1OHZA

Cohesin-dockerin complex from the cellulosome of clostridium thermocellum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
GVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cellulosome Assembly Revealed by the Crystal Structure of the Cohesin-Dockerin Complex
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion
molecule keywords CELLULOSOMAL SCAFFOLDING PROTEIN A
total genus 27
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ohzA00
1TYJA 2ZF9A 4WKZB 3KCPA 5AOZA 4IU3A 4FL4C 4U3SA 4N2OA 1AOHA 4UYQA 4WI0A 3GHPA 1ANUA 2BM3A 2JH2A 2CCLA 1OHZA 2OZNA 5G5DA 1G1KA 4UYPA 2Y3NA 2O4EA 3UL4A 4DH2A 3L8QA 4FL4B 3FNKA 2B59A 2XDHA 4IU2A 4UMSA 2VO8A 2W1NA 3BWZA 5K39A 1ZV9A 2VN5A 5LXVA 3KCPB 2VN6A 1QZNA 3F2LA
chains in the Genus database with same CATH superfamily
3FZUC 2Y7LA 3I75A 4NZ8A 3ZDXB 4DGIL 2QGBA 2ZXDA 4ZO6A 1KLUB 3NSFA 4A37A 2JJSA 2JQZA 4Z7IA 1H3XA 5IHUL 5EUOF 3RWGB 4GUPA 4ZXBA 3K6SA 3RILA 1RK1A 1NBVH 3A6CH 1XIWC 5EOTB 4MMZA 3G5ZB 4U1JB 1YN6B 2CUMA 3ZO0A 5GJTH 3VXSD 1XR8A 1G9NH 3IDJB 2GB2A 5EU5B 3EYOB 1Y1UA 2KKQA 4BSVB 5EOTA 1NDGB 2LTQB 2XN9E 4GO8A 4HIIB 1XGUA 3S36X 1A0QH 2IH1A 4GT7A 4MD4B 5C0FA 2X1OA 1FBIH 2ZF9A 4HKJA 5LAXA 1SMOA 4LP4A 4AKOA 3QWQB 4AQ1A 3I75B 2NY2B 5D7IF 3ETSA 5EZLA 4TNWK 2YOCA 4NHUB 4NO0D 5KVDL 2QZQA 3IXAB 3ZSTA 2W0FA 4R84A 5A6LA 3D48R 4RFEB 1NIAA 3ESUF 2BIOA 3O9WD 3UL4A 1PYWB 4Q6IC 2MQCA 1IARB 4IOSA 2X1QA 2VDRL 3FDWA 3KM2A 2VISA 4GIPD 4Y4FB 5LCVH 3CLFH 2YKLL 3VXUB 5F7UA 1KDJA 1DFBH 4MZ3A 5T3XD 4XXCA 4R6UA 1DBBL 3FPXA 3QFJA 3R1GL 2YGPA 3D2TA 1JXKA 3TT1H 3SZKC 1KENL 5I9QB 5E6SB 4G6MH 1N67A 5BS0E 1YEHH 5FYKH 5A40E 5JHAA 2O5ZL 2XQYG 2WZAA 3EHBC 1QZ1A 4MAUL 2H9GB 1UD8A 2KZ1B 3VD9A 1AACA 1N68A 2BVQB 4K0OA 2VR7A 5HYFA 2ZUUA 3NFPB 3WHE0 3GXTA 4JJHA 1FQ9C 4BH7B 2LT9A 4ZK8A 4UZGA 2BRRH 1D9KD 1Z2KA 4L4TB 2UZPA 4QRTA 5DMKA 4WO4D 5EH1A 5FO7B 3A3YB 3W1ZA 1THAA 5C92A 4ZMWA 4HPOH 4FFWC 4NBYB 3WHXB 5FHBL 1AZCA 3MV9E 1KCVH 1OZUA 1W2KT 1A6ZA 4ZTOH 1E9OA 4P04A 4LSVL 2APFA 2IDFA 2OPCA 1LD9A 5HDBF 4H8UA 1GA2A 3KPPA 1G0DA 1JPEA 2WN3A 3ZOAA 1EJFA 4IJ3B 2IMNA 4JHAH 1RK1B 5D93C 1KULA 3C5XA 1I3GH 5DK3A 3V4VH 1PD0A 3AS1A 1OP4A 4ZMPA 5IOPA 4YHLL 4R0LA 3BKMH 4ZSOE 1F0LA 1ZRUA 2ADGB 3GXDA 3U1SL 1XZWA 3HG1D 1V5JA 3QQXA 1IL1A 5HPMA 3K46A 4Y4KA 2YSSA 2ZCHL 4FXGB 5E1AB 3LKNA 5DGRA 1DUZB 3KGUA 4IEFA 3FQNA 1NC4B 3NESA 2QHLA 4GW1B 4M43L 3U6RB 3NMEA 1IBYA 2HUHA 3EIFA 2AGJH 2O6CA 4YEEA 5F6IB 4YDMA 2PWGA 3MPCA 2DTMH 4TKWA 2CH8A 1NGXB 4K94H 1XMEB 1EO8H 1NM9A 3M45A 4PJXE 1N70A 3TCLB 4QDGA 3GBEA 4ZFFB 3NACL 3TJEH 3BW9A 1F13A 4JCLA 4UT6L 5GSRA 3VGDA 2BH0A 4DW2L 3LN9A 4JRXE 2CLVB 3HNSL 3LQAC 1QQDB 2GUYA 3WFCH 1TQCC 1GY1A 1TVHB 4BA0A 2EH8H 2ZSVA 4GG6B 4G42A 1YC7A 4RZCB 4PWHA 3RZCB 5CINL 3AWEA 5B39G 3CFTA 1CE6B 1GIGL 3T8XA 1BCIA 4TSBL 3HC4L 3BAKA 4NM4H 4GLRI 5GGVL 1XGQB 4H0GA 3O4LE 4LVHC 1OGTA 1J5CA 3R06A 1KG0A 4N1EA 4K5PA 3EGDA 2LQRA 4MAYA 3LHPH 3ARBD 4IBZA 4N28A 3C5ZC 2CRMA 1EXHA 2O61B 1N7ML 4JO2L 3AAZA 1A4JB 2VLJA 4P5KA 3WXWL 4O00A 2JJWA 4ELMB 2Y06H 4IOIB 3CIQA 3IJEA 3UX9B 2VQUA 3IJYB 1JVOA 2XXCB 4FZ8H 2L3BA 3H6AA 4ZFQA 1NTDA 3CBRA 1DVFD 1P6AB 3ALXA 4J3OC 5B1CA 3UMNA 4OFPA 5LQBH 4JR9L 5DQJB 3IAGC 4IRSC 3ZDZE 5EIVA 1FSKB 3IKCA 4P46D 3L4UA 4FQHA 4G6FB 4OZIE 4FZEL 3IDXH 3JWDC 1ZLSL 1OZTG 1KPVB 5F70A 3BRFA 5K9OB 2I24N 3N43F 4CMMA 3RGVB 3EYFB 2IDCA 1L6PA 1J8HB 1WZ1L 4YHNB 4FXGC 5AOJA 1O75A 1P2CA 1NAKL 4YQXH 2YUZA 1A7NH 3JWNE 4F93B 3L4YA 4WDIB 2ENJA 3T0VA 3TCXA 3VI3B 3KYMB 3WNNA 1J1PH 1M9SA 4U1KB 4XCCH 2A83A 3H42H 2DQCH 1JZHA 4Z0XA 3O0LA 4XVTH 3IFLH 1ZLVK 2NNAB 5DVNA 5JQ6H 1A4JA 4UTAA 2EINB 3PV6A 4UQ2A 1UVQB 5E8EB 1EK3A 4MQ7A 3LIUA 5EPMB 5C6WH 3O6FB 4L5FE 4PQXA 4XCNB 4WV1B 1B2WL 2W07A 3KWXA 4U1HB 2WVUA 1CE6A 1DL7H 3DYMA 1OAZH 4PS7A 2BHYA 5E70A 4FRWA 4ZUVB 2XKNA 1G43A 2X6CA 4TQPA 3TH3T 2L4OA 4PS4H 3MVSA 1F11B 4R4ND 5DZ9A 3ULUD 4E9SA 1S8DB 3NCMA 3BZ5A 4BQ9A 1RJZA 4RISL 2UWEE 3WXVL 1CF8L 3IFNH 2YPKB 3F05A 4XWGL 1E42A 3B2XA 3D3VA 1Q38A 4HISA 2OZ4H 5DK0A 4WSJA 3TCLA 1CFVH 1DBJL 1UZ8B 3FO0H 4MSWA 4XNYL 4HKZB 4PYHA 3TN0D 1XIWA 2HA1A 2ALWA 2IMMA 4YHYC 3ML9A 3H9SD 4Z3HA 1Z5HA 1NGWA 1VFBB 5CEXB 4IW4C 5I9QC 2VDOL 3HKFA 2YLHA 1RVFL 5CZVH 2ED7A 4LHUD 3HI5L 4JY5H 3NIDF 4PWGA 1RIHH 3U4BH 1ADQL 4OFKA 1NEZA 2VL4A 2BIMA 3UIYA 3HNVH 5E1IA 3BJLA 4FQHB 1GGBL 1Z7JA 3FTXA 3VWJB 2QL1A 4DGVH 1ZSHA 1X5IA 2ZOKB 1S7UA 4BWWA 5B1BB 1QLFA 4BQ8A 1IGIH 4AUJA 2GIYA 2R0ZH 3QHZH 4M3HA 3JVGA 2R4RH 1T2QH 5A3IC 4YSCA 1S7TA 5DRWB 3D07A 3EGSA 4HWBA 3AXLA 1OCRB 3MJ8B 4MFHA 2N7AA 3C12A 2DWXA 3N44B 4WQOA 4F7TB 2K4WA 1CFSA 1AR1C 1T80A 3IS1X 1FNLA 3KGTA 4CU6A 1I7TA 3IJ9A 2WLMA 1WFIA 1PVHA 3LZFH 2NY3B 1HX0A 4N24A 1KJVA 4TUJB 5FUOL 3Q2NA 3CH1B 1I1RA 4FP8L 1FWXA 1PCXA 2F1AA 1UA3A 2H6PB 3BESR 4HH9B 4HLZH 5DJ0B 5GRZA 4FNLL 4NERA 3PFQA 4W4OC 1X5HA 3UBHA 1EAPA 3KXFB 5TDNA 4H8VA 5PCYA 1BWMA 3UJTL 1J10A 4R4BA 3EDEA 2BDNL 2BVQA 1INQA 3CFCH 2HLEB 2QHRH 4KGLA 2VDQL 4PRDB 4YK4B 4YXLL 3I9AA 4EKXA 3MGOA 2X2HA 1W6LA 5IFAL 4IBTA 1I7RA 1N9PA 1KXQA 4JFOA 2VABB 2ROYA 2M2DA 3O8XB 5G4NA 3QWOA 4D0BA 1R3JB 