4XNUL

X-ray structure of drosophila dopamine transporter in complex with nisoxetine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of Drosophila dopamine transporter in complex with nisoxetine and reboxetine.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
molecule keywords Integral membrane protein-dopamine transporter
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuL01
4XP5L 1B0RB 3VRJA 5SV4A 5IFAL 1A21A 2Z31A 3DROA 4Z7WE 3V6ZB 1MUJB 3P11L 3EFFA 4MCYB 3EFFB 4L8SA 5TE7L 1YJDH 2GKIA 3VRJB 4F15C 3WXVL 1A64A 1MCEA 1HZHL 2DRUA 3KAAA 1YYMH 2OTUA 5T3XL 4PY7A 4NKIH 2BOBB 2D7QA 3UTTA 3V95A 3I6KA 1I1FB 4JPIA 1LQSR 4RRPG 5FM5O 3VFVB 1GCFA 1GZQA 2EE3A 3SO5A 5DD3L 2BNRB 4PRHB 5GS3A 3ZHDA 1KT2B 4IOIA 2AGJH 4HS8L 1GC1L 3OPZL 5TE6H 1RZGB 1DQML 2F53E 5A3IC 1UACH 3K4AA 3G6JE 4FQ2L 4B7IA 1YZZA 5BXFA 2Y6SC 1A6WL 2CK2A 43CAA 5D7LE 3RWJA 3UBXI 3WFEL 2QQLH 4K23L 2E9BA 2VLME 1MCHA 1LP9E 5GSRB 3V4PH 3WJLC 1HYSC 4FQIH 1UENA 1ED3B 3GSNH 5JW4R 3MRRA 4M6AA 1AQKL 3B9KC 3PWVA 5IMMB 2DJUA 1QA9A 1J1PL 5CGYC 5MEPB 3FN0H 4JRYD 4EZMA 3UJTH 3D3VB 4F7EB 3CK0L 2FGZA 5HGHA 4PFEA 5B4MD 4X5XB 3QWOB 3MRCA 1ZLWK 1CG9B 4PJ8B 3ZL4H 3QWQB 4U6VH 3DI2B 1ES0A 2HWZL 1MAMH 3QIBA 2R2EB 3MRLB 1XGPB 3LDBB 4IM8A 4JFFA 2H26A 5ESQA 5F3HA 1RAMA 3SGJA 1ZHBB 3QDJD 5EU6A 5TDNB 2CQVA 5D2LF 4PP1C 6FABH 5C0GB 1U93A 3G6JF 5LGHH 4HK3J 4OCRL 4H26B 3VFPB 2X89D 1E4XI 3ZE2F 5DD5L 1WVZA 3IU3B 3MOBH 1CR9L 1UKSA 5GJSL 3DYMA 3LPGA 1KCVL 4OFKA 4GAGL 4KTEL 2N56A 1LD9B 4FFZH 4TYUA 5EZJB 3ETBF 4AG4L 5E6ZA 3E6HA 5MP6H 2R1WA 1U92A 4LHQB 1EIBA 4NO3A 5DDHA 1EZVY 4O58H 4ZS6D 4DZ8A 1WCBA 2A1WL 4HIXL 1KTLB 1H3XA 3AC0A 2GSGA 1BFTA 1N3NA 4I77L 1LE5B 2VLKB 2ERJB 3PF2A 3VMPA 4MMZC 3EOBB 4UDUB 4QHLA 3MODL 1Z5LA 1I7TA 3OKKB 5E8NA 1CE1L 5D1QB 2QSCH 1EK3A 4N8CL 4L4VB 4RZCA 1ZLUK 2VXUH 3MCKB 4U1IA 3L9RA 4QRQA 3CMGA 4CAGA 3BIKA 5LQBH 1F4XH 3LVEA 4LLQA 1FZOA 5I17A 2BNUA 3OJVC 3O2WH 2AV7A 1PVHA 2G75B 1GZPB 3ARFB 5ENWB 2PYED 1KB5L 3MRFB 5BMFL 1D6VH 1EEZB 3MRBB 3FQNA 1HDMB 3QPQC 4PJCE 5HYEA 3UPRB 1EBPA 3IF1B 2VLKE 4JDVB 5DYOB 5IV2B 1EXUA 2YRPA 