4LF3B

Inhibitory mechanism of an allosteric antibody targeting the glucagon receptor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
231
structure length
231
Chain Sequence
b'QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVMWYDGSNKDYVDSVKGRFTISRDNSKNTLYLQMNRLRAEDTAVYYCAREKDHYDILTGYNYYYGLDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
publication title Inhibitory mechanism of an allosteric antibody targeting the glucagon receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 231
sequence length 231
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lf3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lf3B01
2AJZB 3BJ91 1RUPH 1ZLUK 2NW3A 1SM3H 3VXOA 3G6DH 5DA0B 3RAJL 3SGEH 3NFPA 3DMMA 3N1FC 4PJCA 15C8L 2EH8L 1NSNH 5DD6A 4FQQA 5ILTL 4PJEE 3D69B 4JDTH 4Z7QF 4HFWB 5DI8B 4HZAA 4OD2B 4Q0XH 3MCLL 1IEBB 2NTFB 4LGPB 4QWWD 4HH9B 3GI8L 2YPKA 4JFOB 4KGLA 2KL6A 3SQOL 4G8IB 2AJXL 1VA9A 2DTSA 5ICYB 2HT2D 4PLJD 1JWSA 3STZA 4KY1H 3O2WH 5I66B 4WEUD 3GSNL 5SWZA 3HG1B 1N3NB 3T4AB 4IDJH 1G9EA 1NAKL 4K23H 1E4XL 4MXVE 4X80H 3KXFB 4WHYG 5I1GH 3ALXA 3C60A 4I2XA 4NHCH 5DZOA 5C9KA 4WI4A 4AEIH 1VENA 2P7TB 2DS4A 3BDYH 1GXEA 4M1DL 1AXTH 3OSKA 1S7SB 1SVZA 1YDPA 3NH7L 4CMHB 1MIML 1W8NA 2DOCA 4KDWA 4XVSH 2AK4D 4X8JA 4G5ZL 5IHUH 3K4ZA 4X6DA 1U8PA 3SO3C 4KROB 4QF1A 1K9TA 4BH7A 3I9GL 4PRNA 1A6VH 2QSTA 5L9DL 5CIPH 2VDRH 1S9WB 4UTAH 1BIHA 1DUZB 2WW8A 1BVKB 3M8OL 4I0PA 4LOUD 4IRSD 3UPRB 1OF2B 2K9UA 1IQDB 1MLBA 4QXTB 5GRJL 3EOAA 1QFPA 3QQNA 3ECBA 2H8PB 5DRNB 3WLWD 4PJXE 3L3IB 3RWFA 4HIHB 1TQBC 4NM8H 2PTTB 3AAZB 4HWZB 2R1YB 4XX1G 2PYEA 1MY7A 3BEWB 2XT1B 1MFAH 1IAII 2AV1A 4C59B 2VE6A 3TCLB 4R4BB 3UJTH 4CJ1A 5AD0B 3W5MA 1FFOA 3QUML 2LFGA 1J5OL 2X7LB 5CZKA 4B7IA 1CFVL 4FZEH 4TN9A 1C08B 3TIDB 2JIXD 1C1EL 4GLRH 4HUMB 2P8LB 3DURA 3WJJC 5B8CA 1L7TL 3DO3A 4RGMB 1Q9OA 1KPRA 3Q6GH 1U58B 4LSVL 3CSYB 2VL4A 1A1OA 12E8L 4EUPB 5GGRB 5KANG 2EKSB 5E7FA 1JYVA 2R0KH 3HC4L 1FNGA 4JQXC 3JWDH 5K93A 3ZTJH 2NX5B 3BKCL 3B5TA 5D7LD 4PJ8C 5KSUA 1SQ2N 3VDCA 4NZRL 4NRYB 4OB5H 4K94L 4V1DD 3WDJA 1MJ7H 5EU5B 2BRRH 4RMWA 3DOSA 5D1ZB 1DQLH 4JO3H 3ZYIA 5KS9E 4PGDB 3F7QA 4KQ3L 5HXMA 3HPLB 5D93B 1A5FH 5C08A 3HZYB 1PY4A 3FB6B 3ZKND 1JIBA 3BP7A 1LO0H 1OTSC 5CIPA 3PWUA 3T0ED 1UM6H 3KPQB 1A14H 3GMRB 4MJIE 2BNQE 3MODH 2IC2A 4MNGE 5DO2C 4X4MA 1KB5L 4P9MH 2EYSA 3TIEA 3TT3L 4BK5A 4FQJL 3QUZD 4QRPA 3VFWB 4E41D 2IQ9H 2XKNB 2EXYD 5BV7H 2W9LA 3KPOA 2EC9T 3FB5A 3HE7C 1JZ2A 3V4PH 4Y5YC 1JN6B 2ADFL 2BSRA 1R24A 5CKGA 3PJSB 3FO2B 4RGND 1D5IL 5DVNA 2NY4C 3QH3B 4DGIL 3RAJH 3S35H 3OAUH 4FQLL 4LLMB 5DQ9B 5IB1B 1L9MA 3CD4A 3H0TB 4M7KL 2BNUA 1XF3A 3MCLH 5E7BA 5FO9B 1LD9A 3GI8H 3R1GL 4WWKC 1CL7L 1YEGL 4WFFE 4HWUA 1D6EA 4YHIB 5KVMC 4W6YB 4ODTH 5ALCL 4Q74A 4RAUA 4DVBA 2NY6D 3GSNH 1XF5A 2ZUXA 5I1LA 1P4IL 4B53A 4G42B 2EXWD 4K7PH 4BUHA 1ND0B 5C2UB 4NKMB 1NAKH 4KU1A 3WSQL 5I76B 1WIOA 1RUAL 4BKLB 4KK9C 1N5AB 5DGQA 5TE6H 1CU4H 4XNXL 3U0WL 4X7SL 4JN2B 3S36X 2IWGA 3MJGX 5KAQG 4M1DH 1IEAB 4KJWC 1FG2A 4ZFOA 4S1SL 4GRMA 2JJTA 4G7YL 3NH7H 3EW3B 1LP9E 1R0AL 1FIGH 2Z8RA 4XMPL 3V5KB 1P5UA 5HYJB 2ED9A 4HUKB 1L0QA 5DJ2B 1FC2D 3WIHL 3UROR 4FTVD 2H6PB 5A40E 4NZUL 3HZKB 3QEHB 5BMFH 3MNVB 4JFQB 3IETB 5CEZE 3EJZC 4Y4HA 4YHLL 2BNRD 3P4MA 4X5XB 2X70B 5T3XL 5MEPB 4M5YH 5CWSA 1SJXA 5JW4R 4XPTH 4J4PC 1RZGA 2ENYA 3DLQR 1KJ2B 5FYLL 3TYFB 2HLFD 4MWFA 2C3WA 2JB5L 1CG9B 4HKXA 5EU6B 2HJLA 5I8CA 2MNUA 3DUUA 3MV01 5T1KA 1BVLB 4A6YL 4ODVL 4L4VE 5IB4B 1T20A 1T89A 3DRQA 4OGAD 4IRSA 2DM7A 1JTPA 1PX3A 1UZ8A 4U0QB 2G2RB 1IGFL 4X99A 3CXHK 3FFCD 3LRSA 3ULVC 5E99L 3RJDA 3TBYB 1KJMA 2BCKB 5KVDH 4Z0XB 2IBZX 5E24E 1RSFA 4WUUB 1MH5B 3REVB 1TVHA 2YSSB 5HBBA 3S34L 4DTGH 3IJSA 1JK8B 2JE8A 1YNTB 4X8XA 4P2QE 4YAQA 3M1BA 1CXEA 2CKNA 3R0MA 1WCBA 3HPJA 3ZO0A 1T7YA 3HC4H 3LIZL 1BZQK 4NO0D 3BKCH 5ICZB 1Z9OA 3KWWB 3D1MC 2J12B 4TUOA 1B0GA 2E9JA 1P7KB 1WCQA 3ILPB 2JIXA 4XVTL 2AS5M 4IJ3C 2ILLA 2ZG2A 5CAYB 3N85H 2HJKA 3MBED 2FR4B 1AFVL 5CJXA 4WW1B 1G6RL 1KCVL 1LE9A 3MUHL 3ARDD 4H25B 4KQ3H 2NYYD 3CFJA 2AABH 4F7MA 5FYLD 5JW4N 1U8QA 3TH3T 2L7UA 3UZEA 2OQJA 3SDDC 4IRJA 2Z9TA 1QR1B 3WNLA 1XFPA 5F71A 1UKTA 3WE6A 2F5BH 2ADJA 2CKBB 1AGBB 3TO2B 3KYOA 4RWHA 5E70A 5FYJL 3RDTC 1KB5H 4R2GB 3SDCC 4A2LA 1U8JA 2GTWA 3BZEB 3QXAA 4WHYH 4NN5C 3MOAL 2BY0A 4NBXB 1GAFH 1Q94B 2V5YA 2F58L 4KMLB 3BO8B 1AGDA 4ODSL 4LRIC 1SEBA 2APTA 4L4JA 3OPZH 3RVVD 1XCQB 2UV3A 2A6JB 4RX4A 4DGIH 5IFHL 1OAUL 1RMFL 3HNVH 3O41B 5E8PA 4M7KH 3TN0B 1VEPA 2X4OA 3LOWA 2P5WE 3VDAA 2QQLH 4Y16D 4IHOA 1MVUA 3DXAD 2RAMA 5CJOH 3K2MC 2FEDC 2YMXH 2CLVB 4TQEL 5IFJA 4GXVL 5C0CE 4F37K 3B5HA 4F33B 4QRTB 3WKNA 2QQNH 2YWZA 3HC3H 1MCJA 3RTQC 4O4YL 1J12A 2DM3A 2X5PA 4UOJA 1NFKA 3WSQH 2EDKA 5DJ0A 4NNYA 4FNLH 1MFDH 3EYUL 1WAAA 3FQRB 3AU1A 4XNXH 5CHNA 4X7SH 3U0WH 4G8GE 3U4AA 1CK0L 1M7IA 2X4SB 5JOFB 4QCIA 3NOIA 4HHAA 4S1SH 3HB3C 3LKQB 3BPLB 1KXVC 4R4FH 1RULL 3AREA 4G7YH 4PRPB 2X4UA 3V52L 3DIFB 2EEAA 2DI8A 1KCLA 32C2B 4XMPH 3SKUD 2VLLA 1MQ8A 1M05B 3WIHH 5F1OB 5HGAB 1ACZA 4OF3A 3FHQA 4OCLC 3E6HB 3QQ9D 2FGWL 3BP6B 3DVGA 3OAYK 4X9FA 3DV4B 3WBDA 