS3A 3I6GB 2Q3AA 2XKSA 3KPQB 4ZAKC 3SGEH 1A8JH 4OLVH 5HYJB 3SGJA 5DI8A 1S7RB 1X5FA 4UTBL 3MJ6A 3MV7E 4R3SA 4FQXC 4Z5RB 3IGAB 2JKXA 1JF5A 4GW4A 5TF0A 4ZDHB 4ENEC 1BJ1J 2XZQH 1GZPB 2EDRA 4KK5D 4YC2C 5L2KB 3E0GA 2HJKA 5DJDB 3OR6B 4ZO7A 4JDZB 5IB2B 2VDMH 1UEYA 1MCQA 1BJMA 4ZSOA 3U9UA 2V9RA 5C0NC 3BP6A 4J3WA 5F3HB 1EDQA 4YEFA 4Y0GA 3TBVB 4AMKH 1T0NB 3ZDZF 2IPKB 2EYTB 1QFWH 4FQPA 1L9NA 2HRPL 4X7SL 4GAGL 2DLTA 8FABB 1P1ZA 3QSKB 3QIUA 4QYOA 2JJWA 4CADB 2DMCA 4QHNB 2AS5M 1OSPH 3JWDC 1DLFL 1YEGH 5I8CB 4I48B 3MLXL 4Q2ZA 4TNWK 15C8H 4P5MA 1PX4A 2UWEE 2ZKHH 5DK0A 1XGUB 4LLVA 3RX8A 1LHZA 4DN4H 4YXLH 5FUZH 1X5KA 3ARDD 5HD8C 1DJSA 1G1CA 3O6MH 1I9EA 4F7TB 5C0DB 2FX7H 5INCB 5BRZB 2P8PA 4PJHB 3D69B 5IQ9B 1HCVA 2C4XA 4ZFOL 4UBDC 2AEPL 1ZS8B 1MCEA 4U1GB 4M7JL 1PZUB 4EI6A 3CSYA 4ZUUB 4N5ED 5E08L 4R8WL 2OJEA 4QHMA 1XGQB 3OKKA 5HYJD 2ATPA 4Q6IC 2PTTB 3S9DB 3V95A 2IH3B 1Y0LA 5CBAA 4PJFE 5HI4D 2EEDA 4FTVA 3ROLA 4O4YL 2FWOA 4P2CG 5CJ5A 7CGTA 3VXQB 2XACC 4U1LB 3DV6B 1QYGH 3RWDB 1HDMA 1F6LL 5L2KD 3B8SA 3LKQB 2E9BA 2AK4E 4WUKH 3L3JA 3MLSH 5EBMB 4U1MA 5EO9A 3RNQA 5J9PB 4N9GB 4NQXA 3MRIB 5ITBL 3DO7A 2FIKB 2GSIB 4OCLC 3WIFB 2OZ4L 4UV4H 4WI4A 1CCZA 1INDH 3GJFH 1AP2A 4YHPB 3UTQA 1EO7A 2NNAB 1I7TB 5ESQB 5CD5C 1RU9H 3VWKC 3TCLA 2VR4A 5EIVA 2AJ3A 3OB0H 3RDTB 5GRJL 2XTJC 3B6SA 1JNNL 3CCHB 1FZOA 1CL7L 3DYOA 4I5BB 2BOCB 2NX5A 3ARPA 4R26H 4FP8L 4TSAL 1I85C 1NLDH 3BMWA 2G9HB 4DKFL 4Y19B 3D85B 4JQIH 3EDFA 2YPVH 3TO4B 5GJTL 5JW4N 1C5BL 4PTUA 1MQKH 1T7WA 5FOBA 1OM3L 1CL7I 2BDNH 1ZLSL 1MCWM 4QCIB 3R0NA 1G84A 2VDNH 1VPOH 2ZWLT 3FFCB 3NZ8B 2YBRA 1MWAA 3MNWB 5BZWA 2QHRL 2VLKE 3T0VA 1NCUA 1NGPL 3SKUD 1RIHH 3CAFA 3V6FA 4F2MB 5DD0H 4I18A 4PLKC 1CFQB 3MV9E 5BRZD 5SWSB 1P69B 3TBSA 3WL9A 1GGIL 1OAQH 2RHEA 3QG7H 3VW3H 1OGAB 4M48H 1A6VH 1GGBH 2GW5A 2VDOH 5IBUB 4KGJA 4PRAB 1LDPH 1FH5L 1MJ7H 3QAZC 3UBXG 3WCYA 4YNYB 2MSPA 3QNXA 5SWQB 1LNUB 1FE8L 4LU5H 1Y6KR 1QO3A 2NZIA 2QADC 2FHCA 3AMLA 3QUKA 4AEEA 1PKQA 4POUB 2PO6B 3ARSA 4XHJD 4LKCA 1BZ7A 1GIGH 2XKNA 1FORL 4TPRH 1WCBB 3AREC 2X4SB 2R0LL 4UMGA 4CW1B 3OAUH 4JHAL 4HT1H 4AQOA 2XWBB 3MRLB 1JWMA 3QDMA 5GGQH 3S3SA 4X6CE 4CVXA 3LQZA 3NCMA 1RUKH 3WD5L 4L8DB 5DMIL 3TO2A 3MV8D 1FFOA 3MV7B 5DEFB 3E2HB 1HXYA 4OIAA 4X99A 1XF3B 3DX9B 1A47A 5EN2B 3VI4E 1XIWB 2VWEE 3RDTD 2X40A 4MB5A 4LPXA 2EDEA 1OL0A 1NGWA 1E4XL 1GSMA 1MRDH 5I8KH 4NQSA 1OOAA 1ND0B 4M8QA 4LKXB 1YQVL 1HNGA 2QL1A 3HNVL 3D85D 4Y19D 5HPMA 3GUTB 1HZHH 1SEBB 3QEHB 3TO4D 4R4FH 2YZ1A 1FNFA 4KKBD 5JXAL 5F9OL 5DJ0A 1NANI 2YSSB 4RFNC 5C0BE 5ICZB 3EO9L 1EVTC 4YHKL 2XXMB 3U0WL 2IBBA 3FFCD 4XNXH 3VXMB 5DSCB 4JANA 5IP4A 2OTWA 2E9IA 2OI9B 3QDJE 4XRCB 5D72L 3MRBB 2IBGA 5D2NE 2ADFH 4OLWH 1KJ2B 5SWSD 2YXMA 1MFBH 1YC7A 3EDDA 4X8XA 1OGAD 3B9KB 2GHWB 4FXKB 3H42L 3RP1A 5HYQB 4LCYB 4JZJC 3AS2A 2UWEF 4FOMA 2UWEB 1A0QH 3ZL4L 2ITDA 4HKXB 3U6RA 1LO3H 3HPLB 1OTSD 3BESR 5EU6A 1CI5A 2XY2A 5I1LB 2PO6D 1ZSDA 3CLFL 5T1LB 4NN5B 4JDVA 4L8CB 3T0XA 4N8VG 3QHFH 2V2WB 1N3NB 4NRXA 3I9GH 4P2QE 5GPRA 3SKJL 2BNRD 4MAYA 4ZUTB 2DM3A 1UKSA 5IMLB 1E28A 2PW2B 4MA1C 1DEEB 1MAKA 3UO1H 3MV7D 4PJFB 3EOTH 1D9KB 1ERNA 1MJJB 3FMGL 4BH8B 1BREA 1GOHA 4GXVH 2C5DC 1XIWD 1A9BA 5L8LB 3V6OE 5JW4Q 4HLZG 5I8EA 4J4PC 1OAUL 3RY6A 2VL5A 2AK4B 4OBRA 5C09E 4ZUWB 2FBJL 5CCKL 5D7LB 5K9KB 1W8OA 3MRRB 4LSQH 3IDYB 5IVZB 4GAYA 5A2JH 3S7GA 3HZYA 4LLDA 2EE9A 2CRZA 4M93C 5I1HL 3ZHDA 1NAKL 2JCCA 3RWCB 3C9NB 4NP4H 3SDXF 2NY7H 4OB5H 3LVEA 3VXMD 1MOEA 2H41A 1JZ5A 2A38A 5J1SC 3CDCA 1KJ3L 4G8FB 4EDXA 3MV11 1AD0B 1OTUD 25C8L 1KNOB 2XOTA 4JO3H 3HNSH 2LTQC 5I1CH 