4FQCH

Crystal structure of pgt121 fab bound to a complex-type sialylated n-glycan
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
232
structure length
227
Chain Sequence
QMQLQESGPGLVKPSETLSLTCSVSGASISDSYWSWIRRSPGKGLEWIGYVHKSGDTNYSPSLKSRVNLSLDTSKNQVSLSLVAATAADSGKYYCARTLHGRRIYGIVAFNEWFTYFYMDVWGNGTQVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab heavy chain
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 227
sequence length 232
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqcH01
4CVZA 3GSXB 4TTGA 1QHOA 4LCCC 1L7TH 5EH1A 5JPMB 3GSNA 2VR5A 5D7JA 2IQAB 3BRFA 1JPTL 5F72S 1GC1H 3KVQA 4Q9QL 2G60H 2EXWD 4MMZC 2VSDA 4ELME 3JWDH 2HLFC 3SBWA 3OGCB 4TUKH 1WBYB 5F8RC 4NP4H 3OX8A 2NNAB 5C86A 4X6CA 4XMPL 3CFBB 4IDJL 1DE4B 4I2XB 1AXIB 3LEYL 4FFZL 2W65B 3RVVC 3VFUA 15C8H 1G9EA 3VGDA 2H32H 1REIA 5JIIA 3IXTA 4ODTH 5B38A 5IQ9B 5JA8B 5B38G 3VD4A 4MDJA 4GOSA 1RUMH 1G7LA 5FOJA 1ZWIB 3EDJA 1HXYA 4KXZI 1TDQA 4N5ED 3RI5K 2N56A 2BY3A 2VUOA 3GSXA 1NUDA 5JPMA 4OIIL 1I1AB 5C0AB 2IQAA 5DUML 3S3PA 1XCTA 5J12B 4IHOB 1GIGL 4NZRH 2ZCHH 1WV7T 2BFVL 2R69L 2QJDA 3OGCA 2VZUA 4R4NC 4K7PX 1WBYA 3PG2A 1RUAH 2NNAA 3IFLL 3CFBA 3O8XD 1DE4A 4I2XA 3A6BH 2W65A 1ES0B 1X5JA 3SE9L 3RVWC 1D5IL 4GG6F 1HH9B 5IQ9A 2DQCH 1JTOA 2VN7A 1YECL 1ZWIA 2Z0BA 2DQUL 2AJZB 3HNSL 3MGOB 1PDKA 4HJGB 2R1WB 2LVCA 1I1AA 3IFNH 3KPRB 5C0AA 3MRQB 1CWVA 5F7MC 2GYSA 4IHOA 3QCVH 2WUBL 4IOSD 4ORZC 3LRHA 3H9YA 2YD6A 4U2ZA 3ARUA 4GRWH 2K3TA 1HILB 1T66C 3TCLB 4G6JH 3V0AC 2BHZA 4IMKC 3LZFH 1ES0A 2Q1EA 4G6FD 1RIUH 3FN9A 1HH9A 4TOYL 1VCAA 4RCAA 2AJZA 5E8OB 2VXUH 3MGOA 2NX5E 4JPVL 3QEQD 4JZNB 3V2AR 1V3LA 4UV4L 3QJHB 1OM3H 5I0DA 1J0YA 4HJGA 4LPXA 2R1WA 3FRPA 4X7FC 2D2OA 1H3VA 3KPRA 4DOHE 3MRBB 3MRQA 3MYZA 4FMFA 5H35B 3LKSA 3QDJB 1J1PL 3O3AB 4ODHL 4YX2L 5ABDE 1VGEH 5H2BB 4DGVH 5DJCB 3BPNB 3D3VE 3MLUH 3TCLA 1HILA 2VDRH 3DI3B 3OZ9L 3O2VL 1UZ6E 3UPCA 5JMRA 1MLBB 2X4TB 4OLWL 1AXSB 3CNKA 4U6TA 3O4LA 4ODVL 1OGTA 3P11L 1DZBA 1OB1B 3QIUB 4PRPD 1TMCB 4RBPK 2EZ0C 5E8OA 3WFHA 4JZNA 2VDKH 1XR8B 3QJHA 4HC1A 4U2YA 4G8GB 1HHIB 1HE7A 3MRBA 1ZANH 4YLQT 2NY4D 1JMXA 1YY9C 5H35A 1MRCL 3QDJA 1T83A 4PLJD 3QPXL 5IB2B 3ROLB 1MY7A 2FIRT 5DMIL 5DRZB 5DJCA 1NBVL 2RIKA 3GSRB 1Q0YH 4NZTH 2NX5D 4AY0A 5IBUB 4JG1H 1MLBA 4HKBB 1AXSA 3AVEA 5IESL 2HFFB 4NWUH 3PGFL 4TSAL 2QSVA 1OB1A 3QIUA 4U0RB 1H0DB 1Y6MR 1F3DH 4ZUUB 1H8SA 4CRPA 2I07B 3MLXH 4G8GA 3TFKC 3OJVC 4HH8A 5AWNH 4QHNB 5JQ6H 4M48H 3FFCE 2VYRE 2FD6L 3U4BL 4YXLL 1T6WA 1SYVA 1S5IH 1A7PL 4JGMA 5EBMB 3V9FA 3RJQB 4H20L 5DRZA 3GSRA 5I1KL 3T3MF 1BWWA 5T5NG 1T0MB 3P3YA 3GHEH 3F7RA 4HT1L 5CMAB 1IT9H 3MO1B 4HKBA 4NBZB 1NC4A 1EMTH 2HFFA 1EHLH 1AQKL 4MQXD 3VFTA 1H0DA 1F58L 3O2DA 4ZUUA 3W81A 3P0GB 2J7LA 4GRMB 5FECB 3WXWL 4QHNA 1KFAL 2JJVA 5EBMA 2J4WL 1OTSD 2EC8A 1D9KB 1RZFL 2ZUYA 1T0MA 3QRGH 2DD8L 3KLDA 1VFUA 1N4XH 3ARVA 3ZHKA 5CMAA 1YMME 3MO1A 5B3NA 5I8CB 2PUQT 5DT1L 4DK3A 1KCKA 2VC2H 1F2XK 3UTSB 1NGXB 2HT2D 1OP3H 4TVPH 1FVEB 5A1AA 3EJZD 4MJIE 4GRMA 5FECA 2V17L 5CP3H 4LHJB 2BXYA 3DV6B 4CVUA 5BV7B 2YR3A 4PGJA 5I6XB 4M6OH 3GSQB 3QWRA 4O58H 3SDDC 1M05A 4JO4L 4ELMF 4F8TA 1D9KA 2AJUH 2EDLA 3EDEA 4EOWL 5CJBA 1N7MH 4P2RB 1MCBA 4IEFB 3WNOA 4OFVA 3P0VL 3FMGL 3TPUB 1IE5A 4J4PD 1I9JH 1NGXA 3IDMB 3UTSA 2WNGA 4PJCF 4QRTB 1FVEA 1T2QH 5KG9B 2WV3A 5EU3B 2A1WH 1I9EA 1A6AB 3OB8A 2AP2A 3DV6A 5HYQB 1X5LA 1IM3B 4KKAD 4NJ9L 4Y2DB 4I18C 1YMMD 1KB9J 4LPCA 3TYGL 5DURD 1NEUA 3T1FB 5DGRA 5BVPH 3AS2A 4PJXB 1V7NH 1U3YA 1MFAH 4PJIE 4W81A 3VG9C 4P2RA 2DQFB 5CSBA 1BFVL 1CFVH 3CJJA 1DQLH 3MRGB 2XTJE 3TPUA 4KVNL 3VGAB 2VAJA 3IDMA 4U6VL 4QRTA 4AENB 5J8OA 5CJQH 5C2UB 1Z3GH 3STZB 4FS0A 1YEFH 3QDMD 5KG9A 1MCLA 1DBJH 5EU3A 1A6AA 1BIIA 3OMZA 2CDGB 3T0BA 5IB3A 1IM3A 4AIOA 1N6QL 4Y2DA 1OGAE 1BFSA 4XP1H 3ZMRA 5L2JB 4WO4D 4OD1L 5ACZB 2BJMH 1EO8L 2UWEE 1EGJL 4ZDHB 3TEUA 4PRNB 2UVEA 4PJXA 4XVUD 4WW2C 2J2ZA 5ACLA 4JKMA 3ZE0F 3UYRL 2DQFA 3HE7C 4MNQE 5HHQB 3MRGA 3SCMC 2IG2L 3MBXH 4AENA 4UT9H 4X80H 3STZA 2ICWB 5AAMA 3KR3H 4ONFH 1I9RL 5IEHB 3I50H 1I8KB 2EDXA 2B0SL 4NQEB 4F9LC 2CDGA 3GI9L 3RGHA 2NZ9C 4XVJL 3DBXB 3WLWC 3RTQD 5ACZA 2ZCLH 4KUCF 2CD0A 1GOGA 1LK3L 5IEKB 1JMZA 3F58H 4ZDHA 5TPWH 2XTJD 4PRNA 4FQJH 5FO9B 4WV1C 4JDZB 2W9DH 4X6CE 1A7RH 2HFGL 3OG6B 3LS4L 1LD9B 2X9XA 3UJJL 5CEYA 2X4RB 4C83B 2DLFH 5HHQA 1SJEB 4ZQKB 3SO3C 5JHDD 1D6VL 1F42A 3IS1X 1FG2B 4LPUA 2EXYC 1MFDH 2ICWA 3O2WL 1I8KA 4HGWB 1MCEA 4ZYKB 4WY7L 4L8SC 1X5IA 4IMKA 3E8UL 4NQEA 4KRPB 3FJTA 3NPSC 3DBXA 5HVWA 4IRJC 1NLBL 4N0UB 2YMXL 4MNQD 2LV4A 5IEKA 2B1HL 5DD3L 5FO9A 4OGAC 2NY3D 4JDZA 5J0BA 4ZO6A 1P5UA 2CR6A 4I2XE 1LD9A 4HMEA 5C0RH 2X4RA 5KVDL 4C83A 3HI6H 4QXUL 2CDFB 1SJEA 4ZQKA 4ZTOL 5D7JD 5J7CC 1QUNA 1FG2A 4KDWA 3C6LD 3V4UH 2BNRB 3LEXB 1E28B 3LPGA 4I4WB 1BQSA 4HGWA 4ZYKA 1R3LB 5F88A 1NUGA 2UV3A 1HNFA 4J3VA 4YHKH 3BN9D 2JLLA 3QXAA 4ORGB 3NCFB 4OLVH 1NUNB 1C5DB 4FQ2H 3TCXA 5DHVA 1TJGL 3C2SA 5E6IC 1PZ5A 1T80A 4OCRH 3AB0C 3UBXB 4ONGH 2JCCB 4G7VL 1UKQA 3EW3B 3A6CL 1I3GL 1IGCL 3CGTA 3LEXA 1E28A 4O5LH 4I4WA 2BXZA 4PGZA 1R3LA 4E9LA 1JZ3A 2GT9B 3U0PB 3KPRE 4K94C 3GSOB 