2CXKA 3O6KL 1RAMA 3MROA 1Y18A 4OF0A 3I6LD 4D8PB 2J8OA 3PWVB 2NY7L 1AY1L 1MSPA 2J8UA 1ERNA 4LDLB 4ERSH 4NHUA 5FYLH 3T77B 3FO0L 4LSQL 3RWDB 3S37L 3ZKXC 4X6FB 2GCYA 4X4YB 1EEQA 1Q38A 3MRKA 1XIWC 4ODVH 2VXVL 1EHAA 4MJ6A 3L1OH 2DYPD 1M71B 5C0DB 2J5LB 2C9AA 1IGFH 1U8OB 1TETL 5ANME 4G8FA 2IPUK 3WFCH 2UVFA 1HHIB 1WJ3A 1CF8L 3VG9C 3O4LB 2VDQH 4OBSA 2VQTA 1BFOB 5TE4H 4K2UH 1HYSC 4WFHD 5DHVB 4UT9L 4CW1B 2XN9D 1U8HB 5C1MB 4XB7A 1WC7B 4UNVA 4JFEB 3AVEA 2AJ3B 3ILQD 1J0YA 1D9KD 3ZDYE 4HIJB 5DVMA 4I0KA 5HJ3B 5EBWA 3FFCA 3VGDA 1F3DJ 2Q7NA 4LCWE 5EWIL 4LLQB 3MFFB 4QHUB 4O9HL 1KXTB 4NPYB 2E5EA 2ZOLB 3LIZH 4RGOH 4QOKE 4YH6A 1FV1B 4QRRA 3VGFA 5GGSB 4PJHF 2BC4B 4CN4A 2FB4L 4XVTH 2CMRH 3ARFD 3C08H 1TMCB 2HVJB 5E2VL 1I9IH 5EDXA 1JPGA 2AEQL 3ARQA 5CBEB 1BJ1H 4YBQC 5IG7B 3RUGF 4S0TD 1X5KA 5KSAA 1GZQA 1C16A 1JZ5A 4MA1B 4JE4B 3QDMB 4DQOL 3RA7L 1JYWA 4YHZL 3QUKA 1EAPA 1E4KC 4HPYL 4YWGL 5FGBA 1WBXA 1OP5H 4MA7L 2SEBB 4LHJB 3ULUE 4EVNB 2HP4A 4ODWB 2FHCA 5KN5A 1DEEB 1P9MC 3FAWA 2V2XA 5T1MB 1ZA6A 4LF3A 3QIUC 5FB8B 1R3KA 1NGPH 1TZHA 4PJIA 3ARWA 3JVGA 1X5LA 2DAVA 1DLFH 1DDHB 3O6MH 4QRQB 5CCKL 4JG1H 3EDEA 4OZHA 3GBMH 2P8MB 1KEGL 1CDCA 5EBGA 2FEEI 3TPKA 3LHPL 3LEXA 3UTTD 2V9TA 1E28B 3WDHA 5GSRA 1BP3B 5FA4A 5DYOB 4DJMA 4R90L 5HYSB 4HG4J 3EGSA 2HMID 4FQ2L 4JM2B 3HG1E 3TM6A 5LGJA 4L3AA 4BFBD 4G7VH 2VABB 5HHXL 1KOAA 2FIRT 4NN7C 1Q9WA 4PJHB 1TPXC 2VDNH 4CBPA 1XAUA 1YEDA 5DJXB 1D5MA 3DYPA 5I6XB 2B4CL 3VGAB 4OCXH 3HI1A 1OD9A 2EKJA 2G60L 4FFZH 4S1QH 1QO3A 4XZUB 1S3KH 3QXTA 1GC1H 3UCRA 1OTUC 3RUGB 2R2HB 3FT2A 4UBDC 5IB5A 3MXWL 3C6LA 3DXAA 3CLFH 1JGLH 4CVZA 2NY2B 3DGGA 2DMCA 4MXQC 3EYUH 3RHWF 3CH8A 3STLA 2O5YH 1VACA 3PWNB 1IARB 1HH9A 3U79A 1ACYL 1FN4A 5F9JB 3O2VL 2WIMA 2XZCL 3LN4B 3G6JF 1RULH 1FFRA 4M48L 5MEQB 1CD0A 3U36B 3BPOB 2Z4QA 4M6OL 3CK0H 4IS6B 4Z7UA 2UVEA 1NBVL 1U36A 4CU7A 4MCZA 3CFBB 4W81A 3MO1A 4Z7QE 4P2OC 4U1JA 2EDRA 4UU9B 5SX5K 2B5IC 3SKOA 3OB0H 2F53B 5F6HI 1JWUA 4P23B 2Z31A 3D85D 4MVBC 5M94B 1HINH 4Y5XC 5HSFA 1P6FA 1SMAA 5LQBH 3BZFA 2NY7H 4KVCL 3TFKD 3MR9A 2AV7B 3FO0H 3N1GC 5IEHB 1CXKA 2D9QB 4WTZA 5DVLA 2OYPA 2PR4H 3LCYA 4WNQB 3MREB 1BJMA 4U1NA 3P73B 3FN3A 5DURB 2AJVL 4LPCA 1MI5B 4OLVL 4PG2A 1NBQA 3GMNA 3OGCA 2WM0A 4XMLH 3TBWB 2A1WH 3S8WA 1D3CA 1CDBA 4JFXA 3FOLA 3LKPA 2FZ3A 4UT9H 3GSQB 4BUGA 5HYFA 1CFTA 1MRDL 4C58B 1J1OL 3TV3L 3O11A 2NX5E 4KKBC 3TNNA 4WTWA 4XH2B 5JQHC 1BFSA 5BZWA 2Q76A 1IZKA 5C0NC 5IW3A 1G7HA 4X83A 1NGXA 2E6PA 1LO5A 2DQDL 1NMBH 4HJJL 1LVEA 2D31B 2EDDA 3V95A 3MLUL 5J89A 4KHTH 3VFMA 1WITA 5D71L 4YPGB 1I7RA 4U49A 3JV4A 4Q2ZB 2Q3ZA 2YPLA 3ARBB 1BZ7A 5IIEA 1O5DT 1ZA3A 4KXZI 3LPFA 2UYLA 3KS0J 2W59A 4XPGL 4JVUA 2P1YA 2NLJB 2NY5L 5LGKA 3UC0H 5IB3A 2P24A 5F9AC 3TVMC 3MJ6A 3WO4C 5GGQL 2IH1B 3PABB 1F2QA 3ARFA 1I3RA 5A3IC 3C5ZB 5E6ZA 2OL3A 2NW2B 2H1PL 4YWGH 4MA7H 1FNEA 3O8XC 1ZT7B 4IRZL 3TO4C 1T5WA 5ID1B 3JBG7 5IEKA 3WL9B 43C9A 2WBJD 2GKIA 3IXAB 3FRUA 3IKKA 1HCVA 3MRBB 3FONA 4LAJH 1S5HA 2EO1A 3QNXB 3TZVA 1IM3A 1ZLSH 3VRLF 1MJUL 2ZJSH 3V7MA 1A1NA 4NQCD 1F11B 2XACC 5GSVB 5HHPA 1PAMA 1XF2A 3P30H 4MDJA 4N0UB 3C87A 2XZQL 4M03A 4MA3A 1B4JH 4XCEB 4AEHL 1BF8A 4X6BB 2A6KB 1M7XA 5IVNA 3QJHA 5JORA 1RK0A 5HHXH 3PWJA 1MELA 1OAKL 1CICC 1CQYA 5DK2B 3FT4B 3IDYC 5ESQA 3VRJB 4UDUA 1U3HC 2B4CH 1MCKA 2YRZA 2GJZB 4LHQB 1S9YA 3W0WB 2Q86A 1XGPB 4MAUL 1MEXL 4MMZC 1HEZB 3WNPA 4XWOD 4NQVB 1AHWC 4U33A 4JPVL 1C5DA 2DLHA 4XVUC 5D1QC 2F54A 3QUYD 4NQEB 3LMJL 2V2TA 3IDGB 3D3VD 1DE4A 4KDVA 4F7CB 4JRYD 5HYJE 1DLHA 1DQJA 4NKQB 5BQ7A 1YEIL 3QG7H 3U4BH 3MOBH 4NNPL 3JUZA 2PYFB 4M48H 4Q6IC 1FVCB 1NJ9A 5J6GB 1Q9KA 1CDUA 3BIAX 2VZSA 4YEEA 1I1AC 1KIPA 4O2EA 4N1CA 2BHZA 2AEWA 4PGZA 25C8H 4LLYB 5EOCL 1YEKL 2D2OA 3PV6A 1P53A 1P84J 3BYTA 5EU6E 4H20H 3MTRA 5FUOL 4MXWL 5C0IB 3I75A 3S5LA 2BVPB 2EH7L 1AO7A 3NBNA 4ZAKD 3P4OA 1B2WL 2PUQT 3MGOA 3Q6FA 5EU4A 4DK6A 5DUPH 5IBLD 2IAMC 4KI5F 3G08B 4CU6A 3K46A 4JHWH 4JPIA 4JZJA 4LAQH 4KKAD 3IFPA 1CE1L 1EEZA 4HUVB 3D85A 3ME0A 4OSUL 2KH2B 3MACL 2PW1A 1DQQA 5ISZD 3F12B 1MHCB 5LVEA 5AYUL 4DKFH 5JHDA 3NFSH 5E2WH 2OZ4A 5CP3H 1BF2A 4PJCF 4MB3A 1QFUH 2X1QA 1MRDH 1VFAB 1B6UA 4UV4H 3QSKB 4ZFGL 3HE6C 2UZYB 2QSVA 3RBGA 5EULV 2APFA 2BSSA 4LQFH 4U1GC 3HMWL 2DQDH 3B6SB 3D0VB 5DJZB 5FO7B 3UAJC 4YX2L 2IADB 2BVQA 3QCUL 3MLUH 4GAYB 4R97C 2P42B 2CLZB 4ZUWA 5D71H 2XQBH 1UVQA 1YUHB 2VXQL 4M62H 1NDMA 4JFFE 4OLYL 1Q0XL 2DQJL 2NY3B 3GHBL 2VN7A 3MRIA 4ZXBD 3RZCA 3CFCL 3UTQA 2NY5H 4Z8FH 3BPNC 5JPNB 1T1YB 2XFXB 1MCPL 4RDQG 1ZEAL 3VI3F 1ORSA 4F15B 5GGQH 1INQB 1INDL 1TZGH 5D7JC 1D5BA 3EDJA 1CZ8L 3IAGC 3P9MB 1PY9A 2H1PH 3WLBB 5GS1C 4X6DF 1FZJA 4LHUB 4LASH 3WUZA 4IRZH 4ETQA 4ZO7A 3L3JA 4U0RB 2NW3B 3VXNA 1A7PL 1DANT 4NO5A 3VXOB 3UYRL 3JWNC 4F8TA 3NFPB 3DMMB 1V8HA 4JO1L 4PJCB 4U6TA 4XP5L 4XP6H 5HHOD 4DOHE 1ORQB 1KEML 4FQQB 5DD6B 3BUYB 5DJDA 2HTLC 2GIYA 1EAJA 2HFFB 3RWIA 3JWOL 1IQWL 3D0LB 4PJAA 3N1MC 5I9QC 3BPLC 1S7RA 4ISVB 1F6AA 2VDMH 1PG7L 2HFGH 5DFVC 3GMQB 1MWAL 1CGSL 5FUCC 5CP3A 3RKPA 2J1KA 1JWSB 1DVFD 1DBJH 4Y4FC 4BQBA 4AEHH 2C1PA 3L3HB 1FORL 4FQIL 2W1NA 4J1UA 1CS6A 3LZFH 4PJ9B 3VFSB 5MERA 2CUHA 3RX5A 