1QVOA 4Y16A 3GIZH 2JLPA 4OGZA 4BA8A 3VXUA 2DD8L 2FWUA 4WY7L 1JF1B 1HXMB 5C6TH 2AXJA 2W60B 5DRNA 1U8NB 1Z5LA 4I9XA 1E6JL 1U8NA 3K8LA 3QH3B 3DX8A 3MV01 5C0RH 3ULUE 2IH8A 4UDTA 1C5CH 3S35X 5F1IB 2NR6C 4KWUA 4PJHB 1LK2B 3JV4B 4JANB 1DZ0A 2YAPA 3BHBA 3O8XA 5CBEB 1WZLA 2LVCA 1NC4D 2ADIA 5LNDA 1CB4A 4W4NA 4YS4A 2ENSA 4IBYA 4XN1A 1XHHA 4LLUA 3QEQE 4PG2C 2X6BA 4TPRL 1B0IA 2A4EA 3Q8FA 3GMPB 2VLJE 5I0DA 3N85H 2QQNL 1BFVL 1J8HE 3AM8C 3HE7B 4M1CD 1KTBA 1AQ8A 3ROLA 4LPWA 1MY7A 2X4OB 3P2DA 4DEUA 4PJCB 1MW2A 2VW6A 4X6CE 2IFFL 2VTFA 3KYOB 3LPWA 4U3CA 4GFTB 2CUHA 3SO3C 1QLEB 2Y7MA 3ZDZB 4WVRA 3AQXA 4HUUA 2Q6WB 1A9BB 4BKSC 4M7JL 1TQBC 3ESVF 5EZIL 3B9KB 2BP0A 4PG9B 3L1EA 4BZ2A 4HG4J 1RZIA 2YRZA 1FI8C 1JPTL 2O30A 4GAJL 4HUWB 3EYQD 2V5TA 4TNWF 3QH3A 4ODSH 5IMMB 4FQ1L 1FL3B 2IPKA 4LOVA 3NFPA 3C9NB 4C8XA 5MEND 3SJVD 1HXMA 2WLKA 1QFWH 5HHXH 2B4CC 3CVHB 1HKLL 1ODUA 2F53D 1ZSDA 4G43B 5F9DC 3I84A 5DRWA 1K85A 4JO1H 3QP3A 1NCUA 1O9VA 4F7MA 1GVIA 4GW4B 2EIJB 4MNQD 3SGJA 2R69L 2BVUA 4RWHA 3GQFA 5TE6H 3NA9H 2ZYRA 2DI7A 2EE0A 3NK4A 1JWMA 2R2BB 4LARL 1E4WH 1AHWC 1TFHA 4A2MA 4KRNA 1OD9A 5CJXC 3AQDA 1W9XA 2D2OA 3RFZC 1AO7A 4JFPA 4N8VB 1ORSB 5C07B 4KZ0A 1JHLH 2NY6D 1N5YL 2VRKA 2FE0A 4Z7NE 2E9WA 4RFEA 1ECYA 2OL3A 4ELMF 2JJTC 1KIPB 3JTTA 3QIBA 1XGPB 1DBAL 1NAMH 3TZVC 1XIWB 1LM8V 4L3EB 1TCMA 2IGFH 2YAQA 1B4JH 3MNVA 5T1LB 3VFRB 5IT2H 4HIEB 2X53A 4JRYB 1XXFC 3B2PA 4XOBA 2PMZA 4K3JH 4PLKD 5KYWA 1SN2A 1CI5A 1GHFL 1O6SB 4KTDL 3QQDA 5AKRA 4OW6A 4YDZA 4I5BB 1AGFA 4KY1L 5E6UB 4IHOB 4J3UA 3FUMA 1RJZB 3NJMA 4U6YA 3MRFA 5CZXD 1BBJA 2AS5M 2V17L 3IDJA 1AC0A 3IDUA 3NJVA 3KWUA 2KH2B 5I82A 4L8DA 1NIDA 1MVUB 2SODB 2VDLB 4W9LC 4BUQA 1UGNA 1SJHB 1YNLH 3TVMB 4I48A 3VXPA 2BNUA 3GEWB 2FUTA 4TRPL 3K6FA 3MYJA 4L4VA 2IC2A 1HU8A 1GGIL 4FXKB 3NEEA 3F04A 2UY6B 3JTSB 2CBTA 5FLUA 3WTYA 3IMRA 4G8EB 2OYKA 2K8QA 4I87A 3VXNB 4U1MB 4W9HC 2OZ4A 3GNMH 4U31A 5LG1A 5IT2L 3SJVB 4BUHA 1SJVA 4IRJC 4EQ2A 2VLKD 2CGRL 5C08D 3VTTA 3PP4H 4E9RA 3MJWA 3P54A 3K8MA 4Y8AA 2BSDA 2CRIA 4X99B 2AK4A 3HLAA 4OF6A 1Y7VA 1UM6H 1XH2A 1D5MA 3ARDC 3LIZA 2ADJB 3POHA 2EDJA 5HGAA 1JSYA 4JFXA 3SKUD 3SPJA 4FQ1H 4IKNA 3UTPD 1P84J 2RCSL 1TSRA 3T0EE 2D73A 4Z7UE 4FQIL 4AH2B 4AXWA 3HVDA 2CLRA 4P5TB 3SE9H 1E4HA 2V33A 4WV1A 3TBBA 1IM3B 1MIEH 2A74A 4XHJC 3VGGA 3L3JA 1EXGA 4MQ7B 4DQAA 4UQCA 2OTPA 3A4EA 3PDGA 4L0ZA 3S0PA 1Q1JH 3H0TB 3MRLA 4ELMA 2DBLL 5HTSA 1XAKA 3U9UB 2G4EA 2NNAA 5I71B 1TLMA 15C8H 2MHAA 3WY3A 2X4UA 3EGDB 1GAFL 2ZUQC 1RCYA 1VA9A 4P3DB 4WGKA 5JR1H 1GKEA 4TTDD 2CO7B 5ACZA 1WIUA 2RMNA 1UTDA 2BO0A 3WTUA 2E6JA 4N0CC 5DHDA 5E95B 2P5WE 3VU1A 2MCAA 3CPUA 4OZGF 4UNTA 5HHOB 2ERJB 3SBRA 1OOAA 1DQLL 2V6HA 5IW3A 4AXWB 5FYKU 5MP6H 4RWYL 4QPEA 2C9RA 4RMRA 3M86A 1AJ7L 5IMOB 2PWHA 2VLKB 2JKNA 4GXUN 3IKCB 5LN4A 4TOYL 3DXAA 2UUDK 4UTAL 1MCLA 4PLJC 5INCA 3WFEL 2NY5L 2VT0A 3NH7L 3AS0A 2MPAL 1BM7A 4CVZB 1F58L 5J9PB 1QTSA 3B9AA 1ZXQA 4MCZB 5EF3A 3T0AA 1YG9A 3UROR 5KS9B 4J23A 4NBZB 1L7IH 1OSYA 3Q9QA 4Q52A 2AEQH 3GJEB 4H2CA 4Z95H 2X0VA 5E94B 5E08L 1RSYA 4JDVB 3KW8A 1HQRA 4HU8A 1NZRA 3U7YH 1PLGL 1LEGB 5T1KA 3WV0A 4AOFA 2KLTA 3EXLA 2CR0A 1ERNA 1CL7I 4Y2DD 2I69A 4G8EA 3ESNA 3G08B 3B5TA 3P73B 2EVHA 1B0RB 1TTCA 5HHMB 3MRQB 4U3SB 2HJKB 2JXMB 2QFRA 1JZFA 4NQVA 1Q1JL 4XMWA 1RSFA 5I0VA 1V27A 5BO1H 1TJIH 2D3NA 2K70A 1PNDA 1X44A 2P42B 4MJHA 2XXFA 1DJWA 1QSEB 2ARJB 5FK9B 2F5BH 4D9LH 3IDIB 1OALA 4GRMA 2OR8A 4P4KD 1ESOA 2EUWA 1B6UA 2CLVA 1A4BA 3SO5A 3VFSA 2P5PA 3ARUA 3P2BA 4UCFA 2E7MA 5D72H 4P4KC 3F84A 3IDNB 4HZLA 2FO1A 1OSEA 2VR9A 3FRUB 4PR5A 3A6BH 5EUOA 5ICXB 3DMMA 5C7XL 3V0VA 3M7OA 5FHAL 3FQRA 4JN2B 4JZOA 4LLYB 4PD4J 5DHYA 4CN1A 2EICA 3VD0A 1RL1A 4QRTB 2BSTA 3KPMA 4X6DF 3MACH 1FNEA 1DANT 2W8CA 4FLQA 1A6VL 3KBPA 4QHUA 2GK0B 4PGCB 5D2LB 2J8UE 4JFPB 4N8VA 2XZQH 4Y4KC 3EO1A 1T2QL 1GOFA 4LZKA 1SY6H 4XC1L 3I9GH 1JGIA 4LVOC 1IM9B 5HPMB 5DLMH 4FN0A 5GRUL 4DP6X 2C7FA 3W81A 5AVRB 5LKNA 3T9WA 1WCBA 3F62A 2D3JA 3DUSA 4MA1C 1MY5A 3P0YH 3QIBC 2FEEL 3GSQA 3GSUB 2BHZA 2NY4C 3H9SB 4GKNB 4YO0A 3ETBF 1RIHL 1T3FA 2E4FA 4O5LH 3BVTA 4PYGA 4L29A 4AEFA 2YZ1A 5IJBC 5KN5A 3B8SA 1UZ6F 3C9NA 4M03A 4RISH 3MZTA 4W81A 3SDXA 3F6IA 25C8H 2EIKB 2UZYB 2YGOA 1AQDA 1HKFA 1NCAH 2JIXB 3P40A 1VSCA 2GIMA 1V7ML 2W38A 5TPWL 2BVOB 1OAZL 2OA9A 4HJ1A 1CIUA 5F0MB 3FHQA 4G7SB 1QW9A 1J05A 3CHPA 2EVIA 5IR1A 1TQWA 2PW1A 4E9QA 3MYJB 3VDBA 5AENA 4G1MB 3HPJA 5DMKB 3I3EA 3D18B 3BAYA 3DTXB 3PGFH 2Y1YA 1XGUB 1XSIA 2JH2A 1S78C 4B9PA 2DWEA 1OP3K 4D0CB 3X1BA 1XR8B 3CHRA 4WW2B 3Q8AA 1BVNP 4P46A 4X6DA 3BRGC 1M3IA 2VXUH 4Q2ZB 2HT4D 2YD9A 3L4ZA 3T65A 5J12B 3APNA 4LLUB 1TKWB 4RGND 3Q13A 1E9QB 2WXFA 2A73B 5DZPA 1MUJA 4YDIH 3JTBA 5CBEA 3OC5A 5DU7A 4R7DB 3IDYC 3QJXA 3DIVA 3O9WC 2XWZA 5H2BB 2VISB 3ILQD 4K23L 1QHQA 3LEYH 4UAHA 3PQYA 3GRWH 2PP9A 3RIAF 2IAAC 1TJHH 1YEIL 4K7PY 1EZVY 1OTSC 1PNCA 1J1PL 1PYWA 3EH1A 1HXYA 4NSKB 1BP3B 2FVNA 3CK0L 5K9KB 1I53A 4J12A 4AQ1C 4M1DH 1JVLA 3ZKXB 1A64A 3L48A 4Y16B 1JPTH 4GAJH 4PCSA 1IQDA 1V55B 1P1VA 1U91A 2JB6B 4XZUA 4MD4A 1LP9A 1JNLH 4ZJ9A 2CZNA 2NLJA 1BYPA 4BZ2H 4KRLB 4X9HA 3W56A 2YPVL 