1OHZA

Cohesin-dockerin complex from the cellulosome of clostridium thermocellum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
b'GVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOMAL SCAFFOLDING PROTEIN A
molecule tags Cell adhesion
source organism Clostridium thermocellum
publication title Cellulosome Assembly Revealed by the Crystal Structure of the Cohesin-Dockerin Complex
pubmed doi rcsb
total genus 27
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ohzA00
2ZF9A 4IU2A 3L8QA 3BWZA 1TYJA 2B59A 2CCLA 2OZNA 5K39A 1G1KA 5AOZA 2JH2A 5LXVA 4UYPA 4UMSA 2XDHA 5G5DA 4FL4C 4UYQA 4DH2A 2VN5A 3F2LA 3UL4A 1QZNA 2VO8A 3GHPA 2O4EA 2Y3NA 2VN6A 3KCPA 3KCPB 4N2OA 4U3SA 1AOHA 4FL4B 4WKZB 1OHZA 1ANUA 1ZV9A 4IU3A 2BM3A 3FNKA 2W1NA 4WI0A
chains in the Genus database with same CATH superfamily
3VWJC 4MLIA 4PD4J 1A1NB 2AJUL 1EAJA 2BDNL 2O5ZH 4JQVC 3BZEA 2GITA 4U7SA 1KGCE 3L3GA 5KYXA 2WVVB 3TO4C 4J2QA 4UOQA 3UZQB 5J1SC 3EJRA 3ZE2F 1CL7H 1WA2X 4L8DB 3DPBB 4ELKB 4NPYA 5ENWA 1B2YA 2H2PC 1TVHA 1O7SA 3QUXD 4M6NL 4UTBH 3VFWA 1JMZA 3W2DH 2FQDA 3NACH 4NAMA 3TPUA 4BHUI 3N2JA 4AL8C 5T5FL 4E9RA 1YC8A 4GKLA 5I5MA 2F74A 4K0OA 2E7MA 4PCYA 1BX2A 2QVFB 3E6HA 3K6NA 4NRXB 3RVTC 3MLVH 4Z7AA 4P06A 4YPGA 4F8LA 1O5DT 3ZRFC 2F19L 1AO7E 2E86A 1W15A 3F5WA 3G6JF 4X0NA 1NKOA 4CC4A 1DVQA 5IESH 4F8TA 1S9VB 2CE6A 3WTWA 3D07A 1BEYL 1QHQA 5DR5H 5E9DA 3VYPA 5IOPB 2H1LM 5F2FA 2BP3A 2KERA 4KHXL 2GHWB 4GAGH 2NY5H 5CLWA 3GPEA 1XF2A 4E9QA 4YHPB 1FWXA 2IQAA 3AXIA 4U6HB 4KVNL 1HYSC 1MF2H 4NO0D 3ZDXB 1OAKL 3QFDA 3OL2A 1CFNA 5HDWA 1T0NA 1GHFH 5IMLA 3AGVA 4U1SA 3VXUE 3PE9A 2NY5L 2VN7A 4K3HA 2MPVA 4N2BA 5SX5K 3RWIA 2JCCA 1R3IH 1XCXA 4I0PC 4IDLA 1WJ3A 5HBBA 5FHAH 3BGFB 1V7MH 2WXRA 1WWBX 2DJSA 3OLDA 4YHNB 3RA7H 1A6AB 5TE7H 2VAAA 1G9MC 2E8YA 2QSVA 4WI0A 1SJEB 1NCWL 4CMMB 3SKMB 4MNGB 2YOCA 3OKOB 3A4DA 3RWCA 3SKMA 3PS6A 1I1AC 5DZOA 2VDKB 5EWIL 4YZWA 4KI5E 3R7QA 3CDYA 2NUTA 2JELL 3K6OA 2GTZB 1SYSB 3X11B 2V2XA 2OMWB 4RQQA 3KPRB 3QZMA 1T5XB 4LCVA 3TTYA 3F7VA 3DRTA 2DI9A 2H7WA 4UQ9A 1QASA 4PI2A 4U1JB 4OH2A 3D09A 2XWCA 4XN1A 3KHOA 3BP4A 3SDAC 3VFMA 1JNLL 3V6FA 1CLOL 4A2HA 1BREA 1R3LA 4A38A 3BAKA 5FXCH 2YAOA 3B7TA 4KQ4L 5DSCA 1HWGB 3TYFA 2IANA 3L3OB 3DRQA 1ZA3A 4PJ9C 4KVCL 5DEGB 2BSTB 1JPTL 4ZAKC 5AZEH 3OKDB 3RWFA 2XNAB 3P9MB 4FHKA 4JFDA 4EDWH 5J13C 4N0YL 3EXLA 1BSIA 3GMMA 3MRJA 5E99L 4HWBL 3VWKB 3RE0A 3MLZH 2YEZA 1KFGA 5CGMA 1OSPH 2F74B 3U4EB 2WAQA 4HOMA 2WZ0A 4OGAD 2IAMB 1MJUL 2CJUL 3M1CA 3O6FD 4ZS7L 2APFA 2ZF8A 4B3EA 2WVTA 2XSKA 4JFED 3H2WA 4OUUB 3BKCL 5JXEC 3VD2A 3RVWD 5J1TC 4IBUA 3UTSA 4LCCC 3GXPA 3IMBA 4AM0A 3VGDA 2HYMA 1GKEA 2F8OA 2ATAA 4IOFC 1T1YB 1TJGH 4HALA 4FTVA 3RWDB 4P2RE 4HWEL 3MRCA 3VFUA 2BIMA 3EJYD 2BRRH 3KYOB 2CDGB 3F01A 3RX9A 1O9VA 3ZDZF 1FDLL 5CKAA 1U95B 3U30B 2V33A 4JFXB 3OZKA 5TQ0L 2FB4H 1DQJA 4XMWA 5L4IA 4PJ6A 1H19A 3QDHA 4OFYA 2R4SH 4HJSA 4TQPA 4U6XA 12E8L 4PJGA 2ZUQB 2XKSA 5I1JL 4JM4H 3OQ3B 5EUOE 1BZ9B 1RIVL 2XY1A 3HHRB 5JOEA 3CDCA 5I1CL 3VTAA 1FZJA 2VABB 1LQSR 1UJ3C 4ANKA 5GGUA 4IBZA 4EN3D 2ALWA 3FMGH 1D9KD 5H4YA 4TQ8A 1X9RA 3QG7H 1F4YH 3ARBC 3X1NA 2CHXA 4JRYD 1S9VA 1FORH 2JJVA 4DESA 3DO4A 1U8HA 3WIAA 1Q9KA 4CW1B 2XWBA 5DO2D 4UDUA 5KSBF 2FLBT 1I9EA 2PCFB 4JG5A 4ODWB 4Y89A 3VGFA 1SOKA 3WTTA 5C0JA 4N8VA 4Y2OA 5DHVH 1X5XA 4RMBA 1UWGL 3HEIB 3TN0D 2PCYA 1OOWA 4WI2A 2ZPKL 1XCWA 5D1QD 3JWOH 5I76B 3G6JA 1TLMA 2IOMA 1SJMA 4PIBA 2ARWA 3P73B 3FJTA 1M7DA 3K4DA 3PHOA 2MKLC 3QNXB 4GO6B 4ONGH 5IG7B 3PWPB 4ELKA 4Y7MA 3LEXB 1BD2B 1I7RB 3Q2NA 5HD8D 3DI2B 4PYGA 1YEEL 1OPOA 1BVLB 1TTBA 3QAZB 4Z7VE 3QDGD 4KJWD 2FEDC 2JB6A 3TFKC 4KXDA 3QA3B 3NIGF 4LSDA 3E6FB 4PBVC 1DBML 5C0BE 1CT8B 4YXHH 1WE5A 4GYBA 5L88H 1M9WA 3C9NA 1QI3A 4P48A 3E6HB 1A2YA 4LKCB 1BFVH 4HUMB 5GHWL 2FSEB 3K46A 4UF7C 4W9IC 1TZ8A 3PPSA 3L3KB 3ZHDA 1Z3GL 2B39A 4BK5C 1O6SB 3BISA 2XBTA 4GRLC 5A6LA 1P4UA 1KCSH 3BWZA 3N40F 3OB0H 1M2VA 3IJHB 4JFZH 1TZHA 1X4ZA 2VDNH 4ISVB 1S7UB 3GJFH 4AENB 1YUHA 5KS9E 5HHOD 1H15B 1NDTA 3ESMA 4LDEB 3TOPA 4WJ5B 2M26A 4DKFH 1T66D 3MODH 2GITB 2FCBA 5G4OA 1ADQL 5E7FA 5HYFA 1U92B 5HI4D 1EDQA 4NKIL 1CXHA 1FFRA 1KBWA 4KNTA 4P59L 1SMDA 1CBVL 4TSAH 2OXGB 1DQJB 5EO9B 2R2BA 4LNVA 5KYUA 3AWGA 4GBXB 1ZAGA 1OTUD 3PQYD 3CLWA 5CINH 4KK8C 3Q06A 2DKMA 5J3HD 1EZVX 3O4LA 3ESNA 4H25B 4PGJA 4JUTA 4I18A 4L5FH 4ZX6A 2HT2C 5TDNA 3QGVA 4OJFL 4F5CA 5EZLB 4J3OD 3MBXH 2WBJA 3W37A 3APFA 2Y1YA 3GXMA 4PJIF 5SV4A 5B3JE 1BQ5A 4ACPA 4PJBA 4O2FA 4J3OF 2IPUG 4ZUTB 3GSVA 3G04A 1J5IA 4BZ2A 5EN2B 3G04B 4GEJA 4JS7A 4RGMB 3GMQB 1A3LH 1RFDL 2VXQA 3PWLA 3CXDL 1VFOA 4X7FC 1CD9B 5HYSA 2EO1A 3TIEB 1N6QL 1EJ6A 2J88H 3CG8A 3CVBA 3VI3B 1BMWA 1E8ZA 2YJQA 4FQXB 3QIWD 5EEVA 4J1UB 5ELIA 3OHXB 1X5YA 3CSTA 2E7CA 4IKNA 3MMEB 3BJ91 4ZOAA 2QQNL 1FIGH 1GOFA 4KRPD 3MN8A 4PJ8A 4R4FH 4WI5A 1DO5A 5DHYA 5TDOB 1RSYA 3TZVA 3T3MF 3B5GA 3SDCC 1EXUB 1BXXA 5DCCA 1HXKA 5KYYB 3H42H 2IIJA 2CBMA 4YEFA 4UNTA 3FT4A 4LESA 1I8IA 1MNUL 2PW2A 3K3QA 4M3HA 2VKWA 4LDLB 3ARGA 4BKLA 1W6WA 4JRXE 3AGWA 1BZQK 3CFIC 2JWYA 2PKDA 1WTGT 3C8KB 5K9JH 1H8LA 3ELAT 1R6VA 3FC8A 2D4DA 