2YMXL 4DTGL 1CXFA 5IHUL 3B9KD 1KSRA 4U6XB 5CHNB 3O6KL 3T2PA 2FYYB 4NNXB 3QWOA 4DGVL 1JPSL 6CGTA 3PQYA 1DBAL 1QLRA 4PJGF 3HCVA 4UIMB 3TBTB 5KS9A 2PYEE 5DTFA 4QHUA 1FCGA 3VGEA 2VXSH 1B0RB 4XVTH 4Q9QH 2VLKB 2IADA 1U3JA 5I1DA 5T1LD 4I2XA 3VD5A 1VKXA 4KJPC 4DWHA 3MV9B 4APQA 3TT3H 2ESVA 3BEWB 2ATKB 2ERJB 2FO4B 3EO0A 2HJLB 5D9SB 2D3VA 2A6KA 3S35H 4XMPH 2HKHL 4JG0L 2EIBA 4GRMB 1OPGH 2VXQL 5I73B 3FJTA 1RZJH 3TA3C 3CH1B 4KTDL 2DMKA 3KLSA 5C0JB 3MA9H 4H1LH 3EJZD 5HYSG 1GAFH 1KCSL 2Z8VC 2F58L 5DQ9A 4LF3A 4P5KA 1RQ5A 4XWOD 5E2UL 5E6IB 1EHXA 5IVNA 2Z0BA 4HXBH 4YQXL 1JTOA 3C6LB 4Y8AA 4PD4K 4HWZA 4X5XB 2AK4D 4OGZA 4LVNB 4LPTA 3HI5H 2X4OB 4QXGH 4OAWB 4X6EA 5DR5L 1Z0NA 4RWYL 5FM5O 1MCWW 2Q7NA 4X6CB 5JIPA 5DUPL 2YN5A 3SDAA 3ZKXC 3Q3GA 2XIDA 1IQWH 3VI4F 3NCBB 4F7EB 2CLZB 3DSNA 1KCVH 3MOAH 2UZIH 1TNMA 1G7MB 2GI7A 5I1GH 4XP1H 2XZZA 3FQNA 3U2SB 3LN4A 1CFSA 4FMFA 1UZ8A 3BIAX 5K9JL 4PJAE 1AR1D 3HMXH 4OCWH 5GRVL 1RVFH 3U1SH 1P4IL 2GTZA 4DEPB 2CR3A 4HS6A 1JTPA 5DMGD 3GEWB 5C0BB 3QJHB 1HQRB 5GISL 4XVUD 2J6EH 2HG5A 2VUOA 3QDJB 4ONFH 2VLKD 2QKIB 2WBJB 4KHXL 4NQVB 1IBGH 2Z31C 5D7JA 5D2NB 5HYIA 3MV9D 3SDCB 3FCTB 4LLYA 3CK0H 1I8MA 3KS0J 3GBMH 1P9MA 1M05B 1A9EB 1NCNA 5KTEH 2AABL 4FZEL 3IU3B 5E5MA 4ALAH 4BFIA 4CNIB 3FTGB 4DFHA 1UB6B 4GRLA 4KPHH 4XGZB 1HOCB 1CGYA 3JVGC 5CUSH 4P4KB 4MJIA 3VGAC 4LRIC 5DO2D 3C60B 1XCQB 5FM5M 3FOLA 3HLAB 4J3VA 1SMOA 4LSRH 4ZOCA 2X1XR 5E6ID 3RBSA 1I1YA 1WWBX 1KLUB 4Y5YA 3C6LD 3VFOB 4ODSL 5C7XH 4EN3A 1BMGA 1KTKE 3TC9A 1YC8A 2XZAL 2ZCLH 3JWDH 5EO0B 1ZGLB 4XPTH 1NGZB 4YUEL 2BY2A 3QO0B 2E8YA 4QGTA 2X4QB 1SJVA 1A7OL 2IFFH 3BGMA 3VFVA 4QEGA 1WTLA 3C5JA 1MCBA 1FZJB 1Q9KA 1KJ2L 3V52H 2L0DA 2ZPKH 4Y89A 1FVEB 3DX7B 4RZCA 3MRMB 3BYTA 4JZOA 1MH5B 3VXPB 4FFYL 1ZEAL 1I75A 4GLRI 3G08A 3LPGA 1RZ7H 3DTXB 4OGXH 5C09B 12E8L 4JAMB 3BQUC 1S5IH 2AKRA 2ICCA 1RIVL 4N0RA 5F96H 2X4TB 3JSSA 1H3PL 3QULB 4J12A 4HS3A 5GIRB 4XCYB 1HINH 4X8JB 3KPMA 1T03L 5C0BD 1ORSA 4WWKB 4RRPA 4X6FB 5AZ2L 3QDJD 3MROB 1JWUB 4X4YA 2WBJD 1U8MB 1S9KC 4NNPL 5HY9A 4KZEL 2IQ9H 2NXZC 2YUZA 3PDGA 3SDCD 3PHQB 2R8SL 1B2WL 3EYVA 3UROR 3STBA 1GC1C 4V1DA 1FG2B 3HC4L 4QTIL 2V2TB 5CIPA 1U3YA 1IILE 1TTFA 4XBPB 1FVCB 1FNGB 2EICA 4G8IB 2PYEB 4P4KD 1TITA 4W4NA 3C60D 2AJYL 4BQBA 3SCMB 2AQ2A 1G9ML 3BIKB 5ILTL 2NY0B 2VKXA 5EOQH 3CDYA 3OKOA 5CILH 2YPLA 3D39E 5DD3L 1IAOA 2IQAB 3UJTL 1K2DB 1Z0MA 3QXDA 3BGFC 5K9QG 1T04A 2W9DL 5DDHB 7FABL 5IB3B 4PS4H 1F90H 4S2SB 1ZA3A 5I0ZA 3V4UH 3VCLA 2DM2A 2VR9A 2R9HC 4UAOC 5CEYA 3MNZA 1F00I 4M61B 3LKNA 5E03A 4O02H 2ADIB 3VFGL 3S37L 2BCKB 3LZFH 1UM6L 3NOIA 3TVMA 1RJCA 3SO3C 3L3HA 3O6LL 5C09D 1BZQK 3G6DL 3LD8C 2NW3A 5AD0A 3NFNA 1Q0XH 4OLZH 4KK6C 3KHOA 1WSST 4R7NB 3DI2B 1KIPB 4LASH 5KSUB 4DZ8B 2NY3B 1D6EB 4TULL 4LGSB 1ONQB 5I71C 2VZ3A 2IFGA 4HIHB 4WWKD 2Z35B 5I74B 4HUXA 2XQBH 5DUMH 4X5WA 2DIBA 2X1PA 4N8VB 3GSQB 3VI3E 1E4WH 3RFZC 1CFVH 4WY7H 1FYTA 2DWDB 2X4RA 4P2RA 1NFDE 3B9VA 5IMOB 3UTTA 5HGHB 2R4SH 4PGBA 3CIQA 2DQDL 3NCEB 1RK1B 4XNZB 1ED3A 2FO1A 3V8CA 1QEWA 4UQ2A 4U6YA 2PYED 4LCCC 1AHWB 1JUFA 5DRXA 3BISA 5JQ6L 2YK1H 4X80L 3IT8D 4GAJL 3SCMD 3UZQA 1IT9H 3EDJA 5INDB 4NC1E 1CU4L 3R0MA 4PBVC 4NQDA 4YWGH 2NY0D 1PEZA 4K8RL 3MRKB 5JXEA 1X3DA 1DN0A 3CSBA 3QUXA 4WFGE 5I17A 4WW2F 4M00A 2F74B 2VC2H 2F5AL 4ODXA 3IJHA 4GKZA 3H9ZA 3HUJA 1XFPA 4XPHH 1EMTH 4DZBA 4EBQL 5B4MD 2RJMA 2AAVA 4O2CB 5J1AB 5F1NB 5GGVL 1T22B 2IH1A 3C5SB 2CRIA 4JPVH 4IDLA 1F11A 4RMQA 4MQ7A 4U1KA 3KWWB 3STZA 3GMMB 3EGSA 1U93B 4H1LG 4Z6AT 5FEBA 4Y1AE 5DMYA 4UTAL 4OZHA 4KK8C 3QUMH 4WO4B 3NN8A 3RKPA 3QDAA 2V2XB 