3RKDC 4JMNA 3WL9B 1L3NA 2YAOA 4K71C 4WW2A 3DHPA 3IFPA 5JPMB 4W9GC 1CUOA 2OM5A 2OR9H 4D7PA 2GUOA 5KVEE 3LQAH 2NXYB 5LXGH 3QWNA 1G6RH 4F91B 3KWTA 2VQ1B 4U6XB 2A6IB 2CUIA 1FZOB 2XIDA 2IO5A 2AITA 3B9KA 3VDAA 1AHMA 2XICA 1K3ZA 4FNUA 1NJ9B 2Z7WA 3Q3GA 3WXWH 5CJ8A 4XVTL 2V3EA 3Q06A 3KDMB 1MQKH 1CGSH 2JIXA 4JPWH 4UQIM 3GK8H 4IKKA 3LS4L 1F6AB 4X8JA 3P0VH 2WUBL 4ORGA 2CQVA 4PJCA 3QI9C 3HNSH 5IK3B 4R97C 4LSSH 4QXUL 4BK8A 3STLA 2VLRB 1JZ2A 2R1WB 2WUCL 3Q2CA 3L8QA 2AKRB 4U7KA 2IOOA 5A2LH 5I8EA 4WY7H 3ZRFC 3W9DA 1NBYB 2QKIC 4K3HA 3WN5B 2GT9B 5C0AD 4A7TA 1TMQA 2ZOKA 3PXJA 1SJEB 2B1AL 2QMKA 4GXUM 4QYOB 1A6TB 5IGXL 4J8RA 2F8XC 5DJAA 1GGCL 4L4TE 5F0LB 4CMHC 5KYXA 1O9WA 1CC3A 2DY2A 1T6VN 1MREH 4G11A 1F8TH 3IJ7A 1JHTA 4JFEE 4XPTL 5MENB 2ITDA 1TNNA 4BFJA 1FNGB 3ZQ9A 2YJLA 4G9FB 4J3TA 4N90D 4TVUA 3TH2T 2RHEA 3QC5X 4TQHA 1JCVA 1HYRC 2EIZB 2FL5B 4JN2A 4D0DA 1WHPA 4I0PC 3A0OA 2EVGA 3CV5A 2CRYA 2XY1A 1CXHA 1K8DA 1D9KA 1TZGH 2LABA 3IDNA 4HZLB 4R7LA 3MRJA 3RUGA 2BIHA 1JFHA 1CR9L 3WTTA 2FJFB 2QR0B 3SOTA 4M5YL 4Y4FD 1DBML 1XSOA 1INQB 3BMWA 5IBLC 1QR4A 4N2IA 3QUYB 4Z7UF 3FUDA 3K4DA 2PYFA 3NIGF 4APQC 4ZUVA 1INEH 1NINA 1OK0A 4JRFA 1OGPA 4JFDB 1D5IH 1U58B 4X5PA 4QRUB 2W9DH 3U48A 1HJBC 3QZMA 4LE8A 3Q8CA 5I66B 2F7IA 2E9BA 3CU7A 1F18A 4XNZB 1TF4A 4XXDB 1L0PA 5AVZB 3UTSA 5DC2A 4APQB 5I1EL 3ULUF 2V3FA 4LSRH 1N18A 4HIHA 4LDOB 4QRQA 4K8RH 1CD9B 3DETD 4PWIA 4ZOBA 1GGBH 1BM3H 4GINA 5E4EB 1HNFA 5GS2D 4I0CC 5EN2A 3SDAB 4P4RA 1L5GA 2A5UA 2EJ1A 3ZZQA 1FFPA 4P9HC 5M94B 2Q76B 3GUTA 2VJ0A 5BUPA 2CDEA 2W9EH 3P77B 4ISVB 5IMKA 4FA6A 1RJYB 2VDOB 3G04A 4YEFA 2QPUA 4W9DC 1XVSA 4LLDA 1XGRB 3GJFA 3OLEA 1RUQL 1BVLB 2X4NB 4TULH 4W9IC 3VXME 1ZLEA 2OXHA 3RZWA 4OLZL 3MLVL 2Y7OA 4FAAB 2XRAL 4BFFA 4ZPTA 1NDMB 4JPIA 1VB9A 5DTFB 5AW2B 4GKOA 5T5FA 3MJ9A 5CSZB 3HZ3A 5KVEL 1NCOA 4Y16C 2JTYA 3NZHL 2ADFH 1WTGT 3Q9PA 4QLRA 5IW6B 1SLXA 1KGXA 5LCVL 2NSQA 1QAWA 2MH4A 3D4ZA 4B9KC 4LBEB 1DZBA 4KQ0A 2FYVA 4LSVH 2NY4D 3TV8A 3KBFA 2VZ1A 3AY2A 2Q76A 3GUTB 1ZJBA 2CO7A 3CNKA 4BSJA 4C56D 4L9DA 3L1GA 4KKQA 4HBCH 5ADPL 4GBXA 1HHHA 5CLXA 2QLYA 1RD6A 3H9HA 5C0EB 3U9PL 1DQTA 2VMEA 2DLFL 4MX7B 3O2DL 1KZQA 5JNYB 2R51A 2AJYL 3GSOA 4PCTA 4XAKE 4QRFA 3IGAA 4POZD 5EOQH 3S48A 2CHWA 1I7ZB 5MERB 3X2QB 3CLEH 2BMKB 3WAKA 3WI9A 2X9WA 1U4EA 2IOIA 3MBWA 3C6SA 5SWZD 3UEZA 2H7WA 3A21A 4TTDC 1KYAA 3SDCA 3VSVA 1SY6A 3RZCC 5C9KA 3RTQA 1I1AC 2KQMA 5L6YH 3N42F 2AQSA 1BWWA 1YPZB 3CSFA 8FABB 4KKBC 1EVTC 3TBYA 1IC4H 3ARRA 3AREB 3ZE0E 3NCXA 2H2PD 1RULH 4JJ5B 2FJFA 2DM4A 1Z9PA 5KW9H 2GSMB 2X4QA 4U1LA 5BZXA 1KOAA 1D9KB 4M6NL 2A83B 2AK4B 1EZVX 2DIBA 4HEPA 5I8KH 5I16B 1W0WA 2DEXX 1BZDA 3KHOA 4H88H 4PJBE 3ZPDA 5ISZB 4Z8FH 3FQYA 1Q9LA 2RTTA 3MRBA 4WSGA 3AWGA 1LL1A 5C0AA 5D1ZI 4OQTH 4YX2H 1A4CA 1MCWW 2PW2B 5ETUA 3SPVB 3UG3A 2BERA 2DH2A 3PIQB 5I1CH 1AGCA 3CDGA 3O11B 2Z35B 4G8GE 1C12A 1U8IB 5FUCE 1IL1B 1XT5A 4ZMNA 4A38A 4HX1B 4RIRA 3Q8BA 1IGML 5EIQA 1BZ9B 4JG1H 2XPYA 2KC0A 3OKKB 5EO9B 4MJIA 1QUNA 2R0LH 4HS6B 2Z31D 3WFHA 1HT6A 4WI5A 3ZGHA 3KPRE 1SOXA 4TSBH 1E4XI 1BM3L 2DN7A 2VRAA 4PJCE 5C0CD 5FYLH 2J6EA 3CQFA 5I0ZA 3BOVA 4K5LA 2FYYA 2D0FA 4ZFGH 1R3HB 4DCQA 1ZV9A 2K0RA 4IBLT 4IJTA 4LPXA 3V5KA 3WSQL 1CTMA 1T1WA 2X3AA 3TP4A 2V5YA 3D34A 3P30L 5DVPA 3NACH 3TJEL 1OOWA 2L0DA 2WKOF 3LKOA 1ZMYA 4N2MA 4DSYA 4ZSOA 3OAZK 4I9WD 4UM8A 5F21B 3KPQB 3TBVA 1XCQA 4NP4L 1OT4A 2FAUA 4KHTL 5DFTA 4DZ8A 1URLA 4OZIF 3VA2C 2XWDA 1KGIA 1IC5H 1OLLA 3FT2B 4L8CB 3LD8B 1RPQA 4DP5X 1XF2B 4LCWE 1NEUA 3LD8C 2LLGA 5DC0A 2VR6A 1IQDB 4U0QB 2OW7A 4F3FA 5GZNC 2C1OA 1RIUL 3DHUA 1ZLUH 1BAGA 1KTLB 1EJ8A 3DDGA 2FK9A 5HGBA 2N56A 2BP5M 2H3XC 3RYMA 3VRLE 3R0MA 3ZTNH 2CSPA 2FH6A 4YNYB 3RLSA 3WKPA 1S9VA 4PV1C 2NXZD 4TSAL 4C59B 3SKJH 5JOFA 1OWRM 4ZMTA 3OMIB 4F8QA 4N2CA 3LEYL 4HS3A 1KYUA 2CHDA 4GUQA 5AW7B 1UKQA 2WCSA 5BZWB 3BUYA 3HMXL 4QOKE 4RFOL 1GSKA 4GRWE 3K91A 4NQDA 3GK8L 1AR1D 4U7MA 5IVZB 1E40A 1WIPA 1KJ2A 3NJHA 5D8JL 2FD6H 4N25A 4KVNH 1IGMH 5E1HB 2O5NA 2OMXA 2K45A 1C08A 3GZOA 2ZUQB 3D18A 3OAYK 4N9GA 1YY9D 1YEGL 3QAQA 4JFQB 4R0LC 4KJWC 4JPKL 1ROWA 1T22A 2X4SA 2ALAA 5K59E 5D9SA 3GTNA 1KENH 5JO5A 4LSDA 6CGTA 1N3NA 4GUCA 3WFDH 2DLIA 3UO1L 1CK0L 5CSBA 4PJEF 4QCIB 3V8OA 4KNTA 1CE1H 1QR1B 1YPZF 1OY3B 5TGBB 4ERSL 3JYCA 4NQSB 3A67L 1NCBL 1S7SB 1B0WA 1JGDA 3VACA 4E9TA 1MHHB 2VDQB 1OGSA 3I6KA 3GSQB 4GIOA 4RSYA 4LFHD 1I7RB 3EBIA 1QRNE 1P7HL 2H47C 4IOFD 5DA0B 3MV7A 5TDPB 5K9JH 2V2XA 1BIIB 1HIMH 2VSKB 3IU4L 4KU1A 4NZDA 5D71L 2XV3A 3G6JE 1NC2D 1FF5A 3BWSA 4A39A 4WNQA 1GOGA 3CSTA 4LCUA 2NYZA 3K74B 2Y3NA 4P05A 1DTUA 1HWGB 4J39A 4PJ8D 3Q5TA 5IY5B 1N4XL 1NBVL 4P4KB 4JZOB 3BH4A 1JXFA 3T8VA 4DGWC 3QEHB 3GSXB 3HW7A 3RP1A 4OU3A 3EZJB 4Y4HA 4RX4D 1NWOA 1LE9A 1U0QA 2ZQKA 2WKOA 1BEXA 3IJHA 3OLDA 3BAIA 3X3FH 4URKA 5LN8A 1DEEA 2PPEA 1ES0A 4PJFB 2FYYB 5HSFA 1HZKA 4HXAL 1UURA 3V9EA 4PV9A 2F8IA 2W65B 4FJYA 5DUPL 5C0JB 3HG1B 3ISRA 4DKFH 4QHNA 4XZ4A 2Q7NA 1JZIA 4DETA 4ODXB 3ZL2A 3QORA 1QBML 1RZJH 4ALAL 4HG4K 1I1AD 1BZEA 5AVSB 1NMAH 1A02N 3MV11 3HZVB 3UBXI 5DS2A 3HG1E 1BVOA 1DQDL 4MNQA 5K39B 4LCVA 2ZJSL 4AQOA 5FB8B 4N2NA 