1OAKH 3V6ZB 5GJSL 5I8EB 1Q1JH 1PFCA 4N1EA 3WFHA 5F9OL 3SBWA 5DC4B 3IDMA 4PJGB 2P44B 5E5MA 3X12A 3C60B 3V79C 4XP1L 5H37G 3G5ZA 3MLVH 4MAUH 1DN0A 4LSUH 4HC1L 4TSCH 1BAFH 2B8OT 4LCUA 3N50A 3I50H 2NXZD 1RZKC 4X8JB 1E4XI 4JKKA 3LQZA 3LMJH 4U6HA 4JVPA 4MQ7A 4QRSA 3QHFH 2VXUL 4JY6A 4QF1B 1BQUA 1HZHH 4I0CC 4BH7B 4X6EA 2DJUA 2YEZB 4ZG1A 4KKLD 5J8OA 1BJ8A 1L0XA 2YRPA 3QUYA 1RUQL 2PTVA 3LRGA 4JANA 3LKSB 3QEGL 1YMHA 1AR1C 5D2LA 3ECBB 3U6RA 4L8CA 5FHAH 3KPSA 4JJHA 4WCYL 3EKCA 3QA3A 5FUOH 4MXWH 1T4KA 4KK8D 3RWFB 1G1CA 8CGTA 2EH7H 3TJHC 4WVRA 3ZTNL 4KJQC 3OKKA 2ICWI 1B2WH 2AV1B 3BT2H 1NCBH 2VE6B 1WEJL 1P1ZA 3O4LE 1FFOB 2P5ED 2AKRB 3WUWA 1CE1H 1HNFA 1KACB 4EI5D 5E8NA 4N0FB 4EBQL 2LAGB 4AK1A 2YUWA 4XNQB 4PRAB 4YHYB 1NLBL 3QIWB 5B8CB 4F9PC 1KPRB 4N5EC 4XHQA 5D72L 1A1OB 4RWYL 4HAGA 4HAFA 1M7DA 2W60A 1IGYB 5AZEL 4EN3C 1FNGB 2X2YA 1A64A 3FTGB 4V2BA 1NPUA 3BI9X 5D6CA 1L9NA 1KFAH 1RVFL 4PB0L 1YEHH 1JZ6A 1OW0C 2V5TA 2EE9A 5ECJE 4C56D 1U95A 3NPSB 3SKMB 5BRZE 5HPMB 4QTIH 4OT1L 5K59E 1I8IA 4D0CB 3P40A 3NAAH 5GISH 4YHNB 3GKWL 3QCUH 4CVXA 3EO1A 4LKCA 5I18L 1YEEL 2H32H 3VXPA 4O51B 1EVTC 1OTTC 4XVJH 3X14A 3JWOC 3RWEA 3QWQB 5F6IC 1FGVL 5GIRA 5DHYA 2Y6SD 3QDME 4OLYH 3BP7B 3TJEL 2DQJH 4JM2C 1CLYL 2OXHA 3LY6A 4JGJA 1IRAY 1KCRL 1SYVA 1PJ9A 2F8OA 3NIFF 5J56B 4J3XA 5FDWA 2DQHL 3E3QC 4GW5B 4OIIL 4BJLA 3D39B 1DSFL 3T0WA 1EPFA 1PZ5A 3VXSB 3B9DA 2EYSB 5C92A 3BFOA 1OPGL 4QRPB 5IROC 4K07A 2JK5A 2PXYD 4ZYKB 1XR8A 4M8QA 1T04A 3KPOB 4WFFD 1NAMH 5F88A 5FM5O 2EC9U 4KRPB 3EYVA 1D5XA 1A7PH 4OM1H 2MHAB 5L2JB 4DN4L 3ROLA 5E08H 1GYAA 2VISA 3WEXA 1IFHL 3RPIA 4KH2A 3MV11 1KEMH 5D96B 1RUMH 2BNUB 4CUCA 1AD0B 3EZJB 3QRGL 2A83A 4OI7A 2AJSH 1PG7H 3LKOA 1D6EB 1CGSH 4PJHE 1IKNA 1XGQA 3MRFA 3QUXA 5HHOA 2WMPA 4RAUB 4DVBB 1BGXL 1XF5B 4FQIH 5ESVA 1FZMA 5DT1L 4RBPK 3UTSE 5D2NB 4DGVL 4MD0A 4KDTC 5IBUG 3SE3A 4HZLA 1NFDB 3RUGE 5I75B 1MHEB 4Z7VA 2R2EA 1CL7I 1OLZA 2DI7A 5KG9A 4J8RA 5F9OH 4RISH 1KELH 4G6MH 1BQHB 3WMSA 4UV7L 4XP1H 1EBPA 3DSNA 5ENWA 1XT5A 4M7JH 5LCVL 3GJFA 4OZFG 4APQD 5CEZD 2P4AB 4XC1L 5D70H 3LSOA 3SDAB 1FG2B 4ZFOB 3WNOA 4GRMB 3QG6A 3SGDH 4S1RL 3CUPB 3RKDD 2YS4A 1W0YT 4UB0L 4P5TC 1K8DA 4PJ7A 2IPTH 5BZDB 3NN8A 5I1KL 2R8SL 3GB7B 3QO1A 5MENB 1RK1A 3WN5C 1UG9A 2DM4A 2YKLL 4L4TA 1W0VA 4U6XB 1JZ7A 5HI4D 2YD3A 3UYOD 3CCHA 1QFWI 3MRQA 5CJQL 5F7NC 2JB6B 4ORZC 4Y4HB 1HSBA 3P4MB 2Y5TA 2F53E 4WGVB 4HWBL 4IBLT 5BVJA 1RUQH 1QFOA 4Y8DC 1NAMA 1A7BA 3NCCB 5T5FL 3VXRE 2D7TL 3LPGA 4MWFB 3QWOA 2MPAL 1CGWA 2NY1D 1NLDL 1KCUH 5HPOA 5I8CB 1M6OA 5T1KB 2ARWA 5HI5D 3N9GL 4LP4A 4P2QD 1UZ8B 4EJ1C 2XNAB 3DV6B 4X99B 2QHRL 5MI0C 4OLUL 5C07B 5L88H 1KJMB 3KPRA 5D1XD 2FJGB 3MV8A 1WT5C 3GMMA 4G3YL 1OOAA 4EBQH 3MUGA 1TVHB 2WLYA 4OFIA 1IAKA 4YNYA 3IJSB 5EA0L 1I3GL 3QIBD 1O7SA 1NLBH 1AC6A 1CLOH 4U1HA 1JGDB 1L4IA 4Y2OA 4Z5RA 5D72H 4K8RD 2RBLA 2CR3A 4LVOC 3G6JE 3T4YA 1WCBB 4OGYL 3SCMD 5CILH 2P5EA 5DD5H 3BWAA 1MRCL 3MBXL 3W2DH 3A6CH 3VWKD 4TUOB 1B0GB 2I24N 1RVFH 4PB0H 1D6VH 4UT6L 3IRPX 1A0QL 1MJ8H 2DQIL 4PJBA 1KB9J 5BOZG 4OLWL 3HI5H 1S7WA 5D6DC 4GS7C 2QHLA 3H9ZA 4XNZB 3WD5L 3TBTA 1UWXH 3CFJB 1IL1B 1YEEH 2UY6A 43CAB 1U8QB 3KPMA 5TDNB 5CJ5A 3D9AL 2VH5L 1RUKH 2OQJB 3QI9C 3QXDA 4IRJB 1AGCA 1RZ7L 1FGVH 3WJJA 4GG6B 5FYJU 1FH5H 1WAAF 4C56A 1UT9A 5IMMB 2FL5A 1KCRH 2OR9H 2ADJB 3T0BA 4PTUA 4OIIH 3LKNA 3STBA 1OHQA 3C2AH 5IGXH 3TC9A 5CEZH 1J8HD 1UA6L 1U8JB 1MLCA 4G6JL 3VH8A 1OPGH 4ONGL 3QXAB 4O5LL 4YHKL 5GGTL 5ERWA 5H37H 1FGNL 1AKJA 3OR6A 1QQDA 5C0FA 1R5VA 1RU9L 2AXFA 1SEBB 1KIUA 3Q2CA 3BQUC 3CFKA 4DN4H 2EIEA 3C5JA 5DEFA 3ARXA 5FV1L 2CK0L 3VXUB 2ZUUA 4N0UE 5E8PB 4K3JL 1EH9A 3TF7C 5KVFL 2J8UF 2MMXA 3H7BA 2X4OB 1HXYA 1WFTA 1A6UH 2W07A 4HMDA 2WZPD 1BVZA 1QVOB 3MJ8B 4YLQT 1REIA 4F9LC 4GRLB 2GYSA 3WHE1 2LAAA 1B0WA 2JELH 5IW1A 1HYRC 1BGXH 5SX4I 1CD8A 2DWDA 2Z8WC 5HVWA 1CFNA 1JHTB 2J3SA 5TQ2L 3MYZA 2HT4D 3HAEA 2FD6L 2ID5A 2WBWB 3RWJA 4C83A 1AXIB 1I7ZA 4NNYB 5DHXB 3O45A 2DLEA 3AU1B 5C86A 4NQEE 2D7NA 5CHNB 3C9NA 5LCVH 1M7IB 3GNML 4QCIB 5KVGL 3TA3D 2EE2A 3ZHKA 3C2SA 3B9KB 4N8VB 1IAOB 2X4UB 3EOYG 3P0GB 2JJVA 4YIQA 2C3XA 4K8RH 2R8SH 1AE6H 1HHJA 2ED7A 4N0RA 3MOQA 2VLLB 4UAOC 2X44D 4Y19E 3U4EA 1UWGL 4M93B 5HY9B 2ICWA 1X5YA 3DVGB 2YN5A 4ALAH 4EUPG 5FAAA 1HKLH 4QYOB 4WFGE 1JNLL 3WDIA 3S88L 4RMTA 3MROB 1FNSL 4NO3A 2NNAA 4QTHA 4ODUA 2CSPA 1S9KC 4KRNA 3V0VA 3ULUL 2IALB 1DCLA 3D2UB 3ZHDA 4OFPA 2CUIA 5H8DA 4OZIB 2VLJA 1A7OL 1FNFA 4HS3A 2HRLA 1S7XA 3MRKB 4PLNC 4F58L 1JMXA 5EIQA 3PQYB 2E7HA 1U3YA 4LCWD 4PRDB 4O58H 1G7JB 3KHQA 1JWMA 2QHRH 4RNRB 4G8FB 1QBAA 3VJ6A 3MRMB 2X4TB 2RCSH 5D9SB 3B2VH 4QOKD 4PTTA 3BN3B 4PJIF 1LNUA 5CEXA 1EMTL 2HTKD 4OZHF 4BH8B 3SOBH 4X7TA 1OAYL 5FECA 4P2QA 1S9VB 2Z8VC 4J4PA 3S9DB 1N5YH 5J1AA 4FQXC 5CD5C 1LK2A 3VGGA 5D1XA 5DC9B 1DN2A 3B5GA 5T3ZE 3OBAA 4Y5VC 3DI2B 3MJ9H 4XWGL 3VXME 4QRRB 1NCNA 1IVLA 3QNZA 4QHKJ 4LIQH 4UT6H 3TBVA 2EZ0C 2R9HC 4XP9L 4Z77A 1MY5A 4DKDC 2C7UB 5EZOL 3O9WB 3QEQD 1JPGB 3BVNA 2NQCA 3X13A 1T1XA 3C8KA 2BY3A 3IVKA 3ULUD 1Q9LA 3BPCB 4JZOA 4KAQL 4X6CB 3T3MF 5KSAB 1GZQB 1NMCC 2DKMA 1BREA 5M7QA 1RZ7H 3A67L 3BIKB 2FH6A 1BOYA 1EAPB 5HI3C 