1OHZA

Cohesin-dockerin complex from the cellulosome of clostridium thermocellum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
GVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cellulosome Assembly Revealed by the Crystal Structure of the Cohesin-Dockerin Complex
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion
molecule keywords CELLULOSOMAL SCAFFOLDING PROTEIN A
total genus 27
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ohzA00
2VO8A 2VN5A 1OHZA 3BWZA 1AOHA 5LXVA 3GHPA 1ZV9A 1QZNA 4UYQA 2O4EA 5K39A 2XDHA 5G5DA 2W1NA 2BM3A 1ANUA 2VN6A 4IU3A 3F2LA 3KCPB 4U3SA 4WI0A 2ZF9A 2B59A 4UYPA 3KCPA 2CCLA 2JH2A 3UL4A 2Y3NA 4UMSA 2OZNA 4IU2A 5AOZA 4FL4B 4FL4C 3L8QA 1TYJA 4N2OA 3FNKA 1G1KA 4WKZB 4DH2A
chains in the Genus database with same CATH superfamily
1NJ9B 4JS7A 1SHMA 4JPIA 3B9KB 3G6JB 1AE6L 1DQDL 4H44C 3QDJE 3AW5A 4KXDA 3ZDZE 1E6OL 5ABDE 4D0BB 3Q2CA 1AE6H 1DQDH 5LG1A 4OT1L 3KGUA 4EZKA 5K9QI 4K3JH 2X42A 1J1PL 4XP5H 2HFFA 5JNYA 5HHME 4LPUA 1B90A 3DBXA 1EJOH 4H26B 3RY6C 2KDGA 4G1EB 4M93C 4U7SA 3K46A 4XN8A 4C56D 1MCIA 1OGSA 1RULH 4GMSH 5HDBE 3KLDA 1W8OA 1YZZA 1R5VB 4PJ7E 5DDHB 3BPLB 3U7YH 1HSAA 1VFUA 3DIVA 2KLSA 4WKZB 4KHXL 4KROD 2FECI 3NSYA 5SWZA 2GKIA 1A6ZB 4OB5L 3CIQA 1ZT1A 2JTDA 1UKSA 4HJUA 4NAJA 1NGPL 4P5KB 3ULUH 4GS7B 4P2QD 5GRYA 4JJHA 2F15A 4OGYL 2QSCL 3RUGB 1TZHA 3ARDA 3BIBX 3P30H 5BS0D 4GMTH 4NZRH 2I7SA 1LEKB 3MUZ1 5HVHB 1PY0A 1JPGB 3M45A 1MKFA 1ZSDB 4FL4B 4XP4H 4ZFQA 2HLEB 2XNAA 1G9NC 3POCA 3QP3A 1XGRB 5D70H 4BZ1L 2QGDA 4GRLC 4UT6L 3CHXA 1IAIM 4X9IA 3BZFB 2J25A 4JFEB 2XKNA 4P5TC 1TVBA 4HISA 4ZQTA 3OMZA 3QQXA 3RPBA 43C9B 4XHJC 3CBJB 4JPQA 5L2KB 2C3HA 4BM7A 2Z1KA 3H0TB 2JKLA 5I1KL 3NSDA 4NZFA 2HRPL 1KB9K 4NM4L 5JHDD 2OLDA 3QWQB 3C8DA 5CSZB 4JDZA 5D2LB 3MV9E 5DQDL 2F8IA 4EZJA 4NQDA 3I9IA 4DP6X 1KGYE 5IBTH 1GGCH 4MA3B 4KMLB 3CVHB 4FQLH 4BRJA 1AG0A 4LPVA 3VD1A 4HJJH 2FIRT 3LZNA 3VG0L 4BKSC 2J6EH 2XQBL 4NZUH 3PG2A 3IBEA 2DWDA 1M05A 3JWNG 4FFZA 4R7NB 3QEQB 3RJQB 4AJ0A 1PZAA 1WBZB 2HA1A 1I8UA 5EOCH 2ATKA 2XWBB 3VE0B 1FCCA 2X41A 1ZDQA 3QDGE 3CDFA 3FUNA 4KPHL 3VD4A 1CGUA 1KBVA 3MPCA 3VAEA 5BS0B 3OXRB 1A4CA 3O6KH 1FBIL 4DVRL 1ADWA 1RZPA 5CSBA 1T7XA 3LKRB 4Y4KB 3JV6B 2A73B 2BNRA 2C3GA 3C5SB 4V1DB 1S5HB 5IB4A 3ZKMC 2MPAH 1QLEL 4G72B 3CUPA 1B6DA 1F3JA 5FECB 2DLGA 3D2TA 3EH4B 4UB0H 1JGDA 3FUKA 1XHHA 3Q5YA 2XG5A 4FFZH 4J3BA 5L8LB 3TL5A 1TCRB 3QWOA 1OXYA 1DDHA 2EUVA 4CKVX 5GZOA 1OTSC 1M2VA 3K2IA 5LGHL 1KCUL 3AT9A 1CGYA 5FO8B 1DYZA 5I71B 5DD6A 2CCVA 4MQSB 3WJLC 3S3JA 1W0WB 2YKLH 2YPVA 1HEZA 1HL4A 4WJG3 1VB9A 2CBMA 4K7PX 3PFQA 5EZLA 4IMLA 4D2NA 1NDGB 4OCLC 1OCZB 3C5ZD 3RVUC 4P2RD 4KU1A 3SZ6A 1E27A 3STBA 1LO2H 1QASA 9PCYA 4JFXA 3BKJL 1SZNA 3L16A 1IEBA 5TF1H 3RDTB 5I15L 4IKIA 4ORGA 5F7MC 3TA4D 1Y6KR 4XB8A 3TJEH 4GKOA 5LBVA 1H6FA 1JZFA 4ENEC 3W9DB 1U2YA 3K71B 4KDTA 5DQJA 4PB0L 1R5IB 4QRUA 1JPEA 2R2HB 4U1JB 4ELMA 2Y36L 3W0WE 1K5NB 1X9RA 2LR4A 4J4PC 4P06A 3BUQA 4XNZB 3GMLB 1VERA 1JDCA 8FABB 4AVHA 4LDEB 2QQNL 5I0YA 1Q0EA 4N0FB 1QPXA 2HX8A 1EFXD 3QIBA 4HP5A 1J1OH 4OJEH 5I1CL 1MW2A 2VXSH 3HVNA 3WI9A 3D30A 4KROB 2YN3A 2MHAB 1IAII 2FIKA 3VYPA 3ZHDA 3AJ7A 3S88H 3EFOB 2ICWJ 1H5BA 4WFGD 2WIMA 2J8HA 4ZFOB 1Z9SB 4CVXB 3O6FB 3T4YB 4FYQA 2XPGA 2QMJA 4PG9B 1B0RB 3KHQA 4MJ5A 3D6GA 4OF0A 5DMKA 1UJ3A 4ZUVA 4MD4B 3LPFA 3KWVA 3MLPA 5IP4A 1QA9A 1RSYA 2AGJH 1R5WB 1HHIB 5CZKA 1ZVSB 1N8ZB 1SUJA 4NQEE 5DEFB 4L4VE 3R06B 1O7VA 3VXSA 3MRCA 3LOWA 3KPQB 4JFED 4UV7H 4G6KH 1YNTB 4UT7L 1LMIA 2UVFA 3ASNB 4PH8A 1P5UC 4P49A 4Z77A 1ZS8A 2C1PB 2NY6B 3MLZH 1HHGA 2AAAA 2GBUA 4HWEL 1F1AA 2PO6B 3PABA 1TETH 2HTKC 2I9LA 2M2DA 4XMKH 4WTXA 4YDJA 4WFGE 4F1SA 1JWUB 2B2XH 3S36X 2FQDA 5C0DB 5HHOA 3JT2A 5HYQB 1OIOA 3QZMA 5CLTA 2W65B 5F9DC 1LP9F 5E9DE 4OM1L 1DJGA 4QF1A 2N7SA 3LYRA 4G6JH 3SY6A 4ZMLA 4QRBA 1F4XL 4RRPM 3DHUA 4ZUTA 3C5ZC 2R4RL 2MOVA 4G80B 4H40A 5IJVA 1AYRA 3DX2A 1T1YA 5HPOA 3QAQA 4R7VA 1A6PA 2H1XA 2CAKA 3CV5A 2YAPA 3IETB 4NPYA 2UZYB 5T1KD 2OTUA 3LDBB 4Y2LA 1P7KB 2Q86B 3SGDI 1T03H 1RIUH 5F7BA 1XL6A 4K9EL 1H8OA 1T2QH 3IDYC 4XHQA 5LQBH 3ZKXB 1PLBA 5LBSA 4AKPA 1BXVA 3A4FA 5E2TH 2MSPA 3T09A 3BEVB 5L4MA 4RFNB 1VENA 1RZFH 1N68A 4OFVA 1L7TH 3V52H 4WUUE 1MQKL 2P28B 3HMWH 4KX8A 2YPLE 3QDGD 4Z7UF 3ARUA 5F71A 4ZFFA 3Q2LA 2P3YA 3BZ5A 5F7WC 4LLDA 3VGAB 4YHZH 3L95A 4JKKA 1CI5A 4Z7VB 3VI3E 1JXKA 3OMNB 2CDEB 1WWWX 2V3DA 2IPUG 1HAUA 3HZYB 4NJAH 5FV2A 3P0VL 1G9MH 1NICA 4CMMB 4XP5L 4MVBC 5HHQA 4ODTL 1FAIH 3B9EA 1OPOA 2NYZA 4NJAL 4YQXH 2UZXB 4H8WH 4F7TB 2VR8A 2WINA 3U4EB 4FTVA 5HDWA 4HEME 2DOCA 3TZVA 5F1OB 2CGRH 1J9TA 4PRPE 1ZWIA 3Q9PA 3UJJL 3T1FB 4QYOA 2IWKA 1EDHA 5E1QA 2I24N 5ECGA 3FQWA 3MNWB 3LQAC 2G75A 1ZKAA 4U2YA 3SE6A 2H41A 4X7SL 4YPJA 2GG1A 2NY0B 1V7ML 5EC1A 3KHOA 5C08D 3GBLA 3IDMA 5D55A 2DQUL 5B8CC 2Z0BA 5C0CA 2D73A 2NQDA 2WXRA 1YUHB 2QFRA 5E99L 3SKNB 3VXPA 5B1BB 3CIAA 3V0VB 2D31B 2VH5H 2YRPA 2AXGB 4XP6L 4A2GA 2JKIS 3U83A 5DLLA 3FT0A 3L3IB 2GSGB 4TNGA 3CXDH 1QFHA 1PZUB 2J12B 4WK4B 5MHSD 2VDKH 2V8MA 2EADA 2XXFA 1FZKB 2IVFC 2NNFA 5C0EA 2PR9A 2IDSA 1MDAA 5D2NE 2GTWA 2Q76B 