1OHZA

Cohesin-dockerin complex from the cellulosome of clostridium thermocellum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
GVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords CELLULOSOMAL SCAFFOLDING PROTEIN A
publication title Cellulosome Assembly Revealed by the Crystal Structure of the Cohesin-Dockerin Complex
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 27
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ohzA00
5G5DA 4DH2A 3KCPB 1ZV9A 3L8QA 4U3SA 1OHZA 3BWZA 4UMSA 2B59A 4FL4C 4WKZB 5LXVA 2OZNA 3GHPA 4WI0A 2CCLA 3KCPA 4IU2A 1TYJA 4N2OA 2BM3A 1QZNA 4UYPA 2ZF9A 2VN6A 2VO8A 5AOZA 1G1KA 2JH2A 4UYQA 2O4EA 2Y3NA 3F2LA 4FL4B 3FNKA 2XDHA 2W1NA 1ANUA 1AOHA 4IU3A 3UL4A 5K39A 2VN5A
chains in the Genus database with same CATH superfamily
2RQ8A 5EZOL 2JIXD 1DL7H 1ZD6A 3N50A 4GO9A 2NR6A 3DSNB 3TCLA 4EIUA 3V5DA 2E27H 3EJZD 3KXFA 2AQQA 3UP1A 4GAJH 1GS7A 2R9HC 2ZXQA 3Q3GB 3A5VA 5DDHA 5LAXA 1PCSA 3GZKA 4OCYL 3KLHC 3I50L 4XOAA 1C5CL 4RETB 1HQ4A 3PWPB 1NKGA 1RZ8B 4JFDE 5LNDA 3B9KA 3MV9B 4NSKA 3WFBH 2ZSVA 3R06B 3T8XB 3QQ4B 4HWNA 5IW3A 3WEOA 4ZMTA 4I77H 1AD9B 2DQFB 3LSOB 4H2AA 2YAFA 3ARBA 4FZEH 2H6UA 1A1MA 1FFPB 1HH6A 1QSZA 2IADA 2VR6A 4AKQA 4XO8A 3LB6C 4CAGA 1OPGH 4WW1B 2GJJA 4GRLD 1Z3RA 1NCUA 2WLNA 1U8MA 3FYEB 3QQDB 3PQYA 1JPSH 1OZUA 4U3HA 5FGCE 1D5ZA 5J13C 1NCHA 4YDIL 4P9HL 4XP6L 1SEBB 1SDYA 3SE3C 3QNYA 4JJ5B 5EB9A 5FA4B 3QCVL 4Q56A 3TH3T 1P84J 4XC1H 1XGTB 4F80A 3G9AB 2FWUA 1IEBA 4X8CA 1RERA 1Z1WA 3SY6A 4DPRA 1N4XL 3CMGA 1CMOA 1FIEA 1GGTA 1UT1A 3WNLA 1QRNA 2PO6D 3QJUB 5E51A 4OGXH 3FO2A 4APXB 2K7QA 5B39B 3GMQA 4KX9A 2NCEA 3GIZH 1NCCL 4I9WE 2ORBL 4TTDD 1ZMYA 3FQYA 1KB5L 3WKNA 2J88H 1MFVA 4LARH 2DJUA 4PRAA 1P4BL 5GPRA 2IH9A 4UOW1 4EN3D 5IMKB 1J5OH 1B3IA 2QPSA 3PXHA 2E56A 2BFVL 2ZNWA 3CHSA 4JNXA 2ADYA 3MRBA 4QUOA 5DJ8B 2YD2A 5GHWL 5I5IA 1K85A 4HLZH 1N59B 4AYBA 3MUY1 4H25B 5KBPA 2BM3A 3CIQA 4N0FB 4QRAA 2ED6A 4D3CL 1BVKB 1NGZA 3I3BA 4DP4X 1ACZA 4GW5B 1CICB 4IYKA 2C9XA 3L3JB 4WZ9A 4XT1C 3T2NH 2A73B 4AV0A 1PIFA 5F2FA 3C8DA 2F8IA 1XV8A 4QRSA 4DNLA 2G5UA 5T1KA 3SYQA 5KJ4A 1XXFC 2Q7NA 3KBEA 3PABA 1LO5B 5KYWB 5IF0B 2DN7A 2Z4TA 3AAZA 4M02A 2DPKA 3EYUH 5DMJB 1PX8A 3VWJA 4OB5H 5I17A 4Z7VF 5FR3A 1Q1PA 5JR1L 4NM4L 2YPKB 2DH3A 1JZIA 1DANU 4W9CC 3INOA 4Z7NF 2UX7A 3LVEA 2R2BA 4YXHL 4F27A 3O2DA 3CC5B 2PXYD 4R0LC 3CK0L 1T0NA 4ZD3H 4RGOH 4X98A 5IB5A 4MJ4A 5DD0L 1VZHA 4OV5A 5I75C 2CO7A 2L3BA 1SJHB 4ZW6A 1NFDE 5EZLB 3U6XA 1O9ZA 1R5WB 3QHZH 1JL8A 2OI9B 2PW1A 5E9DE 2SODB 2GJ6B 5TPWH 3U7WH 1J8RA 3O0LA 1I3GH 2VDRB 5EIIB 4PJXB 1Y18B 5C7ZA 5K9OB 4XGZB 2LU3A 2YFNA 1DR9A 3QWRA 5DVNA 4PG2C 3CFKA 3KJ4C 1JHKL 4PV8A 4LHUD 3LKNB 5JQ6L 1CFSA 2EDXA 4L05A 4Y4FA 2PP7A 4NLAA 1A6ZA 3P9LB 3M88A 2WXOA 4U6TA 3FKUS 4HMDA 4BZYA 1WFMA 1XAUA 4RDQG 1XB6A 2OR9L 4OFQA 4XVTH 1OOAA 1TVBB 4LBEB 5HJBA 2B3RA 5IB4A 1QZNA 4NDMA 3WNPA 3L17A 1TSHA 5IROC 2R51A 1XIWA 2FJHA 4Z7QE 2WOBA 4FYTA 4NHCH 4PCSA 2QVIA 1XQ4A 1MEXL 4NRZA 1BBJA 4IRZL 3P2DA 5FW8A 2FO1A 3MLRL 3OMNB 4AQAA 1VSCA 2CMRH 1PZUB 1ZLSH 3OPUA 1MRCL 4O5LL 4L1DA 1KGYE 2V17L 1I9EA 3KCWA 4ZYKA 2VKXA 1X5IA 4MAYD 1ZTMA 2Q7YA 1JZ8A 1G9MC 4QPEA 3RWGB 2XQYG 3X14A 2BCMA 3GJFK 2ILLA 4ZPTA 4JFTA 3HR6A 3ZIYA 2F8OA 1I1YB 4GFTB 3S48A 3POCA 4PVBA 4CVXB 3OMIB 4B96A 3CN2A 3V7AG 2X2IA 5E56A 3JWOH 1E6JL 2J8UB 3HKFA 1CD0A 3L13A 4CU8A 1OAQL 4ZX6A 5IFAL 1ZVYA 3KS0H 1AIFA 2GK0A 4NO5A 5AZ2H 1F6FB 3IMVA 4IKIA 5I0XA 1J5CA 5F21B 5C6PB 4X6BB 4KXBA 5IHZA 1E8YA 1LWJA 2ICWJ 1CLCA 3S8FB 3QO0B 4BUHA 3LH2L 3ARWA 4ATTA 5EPMA 5I15L 2N59A 2WXGA 2CR0A 4M61B 1LEKB 5CJQH 4LOVA 1G7IA 1HHHB 4R7DB 3RI5F 4AVIA 1CQKA 1P4IH 1YJDH 2NNFA 3EADA 4WENB 1SEQH 3Q5OA 2Q2LA 1LL1A 4D0DB 1ACXA 3EJTA 1P84K 3MRPA 3SDCC 4PR5A 5HSFA 3S36H 4FTVD 2HTLD 4ODSH 3L48A 1EJOL 2VERN 4QI3A 2XY1A 4R3SB 4ZAKB 4LP8A 3V4VA 1GGBH 4K3EH 5EUOE 4E9VA 5I23A 2IALB 5E4OA 4D0BA 3RVVD 1S7RA 1EEYA 2FWOA 2CO6B 2WY3B 5EZJA 1WSST 2F68X 5DZNA 1BBDL 4JRLA 2AV7A 4CNIA 5ABZA 3QCUL 2ZXAA 2AQNA 1ECZA 1MNUL 3FMGL 1EK3A 1KTJA 4NQDA 1XFPA 4WTQA 3TN0A 3VXQB 1KIQA 3KHQA 4P2QE 1CLZH 1ZS8A 4JHUA 2VQTA 3EFOB 1TMCB 2B77A 1AO7A 5CJBA 2Z31D 3WKQA 5AAWC 2W59A 5I2IB 2IBBA 4HSCX 4HPOL 5J9PA 1C16A 1MI5E 1S7VA 2Y69B 3L5XH 4JPWL 5EZPA 2HLFC 1SM3H 3DXAE 5KG9A 4MZRA 1WIPA 3B5GA 3HI5H 4N0YH 3FFDA 4WO0A 4P23C 2CPUA 1T2QH 3HLAB 5C3TA 1I7RA 3CBJB 2A77H 4UT7L 4YZFF 5F89B 2ADGA 3IE4A 4CVWA 4KZDH 5EUOA 4PJFE 3EF4A 4JGMA 2RMNA 3V8OA 3DDFA 3ULVF 4H0LC 1T5XB 3BO8A 1T0MA 3KPNA 4IGBC 3PWJA 3T0BA 2BY0A 4QTIH 4ZPVA 5CFAA 5A2LH 5MEOB 5AOMA 3V52L 3D2UD 3EW3B 4XMUA 4M00A 2X4RB 4QRRE 4F7KA 5DK2B 4NJ9H 4JM4L 5ENWA 1AQDA 2DWEA 3BQUB 2W92A 3FTZA 5T3XE 3AG1B 3KG5A 2JI1A 4NKDB 3QCTL 2ENYA 4N87A 5DK3A 2LR4A 2IMNA 2XTJE 3FT2A 4BSWA 1RP8A 2N01B 1ZVHA 5C1MB 2E46A 4HCRL 1AYOA 1Q94A 2B4CL 3GIVB 3NA4A 3TF4A 1DQIA 3ABLB 3HZVB 4KVNH 3GJEB 1TZOA 1ZVNA 2JJTC 2VDPH 1MFNA 2VM3A 1WCBA 3S9DB 1YYCA 3KPPA 5D2NB 1UKSA 3PFQA 2MPAL 3CPLB 1ZOXA 4MZIA 4YBQC 4YO0A 2DIAA 4JW3A 1GGCH 4W1TA 4WJ5A 1YSOA 1G1OA 2IDCA 4U1GC 3APFA 2JCCB 4IHOA 2BRQA 3U7YH 2WZ6A 4APQC 3W9EA 