4XNUL

X-ray structure of drosophila dopamine transporter in complex with nisoxetine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/inhibitor
molecule keywords Integral membrane protein-dopamine transporter
publication title X-ray structures of Drosophila dopamine transporter in complex with nisoxetine and reboxetine.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuL01
2B4CH 2NZ9C 5FCUL 4L3EE 4J6RH 4NKIL 3ZMRA 1IEAB 2C1PA 3OR7B 2DWDB 5C3LD 4NHUB 2RCSH 3OR6A 1B6DA 3MRKB 2IQ9L 5J3HC 2XY1A 2KBGA 5ALCH 1VDGA 4RQQA 4YHIA 2KPNA 1FDLL 2ORBH 1OAYH 5F7HA 3T04D 5IQ9B 4JFEB 2YRZA 4CDGC 3S36L 4HJGB 2L7UA 1FRGL 5HHQA 2A77H 1RPQA 3GSUA 2VITA 2MQ0A 2VLRB 3D85B 5MERA 3H42H 4R2GD 2WIIA 1CFQA 5C9JA 3B6SB 4C83A 2NX5D 5D5MA 4XCEB 4H1LH 4ZUWB 3E6FA 3MOAL 1DP0A 1KLGA 4CDHA 4BH7B 2YPLD 1JZ6A 3U2SA 2NZ9D 3PL6A 4JVUA 2Y6SC 1BZQK 1DANT 3LKSB 1AGFB 1KTRL 4YHNA 5J3HD 3U46B 2JCCF 2JJTA 4PLJD 1SY6H 1U3JA 1FH5H 5DRXA 5EZJB 4OCYH 4XPTH 1MFNA 2DIBA 3UTSA 2NXYC 3VRIB 2JELL 3IAQA 3LAFA 4D0BA 4I1NB 2EKSA 4Z76A 2IJ0C 4U1JB 5F7EH 4XAWL 1FZJA 5EC1A 4JAMB 3LCYA 3S98A 1IQWL 2GQHA 2Y6SD 4AG4H 1IGYA 3BJLA 4EBQL 4I2XB 3LKNA 3WNNA 5F7DB 4M1DL 2W38A 4LPXA 1PLGH 5HYQB 5HDQL 4WO4C 3M17B 4H26A 4M62L 3ULUL 4GKSB 5JUEH 5I9QB 5CLTA 4Z5RB 4BSJA 5H2BB 1WCBB 1YEDA 3K1KC 5FIEA 2PYFA 3NZ8A 4PJDA 4ZD3H 4PJDE 3V52H 3PP4L 2IAND 1T83A 1UKTA 1KENH 1XAUA 2Y5TA 1FE8L 4WI8A 5JHDB 2GAZB 4MDJA 3K46A 3P77A 1OSPH 1ZHKA 3O4OB 3QR2A 4TN9A 4BSWA 3CFDA 5GRVL 1SYVA 4DFIA 4PGBB 1DBAL 2AEIT 2ZCLL 4H1LB 1RUQH 4YQXH 5AG9A 3LKRA 3FJTA 3P0YL 1RUAL 4YIQB 2P5EA 5L2KA 3T8XA 5ICYA 4K3JL 2Z9TA 1P69B 2EH7L 2DWEB 4WO4D 5TDNB 3DVIA 43CAA 4POYA 4JO2H 3DUHA 4DGYL 4RFOL 1UXWA 4GKNB 1UADC 3BD3A 2Z31A 4HX1A 1OP5H 4MHHI 3FO1A 1N8ZA 5DZNA 4JRWA 5ICZA 4OZHF 5LJYH 1UYWL 3GKWH 4JKKA 4KU1A 1TITA 1YEJH 5FM5O 5HTSA 1IFHL 5TFSL 1HINH 1ZA6A 5JLZA 2B4CL 1FNGB 4J6RL 3P3YA 4WFFD 2P8PA 5L9DH 3ZKQD 3H3PH 5GGQH 4K7PY 5E94A 2RCSL 1WJ3A 4BSVA 2NXYB 2ZUUA 4XNZC 1C5DA 5ALCL 3FHAA 2UZIH 2AQ1A 1OCWH 2OQJA 2ORBL 2E7HA 2UY7A 1OAYL 1HHHA 1YY8B 3QCUH 5ERWB 2A83A 3A0OA 2E8ZA 4UTBH 2A77L 1XGRA 2IMMA 2YPKA 3PGDB 1C08B 1AXSA 3VH8G 1EA9C 4LSUH 3GSWA 3O6LH 3H42L 2IPUK 1HDMA 3UJIH 3SY0A 2FH6A 2HKHH 3R8BB 2IAMA 2VLKD 1SJHA 3DVGB 3HCVB 4NOBA 4WY7H 3C6SB 3ULSA 3EJZC 1OM3H 4JGMA 5EPMB 3F7RA 4JPWL 3H9HA 4LF3B 2HFFB 1SJEB 3I6GB 4WCYH 4K23H 5D8JH 2R0ZH 5JOPE 3VH8A 2E27H 5BCAA 4L4TE 4N5UA 1IE5A 1FL6B 2EDXA 5L2JA 3U0PA 3MCG1 4Q6IA 5DFVC 3JV6B 3NVQA 4GG6B 4OCYL 4XPTL 4DN3H 3FT3A 4I5BA 1GC1H 1X5LA 2I24N 1DQMH 3MRJA 5DDHA 4YDKH 1KFAH 5EBMA 3BPNC 3BZ4A 1BQLH 1H3GA 3BD4A 3PWJB 4UILL 1GZQA 2WNGA 5F7EL 5DUBA 4IRSC 3MLVL 3WEXA 3HNSH 3EJZD 2ZPKH 1OLZA 3MYJB 2DS4A 4EN3D 4AG4L 3L5HA 2HN7B 1OHQA 3RBGA 3TA3C 4LCCA 2V2XB 3MGOB 1D5XA 1KB9J 1WBXB 5DWUH 1QEWB 1MCLA 3IVKA 1JWUB 5DFVD 5JUEL 3F58H 4X4XA 3QI9C 5TDOA 5FO9B 3CDFA 1JI1A 1WAAF 1ZT1B 5E00B 4F3FB 4WWKA 4ZD3L 1PG7W 5TGBB 3V52L 4K9EH 1YZZA 3B2VH 1RJZA 1KENL 1EXUA 4KV5F 3HR5B 4LLUA 4FFVC 4O2CA 1OSPL 5I17A 1G7MA 4HWBH 4N0UB 3A6OA 2DLFH 3QEQB 1QSEA 3T65B 4M4PA 3ZTNH 4IRSD 1WEJH 1C1EH 1RUQL 4AY0A 2WIMA 4YQXL 1A6AA 5CEZD 4HWEH 3VFUA 1WIOA 1X3DA 3FRPA 3O9WA 5C0DB 4GSDH 4U1SA 2XTLA 1ZA3B 1X6NA 3TNNB 3L3GA 1IGJB 3IJHB 4EEEA 1P9MC 1IGFH 1E4KA 4P3CL 4EZMA 4JO2L 1PYWB 4FNLH 3QUXA 5C0BD 1VFMA 1AGEA 5GRUH 5LXGH 1FFNB 3AROA 1NGQH 3JV4A 4ORGB 3IFLL 1DCLA 5EO0A 4U6HB 3ZDZE 3GKWL 2QTEA 1YEJL 4OF8A 1IL1B 1HINL 1LK2A 3L3IB 3M1BB 2NNAB 4GMSH 5L9DL 2GJJA 3MA7B 4P23B 1NCUA 3H3PL 5GGQL 3OKDA 2WBJA 1I1RA 3OJMB 3PWNB 3V5DB 3LPGA 2FX9H 2ARJA 3B4NA 3ET9F 3OPZH 4N0RA 4XAKE 2QQLH 3B9KD 4HK0B 2BSSA 3BPNB 1F3DJ 2UZIL 3C8KB 3MFFA 1QQDB 4JO4H 4YAQB 3CX5J 1OCWL 2NY7H 5GGSY 3QCUL 5JO5A 2E8YA 3MRRA 1U9KA 5CIPH 2P5WA 4UTBL 4UDUA 4ZO6A 2P5WE 5E6IA 5TQ2H 4ENEC 3FQXB 1FNFA 1MH5B 5I0ZA 4LSUL 2X89A 3O6LL 3TJHC 1AXTH 1U92B 4PJGB 5D6DA 2X4UA 3X13B 3ZSTA 3UJIL 3TA3B 3W2DH 4I9WE 1FNHA 2HKHL 4WY7L 1SEBB 2HP4A 4U49A 4BFBD 3H0TA 2I9TA 1IILE 5DHXB 1OM3L 2YD1A 2WLZA 3O3AA 4PR5B 1PGRB 2OR7A 3MREA 3QI9B 3ES6A 4K23L 4P2RB 2R0ZL 4J23A 2X9YA 5D8JL 2C7UB 2E27L 1NMCC 4PGDB 1QR1B 1Q9KA 5D7SH 3MRDB 3UJTH 4JFDB 1CFNA 4BM7A 3IJSB 5B3JE 4A6YH 4JFXB 1JPTH 4Z0BH 1TENA 3G08B 3HB3C 1NLBH 4DN3L 3MLUL 3IETA 5IV2A 1GC1L 1A5FH 1DQML 4Y2DA 4ENED 1KFAL 1EEZB 1I9JH 5L8LB 1RZKH 4U1GC 2P24A 3TBTB 1YC7A 5E5RB 1BQLL 3OJ2C 5K9JH 3UAJD 5B22A 3TYFB 1D9KA 5IVXF 1GH7A 1SMAA 3HNSL 1A7RH 2ZPKL 1XF5B 2OJEB 3ZYZA 1LILA 4V1DD 2LE9A 4NFDA 4K3EH 1ZMYA 4NO5B 4KKAD 1KXTB 3BKCH 4UT9H 3LQZB 4R4NC 3UTSD 1LP9B 4FZ8H 1YYLH 3HG1D 4FQHA 1DE4B 3C5ZC 4I48B 3F58L 5I8KH 2H2PC 2VDQH 1B9ZA 1X5KA 3VRLE 4XXCC 3KPMB 5JOEA 4RWHA 5D7KE 1EK3A 2F53B 4HWBL 2ZWLT 5SWSA 2DLFL 5SWSE 5DURB 4WDIB 3ZTNL 1WEJL 3DURB 1C1EL 1W0WA 1I8KA 2B8OT 3BQUB 4GAYB 4NO0B 4C56A 2MQ3A 4MZ3A 3UMTA 4PLNC 5H94B 4GSDL 4LCYB 4X5WA 4ZFFA 1AY1H 2DOCA 4AM0A 1EHAA 2YC1B 3ARZA 3OAZK 3C5ZD 1IGFL 2HRLA 4FNLL 3VWKB 4MNHA 4NSKB 2H2PD 2HG5B 5GRUL 5LXGL 2P43B 2Q86A 4PJ8C 1NGQL 4WFGE 1ZTXH 4Y8AA 4RSVA 4V1DB 3P4MA 3X11B 2VXQL 4AENA 1U58B 