2GAZA 2N1TE 3F6JA 1IB5A 5F1IB 2OQJA 4R4BB 3WMPA 5J6GA 2XBDA 5M95B 4U0RC 3UYPB 1ZPLA 3VWJB 1OGAA 1ID5I 3TNNA 2BRRH 3N06B 4JN1H 3FOMB 4XCEA 5FC9A 2HMID 2JQZA 4B53A 3TYFB 5AFAA 1BQRA 1BAFL 3ZT5A 1IEHA 5B1JA 4GXUN 4JQIH 3KL0A 1FIEA 3HAEA 3HN8A 1I7TA 1JWMA 5DEGA 2OYKA 1YECL 4BSWA 4JQIL 3GFUA 2IBBA 2YXFA 4QRSB 1G1OA 5EU4B 1P9MA 1BZ7B 4WNQB 4UYQA 2R7EA 1WBYA 3NZHL 5GZNA 1RIHL 4Y2DC 2OCJA 2E7MA 5CILH 4XN4A 3HTLX 4OH2A 5C0DA 1KCRL 2VDMH 3EOTH 3ESPA 3H6AA 2JKNA 2ZCKL 5D2LE 3V7MA 5JIIA 4A68A 3IFOB 4IMKC 2BIMA 1A3LH 4KI5F 4PRNA 3T0XA 1R3IH 3MRIA 4X5LA 1MRCH 2GI7A 2ZCKH 2VXQL 3EYQD 1YCSA 3KPPB 2NZ1A 3SDDA 3WN5C 3FW6A 2YBRA 3GIVB 4P0DA 1G7LB 5HHOD 4OGZA 3G5YA 4J3OC 3U0TB 2WSKA 3MV8A 5AYTA 5J1AA 4BKTC 5C0EB 4X5XA 2XXMB 2WB1A 3ET9F 5DSCA 5I74B 4OZIB 2BM3A 5HHMB 1ZLWH 4PSPA 4K7PY 1TU2B 3ZTJH 2AK4B 1EX0A 4OUUB 5F6HI 1GY1A 4Q4EA 1AQHA 2HN7A 4P23B 1FH5L 5I26A 2J8UF 4I0PC 2K6ZA 3EADA 4TLTA 3AXLB 5ICYA 3BUYA 2CA3A 3O2VH 2OMXA 5JTWA 3T5WA 3KVQA 4IW4C 1T5WB 2L3BA 2AQ3A 5CP7B 2GFBA 5TDOB 3V0EA 3BZEB 3WUWG 2MNJB 2W38A 5IMKA 3QUXB 1JYXA 5CP3A 1G7JB 3DMMA 2AEWA 5DS8B 2FBOJ 1JERA 2ZOTA 1NBCA 4XZUA 1TUPA 2BY3A 1ZDSA 1DL7L 4H25A 3CFJB 2HJLB 4WK0B 2AEPH 3D0LB 4X0KA 2AANA 5EIVA 2VDKB 4I18C 3LS5H 3ARVA 1AANA 2YUZA 2VXSL 4NQSA 1JWUA 2Y7LA 4HX1B 4FLHA 5D8JH 4HXAH 5E94A 3BSZA 3RWDB 1AZVA 4EVNA 1HWGB 3FCUB 3KLAB 2DBLH 1CBVL 1YEEL 3IKCB 2ZWYA 1ZMYA 1OGTB 3BAEL 5ICXB 4FZ8L 1XGZA 3BP5B 4Q8BA 3KWXA 5CO1A 2R1WB 4AENA 3U25A 2JI1A 5ID1A 4WNQA 3S7GA 1CDYA 5KTEH 4LLQA 5FFOA 1Z9MA 2CO7A 2X44D 4GG6B 3ZLQC 3NSFA 2F58H 2JH2A 4G8IB 1BA9A 1BM3L 2AK4A 3KS0H 1ACXA 1X4ZA 5ICZA 2ARJQ 2G5RA 4I5BA 5JW4R 3SQBB 1MIEH 5C0CE 1ORQA 12E8H 5KYXB 1SEQL 4DGWC 4F7CA 3PV6B 1D7CA 1MLBA 3SDCD 4R0LB 4JB9L 2C3VA 3EH3B 5L8JB 4XMXA 5A2KH 4GOSA 1FNSL 3FRPG 1GR7A 1E7UA 1E28A 1KGCD 2J57A 4UDTA 1YG9A 2HT3C 1JGDB 3OHXB 4GRWF 5DA0B 5FA3B 1MNUL 3NFSL 4MXWL 2ZWSA 3QHZL 5E9NA 5IVZA 5T3XH 3UZVB 4NHCL 3ZPDA 1DQJA 2NYKA 5ITFB 4KV5F 4RMBA 4YPGB 1PLGL 3VGAC 4C4UA 1N3NB 1VHPA 5EUOA 4JK0D 5KEZA 4NZTL 1E4XL 4XC3L 4CADA 3N42B 4BCZA 3JWOC 3CFBA 2AQ1A 3ECUA 1U91A 3TCLB 3O6LH 1XIWA 5DWUL 3RX7A 1DE4A 1HINH 2Q20A 1DQJB 1XGYH 4YDJB 3VDAA 3ZUNC 4F5CA 2VW7A 2FQGA 3GLZA 1MWAH 3P3TA 4M1GL 5C0RL 5J13B 2IAND 1YNLH 2Q3ZA 3ELAT 4LARH 5ACLA 3FO1B 4OF5A 5DD3H 2N01B 5CJQH 5AG8A 1EEQA 3KGRA 4M43L 5AOZA 4JKPH 1WP6A 3P2TA 4UNUA 1MLBB 3BH8A 4UT9A 4NNYA 4H8QA 1JFHA 3V0IA 2ZXGA 2VUKA 1NTDA 2DJMA 3APNA 4JFDA 3TC9A 4MKMA 4NJ9H 2YD5A 3D7PA 1UYWL 4DQOH 1ICTA 2BWQA 4LXFA 2CLVA 4L3FA 1YAIA 1PZ5A 5C9KA 5CHNB 5DZOA 1U3JA 3W9EA 5LKNA 1HYSD 4FI7A 1OAZL 1J0HA 2JB5H 1CDGA 4G1MB 4OI9A 1ZTMA 4OLZL 4YC2B 1IGMH 3HI6H 3T77B 4ODTH 1OAZH 4P23D 2FIKB 4PJHA 1M71B 2O26U 3L5XL 5LGHH 3V8CA 2QVTA 4YEEA 2WIIB 1NCBH 2EICA 4HUXB 5E6RB 3D12B 4HKXB 1E0OB 1ZLSL 3UG3A 3IJ8A 4XOBA 5E95B 4OFKA 4P5KA 1ZGLP 1XO8A 1UWXK 2G9HB 4FYTA 4QAWA 1U4FA 4WSGA 4TQEH 2B9AA 1T21B 3LKSB 3OX8A 4M6NH 4XBPB 3BLPX 1XEUA 1CU4H 2Z91A 4BYHA 4AYEC 4PJGB 5JIPA 2IPTH 3QO1B 4E68A 5IR1B 1MAMH 1PPIA 3X14B 1RUKL 3ULUF 3D05A 1AACA 4PCSA 3T8MA 3RG1C 2X89D 4IHOA 4CN4A 3H53A 3SE8H 1SVCP 4B9IA 3IDXH 4MAZA 1KIPB 3MSPA 1AO7D 4DUWA 3GRWL 2ODIA 3D85D 1O5PA 2LU5A 3FCSA 3G6JA 1KCSL 3RKPA 1GS8A 5KSBF 4E36A 3T0WA 4P4KB 4K94L 2CIKA 4UOW0 4AQEA 4XI5C 3CFKA 3L9BA 4IOSD 4Y1AB 5JW5A 4G82A 3APCA 4E9LA 3RX8A 3QB7C 1T1XB 1L6XA 1A7RL 3GIVA 2WXIA 4N85A 1Q1JH 1UH3A 3KEDA 5A2LH 1K3IA 2F19H 4FDWA 1LDPH 2WOYA 4PG2C 4LHUB 3L08A 2Z7YA 2FL5B 2I32A 1PF3A 3FUEA 3ASOB 3WTWA 2F7RA 2QKIC 1I1FA 4AZ8B 1TR7A 2FSDA 4XO9A 4AMWA 5JQ6L 5JW5B 4R97C 4U3XA 1TPXB 3AU0A 2FSEB 4KK9D 5DFVC 4HIXL 5KZCB 5KYXA 2HFGH 1C7TA 3PIQB 2ITCB 1PZ5B 1K4CB 1QSEB 2A9NH 4ZFZA 4XMPL 4P3DA 1AHWC 1LM8V 4KUZL 3UYRH 4L2LA 4WWKA 4PJCF 5EN2A 3CLFH 2NNAA 3NIGB 3WLWC 5T1KA 3WDJA 4XTRD 1DUZA 5MHSE 2NYYD 2P7TA 4X4XB 4AI7A 4NQCB 5DQ9B 4HUVA 1OW0C 5KG9B 5I1EL 5DK0A 3CSYB 2SEBA 4O51B 1II4E 4P2QA 4JCWA 2K0RA 5JQHC 3B7RL 3P2BA 1J5OL 3TU6A 4PRBA 5HI4C 3IJ9A 4QXUH 3U0PB 4WI0B 1U58A 1G4RA 3OKNA 2ZPKL 1ZXKA 2H2SD 1SJEB 3CVIL 1M9SA 3P9WB 2PMZA 2YOAA 4HIHA 3TNNB 5ID0B 3MLYH 4J7RA 2VN7A 8FABA 3T0VA 5D4IA 4S2SA 4QEGA 4WLCA 1M6UA 4YFLI 1HL8A 2JJSA 5GPRA 3VACA 1AQKL 4AW7A 4HMEA 3VTAA 4L8CA 1CFMA 4YHPA 1RZKC 4EBQL 3O4LB 5B21A 3VRIB 3W3BA 3U30B 2Z4TA 1Y1DA 2FUQA 5AB1A 1MFCH 3KH4A 3LNFA 5BRQA 2HJFA 3MN8A 2HCZX 3GHEL 3HI1A 3AFLA 4ODUA 1HSBA 3US1A 2QSTA 2O93L 5FGBC 4H88H 1RZQA 1B2YA 2Q8BL 3MLVL 3RTLA 1X5YA 1S7UA 1YUHA 3SKNA 3P73B 4LPXA 2YJQA 5F6IB 3ZN6A 2BIPA 1P4LB 1CD9B 3GI8H 3WKMH 1SF5A 2EDOA 4R26L 4U6VH 3PL6D 4X6BB 3MODH 5D5MF 3Q6FA 4U1NA 1M1XB 5DC2A 1LL1A 2OQJB 3BRFA 4HLJA 1ZHLA 1L3NA 5GS1A 5FO8A 2O5YH 5I2IA 4WIQA 4XVTL 3U0TA 4BH8B 4IDJL 2H1PL 5CLXA 3S3CB 1I8LA 1ROCA 3PL6C 1SHWA 1FZMB 3G5WA 4IKLA 4JHBA 1TKWB 4HKZB 4ANVA 1F2XK 4AEIH 2HVJB 4MSWB 3QIBD 3BKMH 2JXMB 3KNBB 2EH7H 2K6WA 1DVFA 4TVSa 5C9JA 5LN4A 3R18A 2D9QB 2DV6A 3MAWA 1U91B 3Q8BA 3RL2A 4JE4B 2DMKA 1O75A 2VLKE 2ZXDA 1Z32X 4X7CC 1QTYT 3M8OL 1NDGA 5B8CB 3PUCA 4IIZA 1OSPL 2VE6B 1A6WH 1U3NA 2R69A 4PJXE 3TOPA 4MA7L 5I1AB 1GGYA 5JOPE 