4L8BB 3MJ9L 1N2RA 2X89D 3SOBL 4LSVL 2A6IA 4RIRB 1RY7B 4XBEL 3DOSA 5KAQG 3DGGA 5H2BA 3RWEA 1U3HC 2W38A 3PXJA 4HH9B 5DRNA 1ADQH 2NY3D 3FQUB 5CJ8A 1MCSA 3F6LA 3ARZA 3T0BA 3QI9C 4E0RB 3EYOA 1F3JA 1DBKL 4YHML 3KNBA 4ODVL 2Y9RT 5FO7A 1Q9LA 3MUJA 1RZKC 2FL5A 1KF9B 2JJSC 4G43B 2GJ6A 3BZDA 3KJ4B 3WJJA 3WFDH 2QSTA 5C8JA 4U1JB 4OF0A 3PV6A 4ZG1A 1SYSB 2BRQA 4FQ2H 4DCQB 3W11C 5F7MC 5FHAL 2BOBA 2Y5TA 4JM2F 3QEGH 1D5BA 4R97C 1AQKH 1SY6L 4CVZB 1QTYT 3GIZH 1QNZH 2HT4D 4TQEL 2VUYA 2RFXA 5AYUL 3IFOA 2QSQA 1T6WA 3T3ME 4NNYA 5HHXL 1CLYL 3ZDYE 2HFGH 3WUWG 1C16A 1CLZH 5AUMA 1YY8B 1C1EH 4PP2B 1U8LB 3QWRD 4NN6B 4X6DA 4XWGL 43C9A 1MI5A 4FRWA 4WNQA 3CC5A 3THML 2D31B 4JG1L 4CN4A 4H88H 1PD6A 3OV6A 4LHUG 5CGYD 4P4RB 5IOPA 3HNTH 4HUUB 1ZA6B 1CGUA 1N6QH 2HJFA 2HTKC 2HLFD 2I60L 2P1YA 2E27L 2Y36L 1T6VN 2QQNL 1X5JA 4OF6A 4DOHE 3W39A 1MFDH 4LIQE 1QFUH 1H3GA 3QO1B 1K8IA 3TPUA 1KB5A 2BNQB 4WO4D 1MCNA 1V3MA 3G6JF 5FO8B 1X5XA 5F1SA 5I75B 1FNEA 1I3RA 1U91A 5T1DL 2XYCA 3TGXA 1AGEB 3L7EB 4HCRL 3ZYZA 1CBVH 3UBXI 3Q48A 4LPUA 2QHLA 3SGKA 1N8ZB 5DJCB 3WHE0 2ZG1A 5DA0B 5BXFB 3G5VB 1MCIA 2OXHA 2LE9A 2DQGH 3U0TA 4HBCL 4ZXBB 4NHCH 2FEDD 5J1TC 3SDDA 4JR9L 3X3GH 2ORBH 3VRIB 2C3VB 4YH6A 3SY0A 4WI8A 3V4PH 3LY6A 4OZGE 2BY3A 1V7MH 3RJQB 3UC0H 4NO5A 4WVRA 1RJLB 3QNZB 3X12A 1KJMA 4Z0BH 2BVTA 3AB0C 3DVNB 1CDBA 4U1HA 1YEDA 3DURB 2AQ1A 4XH2B 1R0AH 1J0KA 3TZVA 1T5XA 5HDOA 4A2LA 4LBEB 5E7BA 2XWTA 3VI3F 4WEUD 3RX5A 4CRPA 3PGFH 1JHKH 1NFDF 1F4WL 5I66A 1NFDB 3HE6C 4LQFH 2YWYA 3WIHA 4AT6A 2ADGA 2H8PB 5CJBA 5EC1A 5IEHB 1BVLA 3RVVC 1WV7T 5MI0B 2D9QB 1HE7A 3C08H 4CN1A 2BHYA 2ICEB 4G9FE 2JIXA 1DP0A 3PWVB 1XF5A 2VZOA 2E7HA 2WLYA 4HD9A 4MXWH 4PY7B 5EU7E 5J6GA 1B6DA 3SE8H 3NBNA 4JPIA 4Z8FH 1LEIA 1A6AB 2DD8H 1CDCA 3CUPB 5CKGA 4L9DA 3FO2B 4FQ1H 3BKJH 1R24B 1FGVL 1L4IA 4XP4L 1D5XB 3EHBD 4KKLC 1A6ZB 3MBEB 1FBIL 2FJHA 2BNQD 3O3UN 3B2UC 1T7YA 3VFTA 3D39D 1B90A 3TNMB 5E94B 5F9DC 2DJSA 5CSZB 5HHME 5LAXB 3O2DL 4JHBA 1UWGL 5F7LB 1T83C 1JRHL 2ZP0T 4O2FA 3V6BR 3P0VL 1HHIB 5C9JA 4LEOB 4MMZC 3KYMB 5GRUH 4Y1AB 2EDHA 3WN5C 1BQLL 4ZXBD 2X4PB 3MACL 1CE6A 2GSGA 3WFHA 3CVHA 3QEUB 1MLBA 4YHIA 5ENWA 5E4IA 1CDIA 4OLVL 5KVGH 3KYKH 3BXNA 5CSGA 3R1GH 4LPYA 2B2XL 2DLFH 2X42A 2CJUH 5CZXC 2R2HA 5F3BB 1O5DT 5E99H 3MREB 1PKOA 2B1AH 4KJWC 3VDCA 4Y2OA 2XZQL 2BSTA 3SGEI 4L8SA 4ORGB 1BF2A 1AGCB 4OFYA 4OTXH 4MWFB 3FT2A 3VGFA 5IB5B 1BD2E 3KLAB 3BZEA 3LS4H 4MD5B 4HXAH 4AMKL 4MX7A 1HI6A 1DQMH 3PWLA 1EA9C 1QFWL 1HHJA 3WKMH 2EC9T 1Z3GL 4XMLL 2EE6A 1QKZH 4NHUB 3UTZA 2VDQH 1K4CB 2XQYK 2DKSA 1JZ6A 1OSPL 4P23B 5DJ6B 2OJZH 3T3MF 3AU1A 5EG6C 3O41A 5CP3H 4P2OC 3N1MC 3P77B 3ZDYF 1TZGL 1YEGL 5JOPE 1DLHA 1BZ9A 1G6RA 3NPSB 1BWMA 3IFNH 15C8L 3TYFB 1DDHA 1FG9C 3MBED 4WFGD 4GW1B 4Y5VC 3SE3A 4DN4L 3OAZH 4YXLL 5FUZL 4YO0B 1J8KA 3LSOA 3O6ML 1S78D 2EKSA 1P53A 3V6ZA 1C5DA 2FX7L 2FH8A 1GGYA 4KKAD 1HH6A 4NZUL 3ZMRA 1D5ZB 4DVBB 5I2IB 2Z8WC 4Y1AD 4Y5XC 5DRZA 4CMHB 3BEVA 3FAXA 5IQ7H 4DOHB 3TP4A 2O93L 3MRHA 4M5YH 5T3XH 5HHOA 4LLQA 4HGWB 2ICWB 4I77H 2XKUA 3MUGA 1X4XA 4GXUN 4RMSA 1GC1H 3O3AA 4QRSB 1P7KA 1CD0A 5TPWH 4LL9A 1II4E 3RZCC 4ZS6D 1QYGL 3NACH 4FABH 4L9LB 4WUKL 3WKNA 3ES6B 2WUBH 4JDTH 2NPLX 3MQIA 3SGJC 2XTJE 2X1WL 4PG2A 3BD3A 5IVXE 4L3EE 2YEZB 1EEUA 1LE5B 4R90H 5GGVY 2VDLH 4UV4L 4OZGF 1Q94A 2Z91A 2EXWD 3VXOA 1IGTA 1INDL 4OZGB 3V7AG 2XWJB 1JMZA 1G7PB 5GS0C 4BA8A 4F7CA 4MD4A 1RU9L 1NDMA 5DJYA 1NSNH 3GDBA 3GSVA 5IG7B 1OF2B 4BKLA 4H1LB 1OCWL 1A6UH 4O2EB 4R26L 4JO4H 2YN3A 1XF1A 4P23D 3OG4B 3I85A 4JQIL 4B7IA 2YPVL 4MXVF 1TJIH 3GMOA 3DVGA 3L7FA 5HJ3A 