3DTXA 3KPSE 1MHCB 1BREA 4JFPA 3W39A 1NMCB 2P5ED 5L2KD 3T0XA 2H1PH 4G7YH 4X83A 4JB9L 4KDWA 2CO7B 4PRPB 3SGJA 2AJ3B 1K2DA 4UIMB 5FA3A 3RWGB 3L3OA 2I60H 4KQ3H 3IT8D 1JV5B 5GGTA 1DSFH 4L4VB 5KSVA 5F88B 2FX9L 1F90H 3R1GH 2QJDA 3OPZL 1JF1B 2Z31D 3GEWB 3IU3A 2QQLL 3V7MA 3R4DA 1OY3B 2OXHA 2NY7L 3WDJA 2BY3A 1T0MB 3CFEB 2V6HA 3IDGB 3CZFA 2FGWH 4PJ8D 1B4RA 3WIHA 3WHE1 3HE7A 1HNGA 2ITCA 1URLA 1IQDA 5TQ2L 4JFOB 1OF2A 1TNMA 3P0VH 3IGAA 4YXKH 2GK2A 2HLFC 2W07A 4KKNA 4LVOB 2ESVA 4WI4A 3W2DL 4EXKA 1VADA 1F3JA 2YPVH 3JBG7 4I0PC 3CFJA 4ZYKB 5IHUH 1EJ6A 1QZ1A 2CIIA 2ZUWA 3V0AC 4KRMB 5LBSH 1X4YA 1ACZA 1UT9A 3SPVB 1L4IA 3N85H 1D7FA 1ORQA 4YPGB 4FMFA 1HH6B 1EBPA 5HHMD 1P1ZA 1YA5A 3KR3H 2A9MH 4OLEA 2J4WH 1F13A 5D7SL 1DL7H 3KHOA 3UJTL 5FM8A 2A74B 4A6YL 4Z7VA 1JPTL 4Z0BL 2NYYC 1A9BA 1AP2B 1X5ZA 2VSDA 4JKPH 2R15A 4JPKH 4WJ5B 2R56H 4NKMA 3OAZH 1TJIL 3VXSA 1I9JL 4BQ6A 1EEUA 2HLFD 1RZKL 3L3DA 2EC9T 3FB7A 1VHPA 1M7DB 3HC0A 3BEWB 1A6UH 5JOPD 4I0PD 1U6AH 1K85A 5B39G 1WQVT 4OZFH 2PF6A 3L9RB 4ZUSB 5T3ZE 4J4PA 3V6FB 4EUPG 1A7RL 1X5XA 4GW1B 3RVUC 3I50H 4NQXA 4OB5H 3A67H 4HQQH 4K3EL 1GAFH 2W0FB 2X7LA 3BKCL 5DC4B 3C5SB 4XNQB 4HAGA 3KYMB 1YYLL 3I3DA 5D2NA 3LSOB 5D2NE 3QIBA 1QOKA 5L8KB 3FN9A 5DC9B 1NC2A 4ETQA 5I8KL 1CYGA 2BNUB 3O3BB 3LS5H 3W0WA 3ZDYF 2VDQL 1DQTA 1CDBA 4DUXA 1A9EB 3EOYG 3UO1H 2ZP0T 1CL7H 3MNWB 5SWZA 4LSDA 2R0KH 3VDAA 1ZOXA 3JTSB 3EO1B 2BVQB 2K7QA 4X8JB 2QBWA 5CZXC 5HHPB 3OKKA 1I75A 1M1SA 1EFXB 1AH1A 5I1DB 1H3UA 1E4KC 1JGDB 1MQKH 4ZO9A 2X05A 4HD9A 1A6TA 5D1XC 2A6IB 1AY1L 1EAPA 2GITA 4MA1B 5KSAC 1MCDA 2BVOA 4WWKD 5DJ0B 2VZSA 2DQFB 1S9VA 4WUKH 3V6ZB 3VG9B 5EBWB 4U6XA 1U8KA 3ELAT 5HBBA 1QSED 5JOFA 2CKNA 4XI5C 1ZTXL 1X4XA 2DLTA 1J87A 2O5YL 5BZWA 1ZVSA 5I1IH 2MCPH 3FOMB 3LN4A 4Y4FA 5DD1H 2WBJC 1UWXK 3O9WD 3PABB 5CP3A 2IALA 2H1PL 3RVTD 2UWEF 1S9YB 3U4BH 5D1ZA 4G7YL 4KJWC 1ZT4A 1CVSC 4JM2B 1V3JA 2NLJB 5JIKA 1E27A 3IS1X 5LAXA 4K2UH 3VFMA 1QD0A 2I60L 4KQ3L 4P4KA 3U0TB 1P5UA 2W65B 4YUEH 1I7TB 4EOWH 2Z8VC 3R1GL 1F90L 3I9GH 5KSAD 3O2DA 2P4AB 3T77A 2HTLC 1X4ZA 2HTKC 4YHOH 1V8HA 1KT2A 3OB0K 4CN4A 2Z0BA 1NMAL 5FKPA 1I3GH 1M6OB 2FGWL 1J1OH 4MJ6A 2FEEI 4XI5D 5DRWB 4WUUB 1Y18A 4JY6A 2P48B 3P0VL 4YXKL 4XBPA 1T22B 2VISB 4HS3B 4KJQD 5AZEH 3FTGB 1OB1A 1PKQB 5IR1A 2YPVL 3D25A 4QHKJ 2HJKB 3SDDA 2WBJD 4LNVA 1A6PA 5IHUL 1G6RA 3P11H 3EJJX 4KJWD 5LBSL 3QXDA 1ERNA 3N85L 2ICWA 3D39B 1ZHLA 1QLFA 2BVPB 3L95A 1TETH 5D7IB 1JZ8A 2PR4L 3KR3L 3HZMB 5DJCB 2J4WL 2XT1B 2FEEL 3L5XH 1DL7L 3MRFA 4UTAH 3MMEA 1K4CB 4HIEB 2HTKD 4PJEB 1TNNA 4I9WD 4NQEA 3HMWH 4NQEE 4KVNH 5FXCH 3O45B 4JPKL 2R56L 5IW6A 1VESA 1ETZA 2G75B 3MLTB 2CPCA 3PWVB 5IFJB 3ARRA 3I6LE 3W5NA 2VXTL 4X6DA 1KJ3H 2Y5EA 1WWBX 4X6DE 1A6UL 4CJ1A 1HILB 3K4ZA 1F02I 1U6AL 5D1XB 1F4XH 1H8OA 2HT3D 3D3VA 4HKXA 1K4DB 3O3EA 5MI0B 3MUHL 5DHYB 5I19H 3I50L 2DLEA 1UWXH 1CL7I 1GAFL 1QRKA 3WFBH 3QUMA 1T7ZA 4Y2DD 3O4LA 3ZLQC 3BP5A 1YNLH 2AK4E 4JZNA 4HFWB 5CKGA 3V7AE 2NR6C 2XQBH 3VFSA 1BAFL 1JGEA 5DEGA 3LS5L 4QT5B 2OK0H 1N26A 1D9KD 3MRQA 1W8NA 1AIFA 3SDAC 5D2LA 2DM3A 4HDIB 2VL4A 1G7IA 5D2LE 1BZ9A 3QO1B 2J1KA 4HWZB 1CL7L 4X4ZA 2ZUQC 2R0KL 4GG8A 4RBPK 4P5KA 3L7FA 1CE6A 3JWDC 5C3TA 3B2UC 3BKMH 4KKLC 2EDRA 1F45A 1MQKL 3HI1A 2NMSA 4HSQA 4L1HA 4NNYA 1KCRH 4PRIE 2PW2A 2VDRH 3KYKL 2OTUA 5ETUA 2MFNA 3BDBA 2IWGA 4WUKL 2J8UE 4NRZA 4AJ0A 4LSQH 3G9VA 1MREH 3KPNB 5T1MA 1HI6A 3DOSA 3G6AB 3TIEA 4JFHD 1I1FB 1TVHB 5I16B 4C56D 4X6BB 4ELMA 3VFWA 5I1IL 5DD1L 4R0LA 2AERT 4PTUA 3SN6N 1VEPA 3EYUL 1KIQB 1JPSH 1XF1A 3MNVB 2ILLA 4LLDA 1X5HA 3B2UD 3G5YB 2EDLA 4BQCA 3QAZB 4X6EB 4K2UL 1SM3L 1T80A 1WFOA 4HIXH 1UJTA 5E03A 2IADA 3WFDH 4YUEL 3EHBC 4EOWL 3I9GL 1RJYA 1AGCA 4P2OC 3TCLB 4JQIL 1OGAA 4OZIA 3KLHC 4YHOL 3I3EA 1OGAE 1U93B 3RBSA 4OZIE 1HXMA 1VGKA 1I3GL 4G8IA 5CBEA 1J1OL 3UCRA 4KDTC 1M05A 4ZFGH 2D31B 3NABH 1T21A 5AZEL 3AU1A 5D1QA 5FYLD 4CADA 2BVUA 3WS3A 4BQBA 1EO8H 1NGPH 1NBZA 2C5DC 3K8LA 4PJHE 5KJRH 5MHSE 3P11L 1WFTA 1JNHA 4GW4A 3KPPB 4NCC1 3MNZA 4RBPH 3VXRB 1G9MH 3TBSB 1TETL 1LE5A 4IHOA 1OD7A 5I66B 3HE7D 3SDAB 4F15C 3L5XL 3FB6A 1X5IA 4UTAL 4P2OD 1U91A 1TVBB 1G0YR 3KLHD 2PTVA 2ESVD 1IC1A 5C0AD 3HMWL 4R7DB 4KVNL 4YHPA 5JW3H 4PG2A 3FFDB 1WZ1H 2DYPA 1MY5A 5KVEH 5EIQA 1JYWA 1DDHB 1UVQB 2QR0A 3KLDA 3RHWF 3OJDB 5CEXB 1KJ3L 3WBDA 3G04B 3KXFA 2V5MA 3KXFE 1F4XL 4LMQI 1J86A 1CFSA 1BFOB 4G8GB 2NTFB 5I8EB 5I19L 4L8SC 2ICCA 1UKSA 5T33H 1RJCA 3QULA 3GB7A 2EDQA 4DQOH 1VFBA 1OPGH 4ALAH 4G43A 5F89A 5GS0H 5DZLA 1Q9LA 1XCQA 4GRLA 3WFBL 4K94H 4HBCH 4X4YB 1WC7A 3DVNA 4YBQC 2OL3A 3HLAB 3VXSD 1NFKA 5F1NB 1YNLL 2OXGA 4XTRC 4ZQKA 4PJIA 4S1RH 4N9GA 4PJIE 3VXPB 2XQBL 5DQDL 3ZKMC 3S35H 1I9EA 1IEHA 3MRLB 3RQ3A 1GGBH 3GGWB 2OK0L 3LVEA 5HHOD 4D9QD 2W9LA 4MCZA 4J4PD 3H6JA 2QSCH 4QHUB 2XFXB 1P4BH 5HY9B 3REVB 3EGSB 4OF3A 3TBYA 2OTWB 4Y5VC 1LEGA 4OI8A 4OD2A 4NN6B 1FN4A 1GPOL 3VFVB 1OP9A 3QIBD 5C0AB 1NC2D 5FO7A 1JVKA 3W0WD 1KCRL 3ILQC 2AEWA 1G7LB 4YBQD 2BRQA 3MUY1 3G5XB 4X0KA 4XTRD 3RL1B 4G8FB 3AREA 4NJAH 3TBWB 1OAXH 3VMOA 4LSQL 4ONGH 4WHDA 3ZKMD 1MREL 1FCCA 5SWZD 2WANA 3GM0A 4GW5B 5FM4A 4HV8A 5DJZB 