3FN9A 2P5WB 4POZC 1DQQA 4NBYB 2NSMA 2AJYH 1FVCB 4LLAA 4KKAD 4NP4H 2YXFA 5FDYA 1E9OA 4N68A 1RL1A 3PDOA 3TT3H 3VI4B 1WO2A 3RJOA 3ULVH 1A4JB 1OCCB 3HI5L 1OGTB 1MH5B 4KKQA 4C58B 4KNSA 5GGRA 1PZAA 1AR1C 4XOEA 5IROC 5I74C 5J56B 2FX7H 4Y2DC 4IRJC 4XO4A 3RDTC 5I6NA 3CFQA 3EGDA 1FH2A 2LU4A 2ZAHA 4LHUA 4QRSA 4NZRH 3HE7B 1CD0A 1S7VA 1QP1A 1X5JA 4U6VL 1DBJH 4HQQL 1Z5YD 4DT2A 2J25A 1JXDA 1BAFL 4ADGA 1Q0YH 1IE5A 2GKIA 5KBMA 3LKRA 3CHSA 4DK6A 2MOQA 4HXBH 2EDWA 3W11C 4N6RB 3NFSH 4OM0H 1PZSA 4EIBA 5DZJA 1ID5I 1NSNH 2CKBH 3I74A 1ZLVK 3LNFA 5FM8A 4FKEA 3HB3D 3IFOB 2KPWA 5E2WL 5AAMC 3WKML 3L17A 5F88A 2Q76A 4L2YA 3UTSB 4UQ2A 4JRLA 1IKNC 2YBRA 1IBZA 3TO4D 1T4KA 3I84A 3BHBA 1WFOA 2ZYRA 4HJ0C 3SOBL 2VRQA 3RWGB 5GGTA 3HOGA 4F2MB 3U6XS 2EDKA 3P0YH 4P2CG 1SMOA 4PJXE 4PRAB 2H2PD 1X6NA 2JKTM 5D2NC 2C9PA 1FNEA 4OGQC 1VFAB 2ODIA 1FGNH 2YRLA 2JKNA 4B7IA 1PCXA 1RJCA 1T0MB 4QWWD 3T0WA 3SB3A 2QBWA 3HHSB 1PS3A 2GHZA 1TDQA 3TF4A 4FA6A 1F8TL 1S7TA 4L9LC 4QOKA 5T1LA 1A6AA 3COOA 1NUNB 4XWOC 2HMIC 4EMZA 1N5YL 4JZJC 4NNPH 4ODBD 1TZIA 1NFKA 1XFPA 2IPKA 3HAEB 1PZ5B 3A6OA 1XD1A 5DRXA 1HHIB 4MFHA 4XO9A 4F3FA 1U3YA 4TNVK 4X6CB 2H1PL 3OM3B 2YXWA 4YUEH 3BZ4A 1MCWM 1YPZA 3VWJA 2IQAB 2Y7SA 4BQBA 1UENA 3ZE0E 1K72A 5JLZA 4ISVA 4ZPVA 2B1AL 1UD6A 2P7TB 3LPPA 5D7HA 4ODHL 2FJSA 2L7JA 5LCVH 1CD1B 5JO5B 2RMNA 3WY3A 4GUCA 2JV6A 3BPNC 1E3XA 2LW3A 5D7LD 1G94A 4NO5A 1E9QA 2Y5TA 3BESR 4UMSA 1XVSA 5B22A 5EU4A 3QZPA 4KK5D 4LL1A 3L5XH 1JNNH 4I2XE 4D9RD 3NESA 3OKNA 1GMIA 2FECL 3IN2A 4H4NA 4LF3A 4NUJA 5BV7H 2CIKA 1HEZB 1KIQA 1UEMA 2X1PA 5FYLE 4BRVA 4QRAA 3HS0C 3VXPB 7TAAA 4JRYB 1VCAA 3N41B 2PYEA 2E6PA 4CL7A 2WQRA 1G1OA 2ETWA 3GMMB 2L3BA 4YDVA 4ZQKA 3GSUA 4MXVF 4CSSA 2FX7L 2DLFH 5BRZB 4Y4HB 4YAQA 1N7ML 5E4EC 1XF3A 4ZOBA 2K0RA 3TV3H 5EU7C 5CBEB 4CA4A 3ULVL 1G9NC 4H1LA 1HSBA 4OLWH 2GCYA 4OCRL 5FIEA 1S2EA 5EC1B 1NIDA 2OPCA 3SKUD 4W9JC 3P9LB 4P49A 1HE7A 1RJYA 4PP2B 5EU5B 4CVXB 5JW5A 3C87A 4OJYA 2DWDB 3OGOE 4HKXA 3WY2A 3WO3B 1T7VA 2DWDA 1NMBL 1PAZA 1CR9H 2E8ZA 3IJ8A 3R1GL 4FNLH 3VJ6B 1MFBH 1T0NB 5IMLB 5FF6B 1SVZA 2X53A 3G08B 4JFSA 5AW3B 5MEQA 4ODUB 2KZWA 5C0AB 3SYOA 2A9AA 1CGXA 2K3TA 4X6BA 5AL8A 4R96B 6TAAA 3WFDH 2A6KA 4QAMB 3D1MC 2YWZA 2JKIS 1XGTB 3A6BH 1WFMA 2QQNH 4NDMB 5D7LA 4NYLA 3UL4A 5C2BL 2DEXX 1Z9LA 4GAYA 5F6HJ 3D0VA 1WZ1H 4V1DD 3BN9D 4Y5XB 1YY9D 2VM3A 2PWGA 3MBEB 3K2KA 3VA2C 1IJ9A 4J6IA 3UPCA 4AQOA 3CK0H 3MQIA 1AQHA 4YHNA 4PGBB 5EEYA 2XOTA 2ZYHA 1CD8A 3HIZA 4GQ9L 2WXIA 5CIPB 3ARBA 3LPFA 3SE9L 2CNZA 3DKHA 3F7VB 4FA7B 1E7VA 1ZXKA 4ZNCD 2OCJA 4ZXBC 5BS0B 3MV9E 4X7TA 5DVNA 5CZVH 3PAUA 4G9FE 2ADIB 4ABUA 4MNHB 2OMZA 3BPLC 4B96A 4X5QA 2BOBB 4Y0GA 5CJQL 3KYMA 3WXWL 4YR6A 2Z35B 1X3DA 2FT6A 2Z8SA 4K9JA 4XP4H 2DQFA 4JFEB 4ODTL 3AZUA 3OKEA 3QJVB 3QYNA 1HHGB 5DSCB 3MCLL 3MBXL 1J5OH 4BFNA 3PLYA 1M53A 1BFTA 1IGMH 4IMLA 1BJ1J 3QIBB 3TBVB 4L5FL 2YR3A 4NZUL 5FECB 2WIIA 3V4PA 3OXSB 1EV2E 3CZSA 3VFMB 1ES0B 1CMOA 3HS9A 4U6YA 3U36A 2XTJB 4X6DE 2CD0A 2VR3A 3OLEA 2QFPA 2E4TA 4A2MA 3RZCD 1ONQB 1YQ2A 2XZQH 3LH8A 1EJOL 4Y4KB 4PRDA 2QJDA 1AHWA 2ROXA 3CFMA 4LFHG 4TSAL 3BXNA 4JVWA 4TNEA 1ZSDA 3ZTCC 2EDQA 2FLMA 4YC2C 4QXTB 4MS8C 3V0VA 4UOZA 4DFIA 3F58H 2D4FA 2P24B 2B8OT 3BX7C 3J07A 4JJ5B 4MZRA 1I7TA 4ZAKA 1JP5A 4JQXA 1MRDH 4GXVL 4AYSA 5DJ8B 3L2MA 3P3SA 1DJXA 3GQFA 2YGNA 2Z92A 4JM2A 1D9KB 3WEBA 4R2GC 4P4KC 4LU5H 4BH8B 1GSMA 4BZYA 4BKSC 4J23A 3WFHA 3SYPA 4PV8B 4D0CB 4FQQB 3TA3C 3TM6A 3V5KA 3AS1A 4C83B 1R17A 3QYCA 1V5JA 1ZHLA 4FI6A 2AJVH 3PL6B 4LHUD 3SJVD 2PR9A 2UWEB 3N9GL 3UTTB 4R96A 5HYJE 2R51A 3GBMH 1B4RA 4ERSH 4G6MH 1Z3RA 4G83A 3VTMA 1B4JL 2W9EH 4YK4B 1M7XA 4GAYB 2FQEA 2X70B 3VFPB 3VXQB 1BD2D 3WV0A 3WLWC 2ZX8A 3STBA 5EC2A 5GSVB 3I02A 4FULA 2EIEA 2JJSC 2VDPH 2K45A 5CP7B 2GPZA 1QYGL 3DUSA 4LAJH 3FTZA 4HMDA 4L0YA 1P69B 3MOQA 3GIVA 2EIMB 4ADIA 3O9WD 4LOVA 1RZKC 1IL1A 2J6EL 4NFBA 1UWGH 4U1IA 2DQGH 4MA1C 4LCWE 3QG6B 4PS4H 1DJZA 2XV2A 3RY6C 1T1YA 4DIXA 1AYRA 3KM1A 3IETA 5H94A 3MJ8B 2F1AA 1BGXH 1L5GB 4QLRA 4P3WA 4M1DL 4AGQA 1U8IA 1P1ZA 4E41E 4PJ8D 5CMAA 4X6FB 5DJXB 1AVAA 4R6UA 4IHOB 3FMGL 3ARED 4YWGH 2HB0A 2VDQB 3IE9A 1JHLL 3HNTH 1SHMA 3T08A 2HX9A 4ZBJA 2EINB 4N2OA 3BCDA 2CNYA 4HIEB 5FGCB 1I82A 4K5MA 2VLJA 3O9WA 1A7NL 3ZKNC 5I1CH 2F9BT 2ZWKA 4KUCD 5GS0C 4XN9A 3LIZH 2FNWA 4ZX5A 1EEZB 1T0MA 4Y5XA 2F61A 4W9KC 2F18A 2XVGA 1EGJH 2HH0L 5DVLA 3HC0A 4N8VG 3MCYA 2WBXA 1QRNB 1U6AL 4JJHA 3U1SL 4J3OC 1I1AD 2BIIA 2L7UA 3NCCB 1YAIA 3D3VE 1FDLH 1ITCA 4U1LA 2Y36H 1MQKH 4LO9A 4AL8H 1SXNA 3AITA 3I9GH 4W4OA 4UNUA 5E9DB 4ABVA 1VHPA 2NZ9D 4X6CA 1IT9L 1ZLWH 4D8PA 2FEEL 2CR3A 3A6CH 5L2KA 4PP2A 4LSUH 4O2CB 5EULV 2YIHA 5IVNA 1CTNA 4PJBE 5H37H 3VQMA 1S46A 2W0PA 1LD9B 5GGTL 2ZIDA 1TNNA 3FFCA 3O6KL 2OMXA 1KCRH 1UD8A 1ZXQA 4XNXH 2RAMA 2WLLB 2IMMA 5E99H 5A16A 3FBKA 5I73B 2H1XA 4HFUL 2I5YH 3UP1A 4NENA 4EIZC 2LTQB 3OR7A 3I2CL 1SBSH 2ENPA 2EXWC 4XBGA 4TNVF 2AQQA 4W6YB 4KVCH 1KTRL 2FD6L 5TD4A 3ECWA 3DECA 1HOCA 2HXAA 1U8KA 1A6WL 1ZSHA 1ZVSA 2N0MA 4QRRE 4DUVA 1CO1A 3WJLA 3BD5A 2BZDA 4TUUA 1HT6A 2K3HA 4Y1AD 4YHLL 2WP3O 1H3UA 4XO3A 2XPGA 2DMBA 4ESKA 2WXLA 2ZCHL 