3LSOA 4ORGA 4R6UA 3RKPA 1C5DA 1UYWH 4KHTL 1PSKH 4U05A 1U3ZA 4RMRA 5EOTB 1LE5B 1G6RL 4RSVA 3UBXA 2JCCA 2WMPA 4X5XB 5ERWB 3WIHL 3DECA 3U2SB 5B21A 3UBXG 1OOAA 4YHLH 1I1AD 2R0WH 5C0AD 4QOKA 3O4LE 3DO7B 1XF5A 2Z9TA 2YXFA 3MRJB 2BZDA 5BRZB 4MAUL 3K4ZA 1E4XL 4XB8A 4XWOC 1AY1H 3BD3A 3CX5J 1CZ8L 2HP4A 5D7IF 1QPXA 4FFYL 5GJTL 1YPZB 4X4MA 2GT9A 3U0PA 4KKCD 2PTTB 3GSOA 1A6WH 2MSPA 1NCWH 3QDJE 1KN2L 2DWDB 5F1IB 1FGNH 3I6KB 1N0XH 1FE8L 5EOTA 4D9LL 1LE5A 1XF3B 3T2OA 2CLRB 4KI5E 1KCSL 5ERWA 3U2SA 3M17B 5HYIA 5LXGL 3UEZA 2ADIB 3C5ZB 5J06A 5KVEL 3DO7A 3MRJA 3SDDB 3EFDL 5EULV 5J4MA 4K71B 3OAUH 4HKZB 1LNUB 4TPRH 3S36L 1TIUA 4G8GE 4ERSL 2BY0A 1YPZA 4HJ0D 3TWCL 5EU6B 2PTTA 4KTDL 1RHHB 5F9WC 1HZHH 4N1EA 3I9GH 3TF7C 1AGCB 1NAMH 1WTGT 4W70A 3DIFB 2DWDA 5F1IA 5DJ0B 3I6KA 1R5IB 3AMLA 3EJYC 5FHBH 1U6AH 1XF3A 1G7JB 3HPJB 2CLRA 5E2TH 5I73C 5I1GH 3M17A 3IAGC 4U1IB 1B90A 1MCQA 4FNLL 4YHMH 1RV6X 5D1XC 1CU4H 4KK5D 2Z8VC 4TNWK 2ADIA 3C5ZA 3NCYP 4OTXL 4G8FB 4LLMB 3QT2A 3SDDA 4J3TA 5E6YA 4HKZA 1LNUA 5C2BL 5SX4I 3BAEH 3VG9B 1N5YL 5CGTA 1RHHA 4AIZB 4KI5D 4Z76B 1AGCA 3MLWH 1IEBA 3TJEH 3DIFA 5ESAB 5DJ0A 3OKEB 3QIUD 1R5IA 4JFFB 3QXWA 3HPJA 4TQEH 4U1IA 2C7UB 5L88H 2YPKB 4I18A 2O5ZL 1JPSL 4G8FA 4LLMA 2CRZA 3AU1B 5AAWA 2Q3AA 3B9EA 4OM0H 2VB5A 2AK4B 1OWWA 2AK1L 4Y16D 4Z7QE 3BIAX 4WW2B 4X99B 1JGVH 3RNQB 2W9EH 4GXUM 4BQ9A 5DLML 2OZ4A 4AIZA 3IDUA 3IAPA 3B9KC 4Z76A 5E2UL 5C9JB 5ALCH 3SCMB 2DTSA 4JE4B 4ZAKC 5ESAA 1I3VA 2AJYH 5IT2H 4GMTH 1EVTC 1RULL 3QUMB 1AE6H 2VZ1A 3OKEA 3EO0B 2DDQL 4M7KL 2C4FU 1EEYB 1BBDH 1C1EL 2H8PA 3UTPE 2YPKA 1NC2D 2VL4A 3RWCB 1U3HB 2PKDA 3AU1A 1DQMH 2L0DA 2DN7A 2AK4A 5H94B 1G7PB 6CGTA 2MCPH 2ARJB 5D72L 4WW2A 2E5EA 4X99A 4LIQH 2QLVB 3RNQA 3SQOL 1IRAY 4I5BB 5C9JA 3SO3B 4YO0B 2QQNH 5EZLB 1CDGA 3SCMA 1W72H 2PCPB 4MXWH 3ZL4H 3ZO0A 5JHLL 4DUXA 2NY2B 4JANB 1L0YA 5K33A 4LLAA 5C07D 4Q9RL 3QUMA 1OW0C 5C0FB 1JPST 1JK8B 1EEYA 4F9LA 4P2RE 1NGWB 3R1GL 5T3XL 3SE4C 2NY5C 3NPSB 4AL8L 2JJTC 3ZDZE 3C8DA 5KVFH 3RWCA 4KGLA 3FT2B 5H94A 4RQQB 4NM4L 4WV1A 1YJDC 3RDTC 3CVIH 1PKOA 5T3XD 1FYHB 5LJYH 1WJ3A 2NZIA 4I5BA 5BQ7A 4YO0A 2L4OA 3O3UN 5EZLA 2PCPA 3DETC 4UTBH 3QCUL 4JANA 1MFNA 2XNAB 2HT3C 3CFDB 3UTSD 2R9HD 3GJEB 5C0FA 4PJXE 1JK8A 1JNNL 4TTDD 1AGEB 3L3HB 1AQDB 1LO5B 1NGWA 5I1JL 4LSSL 3R0MA 3L5XH 4LSPL 2ED7A 4NKOB 1MY5A 4GRWF 5D7KE 1UEYA 3IAQA 5TQ0L 3FT2A 4RQQA 2EEBA 1AGFB 1A7NL 5E6IB 5HI4C 3WKML 3WXVL 3D9AL 2H6PB 3DWTA 5GISL 3CMOL 4R2GC 1Q9LB 4P2RD 4AEHL 3WFDH 2XNAA 1CGSL 3CFDA 4PB9H 3GJEA 2W92A 1AGEA 3L3HA 1AQDA 2Y06H 3VGGA 1LO5A 4WI8A 2A6DB 1Q94B 4CL7A 4BFEA 5T3ZL 1FZKB 3OJDB 4FABH 2G5BA 4NKOA 4Y2DD 3QXVA 1QRNB 1SY6H 1AGFA 3VRIB 4W4OC 5E6IA 5FGSA 2H6PA 1FFQA 4NQEE 4Z7VA 1NMBH 3VXOB 3WIIH 3BOVA 1Q9LA 3QQ4A 4OCMC 5LCVH 3C60D 1N0LA 4KAQL 5LQBL 4YEFA 2OMNA 4H25B 1L9MA 1IAOA 4XP5L 4OCLC 5FYKU 3B4NA 1M7DB 2H1PL 4MS8D 3VFWA 3BXNB 5L8KB 3ARFC 3VFNB 1DFBL 2A6DA 4DGIL 1Q94A 2W0FB 2VDQH 4EKXA 4Z7WB 4Y89A 1NMCB 4UOW0 1FZKA 3OJDA 4DEPB 2DQEL 3S37X 5I8EA 1QRNA 1HYRC 2DM4A 1EZVY 3HNTL 1YQVL 1IILE 4JO2L 2G75B 4HIEB 4M7JL 3VRIA 2DAVA 4NQVB 3VW3L 3DRQB 4WWKC 5JXEC 4FQ1H 3VXOA 3SOBL 3HC4L 2O5YH 1QPPA 1SEBB 3U48A 2XG5A 4QT5B 4P49A 2ORBL 2CK0L 4XMKL 1QNZH 1SJHB 4H25A 4RGOL 2BCKB 5DEGB 1M7DA 1D3CA 4R9HA 4ZFOB 3VFNA 1F6FB 2W0FA 3FFDB 4WDIB 5F7LB 1FSKB 4Z7WA 5F9WB 4NQED 5KOMC 2ICWI 5I8KH 4GSDL 1WWCA 1LDPH 2VL5B 3WIFB 4AJ0A 5I75C 5ACMA 1CXIA 3AM8C 2G75A 1L6ZA 4HIEA 2QR0B 3ZKMC 4JM2F 5EZIH 3DRQA 5T33L 1S8DB 2JJUA 5I73B 4GLRH 1SM3L 5FYJE 1SEBA 5D1XB 4QT5A 1SJHA 2QQKH 1P1ZB 2BCKA 5DEGA 1FP5A 2IMMA 1MCPL 4ZFOA 4K8RH 3U0WH 4MCZB 4TRPL 5F7KC 2KPNA 4X4XB 3FFDA 5IOPB 5C0EB 5MEOB 5F1KC 4KRPD 3RWFB 3JWOH 4QTHB 1VERA 4QOKE 1E6JH 1ZTXL 1WEJH 1WISA 1K5NB 1UJTA 2VL5A 5C0GB 4XPBL 3KPOB 3WIFA 3P9MB 3TM6A 4GQ9L 2QR0A 1N2RB 3QHZL 2AGJL 1S8DA 3BQUC 5D1XA 3PXJA 1AP2B 1OPGH 3B2UD 2DKMA 4DWHA 1P1ZA 2QHRL 1NLDL 5DFVC 3U7WL 4MCZA 1JIBA 1BLNB 3MACL 3QFDB 2BNRD 1TVHB 2DQTH 1NCDL 3WD5L 4X4XA 1GHFH 3WDIA 3CD4A 4DN4L 4UILH 5C0EA 5IOPA 5MEOA 1R0AH 3QEGL 3RWFA 1KTDB 2BX5A 4LSVH 5FYJD 5C0GA 1K5NA 5CEZL 3KPOA 3P9MA 1YEEL 4WUKH 1G0DA 3JBG7 1N2RA 3U7YH 5HHXL 1YPZE 3UTTE 4M1CC 3BWUC 4JQIH 5CEZD 1AP2A 4HJJH 3V4PL 2GTZA 1OSPL 3UBXI 4Y0GA 1JWUB 4NUJB 1OP5H 1CL7I 4MD4B 3U9PL 4XAWH 4JO3L 4L1DA 1BLNA 3QFDA 1T7VA 1TVHA 3T2NL 4F7CB 3T2PA 4WTWA 1KTDA 4UNUA 3MV7B 1MWAH 4JFDB 3S35H 1EVUA 4QCIB 2PYEB 5HDOA 1FL6A 4P9HH 3V6OC 4WTXA 4WRLA 4FXKB 5CCKL 1OCWL 3TT3H 5E4EB 4F2MB 4WEUD 3CDGB 1UM6L 1KJ3H 2RR3A 1G9MH 1V3JA 2J8UB 4XPHH 4FP8H 2AV7B 5KSBF 3INUH 3C08L 4NO2B 5FO7B 5D7SH 1JWUA 1I7RB 4NUJA 4MD4A 4Y4KC 3RDTB 2VXQL 1BBJB 5BRZD 3O45B 2X4UB 4JB9H 4F7CA 4KK6C 1MJ7L 2ZOKB 4GKZB 2Z35B 2WZPD 5GGTA 1IGTB 2ZUSA 3MV7A 1MCIA 4JFDA 3VJ6A 4QCIA 2PYEA 5L9DL 4M6NL 5I1CL 5CINL 4JN2B 4FXKA 4OZIF 3RZCB 3RAJL 4F2MA 3CDGA 4N8VG 1FIEA 3SE4A 2J8UA 1CT8B 5FYLH 2P5EA 2AV7A 4F57L 5B22A 4NO2A 1MAKA 4Y88A 1ZA6B 5FO7A 1A0QL 3C5ZD 1I7RA 3BRGC 3SDDD 4NN7C 3RDTA 5IGXL 5C0CE 1BBJA 3O45A 2QADD 2X4UA 3VFPB 4LNRB 2ZOKA 4GKZA 4E0RB 1JTTA 1HHKB 4KZEL 3VXSB 4R2GB 5EU6D 1IGTA 3CVHB 