1ZXQA 3VE0A 5F3HA 1G84A 2YSSB 1IGIH 2J6EA 2LTQB 5DI8A 2YKLH 5F7WC 3C8DA 1RV6X 1BLNA 4CVZB 2VRAA 1TTFA 1S7SA 1I7RA 1Q0XH 4HMCA 1NAKH 5BZDA 4F15B 1IEBB 4R4BA 4QOKA 1FZOB 2ZJSL 1G9NH 4P3DB 4C54A 5J8OA 1NEUA 5JW4N 3SKNB 4O4YH 4XB8A 1FAIH 2DI8A 4HIXL 5D5MF 3FAXA 4H88H 3WFDL 3U48A 2YN5A 3ILQD 3P73B 5EOQL 3GBMH 1U0QA 2XXCB 5IB5B 2LU7A 3U7YH 1VFUA 5TJWK 1JTOA 1DEEA 4Y4FD 1LO2H 4GQPH 1AE6H 2GY5A 4ODXA 5CJBA 4WNQA 1YUHA 5D1ZD 4ZFGL 4XX1E 3HAEG 3NABL 2UYLA 3QT2A 5JXEA 4P4RB 4CMMB 3X12A 5D7JC 4DFHA 2ZNXA 1T2QH 4M7ZB 1NGPL 2FB4H 3T1FB 5KJRL 2M26A 3CU1A 4NO3A 3GMNA 2HFEA 1D5MB 1G9ML 4YBLC 3PGFL 4GRMA 2NY4D 5KZCD 3HAEA 3FT4A 3IXAA 1F4HA 2YEZA 2AV1B 3JWNC 3NFNB 3OKEA 4F57H 2YA2A 5BQ7A 1QRNA 5C0CB 5T1LB 1ES0A 3BIKB 4Y5VB 3TBVA 4QTHA 3AB0B 5JW3L 3LIZH 5MENB 4WI7A 1WZ1L 1FFPA 5IMMB 4YWGH 4P9MH 5EU4B 2QL1A 5KVEL 2FNBA 4X6CB 3EDEA 4OM1H 1FNAA 2NW3A 5D7JD 2WWMD 1FVEA 3WCYA 2EYTB 4UB0H 3GSQB 4ODTH 5MP6H 3ARTA 1J0JA 4B5EA 5T33L 5ID0A 4F8QA 3HI5H 1GGYA 4ALAL 2GTWB 5DO2C 3S37H 2VKWA 3NCBB 4K94L 1MAML 1KIPA 2AGJH 3DRTA 5EU5A 5FV2A 3VXNB 2AJZA 4D9RD 5F8RC 6FABH 4S1RL 1YNKL 3S35L 1F97A 4TNVK 1KJ2A 1IT9H 1GGBL 1YMHB 1SQ2N 1Q94A 4WW1A 1HYSC 3D3VD 3ULVE 2QSCL 5ITFA 1MCJA 3QISA 1X5JA 1P4BL 5HYSG 4R7NB 1W72B 4Y1AB 3FQNA 1NEZB 1PQZA 3JUZA 4EI6A 1SEQL 2UUDH 3BZFA 4OCRH 1TQCC 4NDMA 4UT6H 4HAFA 2GCYA 4N0FB 4HKZB 3U83A 2PO6C 3O4LD 3W9EB 4JVPA 1LE9A 3OX8A 1CBVH 4N0CC 4DKEH 4XRCA 4IRJA 4WV1C 2HFGH 3BPLC 5HYJA 4OLXH 5HYJE 4NGHH 3UTTD 1OAXL 5JA8B 4ONGL 4HLJA 2PYEA 1CDYA 4TVPE 3IFPB 1VB9A 3EFFA 4Z7NE 1LMKA 2DBLH 3QUYB 2BP3A 4O51A 1HYSD 4G8EA 1IGIL 2YKLL 5KVDL 5EO1A 4HS8L 4FXLA 1NAMA 1WBYA 3MRMB 2XTJC 1CGYA 3LKOA 1EO7A 1HQRA 1WITA 1Q0XL 1NAKL 3SKMA 1NGZB 3VFOA 3RPKA 3RZCC 3JV5A 3VFRB 1G9NL 2CMRH 1NFDF 3PIQB 3AFLA 3U36A 3HE6A 5H35A 2D9CA 4O4YL 4TTDD 2D7OA 2ICES 3C09B 4H88L 1QFWM 5IP4A 3MV8E 2DQGH 5E56A 4Y5XC 5EU3A 3AY4C 3C2SA 3CZJA 3GBML 3GJFA 1A0QH 3U7YL 5C0NC 1DTUA 4NKOB 2G5RA 4BZ2H 3CX5K 1CFBA 3WE6B 1HHJA 1LO2L 3V8CA 4JJHA 4RMUA 2KKQA 3H3KA 4C4KO 3P2TA 3NFSH 2VLMD 3GSXB 4JQXC 4YJZL 2BXZA 3AXLA 1NDMB 4F9LA 2NY5C 4HBQA 1AHWA 3VGGA 4WHYH 4PRBA 1EDQA 2XTJD 2EE6A 3C2AH 1T2QL 3SGDH 4MNQA 1EVUA 2FB4L 1B0WA 3L3JA 2HVKB 2X44D 4MNQE 3RZCD 3O3DA 2X4OB 4E0RA 5F7FA 1OGAD 5K93A 2YBRA 4MAYA 1JHTB 1IAOA 4WI2A 4PRNA 1IZKA 5BW7A 4HC1H 1IKFH 4F57L 5C0ND 5DD6A 5GGRB 3S3SA 1KTKE 5D1QD 3SDCA 5B3NA 4OIIL 3AS1A 4KK5C 32C2A 3CUPA 3WS6A 1A7NH 4JKLA 3LIZL 2XNAB 1MLCB 2PO6B 4LSRH 4YWGL 4P9ML 5JW5A 4UT7H 4OM1L 5DD5H 1A21A 4MA8H 4WV1B 4Q6YA 1OAUH 4ZAKC 1MVUB 3RUGF 4F58H 4UB0L 2BRRH 5CP7B 5EUKA 4PBXA 1S7RB 2Q76B 4ODTL 5IG7B 5MP6L 1YECH 3VMNA 3ZE2F 2X70B 1X6LA 4HH9B 3HI5L 5SV4A 3F7YA 3S37L 3HTLX 2UZXB 1HHIA 4OLUH 1HHKA 1REIA 2AGJL 3QWRD 1LEKA 1X5GA 2DKUA 2PNDA 4ACPA 2HYMA 2VR5A 2EICA 2X09A 4RMTA 3RVVD 3QG6A 1MHEB 4WVRA 4KK5D 5CSZA 1RZJC 1IT9L 3RZCB 5F7NC 3TPUA 1LQSR 1QBLH 1T3FA 1MCWM 2R1WB 4XMLH 4GBXA 5F9JA 1Z9LA 4ZAKD 3DBXA 4MXQC 4APQA 1C5CL 2CDEA 4OCRL 4Y5XB 1NBYB 3UZEA 4WFHE 4UT6L 3QFDB 4TOYH 1KG0B 2FWOB 3GSNA 1B90A 2HJLB 1CBVL 3KG5A 3KWWB 4DKEL 1AD0A 2LAAA 2ZUTA 1NGWA 2I25N 1UJ3C 3NCJL 2HFGL 2I9LB 1FSKC 4OLXL 1KJMB 1XCTA 2QSQA 4NGHL 5ILTH 4KTEL 5J1AB 2R2BB 1EO5A 1YN7B 3UBXI 1TMCB 3P4NA 5ANMB 2DBLL 2Z92A 5F9WC 3HR6A 1T0NA 4HLZH 3ZKXC 1OTUC 4L4JA 1KPUA 1SVCP 1EGJH 3T0EA 2Y06H 3T0EE 3LN5B 5L6YH 4HKJB 2D0HA 1JPFA 3O11A 1QVOA 2CMRL 5L7XH 5ECJE 1U3HB 3Q6FA 4PRDB 3ARED 1HXYA 3GSRB 3VRJB 2ZSWB 1DQQA 3SGDI 5FK9B 2ED9A 5CINH 2I07B 3MJ9L 4NQDB 4NBYB 1XGUA 4FTVB 1FQ9C 1M71B 5DRZB 5HPMB 4EVNB 3L5WA 2FGZA 4JDZB 2EXWC 4BZ2L 1UH3A 5JXEC 2Y1VA 4QRTB 4JE4B 5CEZH 2BOBA 4PBVC 4P2YA 3NFSL 4QOKD 1OTUD 2ZOLB 1N5AA 1FNLA 4KKBC 1PX4A 1R5VB 5E1HB 3PWLB 3BW9B 2CO6B 3C2AL 4O2EA 1CK0H 3KYOA 4RAVB 3QWOB 4CJ0A 5BS0A 4ZTOL 1QFUL 1CG9B 4XCYA 5C8JB 3LRSA 4J3WA 4ZPVB 2GEEA 5CMAA 4LKCA 5EZLB 1XGQB 4HC1L 2CUHA 5JXED 3DUSA 5GS2D 2HJFB 1CLOL 4MB5A 3VXUE 1EEYB 1LO0H 5CJOH 3CFBA 5DJDA 5IB2A 4LSRL 4UT7L 4KKBD 5DD5L 4K71C 3JTTA 4MA8L 2EYRB 5FDYA 4NNXA 3EZJB 4F58L 2BRRL 2OR8A 1OOAA 4RISH 1WIPA 5ACMA 1MCCA 2R4SH 1R3IH 1YECL 4BZYA 2HT2C 5GS1A 1A7PL 5CD5C 3H9SE 1KEGH 1MFDH 1HHGA 1QRND 1U8JB 1U95A 4P99A 4JN2A 3OKNA 3QNXB 1E6JH 3G6JF 3ZKXB 4LHJB 1LD9B 1INQB 1JNLH 4FXGA 3C9NA 3QDJD 4W4OA 2YOCA 1P84J 4XP9H 3DGCR 1UWGH 3S3PA 1Q1JH 4DVRH 3D0VB 4QNPF 3H9ZA 4OZGA 4OJFH 3BRFA 4QRPE 3CSYA 3BSZH 3LKQB 3DRQB 2VYRE 4R97C 1QBLL 1MFBH 4XMLL 3QG7H 5CBAB 2C26A 1JUFB 4POZC 3VI3F 4MXVE 3A6CH 4M1CD 2HT2D 1UM6H 5EA0L 2DICA 4OAWA 1P7HL 5IVZA 1A6ZB 4TOYL 5CD5D 4KUZH 1A02N 3RIFK 2X1PA 3GUTA 3ZL4L 3CXDH 1SYSB 4UQ2B 2NY6C 3ULVD 3HKFA 4LCUA 3FT2A 4HZLA 4K8RH 5EOCJ 1DLFH 5ILTL 3EOAA 2ITDA 3BI9X 5IBUB 4M43H 2FZ3A 3MCKB 4ZOCA 2BY2A 4HFUH 5IMOB 2EDFA 3T0DA 1NGXB 1BBJA 1J0HA 4TUKH 3T4AA 2FHCA 2AJVH 4HULB 5C08A 2FX8H 1EGJL 1KB5A 5C08E 2E7LA 2V9QA 4G80A 2FJGB 3WNOA 2Y06L 1S5HA 2VZTA 1EIBA 3MV9B 4DZBB 5HYJD 4N9OB 1JWSA 3KNBA 4J3XA 5L7XL 1ED3A 4QTIH 3LS4H 5F1SA 2Z93B 4ZOEA 1DANU 2IPKA 4J3SA 2VB5A 2PYED 3EOTH 2EIZA 5EORL 3HS0B 5CINL 4ZUVB 3UEZA 2NY6D 3F6LA 