5F93C 1XAUA 1MFAL 4YLBA 1M9SA 2R23A 1X4YA 4OCXH 5HJBA 2X3BA 1EJ8A 1H15A 3O4OB 3A4AA 2EICA 1TYJA 3D9AH 2ZOOA 4NWTH 4JO4H 3QDGA 2P5WD 4Q97A 2YMXH 1X9UA 3DOHA 3VD1A 1B6DA 1EEYB 3S36L 4OZGB 3GS7A 1RAMA 4WKXA 2O5YL 1MAJA 4OIFA 1HZHH 4EZJA 4WUUE 1NCWH 5DEFA 4PG2A 1MZZA 3FK3A 2WQVA 4F37F 1D5RA 1HQRA 4G1MA 1NEZB 1BBJA 4QRPD 3FT0A 5D6DC 5B8CC 5SWSE 5AWNH 2JSFA 4IDJL 1T6BX 4U1MB 5KJ7E 4P5KA 3DX2A 4IRZL 4JPKH 3I9AA 4UT6H 3LZNA 2ZOUA 3QUKA 3BRGC 1DBBL 1DQVA 1ZT1A 3HG1E 3O3EB 4ALAH 4PR5B 5D2LB 3QH3B 4QRTA 4E0RB 5ITBH 4HUVA 4PR5A 1FSKB 3SCMD 1FLTX 4AW7A 1I8LC 1JFQL 5LBSL 3SE3A 2V7NA 2HP4A 3G5XB 2HLFD 1Q0EA 1GPOH 4OQTL 2R8SL 1PZ2A 3TESA 1VERA 4RMUA 5I1EH 3WFBL 5JMRA 2NW3B 4GAGL 2ZICA 4OY9A 2I7SA 1MCRA 1BEYH 2IO5A 4XCYB 3UGXA 2ITDB 2XKNB 2E7LC 1JHTB 2GY7B 5F3HB 1SUHA 4MGXA 4IGBA 2PWFA 4Q6IA 5T1DH 2DYSB 4QT5A 3PDGA 4JZNB 3D39B 4J3SA 2EDRA 3O6FB 5IMKA 2HRGA 3UTPD 2VH5L 4CU8A 1DUZB 3CC5B 3EYOB 1XMEB 1RUML 1VRSA 4NX0A 5D71H 4N1CA 3EJZC 5IHLB 5CCKL 5AVUB 1WHPA 5FO8A 2WXPA 3QQ3A 2D3VA 2GT9A 2ZX7A 5CZKA 2IBGA 4HHWA 4K94H 4LCIL 3UC2A 2XZZA 2AAVA 1CL7L 1T7ZA 3OMIB 2G9HA 2CPUA 2PYED 4Z7QB 3MXVH 2VJ8A 1H6UA 2WYTA 3VM5A 2BX5A 5KBDA 4L8CB 4LSSL 5CIPH 3B3BA 4JDZA 3V4LA 3WE1A 2ICEA 1ZHKA 4JDZB 2P47B 1JI1A 3ZKXC 1A0QL 2K70A 3DDFA 4FQ2L 4GKNB 4M5TA 3VXOA 1LJMA 4XVSH 3VFGH 2VR7A 5GS2H 1B0RA 5KYXB 4PS7A 3H0TB 3ARXA 3MUY1 5D6CB 4DUXA 4Q2ZB 1KXVA 4OZGF 4TUJB 4E9LA 3UJIH 4G42A 1V55B 2AERT 5EORL 1PYWB 4Z0BH 4EF3A 2O26U 3A4FA 4LSTH 4X50A 4KZCA 2H3NA 5D7JD 4ODVL 2ESVE 4HUXB 4MJIE 4CILA 2FEJA 5IREA 3T6QC 4XBGB 4UQCA 2YD2A 1VFAA 1KB5A 4ZJ9A 4WWNA 3INUL 4BSWA 5EO1A 4WWID 5CEYA 1JBJA 2AK1L 5FEBA 3H7BA 4HLEA 2HAZA 3DX6A 3K2UL 4ZTPL 1MCCA 1XH0A 4KJYA 3VXNB 4HUNB 3UJTH 1MWAB 2C7UB 2W1NA 4OIBA 5DUPL 3LZFL 4R26H 1VEPA 4MXWH 1E4JA 4C4UA 2JKLA 1NWPA 5LCVA 3IWVA 3RHWK 1R5WB 4PRIB 5DGQA 4XXCA 4D2NA 3O6LH 5I26A 5BMFH 3EFFA 4N25A 3RL2A 5ILTH 4YDZA 3RL2B 3GF8A 4YSDA 1B3JA 1RLBA 4M1GL 4YN3A 4AGPA 3O81A 2QHRH 1MLCB 3TV8A 5I1LA 3NT0A 3VH8A 1RK7A 4XCEB 4I8DA 3GKZA 2WYIA 2VLKD 3EO1B 3KR3H 3NG5A 3NTCH 3QPQD 3TO4A 1BVZA 3MGOB 4AQEB 5KEZA 2E5EA 3RFZC 1TVBB 3QIUD 2HRPH 3L1OL 5AKRA 1BMZA 1UB5A 2FK9A 3IE4A 5D1ZA 1C5CH 4A39A 3KNBA 1E4HA 2MFNA 3DMMD 4JM2F 3VRJB 4YFEA 3OLGA 3CIAA 3PHSA 1SJEA 2XQBL 4WU7B 1E2VA 3QB7C 3SE6A 3NTCL 3FOMB 1OARL 4P57B 2NXZB 4NZDA 3M1OA 3S98A 4H5SA 2HTLD 4WHYG 3BVVA 2Z31D 3VXUD 2ZCKL 1QR4A 4FS0A 5JOPE 3CE1A 1JXKA 3CSBA 3E1F1 1LNUA 4QHNB 5ILTL 3LQAL 3EJJX 3NEXA 4HZ1A 2Q8AH 1KYDA 2XWBB 1KBGH 4BWUA 2NNFA 1AS8A 4C56D 3SE8L 5BMFL 5IEHB 1RU9L 2O6FA 1UYWL 2RA1A 3M17B 5JIHA 5CZRA 2HKFL 1X5IA 4PRIE 2HKHH 4WEUD 1KB9J 3VM7A 1ZDQA 1D6VH 5BUPA 2BCKB 5AUMA 2FE0A 1G5AA 1VSCA 3VG9B 2AK1H 2EXYC 2Q2EB 1WPCA 4L05A 4OI8A 1F3JB 4OLYL 1AR1D 1WA1X 4WV1B 1XGQA 2Y7LA 4AEHH 2EEFA 1IMHC 4N90E 5HDBE 1QWNA 1X5MA 3CVIH 3D0VB 4A6YL 4MJIB 5EH1A 3T65A 4R3SB 5D55A 3JVGA 3TTSA 5KWYC 2WLLA 2FJGB 1NBZA 4LQFH 1OW0A 4OB5H 4Q0XL 4K9EC 1UA3A 2AABH 1IM3D 2IEPA 2P24A 3QHTC 4I0CC 4HCGA 2O72A 2XG5B 4JCLA 5BRPA 4HS8L 2VN5A 4YDIL 2G0KA 4GQPH 1KTCA 2XA8L 3SKNA 1J5CA 1A25A 5E5RB 5FW8A 3EOTL 3T1FB 4OF6A 2IOIA 3VFGL 4IRSB 4AMXA 4CGTA 3ROOA 2DTML 4KKCD 4MCZA 1W2KT 1EEQA 4R2GD 4D8PB 2HCZX 4U3SA 3FB7B 1R0AH 4AW4A 4L4VE 1F1DA 2PCXA 3LKSB 4HUUA 4JY4B 2CJTA 1ZCRA 2DJMA 1DJGA 2F0CA 4M7ZB 3ULUL 4M93B 5D7SL 3GSQA 5I0XA 4X7CC 1HAUA 4TQEL 4DEUA 4XP1H 2AK4A 4G7VH 3EHBB 3LYRA 1KYOJ 4UQEA 4LP8A 1FNGB 5BW7A 3ZKQD 3VFSA 3SD2A 1OALA 2EE9A 2WBKA 4XN4A 5BVJB 4K73A 4NQEB 4OUUA 1P1VA 5BVJA 3FSOA 1R34A 2FH8A 1RUMH 5D71L 2O6CA 4EXPX 4FQLH 5KS9F 3BXNB 3WE6B 3US9A 4MA3A 2JKSA 1HOCB 4OIIH 4X7SH 2ADYA 1KDJA 3VGAB 1XCTB 3FFOA 3MR9A 3RIKA 1CQKA 3GXNA 2FR4B 4C56A 3DV4A 2OZ4L 5GS1B 4LVOC 2FR4A 1UH2A 2HFEA 2NXYD 3IS1X 5CP3H 3HTLX 1HDMA 2A73B 4P46B 1L9RA 2IDQA 2X4PA 2R23B 3MJ9L 4W68A 2VSMB 2DL9A 1HI6A 2EH7H 4B41A 3S7GA 5KBLA 4JO1H 5GGVY 1L9OA 1GVIA 3OWEA 1QSFB 3OX8B 3UBFA 5F70A 1GJWA 5LBSH 4ZTOH 5E2VL 4FCHA 4OR1A 4N4YB 1T22B 3FRPA 3CQPA 2Q2LA 3QHZH 1F3DH 5IEHA 1FVDA 2NR6C 3UTZB 5ITBL 1ZK9A 5T1JA 3ZTDC 5FHBL 1OGAB 4JX0A 2JJWA 5BZDA 1G7IA 4JPKL 4XAWL 4I4WA 2P46B 2B4CC 3HZKA 3LDBB 4GRLA 3BEVB 3OB0K 5LN4A 5K9OA 1G7HA 1JDCA 1TTUA 4ATWA 1B4LA 5SWSB 3WO4C 2FWOB 1RJLA 1T7WA 4WI3A 3GMNB 4Z3EA 2OL3A 4JEGB 3HKFA 4H7VA 4HW6A 5IBLC 5T3ZH 4JFFB 4YE4H 5IP4A 4X99A 4DVBA 2YZ8A 3QEUB 4EI5C 1E8YA 4NWTL 3E8VA 4QAWA 1RUPH 3BJLA 1PG7X 1RULL 5IQ7L 2AKRB 1JWMA 2ZQKA 3PJSA 3S37H 4WW2C 4FYRA 1DCLA 4RX4D 1VIWA 1JGEA 2BP0A 1HKLL 1DSYA 2XN9E 2HN7A 4JFWA 5J11C 2R0WL 1IBFA 3RKDD 4ETQA 3NIFB 2C1OB 3CFNA 1C1EH 1CLZH 1XQ4A 3EYQD 1C12B 1HL8A 1UT2A 2NMSA 3AY4C 3QCUL 4L1TA 2F1EA 3F12B 2PWEA 4YHZH 5JO5A 1LEKA 1MWAH 2A4ZA 3D25B 4L0PB 4CJ1A 5L0QC 3T6XA 4QXGH 1UXSA 2OJZH 4C83A 2EE2A 1W0WA 3QI9D 3P02A 1EFQA 3L6FB 5DFVC 1N64H 5FM4A 5L7XL 3AQDA 3KJ6H 4LIQL 5AYUH 4XNUL 5PAZA 4H20L 3U0TA 1S5HA 3QDME 1OSZB 2FTAA 3RP1A 4JRYA 3HE7A 4LLWB 5CILH 1S5IL 3N50A 4MCMA 5DUBB 4JHAH 4G8EA 4MA3B 2VISA 2B14A 2FHBA 4NNXA 2W94A 2F5AL 4P3DB 4YHOH 1KJMA 1R24A 5AW7B 2GI7A 5DEJA 1ZHBB 4HEPG 5DMKA 2UXVA 1A7OL 1BQLH 2EKSA 