4B41A 1NC2A 3LEVH 4UU9A 3MX0A 4FTVA 1UA6H 1TJIL 1JZ4A 3T2OA 4ODBD 3MJ9A 5T5NG 1NCDL 1YNLH 3BISA 5ISZE 1LO5B 3RHWF 5K9QI 5CKAA 1PZ5B 5GS2D 4KZDH 1NDGB 2DQFB 3PDOB 2ICWB 1RIHL 1GC1H 1CGYA 2PYEA 1PX4A 4WENB 1NLBL 2IBGA 4E42A 5F9JB 3ZZ1A 1S7QA 4ZNCD 4J8RB 5IOPB 1IKNC 4JM4H 2OI9C 4KJYA 4JO2H 3Q3GB 5DUMH 2A9NL 4U1HA 4OLYH 5E2VH 3HAEA 3GSNB 3QXDB 1OARH 4BFGA 3ARTA 4N5EC 5CSZA 5HVFB 1JIBA 1IAIH 2DAVA 1T4KB 1B2WL 3M1BA 3HZYB 5KZCD 2P43B 1FRGH 1F2QA 4XNXH 4CNIA 1K85A 5KSBF 4U1LB 3P4OB 2VDML 1P53A 2P5EB 3PIQB 1I3VA 4QYOA 1XF5B 3C6SB 3HPJB 4WV1C 5SV3A 5I1DB 4P2QB 2X41A 5J06A 1J1XH 1YY9D 4YDKH 1FSKB 1QSEB 3CU7A 3GSNL 1OAXL 3EO9H 3IDNB 4QXUL 1R24B 2XA8L 5SX5K 1U2CA 4MVBC 2AJUL 4YE4L 1D5MB 4ZNEA 3PGDA 1MJUH 3BFOA 4LSPH 3P9LA 3RVVD 3BP6A 4X6FB 4F8TA 3QISA 2CGRH 1FE8H 3LSOA 1DVFA 3ZTJG 3S35X 2YKLL 3C09C 3VXUE 4D0CA 5HHPA 2HTKD 5KSVB 1FZJA 3ME0A 3MV9E 4RAVB 1LGVA 3H42L 4JM2B 3TESA 3S36X 3ROOB 1MIEL 1I7RB 4NRXA 5E08H 4RDQF 3MLRL 3W9EB 3WIIH 3RTQB 4UBDC 2FJHA 3VFMA 5HYSA 3GSOB 2Q8BH 5HHQA 3LPWA 5FA3A 5CEZH 4HWUA 3V4UH 2EIZA 2XWBA 3X12A 3SY0A 5HJ3A 5FUCE 3T2NL 1ZVYA 4WU5A 2V9RA 2LFGA 1A1MA 3W11D 3MOBL 4S1QL 2WIIA 1S78D 2XNAB 1BM3H 4IS6A 2W9EH 3ULVF 3FT4B 4FFVD 3WYRA 3T3ME 4Z18A 2OTPA 3I02A 5BOPA 5FO7A 3RI5F 1FVEA 3LB6C 3A6CH 2AI0H 4RMRA 3VXNA 3EKCA 1MEXL 2DIJA 1ORQB 2YPLE 4RGMC 4OLVH 3SCMC 2VLJB 4RGNB 4KDVA 5C0AE 4U1JA 3UTZB 3SDYL 4LARH 5GRVL 5KVFL 1A7PL 3T65B 4R6UA 3VCLB 5EDXA 5IVZA 4AYFA 5HHOB 4PGEA 2LVCA 3IGAB 2GSIA 2FBOJ 4OFYD 5DHVA 1I85C 4M7KL 4L3EA 4RFNB 3RKDD 5C6PB 1AR1C 1VFBA 4QHMA 1AGBB 1FVDB 4RAUA 3VFUA 3IFLL 3OF6A 5IMOA 4JM2D 1TVHB 4D9LL 3MLYL 4KDWA 4GKNA 1KCSL 4KMQA 3QIBC 5EO9B 1I4FA 5TE4L 3GBMH 1M4KA 2DWEB 3O9WB 3KPPA 3NCFB 2VR5A 3V8OA 1Q0YL 3H3KA 4JRYA 4S1SH 4PRID 1N64H 4ETQA 43C9B 1UWEH 4HCRH 5F1IA 2A0LD 2HLFC 4TSCL 5F71A 1WUNT 4B53A 2HG5B 3CCHA 4DQOH 2AJVH 1CLOH 4Q9RL 1OTTD 3ARBD 3C5ZD 5DMKB 5JQ6H 1IGJA 4HWBA 3B43A 4K7PL 2DQJH 4MB5A 3DX9A 2RB8A 3SDCD 2F54E 5DVLA 4PJXF 1HSBA 1EVUA 3OF6D 4DW2H 3GJEB 1AJ7H 1JWSA 3O3DB 4IMLB 2NLJB 3AB0B 2KH2B 4H20L 2J12B 1A4KA 1T2JA 2DQGL 1CBVH 