1T83A 3H8NA 3WLWC 5CEXA 5BOPA 4G82A 2FSEA 5BVPH 1JFQH 5JUEL 2DYPA 4OZFA 3U7YL 3CVHL 1DE4A 3F83A 3MJGX 5E99H 4LLVA 2YGVA 3L2MA 3RPIB 3ZE1E 5CR8A 3VSTA 3HE6B 5F0JB 5C2BH 1ZHKB 1N2RA 4PLOB 1F58H 1X6LA 2KZBA 3DK2A 3I02A 4JJ5A 5EEVA 2M1KA 1OXYA 2AXFB 4GRWH 1WWCA 2K8MA 3VH8A 4HDIB 5F1NA 1TVDA 4M9OA 2IQ9L 5J1AB 1ID2A 4PJFF 1INEL 4ODTH 3ULVH 3IWVA 4ZPVB 1JZJA 1FRGH 5EWIH 4NCDA 4WJKB 5C7XH 1DJXA 3SE8L 4I85A 1NFDB 1XQ4A 2YZ8A 1LYQA 2E76C 2VQTA 4M61A 3NABL 2XFGB 2WNGA 3P11H 4RWYH 5I71C 2PPFA 5AD0B 3S8FB 4JKKA 4P3DA 3HHSB 2IV8A 5FKPB 2YUXA 4I3RH 1UWGH 5AYUH 2Z8RA 3FB5B 3MBEA 3H9HB 4XMKL 1MVFA 1NBZA 1QOKA 2WLZA 2EYRB 3AU0A 1G4MA 4Y1AB 2D3VA 5BV7H 1G9NC 2X6AA 2YK1H 3S9DB 2HLFC 3LQAL 1BQHB 5IHZB 2ZP0T 4P5RA 4AJ0A 3TH4T 4S1DC 3KEHA 4FS0A 5B8CA 1B88A 3EJPA 5GRXG 3FBQA 1N59A 1AE6H 1E7UA 1S7VA 3QEUB 4UILH 5CBAB 1ET5A 4K4KA 1OTTD 2GJ6A 5DJYB 3FONB 3BQUD 3D51A 4ZTPH 3SKMB 4K55A 3JV6B 3CG8A 1PEZA 2EDFA 3GMOA 4EUPG 3IDGB 4BQ6A 2VLLA 4B3EA 3T8MA 2DM7A 5DMJB 4JDZB 1CU4L 2DQIH 2K3HA 4ONHA 3LS4H 3BQVA 4NS0A 2GITB 4YSOA 3L6FB 4XVSH 1NKGA 1ECZA 2XU9A 4UANA 1IE4A 1YZZA 3V4PH 5FM5O 2QELA 2P43B 1Z9OA 5EF1A 2QLVB 5D1QB 1SEQL 3VXOA 1OP5H 4F7EB 2XN9A 1UH2A 3RWDA 4X7FC 5FO9A 3K4ZA 3TS8A 5JPMC 2WANA 1H8OA 4PW4A 1OGTB 3EFFA 2PN5A 3HPLA 3F01A 4FQPA 2OTUB 1RV6X 2YMTA 1BQLL 2ICWJ 4QRPA 4N2KA 1JZEA 4L8DB 1AY1L 2E7HA 4YE0A 5IHWA 2ZE0A 5D6CA 2MCPH 1E8ZA 3DX6A 3C5ZD 3LN5B 3LSOB 3N9GH 2ZT9C 4XC3H 3KLAA 3OC8A 2AJSH 3U6XA 1SXNA 3V4PB 1D7BA 5E8DL 1SZNA 3QQDB 2OQJA 3O4OC 3TA3B 1YEDA 3NIGB 1IGJA 4JHZA 3PWVA 4Z7NF 3O2VH 5IJVB 3VX1A 4X8XA 1PPIA 4JRYA 4A7GA 1NWPA 3RRQA 5KSVA 2HWZL 2VC2L 2LU4A 1UATA 4KTDH 3NSYA 3MV7E 1L0XA 4UI2A 4AIEA 5HDWA 2BVEA 2H3KA 5GGTH 4IBWA 3SGJC 1KIPA 1S2EA 1X5LA 5D7JC 4N2LA 1AD0A 1QI5A 4G6AD 3EDFA 1QUPA 1RJLA 4HQQL 3QG7H 1URZA 1SPDA 3GINA 4W9JC 4ELME 3KNBB 5FF6A 1W72L 1EO5A 1IKOP 1DO5A 3F00A 3U82B 5J3HD 3DIFB 1F45A 1MH5B 2R69A 2J56A 4UINL 1OV8A 1XX9C 4M8UA 2AQRA 2Z9TA 4O2FB 4PJ7B 2OSYA 1IKFH 4F15B 4DGYH 2IOMA 4M6OL 4MKTA 1KTDA 1WS8A 1V3JA 4WUKL 1IGCH 1SLUA 5AW0B 1PMYA 4YC2C 4OTXL 2RD0A 4WI8A 4XBMA 2XA8H 4AVHA 3CVHA 4PJDF 3SHSA 3C6LD 5B4MC 3FU5A 2HRPL 3DX3A 3QXTA 4CVXB 1EIBA 2QKIB 4YHYB 4C56E 1HC1A 5HHME 3VFOA 3BPCB 5H37G 4JVPA 3V5HA 1YNKH 1H6FA 1ZS8B 1QFWL 1HZLA 3WEXB 1EX0A 2APTA 4KOCA 4MJ6B 4POZC 3I6SA 3KWWA 3T2NH 3WG7B 3KDMA 5CZXC 3MRRA 3DTDA 4X5QA 3TESA 5FDWA 4WFHD 1T1ZB 5KSBA 1YNLL 3CUPA 2WLIA 1L0YA 3BIKB 3MV9D 1R5WB 4U6XA 4JVWA 4Y5XA 2NCEA 2OX5B 3QPXL 2BY3A 5EFIA 4D9QD 4AITA 3MLUH 1Z9SA 3BH9B 4P2QD 3NEXA 2Y23A 3HRZA 4KO7A 1T1XB 3VRJA 1TTFA 3HZMA 1ZANH 1R75A 1RZKC 2HKAA 1DLHB 4KK8D 2JJVA 4X6BA 2H9GA 4NHCL 1EJOH 4YSDA 4K3DH 1KPUB 2YD8A 3GZQA 3PAVA 4NPKA 4ODVH 5CGYC 5EC2A 1HDMB 3QCTH 2APSA 2JB6A 4XZUB 3UJIL 4BZYA 2XZQL 2ZX9A 1SDYA 3KJ6H 2VMDA 3HHRB 3WIHL 1IM3D 5EU6A 2J5LC 1YJDL 4Z7WB 4G6AC 1N5YH 4I0PA 4R3SB 4XO8A 3V6FB 3OR6B 2Q7YA 3U0PA 5DVOA 3VI4A 3EJSA 1BX2B 3VI4B 3S37L 3AQZA 1MEXH 3IXAA 4GQRA 1HI6B 1RZ8B 5GGSB 4EN3A 2LLNA 3DHMA 1WV7T 3MRPA 3QRGH 3Q1SH 4AQ1B 5HGHB 3B1UA 4WFGE 5MEQA 4EIGB 3DX1A 4NAJA 5SX5K 4BZ1H 1AJ7H 1F3JA 2FHCA 1QWNA 3HZYA 3N1GC 3WO3B 3QAZC 1E43A 3QCVH 3ZY7A 3RIKA 1UCBL 2H32H 4KHXH 5CGMA 2DJ4A 4PBWD 4PGBA 4PY8J 3PWJB 4XHQA 5DJ6B 2WD0A 4YDLC 2VN7A 4Z7VF 1PX4A 1Z9SB 1I1YB 5F7MC 5C70A 1IJNA 4G8FA 3FAWA 3RWGA 1BQSA 3I6GA 3K2IA 1U92B 5A2KH 1KPRB 5EDSA 1RERA 5HDQL 1MFNA 4DTGL 2MNWA 4KI5D 2J73A 1JMXA 1ZCRA 2ZP9A 3A4DA 4G5AA 4XP9L 3RPKA 1BVKA 3WJMA 1B4TA 3SDCC 4LOEA 4QRPD 2NT0A 3UBXA 5DMGD 3T71A 2GTZA 4IDLA 3G6JF 3HNTH 3L3IB 2GTQA 3HG3A 1FLRL 4ILDA 3RWIA 4WU5B 3DXAE 4AVIA 3UABA 1KCUL 4W1TA 3EGSB 3GHBL 4GMTH 4N87A 1F1DA 4GW5B 5HHMD 2P49B 1MKFA 1CICD 2GJRA 2RQ8A 3OAUH 1JXDA 2RFXA 2J5WA 1EUUA 3SPCA 5DT1L 2YFOA 1F4XL 2WVSA 2Y9RT 4EAEA 1J1OH 1EERB 1CO1A 4X4XB 2XBZA 2YUVA 4IRSB 4MA1B 4UM9A 5K1JA 5TE7L 5C1MB 4FYTA 4NRYA 1GAFH 1RK0B 4PJ5D 5E5RB 4J6RL 5E8NA 1WC7B 2EO1A 4RMTA 5FX3A 5A43C 1MDAA 2G4GA 1XZ0B 3KYKH 1KT2A 5KSBF 4FKEA 1FN4A 4PR5B 4P23D 3O3BB 1IGJB 2B5IB 2YEQA 1A6PA 1ZANL 3MLRH 1H3VA 3E1ZA 2EE2A 5JR1L 2G9HA 1P7BA 1IAII 1PZ5B 1S8DA 3WUWA 1FE8L 1MWAH 1H9DA 1KB3A 3NFSH 3LKQB 3S4SA 1A6AA 4X5WA 2DWSA 2WZPD 5SWZE 2Y3AA 1NIBA 2CPUA 3ECWA 5A16B 4A6YL 1ZGLA 5AZUA 4ZS6C 1IGYB 4JQXC 2AJVH 3GFUA 3RG1C 2HFEA 4AY0A 1EDHA 1HH6A 2NQ3A 3V79C 4GQPH 4RDQF 1NCDH 1YDPA 1CGYA 1PFCA 2BOBB 1VKXA 2APBA 3QO0B 4BZ1L 1AAJA 3BN9C 3OXRB 5IVXF 1D5ZB 3IETB 4ZX5A 3OSVA 2CM5A 4PWEA 1WFOA 3TPUB 1W15A 2R2EA 2FWOA 1KCSL 3NJLA 3KCWA 2JWYA 4M7ZB 4B6ZA 5E00B 3PP4L 4OH2A 1U8KA 3FQTB 4PRPB 2ZP8A 3PDOA 5IG7B 3L3OC 4YH6A 4GKZB 3ZDYF 5F1KC 3ARSA 3FT1A 5GZOC 3D4YA 5I1GL 4UQAA 2DW5A 2YO3A 3HG5A 4MCZA 3EUUA 4JDZA 1KGJA 1P5UB 3UIZA 3BKYL 2EEAA 1XF1A 2JELL 1J5DA 2ICWI 2JV6A 4LNVA 5IP4A 5DJXB 3PGDA 3G5XB 3M8OH 4F7CB 3BN3B 1M7DA 1P5VA 1RFDH 1UGKA 3MKKA 2CGRH 5BRZA 4PLJD 2NYKA 2OMYB 3ARXA 4NI6A 5SWSB 1UB5B 1KLFA 2VDKL 3OL2A 2NY6C 3AY4C 2R8SL 1X7QB 1WD8A 4FFYA 1N59B 4RCAA 4DFHA 4A2FA 3KJ4C 2BNQB 3EOTL 3NJNA 3E7JA 2GY5A 4IIZA 2W80C 2BIQA 1P84K 4A2DA 1A3ZA 4LL4A 5J6SA 3IGFA 3W39B 3T4YA 1T03H 