1JGUH 4UQ3A 4UB0H 4Y16A 4HC1A 2BDNL 1NEZB 5KAQF 2P45B 3RKDC 3WHE1 5ESVB 3GNMH 2VDNL 1VPOL 2A73A 3QIUC 4LLWB 1R3LB 5GGTH 4Y7MA 4PV8A 4G9FB 3WJLA 2WNGA 2NLJA 1X5HA 5DD0L 3BKYH 1F3DH 4KK9C 2G60H 5L6YH 2CLVB 1QLFB 3MGTB 4EKXA 3GMRA 1OAQL 1RZ8B 4MB3A 4TUOA 3VW3L 5JHLH 2VZTA 4MXQD 5C0AA 4OT1H 4GKSB 1F6FB 4M48L 3MCKB 1A6VL 2VZVA 3RI5F 1GGBL 2VDOL 4AZ8A 2B20A 4I3SH 1LDPL 2BVOA 1MJ7L 5GJSH 4HK0B 2BVUA 4OCYH 3DV4A 1RSFA 4OLYH 1OLLA 4OFPA 3KXFE 4LU5L 1ZMYA 2AXGB 4X9FA 3GSWA 2HT3D 1IARB 2HT2C 1EFXD 1AGBB 5HHMB 3CFDB 4ZAKB 1BBJA 2P5EE 4XNYH 1WIPA 5EUKA 1N5AB 1GIGL 4FQXB 1AD9B 4NFBA 1UVQB 2P49B 4TPRL 2B8OT 4JN1H 5TQ2H 3OAUL 1A5FH 1AXSB 4HT1L 3WUWB 5J11B 5IFJB 2BVPB 5TF1H 4YC2B 5GGQL 3ULUC 1X7QB 4TNVK 2NR6D 3PP3H 4HV8B 1RUKL 3WXVL 1SYVA 4L3AA 2MHAA 3H9SA 1FFPA 4Q58C 4PFEA 1PQZA 3IKCB 4J3UA 5BQ7B 3QPQC 4P3WA 4Y4HA 2OZ4A 3HS0B 3L3DA 3OGCB 2VXVH 2JJTC 3S4SA 5HSFA 3GSXA 3BN3B 5F7UA 4XXDB 3NTCL 5I8KL 5AWNH 3TN0B 5M94B 1FZMA 1Q1JH 4OD1H 1BPVA 1EJOH 3VXUA 1HZHL 3M8OH 4R4FL 3HPJA 2R1WA 4D2NA 5F7WC 1IKNA 4RGMC 1YY9C 5I30H 1KIRA 3VFWB 4XNXL 3RWFB 1GJIA 4ZUVB 4D9RE 3IETA 3WNLA 1BHGA 1MRFL 4G9FD 1KLGA 3V79C 2E5EA 5DK3A 2ADFL 4OLWL 1CT8B 3AUVA 4IOIB 1MFBL 3U46B 1MY5A 4AEIH 5HGBB 3ZYJA 5M95B 3EOBB 1A6TB 3IFPB 5DHXB 1CD8A 1OAZL 5D1XA 1I7ZA 1A0QL 4LMQI 4R7DA 3KYOA 3KPLA 5I19H 4WENB 1LO3L 5HHPA 1RZKH 1A4JB 3FO0H 4I18C 4Z7QE 3KGRA 1LWRA 4Z7VE 1NKRA 5EZOH 5HHMD 3MXVH 4ZAKD 3L3IA 1FVDA 5IMKA 4ZUSA 1YMME 5FA4B 1L7TH 3F7VA 3AROA 4FQXD 2AVGA 3CD4A 3Q5TA 2ZUQC 2PXYB 2NY1B 3STLA 1IM9B 3GRWH 4V2CB 2G75B 1Z9LA 3RHWK 2UYLB 4LLUB 4FNLH 1A3LH 2W65A 3UO1L 5SX5K 2EYRA 5C0CE 2A83A 3V0WH 2BVEA 5C0ND 4GXVL 1QBBA 3G5XB 2MCG1 1KTDB 5FUOH 2QR0B 4ZPVB 5DZOA 2CK0L 3TN0D 5IFHH 3VWKB 4X98A 2VR5A 4U6HB 3GMLB 4ZOAA 4J1UB 4LSQL 5ID0A 2XTJB 3C8KB 3I75B 1BD2D 4OGAC 2XFXB 4OF8A 5IVXB 5EO1A 4L3EB 2Q87A 4H20H 4TYUA 1KG0A 3JV6B 4HULB 3WDIA 2FX9H 3HZVB 3OAZK 5IROA 4NP4L 3P4MA 4WI5A 1PW3A 3EYFA 2NY7L 5DC0A 4OB5L 4LAJH 5L2JB 1AKJB 2EYSB 2DL9A 1JPTH 2I27N 3ARDA 1MQ8A 2DWEB 5F7EH 3EO1A 1CWVA 3L5JA 3QJFA 1BX2B 4JO3L 3HNSL 3C5ZB 1FZKA 4XC3H 2GK0A 3PDOA 4C4KO 1U8QB 3HHRB 2ZCKH 3U0PB 1K6QL 3GMQA 4E5XA 5JOPD 1YEHH 3ARYA 1YEFH 1YPZE 4JRWA 4Y88A 3KPTA 3I6GA 3KPQA 3MBXH 4QGYA 5HYJA 1S7RA 3DUUA 4TRPH 2VXSL 3P4LA 1KPVB 4XVTL 3VE0B 4Q9QL 3ZZ1A 4Z5RA 3QAZB 3ZT5A 2ICWI 2O5ZH 4QRRA 1F4HA 3D18A 1DBBH 2D03H 4ZDHA 3D9AH 1A7NL 1CVSC 3BP4A 4CDHA 3RWGB 1GZPA 2QADB 4S1RH 3TT3L 3S36H 3BDYH 5DJDA 5D1QC 4PUBH 5JORB 2R0ZH 4DUXA 4JDZA 1AR2A 2PXYD 3MLWH 1M7DB 5DHYB 3ZTJH 2NY1D 1IM9D 3QEQB 4DKEL 3S35L 1AI1L 3EYSH 4NRYB 2DKMA 4KDTC 3KXFB 1RIUH 5F3HA 1RZJL 3TBVA 3N9GH 1T0NA 2IPKA 3ALPA 3MA9L 5DJXB 4KXZH 1GAFL 2P5EB 2XTLA 1D7FA 1E6JH 1EAJA 4HXBL 1RJYA 3GB7B 2AXFB 4HGKC 4BFBD 4MAYC 5MP6H 3HI5L 2A77H 3VWKD 2VQ1B 3I6KA 4QXGL 1TZIA 2XTJD 1RJZB 2IPUK 3G04A 5DHVH 4L3ED 1QG3A 2OTPA 3MRQB 2HYMA 5I8CA 3RTQC 4XI5C 3I6LE 5FGBA 1JPFB 9CGTA 3QQ9C 5F1IB 5TE6H 4XCNA 4ZTPH 4OF3A 1IQWL 1XGUA 1P84J 4BH7A 3BFOA 1AKJD 3RY6C 4AENB 2P5WE 1KCVL 2UZIL 5AYQA 3ZKMC 1T21B 1WJ3A 4CU8A 5IKCA 5I1GL 2EDXA 1FL3B 4XP1L 5C0DA 4F7TA 2DQFA 3HFMH 1T89A 3C5ZD 5BRZA 5DD6B 1WWAX 4PJHA 3V5KB 3H6JA 2GFBB 4OKVA 5IQ9A 3HMXL 4OCWL 5KSAC 3QUMB 1RVFL 1ZS8A 4PLKD 3U1SL 1RUPH 3KHQA 1MFNA 2QLVB 3ET9F 4QWWC 4ZUUA 1S8DB 5FFLA 4XP6H 1OHQA 2PW1B 1XGQA 1P2CA 2PTTA 2QJDA 4IS6B 4JZJB 2Y1VA 2IH3A 3WLBB 5ACLA 4CL7A 2BERA 2J6EL 2BSRB 4B0MM 4L5FH 4ONFL 3SPVB 1RV6X 3MRNB 4G3YH 1IBGL 4EI5B 1WZKA 4OM0H 4U1LA 3DVFA 4MJ5B 3CK0L 4P5TA 3RWDA 2YA0A 1OSZA 4F9PA 2QADD 5HVFB 4XP5H 4YPGB 