1MJUH 3STLB 4RGNC 1C16B 1CD1B 3IDNA 4PJCF 3WNLA 4L3EB 1J8HE 4K71B 4F9LC 5IROA 2C1PB 2J5LB 1A3RH 1AHWC 4RIRB 1LNUA 4HHAB 4TSAH 3OR6B 4H5SA 2CKBA 3L7EA 4NKQB 3T4YB 5CEZL 1CD0A 3ILPA 4U05A 4PJ7B 3C87A 4DN4L 3DX8B 3GKZA 3T3PE 4AT6B 2NY1C 4HKBA 3RY6C 1I8MA 1RK0B 2Q87A 4IDJH 4Z7VF 2D7TH 1CK0L 5HHQB 4HS6A 5FECA 2DJSA 2YMXH 5MERB 5DA4A 2WIIB 5C9JB 5J1TC 4U33A 3LB6D 2DQEH 3AM8A 3CJJA 3MBXH 4OUUA 1ZLVK 3WYRA 3LH2H 3DXAA 4XMPH 3WS6C 1BP3B 2WWKO 3MV7A 5B38G 3MV7E 4R97B 1CGVA 5EOTA 5J13C 3S96B 1H5BC 3PL6B 1IC5H 1LO0L 5CJOL 4QF1A 2XIDA 2VABA 1DQDH 4E41B 1NDGA 2FYYA 5GJTH 3S5LB 5IFHH 5C0JA 3U9UA 2X4TA 2NY1D 4O00A 4D2NA 5B38A 4M6AA 2UZYB 4UINL 2CK0H 4RISL 3PHOA 3V6OE 3VXQB 3BRDA 1VKXB 1DQLH 2CRMA 2R4SL 1R3IL 4TUJA 5IM7A 2G5BA 5KW9H 2HT4C 1E0OB 1NL0H 3LMJH 3TESA 3K3QA 1KEGL 5TPWH 2EXYC 1MFDL 4LFHG 4HWUA 4JO1L 3REWB 2EKSB 3IDUA 3NMEA 4O2FA 1IAKB 1FZJB 5DJYA 1AQDA 4PRAA 1JNLL 4P46C 5DJ2B 4ZNEA 4MD5A 4ZNEE 5D7LA 4XP9L 1FL5A 4DVRL 1KPVA 4D8PA 4DEPC 2YUWA 3EDJA 3KDMB 4F37K 1VCAA 3LKNB 1CZ8H 3BSZL 1T7VA 5ENWB 1CR9H 2V7NA 3RL2A 1MFBL 1T5XA 5AEAA 3QG7L 5IHZB 4L3CA 4WGVB 3TZVC 4N8CH 4QXTA 3ARBA 4RGNB 3A6CL 1BF8A 4RA0C 4DW2H 4PJDB 1UM6L 2HT4D 4Q2ZA 5DVNA 4LEOA 1HEZA 3QDGD 5DRNB 3O6FC 4FQQA 4KUZL 2EXYD 4LPTA 2GK0A 4XNYH 3OXRA 4R96A 4KI5E 1ZHKB 3CXDL 2E6JA 3KS0J 1B2WH 1SYVB 1K3IA 4JCMA 4K8RL 1DLFL 1VFAB 4P46D 3LKRB 4NIKB 4WI9A 1ND0B 4M43L 1R5IB 5DVOA 3GI9L 1A3LH 5E2WH 4U3HA 4PGZA 3E8UH 3T8XB 4YO0A 5E8OA 2LABA 2R1XA 4V2BA 2WQRA 3U6RB 5EFIA 2AJVL 2FX8L 2CDFB 2VLLA 43CAB 4N8PA 4JREC 4X6FA 1H15A 2CDGB 4M8VA 4BUGA 4UOW0 5H8DA 1H5BB 1ZHBA 3O0RH 4QTIL 3IAGC 4FOMA 1H3PH 3LS4L 1F3RB 3BD5A 4AEIH 1HH9A 3EOTL 3KPRE 3RNKA 5ICZB 1MJUL 4Y4KA 4G6FB 4ZFOA 4CU7A 4HUXA 1QBBA 4HUUB 2MPAH 3PHQA 5GZOD 1RJLB 1A3RL 4ZFZA 3W11D 4JKWA 4TSAL 1ZKAA 4EDXB 2DL2A 4JQVA 4BSVB 5HHXH 1WF5A 2DLIA 4WGWB 3VD9A 3V4UH 2B2XH 1CDGA 4QYOA 2OQJB 1QTYT 1HHHB 4IS6A 5JPMA 4IDJL 2NPLX 2D7TL 4NT6A 4NRYA 5FYJE 1X7QB 1TZGH 3FFCA 3T0WA 4M93C 3FFCE 2YMXL 2B39A 3GSWB 5HYEA 3UPRA 3V5KA 35C8H 2OP4H 4KVCH 1FO0A 2DQEL 4X6DF 3WXWH 1F58L 3MBXL 2VQ1A 2IAMB 3QQ4A 3LH2L 4XMPL 5DYOA 3ULSB 1ZLSH 3ARQA 5C0RH 5TE7H 3PV6B 1S5IH 3H9HB 3TZVB 1DLHA 1IC5L 4L4TB 3ZHLA 4LGPB 1DQDL 2LVEA 2JB6A 4IJ3B 3V5HB 5GJTL 5BS0D 1TZIA 3O6FB 5IFHL 3QEUA 2E9BA 1RD6A 5FGBA 5IEKA 4FQ2H 3U7AA 5ITBH 2CK0L 2M8XA 4LPUA 1DQLL 5KW9L 5FGCE 2HRPH 3OAUH 4CKVX 3LMJL 1NL0L 5EBMB 3ETBF 1BGXH 1V7ML 3ZE0E 3QUKA 3MRGB 4PJBA 3WEXB 4UUJB 4J8RB 4JREB 4DOHB 3VDBA 4M48L 5T5FH 5HVFB 1MHHA 3LN9A 4LCCB 5HGBA 4FFWD 1CZ8L 2EDNA 5HDOA 3NOIA 1CR9L 3SJVE 4KMTH 4QNPE 5K9OB 3IVKB 3VWJA 4HUVA 3QJHB 3FN3A 4N8CL 4X4XB 2NY3D 4DW2L 2BMKA 1I8LC 2XWBB 1EXUB 1XR9A 4CVUA 4YEFA 3BZEA 3TO2A 3F12A 4XNYL 1JHLL 4O2CB 4ELMF 1G7MB 1H8NA 4O5LH 12E8L 2E6PA 3RFZC 4K3DH 4H25A 1R24A 5JNYA 3KJ4C 1B2WL 2X4PB 5CHNA 4F7EA 1MWAB 4G6MH 1AI1L 3BN9D 4FG6C 2JIXA 4YHMH 1T0PB 1A3LL 3Q0HA 5E2WL 4U1SB 1XGTA 5ID1B 3E8UL 1DQJA 1U2CA 4M93B 4PUBH 1NFIB 1BBDH 2D7MA 1MIEH 3FO2A 2D4DA 3UX9B 4OBSA 3MJ7A 3GJEA 5A2FA 3QUXB 4BFIA 3P9WB 1MLBA 3QHTC 1FVCA 4JR9H 3F7VB 1ZWIA 3O0RL 3RGHA 1MCPH 2JCCA 1PG7H 1H3PL 2JCCE 1JPGB 5IROC 4PJXF 1EZVX 2VDNH 4JRYE 3CC5B 1MY7A 2C3VB 2FIKB 1LK2B 2G9HA 2XA3A 4RFNB 3DECA 1JI2A 2MPAL 3FOLA 1Z5LA 1FV1A 3WFEL 3CCHB 1FLRH 3HI6H 8FABA 1PY9A 5E9DD 5HHXL 5HGDB 3DYOA 2ARJB 5IF0A 5DJXA 3V4UL 4JFQA 2BSSB 2B2XL 4JRXA 3MRNB 1RULH 3MRRB 3AM8C 1NBVH 2P5WB 2VZ3A 1DBKH 5C07A 2EIEA 4XP4H 1TZGL 5E6IB 5C07E 4JZOA 4JN1L 3D87B 5JW4Q 3MPCA 4PJFF 4U1LA 2WP3O 2OP4L 2WV3A 1ZSDA 3OG6B 4KVCL 5HI3D 1KIRA 1BZ7B 2VE6B 3WXWL 3UXFA 2BC4A 1IGMH 1CIDA 4KJPC 2HH0H 3BGAA 2I9TB 1ZLSL 1GZPA 4E5XB 5C0RL 3GMMA 5TE7L 1S5IL 5B8CA 2CIKB 3SKOA 3O3AB 4D0DA 3GMOA 2D3VA 3MREB 5BVJB 4XNMB 3N1FC 3UTZB 2XQYK 4AZ8A 3VFTA 4KDVA 1N6UA 2BNQE 3P9LA 5FEBA 1CFNB 4IMLA 4JZJC 2GSGA 3QUZA 4FQ2L 3KJ4B 1QSFD 2VUYA 5ACZA 5ITBL 5IV2B 3IETB 3DXAD 4XT1C 1FG2A 3MV7D 1F6AB 1IM9A 3OGOE 1Q9OA 1J10A 2AXGB 1N6QH 2HRPL 3OAUL 3OSKA 2GJ6A 3WIFA 3BDYH 1J0YA 1YC8A 2P24B 2GJ6E 3STBA 2QQKH 1BGXL 3I3BA 4HUKB 4LGSB 2BXYA 4OFPA 2P7TB 4OV6F 4L8DB 2Z8RA 5EUOB 5F96L 1MCNA 2VXSL 2W9DH 5I30H 5FYLH 1MHPH 5DMGD 4DZ8B 5GGTH 3EFDH 3QDMA 5T5FL 3HPLA 1DN2A 3QDME 4J2XA 5J6GA 4PJ9A 4OZHE 5K9QG 4ZXBA 2N1KA 3TO4C 4CMHC 4KMTL 1AGBA 4MD0B 3QIWC 4M8QA 2F19H 3GMQA 5EZOH 2K7PA 2JLLA 5GGVY 4I77H 4B50A 4NUJB 1N59A 5IW1B 5KS9F 1CICA 4C4KT 4YK4B 5D7LD 3TH3T 4O5LL 5SWSB 4K3DL 1YEKH 3RWJB 4HCRH 4L8BA 4U7SA 3VJ6B 1I8KB 4G6ML 3CK0H 4LFHD 3U4EA 2AJXH 2O93L 1H8SA 4MJID 3GMPA 1FNEA 4ZS6D 4YHML 3THMH 2OX5A 3QH3A 3ZT7A 1K5NA 1S3KH 2BNRA 3ARBD 4ZFFB 1I3RB 4PUBL 1CCZA 4NC1C 1YEIH 3TO4D 3OXSA 1BBDL 1NLDH 3GHBH 4WU5A 4MNGE 4R90H 3CNKA 3PWPB 4G9FD 4AIXA 4U7MA 3RDTC 9CGTA 1RAMA 4HIIA 2Q86B 2WUBH 4JR9L 5A40E 4NKDB 3TVMA 2DDQH 3HMXL 1PG7L 3KPSB 4UQ3A 5DQJA 4AENB 1XF3A 5T3ZH 4JFPB 3MRPB 4HK3J 1OL0A 2P49B 5HHNA 5F6HI 3FQWB 4JZJB 4OV5B 4ZUUA 4W4NA 2DQTH 4TUOB 5FA3B 5IBLC 1FLRL 5SX5H 3L3OB 1NCBH 3HI6L 5A3ID 5C6PB 5AWNL 5B4MD 4M03A 2VN4A 3RWFB 4P2QA 4XH2B 4JDVA 1RULL 4F7TA 4JFFE 3BH8A 4GRWF 