4UM9D 3LKSA 3OX8B 5B22A 3VG9B 4QHLA 2DQUH 3E1F1 4Z8FL 4UNTA 5D4HA 1VA9A 3L8QA 3MJGX 2I60H 2J8OA 3RZCB 5D6CB 1E9OB 3BE1L 1P4IL 1IIKA 3W0WA 1LE5B 5GZOD 1K9TA 3G5VA 4MXQC 3SO3B 2OMZA 2W0LA 3IAPA 3NYKA 2GJRA 3SE8L 5IQNA 5AOJA 1K5WA 3VFUB 5EEXA 3UTTA 3WIHL 1GGTA 2WCPA 3HAEH 2HN7B 2NY6C 1FC2D 4P23A 3BGMB 4RMVA 4ZZFA 4HT1H 4D0DA 4ZUTB 4HUWB 3ULVH 3KWWB 3M7OA 1S7SA 2V3EA 1L9MA 5E4EC 3PWUB 3KS0J 5HYJE 4IBVA 1QACA 5AB0A 1XD0A 2EDEA 2IWGA 4Y5YA 5D7LD 2RR3A 3UO8B 1MAJA 2UXVA 4X6BA 1MXGA 4HK0B 3D07A 4QY8A 1M1SA 3DVNA 1JGLH 3UTZB 4KRPC 2CJSA 4RX4D 3QZNA 1GZQB 4X8CA 5GGVL 3ZYZA 5A2FA 5EC2A 2BSRA 4GJTB 3OKYA 1AGFA 4XVJL 3BAYA 3MNWA 1E7VA 4QXWA 5HGGS 5DEFA 1YMHA 2QHRH 3N6YA 4YSEA 5D1XD 1JHLH 3QEUA 4PB0H 5ANME 1ASOA 2CBTA 1FNFA 4WAFA 1UJ3B 2XZQL 5D7LA 5B3NA 3EOTL 4MYWB 5F96L 2XA8H 5E00B 2CO4A 2CDFB 4XOCA 1H3UA 4GLRI 3UJTL 4YOKA 2Z7UA 5FHBH 1J1OL 3S2CA 1BQUA 1ESOA 5IW6A 2R0ZL 1YEGL 1SDDB 1U58B 3B9KA 4XX1E 3TBYA 4DKTA 2X0VA 3L9RB 3UAJC 1USZA 5GGVY 5MEQA 1D7FA 2ITEA 1WF5A 1BBJB 1NUDA 5LXGL 1TENA 4FN0A 1EJ8A 3OJ2C 4BWUA 4QD2E 5IQLA 1Q9LA 1P2CA 2BP5M 4KI5C 1OHZA 3RYMA 2YPKB 1QNZL 1RIVL 1AOHA 3HFML 2YBRB 3AVEA 5KYWB 1ERNA 2YA0A 2BVYA 3VWKA 5CJXA 1HKLL 1R5IA 3OTTA 4QRUB 3EBHA 1L0PA 3TBVB 5DDHA 5DO2D 2BNRD 1K4CA 3MGAA 4ZFZB 4OQTH 3I9PA 3V6FB 3WNMA 3KPTA 1UFGA 1C16A 2L7UA 4QIRA 4AIZB 3G5XB 5LCVA 3DBXB 5AAWA 2P24B 3NJHA 2AJZA 2J55A 5ESAB 4MNGB 1S7QB 4QI3A 4ZNEE 1DHKA 1BZ7A 4OIIL 1R0AH 3MV11 2CLRA 1AOZA 4MX7A 5HI4D 3MHZA 4W9LC 5HI5D 1K3ZA 3HMXH 2AJYH 1U8HA 3HAEB 3SDYL 1UT9A 3BMWA 1YSOA 1FYTE 4ZPTB 3SGKA 4XTRC 2JELH 4AQ8C 4U1JA 4ELMB 4M48H 4AH2A 3AROA 2I9TB 3P4LA 1QW8A 3MYZA 1EHLL 3B56A 4ZUWB 4BK4A 1WS8A 1J5HA 1NCOA 2Z34A 4ODSL 4CSZA 2VNCA 1HOCA 1JOIA 2ATPB 3VNYA 3ZKND 2ZUSA 5TH2A 4WCYL 2KH2B 3KPQA 3IDIB 4N1EA 4GXFA 1M7XA 4PGBB 4K71B 4QKXB 2FJGB 4BKLA 2F53E 2NY3B 2WAHA 2OI9C 1TMQA 3HS0B 3H9YA 5DK2A 5CM1A 1T7WA 2TSAA 2HPTA 4MMYB 5KVEL 3QWRA 4ZJ9A 5GS2H 4W9KC 5ISZB 2ZT9C 5AWNH 3V8OA 5GS1B 5ETUA 3TBTA 3FONB 2E27H 5DJXA 3V4LA 1UFUA 3Q8FA 4OIBA 2N59A 2QJDA 2A4CA 4PGZA 4HJIA 3DRTB 1MF2H 1NGYB 3DJ9A 3MOAH 1T1WB 1U95B 3BN9D 1IU1A 4FLQA 3QHZH 4HMDA 3ARBD 1WGOA 1QRND 1TETL 4XMKL 4PJHB 1OQXA 3DVIA 4DP5X 2P49B 1BJ1H 3QNXB 4HUNB 4F8LA 4HZLA 2E9WA 4UT6H 3VFMB 5FYLL 1DQLL 1BD2A 4BCYA 1IIIA 3W11C 1DSFH 1OSZB 3CE1A 3CPLA 1VGEH 1TQWA 4FXLA 4G70B 1NAMA 3RVXC 2H26B 2R56L 1NAML 4AQ1C 3ILQD 4JM2D 4GP4B 4ZPVB 5GZND 1SXNA 3FL7A 1KYFA 3GO1H 4XNUL 4JPVL 5L7XH 2FYVA 3BISA 1RUPH 2VW4A 3AGWA 1KLUA 1K6QH 5KSAB 3BD4A 2I9LB 1BLNA 4X7SH 5IVZB 3FQRA 3RGVD 4OFYA 2AV7B 4MZ2A 1UTDA 4R96B 4OLVH 2C7UA 2ZCZA 3GMOB 2FJHA 2BMKA 5J1TC 1QYGH 4HK3J 1B6UA 3N1PC 4P4KC 4AXWA 3CSBA 1NGYA 3CHRA 1LLAA 4FFYA 1FNEA 3BO8B 1DE4B 2JCCA 3L9EA 4XPGL 1HYSC 5ETUB 2EDDA 3UGEA 1OTUD 1E9QA 4OR1A 3LN9A 5AALA 1IGJA 2WQUA 3P02A 4G8IA 4WI5A 3TJHD 1SY6H 3NDZE 1JPSH 4BE5A 3MR9A 3MA9H 5KVDL 1P7KA 3ZMNA 3GSNH 2DWSA 3LTVA 1IKNC 3MI6A 4CU6A 4S1SH 1OAUH 2XPZA 4GKNB 4WW2A 3WKNA 4F8QA 3OF6D 1IC7L 1WGVA 2FL5A 3S34L 4FHBD 2HLFD 4HGWA 4L1BA 4V1DA 1JFQL 3IFNL 3BDBA 1LO0L 2KKQA 1GAFL 2I07A 5BVPH 3OQ3B 4EAEA 4EDWH 1WDAA 3NSCA 5EBMB 1M42A 1NGPH 3LQZB 4J39A 1HESA 4MAUH 4OLYH 4BWWA 1JHTB 1U3HA 2RJMA 2V17L 1UM6H 3CSPA 4DN3H 3AG3B 2Y3AA 3VWKD 2Q6WB 2W5PA 4RMRA 1V55B 4DJMA 2ZX7A 2NXZC 2O5ZL 3P30L 4U0RB 4DO4A 4TOYH 1QTPA 1CLZL 1U0QA 3KLQA 3MFGB 1DO6A 3CHPA 2WNKA 3EYQC 2RA1A 4NUGL 5AAMA 1NUNB 2GB2A 1NH6A 1N9PA 4F5CE 4GKSB 1L4IA 2AK1H 3TEUA 4OD2A 1J0YA 4MDIA 1S8DA 2CUIA 3ZMRA 4QHPA 3MLXH 4LLAA 5F72S 3I02A 4OZGA 3H0TA 4K94C 5KUKA 3C09C 1FO0L 3GHPA 4YHMH 3NVQA 3VGBA 1UB5B 1RI8A 2O1AA 3IGAB 2XKNB 3JV0A 3MCG1 4HX1A 4KJWD 1HDMA 3BZFA 4Q0XH 5ESQB 3GKWH 5IOKA 5LCVL 1I85A 1AZBA 1IQDA 3CX5J 5DFAA 1A7RH 3GTTA 2JKRM 2XUWA 4ZW6A 4N2LA 3ABLB 2O5XH 3RILA 5C92A 3S3DB 2IADB 2QADC 1FVCA 1MLCB 1SOSA 1WD9A 2OTWB 4LQFL 2CQVA 1CD0A 4LHQB 2VM3A 4I2XE 5JPNB 3WKPA 1UG9A 4LASH 2GC7C 1KY6A 4K7PH 2GITA 1PNDA 2BCKB 2MFNA 3FDWA 5GGVH 3U1SL 4N90D 4KX9A 4FQXC 3WIAA 4C55A 1KPRB 2ZOKB 4M4PA 3HG1B 1QKZH 5AD0B 4L48A 4P9HC 1ZLVH 3LKNA 4XCCL 2BCMA 5DC9B 5JPMA 2Q7YA 1JHKL 1QRNB 5SWZB 3IDGB 1OM3L 5KANG 5L6YH 2YFNA 3FQ2A 3KCPA 3LH8A 4XCCH 2X3CA 1OP5H 1CLOL 4PWIA 3ZHFA 5T1MA 5IUSA 2J5WA 3B2PA 2F61A 4X7TB 2BSBA 5GGTH 2VC2L 4NWTH 1PDKA 2E9IA 1R3HB 4JM2A 1VLXA 5I9QB 1A3QA 2BLFA 1TTAA 4BZYA 4X50A 4N2DA 4XNXH 3UTQB 4FP8L 3DTXB 2ZCLL 2DW5A 4HD9A 4Q6KA 1OGPA 5INCA 3S3PA 1CDCA 2DQ6A 4PJ8C 1P6AB 5IW1B 1J1XL 2R0KH 3U7AA 4DAGH 3HNTL 4IGBD 5HGAA 3C6LC 2ICWA 3TCLA 2X1XR 4RFEA 2WC7A 1ITCA 4B3EA 4FHKA 1WG3A 1XAUA 4AEFA 3B2VH 3BCFA 4ELKB 5I8KH 4YHOL 4FXGA 3SDCA 3CTTA 1AFVL 2COVD 1CMOA 4OJDH 3WE6A 3UTTE 5I1HH 3NFNA 1CE6B 3L2MA 3MKKA 3MRHB 4EXKA 2EDLA 1JZ4A 3O45A 3REVA 1U92A 1XH3B 1YY9C 3TV3H 5HGDB 5E6IB 4ZAKB 2V2TA 2LTQB 3A0OA 3UDWA 5IVNA 5AW4B 1NBYB 2BVPA 2P8MB 2IAAC 3LNDA 1DVFD 5G55A 3DO7A 1FYHB 4EMZA 2K1MA 1NCIA 1R6VA 4XPHL 3SKMB 4CMHC 4WF7A 5D2LF 1RXLA 3DX8A 1GYWA 3C5XA 5AEAA 3FUIA 5GRJH 3HMXL 3U30C 1JK9A 3WLWD 1U8IA 3D48R 1Z9NA 2BSED 4LAQH 2FGWH 4R2GB 4MNHA 2HSIA 2VWEE 4JG9A 3UC2A 2R69L 2EDBA 