3GBML 3LKQA 1WZ1H 4JRYE 5KTEL 5EBMA 4OBSA 3DMMC 4ALAL 5FV2A 3BWAB 3HAEG 4JO1L 1PDKA 4KPHL 3Q1SH 2VLLB 4D94A 2FIKA 2EE2A 4R2GB 2GSIA 5CUSL 4AIZB 3WIFA 3KXFD 5EDXA 1UH3A 1Q38A 3MV8A 3ARVA 4Z7VB 4LSRL 4QY8B 3HG1E 4YHPA 2HWZH 1UEMA 2P5ED 1EERB 1YMMB 1I7TA 1PSKH 5ESQA 1FFRA 1T80A 2YPKB 3D6GA 4MA1B 3RDTA 2MOVA 3CCHA 5DEGB 5C7XL 5FUCC 1KLFA 3F6IA 1EGJA 4YK4C 2ZCLL 5FK9B 3JWDL 1J0YA 4MLIA 3X17A 4XPTL 2ICWJ 2G9HA 2RQ8A 4Y19A 3D85A 3OG6B 4PBWD 5C92A 3TO4A 5KBNC 5T5NG 3ALWA 4IOFC 4FQQB 1HQ4B 3WNMA 2IFFL 4PJ8D 4QCIA 5C0CB 5EU4A 3V52L 3FFCA 1MVFA 4MQXC 5LGKA 4NYLA 3NZ8A 4M93B 3MNWA 4A2MA 4XX1G 4F2MA 2RB8A 3VD9A 4D0DB 1CFQA 4OGXL 3JWOC 5SWSA 1J05B 3PHOB 1S5IL 4TSBL 1P5VA 1V5JA 2HLAB 3EOYG 5F96L 3BJ91 3SDAC 1D5IH 2EDBA 1HINL 1UCTA 2LTQB 4PRAA 1CD1B 3MZGB 3QQ4B 4YNYA 1OAXH 5SWQA 3K2MC 1LNUA 4PIRF 4R9HA 1NCBH 1P5UA 5EPMA 4D9RD 3WO4C 5D7IE 3IFLH 35C8H 4DGYH 2PO6A 2IQ9L 1D6VH 4EI5D 1FNLA 2YUVA 5D96C 2Q1EA 2F53E 3OSKA 1H5BB 1RK0A 1WCBA 3AAZB 5ITFB 2X4SA 3PHSA 1YPZF 4CW1A 2BNRA 5D5ME 2XWBA 1YPZB 2R4RH 3MRLA 5KVDH 4R2GD 3G5YB 1I4FA 5ID1B 2OTUA 3WXWL 5D7JC 1SJXA 3MV7A 5IM7B 5DEFA 5GS0H 2FZ3B 1KIQB 4JPKH 5B3JE 1YMMD 1XF3A 4LVHC 4TTDC 1KIUA 1N5YH 3EYUH 4YZFE 5EOQL 5EN2A 1A7QH 1XIWA 3T0DA 3TA3B 5CILL 2AERT 2NY6D 5DFWH 4JKKA 1A2YA 4NC0B 4GRLC 2E7LC 4GW5B 4LKXA 4PS4L 4KMTH 1F90L 4J4PD 3GUTA 4QRQB 3QEHA 3V4UL 1L7IH 5D2LF 2YSSA 5ICZA 1IAKB 3VRLF 5C0CD 1N0XH 4Y5YC 4NQCA 5DSCA 4O02L 2V5TA 1G7IB 3X11A 3VXSE 3LZFL 3OKEB 3MRBA 1KJ2A 2PF6A 1Q0XL 4QRPE 4OLZL 1BQUA 1YNLL 3B9KA 4FXKA 5HYQA 4LCYA 4LASL 4EXPX 3TH2T 1ZHBA 1AY1H 3K46A 5FIEA 1PY4A 5ERWB 4OZIF 4NC2B 2UWEA 5MEOB 1YZZA 2I9LA 1TTUA 4W6XB 1GHFH 3LKSB 2XQBL 2VYRE 3PP4H 4HKXA 4HUKB 4HFWB 2P5WB 3HPLA 4YGVA 1E4WL 1CFVL 4WY7L 5I1LA 1J10A 3E1F1 5T1LA 4ZFFA 3BE1H 4FG6D 2E7BA 1QBML 4L8CA 2WBWB 1N3NA 2R4SL 1ORQB 3G6AB 2Z31B 3FN9A 2DKUA 5E5RB 1KBGH 3FQXB 5IMMA 4ZUTA 3S5LB 1MCFA 5IMLA 5J06A 3ULUH 2PW2A 1CICA 1NC2B 5EIIA 1DEEA 2YRPA 4L1DA 4KFZC 4PJFA 2FJGB 2YK1L 4C54A 1IT9L 1MJJA 1WIOA 4YWGL 5MERB 4NN7C 3TA3D 3VGAB 4EJ1C 5TE4L 5I1IH 5DD1H 1TJHH 2AK4A 2X5PA 4LCUB 4ZUWA 1UQSB 4JRYB 2CDFB 4XPHL 5HDQH 1EMTL 5E1HB 3ZTJG 1FFNB 5K9KA 4Z77B 3MRRA 4ONHB 4X4XA 5IVZA 3KAAA 4ORZC 1IGJA 5FDYA 3T09A 1S7WB 4HJJL 4JPVL 2HRLA 3MYJB 4PR5B 1R5VB 4L4TB 3HG1B 3E6HB 4D3CH 1UB5B 4M1GH 5D8JH 2BHZA 2HFFA 1H3UA 2H6PB 2R56H 4WDIB 3B5HA 3QUML 4G8FA 1RULH 4EDWL 5EUOE 1AD0A 5TGBB 1RHHA 2I24N 4WI2A 3BP7B 3T4AB 1KYOJ 4JFFE 5FYKU 5CS7A 5I8OH 4U6XA 3D0LB 4RAVB 3MX0A 5CHNA 2FYYA 4NNXA 3I6LD 4IRZH 4K2UH 1ADQL 1XR9B 3U7YH 3TBTA 3TVMC 4U1NB 1B0RA 2P5WD 5D7SH 2VTFA 2VLKA 1TQBB 5CINL 1IAMA 1U36A 2OYPA 2F15A 3MV9A 3FFDB 2P48B 2XG4A 1KEGH 2P8MA 3NCJL 1U8KB 3MLUH 1Z9MA 3BEWA 4WHYH 3WFDL 2Z31D 1TZHB 1OAYH 2ATKA 1LEGB 3L1OH 1U95B 1EEYB 3BUTA 4OUUB 1VFBB 5D9SA 4PJDA 4FQ2L 4I0KA 2V5SA 4CKVX 1H3WM 5IFAH 1NC2D 4C83B 3QEGL 4Q9CA 4GRMA 1AQKL 4G6FB 3IXAB 5D7IF 3GIZL 3KPPB 1QNZL 3CH1A 3NAAL 5I76B 5D7IB 3QCTH 5C0JA 1PLGH 4U6VH 2HFGL 5E6IA 2APTA 1CLZL 1C1EL 1S7TB 5KJRH 2F53B 3L95B 3WE6A 3SJVE 4RX4D 4X5XA 2XXCB 1W0WB 2BNUB 4JRYD 1ZKAA 4DW2L 2X4OA 4H88L 5D5MB 4K7PH 1SEQL 2D0GA 4W70A 4X6CA 3HNTL 4F9LC 2W60B 1N6QL 5B3JF 1F2QA 3MFFB 2O5YH 4D9LH 5JXEC 2J8UF 1S9WB 3HG1D 5DJAA 4MZ2A 1ZT1B 4AEHL 5D93C 2CLZA 1MFDL 3D25B 2X4UB 1IMHC 1QFUL 5F88B 1G7MA 1W0YT 4JFDB 4UAOB 4TUJB 2KQMA 3TBWB 4G9DA 3U2SA 4OV5A 1MAJA 1E4JA 2W0FB 1IEAB 2IJ0C 1NBQA 5AEAA 3V0AC 1CBVL 3SO3B 2W59A 3CPLB 1IZKA 5FYLH 1JGDB 5JO5B 5E8OB 3TJEH 2DQGL 3B9EA 4NHCL 3KLDA 3X3GL 3VXSB 2QKIA 2WBJA 4UDUB 5I71B 4OI7A 