4LF3B

Inhibitory mechanism of an allosteric antibody targeting the glucagon receptor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
231
structure length
231
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVMWYDGSNKDYVDSVKGRFTISRDNSKNTLYLQMNRLRAEDTAVYYCAREKDHYDILTGYNYYYGLDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab heavy chain
publication title Inhibitory mechanism of an allosteric antibody targeting the glucagon receptor.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 231
sequence length 231
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lf3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lf3B01
1P9MA 1AKJA 1JNJA 1AR1D 3DX6B 4HT1L 5EBGA 5MEOA 2DKUA 1BQLH 1UCBH 2OL3A 2UZIL 4PJ8A 1EO8H 2MQ3A 4P2QA 5JW5B 3WKMH 3FB6A 2AAVA 2CRYA 1SJVA 2VDQH 5FYJL 1T03L 3TV3H 3RAJL 3V4VL 1F45A 3QFJA 3KYAA 4HBQA 3CXDH 5FDWA 5CD5D 1WZ1L 3HI5L 5IR1A 1D5IH 1PEZA 3OZ9L 4P4RB 3VXSE 1KV3A 2Z31D 3DIFB 3X12B 4BZYA 4FZ8L 3QRGH 2RFXB 1DZBA 3MXWH 3VJ6B 3AFLA 4QHLB 4O2CA 5HHNB 3O3AB 1EUTA 3PP3H 1UVQB 3A67H 1M7IB 3LMJL 4PRIB 1KJMB 2UVFA 1WUNT 4R96A 5DMIL 1NGXA 4KK9D 4FFZL 2FNBA 3JWOL 5GRYA 3RP1A 3RY6A 3QUYA 3DYOA 1RUMH 1KLUB 4JPVL 3NCMA 1KENH 3RPIA 3DTXB 1QSFE 4YHML 1S7VA 4OCWH 1OGAA 5ACZB 1FE8L 2YD9A 2X9XA 4QHNB 2X4OA 2X7LB 1WSST 4PBVC 4I3SH 4MDIB 3BAEH 15C8H 5FYKE 1DL7H 2WWKT 3RBSA 5B8CC 1RK1B 4CJ0A 1G9NH 1FORH 4DVBA 5DJ6B 1EHNA 1K2DB 5DEGB 2QV2A 3LY6A 2YPKB 5MEPA 2C1OB 2I5YL 3MGOB 2CO6B 5A40E 1S78C 1IEHA 2ATKB 5DR5H 1IRAY 1OP3H 3VW3H 5C0IB 5DTFA 1YDPB 2VXTH 1DEDA 3BN9D 4NQCE 1WTGT 3OX8A 4S11A 3EFDL 4KRPB 1VFAA 3UBXA 1IT9L 1XF2A 4JFXB 3VMPA 3VXQA 4OBSA 3DSFL 4ZAKB 1JPFB 2XYCA 2YD6A 5ENWB 2AV7B 3E0GA 1CIUA 1I1FA 2G2RA 1MLBB 5IW6B 3ARPA 1F11B 1I75A 1DBBH 4KHXL 3MC0A 4LLMB 2VZ3A 1RURL 4PJ7E 1UB5B 3MRDB 2VXQL 5K9JH 1KEGL 1XAUA 1J1XH 4JFPA 1QHPA 1UENA 3QPQD 1I7TA 2J8UA 4LRIC 3KPOA 2HTLC 4M7LL 1YMHA 1KJ2B 1EHAA 1ZVSB 4KJYA 2ICES 4M9PA 4R97B 1GC1C 1UKTA 1XR9B 2MFNA 3V4PL 4LMQE 1JGLH 1A1OA 2O5XL 4CMHC 4NNYB 4LU5L 4I4WA 1DANT 2XTJC 4O00A 1I1AA 4CN1A 2BNQB 2YC1B 2OTPA 3EOBB 5BXFA 1QYGL 2IBZY 4HUMB 3U4EA 4IDJH 1QBML 4OF6A 5HI4D 4R3SA 4HPYL 3ZDYF 5I8CB 1OGTA 4PJCB 3OL2A 4YDVB 2XZQH 2VH5H 1ZWIB 4MAYC 4WUUE 1LEKA 3RGVC 1MIEL 2BC4B 4IIQA 1EFXD 4PLOB 5E8NA 3REVA 3LKQB 2FBOJ 2XN9A 5GISH 4DGYH 1YEIL 3THML 3BESR 3WXVH 3ARWA 4JRYD 5C07E 3UBXG 4U6YA 3KLHD 3C6LA 5GS0C 3WO4C 1EEYA 3G5YA 3QCVL 5C0DB 3O3UN 1LEIB 3UTQB 1CZ8L 2APFA 1FG9C 1R5IB 4WENB 4XCYB 3J8F7 3ARSA 2GJJA 3GNMH 4F8TA 5F8QC 3HG1B 3S4SA 2AXGA 4FQIL 1T0MA 3L3DB 1G7JA 1MHHA 5C2BH 1CN4A 4I0PD 4HIJB 1BBDH 3CLFH 5D1QD 2DKMA 2X2YA 4X4ZA 2DJSA 4KHTH 3DX9A 5TFSL 3SGEH 4NQXA 1F8TH 1YY8B 2RQ8A 1CG9B 2XPGA 3QUXB 4PJGA 4U1LB 2I60H 4WFFE 4PRHD 5E99L 3TT1H 3MBEA 4IOSD 4RFNB 1U2CA 3NH7H 5CUSH 2NY2C 2GK0B 2XWBB 3DETC 3I84A 3FCTA 3PG2A 4PG2A 5F88B 5B3JF 5BVJA 2VABB 4JN2B 5E4EC 1A0QL 3S37H 3NPSC 3MV7D 4GMSL 3SCMB 2XA8L 5KZCB 2XNAA 1I3VA 4P5TD 4TNWF 3TCXA 3L3GA 5LGHH 2BOCA 1FG2B 4HWBH 4HKXA 4QRQA 4QY8B 4EJ1C 3PHSA 4DAGH 3ARGB 1NH6A 1G7PB 3BT2L 4S1SL 5DD0L 5D6CA 1OF2A 3VFTA 2A6IB 5EZIH 4ELKA 3D25B 3TO2A 2J8OA 3ZHDA 4OV5A 5J13B 3U1SH 5E00A 4ZXBD 3BKMH 1UJ3B 5J56B 3BP5A 5J3HD 1KN2H 2D03H 4NCC1 4OD2B 4RDQG 2VLLA 3INUL 2H32A 5HGBA 4C59B 3QH3A 3BPNB 3OJDB 1V3LA 2CUHA 1MJ7L 4UIKH 2LAGB 2RCSH 4PRPD 3S4SG 1B0RB 2Z35B 2VDRL 3OPZL 3BRDA 1NFIB 4TRPL 4N0FB 2E27H 2R69H 4P9HC 3KPLB 1KPRA 4R6UA 2HJFB 5EUOA 4RQQA 5FM4A 2ARWA 1DBAL 3I9GH 3DUHA 4NO0A 2YN3A 1GIGL 3T3MF 4B7IA 1KCSH 2DQGL 3QDMA 1DFBH 1KFAH 1E28B 4GQPH 2VDKL 4U7SA 2WBJC 5BO1H 3F5WB 4UILL 1N0XH 2P24B 5EOTB 4MCYA 1P7KB 4QRTA 3ALXA 2Z8VC 5EBMA 1RZ7H 1LQSR 1A6ZB 1PG7X 2G5BB 1AO7A 3S36X 3OR7B 1FQ9C 2M1KA 4JO4H 3F8UB 2E9JA 3RFZC 3SKNB 2R4SH 5IG7A 5GGVH 2XQBL 4U31A 4YHNA 2R1WA 3CFDA 2EXYD 1JF1A 2UVEA 3KPSA 3L7FA 3NIDF 1ADQH 4R26H 4YDIL 4YZFE 5DGRA 4YPGB 5D9SB 1JPSH 1RZFH 4JO1H 5J11B 4UTAH 1G6RA 3SO5A 4HF5L 2R56L 4FQ2L 4W70A 1CYGA 5T3ZE 5EUOF 2OJZL 3D2UD 4EI6A 1UA6L 2BOBB 3OSKA 3VXPA 3QI9A 3SDCD 5E2TL 1A14L 5C0GA 1JI2A 2FECI 1CTNA 2EDDA 1T3FB 3OXRA 1RZGB 4Q6IA 3LB6D 1X5FA 5D7JD 5KSUB 1BJ1H 4H0HB 3WFBH 3NOIA 2VXUH 2R1XA 3OKDB 3QXWA 3JWDH 2EH7H 1CS6A 2EZ0C 3PWLA 5GRVK 3HE7A 3E8UH 2VAAB 1A7PH 5C6WH 2Z31B 3EFFA 2FX7L 5IESL 3O2VL 5HJ3B 5IB2A 1WFTA 3C2AH 4G6AC 5F71A 5IQ9B 3Q6GH 1MRDL 5FGRA 4NM4H 3TBWA 5I8EB 1J0IA 5JR1H 5CBEA 1IC5L 5FHBL 3OV6A 3PGFL 1OSPL 4DKEH 4KUCD 3O6LL 4WV1A 1S7QB 5MERB 1HWHB 1IQWL 1J8HE 4ODUB 4QRUB 5E9DE 3DO7A 1FL6B 3T65A 1TPXB 3G6AB 3C9NA 1A7OH 4NHCL 1WBXB 5B22A 3FHQA 5F7DB 5HYJD 2ENSA 4ODWB 2GFBB 7FABH 1DEEB 4H8WH 4LCWD 4QHUB 3UJTH 4Y4KA 2PYEE 3C8HA 5ANMB 5D7SL 4OCYH 4L8CB 1G6VK 5CS7A 1HOCA 4NPYA 3H3PL 4GW1A 4MNGE 3ZKXC 3VFMB 1PAMA 3OKNA 1IGMH 4X4XA 4RWHA 4I3RH 4MX7B 1ZMYA 5IWLA 2R2CA 4W6XB 5GSRA 1FVDB 1A21A 4NRZB 4FXGB 5KVDL 4IRJA 3M1BA 4LPUA 4D3CL 5FFLA 4E9LA 4OFKA 4Y2DC 3HR6A 2AJVH 3RL1B 4WHDA 1Q9KB 4PIRF 2X1PA 3RUGF 5IHZB 3ARYA 3TLRA 2ERJB 1A22B 4HJGA 3GK8H 4FQLL 5FM5O 5I1IL 5IF0B 4NZRH 4YBLB 3RIAF 2FH8A 3JV4B 2AJUL 1U58A 1TZIB 5EO0A 4JPIA 5TDPB 4Q9CA 