4UYQA 1I7ZB 4OFYD 3SGEH 2JJSA 4V33A 1HINL 3I9GL 3JV6A 4HOXA 5DS2A 1MQKL 2HRLA 3PIQA 1PLGH 5AYQA 2OAAA 3G08A 4PTUB 4Y5VC 2V37A 3GBNH 4FQHB 2DS4A 2YAPA 4JN1H 2M8XA 3RPIB 1A4CA 3RGVA 3M88A 3AUWB 1EGJL 4MMXB 5FYJL 3WUWG 2FSDA 4ELME 5I6XC 3H3PH 2AS5M 4NYLB 1XGQB 5IB5A 5KVEE 4O02B 4KMTL 5B1JA 4HLJA 5D7JA 4BDVA 1TSHA 5GJSH 1AMYA 5T1KB 3GI9L 4ZMXA 3X13A 3NYKA 2BVQA 4JVPA 4FOMA 3E8UL 3A4EA 2IV8A 2QSCH 4YX2L 4X80H 4KDTA 4W9ZA 1P84J 3QO1B 4LSRL 3D4GA 4E41B 2GJ6A 2N1KA 1WAAF 1Q94B 3MRNB 4TULH 3K80A 2VMFA 1HHIA 2NY0D 5DQ9B 2DWTA 3GINA 2PN5A 2YUZA 3ZTJH 3BUYB 1HILB 1PY4A 2IH1A 2VLRD 5HVHB 2XKNA 2ITDA 2OP4L 4KTDH 1DVFC 3ALWA 2ARJQ 3B2VL 3I6KA 4HIJA 4ZX3A 2ENYA 2ZAIA 3C08L 3ZMRA 1FVDB 2DM2A 3MRBB 4HHAB 4H88L 2FL5A 4L3AA 1A4JA 2BP5M 3BE1L 4QHKI 4G7YL 3VB8A 3GXUB 5DYOA 3VRLF 3SE4A 3F7YA 1Z66A 2VIRB 2BJML 1JJUA 5F72S 1JUFB 1NJ9B 2P5WA 3N9GH 1K5WA 3UTTE 2R29L 1ONQA 3OPZH 4GT7A 4LF3B 2FDBP 3J8F7 2AJVL 1G7LA 1SLXA 2X42A 3D2UB 3ARFA 5IWLC 1E7UA 1A6TB 1LO0L 1DJYA 2NYKA 1WCBB 2KC0A 3ES6A 4K94C 1NEZA 1E90A 4OT1H 4PJHB 4IGBD 4ENEC 3HC2A 4F27A 3EBHA 1XGYH 5CJOH 5I15L 4ZUWB 4P9MH 1ILUA 4M61A 2B4CL 3GKWH 2GBVA 2PXYC 1PZUB 1OIOA 2ZXAA 2P4AB 4OGZA 1J12A 4QHMB 4UT7H 4JK0D 3GZPA 4G71B 4JMXA 1S3KH 5FUOH 1FFNA 4GXVH 3VMNA 1DVFA 4AQ1B 5KYWA 3EF7A 1L3NA 3IJYB 5HI5C 3C5JA 1PJWA 3CZNA 3KWTA 3MO1A 4JFHD 1T03H 4H8WH 3GSVB 4JPIA 5AW5B 4TL5A 1IGTA 4JFFE 3GXTA 5AVXB 5D7JC 2ATPA 1MOEA 2B77A 4W4NA 2VSKB 4GO9A 4PW4A 1ORSA 4U7KA 4EKJA 1J8HD 2XZQL 4OBSA 2AC0A 1DFXA 3Q1EA 4AC2A 4N8PA 1EXUA 3U7WL 1H9DA 5ESQB 2I69A 1E5ZA 3FT3B 3FQNB 5AVTB 1JSYA 1WTLA 1FFOB 2LLNA 4GI8A 4J3TA 2J5LB 3DX4A 3A23A 5F0JB 1CLYH 4AYEC 1YECL 3LD8B 3QH3A 2FBJH 3FN3A 3TVMA 1XIWC 4QNPE 1J5OL 1ZJAA 1QR1A 4E0RA 3MCLH 4FFYH 1AKPA 2ZAGA 4PJDA 2X89D 3P4NA 3CMOL 4MAYA 4G6AC 5I1AA 5KVGL 4OBRA 1JZFA 1SJHA 3BT2L 2YPLB 3ZU8A 3FF8A 4PRNB 1BAWA 2BNQD 3B2XA 2ZX6A 2WZPD 4JGJA 1OT4A 1I1AA 3R0MA 1KY6A 1S6NA 3KM2A 5F88B 2BLFA 5DD0H 1FC1A 3MV9B 1BBDH 1V3JA 5FUZH 2RALA 2XWEA 4UDUB 3N43F 3WDHA 3DA0A 3SE9H 3BWAA 2NYYD 3KWWA 3MRIA 1KTDA 2WCSA 4XPTH 4KXZH 1CPUA 5J7CC 2FX9H 2N4IA 1UGKA 2QPDB 3TH3T 1QFHA 1ZLEA 2MTAA 1P0SE 4QO1B 4YXLH 4CN1A 3VDAA 4Q58C 2DWEB 4GINA 2NXYB 1E5BA 4PJ5A 4LKCA 2E9GA 3QQ3B 1AJ7L 1F1GA 5T1LB 2XG4A 4HPYH 2D03L 5BOJA 4WO4B 1ETJA 1QLEL 1WBYB 4OD2B 4EN3B 4U3XA 1R1CA 1NMBH 1UADC 2QADB 2K4AA 4NXKA 3QUHA 4XCFL 2JI3A 3GBEA 2OYPA 5H35B 5HHQB 3DURA 4F9LC 4N6RA 1X4XA 2XPZA 1YEJH 4X5WB 4AUYA 1YYLH 4R0LC 2G9KA 3GSNL 3HNVL 1XSJA 2ZKHH 4KK6C 3TFBA 2G4GA 2WTRB 3KLAA 3EOAA 5J9PA 2Z8RA 1QATA 5IJVA 4AZ8B 2DICA 1RCYA 1L0QA 3FYEB 1NDMA 1EAPB 4UQ2B 3IF1A 4J5VA 4J4PD 4NAJA 2X4RA 5F1KC 1UT1A 1KSRA 5JQIB 4B27A 4K15A 2P80D 1T04B 1I8KB 3B8YA 4JPIB 1IKFL 4PTTA 5DJ2A 3QWRD 4M43L 2ITFA 5BVPH 4NO0B 4JFHE 4YSQA 3DBSA 4FCAA 5FA4B 3UG5A 4KJPC 2VL5A 1MCOH 5EUKA 5FA4A 5F9WC 4I18B 1GAFL 4M4RB 1YNTB 3KPSA 1RD6A 2DM4A 5E6IA 4IM8A 1MIML 3HRZC 4OLXL 3WLBB 1KXTB 1QFUL 2R29A 1YQVH 5LCVL 2R1YA 2G5UA 1O6SA 2IQ9H 3IJ7A 1BZOA 1SMAA 4LEOB 3ULVC 4TLUA 2B1AH 4RWHA 4B53A 3FU6A 2XN1A 1UJ3A 3IFPA 4N5EC 1NKRA 1T1ZB 4HWZB 2QKIC 4OV5A 1MCPH 1Z9SA 2CR6A 2ZTBA 3N0PB 4JVUA 2JCWA 1IGJB 4JFYA 4FFWC 4GFTB 5LDSA 3QZNA 3H8NA 3B9AA 3MO1B 1MDAA 2X9XA 3UEQA 5HPOA 4P23B 4JBSA 2CHNA 3MCG1 3DX0A 5EIIG 1L5GA 1N5YH 3MX0A 2VM9A 3D8MA 4L3CB 2FL5B 3J27A 4FZEL 5CLZA 2N1TE 1GGIL 1AZCA 4JQIH 3SDAB 3KWWB 43CAB 3TC9A 5JHAA 2C9AA 1YNLH 5C0GB 2NY6C 4KJQC 4LFHD 2EC8A 5EO9A 5AB0A 1CN4A 4MWFB 2VUOA 3GSWA 3T0EC 2C4FT 5K59E 1WK0A 3GRBA 5L4MA 4NJAL 4HAKA 4Q7DA 4GIAA 4DCQB 4G8GD 3LMJL 4YPJA 1L9QA 2EDYA 3HJEA 4IBTA 4P3CH 3B7UX 1P4BL 2KKQA 1F2QA 3V4VA 5DYFA 5ECJE 1SOXA 4OUOA 4PB0H 4Q6KA 5GZNC 2F15A 2Y2TA 2K6WA 4DZ8B 4DETA 4H8VA 4W93A 2H0JA 3GLEA 3SKNB 2PABA 2DWSA 4QRPB 2YMTA 3WKMH 2AEPH 3L3OA 4PGCB 1A8JH 1FG2A 2EP6A 3DOIA 1BF5A 1OE1A 1B2WL 2O61B 3BWSA 1HESA 4OCMC 3NFSL 4R4NC 4F7EA 35C8L 2EADA 1V3KA 1M71A 2LU7A 3STLA 2CH8A 1U8MB 3SBWA 3LX9A 5FW6A 1MHPH 2GVYA 2WGXA 1RZFH 5FYKL 4NFDA 3D05A 2YQBA 1ES0A 3T6WA 4FRWA 1G7JA 1F6AB 1UT9A 1A7PH 1T0PB 1ULVA 2ESVB 1H0DB 2IH3A 4PJCB 4ZO6A 3N06B 5IBLD 4Z7VA 1HZLA 4B9GA 1W72L 2X1OA 3G5WA 3WHXA 4D9QD 3FH5A 4XBPB 5INCA 1IGCL 3P0VH 1XGTA 4NDMA 1PY9A 1BOYA 2H32A 2OSXA 1UUSA 2VLRB 2CBPA 2WQWA 5D1QB 4HOZA 4K7PH 1DVTA 2CRYA 4P3DA 1ZA6B 5DD1L 4Y4FD 1MW3A 4OJAA 3VI4E 3WS3A 3DSNA 5CBAA 1EO5A 3TEXA 4BFIB 3ARBB 4RLDA 4ZUVA 3NP3A 3QORA 1PG7H 4DHLA 4ZUVB 2WTOA 5K9JL 4LL9A 4H1LG 1KCBA 2YKLL 4G9DA 1SLUA 2P5ED 3C60B 3SKJH 4R4BB 2V5TA 5FK9A 5KBPA 3MV11 1BM7A 1QEWA 3PJLA 5CXPA 1JTTA 5LXGH 1G5GA 1N0LB 1Q9WA 5A2AA 2ORBH 3B6SB 2F2HA 3QWOA 4EUPG 3MKGA 2VXTL 3D2UD 3NCMA 4LMQI 2WOBA 3QWOB 3SGDI 4R4FL 3DGGB 3U6RB 1FIGL 5EBWB 1U41A 1ETB1 5I1KL 2KLTA 3MRFA 4Z7UE 4Z18A 3CX2A 4NRZB 3THML 4Y9BA 2DQJH 4KKLD 1XCTA 1NAMH 1WUZA 4PJ5B 2YAHA 2FIKA 3V4UH 4Y16D 4EEEA 1U8LA 3WL9B 5F97E 1AG6A 1XB3A 4P2QA 4QF1B 2LLGA 1TJHH 2G3NA 1DBKL 3BWUF 4B9FA 1CZ8L 1T21A 3KCWA 3VXSE 2HTLC 1FP5A 3QDAA 5B1JC 4NKMA 1F6LL 3ZKMC 4QXUL 3BUTA 4FMKA 4FXGA 5DK0A 4LZKA 5B7MA 2DQUH 4JO2H 1J1OH 4KTYA 4JHVA 4OJFH 3U9PL 4LLUB 