3KYNA 1U8IB 1L5GA 4AZ8A 4Y2DB 4Q2ZA 1ZWIA 3B2PA 4QRRA 3ZE0B 5JXAH 4JKWA 1WTGT 4M1CC 4Y5XA 1N6QL 4NO3B 1RXLA 1CLOH 4G8EA 5TGBA 1RLBA 3GJFA 1MIML 1OHZA 3PL6A 5D7LB 2B1HH 4OVUA 2HKFL 3Q2VA 2QGEA 4N90D 3SDXE 3QQ3B 3QJOA 3WIHL 2WCPA 4GLRH 2HFFB 3T3MF 2CK0H 3DUUA 2DMGA 3OKDB 4PS3A 2X3BA 3WUWB 3HZMA 2J5WA 1MHPH 4FG6D 5C0BE 4S11A 3WNJA 4B3EA 1XGRB 4KBPA 1JJUA 3O0RH 3NP4A 2VR3A 4YFLF 5LGHL 3HRZB 3IM1A 2NY7H 2VLME 3SE6A 4PV9A 5BQ7B 2SEBB 4LL4A 5F97E 1CK0L 1AZNA 4U05A 4DUWA 4HF5H 3V6OC 2QKIC 4YHKL 1YMMD 3QH3B 5EULV 2W65B 1EANA 3BVXA 4XPAH 3ZKMC 3JVGA 2BNQE 3O6LL 3TVMB 4X7SL 4M8RA 1GYWA 1I1CA 4FZ8H 5T33H 2DQGH 3VD3A 3AREB 5AVTB 4GRWH 2YRZA 3FULA 4ISVA 3NPSB 4WVRA 3DK0A 4PRPA 4WUUB 4LRNH 4Y4KB 1E5UI 4X6DE 3ZVVA 4XAWL 4OCWH 5D7JD 4J3OF 1A65A 4OLWL 4KMTH 5CU5A 3TC9A 1GIGL 5HDBB 1KCRL 4GIPD 2CUIA 2IDTA 2DI7A 3ARGA 1IILE 1MRDL 4NJAL 2M1KA 4DGYL 3LNDA 5FGSA 4CJ1A 2VLKD 3EO9L 3UJIL 2EQDA 3OLDA 1JHLH 4L4VD 2WVSA 5A2CA 1YEKL 1ZIBA 1NBYA 4GAYA 3VSVA 4GKNA 1MCCA 1Y6NR 2JJWA 3QUKB 1NSNL 2A4EA 4EMZA 3GXUB 1QSFD 3RIFF 1KBGH 5D1ZB 12E8H 1EMTH 1OW0A 1WAAE 2DQEH 2FYYA 4G7VL 4MD5A 3UG4A 1D6VH 4F57H 1SUJA 1CGSL 3K1DA 2LU5A 3O6FA 1AGFA 2QT6A 4JFPB 2MCAA 5DHEA 4CC4C 1FH5L 5BRZE 2XWZA 3QAZC 2WNGA 4HJ1A 3HBPA 1DJXA 3U1SL 4LVOC 5JHDB 1BLIA 4JVWA 4QXWA 4GSQA 5G5DA 2JJVA 4H26A 4KRPD 3NCYP 4L1BA 3VWKC 4U1IB 4BINA 4RMSA 3G5YA 3BSZA 1INQB 3IXTB 3BZDA 4RISL 5AW5B 1ROCA 4G5AA 1QLRB 4PW3A 1UACL 2FJGB 4HHGA 4BWWA 2EP6A 1GS6X 3ZDZF 1WZAA 4NT6B 1QBLH 5E0FA 1AGEA 5AWNH 3QA3A 1GYUA 4P59H 2QKSA 4ALAH 3O11A 3RL2A 5ISZD 1U6AL 3F7YB 4PJDE 3LTVA 5D7IF 2Q5BA 1BD2B 2WSPA 1KBPA 2VZ1A 3D39B 3VGBA 1N5YH 4NKMB 2ZNXA 1QSED 3QZWA 4FQIH 4TUKH 4W9IC 5E8DH 5KSAB 4XHJD 1WAAA 3JZ7A 3P40A 1RIHL 5GZNC 4P2OA 1NCAH 1BZ7A 5JA9A 3D18B 5EOCJ 1BX2A 4I5BA 4AGLA 1V54B 3DOHA 2RR3A 3FSOA 3OWEA 2RB8A 5HXMA 3HS9A 3CAFA 5DRWA 2VO5A 2CXKA 3MJ7B 4JO8A 2IPUK 1ZCRA 3DO4A 3FCUB 2EDDA 5E23A 4E41D 4HJJL 4X5XA 2Q8BH 2JF1A 5FO8B 5C0ND 3S97C 4O51A 2PPFA 1OWWA 3CN4A 4LEXL 1F3DH 3WN5B 1JMZA 1XF4A 2IWEA 1WAPA 3FT4B 4HJSA 4XI5D 2X40A 5GGVH 3KPTA 5LQBL 4LSVH 1KIUB 2D03H 2EH7H 4LSQL 4J28A 4XO9A 1PSKH 2ADJA 5TDOA 1K5NA 4ONGH 5IIEB 2PETA 3VACA 3EG9A 2CM5A 4YHOL 3LZRA 5ILTH 3MV7E 3UROR 3EOTL 3IFOB 4ZUSB 5I8OH 3O4OB 2BIHA 4PJBB 1NCWH 4PWGA 3LYRA 3PV6B 4YPGB 2ICCA 1HXKA 3C6SB 1KXTB 4ZTPH 1OM3L 1QTSA 2CUAA 3MXWH 3BPNB 5D4JA 3S5LG 1KYFA 5L2KD 2KLRA 1NEZB 3QIWA 1QX1A 4WHTA 1GY1A 4DIXA 2QHRL 1WFOA 3SGDH 2V5TA 5DC0A 3FPXA 1T1YB 3ZDXE 2DKSA 2ZP0T 3EXJA 1J5DA 5JDSA 1HXMB 3VXUE 4DN3L 2HRPL 2VXSH 1F11B 3QT2A 2UY6A 2FJFA 4JFEB 1DUZA 2VW4A 2YFOA 4LOFA 4ZJ9A 5E94A 4XCNA 3HE6B 3LNFA 3FU7A 1CLYH 3JV5A 1V05A 5CJXC 2YN5A 1QR1A 1EFXA 1NTDA 35C8L 1B2YA 1J0KA 3GO1H 4L9DA 4PGZA 3GXPA 3T6ZA 5KSVB 3MYJA 4EAEA 1E8WA 5GRJH 2NLJB 5LN4A 4G6JL 3PG2A 3L95B 5FYLE 2HFEB 1D9KD 1WZMA 1A9VA 3ARQA 2F0CA 2L7QA 2UX6A 1I75A 2APTA 2HT4D 2YPLA 2EO1A 3UBXG 3VNZA 1UXWA 4OFYD 1ZTXL 4J3UA 4LCYB 2JI3A 2LHAA 2YRBA 2BLFA 3VSUA 2OW7A 4ZX5A 2FE0A 5DJ6B 1A64A 2XKNA 3ULUD 1WITA 1A7RL 1MIEL 2VDNB 5FHBH 3W5NA 1BGXH 1IGTA 5CMAB 5GISH 5KBDA 5ACZA 2X9WA 3CDFA 4JDVB 1BOGA 4QDGA 2R9HD 3UO1L 2UXFA 4JHVA 4BHUI 1WAEA 3IS0X 1SDDB 3BZ5A 4OD1L 3HRPA 5C08A 3VQLA 3VD5A 3VYNA 4BK5C 3KLHD 5I1AA 1ZAGA 4H20L 2V33A 2NQCA 4M8VA 2EILB 4XMLH 4ODVH 4HA1A 3OB0K 4P5MB 4AGQA 1P6WA 4X2UA 1CQYA 1FFOA 1UYWL 4G80A 4J3TA 1ZA3A 1ED3A 3BIBX 3X1BA 3X13B 1CURA 2AJZA 4I4WB 3PLYA 3GSOB 3IGAA 3CMOH 5EC2A 2VDOL 4JFFB 3TL5A 1E0OB 3WO3B 3TZVC 2YEZA 3UBXI 4HZLA 1I9IH 4HKXB 4XR8C 1XF2B 3LQAL 1DJIA 3LB6D 3QDHA 5IY5B 3D9AH 4X7FC 3B56A 3RI5K 5CN2A 4TOYH 5EN2A 4FNLL 2WW8A 4FXGB 5IQOA 2WTOA 5MI0C 5GRVL 2O93L 2P8PA 3N6YA 4MNQA 3SGEI 5F9JB 5K9JH 1IGCH 2CE6A 3VXMA 2XKUA 3VW3L 1MVUB 2CLZB 3DROB 4JFHE 4W9KC 4BCZA 4AEIH 1LNUB 3IDUA 1USZA 1PNDA 4HUXB 2MQ3A 4ABVA 1UB6B 5F6IC 1JIBA 4R4BB 4D9QD 4A66A 5AVZB 4IRJC 4ODBD 3V0FA 3MX0B 3VD0A 3V4PB 3HUJB 3K7UA 4Z7UB 5IQLA 5IMOB 1OT1A 3BZEB 1UGNA 1PZSA 3ZMRA 5JOEA 5IEHB 4RFEA 1IBDA 2ATKA 3EAKA 3BHBA 2ZUXA 3UH8A 4DZBB 4PM1A 3Q2LA 1E7VA 4KI5F 4Y9EA 3RY5A 4AENB 3Q44A 1ZSDA 2WLMA 4TYUA 4PWFA 4KQ3L 5J1AB 5GS1A 3CIAA 4HH8A 4JO5A 4H4NA 1YZZA 4LHUG 4OZIF 1KTLB 4NQVA 4C56D 2FRGP 5C0CD 3GS4A 3Q2WA 2MH4A 1UVQA 2DRUA 3SQBB 3VRJA 3FB6A 3B37A 2BS9A 1W8EA 1TLMA 4HSQA 4D7BA 5HGAA 1J86A 1RK7A 1YN7A 4N6RB 2UUDK 4MA8L 5IOPA 3O4LA 4ENEC 3RY4A 4NQXB 5ESVB 4UOZA 5J06A 2YPVA 3IAPA 2W95A 3LRMA 2WLLA 1FNEB 4M93B 5IB1A 5AG8A 1KGCE 1X4YA 1U30A 1KCUH 3MBXL 1J9RA 1CFVH 2AEPH 2X6UA 2IG2H 2BNRE 1M7DA 4UWQB 3EFDH 3NZUA 1FFTB 3QGVA 4NZUH 5EORL 1G7LA 3HAEB 2YLHA 3QJTB 3AG4B 4DEPC 2NX5D 3ZK0A 1FZKB 2VQ4A 4IM8A 5IESL 1JUFA 1P6AB 4ZXBA 3WEXB 4RDQF 3QVAA 3FPYA 4O00A 2LTQB 4HT1H 2X7LB 3P73B 4NUGL 1RUAH 2A9ML 2JQAA 5I1GL 1TITA 1BZ9A 4A7GF 3W38A 4J5VA 5B8CB 4JZNB 4YGAB 1OGTA 2V9RA 3WE6A 2PWHA 4KC3B 3RWCB 4XWGL 4HYTB 1Z3GL 1MREL 5C2BL 5HYJD 3NCCB 1C5BH 3H4HA 2IDUA 3WJLA 2DEYX 3Q8AA 4LVNC 2YQBA 4WFEE 4U1JB 43C9B 4S1RH 1HX0A 3OZ9H 4JLRA 3JTBA 3RTQC 3RVTC 1D6EA 1U8LB 4IKNA 2A9CA 1S3RA 4JDTL 4F5CA 1OTTC 2XG5B 5DUBA 5HVHB 1HFUA 