3HRPA 1YQVL 3BZ4B 2CJUL 2BMKA 3VFWB 1WBYA 4MB4A 5IK3A 1VGEL 1T89C 5IMMA 5DGQA 4PRNA 1RUPH 3KPTA 1KUMA 4M48H 5FB8B 1EUUA 5JW3L 1CGTA 2G75B 4PV9B 1INDL 1AGEA 5MP6L 1VPOL 4KKAC 2OI9B 3IXAB 4EXPX 3WS6C 5I2IB 1HNFA 5JXAL 2FDBP 1QPPA 3AC0A 4R90H 2WSKA 3SKMB 1BFOB 2EDHA 1WFOA 2XZCL 4AK1A 2D7PA 2AGJL 3PWPD 4WHCA 3ZKMC 3TIEA 1UACL 3VCLB 5CZVH 1HI6A 2ADJA 2DOCA 3LKNB 4XPTH 5C0AE 3GSRA 2YKLH 4NHUA 4P49A 1UXSA 3U7AA 1KSRA 5FCUL 2YXMA 3KPRA 1A5FH 2MWCA 3VGFA 1GGIH 1CDCA 4MB5A 5CILH 1ND0A 1YEFH 2WWKO 3UJJH 3DURB 1JI1A 5TQ0H 3O2WH 1YUHB 2IAMA 3IDNB 5DQ9A 4BYHA 5CINL 4L8SB 3AROA 1FFOB 3K2UH 1NGQL 5DRWB 1IGJA 3OWEA 2CLRB 2V5YA 3CFJA 3KHOA 4M43H 5C3LD 3HI6L 5GSVA 5F7EH 3NCYS 1E4JA 4DN4H 3MMEA 1OAKH 4N0UE 4WFHD 2Y7QB 4DN3L 1R3KA 1S78D 3DMMA 1IGTB 1H3PL 2YRZA 5EZLA 1EJOH 1D6VL 1JL8A 2UWEB 3ZE2E 3LRSA 4LSRH 5CEYA 1DSFL 4I0PB 1F2QA 1TCRA 3IKKA 4V1DD 5IW1A 4KH2A 1A6TA 4JFQA 5D1QB 1R3IL 2H1PL 3ZTJH 3EYVB 1RIVH 5SV4A 1EZVY 1MCDA 5BS0A 4YHKL 2P8MB 3IRPX 5DJXA 3WFCL 4PRHB 3BD4A 4AQ1B 4PV8A 1YMME 3MRPA 3HR5B 4UNVA 5KANG 2ICWJ 1VB9A 2OP4L 4OZHA 4RZCB 3PDOA 4L29B 4PJ5D 4DGIH 4JY4A 5IB4A 3L95A 3MV7B 1YJDH 3PGCB 4P5TB 3VFNA 2HTLD 5C7XL 5SWQA 5C0RL 4ELMB 4XP9L 3R0MA 3GUTB 4U6HB 2WIMA 4GAJL 3K4DA 1UKQA 2HP4A 3QA3A 3RZCC 3QISA 3QQ9C 3FTGA 1JWSB 3VMNA 2A83A 2FJHA 3TZVA 2F5BL 4HS3A 1FNEB 2H9GB 2XTJD 5JIPA 4P48A 1GHFL 3EGSB 2DWDB 2P44B 5L9DH 4ZXBB 3F6IA 5KS9B 3BFOA 4DQOL 1J12A 1JZ4A 3VXSA 1UYWL 2ZG1A 4MA1B 4M5ZH 1A6PA 4JFOB 4LASL 3CLEH 5DUMH 2A6JB 2DQIL 4YXHL 1C5BH 3LN4B 5DK0A 4MAYD 4Z76B 1IAIM 3RGVD 5GGTA 2FB4H 5EU3B 4OCRH 3T2NL 4RAHA 1DUYB 5F1NB 1V5JA 4JFEE 3N85L 5E2VH 2R2BB 1LO2H 3NCBB 4OD3L 4YDJB 4ISVB 1QTYT 4G8FA 5GS0D 1NKOA 3TJEL 5DHVB 2KZ1B 5HDQL 1ZT4A 2GQHA 1WWWX 3MO1B 4I2XB 4M62L 4E41B 3C09C 1Z3GH 2OL3L 1QSFA 2VLKA 2B5IC 4KVCL 2EIBA 2J6EH 1ZT7A 4HLJA 4Y4HC 3SE8H 5F1KC 5GPRA 4ETYA 2CRIA 3K46A 4QGYA 1CFQA 4BSJA 5KSAA 4GAGH 4KTEL 5IGXH 3SQOH 1LE9A 3I2CL 4HH9A 4G6ML 1DE4A 1N6QH 3S35H 1IBGH 4R7DA 3WV0A 4YR6A 2VKXA 3PL6A 5MEQB 4HH8A 5FCSH 1I1RA 1FFQA 4JJ5A 2NY2D 1MREL 1XGYH 3DETD 1MAMH 4BFEA 3Q1SL 1QRND 1L7IH 3OAYH 4YHZL 3GFUA 4FQHB 1FZJA 3FQWB 1FH5H 2GJ6D 5LCVL 1GSMA 5D7LE 4NQCA 3D2UB 2EKSA 1BD2D 4GAYA 5LXGL 1R5VB 4AL8L 4OFPA 4WJ5A 3SDCB 3MODL 4JM2F 1U8QA 5C09E 1F4HA 5A1AA 1OAZL 5D7JB 1QKZL 3LDBB 1ZLUK 4PJ7A 3AMLA 1KJ3L 5MI0B 3U9PH 3HC0A 3GM0A 3FQTA 5KOVC 4P3WA 4XRCB 3T4AA 4I13B 5DWUH 5IMLB 3BP6B 2FHBA 3MSPA 4LLUA 4OLYL 2VISA 2YHGA 3O4OB 5HD8C 2WNGA 1W0YT 5DVLA 4D9RD 1MFDL 4RAVA 4EBQH 1CU4H 5E8EA 5AAWA 4U1SB 4NZTH 2D0FA 3ARTA 1X6NA 2A6KA 3D85A 2H8PB 3G08A 2WBJD 3LN5B 3QI9D 4KY1H 5C92A 1U8MB 5GGQL 3BVNB 4DFIA 4JZJC 5HYJB 3IKCA 5D93C 1JYVA 4WUUA 3BSZH 4LCWB 1WWCA 4Q7DA 3HKFA 4QOKD 4X8XA 1N59B 4DGVH 3OB0H 4YX2H 2AXHA 2QSQA 3C5ZC 2GAZA 2UZIH 4PJEB 5I1DB 4K94C 4PJ7F 3OQ3B 4MD0B 5C07A 3W0WA 4BSWB 4DOHE 1QD0A 1OM3H 3TBSA 2QL1A 3V4VH 3LEVH 3MV8E 3P9MA 5HPOA 4HGKC 3GKWH 1A1NB 3QIUA 1QEWA 4I8DA 5I6XC 3MRMA 3ZYOA 1HYRC 5K9KB 3CIQA 2AABH 1TVBA 3D18B 1Z0MA 2NY4C 4K23L 2EIEA 2NXYC 1C7TA 2Q1EA 3WXWH 1TQBC 3SKOB 2RJMA 4ODXA 5EU5A 2QQNL 4XB8A 4Y1AE 2KUTA 2D7TH 2EDYA 1RUKL 4NKDA 1KJ2H 2HWZL 1ACYL 2EIZA 3G04B 2FO4B 5DVOA 2NW2A 4KUZH 2ENYA 3DRQB 3KYOA 3MREB 1MIML 2EZ0D 32C2A 5FKPA 4X99A 3C8KA 3JWOH 5BOZG 4K7PH 4XVJH 4OZFG 3GMPA 2IJ0C 4H5SB 5F44A 35C8H 3WNLA 3SY0B 3EBAA 5FM8A 4G6AD 1MUJA 2HFEA 4G42B 1JNLH 4JVPA 4OUUB 3SGJC 2AJ3A 2GCYB 3EYQC 4ONGL 3TO4A 3UYRH 1PFCA 1V7MH 3BPCA 5CSGA 2NY7H 2C26A 4UT9H 4WI6A 3W5NA 4YGVB 1GC1L 4FABL 1NBZA 4HEME 1ED3A 2OZ4L 4KMTH 2GEEA 4RNRA 3VH8B 1S3KL 4X6CB 4NRXB 1WLHA 1IKFH 5JOFB 5DMKA 3PWPB 3WS3A 2YPVH 3MOBH 3FO9B 1U8PB 4JFZL 1ZLWK 1A6WL 5C71A 4GXUM 2P5WE 3TEUA 5IJKA 3MLXH 5CD3B 4XCEB 1HHJB 3GJEB 3KJ6L 4Z7WB 1SQ2N 1X6LA 3SBWA 4DWHA 3VRIA 5IROA 5B8CB 1JVKA 5DHYA 3KR3H 5ID0A 3DSFH 4M61A 1BEYH 1G7HA 3VXTA 1KJVB 4G6FD 1A3LH 1J05B 4LHQB 3RNKA 1S7XB 1TITA 5GRWA 4JJHA 4EI5A 4M7ZC 1MCOL 1RURH 2ZJSH 4GKZB 1DQLH 5JXEC 4KDTA 2YD5A 3BH9B 3QUMB 2WIIA 1A4KB 4NN5C 4V1DB 5C0BE 5BJTB 4LSTH 4L8DB 4I5BB 5E5MA 1B6DA 2XKSA 4YIQA 3ZKSD 2ZCHL 4NUGL 3X13B 3ULVH 1OY3B 2NW3B 1FZKB 4RIRB 4ZQKB 5JOPD 4H1LH 1HH9B 3KPRD 1NLBH 5SX4I 3LEYH 4C57C 3QEQB 1AXTH 1S9VA 3I6LD 3IJHB 4PTUB 1E6OH 2BRRH 3F7QA 4WHYG 5EO9A 2DQFA 4HPYH 4PJ5B 4WCYH 4MNQD 4ODVL 2PCPB 3A0OA 4Q0XH 4J2XA 1P2CB 4FQ1L 5CFHA 3P0GB 3EYFA 3WJJA 4KKAD 3I6KB 1NMBH 4WW2A 5KVMC 4PJFB 4NO3A 3JTTB 1XZ0B 3QWRD 4DKFL 4HSQA 4CMHB 3KYKH 5HHOB 1T22A 2XTJB 1ZSDA 1BGXL 3K2MC 1KELH 2A77L 1J0KA 5DSCA 3L3JA 1CR9L 5B21A 3VD9A 3HI1B 1FL3A 4WWKA 3LIZH 3MLSL 4FQIH 3MV9E 5JMOC 1WFUA 4HUWB 4JZOB 4MAYB 1CGUA 5DZOA 3QEHA 3RGVB 1CQKA 5C8JB 3PWNB 5IP4A 2YZ8A 4WO4C 4QXUH 4YZFF 4HZAA 4IOIB 4QHKI 1MHCB 4P9HL 1EXUA 2VWEE 2OQJA 5FOBA 1YN6B 4WI9A 3HZYA 3QZWB 1G6RL 1J8HA 4JANA 5BRZD 3R8BB 1EBPA 3GGWB 3WO4B 5E9DA 3QDJE 1B0WA 1F6AA 4UT6H 1MHEB 4JG0H 4WEMB 4QF1B 1PSKH 4U7MA 2IAND 1OTUC 2OMNA 3GMQB 5IB3A 3EYOA 4DZBB 1I8KB 1YEDB 2YPLE 4KPHH 2BDNL 1AGBB 3B9AA 3K81A 1OAXL 1NCBH 2PYEA 3MJ9A 1IM9A 4PJXB 5GXBB 3MNWA 3JUZA 1G7QA 1LO3H 1A7NH 4LAQL 4ONHB 5TPWL 4PB9L 2ZKHH 