3I3EA 2AK4E 4O4YH 1QD0A 4N8PA 4JN2A 1KBGL 4WI5A 1D5MB 3RZCA 2P49B 3I84A 2NY0C 1YYML 1W0VB 2R4SL 4I3RH 4LVHC 1CT8A 3O3BB 4EQ3A 1QR4A 2NY7L 1ZA6A 3HMWH 1T5XA 5I71C 35C8L 3UZQA 3DTXB 5IVXF 4ODXB 2HKHH 2Z31C 3VFPA 4PG9B 3ARGB 1JNLL 3OR6B 2MOVA 3U82B 4E0RA 1HHKA 1QQDB 3MPCA 3VXSA 3BW9B 1T03H 5TGBB 2VXSH 4XWGH 5DA4A 3NFPB 3EYUH 3CVHA 3B83A 3MRPB 2Q8BL 2D4DA 4WU5A 5C7XL 3ARFB 1D5MA 4F3FB 4JFFD 5EOCL 1W0VA 1I7UB 4S1DC 4HXAL 4ODWB 1VHPA 4XP4L 4XBEL 3O3BA 3WHE1 2D03L 4N8CH 1UACH 4KHXH 3PHSA 4QTIL 4HS8L 5KOVC 3DTXA 3D0VB 4W4OA 4MDIB 2LVEA 4PG9A 3ARGA 3OR6A 1QQDA 2A6JB 2HTLD 2OYPA 5A2IH 5LGKA 1HYSD 3BW9A 4OLXH 4WEBL 5TGBA 3SKOB 1JZ4A 3NFPA 4J12A 2V9RA 2B7DT 1KIRB 3ZTNH 2FGWH 3BKCH 4YC2C 3U6RB 3KYMB 4P46D 1BOGB 3ARFA 4F3FA 5F9OH 3SKUD 4JQVC 3L3GB 2N7AA 1JE6A 1I7UA 3FOLB 4OCWL 4CVXA 5CZVL 1UA6H 3MV9B 4ODWA 3S34H 1QKZL 1MAML 5I76B 5JXAH 4JHBA 3K8LA 5A43C 1U3HD 4NZUH 3WBDA 1ADQH 3D0VA 1JRHL 2Z92B 4MDIA 3CSGA 4WWKA 5JXEA 3ILQC 2A6JA 2HRPL 2B2XH 4YDJB 3SKOA 4D0CB 4JZJB 3P73B 1KIRA 4PRHB 2DJSA 3U6RA 2R4RH 1DQQB 3KYMA 2NY2D 3H9SD 2AVGA 1F00I 1XGYL 2Y36H 3PWLB 5FGBA 1XZ0A 5ITFB 1BOGA 4UNTA 5IQ7L 3L3GA 4Z7VE 3FOLA 4EXKA 2OQJB 3MV9A 4YWGH 4ZUVA 1CK0L 3FN0H 4NCC2 1CCZA 2BY2A 5I76A 4W6WB 1P4BL 1VESA 3OKKB 3O41B 3AM8A 1JPTH 3UJTH 2Z92A 2YKLL 2Y6SD 3Q5YA 4M1DL 2EIEA 2YRPA 1WSST 2X4OB 3BQUB 2NY1B 3DMMC 1AC0A 5FM5M 4D0CA 1V3MA 1JGDB 4TSCL 3P73A 4HPYL 1RUKH 1QRNE 5SWSB 1DQQA 3MLRL 1RURL 4FFZH 3PWLA 4G9DB 5A2LH 3VWJC 5IROA 4OI9A 5ITFA 3EO9L 3Q48A 4S1SL 3SDCC 5F9AC 3QNXB 1FNSH 4L4VD 4CBPA 4QHUB 4HXBL 1N26A 2QV2A 2OQJA 3FQUB 4TNVK 3G9VA 3S5LG 1WTLA 3HA0A 4HS6B 4V1DB 1MAJA 2EYTB 3RX8A 3FL7A 2XKNB 3OKKA 3O41A 3SJVB 5C8JB 1KCRL 4HHAA 2FB4H 4KUCD 1GIGH 1S5HA 2FJHA 2X4OA 2WWKT 3BQUA 1B9ZA 4Z7WE 5EA0H 4UINH 4LSUL 1JGDA 3O6LL 3MA9H 3S9DB 4BZYA 2PETA 5E5RB 5AYUH 5SWSA 4GAJL 4G9DA 2HJLB 1CVSC 1ZMYA 3SKJL 2Y9RT 3BDXA 3QNXA 5KS9F 1T89A 3C87A 1LHZA 4QHUA 3Q5OA 3FQUA 1YC7A 5C0JB 5C0NC 1NCBL 4HS6A 4V1DA 4WFHE 4XXDB 4IRZH 3MBEB 2EYTA 4KMLB 2DM7A 4K3JH 2MJWA 4FOMA 4LU5H 2XKNA 3GSVB 1I3UA 5C8JA 1QRND 3UTZB 3ZDYF 1KULA 1CFQB 4U1SB 4JPWL 2F9BT 4FQQA 1A7QL 5C6PB 4P3WA 1GZPB 3BESR 4HUVB 4HUWB 4M62L 4HWBA 3S36X 4XNYH 4HIXL 3RBSA 4QHLB 5D71L 1GZQB 2FHFA 1YEIL 4IDLA 5FUCC 4S1QL 1NFKA 2HJLA 1JBJA 4Y4KB 1F4XL 4GMSL 3K3QA 3OF6D 3O9WD 1A6UL 5C0JA 4XXDA 1CI5A 2A9MH 2YZ8A 4HBQA 1VEPA 3T65B 3HS0B 3GSVA 1DP0A 3V6OA 2FGZA 4FQLH 3UTZA 1CFQA 2DQJH 3HZVB 5D96C 5CBAB 2VDPH 5FEBA 1WFOA 1PQZB 4YDLC 1GZPA 4HUVA 4YGVB 4NDMB 2HT4D 1LO3L 2G9HA 2OTWB 1MFBL 1GZQA 3OR7B 4XBGB 4ZTPL 5BO1L 1BD2B 5GGRY 4NN7B 4Y4KA 4PJEF 3L3KB 1NBQA 5CIPB 2FATH 3I2CL 3P11H 3B8SA 3MOBL 5HDQL 3E3QC 4M6MH 4UU9B 3FO9B 4MA7L 5CWSB 3T65A 3HS0A 4M9OA 2BSTB 5CSZB 3VG0L 3HZVA 1MRCH 1FRGL 5CBAA 5CJ8A 1TZGH 2NY0B 1PQZA 1JHKL 1WF5A 4TVSa 4YGVA 4NDMA 1CD1B 3BX7C 1NBVH 5DMIH 1W8NA 2OTWA 1EXUB 1FZOB 4HLZG 3EOBB 3OR7A 5D1XD 4XBGA 1NBZB 1BD2A 3MLYH 1PBYA 2V2XB 3TC9A 4JHZA 2EDQA 3D2UB 1MFEL 3L3KA 3FHQA 5CIPA 5IESH 2Z31B 5D2LB 2BVEA 3PGFH 5D8JH 3FO9A 5CWSA 3OKDB 5JOPE 4UTAL 1KJ2A 4LDEB 4EUPH 5E00B 5B39B 4CKVX 1EV2E 1FH5L 2FD6H 1BOYA 4KK8C 3VA2C 2Y07H 5CSZA 4O02H 4FQPA 2J6EL 2FX7H 3GM0A 3UZVB 5MERB 4U6XB 4DVRL 3NTCH 1CD1A 1WZ1L 4OZIB 2IJ0C 5I1KH 3MV7E 4OD3H 3IT8D 4LVNB 1EXUA 3NMEA 4JFDE 1FZOA 1GXEA 3GMRB 3EOBA 1BZ7B 4JVWA 4Z8FH 1NBZA 2PYEE 3NBNA 3TH4T 4KJYB 3VCLB 2V2XA 3UYOD 3D2UA 1IGJB 2W38A 4ZS6C 1IAII 2Z31A 2WBJC 4OZGF 5D2LA 4ENEC 1AQKH 3P40A 2J8UE 1K9TA 3OKDA 3CK0L 4P57B 1IEAB 1EO5A 2P5EE 1PJ9A 5TQ2H 5E00A 5B39A 1EFXB 3N9GL 4CUCA 4RGNC 3WL9B 1CQYA 5B39G 3TGXA 4YC2B 5GRWA 5EB9A 4CU8A 2J4WH 5MERA 4U6XA 3I3BA 1NEZG 3AXLB 1MJ8L 3GMRA 3W0WD 4DGYH 5GS2H 1IAKB 4HEME 5JOPD 3VCLA 4KJYA 3KDMA 1IGJA 2KKQA 4KY1L 3CXDL 2YC1B 3QWOB 4PTUB 1CD9B 4P57A 1IMHC 1IEAA 4P5MB 3VXUB 1EFXA 2V17H 3HN3A 3WL9A 2ESVB 4XI5D 1UH2A 3FOMB 1J0KA 2DQIL 3VXMB 3RIFK 3K7UA 5K9JL 4PP1C 2HTKC 4H8WH 2DI8A 2Y1VA 4JO4H 4OKVB 1AXTH 5IVOA 3AXLA 4P2QD 2FBOJ 3HG1B 1IAKA 2XQBL 1KF9B 3PQYB 1PYWB 2HVKB 3TVMC 3DVFA 3P0VH 4XCCH 3FMGH 2YC1A 3QWOA 3NCEB 3RDTD 4POZD 1IC7H 1JTPA 3VMPA 4PB0L 5HHMB 3AREC 4PTUA 1JWMB 4P5MA 1KIQB 3VXUA 2RJMA 3U30C 1MIMH 2ESVA 2X1PA 1GC1L 3DXAA 3REVB 2G60L 1AD9B 3FOMA 5CJXC 2BHUA 2VKWA 3VXMA 5FCUL 3JWDL 3SDCB 4TUKL 3P4MB 5DMKB 4NP4L 1A14L 3RZCD 4GAYA 4OKVA 3RIAK 2DRUA 3J8F7 4PJ5A 3HG1A 3BN3B 5DS8B 4YXKL 1PYWA 2HVKA 3NAAL 1E6OH 4HUXB 4ODTL 3W11C 2XN9B 1RUML 9CGTA 5KVGL 1EH9A 2X40A 4OGYL 2B4CL 4X7SL 2F58H 2N1KA 5FFLA 2DI7A 3T3PE 3MJ9A 1ONQB 1KIQA 2X89D 3TA3C 3VXSD 2UZIH 4LEXL 43CAB 4EI5C 3REVA 5SX5H 1BVKB 1AD9A 3OB0K 3HR5B 2PR4H 4NZRL 3SDCA 5ENWB 2XRAH 2D7OA 2EICA 1QBMH 3CZJA 3P4MA 4U1HB 5DMKA 4XP9H 1EGJH 1F4WH 4RAUA 2CK2A 2F8OA 5EORH 3VI3F 4AMKH 3A6BL 4XPAH 4QRPD 3I02B 5DS8A 4HUXA 4GS7C 3UYRH 5AG8A 2GJ6B 1JZ5A 4LQFH 2XN9A 4FQIH 4KV5E 3KHOA 3EYOB 4FRWA 4F37F 3ARGD 3MV9E 5A2FA 4L8CB 1ONQA 1Z5LA 1I9RH 1KPVB 1EAPB 5GGVY 1BP3B 43CAA 1I85C 3V6ZB 1RU9H 2B0SH 4ZPVB 1BVKA 2LU7A 3QCVL 3RWGA 3AS3A 5L7XH 1MHPL 3FO2B 5ENWA 1DN2A 4U1HA 1LK3H 3ARFD 4HKJB 3S3JA 4MLSA 3D1MC 4X6BB 