5AD0B 3WKMH 1NBVL 3QA3A 5DS8B 1DBKL 4LAQL 1S78C 4XP4L 3MOQA 3DLQR 1JJUA 3IKCB 3U0WH 1T1WA 1I1AC 3IGAB 2ZUVA 1IGTA 3ARGA 1VADB 4PPTA 1ZLUH 3CFJB 1S9XB 2Q6WB 1XIWB 4U6YA 2HH0L 1SHMA 4CMHB 3DI2B 3RWEA 1WAAE 4LLQA 5C0GA 1ORQB 5DTFA 5IJVA 4KV5E 3QIWB 5IBLD 2DM2A 2VR9A 4UI2A 3ZTJG 5K33A 1FFRA 5FYJD 4JG1L 1FZKB 3FFCD 4X9IA 5E5MB 1INEH 3J8F7 4PJ7F 4DKFL 1AR1C 2OZ4L 1OAKH 1S7QB 3Q5TA 3NPSC 1VFOA 3MLZH 1S78D 1E28A 4NKMB 2DRUA 1N6QL 1I1AD 4WEMB 3L3DB 3BDYL 2QQKL 5CP3H 3MRBA 5EIIA 3HC0B 5EU7E 2VLJA 4XXDA 2VLJE 5CJQH 2GI7A 4FQ1H 2W9DL 5I30L 4EI5C 3SGEH 1MHPL 1I7ZA 1U8NA 1UZ8B 1MFEH 5GGTL 1EPFA 3EFDL 3EDDA 4LPYA 3GSVB 3PJSA 4JJ5A 3RDTB 4MLIA 2FJFA 3BMVA 2A6JA 1T20B 5FA4A 2V17H 3MRHA 3GK8H 2C3WA 1P7KB 1G7HA 5J6HB 1IBGH 5D2NB 1AR1D 1MAJA 2F19L 2C1OA 5IB4B 5EZOL 4X7EC 4Z7NF 4I77L 4PJAA 4IIQC 4PIRF 3V0VB 4HJJL 4PP1C 3PGCA 2QKIA 1G6RH 1B0GB 1YEKL 1U8OA 2FLRT 1HOCB 4HCRL 5A43C 3ARWA 2J12B 1OSZB 2AJXL 3KYAA 3VWJD 4HPOH 3UYRL 3THML 1JMZA 2BOCA 1JZ4A 1S3KL 4ZG1A 2PCPA 4NZDA 2VIRB 3LKPB 1Q38A 1YEIL 2APVA 3GHBL 5BRZE 1KC5H 4R90L 3WN5C 3GO1H 3GMLA 3DI3B 4NN5C 4Y16A 5DHVB 4IRZH 2QADC 1U8KB 3FONB 4IMKC 4ODVH 2NZIA 2WUBL 2AJUL 3STZA 2QLVB 2DDQL 4RMVA 4LCWA 4PP1D 5BZWB 2JIXD 1NGYA 4LCWE 3LQAH 5T3ZL 5F70A 3N1PC 4FRWA 1PVHA 1EJOH 2CLVB 1I8IB 2Z35A 4AYFA 1BM3L 5DJ6B 4G9DA 1EVTC 5CWSB 3UTOA 4OI9A 3OKLB 5KTEH 2DQTL 3VFMB 2VAAB 3QFJA 3NPSB 1NCBL 4Z7WB 4P4KB 3QUMH 3ECBB 4M00A 2GTZB 1QHPA 1OWRM 1MI5D 4FS0A 1QPXA 5EC2A 3NACH 5IVXE 3T77B 5J4MA 1D6VH 3UYPA 2QADD 3WKML 4JHAH 3P4OB 2X4NA 4QRRA 3OHXA 5DQ9A 4EI5B 3U0WL 2ADFH 3IF1B 4YC2C 1MUJA 3VXMA 3VXME 4XBPB 4W6YB 5INCA 1C7SA 3IDJB 4CU6A 3SDDB 1I9RH 4MSWB 3RA7H 1ZGLA 3TN0C 2ICWB 3CPLB 4ONOA 3BX7C 4JRXD 2EIDA 4L9DA 2V2TB 3L95B 1FVDA 3D0LB 1TDQA 5FUZH 2WINA 4JPVH 4IIQB 3KPOB 3SGEI 3QJFB 1T5WB 3MMEB 5IWLA 3RGVC 4Q7DA 2XKNA 3FQRB 2BSTA 3MCLH 4NQEB 1NC4D 5EU6A 4ZSOA 5DXWA 5EU6E 3MLZL 4ZSOE 4ONHA 5IW6B 1RURH 5I8CB 4O9HL 2XN9E 3NGBC 3IKKA 4JDTL 4ODUB 1HSAB 3P40A 4XGZB 4GKZA 1SBSH 3U30C 5CJQL 2EDKA 4FQ1L 4CU8A 1QUNA 2AKRB 5EULV 3V6BR 3BKJL 2B0SL 2ATKB 3D2UA 3WN5B 1MFEL 1DVFA 4XP5H 4NN5B 4M6MH 3UTQB 1JNNH 4FHBD 4RGOH 1IGCH 4M7KL 4NZUH 3ZHKA 2ICWI 5CSGA 1KN2H 5E95B 5DK2B 1N0XH 3QUMB 1IM9D 2AK4B 2KL6A 5T3XE 1IBGL 2MKLC 4P0DA 3RGVD 1C12A 3QXAB 3VFSB 5D71H 1JGEB 5DEGB 2R0WH 3ARFA 1S7TB 3CMOH 3WIIH 4ODWB 1AIFB 4Z7UF 1A1NB 3DO3A 2ADGB 1G6RL 3QQ3A 4QCIB 4GG8B 4BELD 3EBAA 4P5KB 4PJ9D 1AO7D 2JF1A 3ALXA 4KRPC 4ZPTA 3KYNA 4PB0H 4ZXBD 4MWFA 1OAZH 2FSEB 3GIVA 1HNFA 2KH2B 4PD4K 5D6CA 1D5ZA 5EZIH 4Z78B 3E2HC 4PS4L 4PRIB 1P7QB 2I27N 2R2EA 1MFAH 4NZTH 4XVUC 4X7DC 4OI7A 1KC5L 2J8UB 1CLYL 3GO1L 5FUOH 4PV8B 5MEQA 1WFNA 4IRZL 1HIMH 4NM4H 1CQYA 1KXVC 3OR7A 4ODVL 4L3AA 5LQBH 3K1DA 4NHUA 1HI6B 2ADJB 2DF3A 3TN0B 3MRKA 3PQYA 4YX2L 2CQVA 3PQYE 2F54E 2ARJQ 3VFWB 1QA9B 3LQAL 3TYGH 2JJSC 4R0LB 1EJOL 2BNRD 4B7IA 5IQ9A 4JFEA 1PKOA 4FQJH 2F8XC 4HJGA 5KTEL 4OFVA 4CUCA 1FPTH 2VLRA 5GGVH 2VLRE 4XWOC 4XPAH 3QUML 2OL3H 4XCEA 3SE4A 1F3DH 4XNXH 5IFAH 4XVUD 3NACL 2YRLA 3TVMD 4BH7A 3DIFB 3ARVA 4OZIB 5LKNA 5A16B 1D6VL 3U30B 1HXMB 1KF9B 5EIVA 1AKJB 4JHAL 1UZ6F 5IB3B 2FATH 3LKSA 1AGFA 2ADFL 5CJXA 3TT1H 1M05B 2X1QA 2UVFA 1T21B 2BY1A 2H26B 1JK8A 3VW3H 3U46A 5JIPA 4CADB 4PJHB 5I18H 1I9RL 4GT7A 3ZHDA 1NBZB 4H8WC 4NCDA 5EZJA 3SBWA 3L6FB 3RA7L 3ZDYE 1JNHB 4P2QD 3HZKB 5JPNB 4WHTA 1FIEA 4OLYH 4XWOD 1CGWA 1OQXA 1BHGA 4IHOB 5FUZL 2CXGA 3BP7B 5IVNA 2RFXB 1C5BH 4JPVL 4OFIA 3WL9B 4U1JA 2NXZD 4LDLB 2BJMH 3ROOA 4CVXB 3T08A 3ARGD 3MCLL 1S7WB 2J6EH 4KRPB 2YZ8A 5EH1A 4AL8L 2JE8A 3RTQC 4M7LT 1HWHB 4OZGF 4I2XA 3QIUB 4PP2A 2DYPB 4I2XE 5F7DA 1K3ZA 2SEBA 4N8VA 2NX5A 1SBSL 3M17A 4H1LG 4HUMB 2NX5E 4MXVF 3KXFB 4GKSA 4TNWF 4NQVA 3FO9B 4Z5RA 2W92A 4XHJD 5CILH 5H2BA 1WCBA 1W0VB 2XWTB 2YPLA 3SOBH 1UXSB 2YPLE 4XP5L 4LLYB 4M6ML 1HQ4B 1JNNL 5JHDA 4RGOL 2GAZA 1KCLA 1XCQB 4GRLB 4NZUL 1IAIH 1KN2L 2GT9B 1N0XL 3DVNB 2OL3B 2UWEE 4PGBA 5HSFA 3RI5K 1Z3GH 4PJIB 4UBDD 4ZNCD 2V5RA 2EYSB 3RRQA 2E7CA 5D71L 2Y25A 2VLJD 2R0WL 2VMFA 3CMOL 3PP3K 4YIQA 3WXVH 3WIIL 4MCZB 2Z8WC 4ISVB 4N68A 3DJ9A 5H37G 5TDNA 4XVJH 1GIGH 5FFLA 3KPLB 4BQ8A 4PB0L 4GKNA 3TEUA 1FN4B 1K8IA 1OAZL 7FABH 2L4OA 3LY6A 1FL3B 3BWUC 4JY4A 3HAEH 4R4FH 2EDOA 5EZIL 3MZGB 5FO7B 1V3MA 4WEUD 1QO3A 3L3HB 3G5ZA 2EZ0C 3JWOH 1MFAL 3DETC 1CVRA 2K9UA 1AD9A 2DIJA 1VACB 1J12A 1FNGA 3JXAA 5GHWH 4O58H 4PTTB 3FO0H 5LQBL 2ENSA 4OD3H 1UCBH 5CEYA 5DMKB 5F3HB 1VENA 2YD6A 2PKDA 4LASH 1FFOB 1T1YA 1S7SB 3MLYH 3TYGL 4KKCC 2Y72A 1YY8A 3ARDC 3DROA 5AZ2H 5HGHA 3EDFA 1J7VR 5CD3B 3PGDA 1FPTL 3EYSH 3PG2A 1CDHA 5GGVL 4Y16D 2FECL 4XPAL 5KANI 2C3XA 3RTQB 2OL3L 1CN4A 1VA9A 3VA2C 2EZ0D 3BOVA 3DETD 3DVGA 4XNXL 5IFAL 4LEXH 4LPVA 4EIZC 4XP1H 1J8KA 1ZVHA 1KJ2H 4WO4A 1DEEB 3ULVH 4LF3A 1H3XA 2HFFA 1SJEA 4KROB 4PGEB 4AEHH 3I6GA 2FATL 4X9FA 4WNQB 5FB8B 4KK9D 1HSBB 5IMKB 1R0AH 4MA7H 3U1SH 1FL6A 1OW0A 3VW3L 5CGYC 3PP3H 1ZLWK 3TJEH 1CF8L 3QFJD 4KKCD 5I18L 3VCLA 2X40A 1RU9H 3ARDD 4Y0GA 4E42A 4NO3B 3GMNB 2Q7YB 4AH2B 4WTXA 4OLYL 4GRMB 4WFFE 3RKPA 5CCKL 4LSVH 4R9HA 3WLBB 3PWJA 1C5BL 