2B1HH 3DROB 2IC2A 3D0VB 3WE6A 1N7MH 5DD0H 5FHAL 4NUJB 3CXHK 2EDWA 4W6YB 5DDHA 2G9HA 3U30C 3PQYD 4XCFH 1P4BL 2NY2B 5I1LA 2O5YH 2FJFA 4NC2B 4U3CA 5DD1H 3FMGH 4KKNA 5EB9A 5I8KH 3RI5K 5E4EB 1QRNB 4NBYB 2VN7A 1OQXA 2VRAA 3NPSB 3SDXE 3INUH 2EDNA 3IDXH 3O6FA 2BSRB 3W39B 4R9HA 5T3XD 1RZJH 2GJ6B 1A7QH 3OPZH 3ARXA 3QPXL 4XVUC 2Y07L 1BD2B 3RZCD 3HZVA 3BP4B 3ESUF 2VLKD 4Y5YA 2EDXA 4OD1L 3HZKA 1G9EA 5J6HB 3ES6B 1QQDA 3G6DL 3X3FL 1VEPA 4CU6A 2DIBA 4GSDH 1MAKA 3B9KC 2P7TA 5E24E 1OLZA 1DBAH 1HXMB 2DQEH 4MD4A 3H7BA 3I6GB 3HCVB 5T1KD 4MZ2A 2VITB 3L6FB 1CD1B 5SWSE 1T0NB 4NBZB 5TE7L 4HUUB 3NZ8A 3K1KC 3OB8A 5DRXB 4UILH 1T04B 3SJVE 4CGTA 3QXAB 5HY9B 1I9RL 3G6JF 1CVRA 3FOMB 1FRGH 4PY7B 4NQED 4I0KA 2DLEA 5C9JB 5A16A 4AEHL 3MRFA 4OLUL 5C0AA 1Y6MR 3R8QA 1GPOL 4CL7A 2FHCA 3PWUA 4U33A 3UAJC 3KVQA 2WBJB 1JRHL 1UQSB 5IMKB 4Y4HD 4X6DA 5C9KA 2IBGA 2R56H 3MJ7B 2VB5A 4QOKB 1DQDL 1QFWH 2VXSH 4XWOC 1CFSB 4TSAL 3JXAA 1T21A 3VE0A 5DT1H 1I1YA 3MRJA 3WEXB 1P6AB 5ILTL 1KPVB 5IFHH 2VZUA 4KKBC 1JGUH 2AK4B 1Y6NR 4N0UA 1WF5A 1S7TB 1OL0A 2AW2A 2A9ML 2XWJA 2MKLC 1IAOA 2VE6B 1EPFA 3JV0A 3AVEA 4B41A 1UZ8A 1AFVH 4BZ2L 1A6VH 2VQUA 3MUHL 4PP1C 2BNUB 1K8DA 1J8KA 3QAZC 4XI5C 3GJFK 5KSVA 3UBXI 1CDHA 4ZTPH 3VDAA 4Z7VB 4XNQB 1YMMA 1JGDA 2MQCA 5EPMB 3EW3B 4U6XA 4XP5H 3V0AC 5C0EB 4F7MA 1MHPH 2HFFB 5C07D 2L7UA 3W0WD 3TN0A 5DRZA 2APTA 1RPQA 2CLVA 2HN7B 1HEZB 1RMFH 3NFNA 4DKAA 1HSBB 1RK0B 2DDQH 5HD8D 4F9PA 3QIUD 3X14A 4LPTA 2QADC 5D5MF 3H7LA 3B6SB 5DEFB 3RVUD 4LGSB 4R8WL 1TVHB 2R0WL 3I75B 4OJFL 3NGBC 4NFDA 3ZE2F 2C9AA 3C5JA 3H3PH 4GMTH 5K33A 4WGVB 1KIPA 4P2OA 3HNSL 2EDQA 4K3EL 4BM7A 3FFDA 2F9BT 2HJLB 2R15A 4LIQE 2ED9A 3D39B 1CLYH 3H9HA 4F7PB 4WFFD 2E6PA 2P8LB 3O3EA 1SEBA 4ZO7A 1T20A 1NKRA 5TH2A 2YWYA 3QCUL 4LSVL 4JFEA 3C5ZD 1ORSA 4L3ED 4X6EB 5T1LA 1MWAA 4TSBH 1QBAA 3EOYG 4XCNA 4Z7UA 4KTDL 1AP2B 4MXVE 3K0WA 4JKMA 3VWJC 1NCAL 5E8DL 3RWDB 1KPUB 2NY5C 3VXUE 3VG0H 4P99A 4TYUA 3ZKXB 5H37G 5I16A 3I02A 4XB7A 1UZ6E 2AJUH 2JKXA 4G6FB 5AUMA 4Y8AA 5E8OA 4JQIH 2DBLL 1D5ZA 1MFBL 1YQVH 2DYPA 2NTFA 5HHVH 4ZYKB 5IBTH 1VFBA 5D2NE 4XP6H 1H15A 2VDNH 3CFBB 5JHDE 2NY4D 4H88L 4Z77A 4O5LL 2NXYD 1EFQA 4HBCH 4Y2DB 2ZSVA 1T1WB 1RZIA 1Z0NA 4XC1H 3FT4B 3PE9A 1VHPA 5FA3B 4X98A 4KI5E 4PGEA 4RA3A 5L2JA 1YN7B 4Y16C 1A3RL 4PJDE 2EE2A 2BVPB 1CFTA 1L0XA 3PP4L 5JXAH 4HDIB 4XP1L 3U0WL 4FQCH 5CGTA 4HFUH 2B4CL 4HUXB 5AZEH 3DVNB 3BWAB 3G5XA 4JFHE 3G5VA 5GGTL 4FQPA 4G7VH 1CLOL 3T09A 5HHQB 2V2XB 2Q7YB 1KYOK 4I48B 1QBLL 4PJ9C 4LEOB 5HYQA 4ESKA 1Q72H 4MNQB 4O51A 4J1UB 3F7VA 5D7LA 1LDPL 2B0SH 3FT2A 3ARFC 3EYQD 3BZFB 3QNXB 1NC4B 1EVTC 2F58H 3TH2T 2JJSA 2JB5H 5DS8A 4YGAB 1A64A 2FJGA 4EI5D 2ZCLL 5DZNA 1HQRA 5GIRA 5C09A 2A74A 3DBXB 2NX5A 1RQ5A 1RV6X 5FO7B 3GB7B 5C6TL 2B39A 2JE8A 4P4KA 2MNUA 2C7UB 4ZUUA 3B8SA 2CRMA 2FBJL 4TTDC 5DHVH 5I1AA 5FYKL 2R29L 3QFDA 1ZTXH 2GSGA 3MV01 4M1DH 4D9QD 1YPZF 4YNYB 2GITB 4KK6C 1T0PB 5EDXA 5EZOL 1FNHA 1F4YH 4R4BB 4HUNB 1LEGB 3DV6B 4UU9B 4PJIE 1L7TH 4Z0XB 2PYFA 1HHHB 4L5FL 5IB5A 3OF6A 2GY5A 2I9LA 1DANU 4Q9BA 4U6VL 5IVZA 1YEHH 5HYIA 3FO1B 3Q6FB 2JK5A 5DC9B 3MACL 3RU8L 1CE6B 1DTUA 1H5BB 5K93A 3U36B 4LLDA 5BRZB 5I30L 3Q5YA 1T5WB 4ZD3H 4LHUA 2IANB 3QHTC 5ESVB 3DXAD 4PR5A 5JXED 1FLTX 5ICXA 4BSVB 5INCA 3VD7A 1QLEL 1GGCL 4GG8A 3VA6A 1HHIB 5FUZL 4RA0C 2N7BA 5E94B 4WU7A 3RA7H 4ZNCD 4QXWA 1KG0A 1NGYB 2CXGA 5C0JB 1YNLL 1A2YB 2BVOB 3MV8A 2F5BH 1QBBA 1BWWA 4G8IB 4J4PA 1RIUL 3PQYB 2FLRT 2R1YA 1FCCA 4P2RE 1V7NL 2JCCB 4OQTH 3S3PA 2XWTB 5BMFL 1P5VA 4DQOH 1HXYA 1QPXA 5E8PA 1S9WB 4XVTL 4HKJA 4MLSA 5LBSL 2EYRA 4FNLL 4M6MH 2DQIH 4OM1H 4LRNL 3HRZA 4XBGB 1HN1A 5TDOB 5E9DD 4O02L 4Y1AA 4FFYL 1AD9A 1F3JA 2OS7A 4XMPL 4XNYL 3RZCB 3QQ4B 1FSKC 4LSUH 5J06A 2PN5A 1RSFA 4U3XA 1X5ZA 5I76A 4X7TB 3RJQB 4QRPB 2PYED 2J5LC 5EWIL 4U7KA 2AEPH 5T1KB 5HGAA 1E27A 3U2SA 3NN8A 4HWNA 1AJ7H 2A1WL 2VLMD 3MUGB 2B20A 4ODSL 2FYYA 1T6WA 2Q8AL 4HK0B 4KQ3L 3B43A 4X8JB 2IQAA 4S2SA 3QNYA 5T1MB 1S9YB 2ZNWA 3OR6A 5ETUB 4WO4D 1CBVH 1DQQA 25C8L 2N56A 4LFHD 5HPMB 3IFPB 3UTZB 1FN4A 5LGKA 4MDJA 5DJYB 3HZMA 1I8MA 3RDTA 3B2UD 4ZUVA 5I74C 1XGQA 4NQEB 2WV3A 5KSBA 4DK3A 4X9GA 4L4TE 3TIDA 2HMIC 3MUZ1 1OTUD 3C09B 2PO6C 1GZQB 2B5IB 5AWNH 4XNXL 1OP9A 1P53A 2IH1A 4R4NC 1IEAB 1PYWA 4Y4HB 3N1PC 3CVIH 2AJYH 4DZ8A 3V52H 4D0CB 3WJLA 3FRUA 4NN7C 4NO2A 4O4YH 1Z5LA 1Q1JL 2BNQE 4XGZB 3OXSA 4M8VA 3UZQA 4HG4J 5B39A 2GKIA 3VFRA 1T66C 4YEFA 4LQFH 4OZ4B 2YXFA 2DQHL 5LWYL 1QNZL 3ORJA 3MODH 12E8H 1F3DJ 1KN4L 3TBYA 5IM7B 4HWBA 1WVZA 4L4VD 1OOAA 2H6PA 2CDFB 3OTTA 4BQ9A 1OAQH 4LCIL 1DN0B 1M05A 1JHLL 5EFIB 1OARH 2OR9L 3G9AB 3M07A 4PS4H 4PJAB 5CKAA 2YZ1A 3QEUB 2QTEA 1OWWA 4XVUD 3S5LA 2VL5A 3SDYH 1CGWA 3ARRA 3TCLB 3ZKQD 4DK6A 5HI3C 4E5XA 2R2HB 3HG1E 4EDWL 3B9KD 3QCTL 4NKMA 1C8PA 1YC8A 4FRWA 3R1GH 3QIBC 4PD4J 1WICA 4RAUB 2I9TA 4HJJH 5C0CD 4NC0B 5IEKB 2VN4A 3S8WA 3FQUB 3QG7H 1EAPA 4L8BB 1HHKB 4HZLB 1HCVA 4XPFH 4LBEA 5GGQH 4OIAA 3R0NA 1T80A 3CSYA 1ETZB 5JDJA 1YYLL 1C7SA 1KT2A 3V2AR 1A9BA 4D9LL 4ZOEA 3MUY1 4ZO6A 3MRCB 3O3BA 4NT6B 4F33B 3RIFK 2C3VA 2ZUWA 5DYOB 1TJIL 1TMCB 2XRAH 1F90H 4F7EB 4A2LA 2E6JA 4PJHB 5B39G 3VWKC 