2ZAHA 3CDFA 2Z31B 2QVTA 4MVBC 4S1RL 3S35H 5JIPA 1CBJA 1GYAA 4FERA 4OJAA 4XWGH 2AQNA 1SOQA 4MNHA 4F1ZA 5EOCH 5C0CB 4HOXA 5I1DB 3W57A 1OQOA 3JSSA 4LOUD 4ZFZA 5DUMH 5FECB 4Y1AA 2EDNA 5B4MD 2A6JA 4KTEH 3ES6A 2V8LA 1N19A 2ZKHL 4NRXB 5DDHB 4ZUTA 3SDDB 2DMBA 1KB9J 4QJ5B 2WWOA 3FUFA 3K1KC 4JG0L 1XO8A 4WWOA 3KPSE 2A9AA 3DURB 5D4IA 3BAEL 3SE6A 3EXJA 4ZRGA 2LTQC 5AD0A 4F2MA 1HSBB 3ZSSA 2V7NB 3KL0A 3O3UN 4NC2B 5HYEA 1VENA 3CFNA 1KMGA 4KXDA 5AYQA 3BGFB 3CCHB 4GP8B 1E4WL 1T66C 2CDGB 1QPKA 2X3CA 3NCFB 3Q01A 4RZCA 3QT2A 3SKNB 1RP9A 2QV4A 4A7VA 4B9GA 2X4RA 2DZEA 2QQQA 1AGDB 4CRPA 1UH3A 4AQEA 4H5SA 2WJ7A 3P4OA 3V4PL 1L6XA 3PGCA 3N1QC 2FJHA 1EMTL 4NQUA 1EVUA 4N5ED 1EXUA 2A99A 3SBWC 1UENA 1W72H 2FB4H 5EO0B 3S3PA 5TF0A 1ZPLA 1BHGA 2CKBA 1DE4B 5DCCA 2CHNA 4OKVA 3ESMA 1E6JH 1B3IA 4HS8L 3QB7C 3BH8B 4U4IA 3UP6A 3SO3B 3D25A 4M7JH 5LCVA 2JNZA 3OKLA 5KAQF 5B38B 4X6FA 4LU5L 1M7UA 3GLAA 4P8QA 2KERA 4AI7A 4JQVC 2ZXWB 1FH2A 3O2VL 5DURD 2F15A 3T77B 4QHMB 4GAAA 3S96B 5ELIA 1HH9A 1KNOB 2ZYIA 3IE9A 4Q7DA 2GJ6D 5HI3C 3EDKA 4HJIA 2QQNH 1NFDF 3D0VA 1RLBA 4O2CB 3MC0A 2CIKA 4RGOL 3OB0H 1R5VB 5INDB 5ESVB 3V4VL 3RGHA 3D50A 5I1JH 2YD2A 4FTVD 3OTTA 2FLRT 3CFEA 4NIKB 3WFBL 1A6ZB 3EAKA 3ULVD 1LO0H 2VXVL 2LGNA 5AB9A 1O5PA 1WZKA 2EUVA 3M88A 4TPRH 3CMGA 3GMQA 4A7UA 4JQXA 3KL3A 4GQ9L 4GRLB 1FIEA 2VL5A 4QUOA 4JHUA 3D69A 5FW6A 2HVKA 2ORBH 1KLGA 1OF2A 3BUBA 4GEIA 4I2XB 3U83A 2B3IA 1KY6A 4PHXA 4NJAH 1P7KA 4L4TA 5KYYB 5DJ8A 4M93B 2EH8L 5C09D 4CSSA 1BV8A 3NBNA 4PRHD 4X2UA 3VXUE 1AO7E 4OZ4A 3ZT7A 5T1DH 1AP2B 2OMBA 1WF5A 3ARTA 3F5WA 2GABA 3RVWD 1IFHL 3DNKA 3QORC 4X4ME 4A7GF 1HCVA 2OMUA 1BIIA 3LNFA 4AKPA 4QGTA 3RAJH 4KPHH 2BVYA 1X5KA 3FTZA 3OGCB 1CS6A 4NN7C 5C8JA 4B60A 4UT7H 1AHWA 4X9IA 3ARDA 1ZSDB 3II3A 4G43A 4TQEL 3PLYA 4ZAKA 4WZ9A 3D0LB 3AG2B 4NP9A 1NGZB 4H8WL 5ITBL 4W9EC 1K9TA 1HH6B 5KBNC 4ZO7A 1K4CA 1ZLWH 4BCXA 3NIFF 3UJTH 5JO5B 1IGTA 3SB3A 4G7YL 4LASH 4PJ8C 1JK9A 3T6XA 1DBKH 4K7PL 1T22B 1A7BA 4MJJA 3KCPA 2E7CA 3GB7A 2ETWA 4F27A 3IVKA 2X28A 5KEZA 4LQFL 3DRTA 3T4AB 3FO2B 2J4WH 4ZMYA 3EJRA 4XPFL 4ZW6A 5LG6A 1WITA 1FBIL 3C08L 3EYOA 5CJOH 1ZWIA 4NQDB 4O9HH 2R0ZL 5DLLA 1IIKA 4DPCX 3G5ZA 4PTUA 1FYTE 1PY9A 4U1JA 4U49A 5CLZA 4L8BB 5C3TA 3SDYL 1J88A 4MRBA 1HYSD 3CFBA 4GRWB 1E4XL 4NQXB 5CCKH 1W8NA 4H44C 4IRSA 4CMHB 3V0FA 5SX4H 1T0OA 2BSRA 3LMJH 3Q8EA 1E5UI 5KTEL 3K2KA 1PKQA 1E50A 5C2BL 2MJWA 4NLAA 3RVUC 1KB5A 4RVBA 2P48B 2JKXA 4OCWL 4R90L 3MKGA 4UDTB 3TNMB 4IDJH 1UWXH 1PD6A 1Z5LB 3T6ZA 1AS6A 2ICEB 3D33A 2F0CA 4HWZA 1I82A 1E3FA 4DJMA 3U4BL 1OGAD 4JRWA 5EG6C 2E4TA 3MJ6A 4WKXA 4AYEC 4OI7A 3W37A 5FWRA 3TA4D 3P9LA 1R3KB 3Q44A 3L3IA 2N7SA 3L13A 4P9HH 5DO8A 4ALAH 5IB5B 3W9EA 4IQHA 5J13B 2CK0L 3RNQA 2EH7L 1V54B 2BNRE 2F54D 4GSUA 4JL1A 4JFHE 2DMHA 3INOA 2HPTA 2YMXL 3SYOA 5I5IA 1U8JB 1RUAL 2FBJL 4MS8D 4DKDC 5KOVC 1LO4L 1MNUH 4FYSA 4Y2DC 1H19A 3GMRA 5C0DB 1N8ZA 1ZVSA 3R7RA 3TEZA 1CICB 1A1MB 5F9JA 4OY9A 3PYCA 4WCYH 3TV3L 3MJ7A 2OJZL 4U7SA 4QF1B 2LHAA 2LAAA 4AT6B 4HJEA 5GS3A 3J2PA 1P7QB 2GK2A 1JHKH 1FG2B 3DVIA 5D1XB 4JPVL 1CLZH 5BMFL 5CIPH 1J9TA 2XWJB 5DD6B 1BOGB 3DOSA 4HKBB 1WZ1H 4JUSA 5AVTB 1IB5A 2DKMA 2RR3A 3RWJA 4F20A 1DUYB 1ZA6B 1KC5H 1AGEA 2OI9C 5G5DB 4O4YH 3BE1H 4BFRA 2EC8A 3U0PB 4YSSA 1Z5YD 4AL8C 2WXMA 4X9FA 3ZHKA 1BZ9A 5HHQA 1HIML 5F71A 2WBJD 43C9B 1KIRB 3INUH 3VWJA 2Y6SC 4OF7A 4PB0L 3ZE0F 4X6CB 3HUJA 3O11A 1IFRA 3IPFA 1TUPA 4JDTH 3LEXB 1GOHA 4L4TD 3L5XL 3H3BC 4XO5A 1X4ZA 1RQ5A 3FT4A 3O9WA 3O8XD 3CVIL 4E0RA 3C6LA 1KIQB 4JO3L 3KPTA 5T3ZL 3WNPA 1X9UA 1HHGB 2VLMD 2DKSA 3P2TA 4RAHA 4Z7UA 5IFHH 2AC0A 2H0EA 2DV6A 3M1CA 4G6KH 3EG9B 1E67A 2R39A 1YEEL 2X1WL 4KROB 4EVNA 2OAAA 3TJPA 4MXVE 2OTWA 2QT6A 1QEWB 2WXPA 4UZSA 1HNGA 3ILPB 2NY5C 1SRDA 3QDAA 1JGEB 1OB1B 4HJJH 1RUKH 1F86A 3APCA 4ZAKD 5BV7L 3HC4H 5D7IE 4YHLH 1CGWA 4KHTH 3UZVB 2YPLB 3OQRA 4E68A 3VXQA 4WTWA 5TTRA 4AMXA 4WNJA 3SCMC 1ND0B 2TAAA 4JHAL 1AYOA 3MRRB 3QYMA 1S3KH 3N40P 3AT0A 4AEHH 2D7MA 1VGKA 2A77L 3MNWA 3LRMA 3TC9A 4ZNEE 5F93C 4NFCA 4IRZA 3Q5OA 5EPMA 3GD1C 5G55A 3SCMB 5HHNA 4MD0B 3MLTA 1V7NL 2ITCB 2GAZB 2WQUA 5J7CC 4J5VA 1H0DA 3QVAA 2EE9A 4JFZH 1CT8A 4TSAH 5I5RA 4X4MA 1HWHB 5AW8B 4Z3IA 4LVNC 5D7SH 3L9EA 4G2AA 3AADB 1DSYA 3FB7B 3BKCL 4OCYH 1AZRA 4IGBD 3VD3A 4FTDA 2BP8A 3ABZA 4H40A 5AWNH 1MLCA 3FT3B 1CURA 4XCEB 4HGKC 5FM4A 2DTSA 5E99L 3ASNB 4NN5B 3MRKA 2EDKA 1FVDB 2DTML 4J4PD 4ZFOA 5IW6A 2Z7YA 4X9BA 3L5WA 1BQUA 3U79A 1YJDC 3GJFH 3O6KH 4BV1A 4PJBA 4KO6A 4HULB 5K9OA 4B0MB 4FNSA 1I9IL 2H6OA 2VIRB 4P07A 2FIKA 4URTB 2IAMD 3O8XC 4NZJA 2UVFA 3RJDA 5H4ZA 3BSZL 2NY1C 5T3ZD 3TFKD 4JFFA 1BVLA 1X5XA 3KLSA 5HDBE 1TNMA 1YO4A 3V6ZA 3S5LG 2DYSB 4LL9A 4MMYB 1SEBB 3VFVB 1AFVH 2HFGL 1MHEA 3EOAB 4HT1H 4YAQB 4UMGA 4ZMOA 3BEVB 3F6JA 1NCWL 4P4RB 3DDFA 3PWLA 2WOBA 4YFLF 2F53E 5DUPH 3BWZA 3GSVA 3HEIB 4QYAA 4S0TD 4X6DE 5T1LD 1K8IA 5KWYC 2OS7A 2VDNL 3ZKND 3K2UH 3KPLA 3PQYD 3R06B 4ZTOL 3BP5B 3T3PE 4LEXL 5B21A 1UZGA 2QQKL 2XWBB 2E59A 5FA3A 3RL2B 1N64L 4XNMB 1LWHA 4ORZC 1I9RH 3ULAB 2L8AA 2R0WH 4LLMA 3VX0A 1P9MA 2PO6A 4PGEB 1XB8A 5KG9A 3EFOB 1NQBA 3O2DH 2ZSVB 1MI5A 3EOAA 