5LUMA 1NBYA 1QBAA 1A4KA 3QNFA 4B60A 4KUCF 1TNNA 2HB0A 3GHBH 1M3JA 4WO4B 5C09A 1BGXL 4C8XA 1E65A 4ZTOL 3DV4A 3B8SA 1T7VA 2VMEA 3PYCA 3LEXA 1CPUA 1KEGH 1ZIAA 5LQBL 4RMSA 5IGXL 1QFPA 4XAWH 2BSSB 1Z9OA 1A8JH 2BP8A 3AREB 3DMMD 5BO1L 1J8SA 1KBPA 2AJUL 3U2IA 5LB1A 2YQ3A 1WT5C 5IWLA 3JWNE 4XX1G 3PRZA 3SPVB 4S1QL 3GJEA 3L7FA 5EUOF 1U2CA 3B83A 2GT9A 4JPWL 4L9LA 2EDNA 4TNVK 4JEGB 1D5ZA 1MCDA 5FGRA 1BM7A 4IS6A 2F5BL 2J20A 5E99H 3PHOA 3VSVA 3HS0C 4OZGE 1FAIL 4NENB 4HW6A 2A6JA 5I1JL 3L7EB 3HI6L 3W2DH 1N59A 1TZAA 1YJDC 5EF2A 5DHYB 3QG7H 1KG0B 3ULUD 3DIDA 4FJYA 3TA3A 43CAA 2X4SA 4YGVB 3L4UA 4QO1A 3HBZA 2E7DA 3SDAD 3L13A 2G2RB 1K4DB 5EU7C 3U46A 3V79C 4PY8I 3G3LA 1CVSC 2DQTH 3CFTA 3AWEA 5D1XA 3O2WL 1E5BA 2DB8A 4JBSA 4G8GA 3KXFE 4Q89A 1KFAL 2EDWA 3DXAA 2IOOA 1SJHB 2DKSA 2R0WL 5I18H 3BWAA 5I19L 4U1GB 4ZX3A 3NCYS 2WCSA 4KI1A 4TNWK 3VU1A 4KNSA 4YXKL 4N5EC 5B7MA 3SGJC 3T65A 3R1GL 5J3HC 3U0WH 3FUFA 4OLXL 3UPRA 4I9XA 4Y4HA 3VXRB 4X9YA 4JFTA 1N7ML 1IM9A 4UZSA 3RY5A 3NQIA 3LIUA 5EIIB 1BQHG 4XPGH 5KG9A 1JZDC 2LABA 5T1KB 4HEMA 4PB9H 1OPGH 1Z5LB 2YZ8A 2ZXQA 3L7EA 4U1LA 43C9A 1W91A 2JKXA 5E1GA 1F3DH 1BJ8A 1PZ2A 2V7HA 5D7IB 1WAAF 2QR0A 4WWID 4GKZB 5CEYA 2DMCA 1UOVA 2VDML 3EYUL 4L4JA 5D9SA 1DFXA 2RHEA 2X6MA 2WVSA 1WA1X 1S78C 2DQIH 4WJ5A 3V0DA 3WHXA 5PCYA 1G4MA 3MXWH 4PP1D 4C4BA 4JGUA 5EH1A 2DQIL 2N3JA 4UT9H 5LGKA 4TXVB 1SUHA 3JVGA 2ZCLH 3NJKA 2V17H 3BWUC 4HIXH 4AE0A 1A21A 2BP0A 3HMXA 5H8DA 3NZSA 2OXGA 1OP5K 5JHLL 2AAVA 4M5YH 4G7YH 4OLEA 2FYYB 4HWZB 32C2A 4J3XA 3IWVA 1RK0A 1BZQK 2ZONA 1FBIH 1ONQB 4WZ9A 1L0YA 4Y5XA 3L3IA 3WEOA 4W4NA 2JI2A 3OAZK 2MEJB 1ZGLA 4XP6H 4DP1X 2ZKHL 4AT6A 4F57L 1T5XA 2OJEB 1NCDH 3MR9B 4UV4L 4IU3A 4ODHL 3TFKC 4JZJC 1F2QA 2NDGA 3MCKB 4NUMA 2NNRA 1H5BB 3B7TA 4AVIA 3V5KA 4G42A 4IKKA 3FFCD 1G7PA 3FFDB 4K8RD 3CFEA 4FL4C 3WO4B 4MXVE 5DFTA 1UA6L 1TVDA 2VN5A 2BDNH 4F80A 1EO8H 3ES6B 3F6IA 2MQCA 1MELA 3CZKA 4XE5B 3HR6A 5IMMB 1A66A 2Y5TB 2BNQD 4YSSA 3V0WL 4I8DA 4XP1H 1S7TA 4YSPA 1QTSA 3LPPA 2P5EE 4A7GF 1KLUB 1ZS2A 1NGWB 1J5DA 2XWTB 3F84A 4Z7UB 4KZ0A 5CMAB 4F9LC 5I15H 3DUSA 3LIZH 3K4AA 4P2RB 5AVZB 2VDOB 3CDYA 1RLWA 4B27A 5LGJA 2J88L 2ILLA 3E8UH 1A7BA 5L6YL 3IJSA 1INDH 1YEDA 3OVUB 4Q6IC 1WYJA 1I7UB 5F89A 2CHXA 3WG7B 5L2KE 4GEJA 3CU1A 1U8LB 4PVBA 1A9EA 1ADQL 3L4XA 3Q13A 4TYUA 3SJVD 2VDNL 2H2PC 1XL4A 2WKGA 4UAOC 2BNQA 3P9MA 2EE0A 1Z3RA 3NPSC 1XQ4A 4XPAL 4JFDB 3TYGH 4PUBH 2FBRA 4R5VA 2Z65C 4Q9RH 3MOQA 3S88L 5EO0A 4NPYB 1UVQB 3ARFA 3TF7C 3ECBB 3RVTD 2DLFH 2XQYK 3EOBB 5GS0C 2FT6A 3INUL 1ZANH 3U4BH 5IIEB 1NIAA 2EDXA 2NXZB 1PIFA 2R4RH 1QSVA 2ADIA 3BAIA 5CGTA 3LKRA 1IC4H 4GQRA 4RH4A 2IAMA 3E3QC 1ECZA 2YD1A 3D3VA 1FO0B 4I1NB 3RVUD 3NIFB 1F56A 3WJMB 1ZHBB 4KKBD 1NDMA 4UTAL 4P59L 2Z92A 3DX9A 2N4IA 3VD9A 1PKQE 1LWJA 1EK3A 4KMQA 4FQCL 4LOEA 2IH8A 3U9UB 2MPVA 2EINB 4B7LA 1M3IA 1ZS8B 2XBTA 4GAGH 2NZIA 1U6AL 3OAUL 4FQCH 3UBFA 2UVEA 4JPSA 2AV1A 4TMPA 4YL4A 5C07D 5DJ0A 3QWRD 3T6XA 1OHQA 2D03H 2X6AA 4Y5VA 2F68X 1M6OA 4P2OB 2VLKA 2PTTA 1KLGB 2PO6D 3MBWB 3QFJA 4HXAL 5B1KA 3UO1H 5C0FB 3ZKMD 2DBLL 2VUOA 4O4YH 4PSRA 2H1PH 3I9GL 4N2OA 4Z23A 4J23A 1HCVA 2AJ3B 3HVDA 2HUHA 1BQKA 1YPZA 1HN1A 1YY9D 2F8VA 4QXGL 4YHKH 1G9EA 4KJYA 3L3DA 3TONA 4UILL 1KXHA 5EU6B 2BZ7A 2PCYA 4NC0B 5DJDB 4N2BA 2VKWA 1AXSA 4FJ6A 2CGRL 4X7FC 3U7WH 2YARA 2XC8A 4K4KA 3RBGA 4PP2A 3OAYH 4UILH 4PY8J 1JNLL 1B2WL 1A7OL 3EGSA 3QXDB 5BVPL 1A1OB 2NXYC 4JFZL 4BZ2A 2ITFA 3UBXG 3P4OB 4MLSA 2H5UA 4U7KA 3I50L 2PYFA 4X6DE 3RVTC 3WHE0 3O9WD 2Z31D 4IGBC 3ZKQD 1QP1A 4AQEB 3KZ8A 5HDLA 4NXKA 3QQDA 4ESKA 4MASA 4PRID 4HDIB 4Y19D 4XMTA 1DFBL 2C4FU 3GSRA 1BP3B 4JRWA 4WKZA 5KVGH 4W4OA 4Z0XA 4ZO7A 3MV8D 3X1FA 2AK1L 2G5BA 1S7XB 3QDGB 5D9SB 3QT2A 1W72A 4PJAF 3KPLA 4HCRA 3CDGA 2EUWA 3V55A 1C8QA 1J8HB 5C0NC 4YUEL 2EEDA 3F83A 3FTVA 3CMOH 5AL0A 4DCQA 3ZHNA 3DX6A 3VXTA 4OZHE 3VRJB 4NQUA 3GJFH 2GT9B 3P3UA 2BIOA 4XOAA 3IDJB 4P4RA 3S37L 5J57B 3I3EA 2AV7A 1FGNH 5DD0H 2QSVA 3C6SA 3FB8B 2Y6SC 5I1DA 1LK2A 4KROC 1E9PB 2ID5A 2DQJH 1PTZA 3B3BA 2JCWA 1AGCA 4JJ5B 2ZSWB 4NRXA 3QS3A 1INQB 4N2MA 3B4NA 1P1ZA 4V1DE 1UGKA 3QZBA 1OT2A 3I85A 3N44F 4P9ML 1C5DA 2H8PB 1WAAA 1E5UI 2BY1A 2ZOLB 4H8HA 2VITB 1ET7A 4OIIH 4HZLB 4PEEA 4XT1C 2K6YA 2A6DA 2O6DA 4N2EA 3P0YH 4R6UA 1U8IB 3DSNA 3QCTL 3T3PE 1J10A 4MQXD 2X3BA 1F6LL 4M1CD 1PEWA 3MRRB 4TULH 1A3LL 3BPOC 1PJ9A 3MLUL 4F58L 1BVNT 1KPVA 3QCTH 3BGFB 3OKOB 4NQXB 1CDUA 3QSKB 1OP9A 4RZCA 4JG0L 3IB4A 3OR7B 2WQXA 2BOLA 2YRLA 4JHZA 2VGLM 1UD6A 2WYHA 3VYNA 4J8RA 1J1XH 2R0KL 5T1DH 4R4FL 3EHBC 1QW9A 2RH0A 5E9DB 5LXVA 4OCXL 5F7LB 5IMOB 2YA2A 3D0AA 1KYAA 4FG2A 2CKBA 4ZOBA 3L3OC 4G43A 2Q2EB 1OP3K 1GGIH 1Q94A 5EIIA 3G5ZA 3G6AA 4TVPD 3T0EE 4D94A 2EO9A 1PYWB 4MAYC 5HGAB 3HFFA 1OCOB 5KVFE 3HKZA 3KPRE 4HEPA 1F58L 4P5TA 3T0EA 1P7QA 4LLVA 1S9KC 1BMZA 1R24B 5GGSA 5CZXC 1U8QA 2WLLB 1ZK9A 2PR4L 4Y4KC 1MJ7H 1U3YA 3LDBC 1RJZB 2AABH 4H1LG 3C6LA 4Z7WB 1EJFA 4K3GA 4B5EA 3NJLA 1Q1PA 2VMDA 1WZ1H 3IJYA 3EJJX 3I84A 4N0YH 4RWYH 2DM4A 5D93B 5DJ8B 3IDMB 5JW3L 4B5ZA 1AH1A 2DYPB 4N86A 3X17A 4QCIA 1JDDA 4BH7A 2GTZB 3FT4A 4O5LL 4ICXA 4KITB 3DSNB 1S7QA 