5JUEL 1P7HL 2ADIB 1MJUH 3LS5L 2ITCB 4U0RC 4XWGL 5D2LF 1FDLH 4KKCC 2P48B 5KANI 3P11H 3SDAA 5J7CC 5ALCL 4WW1A 1BAFH 1JE6A 3WL9A 3UAJD 4Z78B 3UCRA 5BW7A 1Q9OA 1D5BB 1UFUA 3MV9A 4JZJB 3S96B 4ODTH 1LK2B 3GSXA 4K9EL 4MCZB 1ADQA 1A7BA 4K23H 3KYMA 5FGCB 5ISZD 1I7UB 3QUMH 3MYJA 1IEBB 3C5ZB 5FKAB 4L3EB 4XWOD 5DVNA 3ZYJA 2LFGA 3TN0D 2QLVB 3QIWC 4CVXB 1ACYH 4FZEH 3QDJA 2A6DA 3EYUL 4CADA 2RAMA 3EO0A 1HKLL 4KKBD 5T3ZL 1FFPA 1XCTA 1UM6H 3UP1A 3L5XL 4PGJA 1MFNA 3T0XA 3GHBH 4P23A 1CL7I 2YPLA 4RFOL 4H8WC 1WCQA 2NY4B 3EHBC 2NXYB 1INQA 2ICWA 1R5WB 3VXNB 1TQBB 4QTHA 3RWEB 4ODHH 3MLTB 4PP1D 5JO5B 3LKRB 1HH6A 4JFFE 4W4OA 4AM0A 1MNUH 3CVHB 5E2UH 4XI5D 5ICZB 5ITBL 5FECB 2GT9A 2IQ9H 4TPRH 4KZEH 3IS1X 1Y6KR 3QJFB 1GC1H 4KJQC 1TQCC 1XF3B 3E1F1 3QDGA 4CDGC 2D31A 2OZ4H 4R2GC 3RRQA 4JFED 5I17A 5EN2A 4LLQA 1TJHL 1MQKL 5BCAA 1S7SB 1KTRL 3SDXA 3CX5J 1JYNA 2EE3A 4HG4K 1JPGA 1QRKA 3RVVC 4UQ3A 1D7FA 3U46B 2Y72A 3BH8B 3ZL4L 5IBUB 1JHKH 5I0DA 3U0TB 2PW2A 1WWBX 3UX9B 2QADD 4H26B 4JM2C 3KWWA 2X4SA 3P4NB 2BY0A 5F1IB 3IAQA 3F58L 1XR8A 2CPCA 5HYSB 4YHPB 5FYLD 4KVNH 3UTPE 1JMZA 3ZE0F 3BQUC 1ZHBA 1FBIL 1QLFB 1TENA 4X9IA 2IPKA 1J86A 2ZOKA 4X4YA 3QO0B 1IM3B 5CWSA 5GS0H 1KF9B 5SWSA 1HHGB 1FO0A 4OLVH 5GGRA 1K5NA 4DUWA 2Q20A 1T83A 4GFTB 4GLRI 2GTZB 3SJVA 1VERA 4QXTB 3C87A 3DV4A 2VSDA 4O2EB 5EOCH 1UXWA 4XNUL 5B38B 1OSZB 1M6OB 2VKWA 2CKBB 2UYLA 4CMMB 4BZ1L 1IAKA 4CW1A 4NUGH 4N8VB 3EZ8A 3L7EB 1NUGA 3CAFA 3SDXF 4GJTB 4M93C 2Y36L 3DX8B 1BHGA 1KC5L 1RJZA 5D7IB 3IT8D 1Q0XH 4M7ZB 4OZIB 3H3KA 2FIRT 4P3CL 4JO2H 3DXAB 3IDJA 3AXLA 2NX5D 2MHAA 5ADPH 4ODVH 4UDUA 4NN5B 1VACA 2DLGA 2OJEB 4JHAL 2ORBH 2A73A 1FGVL 1ZV5A 3MLWL 4Y16D 3N1MC 4OT1L 3PV6B 4BH8A 1IGIH 1I8IA 2OBGA 4YXKL 5D8JH 2HVJB 4Y5XA 3EO1B 4XBEH 5CGMA 4YHIB 5DVMA 4F37K 2VR5A 1LO4L 3BZEB 2BSTA 1FIGL 4W6WB 1NAKH 1BGXH 5A2JH 3IFOA 1G7MA 4K8RL 4FTVD 4MQXD 4PJ9D 5ANME 3N9GL 2DTML 4XBPA 4M4PA 4DJMA 3BPLC 3ARFD 2ZPKH 4OM0L 1KCRL 2R0ZH 2AXJA 1I7RA 4P9HH 3PDGA 5ERWA 3AREA 1RAMA 2Z4QA 4HIHA 4J3VA 4LKCA 3P77A 3MRIA 1JNHB 5CSZA 4TTDD 4Q2ZA 3KLAB 5TF0A 3QDHA 1BPVA 4KK6D 2D7QA 4OLEA 5C3TA 4C58B 3BEWA 4Z5RB 1OB1A 4NCDA 2MMXA 1P1ZA 2NY3C 4RGNC 5I66B 4EUPG 4WO4B 1XH3B 4O58L 2FSEB 4LMQI 3Q0HA 2OTUA 4Q9RH 5JZ7C 3HE6A 4XZUA 1AQKL 2Y23A 4WWID 1BOGB 4NC1E 1WC7A 4PB9H 5J6GB 4JRXD 4OLZL 2CIIB 3EOTL 3IVKA 3BEVB 2VZ1A 4L1HA 4Y1AD 4Z8FH 2HLFC 1IAIL 1HQ4B 1G9MC 1QO3A 1P4BH 3TA3C 5JNYB 3V6OC 5H35A 3MRNA 4ZDHB 1J0JA 4YBQD 5KVFL 2F15A 4IMKC 5CEXB 4PGBB 1JWUA 2FX9L 4LARH 2BXZA 3KPQB 1HDMB 2QHRH 1MRFL 1K8IB 5DJ2B 3WD5L 1MJJA 4HEPG 4GW5A 4JY6B 1QFWM 3U30B 4OCXH 2PR4H 4L4VB 1T1XA 1YEGL 5CLTA 2YMXH 3E3QC 3F65A 4PRDB 4UV4H 2VIRB 3HPLB 3GBMH 5D2NA 3MXVL 4FG6C 3U9UA 3BW9B 5JHDA 2AP2A 5DA0B 4APQA 2JF1A 2VDLL 5I73C 4Y7MA 3D48R 3AU1A 3VI3F 2JB6A 4JRYE 4PTTA 1RIHH 4P57A 3BGMB 3RWJB 2Q8BH 2YD1A 3HMWL 3ZTNL 1BP3B 1AXIB 3NACL 1BBJA 3GO1L 2YK1L 4X6FA 4M1CD 4XTRD 3W9DA 1Q9LA 4J12A 4LSPL 1CICC 5GRUL 3O8XC 1N5AA 1QFUL 4X7DC 1PZ5A 2UWEE 4WUKH 3B9KB 2YA0A 4PJBE 4ZFFA 4Y88A 3JZ7A 3LN9A 3VU2A 2JJUA 2K9UA 4LHJB 5TGBA 3CFCH 3ZTJG 1PDKA 1MF2L 5IFJA 4OLUH 1BLNB 4F2MB 1MWAL 1IL1A 2HH0H 3L5IA 4JE4B 2LTQC 4CUCA 1ZKAA 4G9FD 1BQLL 4F15C 4PRHE 1UCBL 4G8GD 4XMKH 1EO8L 2HVKA 4HC1A 4DKDC 2J6EA 3WKML 3GSWB 1SBBA 3TV3L 3T0EC 1BZ9B 3PV7A 1GCFA 3CXDL 3MV7E 5CZKA 3DX6A 3QULB 1MY5A 2HKFH 2HMID 4ELME 2DQCL 2V7NB 5JW5A 4KI5F 1LD9B 4RMQA 4R4ND 3PJSB 1TZHB 4GKSB 4LF3B 4PJDF 1FC1A 3MXWL 2GYSA 5ISZB 3OKEB 2W0LA 4MXQC 3WIFB 2XXCB 5KS9E 4MQSB 3W2DL 4P4RA 3A67L 1AGCB 3DIFA 4U49A 5IV2B 3NFPB 3X12A 4JFPB 3O0RL 5J1SC 2NY5L 1WWAX 2RFXA 4NWUH 4GS7C 5E4IA 4OIIH 4PRPE 3VJ6A 1RUML 4QHLA 5HHNA 3O3AA 5TE6H 3ILQC 1TNMA 2P46B 1UVQA 3CSBA 4OCWL 5D72H 1M7IA 3QNZB 4PRIA 2PTVA 1KJMA 4PRBB 3T8XB 1HYSC 1DJSA 15C8L 5AYUH 4EQ3A 1KLUA 3QAZB 4N9OB 1KTLB 1GGUA 3DTXA 5HI3D 1OGTB 3B2VH 3H9SD 1FORL 1I9IH 1BZQK 5ACZA 1V3MA 2R0WH 4BH7A 4QHNA 4JR9H 3QIBD 4P2RA 3O81A 2X7LA 4MDIA 2Q7NA 3QWQB 3MA9L 5IVXB 2AXFB 3VGAC 4LGPB 4PJIF 3QB7C 2ITDB 2XN9B 3MRGB 5DR5L 1ZXQA 1RK1A 2ICCA 2QSCH 3IRZA 4KJPC 3VW3L 5DJ6A 5ESQB 1K2DA 1PY4A 4QEGA 2VXTL 5DEGA 1MCJA 2COQA 4EOWH 2YPKA 2C1OA 3V6BR 3FQRA 2QADB 5EBWB 3MGOA 2V2TB 3SKJH 2AJZB 4YUEH 2ATKA 3VWKD 4HW6A 3BGFC 4J8RB 1YNKH 2K3TA 2WBWB 4CKVX 3NGBB 4KKCD 5C0IA 1YDPA 3ZE1E 1DBBL 2Z0BA 4U1KB 4Y8DC 2P4AB 5K9JL 5GS3A 3SO3C 1MFBH 4RWYH 5T5FH 1A9EB 1QSEB 4FN0A 1J1XL 1OAUH 4JFXA 3QUZC 4ZAKA 1JPFA 2HT2C 2HT3C 2YD7A 5ENWA 3QDGD 4YBHA 3T04D 1I1CA 1MLBA 2WW8A 5IW6A 2W0FB 1F11A 4LVNC 3W5MA 3TBVB 4LLMA 1Q9WB 1UB5A 3MRDA 1PG7L 3IGAB 1JGLL 4F9LA 3VWJB 4LCCC 3QIWD 2XNAB 2AI0H 2YUVA 3VD3A 4UOJA 1NEZG 1NUFA 4L4TA 1ITCA 3FT3B 3RKPA 5F9AC 1KJ2A 4IDJL 4P3DB 1ZVSA 3I50H 1XR9A 2YD2A 5F8RC 2F5AH 2HLAB 3L9RB 3SHSA 2XV6B 1QBLH 3EHBD 1U3YA 5KBNC 4NNYA 2XZQL 3TF7C 3DNKA 4P46C 2NCMA 2BNQA 2YC1A 3EOBA 4TQEH 3WNKA 4NM8H 4Y16B 3SE4C 4JKLA 4NIKB 4H0IA 3SE3C 5T3XH 2X1OA 5GISL 4DGYL 1AC0A 1NFDB 3SQBA 5I8CA 1R3HB 4KJQD 2HG5B 2X89D 4PJCA 3TBTB 3M17B 4YDVA 5HYJE 4R2GD 1ZWIA 5ESAB 3UDWC 1CQYA 1VADB 4LCWE 2BC4A 3O9WC 2V9RA 3GNML 4QNPE 3LKQA 4FTVB 4PJ9B 4J3UA 