4Y88A 1WBXB 5IMKA 3IXTA 4NSKA 2ZKHH 2P48B 1Z9MA 4YHPA 1GGBL 2WAHA 4L8SC 1UA6H 4FQHB 1A8JH 4OLXL 4U05A 3QAZC 4ONGH 3BKML 2V2XB 4O5LH 1ZA6B 3HG1D 5HHMB 1FO0H 1WBYB 4Z7UF 1TZHB 4PJCE 4PJIB 4KJPC 4OZHB 4NQSA 2R1WA 4DUXA 4GUPB 5IWLA 1EO7A 3ESUF 1UB6A 1J8HA 1U2HA 3KXFD 4U6YA 1A6AA 3LEXB 4MAYC 2FX7L 2DLIA 3SDDA 3UO1H 3DNKA 4HGMA 5GSRB 4ZNEA 5FA4B 2ERJC 2X4RA 3WO3B 3IFNL 4PY8I 2GW5A 3EGSB 5SWZE 3GBNL 5KAQF 5LGJB 3DUSB 4HKZA 4NKDB 2I9TA 2CRYA 3I6GA 1KIQA 4R96A 1F2XK 3RDTA 1D5MB 3CX5J 3V9FA 4M7LT 4P48A 3EYSH 1JJUA 3HI1B 5F3BA 3AB0B 3MRNA 4KROD 4I2XE 3MJ9A 1W0WA 2CRIA 3FQUB 4CADA 1C7SA 4FQPA 1U9KA 4LRIA 1P2CA 1UJ3B 3RY6C 5EG6C 5IB5B 2E7MA 3DYMA 3C6LB 1OY3B 2VDPL 1LHZA 2HA1A 3VI3E 4CVZB 3I85A 4K9EH 2BOCA 2Q7YB 2X40A 3STLB 2DQGL 1F3JA 4N1HB 1BBDH 3SJVB 5INCA 4RZCB 3CVHA 1HH9B 4JN1H 1FN4B 3CU7A 4TUKL 4X6DE 5TDPA 3GIZH 1MHPL 3H9HB 4EIZC 1W72H 3FMGH 5EU3A 5IK3A 2Z4QB 2YBRB 3ZKSD 5J12B 2BJML 3T65B 4B7LA 1U92B 1OSZB 2ZPKH 1CDJA 4Z7UB 3MGTB 3ZL4H 1IT9L 4MCZB 3W9EA 4NRXB 1UWGH 4WY7L 1N8ZA 1MAKA 3HZVA 4U1JB 4UDTA 3MRHA 1J0KA 4WV1C 2W65A 3AFLA 3VFTA 3OJDB 1FO0A 2Z31B 6CGTA 4Q9QL 1N0XH 1PBYA 1E27A 4O02L 3Q5YA 3H2WA 2WBKA 4FFYH 3MR9B 4GBXB 4HW6A 2PYEE 3NPSC 5GS3A 3VU2A 4OKVB 1FAKT 4XI5C 5IQ9A 1YEFH 1OQXA 4GXUM 2NX5D 2ZSVB 1JPFB 5HDBF 4F58H 4U1NB 5IFAH 1LEGA 2CDGA 3EAKA 4HS8H 1KENH 5DS8B 1J9CT 5FGCB 3LQAL 4F3FA 1RZJL 1CIDA 4MJ5A 4KTDL 5D1ZD 3KPPA 1KG0B 3SO5A 5HDOA 4JFXB 3FOLB 1EMTH 2FZ3B 1NGQL 4ZUVA 4TNWF 1I4FB 1CFTB 2YZ1A 2E7LA 1AQKL 5JR1H 2A6IA 2HT3C 3O11B 4OD3L 3U0PB 4LCWA 5BZWB 5DZNA 2H45A 5FYKD 4N9GB 1NGXB 3ULSA 4QOKA 4NJAL 2P45B 3LVEA 1HKFA 4J3OC 1XIWA 1T1ZB 2BY2A 1G6RA 2P49B 1I7RB 3AY4C 1K8IA 3QPQC 1UXWA 3JV4B 4MX7A 4PREA 3KYKL 1EIBA 4HIEA 1W72A 4KMTL 2YPLB 2R2CA 2A77L 1BZ7B 5IIEB 3SDXB 1ZA3B 1ZWIB 2UYLB 4LPTA 2DLFL 5ITBL 3OKDA 2A0LD 3AS0A 4QHMA 2F74A 5I1AB 5IB3B 5D7SH 2VLRB 5DD0H 3Q0HA 2WP3T 3H9SA 2BRQA 4GKZA 3BZDA 1P7QA 3A67H 4X4ME 1IC7L 1QOKA 2APBA 2OL3B 3F7YA 5F7UA 4J3UA 4QRPE 2Q1EA 2E6JA 3QEQA 2FWOA 2R23A 1FNEB 2AJZA 3VDBA 2YUZA 5DRXA 1GGBH 3P0VL 3FONB 1FL5A 3TZVB 5J11B 3OF6D 4OD2A 5JW5B 2NTFA 1XGYL 4JFOA 5EBMB 1E4JA 3H3KA 3BX7C 2QEJA 1X5AA 1CN4A 2BVUA 4PIRF 1XF2B 1BJ1J 3GZKA 4LEXL 3F62A 4ZNCD 1GCFA 3IFNH 5IMLA 1N3NA 3MLZL 1E4KA 3T4AA 4WI8A 3QJHB 1CWVA 1H3WM 5JORB 5JQ6H 5ESQB 3KXFA 4ZO9A 4UDUB 5HYJD 5FGSA 2DN7A 4R26L 3B2UC 3QIUA 4OI9A 2Q86B 3H3PL 1UJTA 3HFML 5F1SA 4WO4D 3NIFE 5KTEH 5EZIH 3D5OF 5IUSA 4TTGA 4ACPA 4YC2C 5J7CC 2F54B 1TNMA 4NQXA 5BQ7B 4I8DA 3EFDL 1WZKA 2O5XL 5GHWL 5EU6D 2F5AL 2XKSA 4XC3H 5F7EL 1RZJC 4NJ9L 3KYMB 5FYKH 1NJ9B 1Q9KB 2CKBL 4P99A 3UPRA 1OF2A 1VPOL 4O2EB 2XZZA 3NCBB 3O3DA 1EJOL 3CXDL 5DGRA 4QXTA 4R8WL 4OZ4B 4JR9L 5D7IA 3U2SB 1CBVL 4WUUD 2H8PA 5DRNA 2G5BB 5DF0A 1DUYB 3L3IA 4HIHA 2PTTA 4ONHB 2R1YA 3I75B 3RVXD 1CGUA 3S5LB 1AO7B 4O02H 2N7BA 3P4OB 4JPWH 5GQBA 2OTWB 1GHFL 4R4BA 5C07E 5AD0A 4EDWL 2VMFA 3EYQD 2AQ1A 4JPIB 4NKIH 3IFPB 1EEZB 1DBAL 1C08A 3TIDA 4YXLL 2PW1B 3LQAH 1DQQB 2P8LA 2W0KA 5IVZA 1P4BL 3OXSA 5JHDB 4RFEA 5GGRA 4G6FB 2D9CA 2EKSA 3V6OC 3GDBA 4XNUH 5CS7A 3RIFF 3PGFL 1TVBB 1ZANH 4PJAF 4PRIB 2W38A 3L3KB 4EDXA 4BFGA 3MA9L 2Z35A 4NRYA 4DEPB 2XI9A 3MLYL 3DETD 1PSKH 3JV5A 4YFDB 3QYCA 1Z2KA 1MPAL 2BSSB 4NJAH 3SE8H 5TE7L 5K9KA 1XCTA 2OR8A 4PGDA 4ZUWB 5LWYL 2WWMC 1DQTA 5C0AB 3MLRL 4R2GD 2M26A 5EN2B 1GGCH 5B38B 4Q7DA 4NDMA 1PX4A 2QBWA 5CZXD 4KMTH 1MVFA 4OTXL 2X6MA 4M43L 3MLWH 5FHBH 1MFBL 4XXCC 5ITBH 3RZCB 2ZWLT 3UTQB 2QL1A 1NKRA 5FUZL 1FYTA 3GMRA 1QTYT 2V17L 1RHFA 3F7PC 1C5BL 1YMMA 4YUEL 5D7KD 5J1TC 2XKNA 3UJJL 3TN0D 3WJLC 1FZJB 4H88L 4X4ZA 1JN6A 5C0BA 1Z9LA 3CLEL 5I0DA 5DSCA 4ETQB 1FLRL 1KJ2H 3FO2A 2W9DL 5EH1A 5BW7A 4NO5B 4P3CL 4OIBA 5FCUH 4WI9A 4UZGA 1DANU 5IMOB 4NCC2 1YY8B 5DQ9A 4H5SA 5IB1A 3UXFA 3GUTB 5DJDB 5FO9A 1A7RL 3RWIB 4U2ZA 4HKBB 1S7RB 1F6AB 1ES0B 5DLML 3ZZ1A 5D2LF 4IIQB 3TVMA 1NUGA 4RGNE 5IJKC 2D7MA 5FGRA 1EFXB 3CDYA 1WFNA 4LEXH 5KJRL 4J1UB 2ESVB 2LTQB 2HTLD 1ND0A 1EEYA 4PLKD 2VC2L 4Z7OF 1J1PL 4NKMA 5MERB 3O8XA 1IGMH 1KIRA 4PRPD 5DJ8B 2FBOJ 4JQIH 4UIKL 4AMKH 2XTJB 3WFHB 3FRPA 4YE4L 4I48B 3EDFA 5C0RH 3DHJA 3CFEB 4R26H 1OGAB 1EZVX 1JE6A 3KYAA 1WAAE 1XF4B 1DN0B 4JN2A 3BDBA 1UKQA 1S78C 5ETUA 5TQ0H 1B0RA 1AC0A 5JXED 1DTUA 1HH6A 4P46B 4LSDA 3HS0B 5FKAB 1T83C 4UMGA 3LQZB 4I3SH 4PJ5A 1YEJH 1CFSB 1SBBA 2VQ1A 4MQ7B 4QRSB 4GW1A 2H6PA 1NEUA 5GHWH 3WFEL 4X6EB 4FRWA 3MNVA 4JFQA 2F5AH 3DPBA 3VGHA 5DJYB 1CICA 2X70A 2ZOKA 2J6EA 4HUUB 1KC5H 2CKBH 3MRJA 3A6OA 1VPOH 3RGVB 3DI3B 2X89D 3HNTH 1KJ2A 5L2KB 2J8HA 4R8WH 3O3UN 1KBGH 2J8UE 3O4LD 4XPHH 1YMHB 1I9JH 4BSWB 1CBVH 5J13C 3IJYA 4M1GL 5JIKA 4OZIE 2LABA 4PD4J 1BZ9B 5JOEA 3KPSB 1HWGB 3QA3B 5IB4A 1A6ZA 5KSBA 1X44A 5AG8A 3D18A 4JFED 3O2DL 5B21A 5E8OA 4OFVA 2G2RA 4XHJD 3WIFA 5LKNA 1UB5A 2Q8AL 1YYLH 1G9NH 1OARH 1UQSA 5DRZB 1ZLVH 3EHBD 4WUUA 4ODHH 4XGZA 1P1ZB 2Y36L 3WUWB 3IYLW 5A2IH 4Q6YA 5E8NB 1OL0A 4DW2L 1LK3L 1HQRB 1JK8A 3BAEH 4FABL 1YNTA 5BRZD 4KTEL 5EOTB 1P4BH 3RI5F 1T2QH 1ZTXL 1WV7T 3FFCE 5B3NA 4KKCD 1OD7A 2DKSA 4JHAH 2DLTA 4JHBA 4J6RL 3MA7B 1XGUA 4RMQA 2R4RL 3KWWA 4K71B 3MA9H 4WDIB 4XX1E 