5L9DH 4NKMA 5MEPB 2B1HL 1X6NA 2Q7YB 1JGEB 5C0IB 2FX7L 2EIMB 3M07A 4PGCB 3RWGB 5ACZA 4X6CE 2OSLA 2YK1L 4AIZA 1SYVA 2Z31B 3I6KB 1NGZB 4ZAKA 4B97A 1LDSA 2V2TB 3H4FA 5FCUL 2F2HA 4PLJC 2JQAA 1J87A 3SYPA 4PRIB 5E8OA 5I76A 4Y19B 2VDMB 4K23L 4N24A 3SDAC 1T2QL 1N5AB 3B43A 4A2FA 4IRZA 4NFCA 3UYRL 4QNPF 5I17A 5IESL 1Z6JT 3S4SA 1JGVL 3P3RA 3I75A 4LDCA 3MUY1 3GS7A 2CE6A 3NACH 4B9KC 4N4YB 3OKDA 1NCHA 4B3VA 5DJZA 1JGVH 2CRYA 5M7QA 4R0LC 4FX5A 2CMRH 2B39A 5C0AE 5TE6L 3ZZQA 1CFSA 5FB8B 3WJLA 3DGCR 1HS6A 1YMMA 2V5YA 3CFNA 3PNWB 5KVDE 1UXLA 1U8JB 3TN0B 4LCWB 1J05A 5SX4I 4OUOA 5HXMA 2X4RA 4PJDF 1G7JA 5FDYA 3MRLB 3O6FC 1ZLUK 1TJGL 35C8L 5CIPA 2BRQA 4QOKE 4M1DH 3WIFB 2B5IB 4G3YL 4LZKA 4EN3C 3ZE0E 1W72B 2WUCL 4M1DL 5CR8A 1QABA 2XN9E 3DJRA 4WSJA 5HYFA 3O3BA 2MKLC 4FQPA 4NRYB 5T1JA 1PCSA 2G2PA 3IFNH 4XCNA 3BWSA 5J11C 1HU8A 4IBWA 4UTAA 1T83A 4DUXA 3PF2A 8CGTA 1T0PB 1ZE3C 4OD1H 3QEGH 1BYOA 3FK3A 3D9AH 3DX4A 4QHUB 2F7PA 3QI9B 4HJEA 3V6OC 5A2IH 5DRWB 3ZKNC 4EDXA 2DZEA 4J3UA 3D9AL 4QHNB 4BXVA 5IJDC 2B1AL 4HK0A 2DF3A 1REIA 5JOFA 4QJ5B 2X9XA 2WUBH 4WUUB 3LQAH 3LRGA 1J18A 5E70A 1I1RA 2OMTB 1B4TA 1Q0YH 1SM3H 3G7TA 4POUB 1EAQA 1PAMA 4DZ8A 3VVWA 3M17A 2XLLA 1JYVA 4MJIE 2GPZA 1HWWA 2IOIA 1H5BC 3N42F 3BW9B 3KVPA 4O2FB 4E0RB 2WXKA 5DJZB 1PLGH 4CN1A 3NT0A 5C2UB 3K4ZA 3IJHA 4PJ5D 1MQ8A 1NGXA 1MEXL 3LRLA 4ENZA 3P54A 4F27A 2WXJA 1J8HE 1T89C 4XXDB 4L37B 5CFHA 5I71C 2QSQA 1FFNA 3GIZL 1I8IA 3QDHA 4Z18A 4UQEA 5KSBE 1QVOA 2Q3AA 4HWBA 5DJ2A 3MJ9H 3CX2A 3DROA 4CBPA 4H7VA 3DJZA 1R3HA 2BMKB 2DQEL 2DMGA 1I8KB 1XF1A 3X14A 1P6FA 1S7VA 3LV3A 3MOBH 3N91A 4Q56A 4OCSL 4YDMA 1D5ZB 3V95A 1ED3B 3GPSA 1AD0B 4XO4A 2DIEA 5T1MB 2DWTA 3D2UB 1DQML 4V2BA 5HP5A 4IRSB 4D9RD 2F54B 3ARZA 3LKOB 2NY4B 3QIUD 1JL8A 4HLZH 2D4FA 2EDKA 1FSKC 3IU4H 1PD0A 4PRAB 3O41A 5IJCC 3MLTA 1AMYA 4ABUA 3FF7A 2RD0A 3H8NA 4P5TD 5E2VH 3Q05A 1TQBB 3KW8A 1EBPA 4H2CA 2HKFL 4URKA 1PNCA 3QAZC 5FYJH 2XJKA 5MEOB 1KDIA 5IVXA 2GSGA 1PU0A 1Q9WA 1TYRA 1MHPL 1JTPA 1WPCA 1FG2A 1RK0B 2OR7A 3QPQC 2WHVA 2AI0L 1KB5A 5IW3A 4H8WC 1UOKA 5CXPA 2E5EA 3MRBB 2BP0B 2OW6A 1OF0A 2EC9U 3CNKA 5JHBA 3KDMA 3VFVA 5I0XA 5T1LD 4CRPA 1HH6B 1HXMB 4U1NB 1F18A 4L1LA 1Q9OA 1GVIA 3Q01A 3QXTA 5D7JB 4EI5B 1SQMA 4ICWA 3OV6A 4X0NA 2QPEB 4PV1C 1P69B 1OT4A 3FNKA 3PAYA 3CHQA 4NN5C 4GW5B 1RHHB 3WHXB 3CX5K 4XH2B 1NFAA 2QADD 2VL5B 1BYNA 4E42A 1JD7A 4NAQA 4JZJA 1SBSL 4LVNC 1GL4B 3L3KA 5E4OA 4N1HB 1GGBH 3O9WA 4M6AA 2ZNWA 2V7HB 5D7IA 4D9QD 5IB1B 3PGFH 5TTRA 3H9ZA 4AEHH 4WCYH 1EHKB 1S7XA 3LKPA 1A7PL 1G6VK 4ONHB 2R83A 2QHRL 5DJYB 2NT1A 3GZQA 4X42A 1R0AL 3B2UC 1QKZL 4QKTA 1FN4B 3MRMB 5DHEA 1N5YL 4PD4K 1S46A 4S2SB 4R84A 2IFGA 5JHLA 2ZKWA 2NY6D 1KENL 5F96H 1NMCC 3K4DA 3QCVH 1D5MB 2XV3A 4TQ8A 3HOGA 4HIJA 4G7SB 4LSPL 3VDCA 4ZYKB 3QEQA 1YYML 1AGCB 5DSCB 5M94B 3OKKA 3LEVL 5EG6C 3QXDA 1WCBA 4RESB 3HG0A 5E23A 1PW3A 4F93B 4G8GB 5L2JA 3PJSA 3FB7A 2ADFH 3D18A 1JVOA 3GLAA 3HE7B 4WFED 4K3DH 1ZLVK 1IQDB 4ZOCA 3BEWA 3OAYK 4AT6B 5SWQA 1CGSH 1XGQB 3QJFA 5I6LA 1IKOP 1DVUA 2EDTA 4JGJA 2X4SB 4KXCA 3ELQA 1QPKA 4MZ3A 3UP6A 4BFRA 3O8XB 3LZQA 1D6EB 1QSEA 5E8EA 2JCCB 3D09A 4JQVC 4YDLB 4NO2B 2NSXA 4P57A 3W0WD 4LLQB 3IXAA 5AVTB 4MCNA 3K80A 5C09E 5I0DA 4GAJL 2CIIB 2LHAA 4LDLB 3UX9B 2JJVA 4YSRA 2R9HC 2NTFB 4PBVC 4TPRL 4TQHA 2YS4A 3DVGB 1I82A 5IVXF 1NEZG 4JFYB 3OZKA 2X4NB 3DTXA 1NSNL 1U93A 2WOBA 5IVOA 2XZZA 4U1IB 1EEZB 1RJLA 4LSRL 5FYLE 2BSCA 2K3TA 4H1LA 1A1MB 2OS7A 1FNHA 4FNTA 2K9UA 4YWGL 4HWEH 1EHNA 4KDVA 3ZQXA 4LCVA 3FH7A 3D50A 4E41A 2AEPL 2I25N 3WJMA 3X1GA 1MFBL 3VFRA 4JRLA 2E56A 1QBML 4OJCA 1FSKB 1ZVSA 4HSAC 1VFBB 2UZIH 3ZE0B 2NY4D 3QIUB 1IFHL 1I1AD 3H3PL 3EYVB 3HI5L 1A4BA 5C09D 5CEZE 2XN9B 4LBAA 1NIBA 5IG7A 4YIQB 4KK6C 4F3FB 2KUTA 3LAFA 5EZJB 4KRMB 3TT1H 5GZNC 2TSBA 4HWNA 3RVXD 1L9SA 4NN6C 2OFQA 1NDTA 5B3JE 3OKEB 5KTEL 2V9QA 2LGNA 3JWDH 4LLWB 4QWWC 3P4NA 1BZOA 4JFSA 4PP1C 4OLWL 4P2OC 4YX2L 1JK9B 2K70A 3P40A 3VX1A 1MDTA 3VQ1C 3FU9A 2FYYA 4MAYB 1DN2A 1XT5A 2J6EL 2XQBH 3S35L 4OLWH 1NOLA 2VCOA 1VEOA 2VZOA 4KK5C 4V33A 3SDDC 3AY4C 1G7LA 1GPOH 3KCWA 2PP8A 3KWWA 4K2UL 3BN9C 5KJ7E 3S35X 2Y23A 4JB9H 5T1LB 4X6CB 3UEQA 1B9KA 1FNSH 5CSGA 3ZDZF 4YSQA 4S1SL 4ORZC 5TJWK 5I17B 1B3IA 3TO4A 1T0NB 1UATA 1IBYA 4KVPA 4NHCH 4BEIA 4PJHF 4W9ZA 4FQQB 2BERA 5BJTB 2EUZA 5DZPA 1DSFL 3W2DL 2EDQA 3HCVA 4GMSL 4ZQKB 5DMJB 1DQKA 1S3KL 2OMUA 1GAFH 2Y6TE 3QUHA 1LO5B 4JRYD 4LSSL 4U31A 4DTGL 3ESMA 1JMXA 5EU4A 1F5WA 1DN0A 3TWCL 3UH8A 5BVJB 4L29A 4LSVH 2GIMA 3QQ4B 2NNCA 3SOTA 5KS9E 1BMWA 2CU9A 4NNYB 1JWMB 5DEGB 4AM0B 2F53D 4MA7H 3A47A 2WLMA 2VZUA 5TK2A 4HJGA 4JFPA 2WLYA 1WK0A 2HTLD 2R0WH 4CC4A 2BJML 5I19H 1NBQA 1EO5A 4ONFH 1S7WA 3UBGA 1CYGA 2R29L 1OE3A 5BZWA 3QQ3B 1E2WA 3PWPA 5IKCB 3E80A 3CLEL 3TBTB 4RBPH 2ZNXA 5FO7B 3NFNB 4FA6A 3B1UA 5I5IA 5JPMB 1I7ZB 4LNRB 3SE3A 3IJSB 4EF3A 3EYOB 1CXEA 3MZGB 5DFWH 1FL3B 3MRGB 3G04A 3O4LE 2DWEB 3VYOA 5J89A 4PYGA 1THCA 1Q9LB 3C6EA 3E6FB 4DERA 2YBGA 3RWCB 1UGNA 4TNEA 4EUPG 5T3ZD 4G5AA 3DV6A 1G0XA 3UZEC 1O7DE 1WZKA 1KGUA 2X6VA 2W94A 3ZO0A 5BQ7A 1MFDL 1XGUB 5IHHA 4G59C 3ARXA 4HJJL 4O58H 4QJ3B 1JWSB 1BQLH 