4OLXH 3RWFB 3RVVD 4PJEE 3T0BA 4X4ME 5HDBF 2APBA 3X3GH 5C2BL 3FZUD 1BBDL 3CLFL 5GGVY 3VXMD 3ARFB 4ZSOB 2XKNB 4P2YA 4DTGH 5C0DA 1LEIA 1VESA 4JM2D 3UTQA 4KHTL 1IAMA 1R5IA 4XCYA 5J12C 4QLRA 5D1XC 2HTKC 4C83B 2BNRD 3HG1A 5HHXH 4U2YA 3L3DA 3BQUD 2I60L 3HNTH 3TT3H 3VD4A 1X4YA 4HIJA 4PREB 4FQXC 3VFUB 2DI9A 1MVUB 3IAPA 2OCFD 3PNWB 4UUJA 3LKSB 3VGDA 4NKOB 3HB3C 3I3EA 2IEPA 2CO7B 3S37L 3LKPB 2I26N 1YY8A 4KMLB 1CG9A 3QUXA 4UDTB 4JY5L 2VERN 4EN3C 1OW0A 4AENB 5LGHL 2OK0H 2LAAA 3A6BH 4HWBL 2AKRB 2GK0A 1UWXH 2XWBA 5IT2H 3EDFA 2GIYA 3MJ6A 1YC7A 4XT1C 5L7XH 1I8LA 1XCQB 4N5UA 5FUZH 2FL5B 2VABA 4JN2A 5DUBB 1K4DB 3WN5C 1SY6H 3SCMA 4JRXB 1JZ6A 4GW4B 5EZIL 4KTYA 3CZFB 3QXUA 2OSLB 1N3NB 3U1SL 1FG2A 3BKML 4QY8A 1S5IH 3RWIB 2FZ3B 4MMXC 5BV7H 3ARGA 1KN2L 2D03L 1B3JA 1G7PA 1WT5C 4L9LC 2V5SA 3ZMRA 5SX5H 1T2JA 4UIKL 3ARED 2RCSL 3NTCH 4GBXC 4OFVA 2A6IA 3D25A 1FIEA 4KXZI 2E27L 4X6CE 4O02H 1UJ3A 3LV3B 2R69L 3PWPE 2RB8A 4N90D 1KXTB 4BK4A 4XMPH 2CMRL 4KMQA 3BIBX 4MAUH 4XNYH 3HLAB 4OD2A 1X5YA 5F9DC 4OGZA 3OJDA 1P4LA 5F7FA 1SHMA 3I9GL 1I85C 3HS0B 4HFWB 4GT7A 5EO1B 4ZUSB 1B0RA 2C5DC 2Z35A 4KK8D 1NFIA 4N0FA 4Z7WE 1KCSL 1DFBL 1KFAL 2HFGH 1FYTD 3EJZC 4QHMB 3KPLA 4IM8A 5BO1L 3BXNB 3HE6D 2HJFA 3LZFH 1N0XL 3ULUC 3RUGB 5GGRY 4D0DB 3NZHH 4EKXA 1RZ7L 5EC2B 1E28A 1FSKB 4JO4L 1ZAGA 1N5YH 4HK3N 1ZA3B 4TUJA 3EKCA 1CDJA 2W59A 4WFHE 2X05A 3FO2B 3BX7C 2R4SL 4IRSC 5GGVL 3F5WA 1NGWB 2GK2A 5FO9B 2P24A 5EOTA 2J5LB 5FF6B 1P7KA 5H8DA 1ADQL 5F9WC 4B0MM 4V1DE 1RZFL 1KB9J 1A6ZA 2G5BA 4UTAL 3OR7A 1FNLA 4MA3B 1RZJC 3SKNA 4JG1H 1VDGA 2E7LA 2ZOLA 4EZMA 4KDWA 4G9FB 4L3CB 2NY3D 1T4KB 4G8GB 4NZDA 4RGND 4YPGA 3DSNA 5D9SA 3T0DA 1TIUA 4K55A 4ZUWB 1A6AB 1Q1JH 1KNOB 2XQYG 5JZ7D 4OF7A 2J2ZA 4WRLA 1UGNA 4Q9QH 1FZOB 5I74B 3VMOA 1MCPH 4K94H 4M00A 4PJ5E 1CDBA 5CHNA 4AG4H 2IMMA 4MXWH 2HLFD 2VXUL 3GSVB 3JWDL 3TA3D 3E6HB 2BOBA 2PO6B 3ZSSA 3E8UL 3C6SB 1JHLH 4WI7A 4X9HA 1A7PL 1H0DB 2WQRA 1LE5A 4JAMB 1J11A 1T3FA 4PJFE 1RZGA 4OKVB 2OR9H 2EDRA 4K7FB 2YS4A 4LSDA 4PBWD 1CCZA 5KSUA 1PJ9A 3Q6GL 2XTJE 4NM4L 4NN7B 1K6QH 3OKDA 3D1MC 2IALB 5JR1L 3STBA 2MCPH 5MHSD 5DD3H 3CVHH 2VAAA 4DKEL 2Z31A 3BRFA 4M7LT 3B83A 3H9YA 3VFOB 5HJ3A 4WI4A 3P9WB 2NY6C 4PJGE 5F7UA 5IQ9A 3DJ9A 3K80A 2GY7B 4FG6D 3P4LA 1A7OL 1NCCH 5EORH 5I8EA 2YEZB 5FGBA 3FB8B 3B5HA 5KVGH 7FABL 4H8WL 3UJTL 5MERA 5L6YH 1MSPA 2XKUA 4ODUA 4QRUA 1TJGH 4AEEA 1FL6A 3B5GA 5IB1A 4OCYL 3G6AA 1WBXA 1CICD 1TJIH 3O8XD 5L2KD 5F7DA 3H9SB 3U82B 2Z9TA 4ODWA 2GFBA 4XVSH 1DEEA 2V7HB 5F9OH 4QHUA 4NJ9H 5ADOH 3QIBB 3ZT7A 1IGML 1KTDB 2LVEA 4I3RL 4PJXE 2VUYA 5EA0H 4DFHA 5ANMA 2ZSWB 1CDUA 3IFNH 1KEMH 5IHLB 4L8CA 4LAJH 4GOSA 2X4NB 1CVSC 4GRWF 2AJVL 4G6JH 3VFMA 2DMBA 3V0WH 5DMYA 1BIIB 4MX7A 1W72L 2DQDH 1JJUA 3MGAA 3GK8L 5SX4H 1WIOA 4G5ZH 2W92A 1FVDA 5D6DA 1QRNE 4FXGA 4NRZA 4PRID 3TVMC 5C2UB 1FAKT 2VQ1B 4U0RB 2CKBH 1J1OH 5TJWK 2DM3A 3RL1A 1KBGH 1Q9KA 2GJ6E 5IHZA 3FQNB 5F3HB 4YDKH 1BD2E 2H26B 2APXA 5IF0A 1NBVH 1UWEH 4RFOH 4M48L 1J9CT 3JV4A 3BWUC 1T5XB 1TZIA 5TDPA 3BZ4A 1UG9A 3ZYZA 1MCRA 4MXQD 4TVPD 3VGEA 3T2PA 3VFWA 5CEZH 4S1RH 3T1FB 4R90L 4HUVB 3F7RA 1M1SA 1F6LL 1JNNL 3K4AA 5FB8A 5ITFB 1BFSA 5E6IC 2G75A 1Q8MA 1CDYA 5I1HH 5CZVL 4PV9A 2D3VA 3ILQD 4TUKH 1D6EB 4XPTL 3IXAA 5E1AB 1YQ2A 5I2IA 4JVWA 3VFPB 5C70A 3TZVB 5BVPH 2XT1B 2I07B 2YKLL 3WCYA 4TNVF 3SKMA 4D9RE 1BFOA 1HYSD 1A5FL 1GGIL 1IKNA 2H3NB 5CILL 4XCCH 3VCLA 1MCIA 1IQDB 4K2UH 1YEFL 2ATPB 1LP9B 3UJJL 4X7CC 2YA2A 3LKNA 5TQ0L 4KRPD 2GTWB 1TQCB 3GSQB 4MJ5B 3K2UL 1AC6A 4XXCC 1G0DA 1II4E 4M43L 4R2GB 1LGVA 4UB0H 1FBIH 5EU6D 4DN4L 1OAKL 4QOKE 3Q3GB 1KCKA 8FABB 2W38A 3DURA 1XGTB 4I18C 1EJOL 1YUHA 3MLUH 3IDNA 4ENEC 4KJPD 2R9HC 4LSRL 5HBBA 4L8SA 3I85A 1U3ZA 3MJGX 1FFOA 5CMAB 5DRWA 3VDCA 3VXMB 4OGYH 3RX7A 2CLRA 3S3JA 4HJ0C 4LKXA 2AEIT 1W72B 5BQ7B 4JM2B 4QCIB 2AK4E 1RIVL 5GGSY 2Y7QA 3N06B 1IGTA 5FA4B 1EVUA 2BNRB 3KJ4C 2UWEA 3RIFF 3CMOH 4PJBA 4IOFC 3BQUB 4GG6B 3VGHA 4I0PA 4YQXH 3LQMA 5TF1H 4JRWA 3MLRH 1FL5B 4H25B 4IMLB 5D1QA 3EYVA 3L1OH 1R24B 4YWGH 5CJOL 5DQJB 1S8DB 3QUZD 4YDLC 2HT2D 2HT3D 3MLVH 1YJDL 2P8MA 4YO0B 4Z7VE 4PRHA 1B4JH 1NBYB 4JHAH 2EC8A 4NQSB 5FUCE 3HR5A 3AM8C 1EJ6A 2WLYA 4RZCA 4L29A 3CDYA 3MV7A 2GHWB 4A6YB 4S0TD 3PGCA 4P5TA 1J18A 4M93B 3O4LB 1FVEB 4ELMA 5L9DL 2R2EB 4Y5VC 1K3ZA 1ACZA 3BHBB 3GUTA 4M5ZL 3ARBC 3CLEL 3V8CA 5DUML 4X7EC 1JWSA 3TP4A 3F7YB 5DF0A 1C5BL 1FNEA 2H9GA 1MCCA 3QXDA 1BQHB 3K3QA 2FB4L 3BI9X 4OCRL 3H0TB 2AJXH 2UWEF 4PJBF 3EGSA 4ODBD 5EH1A 4ZXBA 1DUZB 2LU4A 4MNHB 5KS9A 5E2VL 4HWZB 3HTLX 1LO2L 4JFOA 3QXTA 5IOPB 2A6JA 3LN4A 4Z76A 4PRPA 5EU3A 4DVRL 3C60C 5E08L 3O9WD 1DUYA 5F1NA 1Z3GL 4RRPG 2DBJA 1FYTB 2J6EL 5AAMA 3CDCA 3T77B 3QUKB 2R2BA 3VFSB 4YDJA 2X4RB 4ISVA 3KHQA 3RNQB 3BPLB 4JPWH 4GAGL 5DHVA 2V5TA 2FGWH 4OZFB 5IGXL 3MO1A 4I2XA 3BDBA 3NIGE 4OGXH 3GM8A 5D1XD 4E41A 3ULVD 2HTKD 4ELMF 1BFTA 2ZUQC 1N6QL 3DVGB 5AZ2H 2D0GA 1DLFH 1BREA 2V5RA 1MI5D 2Y06H 3HAEB 4OLZH 5HGDB 4FQXD 1NANH 3PXHA 1XGYL 1MAML 2L7JA 3HB3D 1MRCH 1L7IL 4MQ7B 5CGYC 1VFOA 5KS9F 4XP4H 1NUNB 4EN3D 1FH5L 5A2KH 5JQ6H 5MEQA 4OZGB 2KQNA 1P5UA 4PGDB 4RGNB 5JOPE 1NGZB 1E4KA 1IC7L 