3H7BB 3ZYIA 5D2NA 3T04D 3SDCA 3FCTA 4FXGA 3V4PL 1RFDH 4QRPB 1V7ML 3UC0L 4LGRB 4MVBC 4FFWD 3RUGE 4Z7OE 1IRAY 4U3CA 2IANE 1A9EA 4Z0BL 5HGGS 5T3XD 5F9AC 3MPCA 3IU3A 4XCFH 5EZIL 1R0AL 1KPUA 3OKNB 4CNIA 2B5IC 3FTGA 1UB6A 3HC0B 2V5MA 4G6FD 5IWLA 4P4KA 1NMAH 3C60A 1XCQA 4IM8A 5IVOA 3W82A 4JRXB 3HLAA 3PGFL 2FCBA 4NBYB 3MLZH 4HWNA 5K59E 3A6OA 2VZUA 4LCCB 1QPXA 4WIQA 2LVCA 3QFDA 3WJJC 1SY6A 4QHLB 1UM4H 1V3LA 2MKWA 4LQFL 3SDYH 4HZLB 1KLUA 3RAJH 2F53D 3VFOA 4Z9KB 3QIBD 3DRQB 4P2QA 4MMXC 2ZUSA 5EO0A 1ZGLA 4HEME 1MPAH 4A6YB 1NGZA 3QO0A 1KEMH 5MENE 4MXWL 2G5RA 2X4QA 1KT2B 5ESAB 5IUSA 3KLHD 1S9VB 5TH2B 1CXHA 3TPKA 4U7SA 2DD8L 3O3EA 1FZJA 2C3HA 4FQ1L 3BKJL 4AH2B 5EH1A 3HRZA 1TCRA 4FS0A 3RVWC 5CBEB 3V6OA 3MLPA 2HFEB 4JFDD 5E9DE 5C09A 2RCSH 4JAMA 2YOCA 3GMNA 4LVOB 3QULA 4KUCF 3ZKSD 4JLRB 2AXHA 2SEBA 2NY5C 4UV7H 4KK6D 5GRUL 2CUIA 2AJSH 4WWKA 3AVEA 3N1GC 4M5ZH 4X6FA 1U3HB 3TV3H 4HCRA 3LDBC 3MROA 1JWUA 5GRWA 3VXSD 5KVGL 3CFEB 1U8MA 1XGPB 5EUOF 3KYKL 5ACMA 3RNKB 3R1GL 5EUOB 2DLFL 2F19H 4QRPD 2CJUL 4JY5H 3SGKC 1JPGB 1I9RH 3QXAB 2VLJE 3UYOD 2UY7A 5E99L 4JFFB 1FG2A 2B1AL 2DTSA 2V2TA 4P48A 4NM4H 2R0KH 4CUCA 4GQPH 4XBPA 1FVCA 1FNGA 4YFLF 3SDDC 3SE9H 4OTXL 4G8IA 1NLBH 2PYEA 4H0IA 1QRNE 2B1HH 4HIEB 1MCOH 3SCMA 1YUHB 3FKUS 3LS4L 3BIKA 4R97B 4NQTA 3TIDA 4HXAL 2P46B 3MNVB 3QA3B 5DFTA 4JY6A 1OB1B 1DQML 3DBXB 2IQAA 3K8LA 4N1CA 1K2DA 5DDHA 1A7RH 4S1QH 4AM0B 3LEVH 2VDQL 4LEXH 4S2SA 2IGFH 4ISVB 2ZUXA 1MIML 1S7QB 5DMKB 1JK8B 5E2TH 1QSEE 3D0VB 5E5UB 1PZ5B 5JA8B 5GS3A 5F7FA 4KAQH 1JZ4A 4M61A 3IFNL 5D70H 4N0FA 3N1FC 2ADIA 4M1CD 2WQ8A 1S9XB 2BCKA 3RVXC 3SEPA 3GJEB 4HIJB 4M7LH 4ODWA 1JZ7A 2WMPA 3SJVB 3JWOH 2X89A 4OZFH 4PRNA 1HYSC 4R7NA 2OLDA 4UDTB 3C2AH 4U49A 3K4AA 5KSUA 4K9EC 2OR7A 4DZ8A 1D6EA 4B7LA 3VFPB 4RA3A 4HIHA 2Z35A 2CH8A 5IQ7L 1U3HD 2AJVL 3O2DA 2G5BA 4PJ5E 1OP9A 6FABH 3GSQA 3HZKB 3V0VB 2APFA 4M5YL 4LPVA 5T3XL 3HTLX 1CGWA 3BP5B 4O58H 4MJ6A 4N9OB 4I77L 4P9MH 3UTOA 1GC1L 1RUAH 1AXIB 5DJZB 4PJAA 4JFFD 5TPWL 3TJHC 2ZOLA 4AJ0A 4YDVB 3NACL 4FABL 3ZE2E 3U7WH 3NA9H 5IT2L 2WUBL 4JDTL 1AHWA 3AB0B 2CD0A 3A6CH 4NWUH 3RGVC 2J88H 1VFUA 4OZ4B 4YHOH 4JFEA 2VDLL 2XI9A 1IC7H 4XC1H 1R3KB 4Z95L 4MA8H 3IXTA 3MRKA 3RUGF 4Z7OF 4X7CC 2F74A 3PJSA 2Z92B 3O6FB 3HR5B 3QWRA 1JE6A 3RUGB 4QTHB 4G6MH 5BW7C 2M26A 3IJSA 4O2CA 5TDNB 5J1AA 1WBXB 3O4LE 1YNKH 5IV2B 1T22A 3IDGB 3A67H 1ZLVH 3C5SA 5E2WH 2C1OB 5K59F 3KWWA 1TQCC 3GMMA 3SBWA 1TJIL 1U93A 2NQCA 3MO1B 3U4EA 1EO8H 1JGUL 4OI8A 4UB0L 2P7TA 4K71C 4H25B 1MFEH 2HTKD 4EUPA 3SJVD 3GNML 2V2XA 4L8BA 5IW1B 3BVNB 4OIBA 1QOKA 4OM1H 5GGTL 3RWJB 4M8VA 3GSNH 3LKRB 1A6PA 2PETA 4RIRA 2XPGB 4UT9H 3BKYL 5MENB 2G60L 5L6YL 2K3TA 1BFVL 4DQOH 8CGTA 3DGCR 4HH9A 4XPFH 1X5ZA 3FQUA 5JHLL 2OR9H 4OT1L 3EJYC 2EEAA 2Z93B 1F02I 1L0XA 4KMQA 2WWKT 2HFTA 4I3SL 4E0RA 5GJSL 3UJIH 3S3PA 4OLYL 1YMHB 1RZIA 5E9DB 3WN5B 1GRWA 3ZDXE 1WFUA 4QXTB 3H8NA 4G43A 2VABB 2O61A 3MFGB 3SKMB 5CWSB 4WEBH 4XNYL 2FLRT 4FTVE 4HWBH 2I25N 3O9WC 4RFEB 4DAGH 1SYSA 4DCQA 3S96B 3NH7H 4EOWH 1T0PB 4KVNL 4JN1L 5TQ2L 4CVZA 3B2VH 3BH9B 4QT5B 3C87A 3DXAE 5E8PA 1WZMA 1A7PH 3OX8B 1GH7A 1YY8A 4PP2A 3O6FD 5C0IB 4UNUA 1U8LA 2VLJB 4PLJC 1ITBB 4BZ2H 2IAND 1XH3B 3E6FB 4LNRA 4UNVA 1E0OB 2D31A 4AG4H 1NKOA 5GGSB 3RVVD 4PG2C 4U4BA 5AWNL 1Q1JL 4HUUA 4OD1L 1ZA6A 1QRNB 1XR8B 2VOTA 1EJOL 5E24E 5ETUB 5E8EB 4CVUA 1IL1B 4R6UA 2WSKA 3DIFA 3JZ7A 4Z7WE 1FP5A 3LCYA 2FJFA 3H7LA 3N85H 5FCUH 3QO1A 5I30L 4P2OB 2EIEA 3D39A 4OF7A 3KJ6H 1B4JH 1EVUA 5J7CC 5FO8A 4X7FC 4YDLC 4O51B 2OXGA 5FDWA 2R69H 4HSQA 1F8TH 5MEND 1AGEA 3L7EA 