4FQLH 1SOSA 2BRRL 1UOLA 3LZOA 5ALBL 5LGHH 1UQSA 2AK4D 2VN5A 2YBRB 3E6FA 1WK0A 3TIEB 2JKLA 3CVHH 2DM2A 2HFTA 3MRJB 3K81A 4WLCA 3MN8A 3O45B 2XCMC 1TQUA 1FFNA 5DSCB 1OK8A 2F58H 1MW0A 1KYFA 3DBXA 1T7VA 3M1OA 3QG6A 3QEQB 4FFYH 4NO2B 4S1QH 5LB1A 1E3ZA 2G2RA 4ETQB 1KEML 1YEHL 5FYKL 4QRRD 1PLCA 3FRPA 3VE0A 3UTTA 4J4PC 4LSUH 1ZA3A 1XSKA 5J89A 3IU3B 2ED8A 4NNPL 1A8ZA 3FN9A 4XTRC 3LQMA 5JDJA 1T0MB 4GW1A 3CFMA 4PJHE 4HCGA 2EE6A 3WJLA 4LCCB 2X4TB 1YNTB 4FFYL 2KBGA 3MU3A 1KN2L 1J48A 2WNKA 4P5MA 3V0WL 3M7FB 1E8XA 2Z91A 3D4GA 3BZFB 3QQ3B 5ALBH 1U95B 3QZOA 3WN5A 4L3ED 4OF3A 4I18B 2XZCL 1AG0A 4FQCH 2J3SA 5D2LF 1RP8A 1Z3RA 1OAQH 5ILTH 1I9RL 1TJXA 2PR9A 5KZCD 4PRIA 3KM1A 4L0YA 1DJHA 1RMFL 4TXVB 5F88A 3SY0B 3MRMA 4KV5F 2GFBA 2H1PH 3CFJB 3O6MH 5EUKB 1VGKB 4M9PA 1Q1PA 2FGWL 3BD5A 3P3UA 3RE0A 4OZIA 1XCTB 3TO2A 4KI5E 3DJ9A 3IF1B 3FCTA 4KRPD 2P8PB 3FO9A 5MI0B 3UPCA 1ZT1A 2KDYA 4OLXL 4V11A 3VXSB 1WFMA 2H2SD 2AQTA 3PL6D 2ZCKH 3T3MB 1ZHBB 3GS0A 5I1IL 4HMEA 1G7LA 4HT1L 2HX9A 4ZQKA 5IM7B 1MFUA 3TO4A 1LILA 3FOMA 4WK0B 3QFGA 4ZZKA 1Q0XH 5DMIH 3GZKA 5C08B 3U1QA 2R29A 2FSEB 3Q48A 12E8H 2NY2D 1G1OA 1GS8A 3CN2A 4DNLA 3MUY1 4YLQT 3UC0L 2OYLA 4AIXA 4CC0A 4LKXB 4MDIA 5AVXB 1N10A 5K9QG 5AVYB 2K78A 5H4YA 1WE5A 5IVXA 2PTUA 3QCUL 2XYCA 4Z7OE 1FL5A 1DVFB 3SQOL 7PCYA 3MXVL 1AKJD 4JK0D 4XCFH 5T3XH 1DSWA 4NAMA 3OV6A 4K9JA 4KGJA 3EJUA 1HZHL 2NXZB 1E28A 1U8PA 1WFJA 4YOKA 4C57C 2E75C 2NY3D 3NJFA 1SOKA 2ROXA 1NFIB 1T0NB 2PPCA 1P4LA 2BVPA 3MA7B 3NDYE 3Q5YA 4UV7H 2C1PA 5F6HI 4JZJA 2G75B 5K59F 4ABUA 3MROA 5BXFB 1IEHA 4FEMA 1VCAA 1WA2X 1NMBL 3B7UX 4QXTB 1S9XA 4HIXL 5I2IA 3DIDA 5EIIA 1WBYB 4HD9A 4ACPA 2QGEA 2QQKH 3EBHA 2Q1EA 2DWDB 1V8HA 3FQUA 4LSRL 3K5RA 1QNZH 3HS0B 4OZGA 4CC1A 1H5BB 3TZVB 3OKOB 5EU3B 5K5YA 1IEBB 3EYVA 3MV9A 3OJDB 1R17A 4JFZL 5C0DA 2ICWB 3QNXA 3VXTA 2WINB 4ZUSB 1GR7A 3S37X 1DQML 3FB6B 2FR4B 1UWEH 1MFCH 3C60A 3L5IA 2BS9A 4M5YH 5E24E 5E56A 4QTHA 3EJYC 3HMWH 3PL6B 4LNRA 1P53A 2H0JA 4AWJC 1KIUA 1TZGL 3BP6B 2BC4A 3IMBA 3W9EB 4QXGH 1CXEA 3GSRA 5E2WH 3WDHA 4MD5B 3MCKA 3LDBB 1IQWH 1C7SA 1WAAF 5EA0H 3ZKMC 6PAZA 3P0GB 4M5SA 4OD2B 4C56A 3T0XA 1JZ4A 1UCTA 4YX2L 1JN6B 2ARWA 3APMA 4NO3B 3ABLB 3CVIH 3CSPA 1TYEB 4RAVB 1CGTA 5FGBC 3OJMB 3VXMD 1T7WA 3VFTA 5I8KL 3ZDZF 1I8IA 4YFLI 1JWUB 4NKMB 1JZ5A 3DUSB 2V2TB 4NOFA 5LWYH 3ZHFA 3TN0B 1MFCL 3II1A 1RUMH 4Q6IB 3CHSA 5E6ID 5KW9L 3QXDB 1D5BB 2PXYA 4OT1L 5KSAC 4LHUB 2IV9A 2OBGA 4FTVA 1IC4L 4P06A 5L4IA 4QJ4B 3PAUA 2VM9A 4B50A 3LS5H 1VIWA 1ACCA 3FK3A 4L1SA 4U6VL 4BJLA 4JM2D 6TAAA 5IBTH 1MW3A 4ODUA 1JPFA 2WVVB 4RNRA 2HYMA 1FV1A 3K8KA 3X11A 1NMBH 1M1SA 1NBQA 1RMFH 4IIQA 1BAWA 1FO0L 3RKDD 4GG6F 3K1DA 1D6EA 4FYQA 5A3ID 3I3DA 1KJ2H 2GI7A 4ZD3H 5JW5A 2XX1A 5DZJA 5DD0L 1A7RL 3VI4E 2G2NA 2WP3T 4FQCL 5I8OH 3MR9B 2I9LB 4MMXA 4E9XA 1QG3A 1I8KB 1G7HB 2OJEB 5GRYA 3U0TB 3C5ZA 4X8GA 5GJSH 4RFNC 4OF0A 4N3UA 1KN2H 2IXQA 3EYUH 1E28B 1U8PB 2GTWA 2PTVA 2Y5EA 4OFIA 3STZA 3UBXG 5LHDA 4OJFH 4WNSA 4ECNA 4OQTL 4F7KA 2F7QA 2X42A 1DANU 4I4WB 2Y2YA 2B1OA 2I85A 3NJGA 3QQ9C 5DXWA 3W0WE 2CBPA 3DX2A 5DZNA 3TONA 2P24A 1FVCA 3GBDA 3KE0A 5DMIL 1D3CA 2XRAH 3FRPG 1HINH 5HJ3A 1FPTH 3CK0H 3TT3L 5JW4N 2ZWSA 4MJ5B 5I1IH 1GZQA 4W93A 1VAHA 2Y2TA 5KS9E 5DHVB 3IK2A 4HLJA 1THCA 1IT9H 2B3RA 3QUMH 5CD3A 1S7WB 1Y07A 4OM0L 3V52L 2EXTA 1UM4L 2PETA 2X7LA 3CFQA 5ENWB 5IW1B 3VVVA 4K8RL 2FO4B 2OMWB 3BAXA 5KSUA 4D9RE 2CCLA 3BO8B 4FD0A 3ZMEA 4RGMC 1KGUA 4M5ZH 3CFEB 4N2GA 3ZDWA 1OD7A 3LQZB 4XPGH 4YHPB 3U1PA 2CMRH 5SX5H 1KTJA 1U93B 4NZTH 2DQGH 3ULVE 3BP4A 1C9SA 4WENB 5HD8D 1YEFL 3EH4B 5ANHA 3C5JB 3OHXA 5T1MA 3RURA 5J4MA 2XY2A 3OKNA 2CBMA 4Z7VE 4XB3A 4WO4C 1AFVL 2WXLA 4Z6AT 3Q0HA 3BSHA 2JF1A 4XVJL 4NYLB 43CAB 1ILUA 4P5MB 25C8L 1QI4A 1UXWB 3S5LA 5ITBH 1UM5H 4I18C 3PIQA 4H8HA 1EHLL 2QADD 4A2LA 4HKXB 1JUFB 4UNIA 4ZFOL 3V5DB 4L4VD 4OD3H 4G7YH 1BD2B 3GXPA 4OLZH 2VDPB 3LRHA 2OSWA 1C1EL 3VNZA 4X7SH 5F7BA 4L2LA 3S3CB 2F7RA 3QDGB 3DSFH 4ZMXA 1L9PA 5HY9A 5KTEH 3GSWA 2N1TE 3KH3A 5DFAA 2QPDB 3B6SA 1KCBA 3GMNB 4DHLA 5TD4A 4DVRL 2VMJA 2X4RB 4YBHA 3SN6N 5CAYB 4DOHE 4KKRA 4PJXB 1FZJB 1TZHA 3CBKB 4LLMB 2D31B 1T20A 1Q9OB 1IILE 2CJTA 2WUCH 4ONFL 3ZDXE 4RGNE 1YUHB 3TEUA 1QSZA 1H6TA 1JWSB 4QD2E 4H1LB 2W9DL 4FABH 3EBAA 3PP3H 4NYLA 1I7ZA 3IBEA 7CGTA 5MERA 3L95B 4N68A 3WIFB 2JCCA 5E8PA 4C83B 1B4RA 4NJAL 4O2EB 2J1YA 4X98B 3F65A 2FX9L 3L9RB 5A2AA 3VI3F 1RHHB 3WTXA 4KZEL 4UYQA 4TF4A 3ILEA 3RFZA 4OVVA 3RL1A 4MVBD 5K1VA 4RMWA 1ET8A 1PGRB 4JZNB 5E8OA 2EDMA 3ZQWA 5I73C 3HFMH 3EHBD 1PY4A 3VM5A 1T04A 3TA3D 2DQEH 4HPYH 4H4NA 3LXUX 5L4FA 2AZAA 4I3SH 3CN4A 3AY4A 1LE5B 2IPUG 4JB9L 1Y0LB 1X9LA 5GQBA 4FI8A 1HESA 4O02H 4LBEA 3ZYJA 5BRZE 3F58L 1JPGB 3B2UC 3V6ZB 5F89A 3ZT6A 2YPVH 3T6VA 4CAGA 3SKOB 3VRIA 5F44A 2NUTA 2NQDA 1FSKC 1P5UC 5T1LA 3P4NB 4OQTA 1UYWH 3JWNC 3SE3A 4WTZG 3BT2L 3ARBC 5E4AA 3U4EB 3UAFA 4QRRE 4J8QA 5JLZA 1L7IL 4PJ9C 2EUZA 1MCPH 5DEZA 3BPNB 4F1SA 4UDUA 2VAJA 5E2JA 2H26A 1M6OA 2VXSL 1P5UA 2YWZA 4Y1AE 1GZQB 1JVKA 1L9RA 1OLZA 2A9NH 2VSMB 5IF0B 1SXZA 3X1NA 9PCYA 2PO6D 2NY1D 3GMLA 3TFKC 3W0WB 1M2OA 2F8VA 4HS8H 3FU7B 2X5PA 