4Y4HC 4NLHA 4RQQB 5EU4A 1WD9A 1ITBB 3FK3A 3KPLA 3RE0A 2I25N 4L3EA 5CGYC 4HD9A 5MEPB 2QFPA 1X9UA 1FVDA 4PRBA 5IQNA 4G82A 3ZHNA 4CSPA 4J2XA 3SYCA 5D7KD 1JPEA 5IROD 4DN4L 3SKOB 4N2KA 3SN6N 4FC3E 3X12A 5E8NB 4MTMA 4HWEH 4HH9B 2Q8AL 2G3MA 4PGDB 2FATH 2F5BH 5FGBC 5DJAB 4ZK8A 4AMKH 1COBA 1FZJA 2OTUA 4EI5C 3P4OA 3IF1A 4Z78A 1BIIB 1HSAB 1NL0L 5TFSL 2UV3A 1EJ8A 3CVHL 5F9OH 2OJ1A 3FBQA 1PD6A 4J4PC 5FA3B 2CDEB 3CJJA 4PVLA 1MAKA 4A2HA 3ZT5A 1CFMA 1EPFA 3ARTA 2IGFL 3W39B 2BDNH 2PCFB 4AGPA 1T83C 4PGJA 2J43A 3ZT6A 5LAPA 2ZICA 2BVQB 1L6XA 5IW6A 1WTLA 1UWEL 3RDTA 1IKFH 1Q9KA 4NUQA 3HR5B 1OCCB 1KTCA 5LB1A 4GB9A 4NQEA 3V5KA 5C0JA 3P9WB 4NHUB 4YR6B 1P2CB 3BGFC 3LEXA 4TQHA 2OL3H 4UQ3A 1Q1JL 2MSPA 2D3VA 2ZCZA 3CE1A 2WUCL 3F62A 3MV8B 4LLYA 3RIFK 1E3ZA 4ZX4A 1N0LB 1OE2A 3BXNA 1NBZB 2EYRB 4XH2A 1RZ7H 1A3RL 2V3DA 3WNIA 5E2TL 4YE4H 1MFEH 3SDCD 1YG9A 3NUKA 2HKAA 5C86A 1A8JH 1Q9LB 2BPBA 2CD0A 1CXLA 1H3XA 1NUFA 3BW9A 4MJIB 4XNUH 5C71A 5AOKA 3GI8L 1ZANL 1YYLL 2JWYA 2A74C 1G9NC 3LAFA 3NJHA 3UABA 4N8PA 1KPUA 3VGFA 3E6HA 1MUJB 5C07B 5EU6B 4Z7QF 1FNSH 4DAGL 1BXVA 4N0UE 1U8PA 4C55A 1DVYA 1RZFH 3MBEA 5DQDH 4QXGH 1KDJA 1E65A 1L9RA 3JZYA 2XPGA 2R1WB 3K6SA 2Y7NA 1UXSA 4PJ5D 1ZXKA 1HH9A 1CD9B 3CH8A 3O2VL 4Z7IA 1WEJH 3OSVA 1JTPA 1FSKB 4JE4B 1TJHL 3TBVA 4KV5F 2VZTA 4U6VL 2XN9A 4H1LB 3IJSA 4UOW0 1XTMA 1R5IB 5E5MB 3DRTB 1P5UB 2HLFD 3LPWA 5I6XC 2ZG2A 1G6RL 1PQZA 4JVPA 3VCLA 1S9KC 2IAMC 4PJ7A 3MREB 4NBXB 2X4TB 5MENE 4P23D 2D7TH 2WLZA 1NBCA 2A83B 4JAMB 3R0NA 1W8NA 2B3IA 4MNGE 2X4OA 5BNXD 1BFTA 2IAND 5CEZE 1S7QA 5LO7A 1LP9A 5EFIA 4MYWB 3FFCD 1FP5A 1E4HA 3LHPL 3DPBB 3L4TA 3O3AB 2XUWA 1U93B 4NNYA 3GUTB 3CFCL 2GJ6D 4NN6B 4IGBD 5LGKA 5LWYL 5FIEA 1S8DB 3RGVB 1WZLA 4CVZB 3QXVA 4DKAA 3GSNA 1WFIA 1WT5C 3FQUA 4Y19D 4MD4A 1TEGA 4WI9A 1QNZH 3FBKA 5DJCB 2C7FA 2G9HA 1DEDA 1LO0L 2LU7A 2VLRA 3G6JE 3ABZA 5GGVY 3WS3A 1B0RA 4A6YL 4Z7OB 4KQ4H 3LPPA 3VD2A 4PRIB 3HC2A 1OPOA 3DWTA 3RUGB 4MCNA 4ZUTB 4ZUUA 2AAAA 2RALA 4KROC 1VGEL 4XMZA 1AXSA 2EUXA 3QUXA 1IKNA 1SVBA 1S2EA 4YHMH 4F91B 1RHHA 4E42B 4ZO7A 3G5XA 3L3DA 3OKMB 1NAMB 3N40F 4WI8A 4MCMA 3VQ2C 2DBLL 3A6CL 4KTYA 1MLCA 1A1NA 4YBQD 3QQNA 4JANB 4M6NL 5K39B 1AKJA 5EO0B 1MCWM 4APQD 1BQKA 5C09B 4GP4B 4GI9A 2XNAA 1RZIA 1SLWA 2IQ9H 4ZS7H 4GBXB 3BP5B 4FNPA 1MQKH 5JHLL 1KELL 3BKML 2XV0A 3OAYH 4NKOB 3KCPB 4OZHE 4ERSL 2Z8SA 3DBXA 4M1CD 4IOIA 4XX1E 4JO2H 4JKNA 5ESQA 3CH1B 3BSHA 3RYMA 5EU7E 3O6MH 4UDTB 1K4CA 2BSSA 4GIOA 4KDWA 4MX7A 3PHOB 3RILA 3HNVH 1MCFA 2ZUWA 4QRPE 3DTUB 4JREB 4MMYA 1MH5A 2DAVA 4AYID 3VFSB 2UXTA 3QO1A 4PJFF 1PFOA 4LCWB 4KO7A 2VERA 4M8UA 4QOKD 3D30A 1MFCL 3HG1B 5J11C 3MMEB 5IZ7A 4HXBL 5BO1H 2Q20A 1F13A 1NLDH 5DT1L 3W56A 5F9AC 5KUKA 2FWSA 4AGMA 5FXCH 2HFGH 3BH8B 3CZKA 1W72H 1H3WM 1GW6A 4GMSL 1XGZA 3U36B 5I0VA 1N8ZB 3NRPA 4G1MB 2D7OA 4WEEA 3UTTE 2DLTA 2XACC 1D7CA 3ZKMD 1IC1A 4HIPA 2GIXA 4E9XA 3LKRB 4AEHH 3WJMB 3SZ6A 2PWDA 4H8WL 3BZ4B 3KWTA 1MKFA 5DZVA 5CINL 1A7PH 1LEGA 3N40P 1DDHA 4HDIA 4K8RL 3KWWB 4PBDA 3U6XS 5B1JA 3CZEA 4QRUB 3NP3A 2HJKA 1JCKA 3MCLL 4FQLL 4M7JL 3UERA 2Q2EB 2OMVA 4M29A 3SJVD 4MBOA 1SMAA 1ORSA 4FYSA 2NSXA 3ELQA 1V7NL 2EECA 4KTEL 3LZPA 5I1JL 1YNTA 1T7ZA 1MXGA 4AE1A 4CW1B 5CSBA 2UWEF 3WTSA 5HGDA 2XYBA 5BV7L 1DQKA 1E4XH 5I8KL 1HZHH 1FZOA 4ZDHA 2NXYB 1FL3A 3G5VB 2DLFH 2WB7A 1TG8A 3FT3B 4JEGB 2E4FA 3CFTA 4PJ9B 4R7LA 5AW4B 2MOVA 4AIZA 2RHEA 4JFYB 4XN1A 4TRPH 2ICEA 4OTXH 3ZTJG 4M9OA 2F19H 5EOQH 2CQVA 5D7IA 1OK8A 4TN9A 5I1CL 1BFVH 4XPHL 1K4DB 1N7ML 4POZC 1XB8A 4YBHA 2O6PA 4H44C 4PI0A 3BEWA 3SYAA 1A3QA 2IO5A 1EQWA 3AG3B 2OR7A 3OVUB 4I2XE 1EIBA 4DKDC 1J0ZA 4XP4H 4HKZA 3R7QA 3VWKD 5KZCB 3QPXH 1QWNA 4DZ8B 1EDYA 5AUMB 1M71A 4LEOB 5H37G 3X3FL 1JPFB 2W80C 2QVTA 1QKZL 3VXTB 2VUKA 3BP4A 2HA1A 2I27N 3OGCB 3KYKL 1BJMA 4G8GB 3VXRE 2WUBH 3STBA 2CHXA 5CKAA 2EVIA 5AYQA 4HLZG 1QD0A 3PF2A 2LE9A 3Q1SL 4NZRH 5I6PA 5FWQA 2V7HB 4WSJA 5MEQB 2ZOLA 1U2HA 1EHLH 3LRHA 3PHAA 2JB5L 3VGHA 1RZKH 3R4RA 1MCPL 4HWBL 1LILA 2B5IB 4CGUB 4FAAB 2JKLA 3ENEA 4K5LA 4G9DA 1NDGB 1SN2A 2M8XA 1VGKA 3QDJA 2VDQL 5GZND 3O9WB 3P69A 2ERJC 4OZGA 5IWLC 3C5ZC 4L4TE 5DYOB 3GSVB 4GSDH 5CCJA 1E4WH 5E00B 2ZX7A 4UNTA 4HV8A 4UIMB 3JYCA 1NC4B 1T21B 1EEZB 2P48B 4J1UA 4PRHE 1HCVA 4ZO8A 4GSXA 4PJ8C 1NANH 5INDA 3WCYA 2PPAA 3NABL 5CP3H 5IKCA 1Y6KR 1WZ1H 2OMUB 3UZVB 2WGNB 1PX3A 2FIKA 4YWGH 2ED8A 3Q2CA 4Y8DC 4IBUA 4RESB 1ZEAH 4TTGA 2E7LC 2AV1B 4YE0A 2OXGA 2XDHA 5D2LF 5DHXB 3ZGIA 4EI6B 1CDIA 3WDIA 2L04A 5BVPH 4XMWA 1J0YA 4HOXA 1M42A 2FB4L 4QCIB 1VACB 3Q8CA 3ZE1F 3D0AA 2R0KH 1YUHB 1NINA 1A2YA 5EU5B 2X3AA 3PUUA 2DQCL 4G72B 1S7UB 4XCYB 2QSCL 1EZLA 1A7NL 3HE7B 1YCSA 1EVUA 3EBAA 2H4EA 3UTSB 3HMWH 4JPVL 3WAKA 4J8RA 4U1LA 2A5UA 5DMIL 4CUCA 1TJGL 1VRSA 3QEUB 4OQTH 5DD5H 3U2SB 4OJEH 4PUBH 1OF2A 3D8MA 2J1KA 2WAQA 4G8FA 4PRHA 2B59B 3PP4L 1CE1L 4F2MA 4ZZFA 1ZIAA 5KYYA 3DURB 1CD8A 2YBRA 3F12A 4JY5H 5L9DL 5JW4Q 4OV6F 1IFRA 2L7JA 4OJAA 2A1WH 4Y4KD 1Q9WB 1NGPL 2XQYK 3MOAL 3FOMA 5I5JA 1CDGA 3J8F7 1MJ8H 3VI3F 2J71A 3O8XC 5IGXL 4PP2B 4YL9A 5FUOL 1UJ3A 1C8PA 2OM5A 3OZKA 1R0AL 4GMTL 1FIGL 3EDDA 4JKMA 4WWKB 3KNBB 3UPAA 