5D6CB 3ILPA 4QRRE 3QDMD 4AG4L 1MFCL 3MLYH 4OQTL 1FYHB 3UBXI 3OR7B 3FCTB 4GMTH 3V4VH 1F8TL 2IAMA 1MPAH 1MCRA 1XGTB 3F7VA 5TE7H 3JV6B 4KK6D 4OAWB 4CVXB 3EO1B 4LKCB 2BXYA 4LP5A 1TCRB 5H35B 3RVUD 1KUMA 3K81A 4Z7VF 3X14B 4F37F 2L0DA 3F5WA 2WINA 1UM4H 5A2JH 1QR1A 2Y7QA 5DHYB 1T66D 5FM8A 3WXWH 4ZS7L 4F57L 3TO2A 3ARGC 1RV6X 2G5RA 2NY0C 5EO9B 1C5BH 1HN1A 3HE6A 1ZLWH 4PJ7F 2OK0L 1IGTB 4NWUL 5C3TA 2JK5B 2FATH 1Q94A 4WEBH 5HHME 1XR8B 1UJ3C 4PJIE 4NUJA 4P4KC 1T7XA 2W9DH 2ZNXA 4OZHE 1XCQA 3EYVB 3ZKMD 2CJUH 1F4YL 4MSWA 5GZOD 2DQEH 3ROLB 2VISB 1QRKA 3QT2A 4POZD 3O0RL 4EXPX 2YWYA 1TIUA 1A7RH 1QFHA 5DMJB 1JFQL 1PYWA 2A83B 2J2ZA 3L5XL 4F7TA 3MPCA 3VGBA 5DLMH 4ZTPL 4ONOA 3LKOB 2NY2D 1DBKL 4OCWL 3MRFB 2CLVA 4GAGH 4HGWA 3EYFA 3QUXB 5DHVH 4GQPH 2V2WB 4F33A 4HDIB 4X9IA 3GGWB 4QRTA 1FZMB 1J1PH 4GFTB 4CRPA 3NMEA 4MQSB 4HZLB 3IB4A 2GTZB 4Z7VB 2R2EB 1GGUA 1RJCA 3T3ME 4DVRL 3DXAE 4WHCA 3INUH 1LO2L 2DQTH 1DQML 3MLSL 4WHTB 2X10A 5F1IB 5JOFA 2EYTA 3GJFB 1L7IH 3LKQA 3LSOB 4HIIA 2F53D 4PRPA 3QG6B 3VWJC 4P23D 3KVQA 32C2A 1K8DB 1N26A 3PXHA 1RK1B 3K8LA 5IT2H 4L4TB 4Y89A 5HGAA 3UP1A 4Z7UE 3BD5A 1X4XA 5BO1L 3CCHB 3E6HA 1MCEA 3MRQB 3WFEH 4PJBF 1INEL 3LV3B 1HSBB 4RMUA 5T1LB 5E9DA 1FSKC 3IDJB 4NQDA 4EQ2A 5DURD 3LB6D 5C6TL 5BVJB 3PWVA 4WRLA 2CLRA 1X6NA 2QADC 3BMWA 1KN4H 1MI5D 2VKWA 2AW2A 4HPOH 4JY4B 4EQ3A 1LDPL 3QXWA 4U7SA 2FHFA 3RWDA 2E6QA 1H3TA 1M6OB 5E2UL 5DFTA 1JGUL 5E8DL 5C6WH 5C0DA 1JGVH 3SO3B 2Q8AH 1WUNT 4HJ0D 1HHIA 4PFEA 1BFOA 2OXGA 3KPRB 3HMXL 5DHVA 3MV8B 2IBBA 4LSRL 2FYYB 1U8HA 3WKMH 3MUGB 1LO4L 3VGEA 1WC7A 3ZSTA 1IAKB 4JFEA 2PO6C 3NCFB 4YNYB 5HGBA 3FZUD 4FABH 5HJ3A 4KTEH 2WUBL 1RURH 4R6UA 3ARBD 5IHLB 4LLQA 3MFFA 3QZWA 1CFBA 4Z5RB 3GSXB 2GFBA 5TPWH 3T4YB 2ZOLA 2A74A 5E6IC 4MZ3A 3BN9D 4LHUG 1ZKAA 3BWAB 1MCWM 4S11A 4WFHE 1HHHA 5GGSA 1TQBB 5IF0A 4J3TA 4DK3A 3VG0H 1ZAGA 1KCKA 2NCMA 3DSFH 3C5ZD 5CP7B 2HVJA 3P77A 1ZT4B 1J1XL 5J11C 2BERA 2MJWA 4KZEH 1I8LA 3SGKC 2YPLE 1S7WB 4ZFZB 1Y6NR 4H8WL 5CBEA 3TBTB 1ZHNB 3AXLB 3GMOA 2QQKH 4BZ2H 1TITA 2O5ZL 2DBJA 4HMCA 3QXDB 1BM3H 1JF1A 4GRWH 1OT1A 2HVKA 5GGVY 4F9PA 2CPCA 4NWTH 4C54A 5E2TL 4ZS7H 2FL5B 3DBXA 3QHZL 1BD2B 2SEBA 4JFDA 1IGIL 1NBZA 4PTUB 1UKSA 4U4BA 1MCSA 5HDBE 4PJ8B 2PETA 1YJDH 4Z0BL 2YD9A 1DEEA 1EO8H 5T1MA 1MLCB 4YFEA 3VH8B 4OM0H 1OW0A 4WIQA 5IQ7L 3NZ8B 5I19L 5ERWB 1TENA 3JTTA 1DDHA 2R69H 3IFOB 1AKJB 4QRQA 3OR6B 1R5IB 1S8DB 5E95B 1R5VB 2AXFB 2P8MA 3U83A 7FABL 3HLAB 1A1MA 2HAZA 5EFIB 2YXMA 3C5JB 5DEFB 3JV0A 4HBCL 5DYOA 3O0RH 3W0WD 1MWAA 5HYSA 2G9HA 3NACH 4JM2A 1E6JL 3H7BB 5DZLA 4HFUL 4Y2DC 3SDYL 3R8QA 4Y1AA 3ZDXE 4JFZL 2EDBA 2Q20A 5DJXA 4OCWH 4HQQH 4NQED 4WU5A 4M7ZC 1YZZA 3PDDA 1A9EB 1EGJH 5IROA 4ZD3L 5I1IL 3OX8A 4Z18A 3HE7B 4JEGB 3B43A 4XXDB 3X3GH 4Y5YB 5DMYA 1GIGL 3HAEB 4YQXH 5JIPA 4OCSL 4C83B 2NY4B 1KGCE 3X3FL 5T3ZL 2K7QA 2C26A 1X7QB 3MLSH 2F54E 5F9JA 3C9NB 3LN4A 4WWKB 4HWEH 2AXJA 4PJDA 4WFGD 1X5GA 3U36A 2VDKH 1WWWX 3VFVA 4YIQB 4D3CH 2QKIB 4LARH 4HT1L 1CD1B 4IS6A 1CTOA 4V1DB 5T33H 3LPWA 3U4EB 2IFFH 3UZQA 3U30C 4BK4A 4UU9A 5C6PB 4MQXD 2ICWB 3ULVF 2BFVL 1TFHA 5JW4Q 5CZVH 1MIEL 1SY6L 5DJCB 5IW6A 2VUYA 4NO3B 5C6TH 3DYOA 4OCRL 1UFUA 1EXUB 2NMSA 6FABL 4R4ND 4ENED 2Y9RT 5F97E 3B9AA 1AO7E 1LDPH 5AAMA 5LAXB 1ZLVK 1AQDB 2A9MH 5IEHA 5A43C 5E4EC 2A9NH 2UZIH 2VLJB 3VFRB 4HS3B 4WNQA 2OP4H 2AVGA 3P73A 1CGYA 3MRDB 1JGUH 1UYWL 3MUJA 3WN5A 4H8WC 4HEPG 3QUMB 1MI5A 2KQMA 1JWMB 5JO5B 4ZOAA 2MOVA 2HWZH 5FIEA 5I30L 4OLZH 5JHDE 5T3ZD 1JPST 5GZND 4Z6AT 2LU7A 4LSRH 1GH7A 4AH2B 4TRPL 1EGJA 2DRUA 1FPTL 1FNAA 4IOFC 4X7TB 1XH3B 3UJIH 5FECB 4JZNA 5GJTH 2VXTL 4TPRL 4WUKL 4J23A 5J1AB 5GGVL 1CE6A 4UTBH 2NY3D 5TDOB 2X1PA 2R56L 3V4UL 4M5ZH 2R15A 1JHKL 4HG4K 5I74B 5KSVA 5J3HD 4KK5C 2W0LA 4I9WE 2AJUL 3LEYL 4FMFA 4Q2ZA 3QNZB 4U1MB 4AENB 3TBVB 4WU7B 1IBGL 2EE3A 3ARBA 2EIZA 3FO1B 4LHUD 1WT5A 2NLJA 3BVNB 3X13B 1T1XB 3L5HA 1UM5H 3C8KB 1K3ZA 4IM8A 4ZUSB 4JZOB 4POUB 4MD4A 1UC6A 2CXGA 1CFQB 4HXAL 3RWCA 3HUJB 2IQAB 3DMMD 2FX8L 4D9LH 1F4AA 1GL4B 3MRCB 3VI4F 2NW2A 5E2TH 3FHAA 2YR3A 3QHZH 4DZ8A 1IGIH 1ZT7A 5A2FA 3IXTB 5ID1A 1KPVB 4NGHH 1SM3L 3IXAA 4IJ3B 2B20A 4ZPTA 1BQHG 1NSNL 5SWZD 3UEZA 5HDQH 4QGYA 4JDTL 4PJ9D 4Q0XL 3WS6C 5D6DA 2RGSA 2IANA 2V7NB 5KW9H 2COQA 3OB8A 1F11A 4PJAE 5GSVA 3GJEB 1VFUA 3P0YL 1RIVH 4U6YB 4LPUA 3OZ9L 3BH8A 3C60D 3QI9A 4NP4H 2D03H 4TTDC 2X4RB 4XCEA 4FG6D 1RD6A 3O6FC 2HN7A 3ROOA 4DZBB 3KJ6H 1QSVA 4HJGA 4OUOA 1JVKA 4IDJL 1OAQL 3K8MA 3L9RA 4ZQKA 5DK2A 2I9TB 4EIGB 1K4CA 4X80L 2F15A 3RDTB 3SDCB 5SWQA 5I1GL 2XTJE 2GJZA 1QBML 1ZGLB 4I3GA 4KI5C 3RGVC 3W0WA 5F3BB 1XGPA 4NN5B 2OSLA 3MRNB 3QQ3B 1HEZA 1W0WB 2FJHA 4CADB 1AXTL 2VZVA 4RIRB 4U1IB 1I7UB 5E5UB 4XVSL 5T3ZH 2BOCB 4I0PD 1H3PL 2XYCA 3IDGA 5IHUL 4DCQB 4K7PY 3Q5TA 4N8PA 3CVHB 2ATKA 2ICEB 4LQ1A 3U1SL 5B4MC 4OLEA 1MFEL 1VGEL 4JO4L 1FAIH 5EU3B 4F9LA 1FVCA 2VDRL 4UTAL 3L95B 1MCCA 4HT1H 3I84A 1NFIB 5CSZA 4O2CA 4LLYA 3MV7B 4NCC1 2GJ6B 1N8ZB 1WZ1L 3HZVB 4RFNC 4BA8A 3RTQB 2W65B 4XPFH 5JA8B 4LVNC 1R5WA 5D2LE 4MJ2A 4N0YH 1FO0B 5C0IA 3KPSE 4MNQA 2BVPA 3PNWA 1BLNA 1E27B 3QIWD 1MFAL 4F80A 4A6YB 4NC1E 4Z7OE 2BVEA 3UJTL 