1ET8A 5D2NC 1YN6A 3COOA 3LMJH 3T2LA 3V9EA 3WO4C 2YAMA 4IU2B 4JANA 3QA3A 1GZHC 4LIQH 1FH2A 1INEL 3QQ4A 4DO6A 1Z5LA 4U1LB 1GGIL 4D8PA 3MRRA 4TOYL 4PJ9D 5JHMA 2BNUA 5EZOH 4FTVB 4KVCL 4M5YL 3ZYIA 2L0DA 4RGNB 2JLLA 2B4CH 5I1EH 5ICXA 4C58B 3ARDD 4XXCA 1OSEA 2G0KA 1KSRA 1P1ZB 3O0RL 2V5SA 3AG1B 4ZMAT 1C12A 2WO4A 4FXKC 3BJLA 2VDLH 5DT1H 5E94B 3M7FB 3RWDA 3GRWH 5K9OA 3UZQA 2VR5A 1MRCL 4YGAB 4JQIA 5EOTA 3QUYA 3SDYH 2CRMA 3O4OB 2OXGB 4KKLD 2B77A 5KSVA 3VFSB 3DUUA 5DR5H 1EZVY 2PPFA 1BVKA 4QR7A 5FOBA 2OSXA 2O6EA 3MJ8B 4MMZA 4NM8L 2GUOA 4JDEB 1AQDB 1YEJH 2DS4A 3SKMA 1CLYL 2FECL 3WFHB 4UMSA 1TOXA 2CHDA 4DPAX 3HRZA 2OTUB 1XMWA 3FFCE 2HFTA 1KF9B 1Y1UA 4GH7B 3Q3GA 3EH2A 4GAYB 5D1ZC 5CIPH 1KCVL 1R3JA 5MENB 3QZPA 1RZJC 4FQ1L 1MREL 1CZ8H 3M1OA 3V4UL 4P5MB 4D3CL 1A6AA 3F58H 3IS0X 5CGMA 4I48B 4P2YA 1F00I 4JPKH 4KUZH 5ILTH 3NK4A 1FRGL 5DMIL 2CMRL 3FU0A 2XG4B 2EDRA 3RGHA 3THML 3A6CH 4FMKA 2Q6WA 3QQDB 4YHIA 3GMRA 2H32H 2DLIA 3N50A 4XNYL 1WA2X 2BP8B 4YVNA 3ABZA 2PYFB 1PSKH 1YYLH 1ZPUA 3MJWA 2HT3D 2ZOUA 5IV2A 1KJ2A 5K59E 4JFEE 1F13A 4E9SA 1N5AA 3AG2B 4LCYA 4BFIA 3SPCA 3H3KA 4CUCA 2EKSA 5KJRL 3RGBA 2WUCH 5DVOA 3UOAB 2DQCL 2XWDA 5JIQA 2WBJB 3MBED 4XO3A 1I9IL 4WI7A 3VFOA 3NQKA 1DJZA 4Y4FC 4QRSA 4GG6F 1UA7A 2ZUQC 3DOIA 4OD1L 5C0IA 1U8KA 5D1QC 4ES8A 4LCCB 5FUOH 5LNEA 3FCTB 4JVPA 4F33B 3DX1A 2X89A 4KC3B 5A3IC 4DGIL 3MBEC 5KYWA 2DYPA 1IGIL 4N0CD 2VLRB 3D25A 3D18B 1E9OA 1BXUA 3F5WB 1G6RL 2IANE 3GWJA 4ZO6A 1E42A 4LSUL 4W9FC 2IQ9L 1BBJA 1AQMA 1PZDA 4XNMB 4Z7WA 3U36B 3VFTB 3WXVL 1XH3A 3O45B 2W8CA 3REVB 1DBBL 1MVYA 4WW2B 5L2KD 1CWVA 1G7MB 1MVUA 1OCWL 2AQTA 2XV6B 3UPAA 2CIKB 4PREB 2XTLA 5JHDB 4M7LL 4M5SA 2WZPA 3V6OA 1IJ9A 2ADGA 4FFVC 3RWIA 3GSNL 5HJGA 5KYYA 3CFQA 4Y89A 5I1KH 2YLKA 4LRNH 4RIRB 2V5MA 1XTLA 1G1CA 2CKBB 1AIFB 5E9AA 3LRMA 1DVFB 2EIKB 5FM8A 3VTTA 4G6FB 2Y1VA 4HKJB 4MDJA 3WE1A 3O6LL 3ETSA 3ARYA 1EHXA 3GMMB 4PJ9B 3TH3T 3DK2A 1KTLA 3IGKA 5H35B 1PGRB 1X5ZA 3QEQD 4DO5A 4JM2B 4JN1L 5HHXH 2OJZH 3N5AA 5T33H 3QDJA 3GSNA 2VZVA 3U7WL 1JCKA 5BO1H 5KBKA 1O6SA 2H1LM 5I75B 1B2WH 4LOUC 4JDTH 4MA1C 1UM6L 3FT3A 1QHOA 1WO2A 5C71A 3BP6A 4FCHA 1N67A 4Z7IA 3P3YA 5EN2B 4ZX6A 2M1KA 2R0LL 3NSXA 5F9AC 3CFBB 4W9GC 3CFCL 3P11H 2FWOB 1U8OB 4K2UH 3WTVA 5AKSA 2VMCA 4ISVA 4OLZH 4P3CL 3NN8B 5JIKA 4MKTA 1I9JL 1OF2A 3P11L 5F7NC 2X4OB 3LRSA 4Z78B 3NCYP 3D85B 2WXOA 4PGBA 3GSWB 2J6EA 3DHMA 3IDIA 4U1SA 5FYLD 3IEAA 2NYYC 3TP4A 3VB9A 3WS6A 3ZTDC 3GXIA 1NCDL 2LU4A 2VLLB 3PXJA 5JPNA 2ED6A 3WXWH 1IAIL 2OZ4L 2CK0L 3D0VA 3PNRB 5TDNA 2OYPA 3SYQA 4IIQA 1FVEA 5GS3A 3L3JA 3WOVA 1IGJB 3ARGC 3BZDA 3L6FA 2YD0A 3HBGA 3KPSB 1JNNH 1YY8A 2CZNA 1IGTB 3RDTD 3C08L 4KQ3H 2X1QA 3ZTNL 1Z5HA 4P04A 1D9KB 2NY2B 3KYOA 1JD9A 3V0FA 3MRPB 3OB0K 3U0PA 2Q0ZX 1HH9A 1JSYA 4OTXL 4PJEE 1UT2A 2R29H 1F8TH 2P24A 2WBXA 2B0SH 4O51A 1I8IB 1X3DA 2YXMA 4NOFA 3NIDE 4ODWB 1ETB1 3KM1A 5AKTA 3GBMH 4LLMA 1YC8A 4CVUA 2EO7A 1MCLA 1SRDA 5E6YA 3SO3C 4ZK8A 3C09B 1T21A 5GGRY 2WD0A 4PJXB 1E5ZA 4FEIA 4U1KA 3RBSA 4PWGA 1WS7A 3D0LA 4X0KB 2FR4B 2GY5A 1LDPL 2EEXA 1QOKA 5FW8A 3DMMC 3B2DC 3ZGHA 5K9JL 4IRJD 1RJYB 1BW8A 3J7HA 1TTUA 3VXUD 3EDKA 5IBUG 5CBEA 1Q9KA 4DP4X 3QARA 2HTLC 1FVCB 3NCJL 4EDXB 4EZLA 1HZLA 5B4MD 4GKNA 1GOFA 1XF2B 4ANXA 1J9SA 4PW3A 4YBLC 3L48A 3HPLB 3L3HA 4MZRA 5CN3A 1UASA 3CHSA 1D2OA 4G7YL 4MD4A 1IC5L 1JTOA 3NESA 2A9NL 4HG4K 4PMEA 4B9PA 2QZ5A 5EZIH 7TAAA 2ITCA 3QDME 3DPDA 4P23C 4KNTA 1VSCA 25C8H 2FSEA 4MNGE 5H2BA 2WXQA 4FA8A 2ZKHH 4YHOH 3G9VA 1P2CB 3V0JA 3T2OA 5L2JB 4ZOEA 1N64H 3ALXA 4UQCA 3P3SA 2XYBA 2H9GB 3KG5A 4A2MA 5C8JB 4PR5B 4YMPA 4WV1C 4RAVA 3K8KA 4TV3A 1ZVYA 5KAQG 3TVMA 4KFMA 1CFQA 5AW1B 2VN3A 6TAAA 4XNXL 3F8UB 2FGWL 1A7QH 2G9HA 4WEEA 4ZNCD 2EXSA 2WKLA 1HJCA 4WGWB 5DRZB 3UADA 1PQZA 3KLKA 5DHXB 1BZ8A 5L0QC 4MJ4A 4LEBA 2X9ZA 2ZWNA 2PWGA 5LN8A 4HF5L 4KOBA 1DUZB 1RERA 4PVLA 4NKIL 4Y2DB 1LEGA 2L8AA 2YGPA 4FMVA 4HS6A 1YJDH 4O4YL 4QWWD 2CLRB 4UTBH 3H9SA 5IMKB 4XNUH 3TEWA 4NO0B 4FCAA 1YMHB 5AKVA 4WHTB 3QNZA 4E5XA 4W6YB 3V0HA 3QJHB 4IHOB 1KBBA 4KI5D 1N26A 2OMZB 5CJ5A 2DQDH 3GI8L 3WKML 1GZQA 4QOKA 4RMTA 5GIRA 1G0DA 2RIKA 3RWGA 1NKOA 3MGOA 3PDGA 3Q48A 2IMNA 1MIML 1KCKA 2GSIA 3D87B 4LKCB 1HEZB 3JQOB 3WIIL 4KUCD 3CK0L 2BNQB 3P9MB 4JKPL 1KC5H 1OAYL 1CS6A 2VAAA 4XXWA 4ZAKD 2D2OA 3C2AH 4L4VD 2X0WA 2K3HA 3INOA 2VLJA 4RSVA 4ADIA 4OBRA 3HS9A 4I87A 3GC3A 4AXWB 5JQIB 1UYWH 2AQQA 1QPPA 3FQ1A 5C97A 3LPOA 3D0VB 1WWAX 1ZTXL 1SY6L 4M6MH 3KPSD 4PJ7A 2HTKD 1R75A 2W9EL 1VFAB 3PWJA 4PWEA 4X5WB 1L0QA 2WK2A 3T9WA 5I1JH 2D0HA 2OP4L 3J27A 3ATAA 2CNYA 4A2DA 4XVUC 5FYJU 5D2NB 4P2AA 2M8XA 4AC4A 3H7BB 4AWJC 1IGYB 2DIAA 4NBXB 4BINA 1WA0X 3WAJA 3GUTA 4MSWA 4ZFOL 3EG9B 4ZW3A 1EEYB 1XZ0A 4OQ1A 3UROR 1KXQA 1I3UA 4XPFL 1JZEA 4Z7OE 1UQSB 2HT4C 1DO5A 4ZMXA 2B4CC 3U7YL 2JB6B 2J4WH 1FE8L 2I5YH 4WJKB 2F7IA 4K71C 4C83A 5IMLA 2IH1B 4PVNA 4YS4A 4N2HA 3SODB 1X5GA 2PUQT 1CGXA 4MX7B 1J7VR 3DMMB 4EQ3A 3QXUA 5FAAA 4HPHA 2FLBT 2PWDA 3DPBB 4HCIA 4PRBB 2F5AH 2BC4B 5K39B 3S6CA 2ICWI 4WKXA 1XB6A 3G6DL 4YSTA 4POYA 2X88A 1JZGA 2GBAA 2WWMD 4XCEB 3R7QA 3QO0B 4LAJH 2H3XC 4KKRA 4L8BA 5E6IA 