4QRRD 4P57B 5IIEB 3VXMD 3OKEB 3SDXB 3I02A 5ESVB 5TE4H 1G7JA 4N90D 4NFCA 1QACA 1E4WH 3MYJA 2J6EL 3TBVB 1GOHA 1IAII 1YMMD 2GFBA 3BIAX 4NP4H 5C0FB 1RHFA 5E8EB 1QP1A 2XV6B 3MGOA 5CGYD 1X5AA 1DVFC 1WBXA 1WUNT 2NW3B 4JVWA 1QEWA 1N2RB 4WHCA 3RPIB 2VLKA 5CILL 2VLKE 1J1XH 3MZTA 4M1GH 3SOBL 1KEML 4F3FA 4MLSA 5TGBA 3G9AB 5I74B 1NCDH 3EO0A 1I7UB 2EDDA 3B9EA 5HYIA 3HR5A 3FCTB 5HDBF 1AQKH 4D3CH 2CD0A 3GJFH 1J9CT 4KGLA 2Y9RT 1TPXC 1H0DB 3T65A 2X4RA 1WBZB 3F5WB 2DJUA 4I3RH 1BOYA 1KJ2B 3WXVL 1R3JB 1AXIB 5HHVH 1Q94B 5C0DA 2O5ZL 1ZHNB 5JW4R 5DEZA 4HK3N 1DVFD 1IGJA 3IJHA 4V2CB 5C0EB 3FRUA 3FQNB 5E8DH 4NYLB 4XVJL 5F7MC 1PYWA 1RZ8B 3CXHJ 1ZLWH 1FFNA 7FABL 5FOJA 1LE9B 4R4FL 2PXYB 2ID5A 4LARH 1BVLA 3WJJC 4J1UB 4NFBA 2EC8A 3JWOL 4N5EC 1MEXH 1CD9B 5L88L 5CSBA 1IL1A 3M1BA 2NNAA 5GHWL 3MA7A 4O58L 3FO0L 1MQ8A 1Z9MA 4YGVB 4OD3L 5D70H 3PWNA 4G8EB 2AK1H 2R1YA 15C8H 1MCSA 2XI9A 5EO1B 3ULUC 3IFNH 1WBYB 4LASL 3RY5A 5F9AC 5KVMC 4HK0A 4YDVA 2UVEA 3C8KA 3CVIH 1HQRB 3MLYL 2AXJA 4CNIA 5F6IB 2IPUG 1BQSA 5AZ2L 4IRSA 5JDJA 3MLRH 4ZUTB 4CL7A 3EYSL 3HE6B 1MH5A 2XZCH 3UTPD 4MQXC 4CN1A 4J3UA 1MJJA 2QQNH 1U92A 3MV8B 3X13A 4MCYB 3TA3A 4OQTH 4N5ED 1SEBA 4LEXL 4XP1L 3O41B 1KJ2L 3ULVL 1Y6MR 4AEHL 2DD8H 3QI9A 5C0BA 3INUH 4P2RA 5D96B 4JFED 5C0BE 2WZPD 3ULUD 3W82A 3NCFB 1R0AL 1OTSC 4MA7L 1KOAA 3U1SL 1QR1A 3R0MA 3MRDA 2ADIB 2VLRD 3D85D 3TJEL 3Q5YA 3GM8A 4MNQB 1RU9L 4JFXA 1TPXB 2B5IB 3G08A 3TPKA 4BFGA 3GSNH 4E0RB 1YEGH 2O61A 5AAMA 1DR9A 1JMXA 3S7GA 1J05B 1EEZA 3PNWB 4MAYB 4MQXD 2IBZX 2JJVA 4OGAC 3TBTA 5JMOC 2APWA 4LSVL 4Y2OA 1IAOB 3LPWA 2B4CC 3SDYL 3OKMA 4PJBF 4TVPL 4OZ4B 3TYFA 1JTTA 4HUWB 4YHKH 3SDCB 1P9MA 2E3VA 4L29B 1XF5A 2OJEA 1E4WL 3JVGC 32C2B 3CUPB 4QHNB 5GSVA 1RQ5A 5I15H 5I9QC 5LGJB 4LVNC 3ZO0A 4NP4L 2L7JA 5DSCA 4NO5A 3U7WH 5BV7H 1OTSD 3LQZA 1LP9A 4RA3A 1O0VA 2VWEE 1DE4A 4I48A 4NNPH 4K55A 3HHRB 5CUSH 5EUKB 3RWHB 3O4OC 4M1GL 4QRQB 2GJZB 1VEMA 3G5VA 1FGNH 2ATPB 3KPMA 2WLYA 5KAQG 5I6XC 1BOGA 2YWYA 5IKCB 2C3GA 4MQSB 1HHIB 1AQKL 1UH2A 4D3CL 2X42A 2FJHB 1CDUA 3RNQA 5DK0B 4M7LH 1NCCH 4RAUB 4F7PB 3QG6B 3BQUA 4GAYA 1RMFH 4DK3A 4NO0A 2A1WH 1YJDH 4I3RL 5KVFH 3DX9A 5D5ME 2VL5A 4FA8A 4XPHH 5HHVL 5H94A 3MROB 4LCYA 4LOUD 4M5ZH 4ORZC 1T3FB 3ZDXF 1HKLH 2YC1A 4GBXB 3ZYOA 1DZBA 5JHDD 5E8DL 4XPGH 4APQB 1BIIB 3PXHA 2GKIA 1Y0LB 4NSKA 2COQA 3QHFH 2HG5A 3O8XC 5DJAB 3BVNA 4K3HA 1EFQA 2DAVA 4V1DA 1OP5K 3X11A 4R3SA 4V1DE 1U58A 4GAJH 4AQ1B 3HNVL 2AXHA 1MEXL 2R39A 2EH8H 1EZVY 3UTSE 3HG1A 4PRPA 3SHSA 3HG1E 4NRXB 4H0GA 4LBEB 3RWGA 5D70L 2Z92B 1KTLB 3H7LA 2AK1L 5A2JH 15C8L 4L4VA 4QWWC 5F88A 1QNZH 3IFNL 1JF1A 3T0EB 1AGDB 3CVIL 3VXTB 1QKZH 1T0MA 4G5ZH 1JPFB 3F7PC 4NHCH 3CFEA 3IDGA 1OTTC 1QVOB 3MLRL 4Y8DC 4QHKI 4JFOA 1N5YH 4IDLA 4M6OH 2XZCL 1HXYB 1DQQB 3TIDB 4DWHA 5JORA 1R5WB 4LVNB 4ZYKA 4OQTL 3QNYA 2NXYD 1CWVA 2HLAA 4WI3A 4HIHB 1OW0C 3C5ZA 4X98A 2APBA 1B0RB 4QY8B 4YPGA 2BCKB 2DD8L 3INUL 5B21A 3WHE0 4F33B 1XF4B 5TF1L 4XXCA 5DFTA 5I6XB 1WGOA 5I71C 4PY8I 4OKDA 2A74A 4MD4A 5DR5H 3KYOB 3GSNL 3VU2A 1OTTD 2P5EE 4LVHB 5J0BA 5L2KE 1YEGL 1MRDH 3VD4A 2H3NA 4XCYB 4DGVH 5BOPA 3LRSB 5D4QA 3X3FH 3IU4L 2Q8AH 1M7DA 2D7QA 1CT8B 3VXUB 3C6LC 4YHKL 1G9EA 4GW1A 3RIAF 3O8XB 5I15L 5INDB 4PJ8A 4P9HH 1TQBC 3U7WL 3QCTH 3C5SA 5DLMH 2VSCA 1CGSH 4XNQA 3JTTB 3KYMA 4XC3H 5F1KC 2IGFH 4NNXB 3PDOB 4IEFB 1U8MB 4NNPL 4WFEE 1JP5A 5CUSL 5E2UH 2BNUA 3O3BA 5FGSA 3H9SB 5HVHB 2DQIH 3B9DA 1FGNL 2RJMA 1HHGB 4JANB 3OKNB 1J88A 5EBLB 5HHME 3MNWA 3WV0A 1F11B 3I85A 2DI9A 3JTSA 4ZO8A 4M7LL 1A22B 5IOPB 1NFDA 2BVQA 4QHMB 3ZZ1A 2CKBH 4FXGB 1NFDE 5HHPA 1RMFL 1BECA 4S1SH 4KK6C 2A1WL 3MO1A 1YJDL 5I1DA 5KVFL 1MCHA 1JGDA 4QRPB 4PGJA 2RR3A 2CLRA 1G0XA 3BEVB 2ZSVB 1HKLL 3MGTB 5DJ0A 3WDHA 2DQFA 1GC1C 3BGFC 2E5EA 3V6ZA 3WFCH 5EBWA 4I0PA 5CJ5A 1S9KC 1U3YA 2B1HH 3BE1H 3QHFL 3QEQD 5IVZB 4MJ5B 1G1YA 1CDJA 5FM5M 1UGNA 1SY6L 4OLWH 4LGRB 1HYRC 4GAJL 3FOMA 1FH5L 4P23C 4XMKH 3PABA 4XNUH 1FORH 2EH8L 1S9YA 3QXVA 1P4IH 2ITDB 2NLJA 5I71B 2FZ3B 1XGPB 4KK6D 3P9MB 5IBTH 3RWDB 2OR9H 2W65A 1AR2A 1AC0A 4YNYB 1I7TA 3T4AB 3ZKNC 1QNZL 3Q48A 5C08B 1JGVH 4U1HB 1QKZL 2EO9A 1I1CA 1H9VA 4G5ZL 4NHCL 1F4WH 3DX7B 4ZOBA 1JWSB 3KNBB 1M6OA 4LP5A 3T2QA 4CRPA 3C6LB 1ED3B 4ODBD 5DRWA 1N5YL 4FQXC 1PLGL 4WUUA 4M6OL 4F7CA 3FTGA 2EIZB 3AGVA 3B5TA 3RUGA 4P23D 1JGLH 1CE1H 3RUGE 2OYPA 5DMYA 4WW2C 1TQBB 2NY0B 3QXUA 1TZHB 1J8HB 3AC0A 2PUQT 2MWCA 4PLOB 3ZE2E 2GSIB 2A38A 3D39A 1IAIM 2YD4A 4H5SB 1HK6A 1XT5A 1QBMH 2BVPA 4MA3B 3BISA 3DMMB 3ILPB 1RFDH 1U42A 3HZMA 1QSEE 5DJCA 2F8OA 4KZEH 1TCRA 2P45B 1I8MB 1K4CA 4PJEA 1I3VA 2R2HB 4PJEE 1INDH 5DR5L 3TA3D 4HS6B 3IDIA 5E1AB 5FECB 3S88H 3MUGB 1MRDL 5CS7A 4DGVL 2YA1A 3SKJH 3PWVA 4XCNB 3QPXH 2ZG2A 2M2DA 3X3FL 4OUUB 3IJYB 4HUNB 2R2CA 3QI9D 2HAZA 4P2RD 5D1XA 4GS7C 1P4LB 3F7QA 5KSAA 2XZQH 4Y89A 1K4DA 3FQTB 3BGFB 5DHYA 4JFDD 4U7KA 1RUPH 4FFVD 2X41A 1WWWX 3BHBA 1NDGB 4P9HL 2ZNWA 4XWGH 4NPYB 3QCTL 3U9UB 2DI7A 4YDJB 5DLML 2YHGA 5AUMB 2IGFL 1VPOH 1G7PB 5E2UL 3PHOB 5L8JB 1HZHH 4QT5A 4NN7C 1UB5B 2AAVA 4PJAF 4O02H 2DQIL 3I75B 1EHNA 3BQUC 3CDGB 4FZEH 3QO1A 4HWZA 2D0FA 