4AM0A 5IQ9B 2ADGB 3U7YL 4W70A 2VZOA 3VFPA 2CDGB 5HHQB 2K7PA 4FZEL 2A38A 1KJVB 4KVNL 3F12A 1MHCA 2X09A 4WGWB 4B41A 3ZYOA 4ZPVB 2ZUVA 1FVDB 4G9DA 1HQ4B 3KPPB 2R0KL 3EFFA 4ZUVB 3JWDL 3D25A 3BJLA 1FPTH 4S2SA 5CFHA 4HSQA 3UYPA 4P5KB 2BRRL 3RIAK 3ZKXB 1DQLL 2R56H 3TWCL 4JO3L 1T7ZA 3ULSB 3V4UH 1JHKH 2Z93A 4GAYA 3WFZA 3NFNA 4POYA 2IF7A 3D39D 2AJUH 5DD3H 4ODXA 1A5FL 1G6RB 1FDLH 1QNZH 3K8KA 1MUJA 4LLUB 3VXSD 1UXWB 3OAZK 1YUHA 4OFKA 4MX7B 4QRPD 2Z8SA 4HKJB 1LO0L 5E1AA 4HUWA 1QBLL 3VG9B 5IM7B 2IJ0C 5JPNA 1UM6L 1T1YA 2XFXA 1I85C 3DUHA 4KRPD 5ITFB 3WFBL 5IHBA 1INQA 4N68A 3QDGA 4P9ML 5EBLA 2FX8H 3H9SB 4Z78A 1P7QB 2AQ3A 4FQXA 2IQ9L 4PUBH 5I1EH 3F7YB 3F58H 3P9MA 2MCPL 3WLBA 5BV7L 3T3PF 3HZMA 2W91A 1YN6B 2Y1VA 2R23B 2Z92A 4H0IA 5GGTA 4Y5VA 3KGRA 5DRXB 5TGBA 4FQ1H 3RJQB 3PP3K 3S35L 3OAUL 3TH2T 1I1FA 3H3BC 4Y4KC 1FL5B 1ORQA 4U6VL 5EIVA 1R3IH 2YD2A 3BUYA 3NIDF 3QR2A 2HFFA 2ARJQ 3D0LA 4MA8H 4ISVA 5TFSH 5D7IF 3V7AE 5FF6A 2UZXB 3GMQA 5F3HB 2C3HA 3G5XB 3P0YH 4N8VG 1P84K 4ODTL 3RHWK 3OZ9H 3S37X 4LCIH 4PRHA 3MCKA 1QHPA 5DMGD 4PBWD 1UCBH 3L3HA 5IMLB 5HHOE 4K7PL 4PJ9A 3VFSA 3DARA 1OAQH 3SDAD 2D0GA 4L8DA 5JDSA 3PL6C 5C0EB 3V6ZA 5E0QA 1IAIM 5I8EA 1IKFH 4MDIB 1FFPB 1K5NA 2J4WH 4PJGA 4Z7VE 3O6LH 5MEND 2YA0A 4QRUA 5TE6L 3CMOH 1QBMH 4S10A 4NM4L 1CU4L 1VEMA 3NCEB 2APWA 3QIUB 4S1DD 3T08A 3B3IA 1ZV5A 3P11H 4Y4HD 2YD1A 3ZT7A 1FIGL 2VAJA 3K1KC 1U8MA 3G5YB 4MZ2A 4MAYA 5ICXB 1H3PH 4PJ7E 5D4QA 1OP3H 4NQXB 1V3KA 2EDXA 3U1SH 3NABH 4L4TE 1Q0YL 5EUKA 5BMFL 2YEZA 1MFEH 1VGEH 1UH3A 4JO4H 2JJSA 4FFWD 4NN7B 5T1KD 1TPXB 5K9OA 1YPZB 3ZSSA 2WWKO 3PP4H 4M5YL 1KNOA 2HKHH 4XPTL 1VGKB 1GGIL 2C1OA 3O3DB 3RU8H 2I9LA 5C07D 3LKSA 5I1CH 1P5VA 4KTYA 4KPHL 4QWWC 1WZ1H 5D7IB 3RY6A 2AK1L 3KLAA 1OAXH 2GY7B 2HT2C 5DK0B 4OV5A 4PJFA 4JQVC 1PG7W 1J0IA 2X4PB 3BHBA 2IEPA 5KVDL 4NOFA 3KLHD 1EDQA 2CO7B 2AKRA 3KPRE 3U7YH 3JUYA 4N0FA 3MV8E 2XPGB 5B22A 5I2IB 1FRGH 5DUBB 4NFDA 4XNQA 4DTGL 3FFDB 4MHHI 4QHLA 4E5XA 4GXUN 4NUGL 4PRAA 4KVNH 3QIWA 1FVEA 3KR3H 5IVZB 4P2OB 3OXSB 2LU3A 3L3DB 4RFEB 4F7PA 2ZCKL 2B5IB 4WV1A 4X98B 1IGYA 5IVXB 5BS0A 3BSZH 4ZS6D 4JM4H 3ARZA 2P5EE 3FTGA 5BV7C 5CBAB 4Y5XB 4PBVC 4EDXB 3LH2H 3UTTB 2JCCB 1A4KA 2Z35B 4IRJD 1SJEA 4BFIB 4HEME 1X4ZA 2VZUA 3N85L 3SKMA 5HPMA 1RIUH 4W4NA 4PJBE 1J0JA 2Q87A 3TWCH 4D0CA 5F7LB 1H5BC 4JFPB 4LU5L 5K9KB 1XCTB 4FZ8H 3L6FA 1RIHH 4YHNA 2AABL 1NCCH 4O51A 1OAZH 1G84A 4ELKB 5B3JF 1ZHLA 5F7KC 4LOUC 4IRSC 5C8JA 1JZ3A 1BQLL 2ATPB 4NDMB 1EERB 4ZOCA 3BKJH 1QBLH 4FFVD 4HK3N 1KTKE 4C56E 3DECA 2F5BL 4K3DH 3WLWC 4GW5A 2CDFB 2CH8A 1DBML 1FYTB 5JXAH 3D39A 4RX4D 3WFBH 4KGJA 1A21A 4Q58C 3VXSA 1IAIL 1H9VA 1YMMB 3VXUD 1ZOXA 3IDIA 2MCPH 4ZYKA 3IGAA 1GAFL 4U3XA 4FN0A 1FJ1A 1LWRA 5C0BB 1BECA 3N1PC 5TH2A 3BP5B 5DSCB 2VQUA 3OPZL 4GRLD 5CGMA 4DAGH 4PGBA 2MHAA 4NC0B 5L2JA 3AY4A 5JUEL 3D48R 1A7NH 3QCVL 3QB7C 5T1DL 3HNVL 1JRHI 4H5SB 4U6VH 4ZOEA 1TLKA 4LLWB 1ETZA 2VDOH 4KUZL 1AD0A 1WTGT 4N9OB 4ZFFB 1J8KA 2QQLL 3OTTA 3QCTL 5CJOL 3TVMB 5GS0L 1NCDL 3WO4B 1IMHC 2YMXL 4R7NB 5KSBF 3S4SA 2VR4A 5BOPA 2EC8A 1OSPH 4H0GA 2DTMH 4CDGC 4JCMA 4M8VA 4Z76B 4TVPE 5D2NA 1EEYB 3HNSL 2QQNL 3VMOA 1TJHH 3HC3L 3O8XB 1NFDA 4H26A 3TO4B 3ARED 1KIRB 1MHEA 3B9KD 1VHPA 2DJ4A 3EOBB 1ZHBB 4FNLL 4ELMA 1MFDL 3PWPB 1BQHA 3ZKNC 4NM4H 4WW2C 3SQBA 1HK6A 4EXKA 1FE8L 5ETUB 1B0RB 4RAHA 3SDAA 1HH6B 3T0EC 2KKQA 3CUPA 4R4FL 4GKOA 4WTZG 5BZDA 3GB7A 2L4OA 2ITDA 5MENA 4PJ5B 3QUZC 3WNMA 4U6XA 3C6SA 2AERT 2EXYC 1J0ZA 2XWJB 1SYSB 2VQ1B 1J87A 4GW1B 1F00I 3D2UD 1Q0YH 4U7MA 4NZTL 2JB6A 1CICB 2XXMB 4RGNC 1U8NA 2ZOKB 4LBEB 3IDYB 1AD9A 1F02I 1ZMYA 4R9HA 1U3HB 3WIIH 3MRJB 4I1NB 1GGIH 5LBSH 3MRLB 4ERSL 2ENSA 3EJYD 4KPHH 1FNLA 1IGJA 5I71C 5GS0D 2AK1H 4K94C 1AHWB 3IJYB 4MB5A 2HFTA 5I74C 3IFLL 1LEIB 2VLJE 1RJZA 1A6ZB 5KSBB 4M3JA 1MAJA 1HDMB 5D1QB 2M1KA 3D18B 3L1OL 5E8OB 3MXVL 2XNAA 3DV6A 3WIFB 3O3EB 1UB5B 5C07A 3DX8A 2EXWC 4X5WB 1F97A 1UQSB 3WFCL 2UUDH 2DIJA 2VDQL 2FJGA 5TE4L 4K2UL 1HHKB 1P4LA 4XGZB 5EZJB 4YO0A 4Q6IB 1RJLA 4QRRD 1I1AB 3P3YA 4NUGH 2YK1H 1JGDA 2ZCKH 1UENA 2GJJA 3O9WD 4HCRH 1MCOH 1XGUB 3RZWA 4RGOL 3BMVA 2EIBA 5KSAD 3SE9L 1NGZB 2CMRL 1QACA 3C08L 1I9IL 1F58H 3DGCR 2IAMB 3ULVE 2MCG1 1AI1H 3F7VB 4LU5H 4OF8A 2NXYD 2NZ9D 1IL1A 2Y07L 43CAA 5TDNA 3ZDZF 1BQLH 4GG6A 3F5WB 2WINB 3HUJE 4JFYA 3IAPA 2HLFC 2Y7QB 3G5VB 5HHMD 5IMMA 1V7MH 4XPAH 2Z91B 2VZ1A 2XQYG 4D0BA 1UH2A 1G9MH 1DBMH 4OCNC 4OGAC 2X4QA 1IAIH 3HE6B 5C09A 4L3EB 1K6QH 3ARYA 4UT7L 3P2TA 3VFNB 3VFGH 3NCJH 1NGPL 4U1GB 1DLFL 3O6ML 4JG1L 3CU1A 4NUJB 3GBML 4R97B 3DRTA 4HS6A 3AS2A 5L7XH 5MP6L 1L6XA 4MSWB 1NEZB 1WK0A 5JUEH 3WS3A 3VXUA 3QCVH 1J8HE 4JKMA 5T1DH 1A47A 1GOHA 4ZNEE 4KUZH 4XXCA 3QDJB 1PYWB 3MJ8A 1QVOA 2VLKB 4G7VL 4N0CD 3BPNB 3PIQA 3W81A 4F7TB 1JYNA 3C6LD 4GRLA 2VDNL 3QCTH 1TTFA 2D7PA 5GS0H 1NCDH 4HGWB 1LO3H 3EYFB 4OCXL 5D7JB 4HCRA 1AJ7L 4FFZL 3SJVD 3MBEC 4S1QL 4LLAA 1JHTA 1QSEB 4OD1H 4YXHL 1S3KL 3WJLA 1GC1L 5GS1B 1WIUA 3HNSH 3ARDC 4PRBA 2YD4A 5EC2B 2NYYC 5I73C 3CLFL 1NCAH 1JGLL 2ZUQC 4LIQE 1ULVA 1VB9A 1SBSH 3MSPA 2O5YL 5HYIA 4YDKL 5A16A 1GZPB 3VI4E 3S5LG 4G9FB 1FE8H 4HXBH 3HHRB 2EYTB 1AXSB 