4U6XA 4WK2B 1XIWB 1F42A 1FZJA 1HSBB 1KYDA 4LCCA 5EO9A 4BZ1H 4OIAA 1GC1H 2YA1A 1ZT4B 4HVBA 3U2SB 3EJYC 2J1KA 1MG2C 4J4PD 3MUGA 2ERJB 15C8H 4F8PA 4AL8H 2DKUA 3WY3A 3FTUA 4Z95L 2ZUYA 3BZ4A 4BKLB 2CLVB 1IZJA 3BGMA 4K94H 3JZ7A 4FA7B 3KJ6L 2A9DA 3AU1B 4HLEA 3SDDB 5LVEA 3PWPB 1F11A 1LQBC 1X5AA 4A66A 2NX5E 4DIXA 1F4YL 5DQDH 2EXWC 1JPTH 4ETYA 4O58L 2UZPA 5GGTA 3F5WA 2X2YA 5FF6B 2UZYA 3F00A 3IETA 3K6NA 4HIEA 3KAAA 4HXBH 2VDPL 4YHIB 5F7HA 2YMXH 3PGFL 2J73A 2I27N 3QIBC 5JHDE 4OKDA 4RWHA 5IJVB 1M9WA 4P9HL 4HJSA 2IH1A 4FFVD 4JR9H 4RISH 2ZUUA 4YBHA 1KTJA 2OCCB 3W5NA 3F65A 4IOIA 4IRSC 5D5MB 5CD3A 3HG1E 2GFBB 3U4EA 1AGFB 5E08L 1TQSA 1MI5E 2VH5L 4LPCA 5EF3A 5HHOB 4LSQL 3W1ZA 3H56A 1GGUA 4ZD3H 5C9JB 2B59B 3RTQA 4AIOA 4Y2DD 4U49A 5ITFA 1KJ2B 5GRWA 1SLVA 1XF4A 2CBPA 3IGFA 4NWTL 4TM9A 3RI5F 1A64A 4D0BA 5IZ7A 5C2BH 3QUGA 1YQVL 5E1AB 3NJNA 2FLRT 1QHQA 5DRNA 1KELL 3GMNB 4FADA 3MV8B 5J1AB 2EH8H 1FYTD 5KVFL 4R90H 3QIUC 4QRPB 3G6JE 2PYEA 1TZOA 5A6LA 4P4KA 4IRZL 1K4DA 3U46B 5DHMC 1DQQA 3ECVA 3W11D 1DBMH 1NBVH 1VPOH 4WEBL 1AFVH 4UQIM 1EUTA 1YRKA 3NJGA 4LSTL 4XN1A 1YNTF 2ZOOA 5DHYA 1UXSA 2BSTB 1CUOA 3BSZL 2VDRL 4P5RA 3VXUE 5ELIA 1J88A 3QUYC 3KYMB 5EMYA 1BEYL 1JGEA 1VAHA 4AZ8A 2PETA 4ODHH 2DL9A 1QLRA 3ZDXE 2JLPA 3FTXA 3PDOB 4WW2C 4XHJD 1S4IA 4XPHH 1OAXH 4RMWA 3NJJA 4BIKA 3HPJA 5J11B 1MHCB 3FN0L 5FKPB 4XBPA 1UA6H 3VMPA 4CNIA 1NFIA 2WNWA 4RDQG 1KMGA 1X7QA 2NW2A 3EFDL 1N4XL 3FO0L 2E9BA 1E4XI 2ROYA 3MYJA 4J5VA 4UNVA 3EG9A 3N9GL 2CKBL 4XCFL 4XZUB 3DVNB 4N9OB 4PJCB 3CZNA 4LL4A 1TJGH 4LHUG 4ZO9A 3DTDA 5FIEA 3RVVD 1MCQA 5LGYA 1V05A 1CT8A 3PWNB 5EA0L 3O6MH 5DFVD 3NSJA 1YVLA 4MCZA 1IEBB 3TT1L 3G5ZB 2D8KA 1FO0A 2IV9A 5I6MA 2IQAB 2UV3A 4L1SA 1P4UA 3IMTA 1R5WA 4LVNB 4LB8A 1BECA 3GSUB 4YPGA 4CILA 1GW6A 4JW3A 4PRPD 3IMBA 2MRYA 4BSWB 1B0GA 3TTYA 1R47A 5DMYA 4TSCH 3NFPB 2ZSVB 3CQFA 4KTDH 4BK8A 3ULVE 3UGUA 2F8OA 5GGRA 1QR1B 4CA4A 3BO8A 1S2EA 2Y7MA 7FABH 4Q9CA 4OGYH 2DTSA 2YLHA 2G30A 3QXWA 4XC1H 1DVQA 1WTGT 4M5ZL 4YK4C 5D7IF 2XOTA 3HIZA 4J12A 1SFDA 5IUCA 3DO7B 1TJHL 2Q10A 1S7UB 4PHXA 3SCMC 3GRGA 5ICZB 4H0IA 4PS3A 4PRNB 1U8KB 2HXAA 3NCEB 3QUXC 5HVHC 3NOIA 4L1TA 3KLSA 1Y7VA 3G04B 4KKAC 3VXNA 3CVBA 3ZR6A 4PJ9C 4Y16C 3D3VE 3GBNL 2ZXEB 3IDNA 1IC4L 4CADB 5E8PB 5TDPA 2E0PA 2VMFA 2FH6A 3BKYL 2PCPA 1LD9A 2JJTA 4BFIB 4M7ZC 4R7DA 4MB4A 4KK6D 4TSAH 3W38A 4X80H 4QRRB 3VI3A 1E6JH 5DURB 1I7TB 1S7TB 1LJMA 2IPUK 3ARPA 4JHWL 3OKNB 3BQUD 5GGQL 5T33L 3FHAA 5F7EL 1V5JA 5EO1A 4LLUB 2AMGA 4OAWA 1E4WL 3MQIA 3LH2H 3H9HA 4GW5A 3RZWA 3TYFA 4GAGL 2VERA 4DEWA 4HCRL 3EJCA 2WM0A 1JNLH 2H45A 2JJUA 5G5DB 4AC2A 2IMMA 4KKCC 3OC8A 1CN4A 1N8ZA 2VB5A 3SE9L 4RQQB 4DP9X 2X1WL 4HAGA 1MCWM 1NC4A 4LLWA 3F7YA 2E86A 4PRHE 1I9JH 4OZHA 5C07B 3LB6D 3IE4A 1E8YA 3QORA 2OM5A 3K72A 3T6VA 2B08A 3I9GH 5GIRB 1DBAL 2KYIA 4W9CC 4NEHB 2ICCA 4R4NC 1FG2B 1MHPH 1AKJA 1KTDB 2W59A 3AS1A 4HAFA 4PCYA 4X6CA 2MHAA 5D7EA 4WV1B 3ARSA 3IKCA 4HIPA 3U36A 1JN6A 1CDJA 1P9MC 3JYBA 5CHNA 3W9EB 5FOBB 5EPMA 4JM4L 1RURH 4NGHH 1JNNL 1BHGA 2GTQA 3FH8A 2NT0A 4LCWD 5LDUA 5J7CC 1TQCB 1Z9LA 3BAWA 3P4OA 4M6NL 1AC6A 1INEH 2VW6A 1NCWL 2HJKB 1ASQA 4I0KA 1FPTH 3BRGC 1HSAB 2P1YA 3DUHA 5ENWB 3HG1D 4A55A 3GSNB 5KWYC 5I0WA 4KHTH 2PTVA 2NR6C 3C87A 4BGDA 5EBLB 3FJTA 4MXQD 4L0YA 2A9BA 4Z7UE 4LCUB 5CEYB 5SWSD 5TE4H 4ZX4A 2X1PA 1GZPA 1MJ8H 3O11B 4P2RE 4DP7X 2JWYA 1B4JH 1U3HD 4M9OA 4MQXC 4Z7VE 4Y1AD 3RVWD 1U8NB 2J3SA 5KBMA 4HS6B 5IR1A 3ULVL 4YHLL 5F0MB 3DA0A 4Z95H 1CXIA 1W15A 2ZQKA 1PQZB 4LHUD 3FT1A 4QUOA 4L05A 2MIZA 2DM7A 2X3AA 2D7OA 3QC5X 2CKNA 2PO6A 5DGQA 5IBTL 2CJTA 1GMIA 4A6YB 2C1PA 2VLJD 1YQ2A 1W9XA 3GSOA 2XJLA 2B16A 4Y4HD 3HBQA 2MWCA 4AEHL 1UEYA 3WDIA 1DEEA 1YEHH 4NUQA 3ME0A 4K7FB 2ZYHA 4Y1AA 2G3XA 2Q86A 3ZKSD 1NKGA 4YR6A 5C7XH 3GMLA 2IC2A 4I9WE 3ULSB 1HL5A 2CDFA 2HRGA 4LIQL 4B9GA 2NOYA 3ABKB 5CZVL 4PJ6A 2N7AA 4RISL 1MAML 1PZ3A 3LZLA 5FCSH 5AZUA 4DETA 5CZVH 2V33A 5HBBA 2WBKA 1N59B 3FU6A 5E6ID 4S1RH 1AVAA 5SWQB 3FRUA 4ZG1A 6FABL 4GFXA 1JYWA 5LAXA 3VMOA 3MV7A 5ICUA 2XQYG 2K7QA 4HHGA 4G6KL 2R1YA 3E2HC 3MLUH 3BN3B 1XF2A 2VC2B 3SY0B 4KX7A 1XF5A 1CFBA 3DYPA 3HLAB 3IU3B 2Z3FA 1A9BA 4HHAA 4M02A 2BVQB 1HQRB 3CSTA 5K33A 5GGTL 3UABA 3OKLB 4O2EA 4H0LC 4RFNC 1TSRA 4QRRD 4PJGA 1UZ8B 5FGCB 3GI9L 2EKJA 2YQBA 4AYSA 3MYJB 2G4GA 1XCWA 1ZANL 1U9KA 1UD8A 3U4BL 4RIRA 3KDMB 4HD5A 4K9EC 1AGBA 5BPPA 4R90L 1JIBA 4WWNA 1I9IH 3FU7A 5DUMH 3I3DA 4H25B 1NAMB 1EVUA 5CD5D 1A3RH 2IJ0C 1KPUB 2DD8H 1H9DA 3TCXA 5CMAA 4XMWA 1BAGA 1G5AA 4TPRH 4LSTH 4MZIA 4Z7UA 5HHQB 4I1PA 4F91B 3TV3L 2Q8BH 4ODWA 1NC4D 1U36A 4UM8B 3BT2L 5HDQL 1MCKA 5I66B 1SHXA 4JFHD 4J3OD 4XMLL 5JO5A 2B5IC 5FLUA 2J88H 3E8UL 4L8SA 4M7LT 3QDJD 2FWOA 4DN4L 1U8PA 3HLKA 4PJBA 5DYFA 1GSMA 1OCWH 4XVTH 5JW3H 4CU7A 2UWEA 4RQQA 3QIBB 1IBHA 2VRAA 1GPOL 2WNXA 1AAJA 3L6FB 5ISZA 5J4MA 4PRHD 3EBGA 3CVHH 3VFOB 1N0LA 1LK3H 4HA1A 3NJXA 3N9GH 3WKQA 3VI4B 1GHFH 4PJAB 3KPPA 2VLLA 5JXED 5IVXB 3X13A 4M8QA 1OB1A 2AXGA 5CGYC 4RGMC 4KKBC 4A6YH 1G0YR 4S1DD 1OOWA 4RMUA 3SB3A 2E7LC 1IT9H 1HHJA 5IV2B 4WHYH 1LD9B 2Q9OA 3LHPL 4H20H 1BF2A 2J4WL 2HVJA 2HMIC 3BIKB 2AQPA 