4CU7A 1E2ZA 1XBDA 3MA9L 1TQCC 1UGKA 4O02A 1INEL 2W81C 2E7MA 3WO4C 3C6LB 2DLGA 3NZ8B 2Y3AA 3VFUB 1FORH 4HFUL 1AHWA 2EDJA 3PWPE 3EFFA 4UT9A 4E5XB 5DJYB 3N85L 2P28B 2YGOA 4HIIA 5FK9B 3CUPA 1NFIA 3MV9E 3QNZA 1Z5HA 3V2AR 2YEQA 4WU7B 1IT9H 1BZQK 4W6XB 1YPZB 4XMKH 1DQDH 5BUGA 1JNHA 2JLLA 5JNYA 2J4WH 3KYOA 4HK3J 3P3TA 2HWZH 4MJ2A 4BSVB 1ZT1A 4LRIA 3VG0L 2OTWA 1L0PA 3TA4D 1O7SA 4TL4A 4R7XA 3TYGH 4DP7X 3SO5A 5I5RA 5TE6L 5T3XL 4JQVC 3BIKB 1W16A 2CDFB 1FYTD 3K74B 2EIBA 4ZO6A 4GO6B 5CD3B 3L4ZA 3CSFA 4E9SA 3HG4A 3TZVD 4UV4H 1FNAA 1NDTA 2KZBA 2X09A 3QYNA 1J11A 1T1ZA 5EA0H 3T2PA 1XSJA 3QDMB 1TTCA 3VMPA 5H8DA 3KWUA 2JV6A 1NGQL 3C8HA 5L7XH 3C60C 2DMBA 4M5YL 4MASA 5IP4A 4DGVL 1KPVB 3FTGB 4WV1B 4ZMOA 1Z5LB 3KLLA 3WSQH 3PWNA 1BQUA 3NG5A 3AABA 5D5MF 4Y1AB 3VI4B 4OZIA 3FSWA 1IGML 5KBMA 4LGRB 2JKSA 2X0VA 4JY4A 25C8H 4UT6L 4IRJD 2C9UA 4Z8FL 5BZDB 3O3EB 2DYPB 2RD0A 3IJHB 1IQDA 4IU3A 3QXAB 3L16A 5FUZL 4KWUA 4AE0A 3CCHA 1WP6A 4WHYH 4WW2B 3L81A 3HFMH 2WTRA 1UASA 3FXIC 4L23A 1YC8A 4MMXC 1BG1A 3P3RA 3BT0A 2GBVA 1ZT4B 1JFQL 4HQQL 1G7JB 2O5YH 2OXHA 4KK5C 3GJFH 4AK1A 3AMLA 4E5XG 2Y6TE 3JYBA 4FMFA 2IFFL 4N4YB 1ERNA 3IFLL 1KCLA 4X6EB 1ANUA 1A4AA 1L9MA 1T22B 4TSBL 5E1AB 4K2UH 4HU8A 1BSIA 5JIPA 5KVEH 2EUZA 4GRWB 5K9KB 3ZMEA 3A22A 5J6GA 1OD7A 4KUZL 5SWSB 4YZWA 1FHGA 1EVTC 2ENSA 2VDML 2ZWZA 2CBTA 1X7QB 1ZJAA 3NJIA 5BS0B 5DS8A 3IKCA 4EBQL 4AQEA 4A7GA 4KKCC 4M1DL 5HDLA 4JQXC 4ENED 1KIRB 4HJGA 1QLFA 1UZ6E 2VDLH 3QFJD 5C0FA 5AOLA 4NYLB 4KZCA 4HGWB 3MUGA 5LXGH 3MLTB 3FQTA 2HX8A 5E2UH 3WFEL 3QI9B 3P30H 1BAGA 4PJEB 5F7BA 4F7EB 3APDA 4R2GB 3GLDA 3GSXA 5GGUB 3S2AA 3LPOA 3CXHJ 2J8OA 4UILL 3QUYC 4PJXE 1ET8A 4FMVA 1SZNA 1TTFA 1X5XA 3KPMA 2XQYA 2CBQA 5DUPL 4P2RA 1MAJA 2RJMA 4D0CB 4B27A 3VFOA 4E9WA 2GUOA 5EF0A 1TLKA 4PJIF 1NCDL 3V0AC 1L0YA 2AERT 4KNUA 2DTSA 2NW2A 4AYFA 3VG9C 2XZCL 4NN5B 3SDAB 15C8L 3QJHA 4R4FL 4BYHA 5FOBB 4KK6C 5E2VL 4XPBH 5AVQB 5IQ9A 2C1OB 3L7EA 3AM8A 1DQML 1PLAA 5E8EB 1JGVL 1T7XA 4WRLA 5F71A 3L3HB 3PGFH 5LNEA 1T7VA 3GBDA 4LSPH 3RTQD 3RVTD 1F42A 3MCKA 4B97A 4QRBA 5KBNC 1AQHA 2OQJB 4I3SH 4HOMA 5KSUB 1OTTD 3BSZH 3M7FB 3M8OL 3MXVH 4Y4HD 1I7TA 3EGSB 4LCCC 1OCRB 1XGQB 2RQEA 4LQFL 4YSTA 2QADC 1QACA 5CGYD 4IBYA 2C34A 2VXQA 2XQBH 3IDYC 1ICTA 3EYVA 4AH2A 3QUHA 1L9PA 3D50A 4NN7C 4EDWL 1LLAA 2IC2A 1WLHA 2AABH 1ES0A 1QQDA 2YD8A 3FTUA 3U30C 2J8UE 3WV0A 5SV4A 5JPMC 3W0WA 1GW0A 2AJSH 3EGDB 4EI5D 2CNZA 5HPOA 5CBEB 2JLPA 1RPQA 3KYMA 4GLRI 6CGTA 4X7TB 3VFVA 3I6SA 5GJTL 4J4PD 3BKJH 3FJTA 1J8HA 4AYDC 2ENJA 5A7BA 5G2NA 2ATPA 4YDJB 1FVCB 4AQOA 1KJ3L 4F7PA 3T0EB 4Q4IA 5AYUH 3TEZA 4HIJA 4ZSOA 2OYLA 1RZGB 1KY6A 2B8OT 3EJJX 5DWUH 4FNTA 3C2AL 1R3KB 1HHKB 1HEZB 3JWNC 2A6DB 1WGVA 4PCYA 3UYRL 3LKSA 1SLVA 3IDNA 2FZ3B 2OSLA 1EGJA 4UU9B 1IL1B 4FOMA 1I1FB 2Y06L 5JXEA 2EEDA 1XGYH 3CSYA 2YD6A 2VZUA 4O2FA 1BQHG 1BXXA 4I18A 5CHNB 3L7FB 2D7NA 4ZX3A 5B3JE 3MJ6A 4GAGH 3TPUB 1GPOL 2ITDB 1CVSC 3I84A 3G6DL 2DZEA 2HKHH 2M83A 1CXIA 3UDWC 4GXVH 2XZZA 2WSDA 5D96B 2R4SH 3MJWA 3UADA 1L7IH 1YEIL 2B4CC 5GJSL 1DSYA 3D34A 2YAPA 1JP5A 1KZQA 4KKLC 3D69A 5TD4A 3V55A 3STLB 1CE6B 4IK6A 1RP9A 4YUEH 1J8SA 4Q6IB 2VSMB 5JIMA 2I9LA 2YKKA 2VR4A 1JXFA 1QUPA 4FABL 3N43F 1U8OB 1UD6A 5AW9B 4FFYA 3FO0L 4FFWC 1RIVL 2Q76B 4RA3A 1TZHA 1MFUA 2QLYA 4QRFA 4LCVA 4P4KC 1JWMA 4LLUA 3PS6A 1QBAA 2RGSA 3PHSA 5IVOA 1A6TA 2GCYA 3ZDWA 1PKQA 1DBKH 1KJ2H 2N7AA 3ZSTA 5K5YA 2R2EB 3MA7A 4RWYL 4ZOBA 3FQXA 5IFAH 3GUFA 4Y2OA 4G1EB 2NZ9C 4X9BA 2FR4A 2W8CA 1TIUA 2AJYH 1CFTB 2XIIA 3BUYA 5EEYA 1U91A 1A21A 4Z5RA 4KXCA 4PSRA 4P2YA 4WUKH 4N2AA 4K73A 3UIZA 3LH2H 5I15H 1BFSA 1QZ1A 4HJEA 3TO4B 4GW4B 3QNXB 4MMZA 2O1AA 3BJLA 4OF0A 5F7EL 2IAMD 2B7DT 3LQMA 4KJYA 4PGBA 1NC2B 4HK0B 1TFPA 3I75B 2GG1A 1P1VA 2WKGA 1ETJA 4AEEA 4EKXA 4HJ0C 1F97A 3X11A 4FF9A 2E7CA 3GEWB 4PVMA 2VDKH 3MODH 3WXVL 3QUZB 3LKQA 1SUHA 3SE4C 4OAWB 5E6IC 1EXUB 2PKDA 2XWRA 3U0PA 2CRIA 1MFDL 3QR0A 3HZYB 2P7TB 1UH4A 4D2NA 4Z77A 3CXHK 3OR6A 4WTZG 5AW1B 4FQXC 2FSEA 1H3TA 5SWZD 1IAIM 1OCWL 4KDTA 3BAIA 2NRDA 3FT9A 4FGMA 4WK2B 4EN2A 3LZLA 2XY2A 4JN1H 4WU5A 3C5JB 2JCCE 5HHMB 4KROD 2VR9A 3VFWA 1CF8H 3GTNA 2J1ZA 3P11H 4X0KA 4O9HH 3UPRA 4LNVA 3ECQA 2OJZL 3ZE0E 4HU2A 4QGTA 1XB3A 3QWQB 3FB7A 4N8CH 1JDCA 4IRSC 1SGKA 5BJTA 2APXA 5KBKA 4G6FB 3IGLA 4M7ZC 4H13C 5D7LE 1DFXA 3TO2A 4W9GC 3T8VA 3NAAH 4DQOL 4HAFA 5I76B 5C0AA 5IVXA 3BDXA 3WHXA 4LSTL 1JMXA 4R6UA 2ZAHA 3QIBB 1RLWA 3O2WL 3IVKB 3V6FB 5EOTB 1EHNA 1JD9A 2OMTA 2AJ3B 1X5YA 4CKQA 1KXVC 3Q9PA 5C70A 4XCEB 1IAKA 4B9ZA 4LKXB 3TU6A 1MWOA 3ATBA 3BE1L 5DJXA 43CAA 1SYSA 4M56A 5T3ZE 1QA9A 2C9AA 1TVDA 3TA3C 3SGDI 1NGXA 4G7YL 4JG1H 3GRGA 3GXNA 4P46B 4U7MA 2NZIA 1N26A 3ME0B 4M48H 4Y2LA 4Y2NA 1T1XB 3TIDA 2XVLA 3PAYA 5EBMB 5HYQB 4QR7A 5D1QC 1F58L 3U25A 1PJ9A 4JJHA 3TS8A 5FOJA 1WPCA 3L8QA 4WUUE 3HC4L 4NRXB 1BVZA 4KTDH 2DQMA 2UWEA 4XXDA 4HCRH 2FQEA 1IUZA 4W9DC 4FFVC 3QEHA 2X44D 3SQRA 4F93B 3FYIB 1H5BA 1XSKA 4YX2H 2NOYA 4NAJA 4DVRL 4JFQA 2MPAH 4GW1B 4EIGB 1OB0A 4AOFA 4HKJA 3R1GH 2AVFA 3GM8A 4BH8A 1P7HL 2R15A 5TE4L 3SPGA 1VJSA 5D1XC 2BSEA 3ZJAA 3QHFL 4WI0B 1XCWA 5LDSA 2DS4A 