4LCIH 3BP4B 3CFCH 3CSPA 6CGTA 2MHAA 5GZNC 5I1EH 2CKBL 3SDXF 4MD5B 4S1SL 1KN4H 1YPZF 3VWKC 4RZCB 4AIOA 1QSZA 3N9GH 3TNMB 4IBLT 3BZDA 4FQXB 3RL2B 1T5XB 5FYJH 2P42B 4G6AC 4L3CB 4NWUH 1KXQE 5IT2H 3DARA 2F15A 4I18B 3NIFF 2R4RH 4WW2B 4M9OA 4WCYL 2F53D 3KPNA 2B1HL 1RZKC 3BE1L 4Q2ZB 4LEOB 5DURD 1HEZB 1I1FA 1TVHA 5I16A 2CR3A 4X99A 3BQUD 4OLWL 1MRFH 1U41A 4NO0D 4X6BA 2FEDC 2W1NA 4GFTB 4XMKL 4XNUL 4YHYC 1KIQA 1FORL 3PWUB 3GMRB 3MNVA 4YDKL 3RWCB 1P4IL 1ZEAH 3TJHD 3O81A 4PV9A 3T2PA 1QHOA 4X6EA 1A1MA 1KELH 5IBTL 1L6XA 3E6HA 2A6DA 2BFVH 3KAAA 4NQSB 4YO0B 3VWKD 5FO8A 2OR9L 5IK3B 2VZOA 5E0QA 1JGVL 2IH3B 4G6AD 5E2VH 5F21B 3TCLA 4X6FB 2IQAB 3WHXB 4LVOC 4GS7B 1F4WL 2J8OA 5AYUH 3R06A 5FV1L 4OCMC 3WFHB 2D31A 5DWUL 3KPRB 4PRPD 4PRHB 3QEHB 4OUOA 1ZGLP 1HH9B 4YZFF 3RAJH 2FEDD 2N4IA 1JGLL 1CE1L 1G6VK 4Y4KB 3HB3D 1HWGB 4AIZA 4HUXB 4L4VD 5FYKD 1BVKA 3WNKA 5CIPB 4K9EL 3B2VL 3KPPA 1QFOA 1GJIA 1JNJA 2VC2H 2XYCA 3TBSA 3BN3B 1D5BA 3O6MH 3OJVC 3G6JA 1RFDL 4NN7B 3G6JE 4XBEH 5I66A 4KZEL 2X4QB 3SDAA 2MQCA 4JFHE 2W0KA 3HUJB 5I2IA 4HWEL 4IS6B 3TH2T 4C56E 1J0ZA 2X2YA 3FB5B 4KGJA 1INDL 3I2CH 1JPST 4QRSB 4NRYB 1BQHB 4KMLB 4NBZB 1RHHB 4R7DA 3S88L 4R4ND 3BWAB 3SKJL 3QPXL 2H41A 3S9DB 1DDHA 4P5TC 1Z2KA 1UVQA 5CEXA 2VQ1B 3QQ4B 3VI3E 2RHEA 2IH1B 4I4WB 1KACB 4A6YB 3MV01 2YD7A 3EYVA 1FBIH 3W9DB 2XZQL 5FCSH 4S0TD 1BFOA 4G8GA 5I8EA 3HA0A 4G8GE 1RUPL 5ESAB 1YN6B 3FAWA 3GRWA 4XWGL 3ESUF 1TZIB 3MRCB 4X4YA 4LLMB 3HLAA 3ZSSA 5IEKB 4GMSL 5F1NA 3RJDA 1VPOL 2AABH 1GSMA 3JUYA 3QPQC 3NA4A 1JZ3A 5DT1H 1A1OB 3VXPA 5FYLE 5HI5C 5FGCB 2DMBA 1HZHL 4UNUA 4YHYB 3GGWA 4O02L 4NBXB 1FGVH 4QHUA 4Y4HC 4ZFOL 4JO4L 4MAUH 1A47A 4FZEL 5BVPH 3HZYB 5HY9A 4LCIL 5EN2B 3REVA 3HZVA 3T3MF 2NY2C 3CFCL 2OTWA 4M61B 4BYHA 5I1EL 4XC1H 4MA1C 5TE6H 4P2OA 1OQOA 3MBEC 1KN4L 4F8TA 1AXTL 2B1AH 4WFED 3VG9C 2ESVE 5C0AA 1HCFX 5SX4I 5C0AE 1T2JA 3SCMC 3SJVB 4XZUB 4KDTA 4PJCA 1U8HA 2XA8H 3GSOA 4PJCE 3BUYB 1G7LA 3Q2CA 1E6OH 5FYJL 4NWUL 3T0VA 3CLEH 3RL1A 4G8FA 5IT2L 3GHEH 3TBWA 3QPQD 2R4RL 5HI5D 3CH1B 1U8QB 4GW5A 1UWEH 1XR9B 4KWUA 5KSUB 3OAYK 4GAFB 1PD6A 3F12B 4JM2C 1MRFL 1EFXD 4IOIA 5JNYB 4CVZA 4Z7VE 5I1LB 4FQPA 1NLBL 3E0GA 5CHNB 4F7EB 4LLVA 1IEBA 1A5FL 3ULUF 1FZOA 1ZEAL 4K7PH 2HVJB 3VMPA 1I85A 4P3DA 3VXSE 2HMIC 1FYTB 4YDIH 3SKNA 1KELL 3L5JA 3WNMA 1CXHA 3VDCA 5K9JL 1DQJB 3VGBA 5HHOA 4LHUB 1QFWH 3P73A 5HHOE 2GW5A 4D9QE 4P5TB 3MJ7B 5E2VL 1XZ0A 2AQ3A 4BFIB 1MLBB 4D0CA 5AYUL 5JIIA 1ZWIB 4UT9L 4HF5H 2K3TA 3MUJA 2DM4A 3TM6A 4L8SA 4FZ8L 4JM2D 4Z77A 5K9KB 4JRYB 4P4RA 4LRIC 5B39A 5IJKA 5DJ8A 2NYYD 3BRGC 1D3CA 4EUPA 2G9HB 3CVHA 3G6DH 4U1IB 3W0WE 4ELKB 5GSRB 4P3WA 1Z5LB 1D5MA 4GKOA 2HMID 3KHQA 4M7JH 1DBBH 2VC2L 8FABB 3O6ML 1OP3K 5SWZE 1GXEA 4XBEL 5FF6B 5DJXB 4Y4HB 2AV1A 3NFNA 4U1NA 4WUUD 1YEHH 2EDBA 4FP8H 3RVUD 1RZ7H 3I2CL 2NY2B 5C07B 3RJQB 4Y5VA 1S7XB 1BQUA 5JQHC 4K7FB 3BMWA 5MENA 4KPHH 3MBEB 5IMMA 5MENE 1KIRB 1SVZA 5EU4A 3D39D 4H0IA 2BC4B 5MI0C 5FGRA 5F9OH 3S35X 3SCMB 2YRPA 2LQRA 2EYTA 5E2TH 3OAYH 3GIZH 1FBIL 2APTA 3SKOB 4TSCH 1FAKT 2MNUA 4XHQA 4Y5YC 2BNQB 2XRAH 2GTWA 3NFPA 1PZ5A 4L9LB 4UIKH 3P9LB 1JN6A 4NQCB 5CZXD 1NEZG 3VXNA 3WUWB 1NJ9B 3QUZB 4OZFB 2AABL 3LV3B 5DT1L 1FG2B 3K7UA 1DSFL 5D1XD 1BPVA 2GJ6B 1YMHA 4LKXB 3NIGF 1FZMB 2MTPA 4MAUL 4R7NA 1W72A 5BVPL 4Y1AA 1NEZA 4ZTPH 1A8JH 2AEPH 5HVGB 4KH2A 4XC1L 5TE6L 4N0FA 4HKZA 3QDMB 4ERSH 3BPCB 3HPLB 4MJ2A 43C9B 3LDBB 1IMHC 2MMXA 2B1AL 3EAKA 4OZHB 1V5JA 4F9PC 3BPOB 2VKXA 5HI4C 4LHQB 1MELA 3DGGB 5CLWA 2XA8L 1E6OL 1AGBB 3CLEL 1NUGA 1OP3H 5C09B 4M8QB 5D7JA 4HMDA 4TULH 2YS4A 2Z91B 3IFPA 2A9ML 1RZIB 1RUKH 3CXHK 5E8NB 1QFWI 1UWEL 1N59B 3IYLW 5C0IB 2VOTA 2H6PA 3KPQA 2HTLD 1XF2B 1A6VH 1G7QB 3MRMA 3QAZC 5EDXA 2DKSA 5C7XH 4JKPL 3C60B 1NGZA 2EECA 3TF7C 4K7PL 3B43A 3VFRA 4UU9B 4D9RE 3PIQA 1CS6A 3QCVH 1K5NB 4C55A 4U2YA 4RRPG 2YD9A 1S8DB 3OXSB 4MNGB 2EEDA 4CVWA 4ETYA 1QFWL 4WU5B 3D3VE 1CXFA 3V95A 5KVGH 2CXKA 4NKOA 3V4VH 4OB5L 4RGMB 4LL9A 3A67L 3P30H 4HQQL 1J5OH 5D9SB 3WE6A 3ZTJH 2MKWA 4NO2A 5ICXB 4BH8B 3MLSH 2X6MA 4CBPA 3O4LE 4Y5YB 4RRPA 4UV4H 4X7TB 4KHXH 2Y4SA 2DQUH 2JB5H 2VXUH 4M3JA 3G6DL 4GG6F 4PFEA 2X4OA 5DFWH 4U0RC 4ZUUB 3UTTA 4PJ5B 1A7OH 4M7JL 1DBBL 3UTTE 1NUDA 3UO1L 2ZG3A 2CH8A 3VFGH 2YUZA 1JHTA 5HGAB 3FQUB 2XPGA 1RK1A 2BDNH 4FP8L 4JFFB 4F7TB 3EYOB 5GGRA 1KULA 3EYFB 5IGXH 1RZ7L 3S37X 4HIJB 1KLFA 1MPAH 1T1WB 5JDSB 4KJYB 2V5TA 3D18B 2QSVA 4KPHL 4ZDHB 1MLCA 2PO6A 1WIUA 5GRYA 5KOVC 3VXRD 4G42B 4LNRA 2NR6D 3LPFA 5F9OL 4WV1A 1MVUA 4HXAH 1TVDA 5E2TL 3SGKC 1ZS8A 3GIZL 5CP7A 1KJVB 4URTB 1S7RA 3SDAD 5C0GB 1G1CA 5IG7A 4TSCL 5IJVB 5HVWA 2X70A 2FH8A 1V05A 4U3CA 2MCPL 4ELME 2XRAL 1YEFH 4UIKL 2F74B 2R23A 3U4BL 2JK5B 2VLME 5FOBB 3MJ9A 4KKLD 5GGSB 4HGWB 2XTJE 1MHEA 3DX6A 3DV6B 3RZCA 1ORSB 4MJ4A 5EIIB 4G8GD 4NN6C 4UNVA 2R1WA 1UACH 2BSRA 1G9MC 2AEPL 4Y5XA 1KLUB 3AY4A 3EZ8A 4RAHA 4ERSL 4MQ7B 1WV7T 3PJSB 1NCNA 4PJXA 2FWOA 3WJLC 4PJXE 1WISA 2A6JB 3KWWA 2L0DA 4BUHA 3MRHB 4I0KA 4JQXA 2I9LA 3IDMA 4X5LA 2ZOKA 1NUFA 1KJMA 4W81A 3N1GC 2LTQC 3MQIA 5GS3A 2A9NH 3LEXB 5J1AA 2R2BA 4TULL 3A6BH 5CGTA 5ANMA 5DD0H 2W60B 