1ZV5A 1AQ8A 4AM0Q 4KK8D 2D3LA 4YDVB 3RZCD 4MAUL 4W6WB 1PKOA 4ONOA 4EIGB 1SXSA 4XN5A 3VQMA 3D33A 4BV1A 5DD1L 3HHMA 3EZJB 5DO8A 1NLBH 2NRDA 1YEFL 4UDTB 1OWRM 2FHCA 4BQBA 2P5EB 4J2QA 3DVGA 7PCYA 3BZEA 1OAKH 2PYED 1QFUH 1BZ9A 4NQQA 1FZOB 4NRZB 4F7TA 1IVTA 4K8RH 3VXSB 4X7DC 4X9HA 5ANMB 3US0A 3VA2C 2VLRA 3PP4L 1WHPA 3FB6B 4HS3A 4F8TA 2VT0A 2WLNA 4U6HA 2QDWA 2VIRA 1EXGA 3CVDA 4JFWA 4XZ4A 3ZSTA 1CL7L 1JV2B 4PJDA 3LIZA 4DVBB 1PVHA 4A1RA 2ETWA 3S4SG 3T4AA 4G80A 1KIUA 2V6HA 3IMUA 1AJ7L 5GHWL 1YUKB 5EDXA 4YXHL 3ZL4H 2ENPA 3NGBC 3LZPA 1IBBA 1G84A 1IAMA 5HYSB 4JFDE 3E2HB 3R4RA 5EOTB 3QXAB 1XGYL 1T03L 4GG6E 4MNQD 2JJWA 1ULVA 2X2UA 2X87A 4NAMA 5MEQB 5EIQA 1MAKA 2VLJE 2NX5A 5AW3B 1VRSA 1S6NA 3V6ZA 1SN2A 4BFJA 5T3ZH 1RY7B 5D1XB 4DHLA 2CXGA 1NEPA 5C8JA 5IQ7L 5EU7E 4QRTB 5AUMB 5T5FA 4MVBD 3IJEA 1DZ0A 4P9HH 3ZL2A 1RMFL 2I7OA 1EERB 4RX4A 2SEBB 4OLXH 5EWIH 3BPOB 2DLHA 2QLVB 4YNYA 4MQ7B 1WTLA 3BH4A 2VSCA 2XTJC 3HRPA 1A6AB 2JB6A 4X6CF 3TBWA 2MQ3A 1TXKA 2EO1A 5EULV 3GRBA 4MJ5B 3ASWA 4J3WA 1UXWB 4QTFA 3CC1A 2UZXA 4KBPA 1V27A 5J5EA 3ULAB 3ZIYA 4IQHA 2VL5A 2X4RB 4MAYD 3GLDA 2WXNA 3PGDB 1D7BA 4WI8A 1UWEL 1EEZA 1RJLB 2R23A 4AK1A 5EZLB 1D9KA 3KYOB 5CCKH 3GSRB 1PLAA 3NCXA 1J12A 3VWJA 1KELH 4WWKC 5I73B 4Z7QB 4G9FA 4KQ4H 4APXA 2XQ0A 2XRAH 1BVKB 3VGEA 1B4LA 2WXPA 1NGQL 4KNQA 5F1NA 3SQOL 1Y18B 4TQEL 4RAUB 4AQOA 4LSDA 1LO2L 1SYSA 1A8ZA 1B0WA 3GSXA 4ODXA 2VDQH 2VAAB 1E30A 1NANH 4Y5VC 2I69A 4DKFH 3EXLA 4O2CB 1TG8A 3Q8CA 3M1CA 4N6RB 2QDVA 1R5VA 4M7ZB 1OLLA 3I6SA 5EU6E 4Q97A 3V0VA 5KBNC 4P5TB 2WKOF 2K8QA 2ZOWA 4TN9A 2AJ3A 2EVIA 2BFVL 4FXGC 1A4JA 5D6CA 3A24A 5DZLA 4D3CH 1V10A 1HIML 1E9QB 3QIWB 4OCMC 1MXDA 4IOIB 4PS4H 3ZJAA 3NIGF 4DT2A 4PJBB 3ZIMA 3LEYH 2Y1AA 3RWFB 1RHFA 2CDGA 1N70A 3MRDB 4Z7WE 1SVZA 3CFMA 1USQA 3R8BB 1O7DC 5IB2A 2BY0A 4Z1PA 5J3HD 1CD8A 5F7YC 1EHLH 3VFNA 2F74B 4ZS7H 5IHLB 2F19L 3SBRA 3BLBA 4TLKA 1GHFL 4PJIF 1PBYA 3SGEH 3TO4B 2Z92B 3DX9B 1AS6A 5J6GB 1YECH 1AIFA 5IB1A 4AVKA 5ISZD 5J9PB 3B8YA 2AGJL 3G6AB 3IJHB 2X05A 2AXWA 5IESH 3O4OC 3RU8L 1S5HA 5IB4B 2IBZX 1NCJA 1CI3M 3VRLE 2ICWB 4XH2A 3CZSA 5FOJA 4HFUH 2APXA 3DGGA 3I6GB 5DJ6A 2ZP9A 3H1ZA 1DJWA 1OCRB 2VXVL 5T5NF 1CO1A 4K55A 2HX7A 5CUSH 3F64A 4R4ND 7FABL 3ARBB 4HGMA 2J1ZA 2NUTB 4JO5A 3T8XA 2CO6A 2W60B 2GBTA 1UHVA 4X4ZA 2XSKA 3D4YA 3VTMA 3X1BA 3ZT7A 1WT5A 1FYTA 3DX0A 2Y25A 5KJRH 3HNSL 3TURA 4PS7A 4UQ3A 3Q9QA 1Z0MA 2GJJA 3AITA 1MW0A 1IBZA 1WFUA 3DPBA 3HNSH 4L9LC 4NUPA 3NCCB 3SBPA 5E6UB 1BXAA 3QJHA 2AC0A 2F54E 5E8DL 1EXHA 4YWGH 2WAQA 1ETA1 3A4AA 1KIRB 5F89B 3LZOA 3RY4A 4AYBA 4FE9A 3MNZA 1KWGA 1JV5A 2MOQA 4KZEH 1YJDL 3QZLA 1HINL 1SBBA 3KYAA 2E7HA 1K6QL 1NLDL 4FNLL 1QSEE 3L4WA 2C4FT 1SLUA 3QDGA 5HGBB 3J8F7 1KXVA 4JREB 2P46B 3N41F 1RZIB 5HYQA 1YNLL 2ESVE 4YO0A 5EBGA 4WWKD 3WUWA 5HHPA 3O9WB 1JPGA 3NP3A 2X4NA 1OVZA 5KUMA 3L95B 1LEKA 3J07A 5IMMA 4X5WA 4XWGH 1MQKH 4QHKJ 3EAKA 4Y16A 3THMH 3MRPA 1WAEA 1OO2A 4X8XA 3JTSA 4R83A 3LQMA 3AG4B 3K2MC 1ZA3A 1WFTA 4L37A 4Y5YC 4E9VA 2R8SL 3L4YA 2A6KB 3SDXA 3MA9L 4UUJB 5KVDH 1NC2D 3OJDA 4PWHA 5C7ZA 3WJJA 4AL8L 6PCYA 2DAVA 4OCNC 1G1YA 1B0RA 4P46A 2WW8A 2AEQH 2DQCH 1XGRA 5FM5M 1CXKA 3GM0A 4F3FA 4EKJA 3L5WB 1PG7H 1I1AB 5B7FA 1G7QB 2ESVD 3LH9A 1DJYA 1T1YB 2JE8A 3QBTB 3UJJH 4IK7A 4LHUA 3RLSA 5AG9A 2O61A 4NS0A 2VJ8A 3QH3B 4Y4KA 1DQMH 3MDJA 2PCFB 3WEXA 1I3RA 3F3HA 3DUUB 1NFKA 4HXBL 5GRUH 4TVPL 4GP5B 5BXFB 3CFKB 1LO3L 2YKLL 3WV0A 2FO1A 3QIWD 2H7WA 4FERA 4U3SB 2QT6A 4FKEA 2ZXCA 3SQOH 5FK9B 3NG5A 4FQXB 4XCNB 2ALAA 5CF3A 3DO3A 3JVGC 2X4UA 1D5BB 1TTBA 1MOEA 4ABQA 1JNHB 2L7EA 4PJAE 1CG9A 5SWZE 3UAJA 2VR7A 2CNZA 5KVGL 4M7JH 4XB3A 4AQZA 5D71H 3D4GA 3UG5A 4HG4J 3VFWB 3DROB 1R3JB 2BVOB 1XGTA 2XY1A 4HBCL 1JDAA 4UUJA 3FYEB 4Y1SA 3TBWB 2YQGA 1MJJB 3AAZA 3QCUH 4Y5XC 3IXAB 4XXDA 1DQTA 3E38A 3NH7H 5ABZA 3DARA 3TO4D 4UQ9A 1BVOA 4OUUA 1D2PA 3RZCC 1OAUL 5ESVA 3RWHA 3T65B 1EFXA 4XNAA 2YAFA 3OKDB 4GSRA 2P52A 4WEUD 1A1MA 4AGQA 2DQJL 2CG9X 4IOFC 3LD8B 1T5KA 3BWUF 1YA5A 3OWRA 1E3ZA 4PCTA 2IGFH 4FNPA 3MUHL 3V4VB 3GLEA 5DRXA 3EUUA 5TPWL 2BH0A 2OZNA 4NHUB 2LLGA 3TJEL 2H0PA 3UTSA 1C12B 3D52A 4R9HA 2ADJA 4N0FA 3PQYB 3BQUA 4AOFA 4YLCA 3EGXB 3D25B 3HG5A 1OANA 1TTGA 1TZIB 4KJWC 5I5JA 3SGKC 4QO1B 3ZVVA 4BA8A 4ABVA 4HULB 4YGVA 2QTEA 4DQAA 5E2VL 4PJDB 4F9LA 1UD3A 2ATKB 3VE0A 4NRXB 4L3AA 3E8VA 2VISA 2D3NA 2NLJA 3MNVA 4PN6A 4TSBH 4ANKA 2NNXA 1ES0A 4PY7A 2MCPL 2XA8L 3PGCB 4UV7L 2NY5H 5I1DB 4GXVL 1NCCL 5IOPA 1IAIH 2OZ4H 4LSQH 2VXQA 3NCJH 2PF6A 1R1CA 5EFIB 3DSFH 2R2BA 1IM3A 1WFOA 2HT2C 5J6HB 5T1DL 3FQTB 3ZDZB 3PFUA 2Z0UA 3CXHJ 2OCFD 3HZ3A 2XZAH 4BCXA 5IFHL 3WNOA 2PN5A 4NDMA 3BVUA 4WU7B 1KGCE 5GRVL 1NGQH 2VQTA 3INUH 4L29B 1TQBC 2AJXL 1SXBA 5CEZH 2N0MA 5KYYB 1A3RL 1TJMA 3RIAK 1TVBB 2NY1D 3MRBA 4N8VB 3SKJL 4E0RA 4LKXB 4MS8C 3BW9A 4F2EA 4F37F 5I8EB 3DHPA 3PPSA 3KBFA 3QWOB 4OCYL 4XPTL 3U4AA 4E9RA 2JXMA 4GI9A 4L4TE 1XFPA 2CGZA 1PMYA 3DOSA 3DECA 4K3EH 5DC0A 4WO4A 3OHXA 5ILTL 1CVRA 4FABH 1WZ1L 3NEXA 3AUWB 3QQ3A 5IKCA 1FFOB 2YZ1A 3PHQA 4P48A 4U4BA 3WEMA 4E42B 4HV8B 2VQUA 4FQ1H 3V4UH 3TIEA 1URLA 2AABL 1NUGA 4WY7L 3C60C 3VXQA 4L3EA