3PHQB 2ZCLL 1OSPL 2BINA 5JW5B 5CR8A 1YN6A 2AW2A 4UZSA 1CB4A 1HL9A 2J1WA 3L2NA 2N0KA 5JHDE 4F9LC 1MJJB 4I0PB 1B4RA 3GXMA 4E9RA 1MCOL 1H9VA 1LO4H 1ZHKB 2YGNA 3MTRA 4PLJC 3HZKA 5JHBA 2YPVH 1T20B 3A6BL 4P5TB 3CFBB 1NBQA 2EABA 3T4AC 3ZRSA 2FX8L 1HCZA 2YXMA 1DVZA 3OSKA 2PYFA 1WA1X 3K46A 4OZHF 3CZUB 2X1WL 3BKCH 4ZFFA 1ZLDA 3LNIA 4JFOA 4TVSa 5FYKU 3ULVC 1DFBL 2CDGB 1V7MH 2V3FA 1ZPUA 4Y5VA 3WEAA 4B9GA 5IM7B 4POZD 2F54B 3QIUC 5CXPA 1XD0A 1U9KA 1JTOA 1ZVSA 2WLIA 4Z76A 5F1KC 1WBXA 2HT2C 5I8CB 1CU4L 1YNKL 4UUJB 5ELIA 4HP5A 3PNRB 4HBCL 2E47A 1TNNA 4FN0A 3HS0A 2JIXA 1AJ7L 3JUYA 1TCRA 5CP7A 3WIFA 2B9AA 1SMDA 1E9OB 3VX1A 1T89C 4HSAC 1HHIA 1PY0A 2BMKA 2AXFA 2ROXA 4GKLA 3PDGA 4MFHA 5AZUA 1OKEA 3VB8A 4F7MB 3OTTA 4HBQA 2EVJA 2BFGA 1OGPA 4XNMA 1VESA 3P9MA 3RPIA 1HOCB 1U3YA 4LVHB 3S5LA 5DQJB 5FECA 1IQWL 3F84A 3NFPA 1U95B 3ZKXC 2D0FA 1Q8MA 4C8XA 1U58B 1WIUA 4RZCB 3ZOAA 3LEVH 1Q0YH 2M2DA 2GI0A 3UJTL 3JTTB 3VQMA 3BCDA 2ZOKA 4JM2C 1V5JA 1D5IH 1DJGA 3WLBA 1E5ZA 5IR1B 1YEKH 3DPDA 1OGAD 4M4RB 1FFNA 2P49B 3ZTNL 3QDAA 5D2LA 2H1PH 1CWVA 5D6DC 4Q0XH 4RAUA 3RJQB 4NAQA 5JLZA 2FLMA 1LM8V 3D4YA 3QS3A 5GGTL 4OCRH 3ULUF 4ONHB 1WG3A 3L3OB 4M62L 3C5ZD 1AG0A 3DGDA 4G7VH 4UZUA 5ID0B 2KT6A 1BECA 3OB0H 4JVUA 5DRXA 1ET5A 3B83A 2AK4B 4PJGB 2ZXEB 2NY2C 3QDGD 5CNHA 5BPPA 1KOAA 1KXQE 4XPFH 4PJBE 4FLOA 1J1PH 2DLHA 2CIKA 2X42A 2P9RA 3BAEL 4YDZA 4Y9CA 5TQ2L 4PJ8D 4ELKB 3KR3H 4LNRB 4YS4A 3KVQA 4B0MM 3KWVA 4P8QA 3H56A 2X4SB 1LK3H 4NZTL 3UTOA 5CILH 2ALAA 4UNUA 4HIXL 3TT1L 3UBXA 4AXWB 3FB8B 4WFHE 4L8SB 1A6AA 2PO6A 4PY8J 3FRPG 3K72A 3DO7A 1BVNP 3BQVA 3WD5L 3MI6A 3MLVL 3KPRD 3TJEL 1DVFB 1U3HB 4GG8B 3WHE1 3FU3A 5FO2A 3ZIMA 3M17B 1UQSB 4OCSL 4JFEE 3RQ3A 2F5AL 1QLEH 5J12C 2Q1EA 2PW2A 4N9GB 4EN3A 2UYLA 4AEFA 4XNZB 4JO1L 2VN6A 2D2CC 4LCUB 3VI3A 3ZE2E 4EPSA 1YYML 3AXIA 2XI9A 5FYJE 5C92A 2XT1B 4TV3A 5IJKC 3TBWB 3AROA 3LQAC 4QNPE 5I73C 2H6PB 1BM7A 3AS2A 1FVEB 2DWDA 5LBGA 4XBPA 5IVZB 1YNLL 4V1DB 1J5HA 2Q86A 1XL6A 4YXKL 1AFVH 2TRHA 4RIRA 3CVHB 5ADOL 3VXOB 2HCZX 4NNXA 4L1HA 3E8UL 3D85B 1A47A 1KENH 1ZHLB 4DFIA 1U8CA 3BUDA 4BJLA 1JRHI 1H0DA 4PS4L 5BUPA 5EOCH 2VL5A 3OLIA 4IKKA 4DTGH 2NUTA 5E2WL 3SGJA 3BVWA 3INUL 5DMGC 3MU3A 1ZLEA 3EBGA 1VB9A 3H0TB 4X6FA 2NPLX 4JRXB 4JCLA 3O8XD 2ZAGA 4G3YL 4ZMWA 4Q9RL 4NQCB 3AITA 3HIZA 5KYXB 3U82B 1JGIA 3EH5B 3SPVB 5MERB 3CDZB 4PB0L 1TTUA 3ULVH 2UUDH 4BRJA 3RWEB 3BFQG 1JK9B 5AAMC 1F18A 1QG3A 4QRTB 5LUMA 2PXYA 3X3GL 2AMUA 5EEXA 2F7OA 4GPVA 3N55A 1KCVH 2HVJB 2XBTA 3UMTA 2Z7YA 4H0GA 2WC7A 1VAHA 2DV6A 3MNWA 5DD1L 5I74C 5EC1A 1LMIA 5CEZL 5GS0H 3UTQA 4L8CA 4JFFE 3P4MA 5ECGA 1AI1H 2DM4A 3TCLB 4DN3H 3KW8A 3V5DB 1J9SA 1NA8A 1UJTA 1OAKL 3KXFB 3UOAB 4B5EA 1BQ5A 4H0IA 1YEGH 3NCYS 1FGVH 3AG2B 1SN0A 5DDHB 5LAXB 3US1A 2VWEE 3QORB 2O6CA 2YIHA 3DX8A 3JSSA 4KK9C 3NJXA 5B21A 1HQ4B 4LHUA 1HI6A 1NCJA 4J39A 3GSNH 4N2FA 3ROLA 3B9KB 4NSKB 5IEKA 2ZSVB 1OAUL 2TAAA 1N67A 3TOPA 2G60H 1DBJL 2UXGA 3ARBB 1SBBA 1A1MB 2IADB 1HH6B 1KC5L 4NO0D 1HXYA 1INDH 4Z7UE 1U8MB 3CSBA 3D25A 4HXAL 4BCXA 1YEJL 3PQYB 3BLBA 3C60D 1D5ZB 5AKRA 3QNYB 5D71H 1IC5H 1GR7A 4YFDB 4R84A 3WY4A 3L5HA 4MAYA 3F7RA 4QJ5B 3FUDA 4HGKC 3MLUH 2XX0A 1IEBB 5I8EA 4EUPH 2I24N 5ALBH 4YN3A 3TIEA 1M4KA 4MQSB 1JYXA 1BYNA 2Y6SC 3OQ3B 2FQDA 1TQWA 2Y5EA 1QRNB 3ZT7A 1UKTA 3B2VH 3M1OA 1GS8A 3FO2B 1I7UA 3GMQB 1I85A 1MHCA 4J3XA 3B1UA 4OD2A 4P04A 2N4IA 2NNRA 3BRDA 4P2CG 4Z7AA 1XGUA 2Z93A 4KK5D 4YQXL 1XHHA 4PRAB 1CT8A 3L1OL 4M6MH 4RMQA 1SBSL 1S3KL 5J6SA 3MRBB 1C5DA 1J0IA 4IOSD 4FE9A 2EH8L 4J3OH 1OAXL 5C3IA 4JRFA 3DMMC 2OMWA 1XTLA 5FAAA 1CYXA 4LGPB 2ICES 4PJHF 1UM5H 3LZFH 3S0PA 1DVQA 1NGZB 2Z7ZA 5BQDA 4FTVA 3I85A 4JG5A 5TQ0L 1I7ZA 4I3RL 4PJIA 4GSUA 3FU8A 3V0WL 3NTCH 2JELL 4JUSA 4KKCD 2OK0L 1MW3A 2F15A 2XRAL 1EZSA 4YHPA 3U0WH 2QDVA 5ADPL 1DBBH 1S5IL 4QRSB 5E6ZA 4F15C 1F4YL 5T1KB 3PABB 5ICXA 1BV8A 3QULA 1E50A 1X9LA 4I8DA 5T1LA 4Z0XA 3N9GL 4AG4H 3AWGA 3MVSA 4KZEH 4JQIH 4UIKH 3VWJB 2FX9L 3GI9H 3NDYE 5C9JA 3ISYA 5I17B 1UT2A 3QUYD 1U36A 2X0WA 3MLXL 4OT1H 2OAAA 4WK4B 3BUTA 2XPYA 3WY1A 5EEWA 3IU4L 1N18A 4LPUA 5CM1A 3FRUA 4BQ9A 2RA1A 1W2KT 3UGEA 2R2BB 1S7TA 3HMXA 1A7OL 3LVTA 4RCAA 4JCMA 2Z31A 3BPOB 4LPXA 5AVYB 3GSUA 4JFVA 1T0NB 2XA3A 5FLVA 1G4MA 4XNXL 4YHZH 1IEAA 4X98B 1BQLL 3FU0A 1TZGH 5IB5B 4OV5B 4W9JC 2CO7B 4BFKA 2X6AA 1Z6JT 4KK6D 3MLSL 4YHNA 5BVJA 4DQAA 2PW1B 2YARA 3W2DL 3QFDA 3AS0A 2BCKB 2BXZA 2VLJD 1KYOJ 4L8DA 2NCMA 2HX9A 3ABKB 2PCPA 3ARDC 3ROOA 1OK0A 2VOTA 3U6RA 4MA8H 2FBOJ 4DP6X 1JYNA 5FX3A 3WKYA 1HL4A 4TQ8A 1JDAA 3CFKB 3D2UA 4PV8B 2WVTA 3KGTA 3OAWA 3D3VD 1A6UL 3I2CL 4Y4FB 1A6ZB 1DBML 3KGUA 4X7EC 2QADD 1AMXA 4M43H 3HNSH 5BV7B 2AC0A 2A9NL 2GAZA 1A9EA 1AE6L 2EIDA 2K6YA 5IB4B 1FN4A 4NDMB 2DH2A 1X3DA 2GW5A 2GEEA 1IGYA 4IBTA 3U9PH 2OX5A 1XIWB 2FJHB 1CBVH 1JPGA 3LD8C 1YVLA 2DDQH 4NRZB 1OF0A 4I48A 1BBJB 3C8KA 3HZ3A 3ABGA 4AQAB 3MNDA 4JPKL 3B8YA 1X9QA 1I1AC 2D7MA 4AQZA 3TGXA 4S1SL 3SE9H 3HI6H 4ZYKB 3H9SD 4XO4A 3LS4L 4E9LA 3OHMB 2Q7YB 1AACA 1N2RA 1S7SA 1TDQA 4BM7A 3FSVA 3X14B 2CKBA 1EAPA 1PZBA 4ZPTB 2FD6H 3MV8E 4ONFL 2QVFB 2WQRA 4ELMF 2JTYA 3UBHA 3REVA 2P5WD 