3EHBD 5ANME 4TTGA 4U0RB 4EJ1C 1CDCA 3SE3C 2QKIB 1I85C 1A6VL 4WTZG 1BIHA 3LN5A 5HDLA 4HKJA 4EQ3A 5C7XL 5I75C 3QWRA 4PJFA 4PJFE 5GS0C 1FYHB 4K94C 3QCVL 4PRDA 5DVMA 3GSRA 3VRJA 2ZSWA 4PJGF 5FK9A 1F4YH 5F3BB 5BRZB 3SE9H 4NQDA 3QRGH 2GUOB 5EBGA 4FTVA 4WTZA 5CZKA 2X9XA 1M71A 4FTVE 5HD8C 4XPBH 2WAHA 3BIBX 4JDZA 5FCUH 5KVGL 4ZAKA 3P30L 4QRTA 1J5OL 3M45A 5IJKC 5KOMC 5TDPB 3BGMB 4WW2F 4M02A 4M7ZC 3JV0A 4LCWB 2YUVA 1R5VA 2PW1B 1F6FB 2V2WB 3PWLA 4KHXL 5T1KB 1D6EB 2DQUL 3AAZB 1T1XB 3S4SB 2VXUL 3S36H 4RAVA 3QWOA 3ARXA 4AMKH 4B41A 5I8OH 3BP6B 1CG9A 1A7OL 2P8MB 5C8JA 4ZPVA 2XZZA 5T3XH 4MX7B 3VFGL 2FL5B 5IVXB 4HLZG 2IBZY 3AB0C 1S7VB 2BDNL 1IM3A 1QLEH 3BKML 2HJFA 1EEYA 5IGXL 1V3KA 5DQ9B 1MPAL 4U1MB 5SWQB 2VDRL 2F9BT 1GCFA 2Y36H 1LP9F 1ZT7A 3X14B 4JGUA 1G9NC 1UJ3A 3NTCH 4HXAL 2OMBA 4KY1H 4P5MB 2Y07H 5KS9A 5EO9A 5KS9E 4X5XB 1FVDB 3DPBA 5T1LD 5C0CD 3FL7A 3QNXA 1R3LA 1YEFL 5F97E 1JPSL 4QOKE 2FR4A 1QYGH 1LD9A 5MEND 1INQA 1H3VA 5C1MB 1U8IB 3HUJF 5EU6B 4NZJA 4ZSOB 4Q58C 5I75B 3D0VA 2XN9B 5E4IA 3VXOB 2AV7A 3LKQA 5KAQF 3DRQA 1DUZA 5GRZA 1TFHA 3H9YA 5HDQH 4M62H 4WWID 5CBAA 2DQDH 5JTWA 1UACL 2Q20A 2EDWA 4MS8C 4YR6B 3VFPA 3DUUB 5IBUG 3D2UB 2VO5A 4LSSH 1J11A 2DLGA 2UUDK 1A6ZA 3PP4H 1MNUH 3MR9B 5J11B 3KLAB 1EO8L 4UQ2A 1CLZH 5ISZB 2J8HA 3L3KB 3QUYC 5I73B 2EO1A 2VR4A 1C12B 4RFEB 1TTUA 3ARFB 3DVFA 3MCKA 1RUAH 5LGHH 3A6BL 4Y1AD 5DD0L 3HC3H 1ZK9A 3B8SA 5IB1A 1QRNE 3VFNB 2A6KA 4MS8D 4GRWE 4ZPTB 3OG4B 4RFOH 4N1HB 4MWFB 3MA9H 3MV9A 4EXPX 2LV4A 3C09C 4DZBA 3IDXH 3BKYH 4GJTB 3QDJA 1D5ZB 3QDJE 2XWJB 3HS0A 2R2EB 1F4YL 4ZUVA 3SE9L 4FABH 4MDIA 4YGAB 3Q3GB 1C16A 3QRGL 3QUYD 1CD1A 1IFHH 4XPBL 5MEQB 1YDPB 2E9WA 4DQOL 5DUMH 4RIRA 1OPGL 4HHAA 3RWIB 5GS0L 2IBBA 4QXGH 2J2ZA 3PQYB 4HBCL 4G7VH 3T4YA 2F54B 4PJ7A 5KG9B 4PJ7E 4OF5A 3DX8A 2ENYA 4Y19B 4Z0XA 4AT6A 5KSBB 4PLJC 3VA6A 1RK0A 4I8DA 4FQLH 2V7HA 3U82B 3AS0A 1Z6JT 4AMKL 5I8OL 5JIHA 2LAGB 1BD2B 4ODHH 1SMOA 3BH9B 1OT2A 4XBGB 3S5LG 5T3XL 4DJMA 2Q7NA 4I0CC 2ICEB 3IAPA 2YN3A 3K4AA 1QLEL 3P4LA 3S96A 4JPWH 4U1KB 5DO2D 1BX2B 1U8LA 1JRHH 5I1CH 4E41A 3MXWH 4E41E 1JK8B 5HYSA 3S5LA 1LGVA 2Y36L 1CFVH 4MZ2A 4ZOAA 4NJAL 4QLRA 3PXJA 1ONQB 1KCVH 2PYEE 3NTCL 1YNTA 4KY1L 2Y07L 5I76B 3VXQA 1VKXA 4WHTB 1YEEH 2VN7A 5TH2A 2YR3A 4YE4H 1Q9WB 4MB3A 5H37H 3REWA 1T04A 4UILH 4RMWA 2Q8BH 1IAKA 3MLVH 3ROOB 1QYGL 4KRNA 2PO6D 1P2CA 1KGCE 5DJ2A 3I6KB 4N0CD 3FZUC 1S7UB 1FAIL 3BDXA 2H9GB 3KDMA 4PP2B 3MODH 2FDBP 5DC0A 2VJXA 2SEBB 2X4SA 3N50A 4R2GB 5ENWA 4N8VB 2J3SA 2NX5B 5IHZA 2DQDL 4NJ9H 5ELIA 4NQVB 3EOBA 1YQVH 1XGYH 2X5PA 1AE6L 4RGNE 2YPLB 1QBAA 2F8VA 4JPIA 4LSSL 3CFIC 4FQCH 4RDQG 5DRNA 1MNUL 4YDLC 3UDWA 1WT5A 2UWEB 3OQ3B 1CLZL 4HT1H 5E7FA 2ICWJ 1VFAA 4JM2F 3RY6A 3RY4A 3FZUD 1ND0A 1U8PB 1R5IA 5LGHL 3OKOA 3HC3L 4FQIH 4OFDA 1A7BA 3U6RA 5JA9A 5ESQA 2X1XR 2CDFA 4U3XA 3SO5A 1U3HC 4P3CH 3LD8C 2CDGA 4Q0XH 3MA9L 1K8IB 1SBBA 1A2YB 4Q9QH 3IDXL 3BKYL 1H5BA 4JY4B 5HJ3B 3MGAA 4XP6H 2W0LA 3IFLH 1QO3B 3IS0X 2P8LA 3CD4A 3CLFH 5IHLB 3G5ZB 3P0GB 5FKAA 5GISH 4FABL 2RAMA 3OMZA 4GXUN 3ZE1F 2Y7QB 4OCSH 1AD9B 4HUUA 1ZE3C 1RJLA 5DUML 5CEYB 4FXKB 4QXGL 4EDXA 5D7IF 5FHAH 1FJ1A 4G7VL 4RNRB 5J12C 5E08H 3UBXB 3TGXA 3MRIB 3RHWK 2IANB 3QDGA 5D93C 4BQ9A 2F5BH 3QDGE 1T1YB 1NKRA 6FABL 1U3HD 2W0PA 4PJEF 1JRHI 3DROB 4FQLL 5C9KA 5TF0A 5HGHB 4GH7B 4NQDD 1X7QA 1K8DB 4FTVD 4P46A 4X4MA 1LEIB 4ODHL 4X4ME 4IM8A 3E3QC 1UM5H 5GGUB 3ARSA 1QFHA 4YFEA 5CGMA 2BY0A 5FDWA 4WO4B 3PV6A 3TZVA 4EN3C 3HRZB 1I9IH 1S9WB 1X5YA 1JRHL 3UZVB 4L4TA 5I1CL 1LO5B 3MXWL 4PG9A 3V5HA 4YDLB 3O6FA 1CFVL 3QZWG 1II4E 3B3IB 3GDBA 3VCLB 1KCVL 1X5FA 4JFYB 3OGCA 4E42B 3MLUH 3CFKB 3RP1A 4Z7UA 4S1DC 4Z7UE 1YEEL 3QO0B 4YE4L 4JO3H 3ALWA 4MXQD 2Q8BL 3MRGA 4C59B 3QZWA 3QXWA 3I02B 4UUJA 4J8RA 1G7JB 2AVGA 1GVIA 3LD8B 1FC2D 1BJ1H 2Q1EA 4DOHE 1T1ZB 2GFBB 2JTDA 3CIQA 3U4AA 2DQGL 3MODL 3DSFH 3CMGA 4Y88A 5LVEA 1A0QL 5K9OA 1TTGA 4NJ9L 3QJHA 1A7QH 1YQVL 1XGYL 2VLKB 4QHLA 4H20H 2N7AA 3FRPG 3QQ9C 4S1DD 4BKLB 2VDKH 4FQCL 2XWBA 1NUNB 3EO0B 4S0SD 1WFUA 5GRXG 1T89C 4U0QB 1UKQA 5J12B 4XNZB 4Z7QF 2X4PA 4HT1L 5D93B 2X4RB 1MWAA 3E1F1 5BS0E 3U9PH 4IOFC 4OGYH 1FFQA 5ID1A 1GGUA 4FQIL 1NFIA 1IKFL 2ZZUT 1DBJH 2EXWD 2V5YA 3B9KC 5AYQA 3FRUB 4MQTB 5MEOB 4HGKC 4Z95H 2DIAA 3QNZA 1UZ6E 2CSPA 2FO4A 4Q0XL 1A7NL 3QQ9D 1T6VN 4Q9QL 3F7VA 4KC3B 3NN8B 1BVLB 2VWEC 2VXQH 4XP6L 4EN3B 5F1IB 4KZDH 1JPGA 2J5LC 1OAUL 3CLFL 5C2UB 5GISL 1KUMA 3TH4T 3KVQA 3CC5A 2C3VA 4RMSA 2BX5A 2FIKA 4OCSL 5JR1H 1ITBB 4JB9H 3VGAC 4IOFD 5C71A 2WUCH 4NCC2 3QDAA 3CCHA 2O5XH 4G6KH 2H8PA 4OLUL 4PY7B 2R1YB 5FHAL 5HGDA 1KNOB 3MV9D 5E08L 7CGTA 4YDVB 2F5BL 4CW1B 3D48R 4CNIB 3MRNA 1WZMA 4OKVB 4IRSB 1U36A 1EUTA 5IEHB 4OZGE 2VNCA 4L3ED 3PL6C 1MJJB 1BZ7A 2VE6A 2CUIA 1UM5L 4K8RC 3UAJC 2YD5A 2E6QA 4E5XA 3WSQH 4KHTH 4P2CG 2CIKA 2JJTC 5FUCE 3C5JB 1I9IL 3OF6A 1KBGH 4XNMA 5C0BB 5BVJA 3UTZA 5C6TH 5FYJU 1I8LA 3EYQC 4KKAC 4OF6A 3BUTA 4PD4J 4YXHH 1R3HB 3T2NH 2Q3ZA 2O61B 1F6AA 1TJIH 2AXGA 4QRUA 1QLRA 3PL6D 1ZGLM 1L0QA 4JO3L 4POZD 1KYOJ 1F2XK 3PHSA 5L6YL 4K8RD 3HMXA 5E9DA 2P7TA 3OKMB 1MCFA 5E9DE 4L8DA 5EUOA