2JF1A 4AEIL 5KSVB 1N8ZA 1QSEB 3FB6B 5CJOH 5FA3B 5BXFA 4Y16C 2WP3O 1G0XA 4HMDA 4ZXBA 4M6OH 4ZFGH 2C3VA 4ZO8A 3WJLC 5E9DD 4Y5XB 5I19L 1R6VA 3FO0L 3FO9A 3OZ9H 5EZOL 4GS7C 4K07A 1KCLA 3MXVL 1UM5H 1RJLA 3QNZA 1J87A 1L7TL 1J8HE 3DVNA 5DGQA 2YD3A 1J1OH 3WYRA 3DURA 3AM8A 4XH2A 5TE7H 1QQDA 1DUZA 2PKDA 3WIIL 5DRWB 4NQEB 3RZCB 3V4VH 4KJWD 1MFAH 4PJ5B 5DVLA 2PCPB 1BFOB 4FQLH 3GRWL 1G0YR 1JNJA 4YFLI 2D0HA 4LP4A 1LQSR 3QDME 4FNLL 1A3LL 1YECH 1EV2E 1NFDA 3R8BB 3BT2H 2H8PA 3V0WL 2VLJD 5ISZE 3BI9X 5CD3B 4X6BB 1L0YA 3ZE2F 1F3DJ 2VKWA 5FUOL 3PWVA 5EA0H 2EIDA 3VRJB 5HVGB 5KSBA 2A0LC 4PY7A 1LO0L 5IFHL 2XY1A 5BCAA 3ZO0A 5KN5B 2HJKB 1YEKL 4G6JL 1QRND 4WHTB 1A6AA 4S0SD 4NO3B 4LAQL 1X9QA 1VFOA 2B39A 3CUPA 3PNWB 4H20L 3U9UB 5GSVB 2FX9L 1D5XA 2AV7B 3BP6B 1A6ZA 1PG7X 3MBEA 4Y4HC 4P2OD 1NMBH 1J5OH 3TNMA 1U8HB 4NZTH 5E94A 1CIDA 1F4YH 3UJJH 5FYLE 5F7EL 5LAXA 1RD6A 3JTSA 3IF1B 3T2NH 2R1XB 4G6AD 4HWUA 3O4LB 3QIUB 4QYOB 3D3VE 3K80A 2W07A 5GHWH 1QSED 3ILQC 1HHIA 4LEOA 3KYMA 5IHZA 5JZ7C 2ZCKL 3PWNB 4Y1AA 1YEHL 1WAAA 2VL4A 2X4PA 4OV6F 1YEFL 2EECA 3NFPB 2CDEB 1QSFE 3MBXL 4P5MB 3UYPA 1Q9OB 2H45A 1ZGLM 4TRPL 4YR6B 4LLVB 3FT4B 5DD5H 4N0UE 4GO6B 5F3BA 5A16B 2O5ZL 5HGDA 2D03L 3MREA 4MCZB 4GSDH 2DTMH 3OJMB 5J3HC 4ORGA 3S36L 3BDYL 2AEIT 1AGCA 4PUBL 4RGOH 1ES0B 2R0ZL 4MWFA 3RZCD 3MLWL 4PJ5D 4MA7H 3UYRL 1HH9B 3KLAA 4I8DA 3EYSL 4S0TD 1CE1H 1RIUL 4QHMB 3OKKB 1OAKH 2ATPB 3N9GL 2DQJH 4OKDA 3ULUF 4HKJA 4GMSL 4KK5C 4FTVB 1EBAA 1E6JL 1X4YA 1T0MA 1CDYA 4YXHH 1K4CA 5GS0D 2DBLH 4Y2DB 2JB5H 3JTTA 5MP6L 1BWWA 2A77L 4F3FB 4P23A 3P77A 1G7QB 2VAAB 4ZFZB 1T2XA 3DXAB 4NZJA 2OP4H 3BDBA 4KROD 1FV1B 3DO7B 4HUMB 5SWZE 3TYFA 5C6PB 1LK3H 5TE6L 4ZTPL 4GW1A 2AW2A 4E42A 1AP2B 1JI2A 2V7HB 3QZWB 2VAJA 4IBLT 4ZO6A 4YIQA 4RGMB 3IB4A 4LCWE 3RKDD 2NXYB 3O4LD 4ZFOB 3IDXH 1J18A 3HFML 32C2B 5E70A 2NY5H 2ARWA 2VIRB 2W91A 4OFIA 5IROC 3ZDZE 1EEZB 4DVBA 4K3DL 4FQIL 5I2IA 3UPAA 1RUPL 4KK9D 4UIKH 1KB5H 4Z7WB 3MJGX 3LPWA 2NY4C 3GKZA 5A3IC 1UZ6E 4XP6L 1EPFA 2RBLA 1ZV5A 1YEIH 1M6OB 5GGUB 1IVLA 3CZJA 1I8IB 2RGSA 3FAWA 3ZE0F 1HIMH 3GIVB 4HGWA 4MNHB 2ICWA 5LCVH 1TVHB 5BJTA 4L5FL 1A6WH 4UOJA 1EFXA 4POYA 3S88H 5BZWB 4QRSA 1ZTXH 4G3YL 4GOSA 3RU8H 4OM0L 3MUHL 4YHNB 5EWIL 2X05A 1ZLUK 1V7NH 4I18B 2HT2D 3DYPA 4XP5L 4L9LA 3TBSB 4U3XA 1IGMH 4C4KT 1ETZB 3FT3B 3C8HA 3ES6A 4NKIH 2MPAH 5CGTA 3U9PL 4F57H 4HDIA 5FUCE 1CQYA 3Q1SL 2YEZA 4C58B 3HMWH 1LE5A 2A6DB 2ZUQB 1JGVH 4JJ5B 1G7LB 1VCAA 3T0EE 1J7VR 4OZGA 2XWJA 1G7PA 2H3NA 1QO3B 2HWZL 3HB3C 3MV01 1PSKL 1PKQB 4FTVD 4BSWA 1DTUA 1AXTH 1J8HB 1T1XB 4J6RH 2EDWA 4RRPG 3VU2A 1E4KA 1S3KH 2N4IA 1IGYA 4LKCB 1OF2A 2DMBA 4Y2DD 3VFSA 5IG7A 4O2EA 1X5GA 2XKNB 3GKWH 1Z2KA 3PWJB 2XA8L 2KUTA 1KENL 1JVKA 4GKNB 4Y4KC 3REWB 1MCRA 1Y6MR 3DXAD 2W1NA 3UXFA 3QDMB 1JWMB 3K1KC 1R3HB 5IB4B 1DVFB 4M6NH 3EDKA 4CVXB 1NEZA 1UXSA 2X4NB 2WV3A 3QXTA 3TO2B 2JTDA 4XAKE 5B39B 5ESVA 2DYPA 5ISZB 4LLWA 4PP1D 1R3LA 1HHHB 4G9FA 2E9JA 3EOAB 1YY9D 2CKBA 1TTGA 1FSKC 2NXYD 4GAFB 4K9EH 1QLFA 3MGTA 1NGWB 4FHBD 2X44D 4M1DH 1RZ8A 3RVUD 1KFAH 4PYHA 4NQSB 5FGBC 4GKSA 1SJEB 3MCKA 1D5IL 4DJMA 3DPBA 4C56E 2IG2H 5E6YA 1OAXL 4HK0A 5DJ0B 1NCBL 3QNYB 4GG6E 3KYNB 3D2UB 2AXGA 1EEQA 4M4RA 3IFLL 5AG9A 1QFWM 1AGBA 5FCSH 3CFDA 1QR1B 1D6VL 4D0BB 3FB7B 1T66C 3D3VB 2J6EA 4WI6A 5C2UB 1AD9A 5EBGA 3WMSA 4PJCE 1JNHB 4UINH 3CVHH 1RMFL 5E8DH 3U4BL 4U05A 1AXSA 2R29H 4LRNL 4MHHG 3U82B 5IFJA 1DR9A 3O4OC 4PB0H 2R4RL 5EORH 1QSFB 1X7QA 5D1QB 2FSEB 4BUGA 4HV8A 4OLXH 4WFHE 4XHJC 3U6RB 3HE7B 5GS0L 1OGAE 4P5TC 2HKFH 4NRZB 3GZKA 4JPKL 4F9PC 5HDLA 3VD7A 3ULSB 