1XIWC 3I6LE 4IHOB 1I7ZA 1RZKC 4FQHA 3V6FB 1BM3L 3FQWA 1JFQH 4MNQE 1TXKA 2JELH 3CZJA 2DJUA 4LEXH 3D2UA 3TA3B 4I3GA 3U9PL 1R5VA 4NP4H 3WNPA 2Q3AA 2E7MA 3SDCA 5DWUL 3C08L 4ZPVB 5LG1A 1FNFA 2EC9U 3L3KB 1HK6A 1OTSC 4GBXD 4IEFB 4YHYC 4OQTA 5D7JA 1NSNH 1CLCA 3TM6A 1JV5B 4JDZB 3T3PE 1GGBH 1UKSA 1C5CH 1A02N 2UUDH 4NQUA 3ZTNH 4TVPL 4UINL 1HILB 4XRCA 4EBQL 1CU4L 5IMLA 4KKLC 1KIRB 4NZTL 3N50A 4N9GB 3BP6A 4CDHA 1FHGA 4OI8A 1N26A 3TO4B 3T0VA 3TPKA 3EJZD 3LPGA 5D7KD 4F37F 4JQXC 1FPTL 4KY1L 4ERSH 4NN6C 3UMTA 4OZHE 3ULUD 1Y18B 5I73B 3BSZL 5MEND 5D71H 1KCLA 2ICWI 4U1SA 1WCBB 4DGVL 4KK5C 4YX2L 5BRZE 4S1DC 3GKZA 4Z7QE 2H8PA 3O11B 3D3VD 5GRZA 2F53D 3WUWB 3LN5A 4HHAB 1U8MA 5DURD 1CICB 3BVNA 3O8XB 2IANE 5L2KB 4IRSD 5C0NC 5HYJA 1OM3L 2DLFL 4BKLB 2P8PB 4G9DB 3W9EA 4LCWA 3LEVL 4QXGH 3GKWL 5FYLH 1N59A 5GGSB 2P5ED 2FLBT 1Z2KA 1H3UA 5D96C 7CGTA 1EZVX 3BYTA 1MCKA 5EOQH 3VRIB 3B9VA 1P7QD 2DQCH 4XNMB 1L0QA 1QP1A 4PJEA 4X4MA 5I1DA 2AABL 3GHEL 4MD0A 4JPKH 2LTQB 3WXWL 4Z7OE 1WEJH 4MA8H 4F15B 3S97C 1NCDH 1A1NA 1B90A 2D7TL 3PQYE 1B0GB 3GMLA 3S98A 2KKQA 1KJ2L 4J6RH 3MFGB 1IGYA 4MJID 5K9KA 4OSUL 2BSSB 3W2DH 3D18A 3T0EB 2VZTA 4ZTOL 4KUZL 3C5SB 2OXHA 3R4DA 2DTSA 1U95B 3O3DB 3VXOB 3O0RH 3SKOA 2E6QA 2NY5H 2PTTB 3BN3B 5E5UB 4V2CB 5T3XE 4FQQB 3DYPA 3ABZA 5E5MB 4Z0BH 4K7PL 4XVJL 3ECBB 1MLCB 3N1GC 1MCLA 35C8L 4HQQH 4AH2B 2VLKE 3SEPA 3G04A 3RWCB 2FO4A 4HAGA 3DRQA 1JNLL 1UH3A 5ID1B 4UIMB 3MREA 2Y5TB 3UYRL 1V7ML 2DS4A 2NY7L 3SGKC 4UT9L 2DWEB 2AEQH 4H5SA 4QNPF 1S5HB 2KQMA 2J1KA 3SY0A 5DO2C 4KMTL 4C55A 2NY6D 2H32H 4PJEF 4GS7B 2CGRH 4G42A 4OUUA 1IKFL 2GCYA 1RU9L 2YPVL 3MOBL 2CIKB 3BZDA 3MA9H 1S7UB 4XAWH 4YGVA 1ZANL 1SJEB 3MLXL 3S3SA 1ZGLM 1AHWB 4TULH 4QTIH 1DR9A 1U0QA 3ETBF 5F7WC 3VH8A 4X6CA 4NQEE 4NRXA 5JOFA 2AQ3A 3PWPA 3FO9A 1U8PA 3D69B 3CFKA 2D9CA 1AQDB 1MFEH 2N7AA 3MRQA 3KR3L 4HKZB 4WWKB 5CD3A 2EXWC 2DQUL 3L3OA 1BEYL 4XCEA 5DK2B 1HHJA 3GJEA 2MJWA 4Z7WA 1A3LL 2CDEB 4ZODA 5CCKH 4KDVA 1N2RB 5EU6B 3VGAB 4PLJC 3OKKB 2ZJSL 5B8CA 1DQLL 4B5EA 3H8NA 5FOBB 4JCLA 1J05A 4LSTL 3KYNB 1S7XA 3ZZ1A 4PG9B 1KB5B 4AIOA 4WEUD 4WFED 3O2DH 3TNMB 4GKZA 1LVEA 1QOKA 1PG7H 3ULVL 3BGFB 3D87B 2FH6A 3BH9A 3QUMA 3S36H 1A4KA 4PJAE 3ISWA 1NLBL 4V1DA 5BJTA 3LEYL 3DO3A 4L8DA 4N1CA 4I5BA 1AXTL 1XGRB 3OGOE 3NFSL 3SO3B 3GI8H 2X1WL 1E6OL 2BRRL 2CLZB 4HUKB 4WCYL 3MR9B 4MNGB 3WE6B 3QUZB 3X13A 3PABB 4Q0XL 2EDLA 2HT4C 2NW3A 1KULA 5E2WH 1FZKA 2VLRD 4RIRA 4ZQKA 3GSUB 1QR1B 43CAB 3STLB 1SBSH 1HH9A 3G6JB 4LVNB 2Q76B 2EE9A 5ACMA 2DN7A 3VH8G 1NMBL 4Z7WF 1CFNB 3QEQA 3S9DB 4ZG1A 3IJHA 4PTUA 4LCCB 3KYKL 4LLWB 1XGUB 4PJ5A 1WIUA 1A4JB 3WSQH 2PCPA 3W0WE 1P2CA 5E6ID 5HVWA 4POYA 5I75C 4LRIA 1KELL 2XOTA 1NBQA 4PUBH 2D9QB 2D2OA 2GUOB 1CDGA 3CU7A 1L6XA 2J8UF 3I6KA 4PJFA 4RMTA 1A7RH 1XZ0A 3JTTA 1K4CB 3LIZL 2OZ4A 1DBKH 4P46B 5HHOA 3BD5A 4PJHE 3MROB 5ABDE 2ICEB 3UPRB 2XY1A 3B4NA 5IQ7H 4QXUL 4NO5B 3KXFB 3HI1A 3NZ8B 1YEEH 1KXVC 4HUWA 3UYOD 4MAYA 4UT6L 4YAQB 3RGVA 4JG0L 5FGCE 5C8JA 2VR9A 1PSKL 3PWNA 3O9WB 4JFDD 4AT6B 4IOIA 5I18H 4L3EE 1MHCA 4ENED 2VYRE 2R9HD 4NYLB 4KPHL 1YN6A 3QZWA 3ULUL 1NCBL 3NA9H 4KZDL 1UH2A 1VEMA 3GGWA 1P84J 4Z7NE 4JY5H 4NRYB 5EU7C 1L0YA 1LO3L 3CD4A 4QF1A 1A7NL 1P69B 5J12B 3NCJH 5D1XB 4YEEA 3WFEH 4DZBA 2ZKHL 2B1HL 4IOFD 1I8KA 1YEDA 1N7ML 1SYVB 3EZJB 4H1LB 1AGBA 5HVGB 2FEDD 1MI5B 1UM4H 3GSNB 3J7HA 4ONOA 4X6BB 4FQXB 1H8OA 4XCFL 3UJIH 2O5YL 3AB0C 4PJXA 1PBYA 5DD1L 3FMGL 1V3KA 4QRRD 4KRMB 1E4XI 1T2QH 5I8KL 1KLGB 4ONHA 2F8VA 4XAKD 3DROA 3IDXL 3D0VA 5DVKA 5GQBA 3LH2H 1U36A 1XEDA 2DLIA 4NUJA 4KGJA 1RZJL 4EN3B 5D5MB 4LCYB 1A7QL 4N0UB 4PJGF 2NNAB 1D9KC 3GBNH 3Q48A 4ZFOB 1QRNA 3MRBB 3WN5B 2AS5M 2CMRH 5K9QG 4Q97A 4GSDL 1T7YA 2BSRA 1CGXA 3W39A 4EDXB 2DQEL 3B3IB 2GJ6A 3PWVB 4U1MB 1RHHB 3UZEA 4TSCH 1BD2A 3AGVA 4E41D 3BP4A 3ARBD 4K3DH 4L9LB 3ARVA 2CR3A 1U93B 5J6HA 3ES6A 2FR4A 3K7UA 5F89A 4HKBB 4GBXB 3IDMB 1HXMA 1DBJH 3QZWG 3QHFH 4PGCB 2EH8H 5HHMD 3VXRD 1U91B 3I6GA 3HCVA 2VITA 5FO8B 1HIMH 1IC1A 3L6FA 1CD1A 4PJXF 5LKNA 1FRGL 1MOEA 1T0NA 4S10A 4HUUA 1LWRA 5DJDB 3LQAC 4D9QE 3CSPA 5DRXA 2Q6WB 4JKPH 3FJTA 3WYRA 3C60D 4AZ8A 4M8QB 5JW4Q 4RBPK 2G60L 1MPAH 3QXAA 5HY9A 3ZLQC 3TWCH 3MNZB 3FOMA 3ALWA 4PY7A 4LPYA 5HVFB 4HWEH 3IU3B 5MENB 2X42A 3MLZH 3V0VB 5C9JA 1RULH 1QFWL 2VXSL 4I77H 1X5HA 5D7IE 3D3VB 2F53B 2WBJA 1UQSA 5DT1L 4R7NB 5DURB 5IMKA 4F3FB 4OZIE 4JQVC 4IRSB 2V6HA 3DXAE 1CL7H 4JLRB 3RTQB 3JV5A 5IFHL 2BERA 3MJ7A 4JHZA 1JGUL 3DGGB 1XGPB 4QOKA 5F9WB 2P5EB 5FK9B 3UEZA 3BE1H 1N64H 2IG2H 2PXYC 3DHJA 5BZDB 4BELD 5CGYD 1CFSA 1P7QB 3WHE1 1X5XA 4FFVD 1REIA 5IJVB 1AGFB 3GIVB 4WU5B 3IJSB 3SGDI 3WEXA 1AFVL 1KPVA 1A6VL 4X80L 4KROC 4WHTB 2AK4A 4GXVH 1JZ2A 3HPJB 4NQDB 5LQBH 1S7TA 4LCUB 4MJIB 4ZTPL 2Y6SC 3ROOB 2VE6A 4NJAH 2VAJA 1E6JH 5FM5M 2BNUA 1YPZB 5CZXC 4XP5L 5I1CL 2X41A 1P84K 5I9QC 3LSOB 1MHPL 2NY1B 2QSTA 4Z7VA 4XNQA 6CGTA 1RMFL 2ESVB 5E6ZA 1HSAB 3PP3K 2DDQL 5EPMA 3JSSA 1PVHA 2BY2A 5C0EA 1VFUA 3L5JA 5HYQB 1ZE3C 2HFFA 4KKLD 5LGJB 3IF1B 5C1MB 1BVKB 1ZHNB 5GJTH 2VLME 2NY6B 4GMTL 2HN7A 1HEZA 5DFVC 2FATH 2EEBA 4UNUA 4GLRH 1HSBA 1RK0A 1AI1H 4RGOH 3BO8B 4NQVB 3BKJH 