3MRCA 3FT0A 5HBBA 3APCA 5EIVA 3WLWC 1ODUA 1A7QL 1RI8A 3VSQA 4BXSV 4LMQI 2JKNA 2V2TA 1AIFB 2GK0B 3KLAA 4MZ2A 4NO5B 4MJIE 2NY6C 1F1GA 5HHVL 4GFXA 3WGVB 3NJVA 1ETA1 3KVPA 5IHZB 1R34A 1DDTA 4BZ1H 3SPHA 5C07E 5EU6E 1HVXA 2DJ4A 2DI9A 4LE8A 1KCKA 2QQKH 4Y5YC 1EO8H 2VKWA 4MHHG 5EPMB 5KUMA 3QWOA 1W9XA 1KCSL 1G7IB 4ZUWA 1H3PL 4UT9L 2BERA 1AS7A 5K9QG 2DWXA 2JNZA 4KKLD 4NI6A 4PREA 1KBWA 1KLFA 2MTPA 3MRRA 4OLEA 5T5NF 3DHMA 3MLWH 4ANUA 3S8WA 3MRPB 3MYZA 1GH7A 2PF6A 3IDJA 4PR5B 2YMXH 1E4XI 1TENA 4CA4A 1IE4A 2CO4A 4YK4B 3GPEA 4OD3L 3MJ8A 3Q9QA 2QV4A 3P3SA 4PQXA 5FO7A 1ID5I 4FFWD 3ZGHA 3V4VB 3OB8A 4G5ZL 4P4KD 4D0BB 2J8UF 3Q48A 2JK5A 4WFFD 1S7RB 1EEYB 2FWOB 4K71B 3O81A 3QJRB 5D7JA 5GGSY 2H3XC 3NCJL 3BKYL 4OI9A 2AV7B 4JHAH 4CNIB 4K9EH 4DO5A 2NZ9D 1NLBH 2EINB 5IHBA 3II3A 4XPGL 3K6IA 3MPCA 4MHHI 2VLKA 3F00A 3D1MC 3BUIA 4NQDB 4OFPA 1KIQB 3TN0B 3X1GA 5B3SB 1ZS8B 4L4VA 2WQUA 4POYA 3U9WA 5ISZE 1AXTL 4S1DC 1AO7B 3ORJA 4KKZA 5KWYC 5K9QI 4JPQA 4XVUC 3I6LD 5J9PB 1C16B 4GG6F 5DU7A 2A2QT 1QSFA 1AY1L 3WUZA 3JV0A 5KG9B 3H42H 2PN5A 5L6YL 4TNVF 4Z7OE 1A3RH 3FFDB 5DFTA 3UZEA 4PRIE 4O02H 5AEAA 3RUGE 4DERA 4Y1TA 3QEGL 2AF2A 5B3JF 1TETH 1LQSR 1I7RB 1S7WA 4QRQA 4L5FE 4BE6A 2ADGB 4HOWA 4XRCA 7TAAA 2EEXA 3P77A 1ACYL 5EUOB 4W4OC 1HCFX 2WOYA 4WFGD 1SDAB 1YEFL 5E6ID 4GQ9H 4FQ1H 3BO8B 1T0MB 1GMEA 4H8WC 1H6EA 3PWJB 4JRYD 1HE8A 4P57A 4ZPVB 4CN4A 5E08H 1X6LA 2ESVD 2KYIA 4K8RC 3NACH 2P26A 4FQXD 4G2AA 1T66C 5FCSH 1MCSA 5HGHA 3CLFH 3E9UA 2F08A 4N1HB 1AQDB 2DWEB 2LV4A 3L9RA 3GMNA 5ENWB 4FI8A 4NP4L 3RPKA 3AM8C 4ENZA 1B9ZA 4HVBA 1MFAH 5C09E 5ISZA 3SO3B 3V9CA 2ZE0A 4LDCA 1QBMH 1NANI 3FT2B 5EN3A 4BSWB 5HJ3A 1QSEA 1T80A 3P1VA 5IT2L 1Q94B 2YGVA 1SXNA 3P54A 4IRSD 4PW9A 2Q9OA 3HN5A 4XWOC 2BIOA 2BJML 2BP0A 2NW3A 1GHFL 4R96A 2F7RA 2CGRL 2VXTL 1ZSHA 4YLBA 3HEIB 4OR1A 4WEBL 2HX7A 3VA2C 1B6DA 1MFMA 1WCBB 5KVGH 1XR9A 2AEQL 3KPPB 5CFHA 4DCQA 2PR4H 2O5XL 4YO0B 1KYOK 2IDFA 2GC4C 4LCWE 4WJ5B 3T0VA 1R46A 4D9LL 4IHOB 4V2BA 3HG1E 3W9EB 5I6MA 4X50A 3BUQA 3KYNB 4E41A 4U6XA 1UA6H 1L5GB 4PBXA 3T0ED 4AZ8B 1LGVA 4LSRH 2R8SH 4MVBC 5I66A 4Q2ZB 1ZWIB 1BVLA 4FQJH 2EDBA 4QRRB 4LASH 4Y5XB 2PYED 2ZJSL 4BZ2L 3TA3D 4RGNB 4G8EB 4WI4A 3I3DA 5TGBB 3GJFB 4FFZL 3PL6B 1J5IA 4OCNC 1KWGA 2VM4A 3RAJL 1BEYH 5CCKH 4XBEL 1ZGLM 3HI1A 4FJZA 2ED7A 5D1QD 1TTAA 4ORZC 3HZMB 3RGHA 4XNQA 3IGFA 5DRZA 1K9TA 5H37A 3T6VA 1QFWM 3GHBL 3QRLA 2AANA 1QPXA 1CZ8L 4QO1A 2JH2A 4PV9B 4YDKL 1DJHA 1V3JA 3FNKA 5L2KA 1NMAL 3W37A 3SKUD 1IZJA 1KY7A 2J6EH 3NSXA 2MFNA 1H3VA 2JCCF 2VDLB 1AZUA 3K4DA 3WXWL 4FEIA 1WBYA 3N42F 3ILQC 3QZNA 1FBIH 4AX3A 2OW6A 3DA0A 5D1XD 3C09B 3ZE0F 4M6OH 4R8WL 1AMYA 4ISVB 2D0HA 3BPLB 3UO8B 4ABUA 4DKEH 1H15A 4IMKA 4PRPB 4ERSH 2H3KA 4J12A 1MJUL 4AK2A 1M3JA 4Z7WF 2R23A 1MRFH 3GZOA 3LDBB 1CGXA 1JZEA 2HTKC 3ARGB 3QEQD 2AK1L 3L4VA 5IJCC 3IJ9A 5BOPA 4PLJD 3GNML 1QSVA 3FB5A 2VXQL 4PB9L 4AT6A 1NBYB 1OCOB 4GAYB 4GKNB 5T1MA 3IJ8A 1VENA 1H6UA 3EYOA 3J27A 1I4FA 1L7TH 3FN0L 4KO9A 6PCYA 4ABWA 3BT2L 4Q9CA 2WWKO 3UAJC 3ULVD 1C7TA 4G8GE 2P5ED 3VU2A 3WDJA 2C3XA 4OUUA 3MBWA 5I1DA 4MD5B 5FC9A 2FYYB 3QIUD 1H6TA 4OFYA 3VFPA 3O6FB 1AGFB 2HT2D 2OMBA 3L08A 1PZ5A 2FJSA 3S37X 4OBSA 3H2PA 5KS9A 4UV7H 3CDYA 5G5DB 4OGQC 2CPCA 4H26B 2XXFA 2K45A 4AI7A 3NZHH 4WY7H 3D06A 2HXAA 3G5YB 3KL0A 1A14H 2FSDA 3BLPX 5KVDH 2AHIA 1FJ1A 5HDBF 4LCIL 1OARL 4M7JH 5B38G 4JR9H 2FUTA 4UM9A 3CFUA 3I9GH 3UJJL 4JUTA 3ZHFA 3BI9X 4KMLB 1CLVA 1JPTH 1AGEB 1N6UA 4KHTH 4F2FA 2EEBA 5DZLA 1GZPA 4NENA 3QA3B 4JM2D 3O11B 3P0YH 3RL2B 3EO1A 3U2IA 3RWHA 4YHYC 3VD9A 2Q3AA 3QZWB 1YO4A 1HINH 3C87A 3W57A 3X1NA 3FONA 5CIPA 2XZAH 3VYOA 3FC8A 2E6PA 3D52A 4P2OB 1BZ7B 1I8LC 2I5YL 1IMHC 1R5VA 1N7MH 1BX2B 3B5TA 4HW6A 4I5BB 4M7LL 2XWBA 4YHLH 4ZNCD 2NY2D 1PEWA 4TVPL 3BN9C 5DRWB 3SE3A 3CU7A 2O5ZL 1JGUH 1L0QA 3LEYL 2X41A 4JDZA 5C0CE 3N1GC 3FFOA 1RKRA 2NY0B 4FFYL 3W5MA 4FKEA 1GC1L 4X5XB 2E9GA 4FQQA 1BZEA 1R75A 4O51B 1VEMA 1WFJA 1XF4B 5TH2A 3UTSE 1Z9MA 3CU1A 3OKOA 1QW8A 3NJLA 4BKLA 2VQUA 4XMPH 4Y9GA 2ADJB 5TDOB 1QI5A 3LZQA 3F5WA 5EBWA 1K5NB 2AI0L 3EG9B 1EGJH 3DIFA 3QNFA 1W80A 5EEVA 1NGYA 4AQ8C 2EAEA 1K6QH 1DQQA 1FQ9C 2V9TA 2PTUA 3MRLA 3M45A 2EXSA 5F88A 2XTJC 4AKOA 1TYRA 4YJZL 2DM3A 2MEJB 4KZ0A 3KBHE 4X80H 2N1TE 5ANMA 5ALCH 4S0TD 5FM8A 4DFHA 3MRNA 3SKJH 3QIWB 1GY2A 4WHTB 3UYPA 5C6TL 4NWUH 3RKPA 1M6UA 4KH2A 4OLZH 5CKGA 2I9TA 1DJYA 2Y1AA 4C56A 5IHUH 3GK8L 1NWPA 4LB8A 5C0CA 2DWYA 3DTXB 3SDYH 2FEEI 2WYIA 5JDSB 4N8VG 3GHEL 1FCCA 2UY6B 4KKNA 2XZQL 1D7FA 4ZTOL 4KHXH 4JHZA 2FJFB 4FQCH 1WS8A 2VYRE 4JFXA 3ZO9A 1DUZB 5EHFA 3LH9A 1RUQL 2ZD0A 3Q01A 5E94B 3NABH 4MXWL 5BW7A 4XCNB 4LT7A 5DMGD 3FU7B 1AAJA 3S35X 5L88H 1I3UA 5AKTA 5C0EA 1GKOA 1IM3D 1QR1B 1K72A 1EFXB 2DQJL 3ES6A 4RRPG 1F90H 1IC7H 1QEXA 1IC4H 4P48A 3QPKA 2CJUH 4RMRA 4CDGC 2C3HA 3MYJB 1YPZE 3NGBB 1XVSA 5IB3A 4WO4C 1ZHNA 4RX4D 4XB3A 5M95B 2GYSA 3PIQB 1TTGA 2GSGA 4KX7A 5LCVA 1M57B 1N0XL 4PW4A 3VQ1C 2NX5A 3FQ1A 1ODAA 3EYSH 5EZIH 4R0LA 1OP9A 1LHZA 2YPLB 1M7IA 5FDWA 3V4UH 3S5YA 1UXWB 3FO1A 5MHSD 2VDKB 3LXUX 3T0XA 5GS2H 1J0JA 1KB9J 4IDJL 4KKBC 4HC1A 4U0RB 5DD3H 2J3SA 