5I9QB 4HIIB 2BDNH 3B9KA 4N8VA 1IAOA 3CNKA 3MFGB 1QUNA 2GUOB 2Z31D 1CQKA 5IJKA 4NNXA 3CK0L 5F70A 1T0PB 4XCCH 4Y4FB 3THML 4YXKH 1N6QH 1X6LA 5BCAA 4GBXD 1TVDA 5HY9A 5C2BL 4NZTH 5T3XE 3MLPA 5K59F 2VNCA 1BBJB 1KB9K 3RX8A 1IC5H 5DUMH 3CVIH 3RVVC 3W39A 4QYOA 3DX9B 1G7QB 5E9DB 4ZTOL 3MQIA 5ADPH 3S6CA 4NQDB 1HINL 5LQBL 4G43B 4MLSA 2CLRB 2IALA 3D2UA 4NT6B 4YBLC 4OZIA 3ZYZA 1G0XA 2OJZH 4K3GA 4Y16C 2PR4L 3IFLH 1T83A 3PQYA 2V5SA 5IKCB 4PV9A 3Q48A 4PRDA 3MXVH 5H2BB 1G7JA 4RNRA 4QXUL 5DR5H 3MRMA 1R3HB 2EEDA 1U93A 2JJUA 3H8NA 2VIRB 2X4TA 3CX2A 4LNVA 5GRYA 5B38G 5D9SA 4XMLL 4P59H 2A1WL 4RCAA 4WENB 4CKVX 4BH8A 2BZDA 4ZDHA 3CAFA 4JREB 1BEYH 1S9VA 4U1SA 1JZ4A 5HGBB 4OFDA 4Q97A 3CDGA 2FRGP 2YPLD 2ZUWA 1PG7X 3QZWB 2DQFA 2GFBB 1A22B 1NMBL 5K9QI 2A74B 4JM2F 1H15A 2N7AA 3BGFC 4KHTL 2XV6B 4P49A 1HHHB 2VLRD 3SE9H 5JW3H 5AZ2H 5IF0B 2EYRA 1LE5A 4U7KA 3EDDA 2HFEB 3P77B 1QRNA 3VFOB 3R4DA 1TTGA 1UCTA 1WFOA 3QQ9C 4BELD 2C7UA 1FFNA 3O9WA 5I1DA 2C4FT 2JLLA 1UEMA 2CIIB 3UC0L 2D7QA 2Y07H 3BPCA 3GMOB 4HK3J 4X6CA 5HD8D 3QJFA 3AGVA 1T6WA 5I8KL 3BIKA 1JF1B 3VMPA 2HVKB 4PP2A 4DKAA 3TZVD 4XAWH 1UACH 3H9SE 4N8CL 1PQZA 3DBXB 2C3GA 2HH0H 4EN3B 4JFDB 1NBZB 2Q8BH 5CINH 3QEQE 4PJDF 4Z7NF 4FQHA 1DEDA 2WLZA 4GRWF 2Y06L 1S7TB 4UT7H 5K9JH 1YC8A 3K80A 3LN5B 1WBYA 4XTRD 1ZLSL 1F13A 4AIZA 3JTTB 4JFHE 4GUPA 2ZJSL 1JI2A 2W92A 4PBXA 1R3JB 5MP6H 1A1MB 1B9ZA 3P30L 2CGRL 3ILQC 3ZKQD 1D9KC 1G7LB 3E8UL 5F6IB 1B4JL 1MWAB 4LPXA 2G9HB 2DJSA 3DUSA 4TOYH 4Z7WA 4NKDA 1I8KB 5ACLA 4Y1AB 2H3NB 4M1CD 1OM3H 1KGCD 2FCBA 3TPUA 2F54D 1PKQA 4WU5B 1MQKL 3ARFC 3KXFE 4HUXA 1KYOJ 1YQ2A 1AJ7H 1G1YA 1QLFA 2Z0BA 4YXHH 3FQUA 3OX8B 5D8JH 1DJSA 3AM8C 1UJ3A 2AGJL 4P4KA 4M9OA 2Q7YA 4YDKH 1QD0A 3ZT5A 1U8LB 3SJVA 4RZCA 1FCGA 3QG7L 3T3PE 3U4BL 3MOBL 4MS8D 4PJDB 5MEOB 3H9HA 5JZ7D 4GRWB 2JF1A 2YBRA 3T65A 3VFVB 1YPZE 1U92A 3WUWG 1OSZA 1T5XA 2H2PD 4L9DA 3THMH 1AO7D 3MGTA 3RNQA 2R0ZH 4NRXA 25C8L 3NIDE 3H9YA 4UNTA 4ZUUB 5C2BH 4MJIB 2FEEL 2BNQB 3MV9A 5D7IE 4EKXA 5HHNB 2OL3H 2NR6D 4ZTOH 1IGCH 4H20L 4HF5H 3OJDA 4KJYB 5IW6B 5CGYC 1OLLA 2OS7A 3ORJA 1QEWA 2V7HA 1T0NA 3JXAA 4GBXA 4P57A 5JHDD 2HMIC 4NO2A 4OKVA 5DUPL 4G6FD 3O2DA 3LRHA 5JOPE 5TF1L 3RFZC 4JHWL 1NCTA 3VWJA 4LAQL 2ZSVA 2E9BA 2I5YH 1JPFA 4P5TB 5F1KC 3IF1A 1ZLUH 1N7ML 5DS8A 5SWSA 3WN5B 2BXZA 2W0FA 4OCYH 4QXUH 4DKFL 4F7EA 3NFSL 5E2WL 4UUJA 4UINH 2F19H 3CJJA 2H2SC 3UBXB 1KG0A 1BX2A 3L3OA 4I9WD 5J06A 1CLZH 1QFUL 4MMXC 1I4FA 4L9LC 5J6HA 3PXJA 4UV4L 5C0AD 4TVSa 3U0PA 3CZFB 5B39A 4JZNB 3E6FA 2JCCE 5MHSE 5SV3A 4OQ1A 1CE6B 4N9GA 4R7DA 4LQFL 3RZCD 3I2CL 4E42B 1PEZA 3A6BH 2CD0A 5KSVB 1N4XH 3WFDL 1T1ZA 1WIPA 3D87B 4MJ4A 5BVPH 5HVHC 2XQBL 4RMVA 4M62L 5MI0B 2EIZB 2V9RA 4CVWA 2R1XB 3CX5K 3SDXA 1ZWIA 2HKFH 4KQ4L 5FYKE 3BRFA 2HJFB 2PCPA 5I1AA 1YNKL 4Z8FL 3RBSA 4J3SA 3V7AG 2VLRA 2FO4A 4MD4B 1FYTE 3VA2C 2YD8A 3RWCB 1KTDB 1TZGL 5I8KH 3TFKC 1MAMH 4LGRB 2ZCHH 1YMME 2AAVA 3MLXL 5EUOA 2A73A 4N8CH 5F93C 4RMRA 2B7DT 4LVOB 3DX7A 4DZ8B 2B4CC 5E6IA 3C8HA 4LASL 5C7XH 5C0BE 2QSCL 4P2YA 5HVGB 2Y06H 4CN1A 1V3MA 5LGHH 1FBIH 1EFXD 4JKPH 4XP6L 1J88A 1T0MA 2EDFA 4ZPTB 5JW5A 3SGKA 4GS7B 5EBMA 4L4VB 2IANB 1T2XA 1F45A 2VDML 5EZLB 2HFGL 2XTJD 1E0OB 5TF0A 5DQDH 2CGRH 2X05A 2ZCLH 3E8UH 3BH8B 3QI9B 1T22B 2HLAA 4KFZC 4LVEA 1DBJL 1OGAD 4GJTB 3SGEI 3EIFA 2HN7B 3ROOB 3LZFL 1R3LA 4HJGB 4P46D 1OP9A 1FQ9C 2QQQA 2X42A 3L9RB 4ZQKB 5ID0A 3IKCA 2OZ4H 2EDWA 1Q1JL 3ZE1E 5B3JE 1K4CB 3RNKA 5CJBA 4GH7B 5SWQB 1MQKH 3JZ7A 3LAFA 4MQTB 5KOVC 3MLVL 1URLA 2OSLB 4LSSL 4LSUL 2B0SH 1MHHA 2FJHB 4TSCL 2AGJH 3LDBC 5INDA 1BAFL 2WANA 4LVHC 5E2JA 3FT3B 3I50L 3BQUB 2VDLH 4DKEL 3PGDA 3UZVB 5FXCH 3QIBB 1EHLH 3CC5A 1KT2A 1F5WA 2I26N 4PJ5E 5L2KD 3FB8A 3QHFL 2ATKB 2IG2L 1HZHL 3VA6A 1RY7B 4LPYA 4IOIA 5DWUH 5EORH 9CGTA 3KPSD 3KYMA 4G80A 2QLVB 3SKJH 2WBJC 4GAJH 2BY1A 1GPOH 5CSZB 5C3LD 4O2CB 2EDHA 1A3RH 3BE1H 2BOBB 2DL2A 4TNVK 4OZ4A 3PHQB 5GRVL 1MF2H 3U2SA 5A2LH 2G5BA 2I60H 5FHAL 4ZMAT 1DUYA 3BRGC 1R5WB 3SBWC 1Z9SA 4ONHA 4MNQB 5KSBE 1LEKB 5EO0B 4B5EA 3PNWB 4CU8A 4Z95H 1BLNB 4G6AD 2OTWA 4IEFB 4KHXL 3BT2L 1NCBL 4LNRB 4HLZG 4LPWA 5TF1H 4AM0B 2ICES 1T80A 3UTOA 3GHEH 4WUUE 3VD9A 3W11D 3VFPB 1N7MH 3RX7A 1YNLL 3VD5A 3IDXH 2NY5C 4M4PA 1MCHA 4UAOB 2P5WB 4GW4A 4XMKH 1NUNB 4G9DB 3BRDA 2VRAA 3MZTA 3EFFB 4TULH 1TVBA 3D25B 4PRIA 2N1KA 3L3KA 5IV2A 5C0CB 4S2SB 3QUYC 2CRZA 3SE4C 1KFAL 4HV8A 1IC4H 1XF1A 1YEHL 4LSPH 1SMOA 4AZ8A 4GLRI 3VH8G 3TT1L 4NKOA 5IBTH 8FABB 4QTIL 4MNHA 3I2CH 3NAAL 3KPLA 5GISL 4NRZB 3PDOB 3O4OC 2Z93B 1EA9C 2ZSWB 3MCG1 2JKXA 3NFNB 3WFDH 3OWEA 2R29H 5C0AA 4ODXB 4XVJL 5C0JB 4G8GB 5EN2A 1MUJB 3T1WA 5B38A 4PJGF 5ADOH 3EOTH 2E8YA 1GOFA 5DJ6A 4K3HA 4ONFH 5E1AB 1OP5K 4HUWB 1ADQA 4KQ4H 3W5NA 3VRIB 5ALBH 1YNKH 4W68A 1GVIA 4PR5B 2FGZA 3QDGB 5EBLB 4ZAKC 1GOGA 4Z78B 3S7GA 3MLXH 4FQXB 2YPVH 5IBLC 3BUTA 3HZMB 1ZHKB 2QR0A 1NAML 4KKAC 2Z92B 5I16A 4EI6A 2CUMA 4Y5VB 1MJJA 5F89A 2QSCH 4JGUA 5TGBB 4OM1L 1UH4A 3HAEG 4W4OA 5E08L 3QUXD 2UWEA 5IMOA 2VKXA 2ZG1A 1YY8A 4OZFB 1HI6A 1I1FB 1FZOB 5D7KE 1TQCC 3GUTA 4JO2L 2DD8H 4JPKL 1OVZA 1RUML 4JKLA 3ZT6A 3FB7A 2EDYA 4PP1D 1HOCB 2DL9A 4HKBA 1A6WH 