1W8OA 2CO4A 5AZEL 3REVB 5JHDD 2VE6A 5HJGA 1XEDA 5AB1A 3ECBA 3SOBH 2FQGA 4JPVH 4AIZB 2CA3A 1NA8A 4F7PB 4YDIL 4UM9D 2P46B 3WO4C 1VADA 1OSPH 4PJIB 4PG2A 5HI5C 1DJGA 5EO1B 3KS0H 4L37B 2O72A 2E7LC 2F54B 4B95C 1HHKA 2I5YL 4MAZA 3D30A 4A63A 3H6JA 5GHWL 1IGYA 2B7DT 3HCVA 4GH7B 1TQCB 4EE2A 3U0TA 5IROA 2RB8A 3DGGB 4HV8B 4UNVA 3FFDA 3ZE1B 4HHAA 3ZKQD 2ENQA 2WPGA 4N3TA 1G7MB 3S3BB 4APQD 5KANI 2ZXGA 1UEYA 5DZLA 4DK6A 2MCG1 5LGKA 4G6JL 2BPBA 2Q7AA 1D5XB 2HFFB 3QI9A 3L1FA 4BSWB 1BVNT 1XL6A 3BZEB 4GMSH 5T8IA 4LU5H 2FLBT 1NPJA 3QJUB 4LCCC 5EZOH 5T3ZH 3EOTH 3N0AA 1WC7A 4DN3L 5I23A 2CM6A 2EDRA 4JLRB 5L2KD 3MUGA 1ETZA 1M53A 1S5IL 3ZLQC 3M1BA 4GKSB 2C34A 5EDXA 2HUEA 2VJXA 3CTTA 4FTVB 2AJZA 5F7NC 4ZBJA 2V7HA 4M1DL 3VD5A 3G5WA 2BP3A 1ULVA 3V7AG 3SGDI 2DEYX 2J25A 1RUPL 3FQXB 5DO2D 2EEDA 4XTRD 4N86A 3JWDH 2ZUTA 3KGRA 1IE5A 1IJ9A 3UZEA 1PIGA 4JFYA 4PJ9A 5DO2C 4ZS7L 4LSPH 1MQ8A 1G9ML 3LMJL 3LPPA 3BPOB 5JYLA 1VACB 5ABAA 3US1A 3NZUA 3PABA 1WBZB 3AU1A 4MMXC 3OX8B 5D1XA 2Z8WC 3FTGB 35C8H 2CA4A 3RWHB 3V55A 1MF2L 5E6IC 3MRIA 3VD7A 4DKEH 3O3DA 2OCJA 4HIJB 5I1KH 5JDSA 1JMZA 4GFXA 2Z4TA 4RLDA 4X80H 4DP1X 4ELDA 1BF8A 4G72B 2CO2A 2X4PB 3QZPA 5E5MA 5F9AC 2C3VA 3JVGC 4QRAA 4BDVB 3GSNH 3MOAL 3BEWA 1MI5D 3F7KA 2KYIA 1KTCA 1AKJA 5F3HA 2A9DA 4NDMA 4S1SH 1MWAL 3L3KB 4KUCF 4LCYB 3ZO9A 1VCBC 2WINA 3ECVA 4GG8A 1IAIL 2AJXL 4L37A 4NENA 2QQLH 2VZ3A 4XMUA 2X6MA 1I9EA 1PLBA 3WGUB 3L45A 1E30A 2P3YA 1I7TB 1MCWM 3N1FC 1DFXA 1G7PA 1KGCE 3KLHC 3BVDB 1QACA 3VI4F 3DWTA 4YPJA 3H7LA 1JNNL 2FZ3B 2IH3B 3HIZA 3QDJD 3ZL4H 4NRZA 2IADB 5FYKD 3C87A 1ETB1 2H26B 5DLML 5GRUH 4WWKB 3MLWH 3MXWL 3NA9L 4NC1C 3L3GB 1IGFH 1A1OA 2DB8A 4UNUA 1PEWA 1FUNA 4YPGA 1KB5L 3KS0J 5CJQL 4G80A 3UAJD 3BQUC 4YE4H 2X88A 2XV0A 4WI4A 3T0ED 4P59H 1KCRH 3RHWF 2VXQL 2HZHA 1C8PA 1TVBA 2VRQA 4JLRA 4Q2ZA 3ETBJ 4MWFA 1LO0L 2VXVH 4BELD 3GIVA 5ID1A 2MWCA 2IAND 4YBQC 4FADA 1JOIA 2WBWB 2WMPB 3ALWA 3OPUA 5DK0B 3UYOD 4MMZC 4KJQD 4JGMA 5ITFB 3KVPA 1CL7L 4LRIA 5DD3L 5DK2B 3WIFA 3BWAA 3H54A 1NPNA 4OJEH 5GPRA 1S5HB 4MAYD 1CD1B 1ZE3C 4MRCA 3WJJC 5KYUA 3FCTB 3TCTA 2J12B 1AXSB 5FFOA 4X5LA 1CBVH 5GS0D 3VMPA 5FGRA 4Q9RH 3G6JB 3V4UL 4NKIL 2P5WA 3UPRB 5TE7H 4X5RA 1EEZB 2VO8A 5FYJU 5TF1L 1BJ1H 3C5SB 3ZUNC 1CLYH 2EECA 2X1PA 3NN8B 1HS6A 4TLUA 3MO1A 1LTXA 3B7TA 4L3EE 4ZMZA 3L7FA 2X6UA 4U1NA 3FU7A 4U1SB 5E23A 3DLQR 3S5YA 2BRQA 3IJ8A 1OVZA 4FXTA 4TOYH 1I4FA 2E9GA 2K9FB 4S2SA 1UM6L 4LCCA 4Z5RA 3RU8H 4BFIA 4OZ4B 2CAKA 4QHUB 2R56H 3RDTA 3OR7A 4DK5A 4FMVA 5EBMA 2WVTA 1QSFD 3WIIL 5CHNA 4IK6A 2BWIA 2YQ3A 3DVFA 4DVBA 1UD2A 3DO3A 3DBSA 3FC8A 4TVSa 4ZI8A 4K3DL 1YLBB 3WKMH 4X7EC 2B15A 1WYJA 3FSAA 2Z64C 2Y4SA 1O5DT 2GKIA 3GYRA 1FCGA 1FIGL 2YQ2A 4YSUA 2E47A 4YHMH 3QPQD 2B2XL 3TX4A 4D9RD 1DBJH 3FO0L 4OD3L 15C8L 4WGWB 4R7NA 4DPRA 2X3BA 4EI5B 1CF8H 2PYEA 2VUYA 1A4KA 1B2YA 3IFNL 4NHCH 2JLLA 2Q5BA 3RNKB 2W0KA 3DX0A 5TFSL 4XXWC 5EORH 4LGSB 3IAPA 5I73B 3MYZA 4N6RB 3RWFB 3T08A 5KUKA 2UZXB 4MAYB 2IGLA 1E27B 2PWDA 3AT8A 3WLBA 5AVWB 3UG5A 3BGMA 4X50A 3BCDA 3QPXH 1QFWI 4J28A 1OPGL 3LH2H 2UZXA 3LRSB 1ZJAA 2YD7A 4LEOA 4JRYE 2DQGL 4HUVB 3IMSA 1T4WA 2Q2EB 3QRGL 4FQXC 4UYPA 5JZ7D 5CIPA 4MXWL 1EANA 4HJ0D 4PJXA 1XIWD 1SDDB 3GJEA 4HK0A 5DEJA 2MMXA 4MQTB 4TNVK 5ID0A 3UGEA 1IKFL 1MF2H 4ZS6D 2DYPD 4J4PA 2VAAB 4HWEH 3Q6FB 4NUQA 3ZDXF 1PQZA 2CKBL 4CC4C 3GSWB 4KK8C 4OM0H 3V52H 4PD4K 3FUEA 1EPFA 5D4HA 3BDXA 4AGNA 2P5EE 5D2NB 2TRHA 1J7VR 4P57A 4HOMA 4QO1B 1WT5A 1W91A 2GI0A 4ALAC 4F24A 1F56A 3OMZA 4PB9L 1S5IH 4TYUA 2BFGA 3WD5L 4PJDB 1ZLDA 3BD4A 5A7EA 3LH2L 1F2XK 4JM2A 1KFGA 1OPGH 2HLAB 4DIXA 2BNRA 4H13C 2ZKYA 4Q9BA 3FH5A 2OSLA 1VZHA 2WWNA 4GMSL 4IU2A 1M6UA 1R33A 3DOIA 1UXWA 3S5LB 4FXLA 4E41B 1Z9MA 1ZT4B 4B9FA 5HVWA 3T4AC 4PJGE 1S9WA 4Z3EA 2AJSL 3L7FB 4ODHH 3RWEB 2EYRA 3TURA 4RESB 4RMVA 2CUAA 2MQ3A 5HI4C 3ULSB 2A4ZA 3B4NA 4KK9D 3ROOA 5IEHB 2Y69B 1NMCB 5AOLA 4LSQH 3L3JB 4FLRA 2PR4L 5IB1B 1ZOXA 3WKML 2VB5A 2DPKA 2HVJA 2K6YA 3CAFA 4G9DB 4AM0Q 4Y1SA 5D70H 3VW3H 5B3SB 3VUAA 5D4JA 5E4IA 1J0KA 3DYPA 3A4AA 2OMYA 3HBPA 4Q6IA 4FL4C 2I5YH 3VFMB 1S6NA 5FO8B 1GS7A 1K4DA 4PGDB 4MHHG 5GGSY 4ZOCA 3SDCD 3CPLA 4XCCL 1ITBB 3OXSA 4U6VH 5JOPD 1T83C 2WQ8A 4KBPA 3VMOA 1SDAB 1OSPL 5LDSA 2D7PA 3SEPA 1F00I 2VZOA 5IB2A 1MLBA 1FFTB 2QADC 4L8SC 2YD4A 2J43A 5F7EL 2CO1A 4JFSA 3IDXL 2FLMA 4H25B 1RUML 5TF1H 3SGDH 2IG2L 2CR6A 1CG9B 1T1YA 5JXEA 4Q0XL 3LEXA 4N5UA 4YPGB 2VMCA 3V4UH 5BS0B 4KUZL 4HSQA 3NCCB 4LPCA 5C9JA 2D4FA 3GHPA 1KIRA 1T5WB 3GHEL 4MBRA 1E65A 4UOJA 2V2WB 4J1UB 1VKXB 1LGVA 4XC3L 5HDRA 5TK2A 4AVJA 1IAMA 2Z3FA 1SMDA 2HCZX 2MCPL 4G5ZL 1GMIA 3NQIA 4KRMB 2DIJA 4APXA 1L4IA 3RWJB 3LY6A 1IUZA 2Q87A 1M05A 5J6GB 1IAKA 4Y4HC 4JM2F 1FNSH 3NSDA 1J0JA 1U3HC 4WFHE 1OP3H 1D6EB 4NJ9H 3LRLA 5I74C 3ATFA 4ZMAT 1QBAA 5CEZD 1GMEA 1R0AL 1ZT7B 2FX8H 2WWKT 4WEUD 4FLOA 2WMPA 2J1WA 2K9UA 4NQEB 4RQQA 1AXTH 5F7LB 2Y36L 2YRPA 4OGXL 4QTIH 1ILSA 2H45A 4GAGH 4GT0A 5C07E 1TVBB 2B5IC 1ID5I 1T2JA 2RGSA 4P2OB 1AD9A 2BVPB 3SPIA 4JKMA 2B8OT 3N5AA 2HG5B 5A6MA 3LJ3A 1IGFL 1Q9WB 3LKPA 5FC9A 2YR3A 5E0FA 5AVQB 1IKNC 5F6HJ 3BUQA 3F2LA 4ONFH 3DSFL 2HJFA 