2E27L 3KDMB 2WZAA 2Z92B 1JYNA 3TT1H 1KOAA 2CO2A 5LN8A 1RY7B 3O45A 5EG6C 5LNEA 3S48A 4BHUA 3ZZ1A 1OLLA 2FBRA 3WFCH 4ZSOE 1OZUA 4J27A 5HHPB 5J12C 3ZE0F 5DVOA 1QRND 3F7LA 3LNDA 2A4CA 3HC4L 5CZXC 5GGSB 2CGRL 3BSZL 3RILA 3KNBB 3K6FA 1JYVA 2HTKC 1S7XB 5DHVA 1Q72H 2UVEA 4WUUB 3Q3GA 4NKIH 1T3FA 3TBTB 4NHUB 4NT6A 1J8SA 3IRCA 1VZHA 5BZWB 1ZE3H 1QHOA 5EU6E 1EH9A 1VADA 1XR9B 1T0OA 2FUQA 1MW2A 2AV7A 4AGNA 4EKXA 2MCPH 5LLIC 3ARUA 2BHYA 2AJZA 4U3HA 5T1KD 2AQSA 4KY1L 3C5ZA 5T8IA 1P84K 4DEPC 2F53A 4PV9B 5KS9B 1ZTMA 4FQXD 1G1CA 1IEBB 4ECNA 2EC9U 3V6ZA 1U92A 1MLBA 1PKQB 4P5TA 5JA8B 2CG9X 1MPAL 2YRBA 1YEFH 3Q8BA 5KVDL 4YFLI 1B88A 1LK3H 2APSA 2XWJB 2VXSL 4HKJB 5CMAB 4BYHA 1WA0X 1UA6H 4AQ1A 1CG9A 1NCHA 1Z3GH 5KYWB 2NY0B 4TSCH 3ZXAC 3M46A 3TH4T 1GMEA 2W38A 3CPLA 4CBZA 3GS0A 2EDNA 3TNMB 1CVRA 2YD9A 3CDGB 5C0BB 3U79A 2VRAA 1NCDL 4J6RH 4P5SA 3QUXC 5T1LD 1IARB 2XZAL 1MFEH 2VDMH 4Z7VB 1ZT4B 3FTVA 1K8IB 3K0WA 3T3MB 4B9ZA 3ZUNC 1CDHA 1K6QL 2UXTA 4Q6YA 4WGKA 2W60B 1BW8A 3AROA 2NX5B 5G5DB 1NDGB 4XPBH 4WSGA 3QA3A 2NX5A 5CLXA 3RVVC 3UYRH 3VQ2C 4EXKA 4LRNH 4XN5A 1WIPA 4QTHA 3FZUC 1AE6H 4FLRA 4UV7H 5I1DA 3VA6A 5JPNC 4FE9A 5EMYA 4YDNA 3V4VB 2XCMC 1ZTXL 1XWVA 3OAZK 2B2XL 1CICD 3DSNB 2VNCA 5IQ9A 2DLHA 1GR7A 3BH8B 1CGSL 3HPLA 4BZ1L 3HR5A 3DX1A 2K1MA 3NPZB 5EF1A 3ZRSA 3WUWA 5J9PB 3VXTA 3EDKA 2H6PB 4GG6F 5TE6L 4ONFL 4MJID 3VGEA 4A6YB 3RWHA 3T0VA 1UTDA 4I3GA 2PO6C 1QLFB 2ADIA 2NY2D 4CU6A 2JK5A 2AEQH 3TWCH 1JF5A 4ZMVA 1UWXH 2PTTA 1QRNE 3BPCB 3FU3A 3QQDA 4XC3L 3IAQA 1WWAX 5C6TH 3V10A 4EIGB 3ZDZE 1AOHA 1CFNB 1OAXH 4JGUA 4WTZG 3MLTB 2IXQA 4FMFA 3HB3B 3IDXL 1SRDA 4EZLA 3QWRA 4Z9KB 4RMWA 3HE6A 3QUMH 4Y2DB 2OI9C 5HYJA 5C08A 4N2CA 5TQ0H 4OGYL 3X13B 1WFNA 4OZIA 5JYLA 2AXWA 2VXQH 3MNZA 2OM5A 1E4KA 1AHWB 4HFWA 3EHBD 3Q2LA 2Y06H 4X9BA 2GG1A 4G9FA 4HIPA 3S5LB 1BVNT 3L2NA 4YO0B 1P7BA 2ED9A 4GW1A 3OMZA 5AZUA 3RYMA 2CO4A 4WU5A 3CXFA 3RKPA 4BFIA 1MCKA 1NGZB 4HWNA 3MJGX 2A83A 3EGDB 2BMKB 3WIHH 3DROB 4I9WD 4XZUA 4LLUA 2WY3B 4ZS7H 1JGUL 2QZ5A 3TASA 5E8NB 5F0MB 2AK4D 4BQ6A 3T1WA 2E6QA 1KIUB 4A7SA 1WBZB 3GMRB 3G6AB 1YMMD 4ZODA 2FYYB 4I48A 3UAJA 1JK8B 3PGCB 3ALPA 4A7UA 5B39G 2AP2A 1XO8A 2WXQA 3MV9D 1ACZA 1CK0L 3PABB 4HPHA 3ZDYF 5C70A 2XY2A 5GS0H 2XYBA 3IDJA 2UWEE 3UO1L 2Y2YA 2EZ0D 3LOWA 4APQC 4PJCA 4RWYH 1KXQA 4NN5B 5HHMB 1XF4B 3QEGL 1JGLH 4HMEA 2IPTL 3MRLB 5ESAA 1FRGL 1MCSA 3DK2A 3UPRB 3KYKL 2XFXB 3SD5A 1OAYH 5E0FA 2BZCA 4JMNA 4PY8I 4G80A 1YEKL 4JZJA 2OMTB 1JV2A 3HG1D 4Q9QL 3DPBA 2CAKA 1TMQA 5J6HB 1YEWA 1J1XL 1MCWW 3TVMB 3QXWA 2A2QT 2Y1VA 3P4MA 3L9BA 4A66A 4HUXA 5HVFB 4PWEA 1FFPA 5C0DB 1EEUA 2WXNA 3WAJA 4H0LC 4HUUB 3EJYC 2E59A 1MDTA 2EDMA 2YPVA 1QUPA 3NIDE 3N42B 2A6IA 3II3A 5EWIH 2X6UA 4HIEA 4M3JA 3S0PA 2CKNA 4HJGA 1M6OA 1F5WA 2J1XA 4HC1A 1IO4C 2J1KA 1VGKA 4PW9A 1N2RB 1JF1A 5TE7L 5IMOA 4X9HA 4LHUB 3GK8L 2E7DA 4LLWA 5ID0A 5IM7A 2O5XH 4I3SH 2Z31A 3UG4A 3UTTD 1IAIL 1S5HB 1TTGA 3JYBA 5H37A 1R3IL 3EDFA 2XTJE 1ZE3C 2H32B 2YD8A 1MCIA 4X4XA 2XWRA 3VXUB 2ZNWA 1OP3H 1ET8A 4D7BA 1DN0A 1KIPA 2QGBA 5IMMA 4ZUUB 3ULVD 1KTLB 8FABB 5ESVB 4F80A 3GIVB 5AG8A 4N2GA 4YSUA 2FJUB 4QMEA 4RRPA 4E68A 5D1XC 2Z7UA 3BP6A 1CFSB 2V6HA 1QABA 2MNJB 4O51B 1NPUA 4FFWD 4G9FB 1H9VA 3SZKC 5DR5L 4CADB 1MVYA 4FFTA 2Q7YA 3IJEB 1I1YB 4D7PA 3MLPA 3DXAD 2JB6B 1CFQA 2J2ZB 4KTGA 5CD3A 2A3TA 4JG1L 3RU8L 3UJJH 3CVHA 3MLVL 4XI5C 1PKQE 4LOEA 2J4WH 5DFAA 1QFWI 5F7DB 5ICUA 5SV3A 4X4KA 3FYIB 1KB5L 1P7KB 5JOPD 2FHFA 3FFDA 3GUFA 1FN4B 3QXUA 3CMGA 2CJSA 3FPYA 3N44B 2YQ3A 15C8L 2YD1A 1MW0A 4U1HB 3WU1A 5SWSA 3SDAD 1P7QA 5AQ0A 5HYSB 2WCGA 4M8QB 4DKEH 2ZX5A 1KBVA 4N0CC 3FCTA 3L81A 4N9OB 4JGNA 4Z78B 1RK1A 4X9YA 1PPIA 4JAMA 2BOCB 4TUKH 5D1QA 3UTSD 3FDWA 3VI3A 3DVIA 4MTMA 3MBEC 1L7TH 4OW6A 5DLMH 1E4XL 2VUKA 3GMOA 1AXSA 3BP5B 4ETQB 3GMOB 2XTJD 1UXMA 4LNRA 4NUMA 4OF5A 4ZSOB 1DDHA 5LWYL 3VH8B 3SQRA 3SN6N 4JR9H 5E1GA 4XZUB 3IJSB 2XXFA 1ADWA 2L8AA 4O2CA 4XNMB 3ZRCC 2CIIA 2PO6A 1SY6H 1KIRA 4HHAA 2IGFL 3LB6C 1X5LA 1UASA 4LEXL 5I8OL 3CBJB 4M6ML 4KUCF 5BRZE 5HI4C 2VZ3A 2VWEE 1N4XL 3QJUB 4I13B 1D5BB 2DQTL 4F9PA 3GSXB 3G5VB 4XX1G 5AOMA 3EGXA 4WZ9A 3OAYH 1NJ9A 1EQWA 4OZFG 5IT2H 1UWEL 3FB6A 1BJ1H 1KCUL 1W8OA 3JZ7A 5JQ6L 4QRUB 5BXFA 2X2HA 3G6DL 4Y2DA 1JPSH 5DUML 4M4RA 3DSFH 4UIKH 1PNDA 3T4AB 4BXVA 1SXSA 4TQIA 1WWCA 1ZVSB 2ZT9C 4AEIL 4OF3A 3Q2VA 1XIWD 4Z7UB 4GS7C 1JAEA 1Z7JA 2AEWA 4G5ZH 4M61B 4N28A 3IMSA 3QUYC 4LARL 1ZJBA 1MLBB 2G2NA 1R3HA 1T2QL 2VMCA 3ZE0B 1T5WB 3ETSA 4PWFA 4Y9CA 1PF3A 4YSOA 2X4OA 4G3YL 5F1NB 1RERA 1JVKA 4U6XB 2ADFL 3N91A 5CR1A 4N0UA 1A14L 3EYOA 2CGYA 3DXAA 1HQ4A 1WT5C 4XPFH 1QA9A 2DLIA 1EZLA 3UYOD 4IBWA 4NHCL 2V4LA 3LEYH 1FH5H 1GGYA 1I3VA 2FHCA 3IDNB 1CFQB 4NCDA 5AENA 2KS0A 2F54A 1J8KA 4Q9BA 3ABZA 5DJYA 1HQRB 1H6EA 5I1HL 3N1QC 4XC1L 2IADB 4ZNEE 2GT9B 4QRBA 3F85A 2O1AA 4R84A 2I60L 3N41F 4HK3N 4Y16C 1NPNA 4BKLB 2V8LA 1A7QL 4N20A 1IBGH 3L9EA 4P46D 4ZMLA 2EUWA 3L95A 5EU6A 5I5IA 4PJXB 1HAWA 3LNGA 4G8IA 4PJ7A 4TQHA 2D3JA 1UZ6F 3CSPA 5D70H 3QIBA 2G0LA 3TBVA 4F2ME 4ZW8A 5EOCL 4AVKA 5I0VA 1FHNA 2R1XB 1M7DB 4XN8A 4KZ0A 2JKJA 1MHEA 2BC4A 4FQQA 4RGOH 2ZNXA 