4G6JL 5H37G 1NL0L 2MNUA 1EA9C 3SY0B 3LZFL 3I02A 4KJWC 5CZXC 3LS4H 4J1UA 5DC9B 5C0DB 1NSNH 1RIUL 2CIIA 2GJ6A 5I2IA 4NO5B 4M7LH 5D96B 2VXUL 3EYOA 4L8CA 5FM5O 1OM3L 5JXED 3S97C 3GRWH 4I9WD 1KPVA 1AI1L 1EAPA 8FABA 4M43H 3V6ZA 1Q0XL 4ZPVA 5FDYA 2MCG1 1Z9SA 2X6MA 5HYSG 1NLBH 1VGEL 2D7NA 3FO2A 4DGVL 1QSFB 5JQHC 2PXYB 5HDBF 4HKJA 1U58B 3MCLH 4U49A 1MUJA 3SY0A 4GW4B 1QFWH 3CXHK 5SWSE 5C0DA 3RKDD 4LKXB 4LAQH 12E8H 5KVDH 4BA8A 1IVLA 4NO5A 4ZSOE 4FZEL 4JR9H 4A2MA 2RGSA 1HQRB 4NKIL 2VDKL 3R8QA 5I66B 4J3UA 4V1DE 5CILL 4XXCC 1LE9B 3QQ3A 4LLVA 1ZANL 3PL6B 4PRHD 4H1LB 1XGUB 2R2BB 4DKFL 2PXYA 2VAAA 4GKOA 5MEQB 1U58A 5HGAB 3TLRA 4NZTL 4PJGB 3WCYA 4PG2C 4YDKH 1JZ6A 2IMNA 1K8DB 4GW4A 1U95B 4JG1L 4LKXA 1OSZB 1RZ8B 2BRQA 4PY8I 4JHWH 3G5VB 2FX9H 3DOSA 3R0NA 3ZYIA 3LB6C 3N1QC 5DHXB 4K9EC 3A6CH 1TCRB 1HQRA 3MLXL 4LHUB 3ARZA 3FCTB 4ZFFB 5JQ6L 3BQUD 1LE9A 2NY1D 4M48L 1HDMB 5FDWB 1B0RA 3PL6A 1H3XA 4ZPTB 2XT1B 3V6OE 5HVFB 2OK0L 4H1LA 1M7XA 1S5IL 1XGUA 1VEMA 5SWSD 4WFEE 3LHPH 2R2BA 5FXCH 2WBJB 5MEQA 5HGAA 4PJEB 4PJGA 4KHTH 2AEIT 2FBJL 4R4FH 1K4DB 1K8DA 2V2WB 2XY2A 1U95A 4LPVA 1C8PA 1IT9L 4V1DD 1R3KB 2P7TB 4DZ8A 1OSZA 1EMTL 2EDFA 1RZ8A 3WIHH 4YQXL 1EHLL 3ARXA 1HHJB 2OJZH 2AEWA 5C3TA 3SJVD 1TCRA 3LKNB 4HUUB 3PUCA 4LHUA 3FCTA 4N0CC 4M1CD 4MAUH 1E4XH 4ZFFA 1A2YB 1CZ8H 3D6GA 4FFYH 1HDMA 3F6IA 4ZPTA 2H26B 2MQ3A 2OTPA 1BJ8A 4IOFD 1KN2H 2WBJA 1Q8MA 1P6AB 3NCBB 1UWGH 4R0LB 5HTSA 3QRGL 1ZLVK 3KLSA 5D6DC 1K4DA 1N4XL 5GS0C 2V2WA 2DKSA 1ZLVH 4D9LH 1R3KA 1BD2E 2P7TA 3C5JB 3MBED 1KCSH 3KAAA 5B8CC 2VC2L 1QLFB 1HHJA 3FB5B 3T4AB 4NC2B 4OCXH 2CSPA 5KVEH 4PD4K 4TVPL 3LKNA 4WFED 5SWZB 3UAJC 1U8MB 2LQRA 1QSED 3H8NA 4KGJA 5GGSA 1A2YA 2UY7A 1ZLUK 3S36H 1BX2B 1V8HA 4ERSH 2GW5A 2OXHA 2X05A 4OI7A 3HUJF 1H8NA 3TWCH 4Z78B 2H26A 1B2WH 4M6OL 3VU2A 4E5XB 1Q9OB 4O58L 4YXHH 3OHXB 2AJUL 4QHMB 4R0LA 1D6EB 1N7ML 2BRRH 3NA4A 3U30B 4LLUB 1CS6A 3C5JA 2UZYB 4P2OD 3RVTC 4MNGB 1NFDB 5FKAB 1JPGB 1QLFA 3HTLX 3FB5A 1I9JL 3QHTC 3T4AA 4U1LB 3BZ4B 4WGVB 2ZCKL 2GQHA 5D2LE 4KTEL 5SWZA 1U8MA 5KANI 2OL3H 1T2QL 3TN0C 4YFEA 3H7BA 3GJFK 1CVRA 1G9NH 1BX2A 5C2BH 5K9KB 3WN5C 3GJFH 4Z78A 3EZ8A 5DD1H 4BQ6A 4N0YH 4RDQG 3I6LD 3OTTA 4E5XA 1Q9OA 3KPSB 4HBCH 4GRLC 1GH7A 2H2PD 5BVPL 4QHMA 1D6EA 4BKLB 1FHGA 1V7NL 2DF3A 5FGRA 1VPOH 3HI1A 1MFAL 3TA3B 3GNML 3K1DA 4LLUA 5KBNC 1CFVL 4V2BA 3R8BB 3LRSB 4MNGA 1NFDA 4ODSH 5C9KA 1JPGA 4HZAA 5CJXA 4Z7NE 1HN1A 4U1LA 3BZ4A 2ED8A 5CJQL 1JPSH 1Z3GL 2MQCA 1YEFL 5GPRA 2EH7H 2AK1H 4IJ3C 1DCLA 4JGUA 3D39B 5K9KA 1KB5B 4HULB 1C5BH 1WCBB 5TF1H 4GS7B 4XP1L 5GIRB 2BJML 5E2UH 3TO4B 4LLYB 1QRKA 3D2UD 4P59L 1BJ1H 4BKLA 3BHBB 3JTTB 2Z31D 2P46B 3BP5B 1RULH 2EE2A 3HB3C 4ZO8A 4YHYC 4C4KT 3TA3A 2NYYC 1KELH 4RFNB 1S7XA 3W5NA 4M7ZB 3BWAB 1SY6A 3WS6C 3B2VH 1A6TB 1C1EH 3UMTA 1P7KB 4LPWA 4UT9L 4X80L 4HCRH 3KR3L 4ONFL 3I50L 4OFPA 4AEEA 1URLA 2BNQD 3VXUE 5D72H 3D39A 4D3CH 1KB5A 2ESVE 3DXAE 1WCBA 5AUMB 5GIRA 1BZQK 2QBWA 2ZCLL 3GKWH 3F58L 4LLYA 4OT1H 3TO4A 2FECI 3DURB 4PPTA 3V8OA 4BSWB 4KQ3H 5MEND 3BHBA 3JTTA 2X41A 4ZFGL 2W9DL 1CR9L 3BP5A 3WUWB 2MTPA 4XTRC 2YRLA 4PJ5E 1FVDB 4BH7B 3HG1E 2MPAH 2E7MA 2DLFL 1I85A 3BWAA 5EZJB 2VTFA 3STBA 3R1GH 1A6TA 1P7KA 1Z2KA 3BGFB 1YNKH 3REWB 5IHUH 1MFDL 1P9MC 1ZSDB 1TTFA 4LRIC 4XCFL 4ZOCA 4NFCA 4WI9A 3AS1A 4QHKJ 3QQ9D 2EE6A 3G04A 3TZVD 5AUMA 2YA0A 1Z6JT 2R1XB 1DSFL 3DURA 2EXWC 4BSWA 1MQKH 3WUWA 2PTUA 2ITDB 4MJ5B 4XPFH 3VH8A 2IGFH 4BH7A 2XACC 5C0RL 3VH8G 3HI6L 1ZE3C 5EZJA 3VXUD 1RUQH 1OAKH 3SQBA 2VDOH 4OQTA 2XN9E 5FYJU 2CJUH 2E6QA 4LSPH 3REWA 1VGKB 4GAFB 4JCMA 3VXMD 5MHSD 1ZSDA 5DJ2B 1KXQE 4K3DL 5TQ0H 1FN4B 4PREB 5K9QG 1QBAA 1A7NH 2COQA 4YHKL 3WXVH 3IDNA 5GISH 3CMOH 3HG1D 5I0ZA 2R1XA 3PQYD 4KDVA 3MLVH 4G6KH 4KROD 4FQ2L 4P5KB 1HQ4B 1CGSH 3MLTB 3CAFA 5DR5L 4LKCB 3DYPA 5HYJB 2ITDA 3HKFA 4OCRL 4MJ5A 5HHMD 1YMHB 4XXCA 4NJAL 4ONGL 3HMXA 3WDJA 1IGIH 3NZ8B 4BJLA 1Z0NA 4D0BB 2GJ6E 1FVCB 3O8XC 3RX5A 3ULSB 5T3ZH 1VGKA 3THMH 1XGTB 2E8ZA 1ROWA 4O5LL 5DJ2A 4KKNA 4F7MB 3ALWA 1FN4A 4PREA 4PG2A 2DJUA 3DUHA 2ZUQC 3QNZB 3KPLB 4X5LA 4S2SB 2JKXA 5FUCE 1L6XA 3F7VB 5ID1B 1JV5B 1E0OB 3WYRA 4P5KA 1UYWL 3LV3B 5ESVB 1HQ4A 1K3IA 3MLTA 1PSKL 1IJ9A 4LKCA 5HYJA 3GUTB 4JFXB 1VADB 1YMHA 2H1PH 2VLLB 3RWHB 1BJMA 1MWAB 4Z7UB 4L8DB 4ZXBC 1OTTC 2DQHH 3NZ8A 4YHLL 4D0BA 1FVCA 4MXVF 2FRGP 2R0WL 3ULSA 1AJ7H 4JFQA 2APTA 2Q76B 1YZZA 3LKOA 1XGTA 3TIDB 5DJZB 1S7TA 1AY1L 3QH3B 1IM9B 4PRAB 3HNTH 1SEQH 4F7MA 3JVGA 4JO2H 4MCYB 2GIYA 5IJKC 3QNZA 1FL5B 3KPLA 4S2SA 4JCLA 1A6WL 1IKFH 1NCWL 5B8CB 3F5WB 3HC4H 4X6FB 3F7VA 5ID1A 1JV5A 1KEMH 2GJ6D 2C3VB 4GG8B 5ICYB 2KZWA 3LV3A 1N0XL 1UJ3B 1IC5H 1XAUA 3GUTA 4JFXA 4FFVC 1QLEH 1VADA 5HY9B 2VLLA 1MWAA 1QSZA 4Z7UA 4E42B 1CDYA 1MHCB 1LQSR 4HEPG 1IARB 2R15A 4TSBH 2HG5B 2L7JA 2Q76A 4GSDH 1SMAA 2C3XA 2W59A 2X10A 5D1ZB 3VXRB 1UT9A 2PO6C 3TIDA 5DJZA 4FHBD 1RI8A 3OAUL 3QH3A 4TPRL 4PRAA 3VWKD 3LAFA 3LEVL 4ZG1A 5E8PB 5D6DA 2X4PB 3BEWB 4X9IA 1FL5A 1HZHL 3FB6B 3QO1B 3I9GL 1PG7X 3ORJA 4OQ1A 1NAML 3TO2B 4KMQA 5B8CA 3F5WA 4X6FA 5EOQL 1CXFA 1C08B 2C3VA 4ZS7L 4GG8A 2VABB 5ICYA 2DMBA 4F7PB 4PLJC 4I8DA 