3IKCA 3EYUL 1N5YL 4RDQG 1A7QL 1J8HD 5CP7B 5BQ7A 3QUZD 3HS0A 3OGCA 1H0DB 2WIIB 4JDVB 4JGJA 5JLZB 4XXDA 4G8EB 3PWUA 4NQUA 3VFNA 1PJ9A 3TN0A 1P4BL 2BZDA 4NO2B 5GRZA 4KMTL 2ADJA 1BD2A 4H0HB 4MAYB 1L7IL 3QDMD 2IBZX 5GRXG 2GJJA 1DVFD 1RUMH 4DVRH 4OGAD 1N0XL 5ISZD 3VFWA 3RWFA 3RTQB 3TBYB 1GVIA 3BN9D 1WK0A 4ZUVA 5I1AB 2ZJSH 2BFVH 2VISB 1A1NB 2FB4L 4I0PC 2AJZB 2XG5A 3LH2H 2I26N 5C6TH 3U46A 1G6RH 5HGBA 2YA1A 3EOBA 5D4QA 3L5IA 1A6TA 4JGUA 3IFPA 3TWCH 4YPJA 4GAYB 5C08E 3IDUA 4C57C 3GHBH 4ACPA 2JCCF 4HLZH 5SWZB 4JZNB 1GHFL 5KSAB 2JCCB 1T3FB 4GBXC 3D2UD 2EH8H 1A4JA 2B0SH 5FYLD 4LCWB 1U58B 1JL8A 2DQCH 3D3VD 4EDXB 4EZMA 2E6QA 3K74B 1IEBB 4I9WE 5FYJH 4NT6B 3LHPH 5SV3A 3VXME 2WANA 1UZ6F 1KBGL 2PXYA 2JLLA 3NGBC 2WUCL 1H8NA 3ULUL 1MSPA 1QSFD 2G75A 1EUUA 5KS9F 3I84A 2UYLA 4LLUA 5D1QD 1QLRB 3K0WA 3RIAK 2R23B 4LSDA 3K4DA 3DMMB 4QHUB 3HE7D 1T4KB 1OWRM 3HI6H 1ZXQA 1TETL 1H15B 2IADB 2AQ3A 4LFHG 5I1DB 3QHTC 1KTDA 1VKXB 3ORJA 2AV1B 1EXUB 4K3JL 5I1IL 4ZPVA 5DYOB 1WITA 5DD1L 2EDLA 1TJHL 5HDQL 3VWKA 4IIQC 3GMLA 2XFXA 3EO0B 5IVXA 1OT1A 4L3EA 1T1YB 2A6KB 4RISH 3VFMA 3JV6A 5FHBH 3RL1A 1F45A 3T0EB 1XF2B 1XIWC 1VSCA 4D3CL 4M1GL 3RTQD 4XI5D 5D8JL 5L2JA 1AKJA 2EYSA 5DQ9B 2R56L 4LF3B 1WFNA 2APVA 4X7SH 4GAGH 1RULL 1FRGH 1BX2A 5B8CB 1HILA 2DQEH 1DQDH 1F58H 3C5ZA 3ZKMD 1RURH 4HC1H 3K7UA 4X6EB 5I8OL 1U8QA 3O0RH 3U0PA 3O11B 4CVWA 4AIOA 4IRZL 4K2UL 3Q6FB 1BQHG 5SWZD 2AK1H 4OZFB 4TVPH 3U7YL 2OI9C 3ARTA 5KSAD 2VNCA 3HI1B 5D7LE 1KPVA 3DUHA 3VE0A 5D7SL 1OTUC 1I7UB 4RMRA 4LCWD 1BEYH 5L9DH 2YD5A 1VERA 3KVQA 3LKPA 4LNVA 3VG9C 1X4ZA 3FN0H 1NCAL 3WO4B 5CAYB 1KEGL 2K7PA 5LGJB 3RWGA 1I7RB 3MLUL 2CIIA 3VWJA 5JORA 3SDXE 5LQBH 4X4ME 3QCVH 1M7DA 5D96B 4C56B 2Y6SC 4HIXL 4GG6F 4LQ1A 4NRYA 3SQOH 5JMOC 5D1ZA 1UT9A 2YUWA 3LQAC 5CLWA 3KXFA 4GG6B 3DMMD 4NJAH 4XXCC 2HH0H 3MRCB 3QCTL 5JOEA 1PLGL 4U6VL 2HG5B 2P5EA 3MRGB 3RRQA 4PJCF 4TOYL 3GB7A 5KJRL 2AXFA 1ZLWH 4PJCB 4WV1B 3T1WA 1HSAA 2VQ1A 1CICC 4PJGE 3PIQB 2C3WA 3VXNA 1C5CH 1RJZA 4G5ZL 3WLWC 4MNGE 3MXWH 3WFZA 3MRQA 4K7FB 2ZSVA 1PX3A 1JPFA 4PJ8A 3T0ED 2WK2A 4MJIB 2O5YL 4XWOC 4D9LL 4PBXA 4LSUH 5FM8A 3FOLB 3VG0H 5BVPH 1ZVYA 1BM3H 4AENA 2XV6B 3ARGB 3BZ4B 5ADPH 2KQNA 2CDGA 2BVQB 3LAFA 1GOFA 4U2YA 5DD6A 3ECBB 3V5KA 2GFBA 2CSPA 4BQ8A 3QUMA 2Y06H 4G7VH 1NCWH 1TVBB 3VDAA 2Y5EA 5GJTH 5FYLL 1S8DA 5CSBA 3BZFB 3GSNB 5IHBA 3NFSH 2XN9E 3BGMB 3VFVB 4XAKD 4IS6A 5CJXC 3WLBA 3K1DA 3CXHK 3D5OF 2CR6A 3I02A 1IGIH 4ONGH 1ADQA 3SPVA 3CFCH 5DQDH 1WZLA 4RZCB 3ZLQC 4EI5A 4JZOB 4IHOA 4X7DC 4MJ5A 1RFDL 4WU5B 4ETQB 1CDUA 1VACB 4YPGA 5HHQB 1GGIH 4XNUL 1JCKA 5C08B 1HWGB 4C56D 3QT2A 4XCFL 2IAMC 1GYAA 4XVUC 2VSDA 4WFFE 4CU7A 2VLLA 4QRTB 3BHBB 3P40A 1NMAL 3OJDA 1X5YA 5ADOH 3UPRB 4Z7VA 4HPOH 3VJ6A 3MLZL 3KPSE 3OB8A 1YMMA 3BO8B 1I8LC 1UM4L 2YPKA 5DEGA 3CMOH 3RAJL 3G5ZB 4G42A 4B50A 4M43H 3Q5OA 1CD9B 4TTDD 4UT6H 2DOCA 4NN7B 5IW6B 1J0HA 1MPAL 2A2QT 4W6YB 4J4PA 5DO2C 4FZ8H 4NIKB 1KEML 5B38A 4ZNEE 3U7AA 1NUFA 3BD5A 4FQQA 1U8IB 1HQ4A 1CN4A 5E1AB 4WFHD 4PRIE 4BZ1H 5E6IC 5C0CA 4P59H 4HS8H 1R5IB 1IQDA 3ARGD 2DDQH 4DKAA 4KKCC 3VH8B 2GEEA 3OKOB 5IBLD 4D0DA 4I0CC 2RCSL 4IRSC 2WW8A 1J05A 3PHOA 1FJ1B 1UYWL 2D4DA 1E4XH 3PWPE 2HLAA 3QCUH 4JFHE 3DLQR 1T04B 1ZWIB 3P0YH 4HBQA 5BV7C 3WFEL 4UV7L 2B4CH 3QQ4A 3VCLB 1NGYB 1Y18B 2HVJA 2VWEC 2AJSL 5J89A 4JO2H 4M5ZL 1QZ1A 3TV3L 5CEYB 2VQTA 4MGXA 4YHKH 3DECA 4FFVD 4KHTL 1CTOA 4KZDL 3SKOB 4KV5E 1JPST 2F19L 1BAFH 4OD2B 4JY5L 1I9RL 2Y7QA 3EAKA 1H5BA 3NFNB 5I1KH 3JUZA 5ITFA 4QLRA 5C08D 4NM4L 3H42H 1NBZB 4WUUA 1YPZA 4RDQF 4XPGH 3SE9L 1YYMH 3GK8H 2IMMA