4NKIH 1J87A 1SLXA 2XKNB 4MQTB 3WKMH 5ITBH 1P7KA 3FUKA 5HYJA 2A7BA 1IGTB 1QFUL 5ACZB 1BOGB 1CE1H 3UGXA 3G3LA 4OSUL 4YNYA 5C08B 1WYJA 1PG7H 3QDME 3OG4B 5I1AB 4KK9D 4F24A 4PG2A 5D6CA 2WKOF 4E9QA 2MKLC 4UQ9A 4Z95H 1FFOB 3BAYA 4G80B 5AOJA 1ZA3B 1ED3B 3WFDL 3WIIL 1BOYA 2AJZB 3K8KA 1B4JH 4ZOCA 1ESOA 4FXKC 3IGAB 3SKMA 5I30H 4Y1AE 5EC2B 1FPTL 3VI4E 1ZV5A 1M2VA 1OP4A 2YEZB 4GRMA 5DTFA 4HZLB 1T5WA 2KKQA 4HKBA 1R33A 1OEZW 5IROA 4IOFC 4XCFL 1HTYA 1DSFL 3GKWL 5DEGA 5JUEL 3M46A 3MLYL 4QHNA 5EN2B 1GA2A 2CLRA 1CG9A 3EOBA 5FLUA 1SJXA 2Z8WC 2P8PB 5IV2A 2DM7A 4QHKJ 1HKLL 1NAKH 4MNQB 4FG0A 1LO3H 3QYMA 2R4RL 3VXMB 4AUJA 2ARJQ 4IDLA 4O4YL 2KPWA 3CBRA 3BMWA 2MHAA 4Q52A 3JV4A 3VD1A 4GRLC 4PJHA 2Y6SD 3F58H 5IQ7H 4XP9L 5T3ZL 5IB2A 3ML8A 3N5AA 4J6RL 3UC0L 1ECYA 1SJVA 3HNTL 4GRWE 3V0JA 3AQYA 5SWSE 3SD2A 3OM3B 5ERWA 1MCHA 1JV5A 3ML9A 2X6VA 1QFPA 1CR9L 4RFEB 3B43A 1PLGL 3LRGA 4ZOAA 5BS0E 1GCFA 3QXUA 4V2CB 2ATKB 1YHPA 3EJRA 2HVKA 3BHBB 5F7WC 4TQEL 2UVFA 3PWUA 4MD0A 3OQRA 3U83A 8FABA 5E4EB 3VDBA 4ZQKA 1GYCA 1ZSDB 1ZHBA 5HDWA 3D4GA 1F0LA 5GS1B 3DMMD 1TZ8A 3OBAA 1DZBA 3AJ7A 3Q6GL 4Z7NB 5DJ8A 4NQVB 4M5ZH 4HGMA 3DNKA 3HKZA 3GM0A 4DVBA 3CQFA 2DY2A 3SDCA 3HB3C 2XICA 1UVQB 1V3KA 4X9HA 2I60L 4RGMC 3VRJB 4N0FA 2EO9A 2JQMA 2O30A 3FB6B 2NXZC 3NESA 3BD5A 3JWDL 5FYKH 5EWIL 5HGAB 4LLQA 3V6ZA 1PMYA 1YN7B 2X2JA 3L6FA 4N2HA 4CSSA 1WFUA 3C6EA 5IOPB 3O4LB 1TO5A 3HUJF 4Z7UF 1II4E 2WXIA 4N86A 1W91A 4LLVA 1BJ1J 4LOUC 4UAOC 4XO3A 5IB1B 4S1QH 2WLLB 4DETA 2ICWI 4NQSA 3LIZA 1QAWA 2LAAA 1BF2A 1NCBH 4PJ5A 3CVCA 1M7DB 3WHE0 3NBNA 4JB9L 1RURL 2DJSA 2R29L 1G7LB 1KV7A 1UURA 1X5HA 2XCMC 2AP2A 2WZ0A 5IUCA 3GT6A 1UM4H 4GKSA 3UTPE 1DLFH 5AAWA 1RZPA 3N1PC 4PH8A 3K0YA 1F02I 1UCBH 3TEUA 5A3ID 3JQOB 3NJFA 5HY9A 1JUFB 5I6KA 4WCYH 4ZXBB 2H8PA 4HUUA 3UTZA 1ZGLP 3T4YA 3Q5TA 5DR5H 1BZ9B 2LVEA 4P23A 1N3NA 1OGTB 1BQHA 3WE6B 4UDUA 4LLAA 2X1OA 2IANA 3FFCA 1Q4NX 2HJFA 3ZL4L 3ARDD 4QHUA 4JKLA 4IGBA 1XR8A 2VITA 2OLDA 2ZCHH 4YHIA 5GRXG 5IJVA 2XN1A 5IBTL 2AXHA 4Y19A 5E7FA 1UT9A 4JLRB 1KFAL 5ICUA 1D6EB 2F1EA 4TUJA 1SFHA 4N3UA 2BRRL 3QORD 5DUBB 4AQ1C 5EU4B 1CI3M 2R69L 3KPLB 4ELMA 4FP8L 4L3EB 4KKPA 5KVFH 1UXMA 4PRBB 1FVDB 2VRKA 4UTAL 1RY7B 2IGLA 3LV3A 4ZW5A 1EAQA 1FDLH 2F9BT 1G7HA 3MFFA 3X12B 4C54A 1QOKA 3F6LA 2JJTA 1FZJB 4BD4A 2OTUB 2P80D 2VMEA 1I1AD 3DX2A 3IF1B 3P4OB 2QSTA 4GXUM 3V0HA 4AVJA 4Z78B 1M6OA 4XOBA 4BFOA 4PYHA 5DD6A 2K70A 1OWRM 2WZ5A 2PNDA 2EC9T 5KW9H 4APQA 4CBPA 2XWTA 4AJWA 4FCAA 1VF5C 1KEML 2FO4A 3HVNA 3MUHL 1HJCA 4OJCA 4X4ZA 3WLWD 3UC2A 5LBVA 1SXCA 4YEEA 3S35L 3V4LA 5F6HJ 4BCYA 5IW6B 3WTXA 5ACMA 5H2BA 4LSUL 3RDTB 3OKLA 2Z34A 4NBZB 1Q9KB 1QLEB 2WZPD 2NY6D 4JFDD 7FABH 2W9EH 4AL8L 4Y89A 2C5DC 3VO0A 4LQFH 2X2HA 3V5KB 1CGVA 4NQEB 5C0JB 3PP3K 2OMXA 4L9LC 3VGAC 4F9PC 2A6JA 3LEXB 3IDGB 5J1TC 4KNSA 4UQ3B 3GBEA 1M7UA 4YDLB 4QOKA 5FYJL 4LLYB 4U6HA 2VJXA 3BXNB 3HS8A 3TV3H 4XH2B 3PDDA 2W9LA 3GMLA 2Z6FA 2JJSC 2B39A 2ZCKH 3V6OA 4YSPA 1VFBA 2QPFA 2QKIA 2GT9A 4DW2H 3FAXA 1NOAA 3FQ2A 4GG6A 1I9JH 1QEWA 3SDDC 4BH7A 2DQTL 3BW9B 2B0SL 3KL5A 1GZHC 4EQ2A 1DTUA 2BIIA 1G1CA 1EJFA 1KPUB 5FUCC 3B9VA 3E6HB 1T0OA 4WLCA 5F1SA 3TYFA 4N2CA 4RBPK 4Z3HA 5C2UB 4ODHL 1SXAA 1U8PB 1NIEA 2FIRT 1FO0A 3AWEA 1J1XL 3E2HB 3MBEB 3SJVA 2CGZA 2XA8H 2R56L 2XPGB 4OJYA 3GFUA 1VPOH 4U1MA 3KMDA 2DQDL 1G1KA 3K6SB 1H9DA 1AGDA 2APFA 1HZKA 1UXSB 2QVMA 2VDNL 4RDBA 4UB0L 1HH9B 3DIVA 4I9WD 1UC6A 3GBML 1OGSA 4B9FA 4S1DD 1VADA 3TBVB 3HOGA 1G5GA 3GB7A 2XN9B 4XVUD 3RVVC 3G6DH 5JTWA 3QC6X 1SXZA 3IJSB 1JZHA 1T4KB 5DRNA 3NCBB 3R7RA 1PQZB 3VCLB 2IWFA 4PJ7B 4B9IA 4JBSA 1T4WA 4CC4A 4TULL 1I8KA 2Y36H 3ZDYF 3OPZL 5CCHE 5TF1L 4IHBA 4F7CA 2X4OB 4OF6A 5HHME 3QZOA 1S7QB 1LP9B 4JS7A 5EFIB 2P45B 4OZ4A 1NCNA 3UG5A 1NPUA 2EDYA 3HBZA 4NNYB 3VWKA 1MHHA 3E3QE 4JG0H 2Y7MA 1JZ5A 2WKLA 1OAZH 1KTDA 3FQUB 5K1JA 1FF5A 4MD4B 4K8RD 2DQHH 4OBRA 1T66D 1XH0A 4TPRL 3VFGL 2G9HB 1W0VA 1X5KA 3PGDA 2VLRB 4JFZH 3NEOA 3WS3B 2DICA 1B0RB 1PW3A 5A1AA 5AW0B 1PG7W 3DV6A 4DKFH 4HEMA 5JPNC 2JI2A 5FYLH 1DE4A 1E67A 4ZUUB 5IBUG 5D7EA 2FEDD 3X17A 2L7UA 1IBYA 3NH7H 4JZJC 1AXSB 3QUXB 4XWOD 1RHHB 2IXQA 4YBLB 3G5XB 4M5SA 2ZTBA 3KL3A 5GZNA 3KPSD 2WVVA 2QMJA 2WBWB 3O6KH 5F93C 1UZGA 1MLCB 4BUGA 1A1NB 3LQZA 4B50A 4CN1A 4DHLA 1BHGA 2NY4B 2DQIH 1AKJB 1A0QL 3ZMNA 5E9DD 5J1SC 3PV7A 2XNAB 1RZIB 2ARJA 2EDTA 2D9QB 3I9PA 4MVBD 1JGLH 4KI1A 5TE7H 3CHXA 3DBXB 3DK2A 3STZA 4IOIB 2P8MA 1EX0A 2VMJA 3MO1A 5FW6A 3A47A 3MOQA 5ESQB 1N6VA 3WFCH 4ONOA 1K4CB 2BSSB 4MX7B 4H8UA 1XF3A 2YBGA 4XTRC 2Z0UA 2NY1B 3SE8H 1C12A 4C83A 1DO6A 4MMYB 4RLDA 1MH5B 2IOIA 2XWCA 2LAGB 4XP1H 3QO1B 8PAZA 4Z7WA 1EZVX 3HMXL 5KYUA 2BP3A 3OAZK 2NTSP 1AR1C 2OJZH 3WUWA 5AALA 1G7QA 2BSRA 2HSIA 1KT2A 1G0YR 4OIIL 5JMOC 4Y1SA 2WBJC 1VIWA 1T03H 1JZFA 2YQ3A 4ZQTA 1MCLA 3EH2A 3V0VA 1TJIL 3IDIA 3ILQD 1DJWA 4OIFA 3T77A 2NY5L 4PYGA 2X4QA 3VD7A 4YC2C 1U0QA 4DPBX 4K3JH 1LEGB 1DDHB 4HDIB 3A67H 4K7FA 3VTAA 3MJ9L 2HJKB 4HCIA 4LZKA 5AYTA 1I8UA 4DO6A 1X44A 2OMVB 1O0VA 2F54E 1ORSB 6FABH 1SPDA 4HIQA 5I0ZA 5CJXA 2HTKD 3ULSA 1P7QD 1BA9A 2EVFA 2VUYA 1YNTB 1L3WA 2ZUQC 2GY5A 1LMKA 