1UJ3A 3TN0B 4OIBA 4PJGE 4HK0B 1RJLB 5HY9A 1U6AL 3V4VH 1MCPH 1RPQA 4E42A 4PS4H 5I1GL 4TRPH 3WN5B 4YHML 1MHCA 1CU4L 3IKKA 2HG5A 2YN3A 3LIZH 4KRMB 4GRLB 3SGEH 5D1ZA 3VXRA 4JRWA 1TFHA 1OWRM 1QSFD 4U3CA 4XPBH 1QO3B 4N9OB 2PXYD 5E8PA 3BAEL 1EEQA 4GQ9H 1ZLSL 2X4PA 3BEWA 3FB6A 3QO1A 2FH6A 4XB7A 3TO2A 3ZSSA 3MLWL 2EEAA 2NR6D 3NIDF 5CGMA 1C08A 3EYQD 4F7PA 1FFPB 4LDLB 5JMOC 3TN0A 4MA8L 1ED3B 4HK0A 1RJLA 1QVOB 4M8QB 1NCCH 2WLZA 3HC0B 4N90E 3WN5A 4RGNE 2GCYB 4Z18A 4M3JA 2W0PA 3PL6D 4LP4A 4GRLA 3KYKL 1U8QB 1UQSB 1L0QA 4JPKH 5EBWB 3ZLQC 1QO3A 4NHCH 1NAKH 1JGVL 3B5TA 2W9EL 1SHMA 4NN5B 1KIPB 1Z0MA 2EC9T 3AAZB 5HGHB 1T7ZA 1K2DA 2AJYL 5IT2L 4GMTL 1FFPA 4BQ8A 3NFSL 4WUUA 1OTSC 1J5OL 4APQB 3IDGB 1EFQA 4M8QA 3PV7A 3RX7A 1KGCE 3S8WA 3HC0A 4LHUD 1BBDL 3WUZA 3T2NH 4E41B 3KG5A 2P8LB 1J8HD 1U8QA 3ULUH 2CO7B 1DQML 1UQSA 5SWZE 5EBWA 2NQCA 3Q6GH 3RIAF 2RCSL 4Y7MA 1B88A 1JF6A 3HHRB 4ENED 2HT2C 4TULL 4LIQL 1RMFL 4XZUB 4I77L 5CCKH 1OCWH 2FLRT 5C3LD 1TTGA 3WS6A 2ZSVB 3AAZA 4N90D 2QQNL 4MXWL 3ZL4L 4Q74A 3VD5A 3BMWA 3G6JF 3LQZB 1YNTB 4APQA 4DUVA 3IDGA 3SKMB 4G6MH 4NWTL 4P2CG 2NW2B 3RQ3A 2BSED 5F9DC 4E41A 4OUUB 4MNGE 5KVFL 1JF1B 2P8LA 4CN1A 4U1KB 4JLRB 4OFYA 4J4PC 5L9DH 4P0DA 1F3RB 4RX4D 4X4ZA 5CINH 4XZUA 5EG6C 1OT1A 3WNPA 3GB7B 1KGCD 3AFLA 1MJJB 3QAZC 3LQZA 4HG4J 1P9MA 1YNTA 4F57H 1GGTA 1A0QH 4V2CB 3PIQB 5SWZD 3SKMA 4PP1D 2HTKD 4LRIA 1UWEL 1CDUA 2NW2A 5IGXH 4PJBB 4OUUA 5EPMB 2OM5A 2XPGB 2ZUTA 4LVOC 1JF1A 3T0WA 4U1KA 4JLRA 4IMLB 3KPPB 1PKQA 2AS5M 5I9QC 3ARRA 4H5SB 5GRZA 1OAXL 1KBGH 3D39E 3ISWA 3JTSB 4KXZH 3GB7A 1FO0H 3O8XB 1MJJA 4C56B 4EEEA 1YEHH 1UC6A 3VA6A 1MRDH 4OUOA 5ADPH 1KYOJ 4PB9L 1BF8A 3L3JB 4WO4C 4M1GH 2Y06L 2YD3A 4BFBD 5IKCB 35C8H 4LVEA 4JDTH 3C2AH 3SDXF 4XVUC 4PJBA 1JNLH 4M03A 5EPMA 4MXQD 4NC0B 5IBLD 2XPGA 4X5WB 3EO1B 3BYYA 2IH1B 3W11D 5HI3D 3KPSD 4IMLA 1F4YH 3WDHA 4IRSC 3TYFB 3KPPA 4H5SA 3LD8B 2YK1H 1NMBL 3WIIL 4ZXBB 5EOCH 1CXLA 3O8XA 1KTRL 2J5LC 4C56A 2F5BH 4HXAH 4X6DF 2A2QT 5BCAA 2VSCA 3L3JA 3RTQC 3MRDB 4QTIH 1S9KC 2GI7A 5EDXA 2HJFB 2VDML 5KSVA 3OAYH 3EO1A 4X5WA 2IH1A 3QEHB 4YFLI 1P5VA 2GSIB 3CSBA 3TO4D 3M45A 1C16B 1AH1A 1MEXL 2Q7YB 4OF8A 5JORB 2D9CA 4AZ8A 1KTLB 2R8SH 4ZXBA 2O5YL 3QP3A 4OI8A 5EC2B 5CZVH 4OCWH 2B39A 1QNZL 3U4EB 2QQQA 2EYRB 1J11A 2ATKB 2PO6B 3MRDA 1FAIL 4Y4HC 5HVGB 2F53B 3RUGE 1T1ZB 2EIZB 2NY3C 5IJKA 2HJFA 4GH7B 3QEQA 3W82A 1R3JB 5I8KL 3OKMA 3NIGE 1YEDB 3QEHA 1HHGB 1LDPL 1DBAH 1FJ1B 2GSIA 4MX7B 3DPBA 4UI2A 1C16A 4K7PY 3C6LC 5EZIL 4C59B 5CD3B 2Q7YA 5MP6L 5JORA 1KTLA 2XZZA 5FHAH 2NMSA 2FEEL 3GZKA 5I1DB 1X7QB 1OAZL 5SWQB 4YK4B 3U4EA 4OBRA 1CK0H 3BN9C 4XT1C 2D31B 5DK2B 1SMOA 2ATKA 2PO6A 1GSMA 3N1PC 4K8RL 3U0WL 5HYJE 2F53A 3SN6N 4PY7B 4PRPA 4HQQH 3QXUA 1T1ZA 1RK1B 1R3JA 3WFZA 3K81A 1DR9A 4PTTB 3JWOL 4GLRI 1UWXH 1JHLH 1MCOH 1E6JL 5K9QI 1DBKL 1WEJL 5LKNA 1DBBH 1RZKC 1FJ1A 4K8RD 4KPHL 4MX7A 4TYUA 4RAVB 3GSWB 1RURH 4ZD3H 3P2TA 1I3RB 5CD3A 3LRGA 4PLKD 3EO9H 4EUPB 1EK3A 3VRLF 5CZKA 4LOUD 2FCBA 3PHQB 3T0EB 2VLKB 1QSVA 2P43B 3OL2A 1X7QA 1OPGL 5SWQA 2B1AH 4OM1L 4X7TB 2D31A 5DK2A 5FM8A 2DB8A 4XCYB 4PY7A 1AGDB 4FQCH 3QNYB 2DQTL 3H2WA 1GHFL 4Z7UE 1RK1A 4UILL 1INEH 1R0AL 1RSFA 4L9DA 4PTTA 3W5MA 5ANMB 4LSVL 4WTZG 5FYKE 1TZIB 4WUKL 2FHCA 5JLZB 3BEVB 4RAVA 3GSWA 5DJAB 1RJCA 3PJSB 1I3RA 1PW3A 4JFEB 4NFDA 4ZNEA 1CDCA 4EUPA 3PP3K 1OT2A 3WFCH 2VLKA 4JQIL 2YPLD 5D7LD 4KKCC 3OPZL 1MELA 1P6FA 2APFA 2OI9C 4HJJL 4X7TA 43C9B 1FNLA 1T2XA 1DJSA 4PLOB 1X4ZA 5I74C 4XAWL 4XCYA 3T77B 1AGDA 5FUZL 3QNYA 4YHIB 3NN8B 1A5FH 4CGTA 4LSRH 2I9TB 5KSAB 5ANMA 4LSTH 4M62H 1AC6A 3VXRE 5GXBB 1TZIA 4P9HL 3QDGB 5D71H 3NIFF 5JLZA 3BEVA 1W8OA 4P3DA 1GVIA 3CC5B 5DJAA 4CU7A 1VFOA 3PJSA 3TT3L 3V5DB 3LH2L 4U4BA 4GMSH 5D9SB 5AD0B 4XPHL 3NCJL 4HJ0C 1II4E 4FP8L 1VEOA 4KQ4H 5CJ5A 1INDH 5D7SL 2IANB 2Y72A 5FYKD 3PNWB 4JFHE 3T77A 4YHIA 4JB9L 3M07A 1IM9D 4EBQH 2J12B 3EOAB 3VRJB 2I9TA 1BFOB 5GS0D 5KSAA 2JF1A 1LO3H 4UMGA 3QDGA 3IYLW 4F33B 5BO1H 1OAQL 3QG7H 5DTFA 1T83C 3NCCB 3V5DA 3ARBB 5D9SA 4AM0B 5AD0A 1UM4L 2R39A 5EUKB 5FYLL 4NNXB 3MOBH 4QRUB 2FLBT 5GGSY 2R2HB 2IANA 4KI5C 4UUJB 1X4YA 2YD8A 4WUUE 4J4PA 5D1ZD 3PNWA 2J8HA 2YUZA 5GSVB 4NYLB 2ADFL 5IB4B 1Z9OA 3EOAA 3QDMB 3VRJA 3PDOB 1BFOA 1OAYH 4OGXH 4L4TE 4BH8B 2XXMB 1PY9A 1I1RA 4ZO9A 4F33A 5CHNB 4WO4B 1FBIH 2APWA 3ARBA 3TN0D 2NTFB 4AM0A 5ICZB 4Y16C 3VI4E 5EUKA 1XMWA 4NNXA 1OTUC 4QRUA 1J8KA 2VN4A 2R2HA 4UTAH 4UUJA 3OXRB 1ZLWK 1RIHH 4WI3A 3RY5A 4IRSB 3GM8A 4XX1G 5GSVA 3MC0A 5HYFA 2HKHL 1FH5H 4NYLA 5IB4A 1KPRA 3PF2A 4MB3A 1U8LB 4MVBD 3QDMA 1T03L 3S3SA 4E41E 1Q38A 3PWNB 2VXSL 4XWGL 2J5LB 1WZ1H 3EYUL 4J3WA 5CD5C 4BH8A 5KJRH 2I26N 2AQ1A 5CHNA 4WO4A 4YZFF 3ZE2E 1CXHA 3GK8H 2A77H 2XICA 2NTFA 1P69B 5ICZA 1VKXB 1MCJA 5FKPB 1PG7W 3RL1B 3ELAT 2NW3B 1WIPA 3JV5A 4N8CL 1A1OB 4P9MH 1C5CH 3FONB 3P4LA 2CXKA 5EUOF 4KHXL 1VENA 3WV0A 4AT6B 4OZFG 3OXRA 1F4AA 5JHDB 3N9GH 1PX4A 4IRSA 4S11A 4RFEB 3NA9H 1J0IA 1KXVC 1U8LA 2A6IB 1WWBX 4OLXL 3RUGF 1FYTB 5BW7C 3PWNA 2NYYD 3MOAL 4MQ7A 4OF6A 3ZTNL 1U41A 2FGWL 3BKCL 3ZZ1A 4Y4HB 1PKQE 2UZXB 3ULVE 4JREC 4BZ2H 3HAEB 3RP1A 4APQD 1VKXA 