1EPFA 4KHTL 2R2HA 4RIRB 2ARJA 1VKXA 3MLSL 2OL3B 2O6PA 2WBJC 3FTGB 4PLJC 2AEIT 3PGDA 3QJFA 3QI9B 5D5MB 5HGDA 2EYRB 3MRHA 5DJXA 4XNQB 2IALA 1GZQA 4HZLA 1LMKA 1INDL 1UM4H 2L7QA 3TO2A 4WEMB 4EOWH 4JY6B 3ZIMA 2DYPA 4J8QA 2P48B 1IBYA 4R0LA 5DJDA 3IYLW 1GOGA 2GFBA 2BSBA 3MUZ1 4KZEH 4HUCA 3KBPA 4S11A 3HBPA 3SKOB 1SJXA 2FATH 2APVA 2ROYA 3HG4A 3SKOA 1CDUA 3ARYA 3MV8D 1JWUA 3I6LD 4K4KA 1IBGL 2HLEB 3IDIA 4P5RA 4ZW7A 1AFVH 2EUZA 5KVFH 1FYHB 1BZ8A 4WUUD 2WANA 1RV6X 4F3FB 2CK0H 4JANA 3CIQA 4OFIA 2P5WE 5D8JL 2HN7B 5F96L 4K5OA 4XVJL 3P4MB 3ECUA 3HBQA 4G6JL 4GH7B 4G8EB 4RAVB 4JRXB 3IJYA 4FMVA 2X4UA 1ED3B 4MXVE 3RY5A 1MWOA 5J6GB 4JB9L 1BQRA 1Y18A 3EO9L 3QORC 2CK2A 1T2JA 1EZVY 2RGSA 1C9SA 4HVBA 2UY7A 1FE8H 4P9HH 1IL1B 1FJ1A 1W0WB 2Y7MA 5LVEA 4HBCL 3DI3B 1CGTA 2CIKB 4AYDC 1LWRA 1ZIBA 4BA0A 3VGHA 4UZUA 3QK0A 4GSRA 4F15B 4TLKA 1LDPL 3VI3E 2OZ4A 1PW3A 4TPRL 1JCKA 1JPSL 2JQMA 3U4BL 3A67L 5AB9A 5KAQG 2LTQC 5JQ6H 1NMAH 1CICC 4GI9A 2V17L 1OY3B 1JZ3A 4GIPD 4YQXH 3LKQA 4PVBA 5C71A 3WUWB 2BVPA 2VN4A 4EJ1C 3FT1A 3VDCA 4X6BB 3V6BR 3CDZA 2RQ8A 1JK9B 1YEDA 5EEZA 4M1CD 4UINH 4ZDHB 3WXVL 1LEGB 3B9KD 4KI5D 2JXMB 2KZBA 3D12B 3NCYP 5AFAA 3MOAL 4H0IA 4HKXB 2BIHA 2XZCH 4JCMA 3P11H 5IEKA 4MS6A 4FJYA 1S7SA 2MTPA 1XSIA 4P2OC 3FHQA 1KENH 1U2YA 2Y5QA 4R83A 1V7NH 1OF2B 2Y9RT 3EYFB 1YAZA 2F5BL 5IBTH 5BZZA 4XNQA 5CHNB 3IDGB 5F9JA 4N2KA 4S10A 1DQDH 4POZD 1WRFA 2Z6FA 3TS8A 4TUKL 1L0PA 3KLQA 2Z35A 1DLFL 3BSHA 5J8OA 1TVDA 2NY4B 1OAQL 2LV4A 4HDIB 3E3QC 2CWRA 5JOFB 5DMIL 5DMJB 4YHML 2MRYA 4WEBH 3NJXA 3DOSB 3RTQD 4DPCX 3L3HB 3CSYA 1QFWM 1XXDC 2BVUA 2NXZD 1XGRA 1CGUA 2DQCH 1GRWA 4L1BA 1HH9B 1U3ZA 1D6EB 3G9AB 5HTSA 5IOPA 3NDZE 1F42A 4UM9A 1HH6A 3VDBA 3P4LA 4NZTH 2MSPA 3BUIA 4H8WC 1NCGA 2W91A 2X4OB 2WKGA 3MU3A 4K9EL 1P4IH 5HYEA 1THAA 3NSFA 1KEGH 4MHHI 3DETC 1YYML 3BPOB 3UG3A 2QKIA 4FQXA 5FYKD 1DEEB 4KZDH 1ZT1B 1KG0B 4LOUC 3U0WL 5E8PA 1NINA 1P5VB 2PTVA 4MD5A 4YHKH 2YPLE 4K2UL 2EZ0C 1THCA 5D4IA 1YN6A 2ZG1A 5C07A 1UJTA 1HCFX 4MJIA 2GSGA 4WW1A 1DVUA 5DJ2B 1RUKL 3HKZA 1BD2E 3LRKA 5GRYA 4TVPH 2PPEA 4PJAA 4NIKB 4WFED 4IIQC 3I3BA 1CICA 3MRNA 2YZ1A 3KVDD 2DQMA 2APWA 4BSVB 3OKEB 4ONHA 4XNAA 1IAIH 2P3YA 2C3HA 4JDVB 1U93A 4MMZB 5IIEB 3BSZA 2Q7AA 5HDOA 3SZ6A 3KBHE 3M1BB 4IRSD 2W95A 1NAKH 4NQXA 5KSBA 5I1GL 1DJSA 3AS0A 3UADA 2IDUA 3ZKMD 2ENJA 2XUWA 5HY9B 1QQDB 4R90L 3UZEA 1HEHC 3NIDB 1FLRL 3BVDB 4AZUA 1JRHH 4XXDA 2HMID 4GW5A 1LO2L 4YDLB 2WSDA 3FN0H 4KKNA 3WMSA 1OP5K 2VQTA 4HLZH 1CYGA 1ORQA 4WFFE 3QJOA 1FNSH 2W9DH 1ZT7B 2J43A 1ORQB 1YEGL 3QNYB 2R0ZL 1MQ8A 1O9ZA 1ZV2A 2G75B 2XRAL 2J57A 3DLQR 4WY7L 2EDLA 3M8OH 3RZCC 2KDGA 3V5HA 1LO3L 1P9MC 1DN0B 2R0KL 3S5YA 2LT9A 3GSWB 3MRQA 2WP3T 4PJHE 2R69A 5DT1H 3TBWA 3QFJD 1X5AA 3C5ZD 4JUSA 5HHME 2B1OA 5DA4A 3O3BB 1WFIA 4TRPL 4LPXA 1CXLA 4NPYB 5E8OA 5ENWB 4QT5B 2YRPA 3ML8A 1ZD6A 2DQHL 3GMLA 1I3RB 3QQ4A 2B0SH 4NM4L 5DRWA 3RL1B 5IHUH 1CK0H 1PD6A 3GDCA 4ZUSA 3LZOA 4F24A 3V7MA 4GXUN 4K3JH 4NNYB 3EJSA 3TYGH 5KSVA 5DMYA 4G42B 5ITFB 1TT6A 4Z0XB 2WTRA 1NLDH 2A4EA 1KNOA 3GTNA 5CLYA 4XNMA 2SODB 1BVLA 4LSVL 2ZUTA 3FFDB 1JNHA 1KTKE 1NLBL 4F2EA 5KN5B 1TVBA 1NEZG 2FECI 2VW7A 1MHCA 3LNHA 3O2DL 2QMJA 3F12A 5GGQL 1J0JA 3DUSB 5IBUB 4D0DA 1A21A 1G9NH 1EWHA 4Y1TA 3AC0A 2KUTA 5EN3A 4FZ8H 4UU9A 3IGAB 5C0EA 4G59C 3K8KA 4QGYA 2HT4C 5EU4B 2YPVH 5DJDB 1T1WA 2QEJA 5FUCC 3FCTB 5EC1A 3GI8H 3KPLB 2YSSB 4HK0A 2XWTA 3T9WA 2A99A 4O58L 4PWIA 3QHFL 3P2BA 3T2NH 1ZS8B 4OZFB 4K7FB 1PGRB 4YVUA 5IB1A 1OANA 4HS6A 1CFVL 3QARA 1G9ML 4Y4HA 1MHEB 2BC4B 4YAQB 3ZOAA 2HJFA 3RVXD 3ZDZB 1TQCB 4LLMA 1HHJB 1DVZA 2VR6A 5GJTH 1KFAL 4L1HA 3MYJA 4NRYA 1EUUA 4RZCA 5F1OB 4YJZL 5C6TL 3CFUA 4AVJA 1BVOA 2BIPA 1E4WH 3KPRE 5HYSG 4JL1A 1UQSA 4PLKD 5T5FA 2BXZA 5MEPA 2JTYA 2AXGA 2G2RA 3QFGA 4ZPTB 3G5VA 4Z3IA 2P9RA 3HMXA 1NCCL 5KZCD 5IEKB 3AREC 4MNGE 5CU5A 4TUJA 4M03A 3FSVA 2HG0A 3NH7L 3QE5A 4HIHA 4OZ4B 4AYBA 2B2XH 4XP5H 5HHOE 4TNWF 2E9JA 2NQCA 4U7MA 1OAZH 2ZE0A 3VG0H 4RAHA 4PD4K 3NJGA 4NKOA 4W1TA 4KO7A 4E9YA 4ZOEA 1XTMA 2NX5E 3VQLA 2VDLL 4KMLB 1EAOA 3ZDXE 1KDIA 1QKZL 4RGNE 1BJ8A 3QDMB 2KLSA 3O3DB 3T3ME 1G6RB 4XAKE 4D9RE 4P5MA 4Z95L 4XE0A 3VX0A 5EHFA 2OXHB 5ABZA 4JRXD 1NC4B 3G7TA 1NCBH 2CPCA 1INEH 1L7IL 2D31A 3QZLA 5IHWA 2R83A 4MQTB 1J9SA 4ETYA 1AS6A 3ZTJG 4HP5A 3PY9A 1F4WH 3KYMB 5ADPH 1AO7B 5E03A 3V6OA 3QPXH 4X8GA 1FNGA 3K6SB 3QR1A 3CVHB 4KITB 1WEJH 4BFRA 5IK3A 3AJ7A 3BUDA 4PJ9D 2VB5A 2G60H 3JXAA 1MHHA 2HWZL 2XN9B 3SODB 3QCTH 4EI6A 4JFOA 5IB5B 4JQXC 3ULUE 4TOYL 3WN5B 1YHPA 4G1MB 1WCBA 2MCPL 3OF6D 3L95B 5EU6B 3UP6A 4DVRH 3INOA 4APQD 1NC2A 1UZ6E 1Z9OA 4XMUA 5CN1A 2H0FA 4GSDL 1CIUA 1SBBA 1GC1H 2CO6A 4WQOA 2UZPA 3IDIB 4G8FB 1ZMYA 4MD4B 3VGAC 3EO0A 3BSZH 2W65A 1QX1A 3ASOB 3ZO0A 2AGJL 1SYSA 3X11A 4ODUA 1TJIH 5HGGS 4KXCA 3WFCL 1DDHB 2Q0ZX 4K71C 4MAUL 3FUEA 4XCCL 4Z76B 2K9UA 3NA9H 2WIMA 4NRYB 4RZCB 3I6KB 4CKVX 4QRSB 1PD1A 4RMRA 5EZPA 1B4TA 2E27H 3IFPB 3VUAA 2QGDA 2WKLA 3T2PA 4JZOA 2JI2A 3F83A 4OM1L 3EJQA 3O2DA 5MEPB 1QSFE 5LGHH 5KYNA 3MTRA 3NUKA 1QSFD 2A9ML 3FQXA 4CW1A 3I02B 1UM6L 4X7DC 3BKJL 4QXUH 4ATTA 1RP9A 3GHBH 3VXSB 3MV7E 1BOGB 