3RKDC 3B6SA 5DEFA 1CLYL 3MNVB 1M71B 2NQCA 1TVHA 4R0LC 3I75A 4FFWC 4KGLA 4FQJH 1XF4B 4KK5D 4NZUH 4BUGA 1EDQA 4TSBL 5DD5H 4HLZG 1W72H 1B4RA 2HJLA 5C0ND 5FOJA 3D39A 3DUUB 4F7PA 6FABH 1U8IB 3VG0L 1OAYH 1OT1A 1SVZA 2ED7A 2E9BA 3SDDC 1OPGH 4JM4H 2BVEA 4JQIL 4Z7VF 4OAWB 3RVXC 4X6EA 5HHVL 5IBTL 1UM5L 4XP6L 2VDNL 2IF7A 1AP2A 5EUKB 2JK5B 3RWDA 1DVFC 1UB6B 1KPUA 5GRJH 4HBCL 2FD6H 3IETB 5IEHB 1LO5B 4XC1L 1FAIH 1FJ1B 3KPNB 4L4VE 4Y4FC 4ZYKA 4PRAB 4HPOH 3CFBA 4NOFA 3TVMB 4IS6B 1OTTC 4N5EC 4FQCL 4WVRA 4Y19D 4Y2DA 4HFUL 3VDBA 1JNNH 5AZEL 1GAFH 1T1WA 4A6YH 3FT4A 5FA3A 4QGTA 1W0WB 1CXFA 3BKCH 4G7VL 1IGCH 1PQZB 1YN7A 2DQTH 3GMOB 4OV6F 4JFYB 1R0AH 1U8HB 3UTTD 2BVPA 2VLJD 3QP3A 1Q72L 3U7WH 4HDIA 1HCFX 2B0SL 4X6DE 2VLRB 3OGCB 4HUXA 3DVNA 3BWAA 2F58L 5JIKA 4HMCA 4CNIB 2JB5L 1K9TA 2BJML 5HHQA 2V2XA 5C0CE 4I48A 1T89A 2IADB 4MD5B 1BVLB 4HXBH 4LEOA 5DO2D 5I71C 4HX1B 4MNQA 4J1UA 1H5BC 5E6IB 3BZFA 1F3JB 3QNXA 1NC4A 4MYWB 3VFVB 4YHOH 3WS6A 1ZTXL 2EYSB 4M1DL 4RFEB 5SWZB 2ADFH 4HIEB 3HA0A 3QWRA 3DBXA 4MVBC 1KCUH 5FO7A 3GB7A 1F4YL 4DW2H 3AY4C 1L7TL 2C7UA 4HXAH 1QFHA 2D4FA 3HC4H 4G8EB 4QRSB 3UROR 3MYZA 4OF5A 3K8LA 1JN6B 4OZFH 3T1WA 2XA3A 2AK1H 1YEHL 1VA9A 2C1PB 2EXWD 4NNXB 4YNYA 1T1YB 2GITA 3UO1H 4YE4H 4KAQL 4R4BA 1LEGA 2F19H 3DV6A 2VDMH 4UU9A 5DJZB 1FP5A 4Z0XA 1BIHA 3LS4H 4OF0A 1HHHA 3HAEH 1BJ1J 4XNZB 4ZD3L 2RIKA 5ISZE 4JFDB 4ETQB 3WFHB 3QEQD 2FX8H 4I18B 1A47A 4KQ4H 3FO1A 3Q6FA 5CJOH 1WAAE 1CE6A 3U36A 5IHUH 5BRZA 1AR1C 2H41A 3BYYA 1ZHKB 1CE1H 1T5WA 3K1DA 3RA7L 3O41B 2P5WB 2IANA 3DX7B 5ESVA 5AG8A 2ZG3A 1IZKA 1Q94B 3KJ4B 4Q58C 2VDOH 3IJYB 2R0LH 5JORB 2CR6A 4BSVA 5HHOD 1INEH 4MHHG 1JPTH 4FP8H 1U8NB 4OQTL 5FUOH 1AY1H 5DD6B 1HHIA 4WNQB 4QRRB 3T3PF 1ZT1B 5E94A 5IUSA 1G9MH 4JGJA 4YDLB 3LEXB 1NGYA 5C0JA 1H8SA 2HT4D 1A2YA 4M6ML 4OM1L 3TBYB 2BVOA 4MJ6B 1CXLA 4G8IA 1J5OH 3PQYA 3D9AH 1ZA6B 2XWTA 3GI9H 5IVXE 4LSUL 4E0RB 5D2LB 1S9WA 2DD8H 1CTOA 4Z7UE 1P4IH 4U0QB 5F7NC 1RZKL 5C0BB 4OZHF 1SM3H 4WI8A 3DPBA 5TDOA 1C12B 2AEPL 5AEAA 4Y5VB 4DVRH 5E08H 3RZCA 4P5KB 1NMCC 3QQ4A 4Z7QF 2BVQB 1AJ7L 3ARBB 4TN9A 4JB9H 3AS3A 4X7TA 1EEQA 5FYLE 4QRPA 2FWOB 5JPNB 1JGEB 5HHMB 1CBVL 2YSSA 3VXRB 1I4FB 5T1KA 1YNTB 4B7LA 1T2XA 3CGTA 1UCTA 2CXKA 3MUGA 1NMAH 5KTEL 2X4TB 3F62A 2MPAH 5FYJU 4WDIB 1PKQB 1HINH 4HK0A 1JGVH 5DJCB 3MGTB 4X8JA 3C60B 3MBXH 4S1QH 2J3SA 5BV7C 4Z7OF 1ORQB 5T1MA 1S9YA 3PIQB 5ETUA 3BPOC 4AYFA 5AWNL 2JLLA 1YECL 5HPMA 3IFPA 4EEEA 3UTZA 3ZT5A 5DJYA 4TVSa 1WQVT 3FFCD 3CVIL 2AJYL 4NQEA 3V52L 5I0ZA 5DK3A 4JDTH 4O4YL 2HRPL 3WL9B 2NXZB 4L3AA 1GZQA 4X7FC 4AIXA 2J4WH 2ZUQB 4LQFL 3HNVH 1IC7H 3MV9B 1IEAA 1KACB 4Y4HA 12E8L 2VTFA 3FO0H 1BM3H 1IZJA 2NX5E 4D0CA 3B8YA 3LKOB 1OAQL 4D94A 3WHE0 4XGZA 3VGGA 1OARL 2Z8WC 1ODAA 3T2OA 1NFDE 4OZ4A 4G7YL 4PS4L 3C08H 2WWMC 5IM7A 2IBBA 4ACPA 4HMEA 2CDFA 3SDYL 1BQSA 1DN0A 1D9KD 1JUFB 5T33H 3TPUB 4U6TA 5EFIA 1XIWB 3QJHB 2QQKH 4TVPH 4UINH 4FTVE 2W0PA 4URTB 1U3JA 2XG5A 1INQB 1JTPA 2PNDA 4PJAA 3EDJA 3FHAA 1JZ7A 3R1GL 3QEUA 5DFWH 4HJJL 4ZSOE 2JJVA 3TCLA 2VMFA 4HS8H 3QG7L 2Z8RA 5DJ0B 3E2HC 5GS2D 3QG6B 1FPTH 1BZ7B 4XPFL 3VRLE 3GMMB 5DLMH 2R2HA 1NUDA 1X7QB 2D31B 4YHYB 1G7LB 3KPMB 3F6LA 1QUNA 3SN6N 4RAUA 4LLQB 5IEKA 1RUAH 2XRAL 1F90L 2DM2A 3FQUA 3HUJE 4L8BA 5GS1C 1HHKA 4HZLA 3DECA 1S7WA 1MJUL 1ETZA 2P42B 1FDLL 1FNGB 1EGJL 2DLFH 4M9OA 3MOAH 3P11L 5JHLH 3H6JA 3MRCA 1VGKB 2AK4D 4F33A 1BAFL 4NT6A 1OHQA 3BKYH 1JK8B 2E3VA 5DYOA 4HMDA 3CFEB 3KDMB 4F7EA 4NN6B 5F7HA 3EJYC 5ICYB 4ODTL 1C08B 4PJHA 2IPTH 3GHEH 3HMXH 2ADIA 5D1ZC 2ITCA 3P30H 3UYPA 4JRXE 3QUML 2JJTC 2YR3A 1K3IA 3ZDXE 3V79C 1TCMA 5FYJD 4Z78A 2IPUG 2W91A 1EHXA 1D5BA 3QQ3B 4JZJA 1VKXB 3S96A 3CC5B 1KB5H 2IH3B 1LK2A 4FZEL 4OSUH 4MCZA 3P73B 4ZTOH 3ZKNC 4XPAH 5KG9B 1BVZA 5LAXB 1I7UA 1UM6L 1QLRB 2YUZA 4YFLF 1IEBA 5D96B 2PXYD 3C5ZA 5FKAA 3MJ9H 3GHBL 4L3EA 4N0YL 4XXDB 5HGHB 1KIQB 4F58H 4ZFGH 2W65B 1IAKB 4CVXA 4CVUA 4ODHL 4KROD 4F80A 1E4WH 3W11C 1MNUL 3IU4H 5E2UL 5IMOB 4LSSH 4ZS7H 4CVWA 4DCQB 3ZSTA 2IQ9L 4TPRL 4KZEL 1X5JA 2Y6SD 1U3HC 3F7PC 3AXLB 3AS2A 1R5WA 4Y19B 4HULB 3RUGE 4EUPB 2A73B 3RWEA 2VZSA 3FN3A 3JBG7 3MLTA 3LKRA 4PJHF 5CZXD 5JO5A 3WLBB 5M94B 3CVHA 3KNBB 5EIIB 5KSBE 3GSOB 1RU9H 2DQJL 4K71C 5ICZA 5FECA 1PY9A 3UTTB 3D39D 3QJFA 1BX2B 2OR8A 2VLJB 1U8OB 1EIBA 1ZANH 2P43B 1XF3A 1JHKL 2NYYC 5IHBA 3P4MB 2DL2A 3NAAH 3NMEA 1G7MB 1S7SA 5CJXC 2QR0B 1OCWH 4KVNL 3ARDB 3U46A 1RVFL 1WJ3A 3BH8A 5TE4H 2DQUH 5DFVD 3CK0H 4M6OL 3SGJA 3U0TA 3WIHL 4OCMC 2Y25A 5GS0L 4G9FE 4Z7NF 4H26A 4G8GE 3RKDD 4OLVL 3P4NA 3H42H 1J88A 3L5WB 5F1IA 5HYSA 4YHPA 2R39A 4FXKB 4FFWD 1N6UA 4X5LA 1QLFA 4Y2DD 3ESVF 3JV6B 2F54D 3QO0A 3OKLB 1IM3A 1Q0YH 5GJSH 5EOCL 1HHGA 1T7WA 3G5ZB 4MB3A 1MFAL 5CIPB 3SDDD 4U1JA 1NCWH 3O6KH 2HA1A 2GTZA 4F7CB 1NDGB 4GRLC 3RVXD 5HI5C 5IVNA 1Q0XL 3GSNH 4KXZH 4QXTA 4O2EA 4JO2L 5B38A 1OSZA 1M6OA 3NFSH 4BFBD 1DVFD 2CKBA 3JTSB 4CMMA 4KC3B 5ADPL 4N8VA 3L7EA 4P59H 2ORBL 3DX8A 5C86A 1EHLH 2OYPA 4Y4FD 1NC4D 5D7IA 1IGIL 2AV1B 3DYMA 4OZIA 5D8JL 3DXAA 1OQOA 4XBEL 3B9EA 1OTTD 5DA4A 5JXEA 4UQ2B 1PKOA 1NQBA 3LB6C 3M8OH 4ZPTB 2OJEA 1UC6A 4OFYD 4JN1H 4OTXH 1NAKL 3ZKMD 