5FKPA 3CXDH 1S9XB 5GQBA 3RL1A 3S34L 2NW3A 5DVKA 1A1OA 3FONA 5CUSL 4AT6A 4E41D 1S7VB 4OKDA 5JXAL 3A6OA 2CKBA 4NZUL 5JHDA 1ADQL 5JA9A 4HWUA 4RFEA 3IU3B 3QB7C 1WAAA 1LP9B 4YUEH 3C6LB 2A6IA 2R9HC 2DQIH 3ARPA 2B2XL 4XTRD 4PJBE 2VIRB 5TH2A 1A4JB 3CX2A 5FV1L 2XI9A 3GMNB 5CKAA 2Y36L 5ELIA 5GRVK 1ERNA 3W2DH 5BV7C 2GEEA 4Y4HA 3HAEA 2A9NH 3HAEG 3GSNH 5T1MB 1S9XA 3QA3B 3FN0L 4C56E 1S7VA 2QL1A 4QWWC 2CH8A 3JUZA 4O2EB 4I0CC 3IU3A 3UJTL 1LP9A 1LMKA 2I5YH 3L5JA 2H9GB 2CMRH 3C6LA 1T1WB 3BZEA 4PJHB 3Q0HA 4R7NA 4YIQB 5FCUH 1HK6A 3ULVD 5DO2D 2VIRA 1A4JA 2VE6B 1A14H 3O6MH 5GJSL 3FN3A 1RUKL 4PGDB 2D3VA 3GMNA 5C08B 2ZG3A 1NCNA 4PJAB 1R5WA 4YXKH 4Y2DC 5J1SC 3NAAH 2A38A 1FNSL 1T0NB 1Y6KR 2QEJA 3MRHB 5T1MA 5KVGH 4OGYH 2XIDA 3QA3A 2B4CH 1A7OL 4X7SH 3BP4B 1L7IH 3QSKB 1LGVA 2KZ1B 4Y5XB 3RNKB 4LEXH 3C60C 1OF2B 1B4JH 4RMUA 2ZP0T 2FB4L 1ZK9A 2H9GA 1TJIH 1T1WA 4PJHA 2M1KA 3VGAC 4A2LA 4MS8C 4NRXB 3QEQE 5EA0L 3RBGA 4UINL 1CF8H 1G6RB 3VFGH 2VE6A 2V7NB 3FQNB 2XA8H 3MA9L 3O3DB 1J18A 4J3OC 2OI9B 4PGDA 5AYUL 4C56D 1H3WM 5C08A 4PJAA 5I74B 4XVSH 3GSUB 4WFFE 1W0YT 3L1OL 1T0NA 2R56H 2FJFB 3MRHA 4KC3B 3NZHH 2VZ3A 1LEIB 4IRZL 4K3JL 3BP4A 1UZ8B 3QUXB 4LU5L 4Y5XA 3RNKA 2AJ3B 1DLFL 1S9VB 2VISB 1KSRA 1YN7B 2F53E 2YHGA 3SE8H 4PRPE 1EDQA 4X0KB 4NRXA 1MHPH 1G84A 5DD5L 1FGVL 3PWPD 1G6RA 3GIZH 4HAGA 1PY4A 4XNYL 2V7NA 3FQNA 4ZXBD 1OTTD 3O3DA 4O2CB 5LGHH 1NL0H 3DHMA 2HFTA 3DO3A 1HKFA 3GSUA 4U7MA 2FJFA 3BIBX 4YFDB 2GUOB 3FTGB 4LFHD 3AY4C 2HWZH 1QFUH 6FABH 1LEIA 2A9ML 3ZKQD 5IMKB 3QHFH 1UZ8A 1X3DA 3QUXA 1CGVA 1KCVL 1AI1H 2AJ3A 2OR9H 2W9LA 3FRPG 3X17A 1Q0XH 1S9VA 2VISA 4FQLL 1YN7A 2DQJL 2ZJSH 2VDPL 4X0KA 4WFFD 4FFVD 3SEPA 5J6GB 2J1KA 5DQDH 2CRMA 4WWID 2YD4A 4O2CA 3N0PB 3DHJA 1NGQL 4KRPC 2FR4B 5JOFB 1BWMA 3D5OF 2PO6D 4HC1H 2FATL 4ZNEE 1FFOB 1U8NB 2F53D 2GUOA 3BKJH 4FZEH 3FTGA 4M6ML 1GJIA 3ULUF 4NKIH 1CLYH 5IMKA 4RBPH 2X1OA 2VUYA 5SX4H 5CILH 5JPNB 5I16B 2HYMA 3DLQR 1IC4H 3B2UC 2YD1A 3RFZC 1KC5H 4OZHB 3O3AA 1TZGL 3GMQB 5H2BA 3T08A 4DKFH 3BH8B 4Y16B 4POUB 4BSVB 4POYA 2IF7A 4XHQA 5J6GA 4WHYG 5ANME 2Y5TB 4NKQB 1XFPA 2AQ2A 5F7UA 3MLYL 4Y2OA 4AQOA 3BGAA 5JOFA 1S78D 3QI9B 4M4PA 4PJ7F 1KJ2L 2X4TA 1FFOA 3ZTJH 3IU4H 1QG3A 5D8JL 4F7EB 4PJDF 3MREB 3QFJD 3UXFA 1P84J 1L0XA 1XR8A 3FO0H 1HHIA 1WWWX 5JPNA 5I16A 3KPNB 1NC2B 4WHDA 3ZTJG 4OF3A 2Y07L 4O02L 1A1MB 1LVEA 5EO1B 4N5UA 2FX7L 2OK0H 5IB2A 4OZHA 1S3KH 2YS4A 3GMQA 4PJFB 3ROLA 1ZKAA 4NKDB 7FABL 1U2CA 2YPVH 3NTCL 3BH8A 1A6VH 4Y16A 4BSVA 3CH1B 2MWCA 4OD3L 2Y5TA 3T0ED 2VLKD 5HI5D 4OFIA 3HPLB 4Z8FL 1P84K 2FBJH 5D5MB 4WVRA 4AEIL 5IHLB 4GKSB 3QI9A 3DGCR 3O2DH 5IBUG 2R0LH 3EAKA 4YQXH 5J3HD 5C07B 1H3UA 3RHWF 2V5TA 2QQLH 4FQHB 5IIEB 2P24B 3MREA 4P23B 1KEGL 5JIKA 3ZYJA 2I07A 5TQ2L 4OV5B 2IANE 3KPNA 1NC2A 3FKUS 4XAKE 2BDNL 1A1MA 5BJTB 5EO1A 3LQAH 1MREH 4JREB 4PJFA 4NKDA 1KJVB 4XGZB 4MD0B 2DL9A 1S7RB 4JFED 3CH1A 1EIBA 1YEGH 5E8EB 3H7LA 4DGYL 3LOWA 1GOFA 5J56B 5D5MA 4GKSA 3UTQB 3MRRB 1HSBB 3TBWB 4MQSB 4KRLB 5C07A 1TZHB 1Q1JH 3IFOB 5E2WH 5IIEA 3B43A 4FQHA 2P24A 1F4HA 2JB5H 5F8QC 1ORSB 2BVTA 4P23A 5BW7A 4D0DB 1XIWD 3BYTA 4OV5A 5KSAD 2WWMC 4XX1E 2X42A 5BJTA 3QDGD 5LGJB 3C5ZC 3D25B 1KJVA 4DN3H 4H8WL 4XGZA 1DEDA 3QDME 4MD0A 1S7RA 3FRUB 4HD9A 4LLDB 1AXTL 2XV6B 3V6BR 1J12A 2QADC 4K71C 1KACB 5E8EA 5SV4A 2YWYA 3UTQA 3HFMH 3MRRA 3HCVB 1JGEB 4XCCL 3GBLA 5I8CA 2IAND 1HSBA 3TBWA 5DUBB 1TZHA 3IFOA 4XAKD 5I1IH 2VXVH 1YEJL 1IC7L 1N5AB 3DUSB 2ZCKH 1ORSA 4KTEH 4D0DA 2JE8A 3E6HB 4MD5B 3U79A 1MIML 5JNYB 3DGGB 3BKYL 1LEGB 3GSQA 3D25A 4YAQB 4HWNA 3AMKA 1YC8A 3FRUA 3ARBD 4LLDA 2NXYD 4QXTB 2VLMD 4NO3B 3GNMH 1E6OL 4JJHA 1VACB 3C60B 3DSNA 3HCVA 3MYJB 1JGEA 1QACA 1WWAX 3VD7A 3MJ9L 4D9RE 1SBSH 5DUBA 5E03A 1UB5B 1N5AA 3DUSA 3VMOA 4CMMB 4R4BB 2F58L 5HHPB 1F90L 3E6HA 4MD5A 2UZIL 5DVOA 1I4FB 8CGTA 5JNYA 5D2NC 4LLQB 2GFBB 4UQ3B 5JHDE 3DGGA 3NCYS 3WEXB 5HYQA 1BQHB 3UTOA 3W39B 2PR4L 3STLB 1GGUA 1WAAE 2WIIB 1LEGA 2XRAL 5LBSH 3MNZB 3VD3A 4YAQA 1QBML 4XP9L 1BIHA 1F4WL 3T1FA 2M8XA 5EORL 4QXTA 4P59H 4AMKL 4NO3A 3R06B 4XPAL 5E2VL 2EEDA 2HTLC 1HYSC 1FORL 4XC1H 1VACA 3C60A 3MYJA 3ARDD 4LQFL 4FQIL 4IRSD 1UB5A 4FXGB 4CMMA 4R4BA 4P46C 4OB5H 2ICWJ 4NM8H 1I4FA 5IFAL 4LLQA 1RU9L 2GFBA 4UQ3A 5E2JA 1RAMA 3WEXA 1BQHA 3W39A 2ID5A 5IB5B 1DL7H 3STLA 1BQHG 5GGQH 5L7XL 2WIIA 5L2JA 2IBZX 1U3HC 3MNZA 1MCKA 3U9UB 2AJXH 3O11B 4D9RD 4EIZC 3N50A 2YXMA 4ZFGH 1CR9H 3QUYC 5EIVA 1NSNL 1FNGB 2F74B 2IH3B 1KN4H 1EERB 4M7LL 1UZ6F 4PJ9B 2NY2C 4GBXB 5DEZA 4M93C 4FXGA 4X7CC 4C4KO 3BZFB 5F1OB 3GRWL 4YPJA 4P99A 5IEHA 1FYTD 1CLZH 3MR9B 5GZOD 4M43L 4XCFH 1DQDL 5IB5A 4ESKA 2OP4H 4X7EC 3TP4A 1WVZA 4PJHE 3U9UA 3O11A 1DSFH 4Y4HD 2CRYA 5EO9B 5CGYD 1E4JA 3IJSB 2Y5EA 4GG6B 2VLRD 3MCLL 3AY4A 2Y6SC 3GEWB 4PGEB 5EN2B 5DVLA 2XXCB 1QFWL 4OGZA 1FNGA 2F74A 12E8L 4LAQL 2IH3A 5C08E 5IVNA 4PJAE 5DVMA 3I75B 1A3LH 1KCLA 4JR9L 5JUEH 3C5SB 4PJ9A 1SJXA 1F2QA 4EDWH 1CN4A 3BZFA 3BE1H 4WFGD 5TE6L 2M26A 3MR9A 4K3DH 4NQTA 1CIUA 4JO1H 5C0AE 1MI5B 5DHVH 5FUOH 4N0UA 5AZEH 3PV6B 3QIWC 5DJDB 2DTMH 5EO9A 1DUYB 3IJSA 5DHYB 4P4RB 4GG6A 4M7LT 4PGEA 4G9FD 5EN2A 4YDKL 5DR5H 