5D7IA 2J44A 4IJ3B 2F7QA 1DBKH 2BSTA 1K8IA 4YDMA 3EUUA 4Y4FB 1P5UC 2XQYA 2IFFL 5F6HI 5BXFB 3VX1A 3L3HA 4PJ5E 4U1NB 3DIVA 5JDSB 1HL4A 1NWOA 3Q2CA 5A2KH 3MBWA 5LAXB 4X98A 3T09A 3CVCA 4BE6A 3DX7A 1QEWB 3N0AA 3NFPB 5FDWA 5KSAC 2FO1A 3BMWA 3LRGA 1P5UA 1I1AB 3MLWH 1ZLSL 4WNJA 3VI3F 4NUGL 1AQDA 2Z4QB 5KUKA 2HLFC 3MGTB 4UTBA 1KGXA 4NQEE 5ICZB 1AHMA 3Q43A 4QEGA 5D1ZC 4IU3B 2QVTA 1ANUA 3P4NB 1J05A 5CBAB 3D0LB 1Y6KR 4MHHG 3A22A 3X12A 5A6IA 4NQDB 4DJMA 2G2RB 3ZL4L 4BFBD 1MW1A 1UH3A 1MEXL 4FTVB 2YKLH 1BD2A 4CDGC 2P80A 2YHGA 3NGBB 1NFDA 1USQA 1RZGA 2E7HA 4XR8C 1B9ZA 4L4VB 2WZPA 3W9EB 3UIZA 1TTFA 2WUCL 5EZIL 5HYQA 3MI6A 1H3TA 4TUOA 1R5VB 1KJ2L 3SO5A 1NFIA 3OGCA 3WNMA 5DD1H 4CSTA 1AQ8A 5D1QE 2FSEA 2VLRE 4K7PL 4PRPA 5I82A 4PUBL 1OM3L 5DZAA 3TFKD 4AMWA 2X09A 3RB5A 5JR1H 4NO3B 4PY7A 5DURB 4DGUA 1A9VA 2BSRB 32C2B 2YSSA 5ACLA 2C5DC 2OJ1A 3PHAA 3FL7A 4JE0A 4KJYB 4PJCE 1RIHL 1RZIA 4JJOA 2DM3A 1H8SA 1AD0B 2HUHA 5C92A 5DI8B 2AV1A 4APQA 4KMQA 5HDBB 4Q9RL 1QEXA 2TRYA 3NN8A 5ACZB 5I19H 4WSJA 4ELMF 1WIUA 1MHPL 3NN8B 4ZOCA 4HCRH 4A67A 5ACZA 1AGCA 1N8ZA 4GBXA 2JB5H 2OLDA 4M5YL 4CMHB 4Z7IA 5E2UH 2IWGA 4FXGB 5DK0B 1C08B 4WUUA 3RWEA 2UX7A 3S4SG 1GGCH 4FXKB 1T66C 5IFJA 5SWZE 2UZXA 3MJWA 1BPLB 4QRPE 4GKSB 1OVZA 3TCLA 1MFCL 3DGDA 1FNAA 3N1MC 3FUIA 3S34L 5I8EA 1WBXA 1AQKH 5AZ2L 3RZCA 3C5ZB 4DN4H 4GQZA 4MKMA 3LNEA 5ABAA 5D9SA 5FKPA 4MMXC 4WW1B 1FZKB 2DYPD 3Q1SH 5TE4L 5I6XB 2ZUQC 4LXFA 1EHKB 3U46A 2X0WA 1IQWL 4HHGA 3QG6A 3H54A 3D4ZA 3D51A 4HJ1A 4NJAH 4TN9A 2Y7NA 4YBQC 4MAYC 3CD4A 2ZUVA 2WVVA 3CZKA 4P4RA 4PWJA 2V5SA 3SE4C 4F7TA 1A2YB 3IGKA 4BWTA 1YC7A 1YNLL 4P2QB 1ZK5A 1NMCB 3T77B 1MXGA 1A6VL 3L4VA 2F8IA 2VZVA 3N43B 1GW6A 3SEPA 1IJNA 5FO7B 5TQ2H 2D3LA 3FQTA 4TVUA 1YUHB 3SJVE 2YXVA 2XA3A 1LL1A 1SLWA 1PX3A 1XR8B 5C9KA 2G30A 4Z7NB 1MXDA 4HXAL 3FO2B 3OD3A 5FCUL 9CGTA 3KLHD 4Q4EA 5AW9B 2J12B 1UOKA 3BUQA 3RUGE 1TZGH 4L9DA 2OMYA 3ZGIA 3D39D 4PJXF 4S1DD 2IQ9L 1AY1H 2MH4A 3KD4A 2YN5A 1W0VA 4FNTA 2WO2B 5F21B 3GLDA 3E9TA 4PJFA 3FCGA 5DQ9A 2EVGA 2J8UE 3B37A 3L4XA 5FS5A 1ZV9A 4RH4A 1PJ9A 1OZTG 2FBOJ 2J55A 1DCEA 5I0ZA 3KYOA 3QRGH 4DO5A 2NW2A 3I75A 3H9SE 4S0HA 1MRFH 4BZ2H 1AYOA 5D2LA 3ULUF 4J3VA 4OD1L 3SPGA 1J9TA 1FYTB 5IVOA 3ZE1E 5LXVA 1EHXA 2EKSB 4LVEA 4RMVA 2WYHA 3WFEH 1U42A 2ZCZA 4O02A 1BVNP 1DQTA 3TU6A 5KW9L 4ZI8A 5IROA 4WO0A 1INQB 1XB8A 2IJ0C 2PXYB 5MERA 5KVMC 1OV8A 3ULSA 3GT6A 3WEOA 1N10A 3G3LA 1AGBB 3WYRA 4JHBA 5LBGA 4KK9D 4GAJH 1Z5LA 1FPTH 2KL6A 4Y2DD 5IUCA 4R97B 5KVGE 3WEMA 4DGIH 3F7RA 4KQ0A 4ZMPA 5BW7C 3FRUB 2CUIA 4X0KB 2QR0B 3WS6A 4FNPA 1PKOA 1A7BA 3SYAA 3CDGA 2WQUA 4KY2A 5FKAB 3HZVB 3SGKA 3VACA 4Z7QE 3CFDA 5D7JB 2VLRA 3UTQA 5AD0A 1R19A 3KJ4B 1LO4L 1GY2A 2MHAB 3GSNA 4HDIA 4HPYL 3N3EA 4WK2B 3T65B 5DJAA 5JOFA 4HGWB 3W3BA 5HI3C 2QDVA 3R8QA 3DV4B 4HJJH 4GLRI 4AK2A 4XBEH 2FX8L 3AWFA 4ORZC 1FNEB 3V6FB 5BO1H 4HGMA 4L2LA 1UUNA 4OCSH 5DLLA 3TJEH 4QTIL 5EZOH 2HWZH 5BS0A 1ZOXA 2WQSA 3OKMB 5I16A 4Q52A 5J1AB 3VWJD 3TONA 4U0QB 3P40A 1XGZA 2ARJB 2VDLB 1VKXB 2W0KA 5ADPL 1NIBA 4OGXH 4RAUA 5C7XL 3SPHA 1NFDF 4FXKA 5C9JA 3EJUA 1TUPA 3IGUA 3GPSA 2P5PA 5ANMA 2VZTA 2L7EA 1BBDL 4ZW6A 5I8KH 1F3RB 3GXDA 2DBJA 4YGVB 1I1CA 2VQ1B 5LKNA 1ML0A 3HUJF 5FK9B 1NANH 1E30A 3DDGA 4CKQA 1MG3C 4Y2NA 4PAZA 5IZ7A 2LABA 2R56H 2XPYA 1N67A 2BOLA 4HIHB 2FIKB 2AQ3A 1T7XA 2ESVD 4LASL 2H9GB 4AK1A 4UAOC 4OCWH 2XETA 1PZ5A 3RHWF 3OHXC 1YECH 1JXJA 1MJ7L 3F2LA 1AI1H 1T6WA 3HG1B 1KELL 1XZ0B 3VG0L 1MCEA 2OKMA 3DUUB 1HFUA 4NO2A 2P1YA 4X4MA 2CRMA 5C97A 1J0KA 5KOMC 3BP7A 4XVUD 2IOOA 5ALCL 3E0GA 2NXYC 3NK4A 5BV7B 1ET5A 3U7WH 4X98B 4W70A 3MACH 2VYRE 3QIUC 2NT1A 2NQDA 5GGRB 3WG7B 2P7TA 5L4FA 1U8JB 3EDDA 1OK0A 5KSAA 2WZ6A 3E9UA 4A7TA 2DBLH 1CDYA 3BAIA 4XMLL 7FABL 4J28A 1A4KB 3VE0A 3U7YH 5EBGA 5JUEL 3BC9A 1JHKL 3FHEA 4A7GF 2WXGA 4FNQA 4JDEA 4XP9H 1F4XH 2FQFA 1E4WL 2YS4A 4NC1E 4GIOA 3RRQA 5SWZD 1P9MA 1JYWA 2Y3NA 4GRWE 1CFMA 4I0PD 3CAFA 2I07A 2R1WB 5DQJA 3ZT7A 4LCYB 4PBDA 4KK5C 4Q74A 4ODSH 2XG4B 4FG0A 4OI7A 1SDYA 1G9MH 1OHZA 1KLUB 2CMRH 3BP6B 1JZEA 3IGFA 3MRFB 4X99B 4DVBB 2VT0A 4XVTH 5E1AA 4QRRB 5FFGA 1LNUB 4NJ9H 5BZWA 2A74C 3QHFH 5EO1B 5D9SB 5JW4Q 1Q9OB 2Y69B 3KPQB 2AXJA 4X5WA 2CDFA 3HS8A 4WTQA 4TLSA 2YPVL 3FU0A 4I3RH 2AJXL 2Z1KA 4KTEL 3RTQC 3MNMA 5CP7A 1SDDB 4B97A 1DQMH 1QSVA 2CO6B 2WXOA 2RTTA 1A1NA 1OLZA 2WLKA 4WLCA 3G6JB 4J3XA 2IBZY 5MHSE 4PRHA 1G7QA 5GGQH 4WFFD 5D6CA 2F58H 4Z7OF 4AQZA 5EPMB 5JIQA 3NCXA 4RBPH 3UX9B 1D7BA 3OHMB 4LSVH 1DSFL 4XP6H 3D85B 5E56A 4KGLA 1GC1C 3QZBA 4YBLC 4H88H 4PJBB 5TDOA 2CLZB 2PR4H 1L9NA 3BDYL 4FG4A 4PWHA 4ES9A 3ATEA 1Q9LB 4I77H 5I6MA 4K3JL 3IMTA 1B0GB 4KTDL 1DANT 1YJDL 4JAMB 1ZLVH 1CG9B 3UGUA 3FQWA 4NM4H 3FSAA 5E9DE 4QJ4B 5JIIA 2DF3A 5B3JF 1IGIH 2C9XA 4P23D 2B5IC 3QULA 3IMUA 2IG2H 2MPAL 4NQED 5AVVB 4B5ZA 3B9KA 2VDKH 3QIWA 1OB1A 4PN6A 5GIRB 3UDWC 3NZHL 3WNOA 4LSRH 3K6DA 4R5TA 1WWWX 3UAJD 2YFNA 4AIZB 2WINA 2OS7A 5DT1L 2NY6B 1G6RL 1NCOA 3JZYA 4M7KH 3MRKA 1EAPA 3MLYL 4YMPA 5E2TH 4G70B 1JZDC 2B1HH 5JXED 5GJSL 5L2JA 3WNJA 5CFHA 4NP9A 4Y7OC 3MBWB 1BQUA 1EBPA 4W9DC 2G3MA 4WHCA 4YXKL 4MBRA 2PCPA 5ADOL 4PG2C 