1ES0A 2AJSL 4ZO6A 5FF6B 4KC3B 4IIQA 4U1KB 4WJ5B 1NMCB 1EFXA 4PRHB 3MCKB 5IOPB 4PJFF 1TJIH 2ESVA 4OGZA 2APXA 3H6JA 3ISWA 1QSEE 4P9HH 3AS1A 4L8DB 5DJ8A 5JDSB 5F9WC 1MOEA 1W8OA 3MJ7B 4I48A 1K5NB 4L8SB 4RISL 1KELL 3ZDZE 4G6ML 2BVOB 4QRUB 3CFEA 3QAZB 1OGAA 4KXZH 1XF4A 4L4TD 2Y5EA 4LSSH 1QKZH 4M7JL 3WS6A 4ZXBC 4BQCA 3CSPA 4P46A 4R0LC 5D70L 1K85A 3B3IB 3HS0A 5T1LD 3HI6H 4PRPE 5FKAA 4DKEH 2IPTL 4FXGB 1N59A 1U8MB 1B3JA 4UIMB 3IU4H 4MAYB 3MNWB 5FUCE 4GT7A 2DKUA 5E8EA 2ERJB 1CFSA 4ORGB 5F1NA 3ALWA 3O6FA 1CXLA 2IG2H 3OB0K 5EUKB 2D4DA 4PGCA 5DJYA 4BZ1H 5CLWA 4HUUA 5K9OB 1JI1A 3CH1B 3G9VA 4M6NH 5E9DE 4JREC 3HCVB 5CUSL 1KNOB 4NQDE 3RGVA 2C1OB 5J9PB 1CGVA 2I9LB 3U9UA 5L2KA 1LGVA 1R6VA 3GRWA 2DQUL 4BSWA 3SE3C 1KCUL 3KPRD 3MV8D 3T0DA 3KLAB 1BZ9A 2EDEA 4TNWK 3VCLA 1DVFC 4OV5B 4PJFB 3RVWC 1KTLB 1UXSB 4FQCH 4X5LA 3BHBB 4KHXH 3ARUA 5L88L 2Y25A 4RRPA 5DRZA 3OG4B 2XQYK 3MYJB 1Y0LB 4QHKI 1NC4B 1RZIA 1XGRB 2Y4SA 4LKXA 3OHXB 1QSFA 1HQRA 1YNLH 3WHXB 5J4MA 4QHLB 4E5XB 4JFEE 3U9PH 3NGBC 3K2UL 5EOTA 1FVEB 1CLOL 4OF5A 1I7TA 4LPVA 2PW2A 3MRGA 4F7PB 3MA7A 3R06A 2KQNA 4WV1B 5CILL 2OTPA 5DD5L 5BS0B 4TVPL 4FXLA 2NXZC 1EHNA 3W2DL 3A6CL 4WDIA 1KJ3H 1HSAA 1A4KB 1J18A 1D6VL 1SJEB 3L5WB 5ESAA 1MJ8L 1ZK9A 3FCTA 3OR7A 1JNNH 3UTZB 5CEYB 3TT1H 3HI5L 4U1LA 1XGTA 3UPAA 3JV6A 4OAWA 1BD2D 4YK4C 3L6FB 3MLTA 4KKLC 4DN3H 4P3WA 3GJFH 4PJ8D 1TCRA 1NFDF 5H35A 1ZHLB 5C8JB 3V5HA 1RUKL 4M61B 1YY9C 1G7MA 4ELMF 3RRQA 1FH5L 2GSIB 2EICA 2QTEA 1AKJD 2OR9L 5I1HH 3C2AL 5EO9A 5IGXL 4JFDE 4KK8C 1OCWH 2B1AH 5CEZL 3KDMA 4CJ0A 2GQHA 5DFWH 4JRXA 2VXSL 3QFDA 1IGTA 3SGJC 1ZGLM 5AWNH 1OTSD 3IDIB 1QG3A 3IGAB 4XNMA 5F96H 3K0WA 2F8XC 1FJ1B 4X4XB 3OAYH 5L8KB 2E27L 1MCBA 5TH2B 4EI5C 4EOWL 1BFVL 1QFWM 1E4WH 4PGBB 5DO2D 2LVCA 4AT6B 2OTUA 3OV6A 4JCLA 4TVPD 3B9VA 4JO2H 4JPKH 5I17A 1ETZB 3HE7D 1N64H 1A6UL 1I85A 3VW3L 1I1YA 4IMLB 2WQ8A 4YHMH 4Y1AE 4KRLB 3E3QE 2NY4D 3GM8A 2CR6A 4PD4K 4QY8A 2JELL 2V2WA 5DVOA 2N4IA 1FLTX 3S4SB 4HDIA 1VFOA 3GGWA 3LD8C 4YZFF 1U42A 4WWKD 2GTZA 4H26B 4QHNB 3X17A 2N56A 4YPJA 3QFJA 3GSVB 3BKYH 1D5ZA 4ELMB 4Y4KA 2Y6SC 4WHTA 5F1IA 3ZE2F 5FA3A 3LEVH 1WBZB 1A7QH 1JHLH 1G7PB 5DD1L 2ZZUT 1U8IB 1C12A 4HLZH 3P4NA 2KBGA 3ULVL 4PJDE 3LS5H 2J88H 2Y72A 1KCSH 4Z7NE 2BHYA 4KK9D 4K8RL 2FSEB 4GRWE 1AE6L 2ITDB 5A1AA 4PB9H 3M07A 3C6SB 3FN0H 2PXYC 4QXGH 3BGMA 1KLGA 1U2CA 4KJWD 5JHLH 1JF5A 3PL6A 2VLJD 3EO9H 4ALAL 3LV3A 2IPKA 1PDKA 3OKLB 5T1LA 2GITB 1U8NB 35C8H 3IDJA 1HKLL 4NZDA 1AD9B 2IH3B 2KZWA 1S9XB 5CUSH 2DMKA 3NZHH 4JY4A 4LSTH 2K3TA 3B83A 2FX9H 4GG6F 2DQUH 3DROA 1IGJB 5EC1B 3EJZD 2R0LL 3RIFK 1ZVYA 1RJZB 2O26U 5KANI 4YC2B 1CGXA 1JNJA 3CFIC 15C8H 2EH8H 2FJFA 4J4PD 2C5DC 4O58L 5ILTH 3WXVL 3DX8B 3ZMRA 1ZVSA 1MI5E 1EHXA 3NA9L 2RCSL 4ZO8A 3B2VL 3CGTA 3SQOH 1S5IL 2GI7A 1RFDL 2AJXH 1P4LB 2FYYA 4NN6C 3KJ4C 4Y8AA 4YO0B 3BXNA 5AG9A 1RJLB 2D7OA 1WVZA 1QZ1A 3SOBL 2X1XR 3K2UH 1N5YL 1A2YA 4GKNB 3ULVD 5E56A 4S0SD 4APQC 3HRZA 4FP8L 3GSXA 4LEOA 2XWTA 5AAWA 3RKDC 1E4XH 5HHVL 4TVPH 2I27N 3AMKA 3MJ9L 4YDLC 3HR5B 1JPTL 4UOW1 1MCQA 4JQVA 3VXTB 4LIQL 3HAEH 1QFWL 4E0RA 5CP7A 5HI4C 1ZT4A 1PEWA 5F7YC 4ESKA 4ZFZA 4L1HA 5I8OL 1ZHNA 3AXLA 3E2HC 1MIMH 4DGYL 3C09C 1KPUB 3CVHL 4NBYB 3GMLA 4G6KL 1S7QA 4G5ZH 1XEDA 2F9BT 3I3EA 1B88A 4JFYB 2YN3A 3DHMA 3I9GH 4WO4B 3V5DB 2NY1C 4OKDA 3B9EA 1BD2A 1H8OA 4NFCA 4D0BB 4JQXA 5L9DH 2ZKHL 5HI5C 5EOQL 2AK4A 4PJ8A 3OG6B 2P8PB 3M8OH 1FL3B 2X4QB 3SDDD 5C09B 4JDZA 1H8SA 1XMWA 5EIIA 2VXSH 2VR5A 5GRJH 5DMKB 3NZ8A 4D9RD 1FO0L 5BJTA 3ELAT 3IFOA 1R5IA 1H5BA 1S8DA 5D1XC 1X4YA 1T3FA 5SX5H 2E27H 5FV2A 3ZLQC 4EOWH 3DRTB 3HLAA 1NGYA 4HS6B 5HYQB 1BFVH 2IANE 1FFQA 3RDTD 5EFIA 3SDCD 3WS3B 3QIBC 3UO1L 2YRLA 3UDWC 5FDYA 5FK9A 1A6TB 4K8RC 3EUUA 3QUMH 3SCMC 4M6ML 1J5OH 3GSNA 3PIQB 3VW3H 4OZIF 2J7LA 5EU7E 3VWKC 4J3VA 1CFVH 1C1EH 3EYSL 3SEPA 1T7WA 1A9EA 1L7TH 3PWLA 1BWMA 4LSVH 12E8H 3OKOB 3FQTB 3W0WE 3HE7A 4XXDA 4Y5YA 4XBGB 4PRBB 1ZS8B 3RY4A 3T09A 4K3EL 3AC0A 4P2CG 4NZRH 2KPNA 2FEDD 4K9EL 1X7QA 4K94H 3O3BA 5A16B 4D9QE 1BBDL 3MV7D 5T3XD 4JN1L 2GJ6D 3GIZL 1V3JA 4WWKA 5DD1H 3RTQD 1S7UB 5IWLC 3ULVH 1W72L 3FMGL 2VSDA 5D7LA 5GGRY 4I18C 3G6AB 2QKIA 3KNBA 1CD1A 4JFFB 3R8BB 1KF9B 4V1DA 2ZPKL 4NNXB 4TYUA 2R4SL 3ZL4L 1QLRA 5GRVK 4PS4L 2ADIA 3HB3D 1YQVL 4BSVB 1JV5A 1H3VA 1AGFA 5DJCA 3W39B 3EBAA 4HIXL 4LGSB 3DVNA 4GG8B 1F42A 3TT3H 4KRMB 1N0XL 4FQJH 1EXUA 4WW2A 4X6CF 4D2NA 4MNQE 3W9DB 4DFIA 4I5BB 3DJ9A 5LAXA 4FFYL 5ELIA 3RI5K 1AQDA 3OKMA 3IJHA 2FIKB 2ADFH 3T0EA 2OI9C 1IAMA 3VFRA 2R0LH 1YEFL 1V7NL 1D5IH 2VZTA 3G04B 1WZLA 3EO0B 3MRDA 5IFAL 1SJHA 4PV9B 4FQLH 4HS8L 4DOHB 1KENL 4BZYA 3IDUA 3QUZA 3QUMA 4E41A 4QO1A 1NDGB 1BHGA 3WXVH 5JO5A 4YFLI 3NA9H 1U93B 3R1GH 1CL7H 1S5IH 2DLGA 1YEGH 1RFDH 2HT4C 4AH2A 4JAMA 5IESL 1XIWD 2ZP0T 3I3DA 5ALCH 5JR1L 4ZDHB 1XH3A 4U1SB 5JLZA 4LCCB 1P4IH 3CDGB 1NGWA 1T7VA 2BHUA 4FP8H 5TDOA 3TA3C 2DQFB 1HYSD 3K4AA 5J13B 1AIFB 3BZ4B 3F6LA 5HHVH 3QDAA 1H15B 3GJFK 1RUAH 4Z7WF 1JPTH 3CMGA 3OQ3B 2EYRB 4U1MA 3TNMA 4AENA 1LE5B 3H9SD 4WU7A 1FZKA 1QFWH 2V9QA 1P7QD 4ZSOB 3FO1A 3P9LB 1QRNB 2H9GB 1PZUB 5FYJD 2AXGA 5F7WC 1FFNB 5I1DB 5I8OH