3V5KB 1OQXA 3OAZK 4NJAH 4RWYH 3P77B 3I75A 2CDFA 4JHWL 3NOIA 3L3DB 2FX9L 3C5SA 2N4IA 5FYJH 4PRIB 3T09A 3ZT5A 2BNRA 1YN6B 2I24N 2UVFA 4GXVH 3BZDA 1RZIB 4HUMB 2IPTH 3IKCB 4QF1B 1MI5A 1KLGB 1WBXB 3KLHD 1NH6A 3LHPL 1KCUH 3S35X 3PV6A 4O9HH 2Y7QB 5C08D 5DJDA 3SHSA 1DUYA 4MZ2A 4P4RA 5DHYA 3P9LB 4R4FL 3SPVB 3V5KA 4J7RA 2R29H 1I8LA 5FA4B 5C1MB 3P77A 2PTVA 2FHBA 3L3DA 4DQOL 2OJZL 3CH8A 4WI6A 4JHAH 4JN1H 4PRIA 1YN6A 1Y18B 3KPTA 2O93L 3O9WC 5K59E 5DRWB 1RZIA 5BS0D 3IKCA 5ILTH 4QF1A 1KLGA 1WBXA 2AXHA 5D70H 1NMCC 1T4KB 4DEPC 3MLPA 1U8HB 1UWGL 4PJ7B 3DV4B 1ZT1B 4IIQC 4U0QB 3P9LA 3SPVA 3WNKA 3L9RB 1CGYA 1E4XI 4G6AD 2HT4C 4X5XA 1YYLH 3QUXD 2BHYA 4OCXL 1OAUH 3IETB 4L9LB 5DJXB 3FAWA 5DEFB 2AJVL 1GGIH 3BDBA 5BRZA 4AIXA 2QADB 3KJ6L 1Y18A 3F7QA 2HJKB 4X83A 3LEVH 4H0GA 4PV8B 5DRWA 4JY4B 3OJMB 1MLCB 1JZ7A 4OF5A 1B2WL 1FSKC 1T7XA 1FCCA 1C12B 2DM3A 4RA0C 4JFOB 1T4KA 4YXHL 1H5BB 4OZHE 5EOQH 1U8HA 3MV8B 5CFHA 4ZS7H 3DV4A 2PW1B 1ZT1A 2QSTA 3L9RA 2BRRL 1T0PB 3LVEA 1PLGH 4JGJA 1RFDL 3P4NB 4TUJB 5K9OB 4PJIF 1N59B 4L9LA 1ZHKB 2OL3L 5DJXA 4N0RA 5KW9H 5DEFA 4RWHA 5I1AB 1G9NL 3ZE1E 2HJKA 1P7QD 4PV8A 4RFOL 4JY4A 3ROOB 5DD1L 1MLCA 1ZLSH 5EU6A 4N0YL 3OJ2C 1C12A 1X6NA 1P4IH 4JFOA 1HWHB 4HBCL 1H5BA 4PJFE 3MV8A 3CCHB 2R0KH 2PW1A 1VPOL 4M4RA 2H41A 2ICES 2UWEF 4LGSB 3BUYB 1XF2B 2BVQB 4MA8H 2DLEA 1G7JA 5D5ME 5D2NB 4MWFB 3P4NA 4TUJA 1J0JA 4ODSL 5K9OA 2DLIA 1MJUL 4ONOA 3CLFH 1N59A 5C07E 4GXUN 5DK0B 3KYKH 2C26A 1G7IB 4LMQE 2OZ4H 4MA3B 4XVTH 2I27N 2EH7L 5I1AA 2ILLA 1IC1A 1OTUD 4ELMB 3ROOA 1C5BL 5TF1L 5TJWK 3P4OB 1MHHB 3QR2A 1SYSB 4MAYB 1R5VB 3QI9D 4AG4H 4JVUA 4EIGB 2ENSA 3CCHA 4P46B 4LDOB 5ITBL 1UKSA 3MA7B 3NFSH 1DN0B 5T3XE 4JFFA 1XF2A 3BUYA 2BVQA 1J5OH 1KELL 4YDIH 4PJCB 4N1HB 5D2NA 3DSFL 4MWFA 4X6CF 3B2VL 2E7BA 4K55A 5CD5D 5GZND 2C7UA 4URTB 4OLUH 2OBGA 5LG1A 5DK0A 3QO0B 3UTSE 4HCRL 1G7IA 2B5IB 4MA3A 5TDNB 4KKBD 2RCSH 4D3CL 4ELMA 3QUYB 4TULH 3QIBC 1ND0B 1U93B 4YJZL 3TJHC 1RMFH 3P4OA 1MHHA 3QUMH 4I77H 1SYSA 3E0GA 4MAYA 3GKWL 1R5VA 5DRXB 4OT1L 1GAFH 4XI5C 3H9SB 4KQ3L 4M93B 3RI5F 4P46A 3MA7A 3CLEH 1DN0A 3EO0A 2MPAL 5IG7B 4P23D 4PJCA 5E4EC 4NWTH 3ARWA 1CD0A 4JRYB 1U8JB 4G3YH 2ZPKH 4LMQI 5ALBL 1J9CT 1MCNA 1YNKL 2V5SA 4QNPE 5IHUL 1KUMA 1U3HA 3QO0A 4I0PB 4FG6D 3ME0A 3PWUB 1G7PA 1RZ7H 2ARJA 4POZC 1UEMA 3QUYA 2HH0H 4MLIA 5F6IC 1A6ZB 1MPAL 4NRZB 4RGMC 4K23L 1YQ2A 3OV6A 4C55A 5DRXA 1FZMB 5IW6B 3WNNA 4TUOB 3H9SA 3NFNB 2BOBB 4D2NA 4PGCB 5GRXG 1MQKL 5GS3A 4AK1A 3IDYC 4XPFL 1NANI 4RMWA 2IGFL 4L4VB 3TT1L 5IG7A 3RZCC 2GJJA 4JRYA 1OD7A 1RUQL 1U8JA 1UWEH 2APBA 1OAKL 3N1FC 2VDOL 1GC1C 2CJUL 4EXPX 2QSCH 1K6QH 3QIWB 3FQRB 4I0PA 4PLNC 1H3TA 3JWDC 5J11B 2DIBA 2WUCH 1RD6A 3PWUA 3AC0A 2DQGH 1HINH 4MJ4A 2KQNA 2OTUB 5GRUH 2VLJB 1A6ZA 4OF7A 1OAXH 4NRZA 4QWWD 1FZMA 3MLVL 4G6KL 3MUHL 4S10A 4YEEA 5DC4B 1VFBB 2C4FT 3OSKA 2BOBA 4TUOA 4PGCA 2F5AL 1MRFH 4XP6H 5F7EH 1TETL 3MCG1 1TITA 3SGJA 1VDGA 4L4VA 5HGBB 2HMIC 4CJ1A 1IGIL 2AXGB 5M94B 5E1HB 4MSWB 1NDGB 5IHBA 4M00A 3QIWA 5GGVH 3THML 3FQRA 4WCYL 4PV9B 4EQ2A 1GYAA 4I3SH 3QCTH 1WUNT 3EJJX 1WICA 2OTUA 1CLCA 2JIXB 3ARGC 4JKWA 2VLJA 4XNZB 5T3ZD 1TPXC 4OD2B 4MHHG 5I15H 1VFBA 3MRNB 1WFTA 2VKXA 4K94H 3SGKC 5FV2A 3LN5B 1SQ2N 4NNPH 5HGBA 1CYGA 1YUHB 3O9WB 2DQHL 2C3WA 2AXGA 2FSEB 5MI0B 4MSWA 1AJ7L 1NDGA 4KI5F 2VDMH 1IFHL 2WK2A 3NACH 4DZBB 4PV9A 4FZ8H 4M5YH 3FFCB 3RVXC 1SEQL 4XRCB 2EDDA 4IIQB 3GHBH 2D7QA 3P0YL 3X3GH 2JIXA 3N1MC 3IXAB 4XNXL 1MEXH 5FO8B 1IKFL 2WP3T 2EO1A 4N0UE 1KEML 3DVGB 3MRNA 2E6JA 5FM4A 1YNLH 3R4DA 1IC5L 4UOW1 4GG6E 3LN5A 1QLEL 1QTYT 3BXNA 5FGBC 1FAIH 1YUHA 5T5NF 4Z5RB 3OF6A 3O9WA 3LDBC 2FSEA 4EVNB 2AEQL 1KT2B 4TSBL 3C09C 5E8NB 3RKDC 5JZ7D 3K8KA 4HSQA 5TDPB 1W2KT 1WIUA 3OKLB 4IIQA 4XRCA 2BNRE 4M3KB 2XZCH 1JP5A 4NQVA 1WC7B 1GGCH 3IXAA 1BVLB 1JPFB 5FO8A 5MP6H 1MI5E 4YE4H 1DEEB 3H3PL 1WT5A 4JRXD 2OMBA 4JZJC 1G7QB 3DVGA 3O6KH 3QDHA 1OAZH 4Y19D 2UY6A 2AV1B 3LPWA 4PJ9D 4GBXD 3V4VL 5IROC 2YD7A 4PS4L 2JB6B 5GRYA 2E7LA 1BVZA 4WDIA 2JCCE 3KWWB 1Q9KB 5CEZE 1N6VA 1KT2A 5D7IB 3LIZL 5E8NA 3BI9X 3CMGA 4UBDD 1DBKH 3W9DB 3E1F1 1KXTB 1WFUA 5TDPA 2EH8H 1HKLH 5D93B 3OKLA 2H2SD 4KPHH 4PRIE 2IWGA 3F8UB 4F9PC 2E9BA 1WC7A 4X4ME 1BVLA 5F96H 3CPLB 1Q72H 4Z7QF 1JPFA 2Y23A 1RUPH 1DEEA 2NY1C 3ESUF 4XNQB 3UP1A 1G7QA 4KJPD 2VR9A 3UC0H 4OM1H 2D0HA 4WGWB 2AV1A 3TBTB 4HIHB 3CFEB 2EIDA 4UDUB 4NZJA 1NCCL 2J88H 1ITCA 2JB6A 3ZDXE 1T89C 3RPKA 1BEYH 4FFWD 3KWWA 4OCSH 1Q9KA 2A73B 2BERA 3TIEB 5D7IA 1MI5D 4QTHA 4JPKL 4U31A 2KBGA 4L3EB 4ETYA 1IAMA 3W9DA 1IBGL 32C2B 3T2QA 3ZHLA 1SVZA 4NHCL 5BRZE 1MSPA 1LDSA 1NAKL 5JO5B 5L6YH 1IAIH 1U92B 2EDWA 5BVJB 3CDFA 3CPLA 3L3OB 4X9BA 4DCQB 1ZHLB 3W0WB 4XNQA 2DLHA 3V0WH 3ALXA 3TV3H 2OCFD 3OPZH 4R8WH 1P7HL 3TBTA 2J6EA 4HIHA 3RPIB 4IOFC 3CFEA 1G1YA 4JFZH 1HOCB 4Z95H 1YY8B 4NQCD 4PRID 4RMTA 5FUZH 3PDDA 3SDAB 4JEGB 3QIBB 4Y4FB 2A73A 3TIEA 5BOPA 1B6UA 2NLJB 3ULUL 1JGUH 3MBEC 4L3EA 3Q6GL 3IS0X 3ZDZF 1K85A 2K9UA 1MFCH 3V6FB 5JW4M 3GBML 4U6HB 1U92A 5BVJA 1UFUA 3T3ME 2EO9A 3L3OA 1N64H 1ZHBB 3LH2H 5EU6E 4Z0BH 4YNYB 4DCQA 1ZHLA 2W0KA 4P2QB 1PZUB 3ULUD 4YHNB 3W0WA 3NCJH 