3U0PB 4ELMB 2YLKA 2VZSA 1U9KA 3EGXB 4WGVB 1SOQA 2X6BA 5AVQB 4HKBB 3D30A 3EJPA 1J05B 1GIGL 4HSCX 1WISA 1M2OA 3QJHA 3RVTD 4DKDC 3BIAX 4GKSA 4UB0H 3X1EA 2BVEA 1I3GL 3AQXA 3SPJA 2GJJA 5FX3A 2IWKA 2D31B 3BW9A 2NY1B 5CSZA 5JMOC 2W0FB 2EEDA 1HINH 1T5XA 3VCLA 1N59B 3Q8AA 3GTTA 4LCUA 2EDTA 4TVSa 4TV3A 3I6LE 4BE5A 2D7OA 3MV01 4HMCA 4NC0B 4E9SA 4AVHA 3U46B 3QO1A 2X4QB 3HAEG 4ZO9A 1KN2L 2FVNA 1AIFA 3T3PE 3WJJA 3L4YA 3QWNA 4QRQA 4HT1H 5GRVK 4P23A 3VVVA 1JRHI 3HS0B 4MD4A 2A5UA 2NSXA 5L6YH 3MRRA 4JPVL 1UCTA 1XDTT 3FTXA 1NFAA 4XMPL 5HYJB 5MP6L 4PEEA 4JQIA 4QPEA 4H20H 5I1IH 4HYTB 5D1ZD 4XNUH 3U0WH 1A3RL 4Y4HC 2K7PA 3KG5A 1HSAA 1YYMH 1FCCA 3B2UC 3FB5B 2K7QA 3I85A 4P4KD 2G3ZA 4QXGL 5CO1A 5C09B 3WDJA 1DQKA 1MNNA 2X38A 2J71A 4AM0Q 1NFDB 4M6OL 3V55A 4UTAH 3KXFA 4OVVA 3C5JB 5EF0A 4XH2B 3L1GA 4PHZA 4XMKH 2B15A 3D3VD 5L9DH 3NIFE 1DE4A 4NZTL 5C0RL 1EBAA 4LHUG 1D7FA 1SXAA 4KROC 4EBQL 2RIKA 2XTLA 2XX0A 5I75C 2ZYSA 3I6GB 4S1QL 3RZWA 1D5XB 4OCYL 8PAZA 4NN7C 3ZGHA 1PD0A 3DX8B 3VGGA 1U8NA 3WUZA 2X1XR 5M94B 1XCQA 3WTVA 3OZ9L 4NLAA 4MDJB 4EUPB 1XF4A 4NO3A 4PY7B 3AAZA 3DX9A 5IQ7H 1RUPL 3Q5TA 3US0A 4IKLA 2HT4D 4N9GB 3HMXL 4EBQH 3CN2A 1FHGA 2L0DA 3HCVB 3IBEA 4N8VB 4B95C 5T3ZL 1G7LB 2I32A 5HP5A 2A1WL 1ODAA 3QJRB 1NCAL 3D7PA 3BI9X 5DFVD 4P5TD 2ATKA 1WAPA 1NAMB 4MA8L 1UXSB 1VA9A 1CBJA 2NY7L 3H9HB 1KENL 1U8JA 5T3XH 3HNSH 1OGAE 1E6OH 2J7LA 4AYFA 1CI5A 2V3FA 1IC0A 2A83B 1VESA 5FHBH 1G7MB 1RKRA 5MP6H 3PU7A 4WRLA 5AOLA 1YA5A 3MOAH 3BPLB 4QDGA 1BIHA 4JFEE 4JZOB 2PETA 1DDTA 3QJHB 4Q9CA 4OD2A 5DD5L 4EN3A 2ICEC 3MRMA 4EAEA 4WENB 2OW7A 1CYXA 1JGDB 1KJ2A 2QDWA 2NNCA 2GIMA 1XF1A 1A3QA 4QY8A 5TPWH 1N0XL 1BX2B 1FIEA 4WWKD 4X4YB 5BS0E 4KRNA 4IK6A 3HR6A 1QRNA 4CAGA 3IDJB 1NMAL 1Z9MA 4JKLA 3MOBL 2WAHA 2OZ4H 5J3HC 3ATAA 2Z93B 4XNZB 1XSKA 3ARPA 3ME0B 2AXHA 3Q8FA 4K7FA 4WHYH 2FGWH 3QXAB 1U0QA 4OZFA 4B5EA 1AKJD 2DIAA 4I85A 2FO4B 4H0GA 5EA0H 4HSQA 5DFTA 4FLOA 4WNQB 1JWSA 2C1OA 3EO9H 4LGPB 4BA8A 5C0AE 3QXTA 4E42B 3C6LB 4G2AA 4Y8DC 1DQIA 2JXMA 4G7VL 3MRJB 1IM9D 1D9KC 4L8SA 4PLNC 4P2QD 3CN0A 2C34A 1J0YA 1NIFA 5D8JH 5DFWH 1S78D 1CU4L 1ZTXE 3EG9A 5EDXA 5LGYA 1KXVC 5J6SA 4M8QA 1H5BB 3SE3C 5J06A 3VRIB 3PNWA 1A5FH 4OQTA 2BERA 4NQSB 2EKJA 4KRPC 4R5VA 4ZS6D 2ZJSH 1OO2A 5AKTA 4MD0A 1AFVL 2WK2A 3NIFF 3V7AG 1Z9SB 2RFXB 2D2CC 1U36A 2W60A 3PL6C 2IAND 4NWUL 2VLLA 3GMPB 4LPWA 4NNXB 4YDIH 2TRHA 5DVKA 1XZWA 3S3SA 4BFKA 3KMDA 2DWEA 1J0HA 1TETL 3CJJA 3S2AA 4TTDC 1PG7W 1FGVH 5HJ3A 4LQFL 3S4SA 3HC0B 1UXLA 4C54A 5HVWA 4KZEL 2V7HA 3BKYH 3U4KA 4P05A 4QHUA 3VXRA 3CN4A 1OXYA 4NB7A 2C9SA 2GBTA 4I2XB 3F65A 1GGUA 2AJ3A 5KSBE 1TXKA 2P5EB 3C60D 4LRIC 5FA3B 7PAZA 2A6DA 4FNSA 2V8MA 3MAWA 4FX5A 2KLRA 3S3PA 2CA3A 4Y5YC 2PP8A 2AJXH 3GLAA 1CF8H 3F64A 5IV2B 3HLKA 1YUKB 4MMXA 4AE0A 3ZX1A 1J9CT 4KDWA 2Q8AL 1YNTF 4S2SB 1TTAA 4PP1C 3LIUA 1VGEL 2PXYD 3LQMA 4X42A 2WN3A 3QEHB 4QYOB 3FAXA 4YHIA 5EOCH 4Z7WF 2NY2B 4HA1A 1U58B 5E8PB 4DGYH 4ZMOA 3T1FA 4BQ8A 5F71A 4ODSL 4LCWD 5D70L 3KPQA 3FO2A 5DYOB 1UH4A 4I1PA 2CDGA 1WITA 4NUPA 1U3NA 2CO1A 1X44A 2OK0L 4GP5B 1HQ4B 3L4UA 1OWRM 2YGPA 1AO7D 1U8KB 1Q38A 4D0CA 3UEZA 5E8EA 3UERA 3P4OB 2RH0A 2D73A 4CVUA 1R9FA 3NJHA 4X8CA 1G7JB 3L1OH 4JKPL 2ZOLA 5DZ9A 3TZVB 2HFGL 1GZHC 3TGXA 3DRTB 3CCHB 4NHCH 1J1PH 1ZRUA 5A16B 1CGYA 2GSIB 2D7NA 3ASWA 5D2LF 1J10A 4KAQL 4L4TB 1IFHL 4XMZA 3ZMEA 4MCNA 3UBGA 1KELH 3FT2B 1QSZA 1MJ7H 3E7JA 3PP4H 1Q1PA 3UTSE 2JKWA 3OG6B 3BVWA 4G8GA 4OCWL 4DSYA 1T20A 3MZTA 5JHMA 2IAMD 4BUGA 3HZVA 1BZ7A 3L4ZA 4R7NA 2LLLA 4K7PY 4RESB 5IQOA 5CSBA 4YOKA 2QTEA 2YJLA 3K4AA 3QUXA 4KU1A 3RIFK 4LSQH 2X12A 4XWOD 3BEWB 1C5BH 4NCC2 4QUOA 4NERA 3X3FH 4K5PA 3DSFL 4ZTPH 3K2UH 3ARVA 4U1JA 3IK2A 4KGJA 4A7QA 1E6JL 3ULUD 3IDMB 1JD7A 5G5DA 3BP4B 3KS0J 1J1PL 4CN6A 3U1QA 3G5ZB 2X2IA 1MUJA 4UM8B 5IT2L 4JKPH 4M8UA 2R15A 5HDQL 3ZE2B 1KCVH 2PPDA 2WN2A 4OGXL 4NN5C 3GSRA 3GZQA 5GGSY 4OLVH 3W5MA 1M56B 5KG9A 3ZQWA 2DQIL 1TVHB 1VCBC 2V5RA 1S8DB 4M6MH 5EZOL 5KTEH 4XO5A 3O9WB 5JPMC 1QD0A 1SY6L 1WDAA 1QHPA 5GQBA 1N12A 3MFFA 5ITFA 4G1EA 6FABL 4Z3FA 5DMGD 5MERB 2I07B 1V27A 1Y7VA 1NICA 4R4ND 2N3JA 1LO4H 1YMHB 3V6OE 2X6VA 3KPSD 3NJNA 3W39B 1YN6B 4OFDA 4J8RB 5DLML 2E0PA 4L1LA 1NFIB 5KSUB 1U8HB 3PWVB 4ZNEA 1A7RL 4WCYL 4XPAL 5AYTA 2XWDA 1QSFA 3OX8A 1UKSA 1LO5B 2Q86A 3FQ1A 1XF2B 4WJKB 3LN5B 1H0DA 2IH3B 2V5YA 4ZFOB 3C5SA 3DHPA 3WTYA 1ECYA 1CS6A 4EVNA 1PFOA 4HEPA 4BH8A 5E4IA 3MGOA 2CALA 4AQEA 1Z0MA 4D3CH 3ULAB 5JHLA 5CCKH 4TVPE 4ANWA 2VM4A 4BWWA 1T4KB 4FABH 5IUSA 2VLMD 1PEWA 3WFEL 1MLCA 2G5RA 1KT2B 3D39E 3KCPA 2VR9A 3EH1A 2H6UA 5IB2A 2RD0A 3MLXH 1RZKH 4KO6A 3HJ0A 3Q6FB 2V2WA 3IPFA 3VRJA 1E28A 1U8PB 2ZCLL 2OQJB 3TBYA 4MRCA 1TQUA 4F8NA 4XHJD 5DJ6A 4AJWA 3QEUA 3M7OA 1IFGA 4YSRA 5J0BA 1FAIH 3WJMB 4UYPA 4FYTA 2NLJA 2X87A 2ZJSL 2CLVB 2W9LA 4X4XB 1AOZA 1GYUA 4QYOA 4QHNA 2V9RA 5AAMA 4GRLB 3O0RH 3P3RA 5FKPB 1IUZA 4AGOA 3GHPA 4BGDA 2WLIA 4S1DC 2UYLB 1BVKA 1Z0NA 3E38A 5D2LE 1MFNA 3QDMD 4AI7A 1DBBH 4RBPK 3FB8A 2K8QA 4HIXH 3LRSA 4XO8A 3T0BA 2ITCA 4LT7A 1NC4D 2GABA 5BZXA 3DX7B 2R2CA 3BD3A 3M17A 4FG6D 3A5VA 2C9RA 2WWMC 1CD1A 2NY6D 1BXAA 2DN7A <