4NO2A 2WXNA 2YK1L 3GRWA 4MKMA 1DQJA 3HC0A 3ZYZA 1CTMA 2FX7L 2ZP9A 4ACTA 2NY3B 1FZOB 4ZDHB 1FL3B 1FFQA 1UWGH 4JMNA 3ZDZB 3DX6A 5FKPA 1YEHH 1YECL 4AIZB 3U4BL 3UAJD 2Y1ZA 3HC4H 1MN4A 1RUML 5EO1A 4DEUA 2WO3B 5KSBA 2VO8A 4N2IA 2ICEB 4EUPG 3FT1A 3EYQC 3RFZC 1UOLA 5D7IB 1WV7T 4YLCA 4W9FC 3KH3A 2GBTA 4AGOA 3FRPA 3BEWB 4HPYH 5DURB 4GS7B 1C1EH 1KG0A 1TCMA 1ZKAA 5F96L 4HPHA 4HKZB 5HTSA 1RULH 1UOKA 4DGIL 3O41A 1IRAY 2G30A 4NXKA 1M71B 2I32A 1KTKE 1UWYA 5B1BB 4F33A 4BK5A 3BP4B 4OLXL 2IJ0C 3UMNA 4P05A 4ZFQA 3ETTA 3NJGA 2AK4E 4MB5A 4NUJA 4TUUA 5AAPA 5HI5C 5KTEL 2BW4A 4J3OG 4PJGE 5B1CA 4A7TA 1MG2C 2FDBP 4X5QA 5IK3B 2CCVA 1A5FL 2VSKB 3UBFA 2WINA 3HA0A 1FYTA 3NIFF 2O5NA 1TR7A 2ZOLB 4H8HA 4P2QD 4JHWL 4L3FA 1SY6L 3TZVA 3MGTA 3ESPA 3B3IA 4YFLI 3LXAA 5CJ8A 4G9DB 4H5SA 3RB7A 3SQOH 1VGKB 1MI5D 3H6AA 3IAQA 3QDJB 3US0A 3RZCC 2FBJL 1MXDA 3SCMC 1MSPA 3DXAD 2LFEA 4FTDA 5E9NA 1JHTA 4OZGB 3NSDA 1G9EA 4KAQH 3BDBA 3BN9D 3GMRA 1YNKH 1H8SA 4S0SD 3TONA 4BEIA 4HV8B 5DVMA 2X3CA 3WMQA 4PU2A 4X6CF 2VSDA 4LIQH 3N3EA 3GSWA 4Q9BA 2BS8A 5MP6L 3QRGL 1ORQA 4J1UB 1XD1A 3BD3A 1E9PA 1UUNA 4XCCH 5INDB 1H3UA 1QUNA 4N0CC 5IKCB 2CA4A 1B0GA 4IRJA 4TSAH 4YXLL 2FIKB 4QRRD 5HD8C 1I1RA 2CKBH 4V1DE 5BMFH 2OXGB 3WNMA 1G1YA 4ZNEA 4ORGA 5T3XD 1FA4A 2DMKA 2G5RA 3VTTA 4HMCA 1KN2H 4NB7A 1XCTA 2Y2WA 1A2YB 2HH0H 1HIMH 2XTJD 2WO2B 4MGXA 1UHVA 3WJJC 4F8OA 2C4XA 4JFWA 5IMMA 3C9NA 2I69A 2OL3A 1RZJL 3FUHA 3U79A 5GGTH 3SBQA 4TKWA 4JRXE 3E9TA 5CO1A 4J8RB 4U1LB 3VRIA 4GI8A 2GTQA 4A7UA 1FZMA 1MF2H 1R19A 1JZGA 3ARUA 4YGVA 1OF2B 2MCPH 3B7YA 1T5KA 3OKYA 5I71C 4G8FB 2H9GA 2MCG1 4MXQC 1E27A 1CUOA 4PRHB 4U6YA 3S36X 1Y0LA 1DL7L 3BAEH 2FNWA 4F2MB 3H3PH 3ECBA 2ZKXA 5D55A 3CC1A 2OCFD 5KYYB 3E8VA 3K71A 2E27L 1RMFH 2YBRB 3F12B 3QFJA 2ZXWB 4GAJL 4W9ZA 1R3IH 4WNQA 4K3DH 3KPQA 3S5ZA 3SOBH 1IIKA 3FOMB 5EU7C 1ASPA 4WK0B 4QJ4B 4Q9QH 4MCYA 5CZVH 1UJ3B 4WO4D 3TBSA 3CFMA 3KXFE 4K7PH 1HNYA 4IIZA 4IMKC 5I1KH 3PDOA 4Q14A 4R26H 4DP9X 2AZUA 2WKOA 3WFBL 4W70A 3MNZA 3Q7JA 4JKKA 2LVCA 1CL7H 4O02B 5C0BD 5LBSA 4I77L 2XG4A 4FZEL 1LO2H 4B3VA 3UACA 5TDNA 1AHWB 4L3CA 2DYSB 3EFFB 3CN1A 2VLMD 1XSOA 1OPGL 4HIIB 4GY4A 4KKBD 1ZJBA 1NFIB 1R17A 3CUPB 3KDMA 3QNZB 3MRIA 3HPLA 4K5MA 4NZFA 2LU4A 3DVFA 3V9EA 5K59E 1AYRA 5AKSA 5HVGB 4C4KT 1D9KC 1MCKA 2BNQD 4G70B 4KY1L 1EXGA 5F7FA 2GHWB 3T71A 4FA6A 1JNHB 5JNYB 3IB4A 3KYOB 2E7BA 3EO0A 4XC1L 4Z3IA 2YKLH 3H3KA 1ZT1B 4M8QA 1FV1A 4OZFG 3U9UA 3SKNA 1JDDA 1TEYA 2OTWB 1K8IA 3PQYE 3DUSA 4WHCA 2Z8RA 3RTQA 4BFIA 5CEXA 3ATEA 3ULUC 2AJVH 3DBSA 4HUWA 4LVEA 1KBBA 2DJMA 4Y4HA 4OGXL 2C3GA 2X05A 3TXAA 2YAOA 2D4DA 3GIZL 1KGJA 4AV4A 4Q74A 2ADIA 2YRLA 1R6VA 2J88L 2MPVA 4IOFD 4BQ8A 2CIIA 4LARL 1ZGLA 1T1ZB 4W6YB 1J5OL 1QRNE 1TUPA 1MWAH 1RU9L 4RMWA 5FGBA 1F8TH 1UB5B 2DI8A 1WWCA 1X4XA 2WQVA 1BW8A 3L5WA 4EI5A 5BRZD 2JKIS 1SRDA 5DD1H 5EBGA 4U3CA 2VXVH 2XETA 5C0RH 2H5UA 3GSRA 4J4PA 3PWNB 4MA1B 1O6SA 5SV3A 2HG0A 4OZIB 5AL0A 2JB6A 2Y5TA 1OAKH 4LMQE 4WKZA 2ZX5A 4YDVA 4HJTA 2N56A 4J8QA 3D48R 4JY4B 4BE5A 1T83A 3QHTC 1SJEA 4IU3B 1IQDB 3T2NL 3OHXC 5C8JA 2P5PA 3BYYA 2AQRA 3CCHB 4FL4B 2CK2A 4L0YA 2QPUA 4DP8X 2J73A 4Y16C 1PZ3A 4Y9FA 2O72A 1ZT7A 3KDPB 2OZ4A 1QMUA 1D7DA 2WTRB 3V8CA 3DVGA 3BVUA 3EYUL 3GS7A 5A2IH 3ZTJH 4OB5L 1DQLH 4OLUH 3ARVA 2OXHB 3GF8A 2AGJH 4MJHA 5FF6A 3VH8G 3DYOA 5JW3H 2Y22A 1IJNA 2Z0BA 1V27A 1F6AA 4TLTA 1OSEA 5AOIA 4OJDH 5KOMC 3EGXA 3IFNH 1C9SA 2YXWA 3DX3A 3HB3D 4RGOL 5H37H 5J6GB 3UFIA 3DRQA 1W72A 2WP3T 4K07A 4RMTA 2X9XA 1I8MA 4XODA 2NXZD 3QUMA 3M6DA 5DGQA 2A74A 1ADQH 2I7SA 5DS8B 3VVVA 3DV4A 1V3MA 3IKCB 4QT5A 3QHZL 4AQEB 3U7WL 5TPWL 1I3GL 4HJGB 5HDQH 1QLFB 5C0FB 4LOUD 2X6CA 1UM6H 2J6WA 5FM5M 1F4HA 4WW2F 3MUGB 1KYDA 1E2VA 3FQTB 4LAQH 2D7PA 2Q7AA 2QQQA 4KX8A 5CEYA 4IIQC 1Q38A 3B5HA 2DM2A 1DVSA 3GSXB 3AVEA 5J4MA 1WF5A 5D70H 3G5WA 1UENA 4JDEA 5BW7C 3MV7D 3KPMB 3CZFA 4WGKA 1N5AA 4M4PA 4XVTL 4P2RB 2O61A 1BYOA 2EDFA 2QTEA 3VFOB 4WWPA 3DETC 2GUOB 4UNVA 4NIYE 5GSRA 4LOEA 1AQKH 4R90H 1TYJA 1M1XA 2IAMA 4NHCL 1M53A 3LN5A 5EBLA 2VC2H 2NW2B 4AYFB 5A16A 3QJHB 1D3CA 2PPEA 5C0DA 3P2TA 2CMRL 4Z3JA 1ZLSL 4LDOB 2JCWA 3S88H 3HG3A 3ARFC 4UTBL 2JSFA 3L7EB 3VXUD 1A02N 4Z9KB 4I88A 3C5XA 4ZODA 1M1SA 3NEEA 1WT5A 5IG7A 5F0MB 4PJEF 1F4YH 1WICA 3ULUH 5FHAH 4M1GH 2EKSA 2EIEA 3MCKB 1VHPA 2R0LH 3B9AA 4L0PB 3T3PB 2XOTA 2UY7A 3JWOL 5SWZA 1SOQA 1I7TB 1GOFA 2VISA 1J05A 1PZ2A 4QXTA 5AZ2L 2O4EA 3EYVB 3IU4H 4AH2B 1RK1A 3H8NA 5FYLD 4AVKA 4AYSA 1ZS2A 3GDCA 1ES0B 1QQDB 1HHGA 4PD4J 1GL4B 2ZUYA 4TQIA 4XNAA 5F7KC 3W0WB 3OX8A 2CRMA 1KYUA 5CJQL 3MRDA 3Q5YA 1UWFA 1YJDL 3KYMB 1C8QA 1SEQL 3EYFA 5CIPH 3F65A 4MLIA 4OGZA 4EXKA 3VFVB 2H0PA 4DK5A 1J8HB 3R4DA 2ATPB 5JA8B 3S36L 3EJYC 4FNUA 4O58H 1NWOA 2X1PA 4HIJB 4ODSL 4ZSOB 1J9QA 1I8AA 2W1NA 4TUOA 2R0ZH 1IM9D 1GGBL 3FHAA 3LKSB 2FQGA 3QXDA 4K3EL 4M3KB 3IDNB 2OSLB 4E2OA 1E42A 1RUPH 2EDWA 4N1CA 2HLEB 5GRWA 5CP3A 5GRUH 4DSYA 2W9DH 3CSYB 4H8VA 5BXFA 3N44F 4O2FB 3DX1A 4I18B 3OLEA 4TQPA 1WD8A 1E6OH 3V0GA 2F58H 3MKKA 1DJZA 4X4MA 4JGNA 3QE5A 4C59B 4LSDA 1BZ8A 1IE5A 5T1DH 3NDZE 1VEOA 2FCBA 3BESR 2EXWD 3EHBB 3DOIA 1IJ9A 3EJQA 3J2PA