4LBEB 2Z4QB 3BPOC 4KTYA 1BZ9B 4Z9KB 4QRRD 3EKCA 4XNUH 1BM3H 4G6ML 5GGTH 1P4LB 1YY8A 3IDIB 3SDAA 4PJXF 5L2KD 3QIBA 4Y4FA 4Q97A 5F6IB 1PEWA 4RGMB 2P44B 2NLJA 3CSPA 2YUXA 4P2OC 3N1GC 5ESQB 4R26H 3FQXB 4HK3J 3C9NB 2GKIA 3V6FA 2NY5H 3IDYB 3QZWB 3VGHA 3G5ZB 4U6HA 1OAQH 3KYOB 1ZHBA 4YNYA 4P2QA 4YHNA 1UM4H 1QA9B 1YJDH 4LBEA 2BVOB 2WWMD 2Z4QA 3S4SB 1ACYL 3NPZB 4G8IB 2GTWB 3VFUB 4JFFE 2H2PC 1OP9A 1P4LA 2CUIA 3IXTB 3IDIA 4QXWA 3S6CA 5ADOH 2ADFH 5D2NE 4JKPL 2Z35A 1MCDA 5DUPL 2H32B 3OKNB 5ESQA 5JOEA 1G1CA 3FQXA 3F65A 1XGPB 3C9NA 4KJQD 1YEKH 4DTGH 3MV8D 3QZWA 5F71A 5I30H 1XCTB 3G5ZA 5INDB 3KYOA 3QZWG 1DANT 5C71A 2Q8AH 1FO0L 3SGDI 1D5XB 5M95B 4D8PB 1LEKB 1QA9A 4QRPB 1YEHL 2BVOA 1MRDL 4HGMA 3S4SA 5ADPL 4L5FH 3VDBA 3S4SG 5HD8D 4WHCA 3G6DH 3MJ6A 4M1GL 4NN6B 1A7BA 4G8IA 2GTWA 1G7HB 3B9VA 3FO1B 5A3ID 3D48R 4X8JB 3ET9F 4JDTL 3C2AL 4YBHA 3CVHH 4PJCE 2GHWB 4LNRA 2O5XH 2X89A 5I8OH 1TPXB 4LF3B 2H32A 3OKNA 1F4YL 1XGPA 1WBZB 4DFIA 1V7ML 3CFCH 5INDA 3M8OL 2DL2A 2YK1L 1NMAH 5CBEB 1D5XA 4D8PA 1LEKA 2F5BL 4QRPA 4LVNC 3MUZ1 5F3HB 3L5IA 3H9SE 3QQNA 4U1NB 1G7HA 5FB8B 3FO1A 5F7YC 4X8JA 3BRDA 4GRWB 1D5ZB 4ODXA 4XPTH 5TFSH 4B5EA 4JRYE 1E27B 3FZUD 1CICC 4LF3A 4OLZH 4F80A 5GS1C 3MOAH 1A3RH 4G7YH 3X11B 2P48B 4MAYD 2ZUXA 1WBZA 5JW4R 1AKJB 3MRPA 3SGKA 2NY6D 4RA3A 3RGVC 3LKSB 4ALAH 1TVDA 5IFJB 2R8SL 5CBEA 2P8PB 3LDBB 2FX8H 2NCMA 4A6YL 1T7WA 4JKLA 2EDTA 3QQ9C 4NRYB 1FLRH 3C09B 5F3HA 3ZE0E 5SV3A 3TZVC 4G43B 3AROA 5CUSH 1CD8A 3KXFB 1X5FA 4U1NA 5FB8A 1J86A 4HWEL 1D5ZA 4L4VE 1FQ9C 4M5ZH 3O4LB 1OGTB 1NCAH 3WFBH 1E27A 4S0SD 2BOCB 2BMKB 1NGYB 3QUYD 3WFHB 2JCCF 2B8OT 1DBAL 3X11A 1CLOL 3S37L 1AKJA 2Z91B 1XR9B 3EOYG 3HE6C 5IFJA 3U36B 1RJZB 5FHAL 1JRHI 2VLJE 4UB0H 1J1XL 2P8PA 3KGRA 1I9IL 2FEDC 1U9KA 4ZOAA 3WHXB 4JRYD 4NRYA 4PY8J 2EDOA 4G43A 4KRNA 1V3KA 2EYSB 3KXFA 4NBYB 4I0PD 4HQQL 5LVEA 2E9JA 4KROC 2XZQL 5T1KB 2CDEB 1WITA 2BOCA 4P5TC 2BMKA 1NGYA 5B4MD 3ZDXF 1JHLL 1MCOL 2CO6B 3EYFB 4YDJA 4OLYL 1DBBL 3MFGB 4LNVA 4JZJA 5GJSH 4PRHA 1KTKE 5CLWA 2Z91A 2QKIB 4Q6YA 1XR9A 4XPGL 4ZD3L 3TNMB 1F3DJ 2RBLA 4AYFA 3U36A 1RJZA 1SYVB 2YD9A 3WMSA 5HHOB 3MLZH 1FC1A 1YPZF 4K3HA 3WHXA 2B1AL 3QUZB 4CADB 3O81A 1A7OH 1RJYB 5KN5B 2EYSA 1QHPA 3QIWD 1G6VK 4FQCL 5T1KA 1NC4B 4F9PA 2CDEA 2X5PA 1INEL 3O6FD 5E9DB 3VFTB 5L0QB 2X4SB 3AUVA 2VLJD 3EYFA 3B8YA 4JM2B 3BD4A 3MODH 4TN9A 3D3VD 1I8IB 3MX0A 4HH9B 2QKIA 1NGPH 4IOIB 4MHHI 1SVCP 3NABH 3TNMA 1R24B 3Q3GB 4XCNB 3WFCL 2ENYA 3L1OH 5HHOA 2VZOA 1MF2H 1RIVH 3QUZA 2P5WB 4CADA 4TNWF 1BMGA 4G5ZH 1RJYA 1A3QA 5KN5A 2EE3A 1F6LL 3MXWH 4X4YB 2Z8WC 3SJVA 1DLFH 4HWBH 3D87B 1A5FL 4LSRL 4Q0XH 1QSEB 3LQMA 5E9DA 2X4SA 2JIXD 5DD5H 1FGVH 4LSTL 4JM2A 3BPOB 1I8IA 3DYMA 5JR1L 4HH9A 2HN7B 3L7FB 4IOIA 3RU8H 3RA7L 4MA1B 1R24A 3DVNB 3Q3GA 4XCNA 3VWKC 4P4KB 1M05B 4NQSB 4FN0A 4KQ4L 1FAKT 2P5WA 2ZKHL 1INDL 2VZSA 4P2OB 3MBEA 3RJDA 1H3GA 2PN5A 1KLFA 2DBJA 1KCVH 4XH2B 4X4YA 4XHJC 1EBPA 4UV7L 3FFCD 4EBQL 3MOQA 2PW2B 4FMKA 4U1SA 1BQLH 1WIOA 1OP3K 7CGTA 1QSEA 2XWJB 2X9WA 1J7VR 5D7IE 5DMGD 5T1DL 4HUWA 3L95B 3WNLA 2VITB 2WIMA 4QHLA 4UNVA 1NGQH 2HN7A 3L7FA 3QG7L 5FGCB 3QBTB 1CFTB 2EE9A 4Q6IB 3DVNA 4XC3H 3QG6B 5CP3A 2PXYC 4HIJB 4KKLD 4WW2F 4P4KA 3K4DA 4NQSA 2AJSH 5BMFL 4DKEH 1IEHA 4P2OA 4LCCB 2NR6C 1DLHB 1JVKA 1QFWM 4XH2A 3EYQC 5KANG 4HLZH 1MCHA 4OSUH 2PW2A 2OXGA 1OAYL 2XWJA 4OGXL 4MYWB 2I9LB 3BJ91 4MGXA 3L95A 4LL9A 5EU7C 2VITA 3V79C 1MHEB 3O0RH 5CIPH 4L3EE 1FFRA 4MB4A 1BIIB 1ZEAH 3PL6C 5DWUH 1FBIL 5IB3B 1CFTA 1TNMA 4Q6IA 1WFNA 5KSBB 4NOFA 3QG6A 1KJ2H 1GRWA 2VQ1B 4F58H 4HIJA 4LARL 2EDRA 4ODUB 1CTNA 2ZNXA 4KUZH 2VNCA 2VH5L 4UU9A 5C0IB 3W0WE 5E8DH 1A21A 1RIHL 4LCCA 4MJID 1DLHA 2GK2A 1JI1A 2BSTA 1FNEB 4O00A 4WENB 2IALB 5CJOH 7FABH 3UYPA 1UG9A 2BNQB 1KB9K 2I9LA 5J9PB 1MHEA 2DS4A 5F3BB 5KJRL 3ZKND 1KLUB 4AEIH 5I1HL 1UENA 3GK8L 2A77L 5KSBA 2JK5B 4NZDA 5MENB 2VQ1A 4ODUA 4JG0H 4KWUA 2IC2A 3MJ8B 5IBTH 1CICB 3OKYA 4P2QE 1C5CL 4P9ML 5C0IA 2UUDK 5KVMC 5GS1B 1KEGH 1F8TH 2UUDH 3D18B 5DA0B 3NA9L 5CEYB 4L3ED 4BFGA 1FNEA 2BSRB 1CDIA 2BDNH 3RGVB 2IALA 2Q6WB 2I60L 4LCYB 4WW1B 1T7YA 2BNQA 5HPMB 4OZIA 5J9PA 1IQDB 4UAOC 5F3BA 3TZVB 5F44A 3NGBC 1BZ7A 1KLUA 2YA1A 1HNGA 4CAGA 4BZ2L 2JK5A 5EU4B 2CKBL 5MENA 3T4YB 3KPMB 3MJ8A 4R0LC 1CICA 3SDAD 5IVXB 1U3JA 3QIBD 4Y4FD 1JGLL 4Z7VF 5GS1A 3TJHD 4ELKB 1X4XA 5EZOL 3WFEL 4HWZB 2Y25A 3D18A 2W60B 2BSRA 4YUEL 3L5HA 3ES6B 3EIFA 5DMYA 3RGVA 3HE6B 2Q6WA 1OGAD 4LCYA 2AXFB 4WW1A 3GO1L 3VXSE 5HPMA 1NPUA 1IQDA 1OVZA 5F7NC 5F88B 3TZVA 4MJ6B 5E95B 3UJIH 1EJOH 3W2DL 2ZSWB 5GRVL 4KROB 3QXAB 5EU4A 2A9NL 2VO5A 3GSNL 3N85H 3T4YA 4P5TB 3KPMA 1YEJH 4UIKH 5IVXA 5DHVB 1FDLH 4LCUB 3KLAB 4QRPE 4ELKA 2BC4B 4HWZA 1PZ5B 1CBVH 2VMFA 4X9FA 2W60A 5IMOB 2I5YL 2WM0A 4NIKB 3BKYH 4OCYH 1KENH 2CMRL 5E0QA 3ES6A 3DJ9A 5IFHL 2DLTA 3HE6A 4HUKB 1LO2H 2AXFA 1Y6NR 1M4KA 3O6ML 5BZWB 4LAJH 2A0LD 4Z7WF 4MXQC 4MJ6A 5IBLC 4J6RH 2Q20A 1F13A 4JY5H 2ZSWA 1QBLL 3GIVB 3PQYA 3LSOB 5HI3C 1RZKL 3MJ9H 4C54A 2FZ3B 2FYYB 1AR1D 4P5TA 2D0GA 2D7TH 2N7BA 4LCUA 3KLAA 1JWMA 1F90H 1L7IL 2BC4A 5J6HB 3K2UH 3V0VB 1B3JA 1B4JL 5FA3B 2OSLB 1QYGH 2LFGA