4Q74A 2X9WA 1NDMB 1Y0LB 2J12B 3PV6A 5CJQH 2EEAA 5L8KB 3VXUB 2HVJA 3EO1A 2ZUSA 4YHIA 3H9SE 1ZHLB 3BZEA 2GJZB 2ZPKL 4I1NB 1M4KA 3CPLB 1I9JH 2R0ZL 2E8ZA 2CRZA 3CMGA 4OGAC 2B7DT 5BZWB 1C16B 2H2SC 4G3YL 1WFNA 1PGRB 1KCVH 2E7HA 5L0QC 3AU1B 1P9MC 3L3IB 5I75B 5ELIA 5E7FA 4PJDB 4R4FL 4PJ8C 4L1DA 1QFOA 2C3XA 2CH8A 4RBPH 4MVBD 1BQUA 2YA1A 2FECL 1B9ZA 4ONFH 4YLQT 5KW9H 4WW2F 3IB4A 3ULUH 2ZNXA 5GGUB 5DJ8B 4KZDH 4G43B 1JNHA 1LHZA 4N8VG 5IFJB 3KLAA 5TDNB 4Q9RL 4CU8A 3GIZH 1B2WH 4PB0H 4Z5RA 3JUYA 4GKNB 4Z8FL 3QDGE 4XPGH 5I66A 2NZ9C 4LVHC 4WO4A 3TGXA 1XH3A 5GHWH 2FSEA 4PGZA 2DL9A 1BOGA 3OJMB 1AD0B 5J6GA 4LARL 4JCMA 2QHRL 1G1CA 2DKSA 1EA9C 2CIIA 3FFCB 3GRWH 4UTBH 3V5HB 3WNOA 1AXSB 3BEVA 3PHQB 1JTTA 2Y9RT 3MRRB 1HQ4A 3RY6C 3QUYC 5JNYA 3MRKB 1CGSL 3QQ9D 4ZDHA 3FONB 2MTPA 1S9XB 5CEXA 4PGBA 4JZNB 1FGNH 3FN9A 4XMLH 3KPQA 1HDMA 1QHOA 4OCXL 4PJIB 2PR4L 4QRPD 1K8IA 3MA7B 2P49B 4KV5E 2YMXL 3AB0B 2CQVA 4UV4L 1KLFA 5DJ2A 3GBML 3OAYK 4LPWA 2E8YA 1MCSA 1UEMA 1LP9E 5E70A 3D6GA 2QJDA 1NL0H 4UV7H 4JY6A 1RIHL 2Q8BL 1ZEAH 4L4VA 4YPJA 1U6AL 4FHBD 4PRDA 2VIRA 3HPLA 4ORGB 1D9KB 5C08D 1JZ3A 3U0PB 3BW9A 3AAZB 4MS8C 4FXLA 1YY9C 4HIXH 4WUKL 2Z93B 3IDIB 2IGFH 2OTWB 5E0QA 3RWJA 3BGMA 3K8KA 3R06B 3VXME 5FEBA 3CFCL 3FQXB 4RMSA 3UTSD 4G6KH 4MSWB 4RMVA 2G60H 3V5KB 1NEZB 3CUPB 2HH0L 3RL2B 2BY1A 4LFHG 1AE6H 2BNRE 4YK4C 4BH7B 3B9KA 3G9VA 1JZ8A 4P2RB 5F7YC 4GG6E 4U1NB 4XMKL 3QDAA 1GOGA 3OAUH 5C0CA 5JW4N 5JLZB 1BLNA 1RJLB 4OIBA 4F2MA 4X5WB 5H2BB 2F74B 1AGDB 3PHOB 4OB5H 3WBDA 2HKFL 3HC3L 2LU7A 3FQRB 3GSWA 4W81A 2XXMB 3CCHB 3TYGH 3U6RB 1FNSH 4HS6B 1TETH 1BZ9A 2Z92B 3OB0K 4C56D 1AIFB 1FZMB 3QULA 1I1AC 1TNNA 2X70B 1EEZB 3O4LE 4X80H 5F7KC 2V7NA 1C1EH 1LD9A 2DJ4A 3GJFB 1TZHA 3PJSA 4GKSA 4LF3A 1NLDH 2OR7A 1WGOA 3IS0X 4NWUL 4OIIL 3P9LB 1W0VB 5ISZA 4X6DF 4IIQC 3OKEA 5TE6L 3QEGH 2PXYB 3RWHB 3WIFA 1U41A 2IFGA 1LK3H 4HV8B 5I1CH 5D72L 1AGCA 1WAAA 4N90E 5IV2A 3NFPA 3ZYIA 4JDVB 3ROLB 2JIXD 2WWMD 1F4WH 4OCSH 3HFMH 4L4TB 3C6LC 4KROB 1F13A 4ZFZB 5AYUL 4N1HB 5CP3H 3OKOA 5I19H 4JHWH 2WUCH 3B2VL 1FYTE 2J88H 1I9IL 4X7SH 5EG6C 3QNZA 3KG5A 4LLYB 3PWJB 4PRBA 43C9B 1DCLA 1FVCB 1F42A 3T8XA 4JR9L 5JDSB 1NC2D 4WI3A 3NIFE 4FMKA 1U92B 1KTLA 3L5HA 1B6UA 5I9QB 1NJ9B 4ZO9A 2QSCL 4RISH 4KFZC 2NY0C 5K9OB 2QKIB 1OD7A 2RHEA 1F58H 3IXTB 3TC9A 5FGSA 3MBEC 1HZHH 4EOWL 5IVXA 2ZUVA 2AXFA 2Z91B 3IDUA 4PG2C 2ITDA 1NAML 3SKJL 1X5IA 4YUEL 1EERB 2X4PB 3MRGA 1IC4H 1YNKL 1GH7A 3MUJA 5GZOC 2UY7A 5ESQA 1WAAF 4OZGE 5JTWA 4RGNE 5T5FL 4RWYL 5EBWA 3EJYD 2V2TA 1OAUL 1UM5H 5DI8B 2AJZA 4K3JH 1U8JB 4J8RA 3S88H 4R0LB 5D1ZD 2ADGB 3U4BH 5F6IB 2F54B 4RX4D 3MRHB 1BJMA 1MCBA 4U1KA 1M7DB 4UUJB 5DQDH 5K9QI 3V6OE 1A9EA 1QSEA 5J1AB 3KLDA 4CAGA 2AI0L 2O61B 3ZKND 3EIFA 3SDDB 4PY8J 2RR3A 1JBJA 1JWMB 3UXFA 2W0FA 1KOAA 1N0LA 3RWGB 2B2XH 3TBVA 1Q9WA 3I50L 2F5AL 4OF8A 3IGAA 3P0VH 3X11B 5IVXF 3UC0H 3VWJA 1DVFB 5MHSE 4Z7UF 3FT3A 3W11D 1NGPH 4TQEL 4NM8L 4Y4FB 5T3XL 3E3QE 4P3DA 5EU4B 5ALBH 1U3HD 2BJMH 2HLAA 3L9RA 4ZUTB 4RDQF 4HGWB 4UNTA 3CDFA 4NFBA 4U1HB 3A6OA 2XQYK 3PDDA 4U1IB 3MJ8B 4Y16A 1MCHA 1B88A 1NFDA 4OLXL 1R3HA 3X3GL 3U4AA 1JF6A 2HG5A 3EYSH 5H94B 1P4LB 2X4UB 5L2KE 5I1KH 3TBTA 3M17A 3SPVB 2NYYD 3STZB 1ONQB 4DTGL 5ESAA 1VADA 5CBAB 3BJLA 1NAMB 3CH1B 5EZJB 3WHXB 4POUB 5HHXL 4FTVA 2QQLH 4PJ9A 1A1MB 3RWFA 5I71B 1CK0H 3HNTL 3TT3L 5KJRH 2DMCA 1J0HA 2ZUXA 4JFFB 2O5ZH 3ARFA 4BFIB 2BHZA 4ZSOA 2XKNA 2IWGA 5EC1B 3UPAA 4KAQH 4Z6AT 2W60B 3BIKB 5F6HI 1MAJA 2WAHA 1EO7A 1YZZA 3QI9C 3O6ML 4C83A 4TUJB 3RVWC 5M95B 1DLHB 4Q6IC 5D70H 3T0EE 1LNUB 4EVNA 4PRIE 4UT7H 2OK0L 1G7IB 3A6BL 4PREA 3VFUA 3GMNB 4EIZC 5CEZD 1SEQL 1MVUA 5IT2L 3PNWA 5L7XL 3LKSA 1TTUA 1MEXH 3HUJA 4NKOA 2VC2H 3HE7C 3LKPA 1SY6L 1I3RB 5DUPH 1ZGLB 4UDTA 1NFDF 2X40A 3V4UH 2ZOLB 3EDEA 1F97A 1QA9B 4GRLD 3LVEA 4AENA 5HI5D 4KRLB 1S5IL 1YA5A 3O2DA 2AKRA 2NMSA 5BV7L 3FKUS 1ZLUH 2VL4A 1XCQA 4TVPE 2FL5A 5DUBA 1K4DA 1MQ8A 5KOMC 4QWWC 3NTCL 4XHJC 4JRXA 4WV1C 4XPBH 4RMWA 5CHNB 3QHZL 4LNRB 4GW4A 1SYSB 1YEKL 3CZFA 1ZLSH 3REWB 3TYFB 2OSLA 1N3NA 1X5GA 1R3LB 9CGTA 3RWIA 2FZ3A 5KN5B 3LD8C 3QBTB 4MAUL 2XFXB 5K59E 1LE5B 3EDDA 3LQZB 3P3YA 2CKNA 5SV3A 4D0BB 1RFDH 3VRLF 1OT2A 4IBLT 1RZKH 4Y4KC 2V2WB 5FUCC 4MA7H 2HFGL 1Z9LA 3LV3A 5JPMB 1AR2A 1U8KB 4GRWB 2MKWA 1FV1B 3HLAA 3LZFL 3FAXA 3HUJF 4LHUG 3HS0A 4HFWA 5EO1A 3NZHL 4ZUSA 4N8CH 3SOBH 1W2KT 3T2QA 2VDPH 3OKMB 4QT5B 5INDB 5J57B 2ZCKH 4OGAD 4QHMA 5EU6E 5C08B 5IWLC 2D0HA 1N5YL 2H2SD 2V17L 4E42B 1T1ZB 3BXNA 1JYXA 4Z9KB 1LDSA 4IRJC 2YBRB 3RUGA 5L88H 1AKJD 4D0DA 5KTEH 1U8LB 1WZLA 4PJ8D 1ROWA 5EC2A 3DUSB 5IB1B 4P2QD 1JMXA 3S37X 2OX5A 3UTSB 1NMCB 4P5MB 3ZDXF 1ZA3A 1YECH 5AD0B 3FO2A 3WKNA 4JG1L 4LQ1A 3MRLB 1NGWA 5FO9A 3QFJD 3O45B 3FOLB 4MQTB 5FF6A 1MCQA 2W0KA 2HRPH 2BVUA 2FGZA 1UH4A 4Q9QL 3NA4A 1GZPB 4LLVB 4MA3A 2PW1B 1FO0H 1MCPL 4K94L 4AG4L 1D5MB 1R3JB 4MXWL 4PJCE 3CNKA 4G9FA 5E5RB 3BUYB 4L3CA 5BV7B 1T4KA 4G8GA 2NZ9D 2YUWA 3BPOB 3BMWA 4CVZB 3G6JE 3A6CH 4MJ2A 4TOYL 4ZUWA 1A6AA 4TNVK 1KNOA 2XG4A 1IFHH 1FZOA 4X5XB 3P4OB 3IFLL 3FB7B 1YEJH 4G7YH 2CK0H 4C56B 2NLJB 1IILE 2VXVH 3GSVA 4F8QA 1K6QL 4G80B 4Z95H