3DJTA 1MAML 5KSAB 1C5DA 1X7SA 1JWMB 2R2BA 3FUNA 5AEAA 4EZKA 4FG2A 3IMWA 4DVRH 1PAZA 5AL0A 3VI3E 3DJRA 3RVTC 1YMHB 2VW4A 1WBZA 2E5EA 3MA9H 4HMCA 4MCYB 5D2NC 4XWOC 3FN3A 2GSIA 3VXRE 5JTWA 2AANA 2QDWA 2GSIB 2DJSA 3ARED 2YAHA 2ZJSH 1OGAE 3BGFC 5DZOA 5T33L 4LSTH 3IBOA 4M7ZC 3EGXB 5C0BE 3GWJA 2DIEA 1SHWA 5IMMA 4PS3A 2VR5A 4OZHF 4XBEH 2GHZA 3TTSA 4O58H 2AJXH 1BREA 3ASOB 1DR9A 1QBMH 4G9FD 3ZE2B 3GSNA 4FQ2H 1NDTA 3HZKA 3RUGE 5FR3A 3HAEH 4OUUB 2X4SB 4NB7A 5AYUL 3LKRA 3PHOB 1X5MA 1S7XB 4LVOB 5I5MA 5JW3L 5DD1L 2HN7B 4N0UA 3TO2B 3BFQG 1MWAA 4PS4L 3TBWB 4K8RD 2X4OA 3IRZA 3ZTDC 2EVFA 4GSQA 5GS1B 3KYNB 1ZV5A 4OSUL 2AV7B 5FA4A 4A55A 1SYSB 1B2WH 2ZOWA 1AANA 1IEBA 3O4LD 3CZEA 1FAKT 1G9NL 4YDLB 1GRWA 3AACA 2X12A 4JO4H 3KPSD 3DO7B 5D1XD 1FVEA 4HS3B 2JI2A 4WHYG 3GB7B 2EUXA 1MXGA 2J6EH 5MEQB 3BZFA 1MEXL 3CDZA 2H1XA 4L9LB 5GIRB 4DP0X 2KL6A 3S37H 1CTOA 3H4HA 1JK9B 1IGIL 4N8CL 2P5EA 3MROB 4QNPF 1YNTA 3MBEC 3E80A 1YJDH 1CFTB 2LE9A 3X14A 1NMCC 4DGIH 3BSGA 1T0MA 1SQMA 5ERWA 1FPTL 4B0MM 5I0XA 4TV3A 5AG9A 1QI3A 5C0AE 1SM3L 2VDMH 2GSGA 2XZCH 5CZVL 2BOCA 4F3FB 1B9KA 4OZHA 1XGTA 3HA0A 2V7HB 3T3MF 5E4OA 5CFHA 5IQOA 3PWPA 4B3VA 2H0FA 4UTBL 4Z3TA 1BLIA 5IB3A 4YDVB 3MUGB 1PCSA 5CN1A 3VG0L 4PRDA 5E6IA 3LZNA 1TQVA 3MV8B 1NKOA 3C8DA 3D08A 4P2QE 4CW1A 3KYAA 2HTLD 4F57H 5IJKA 5E8DH 3WXVH 5BQ7B 4AJWA 5DJZB 5FIEA 4M4PA 3QWRA 5EEXA 4Y7OC 2CG9X 2WTOA 5GRVK 2PPAA 1YQVL 5LBGA 2PYEE 3BXNB 3U4EA 1BJMA 4E5XA 1IQWL 1ASOA 1DN0A 2FBOJ 3QXAA 1KJVB 3T09A 4EUPH 3ABMB 3MV7D 4G6FD 4U33A 1UT9A 3MLSH 4FKHA 4PJ8A 1DO6A 4HOWA 1HSAB 3DUUA 3UAJA 3VGEA 4KY2A 3FKUS 3O41A 5F88B 1WISA 3UO1H 4N1HB 2LFGA 3MRHA 1LO3H 1N64H 1R5VA 2D03L 3QAZB 4XE0A 4F9LA 5AZEH 1IZKA 1FAIL 1ZAGA 4RDQG 2ENYA 3TLRA 1INDH 4OT1H 4E42B 3U2IA 2VLRE 4KK6D 4CSZA 1RHHA 1ED3B 4N2EA 1RURL 1Z9LA 2A9NL 5D1ZC 2CU9A 1ZXKA 4UIMB 3FTVA 1HH9B 1FZMA 1NCTA 2ZSWB 4JKNA 2FIKB 5JZ7C 2C3XA 4OD1H 3ZHNA 2WIIA 4F15C 3KNBA 5FF6B 1HOEA 2XG5A 4XI5C 1M6OB 3UGUA 3L81A 2I7SA 3AB0B 4EIBA 1EHNA 3KVQA 3L4XA 4GLRH 1LP9F 1AIZA 2AGJL 2NTFA 4S2SB 4Z5RB 2PLTA 4KVCL 1HAUA 3B2VL 1Z1WA 3CN1A 3B6SB 4JFDE 3BAWA 3QUZD 5HYQB 1MJUH 5CNHA 1KCWA 2FATL 5CWSB 2OYPA 2F19L 3CU1A 3SQBB 2UY7B 3LPOA 3MO1B 1MHCA 3E6FB 3HFML 1BZQK 3AABA 5D7LD 4X6EB 2DQ6A 3AREA 3BDBA 4ZDHA 2A9MH 3HLKA 1M1XA 4A2HA 4BK4A 4F37K 1AGDA 2O5YH 3UC0H 3WS6A 2WXNA 1QKZL 4YHIB 2W0PA 1C5BH 1KJ3L 3B5HA 3HAEA 3ECUA 4PJ5B 4PRIE 4U0RB 3VXRB 1UWFA 4NKOB 3C6SB 2ZYHA 4NM4L 3T6WA 2DLHA 3EFFB 4QIRA 4D8PA 1CD1A 3L95A 3PUCA 3WS6C 2DQUH 1KELH 3D39D 4HCRL 1OCCB 1FAIH 3OKEB 1U3HD 5BW7A 2DRUA 4MLIA 5ITFA 2HKFL 4NT6A 1SN5A 3QXUA 1RZQA 4JPSA 4N0FB 3ZTCC 1AZZC 5C0NC 5J56B 4Z7QB 4FC3E 4M29A 4LF3B 1J0YA 2M26A 1JRHL 4ZNCD 4Y2OA 4ONHB 2F6AA 4LXFA 4ADJA 5E6IB 2SEBB 5I1LB 4MMYA 2EDEA 2W0LA 5AOIA 4ZTPL 3V6BR 1A9EA 1OW0A 2YKKA 4YSTA 1CDBA 4HWBH 3SQBA 1JFQL 5I18L 5JUEH 2A9BA 3AB0C 3MTRA 4W70A 1G9EA 2D0GA 1AE6L 5ILTL 1NUFA 2X2JA 5HYQA 5DJYA 1XR9B 5AUMB 5FUZH 2B1HL 2WXKA 4DVBB 4H26A 3DX9A 1JYNA 4ZPTB 2BX5A 4H88L 3IJSB 1CTNA 5F7HA 3MV8E 4G1EA 3ZYIA 4WWKA 1HJCA 1IX2A 4HJSA 1F3DJ 2NXYD 4A6YA 1YMMA 2YD3A 3WNMA 2B9BA 4DT2A 2DQFB 1BQHA 1T7XA 5DRZA 2NUPB 1YYLH 2BP8B 2MPVA 3PHSA 3PWUA 5E2TH 4DKFL 1ET7A 5HYJB 1WA1X 4PFEA 1QTPA 1FVCB 3GM8A 4KH2A 4R4FL 3RVWC 1YYMH 1M42A 5C6PB 1XBRA 5DFVD 4UZUA 3ZE2E 3H3KA 3US9A 3HB3D 3NPSC 1KGCD 4M5ZL 1G7QB 2FQDA 1U93A 5GISH 1KCVL 1MCDA 3FF8A 1T21B 1KC5L 2R2CA 2WB1A 3PDDA 3QWRD 4QOKD 4UQ9A 5E2UL 3T3ME 3U6XS 1VZIA 3UPRA 1A2YA 1G6RA 3UTZB 2IQ9H 5L88H 1MWAB 3CLEL 3D2UB 4K5MA 4PY7B 3AVEA 3TGXA 2W1NA 4JDEB 3IMVA 1ND0A 3KW7A 4GAYA 5F7DB 1CZ8L 3SE4C 3BWAB 1JYVA 2EYSA 3MLSL 1HEHC 4TUOA 3MLXH 1T4KA 1QEXA 1Q8MA 1LO2H 5E2UH 5DJCB 1OB1A 3RX9A 4WEBL 1V3LA 4DO4A 1WT5C 1ZHKA 3S6CA 1I1FA 3ZRSA 1JRHI 3NCJH 4ELKA 3N04A 4N1CA 2OTWB 4GSDH 5EHFA 4MAUH 3AU1B 1OAQL 1TT6A 4F2FA 3PHQA 4MWFB 3LV3A 5C0IA 3NIDB 1MJ8L 2UXVA 3HE6C 4POYA 4JPQA 4Z78B 3DX7B 4B41A 4LSUL 3TBTB 1E9PB 1VZGA 1IZJA 3L3OA 4HJTA 4AK1A 4ZUWA 2P24B 3X12A 4IM8A 2G60L 3GS4A 4G80B 4G3YH 1D5BA 2PXYB 4I4WA 1BXXA 4M6NH 4RBPH 5AZ2L 2BOCB 4O51B 4JFUA 5TE4H 2HJFB 2PXYC 1LWRA 1AG6A 2APXA 5DF0A 5KSAA 5LVEA 4KJYA 5GRJH 3NCBB 1XF3A 1ORQA 4WI7A 4GXVL 2B1HH 4NQED 5HHPA 3CMOH 4PIBA 1J5HA 1HEJC 4HXAH 3EH2A 5I8EB 1KJ2L 4G8GB 4P46C 5J1SC 1I8KA 5J11B 1CDHA 4XXWA 3DYOA 3PE9A 1L0QA 1YN7A 2GCYB 4NEHB 2CIIB 4J3OD 5JIQA 4Z3FA 4PUBH 3UBXB 5H35A 1Y18B 1JNHB 3W0WD 3T4AA 3HC0A 1N4XH 5ALCL 4MKMA 3A6CL 2C7UA 4AV5A 5D1QC 3KEDA 1NOFA 3U9PH 2BSED 2WXGA 1MRCH 3VFPB 3WOVA 4F58L 2Y0SA 4W4OA 2BHUA 3OQ3B 1Q0YL 1R3IH 4OM1H 2FECL 5I1AA 5D1QD 4N0UB 2XXGA 1FJ1B 3R4DA 5IIEB 5I75C 4PRHA 2G5BA 2IAMA 3AQYA 4FG4A 1A6WH 4UMSA 4EF3A 3N1MC 2X1XR 5F0PB 4ZAKB 4PJIA 4F5CA 1JXGA 2VR4A 1UZ6E 4K7PH 3L7EB 1YYLL 3JT2A 4NKMA 5E2TL 4N0YH 1TQTA 3OZKA 4FQ2L 2HFGH 1JV5B 3I6KB 4KKNA 3U2SB 3UOAB 3UCQA 3B9EA 3HR5B 5I2IB 2OMUB 2BNRD 1NFDE 2B4CL 3ILDA 1FFQA 4NN6C 2WAHA 1EEUA 4K94C 4XPTH 5TQ2H 1SQ2N 4FQQA 2Y5TA 5I0WA 4QJ3B 1MREL 4KOBA 4AYDC 1ZHLB 2ZUYA 2IGTA 3X3GL 3S7GA 3BX7C 4NOBA 4PGDA 4R2GC 3DPDA 3NJKA 5DVKA 4LKCB 4I0PB 2XTJE 5I17A