2W0FA 3WE6A 5ETUB 3OKEB 2APWA 2NW3B 1A5FH 5ERWB 1EH9A 1KPRA 3E3QE 4ONGL 4CJ0A 4MAUH 5T1MA 2FD6H 2X1QA 2J8UB 4LLVA 3BWAB 2CLVA 4LLDB 3UTTE 1A7NH 5HHVH 1F02I 2P48B 1WBXA 3FRPG 5SWZD 2RIKA 4MD0B 2W59A 4XPFL 3ULUL 1KCUL 5F6HJ 4RRPA 3TT1L 4F7CA 1HQ4B 4N1EA 2EKSB 3TO2B 2HRPL 2F54B 3LV3A 2KPNA 5DJDA 5K9JH 2Z35B 1FIGL 4RGMB 3QIUD 3TIEB 1EBAA 2H8PB 2VJXA 4L8CA 2LTQB 1HH6A 2NX5E 3D39D 4KI5C 1IARB 4A2LA 1OGTA 5F7EH 5D6DA 1MCDA 4O58L 1YMMD 3K7UA 2YPKB 3KYNA 3TO4A 3WXWL 3HNSL 3KPRE 3MJ9L 1PJ9A 2QJDA 2L7JA 5I1KL 3GMPB 5EC2A 5EOTB 3ZKXB 1T0MA 4KHXH 4BH8A 2WK2A 4ODSL 3WEXB 2NY3D 2E6QA 3QQ4A 4M6ML 3N9GH 5DD6A 3FCTB 1HHIA 2OJZL 3QDJB 2UVEA 4KZEL 1IMHC 3MQIA 1Z0MA 4Y16A 1NCCL 4A6YA 1HHGA 2PKDA 4XRCB 4Z7QE 4UUJA 4K9EL 4Z0XB 1F13A 2QHLA 2XWTA 4Q6YA 4H0IA 2H32A 3EZJB 3MNVA 3SGEI 1HXYB 1EFXA 1J11A 3RWIB 4PJAF 4LSVL 5BCAA 1I9IH 5DUPL 3OJDB 4F3FB 3BKMH 5F21B 4NUJA 4Q74A 4IDLA 4OLEA 4QHNA 4PD4J 5GJTH 1ITCA 4GAJL 4YHIA 3MA9L 1KULA 4M62L 1MIMH 4Z8FL 4E41A 1VDGA 2BSSB 4H1LA 1CQKA 5HGAA 3ALXA 4ODWA 3O3AB 3BD3A 5HYJD 3GM8A 5IHLB 5L6YH 4MDIB 2GI7A 4XZUA 2ARJB 2OR7A 1Z9OA 3TIDB 4ZDHA 1I7ZA 4KK9C 2V7NB 2AJYH 2M2DA 1FGVH 2RR3A 5E5RB 1IGYB 4JN2A 4Y19B 2IWGA 4ZFFA 1TXKA 1UZ8A 4Q97A 4M7ZC 1WFUA 1T7WA 3BQUB 4NPYB 3C9NB 4P2OB 5IF0B 3ARGD 1UH4A 1S7TA 4ZFZA 3LQZA 4KKCD 2J5LB 2X70B 4HMDA 4RBPH 1A6VL 3C8DA 1U91A 4PB0H 3W5MA 1AO7E 5TFSL 2FBJH 5E9DB 3O8XA 3TN0D 5C86A 2P24A 3N1PC 3P73A 4FQXD 2YD5A 5KG9B 4ONGH 3MLZL 4XCNA 1BF2A 1MJ7H 4L4TE 3QH3A 3MRKB 1J1OL 2R0ZH 1KEGH 1INDH 5CP7A 5T5NF 1P69B 1JWUA 1JRHH 1MFEL 4I2XA 3JV5A 4MAUL 1SM3H 2LU3A 1DQLH 3SPVA 2VIRA 4V2BA 3Q6FB 4N1CA 4G6KL 5IKCA 4KJWD 5I8EB 5D70H 1S5IH 1I8KA 3X11A 2XTJE 3FQUA 1G6VK 1JPTL 3OXSA 3H3PH 5FGBA 1NDMB 2D0FA 3IDGA 3IXTB 3SDAB 3LKQA 2B7DT 3BMWA 3L5XH 3MRJB 2KUTA 2W9LA 3TH3T 2RBLA 3EYSH 4LFHD 4TNVK 3HZMA 4WW1B 2VAAA 2HFGL 4PGBB 3RBGA 3WHXA 2DYPD 4MX7B 3TVMB 3MROB 3UZQA 1G7IB 3V8CA 3HI6L 4ZSOA 5LG1A 2CUMA 5C0CE 1BREA 1F58L 3P0VH 5IWLA 4BYHA 2A9MH 1M7DB 3IJHA 3B2VL 3QEHA 2MCG1 3RWGA 5IQ7H 1X7QB 1VFOA 2IAMC 5EZLA 1G0YR 4OZ4B 1BLNA 4Y5XB 2O5ZL 2HH0L 2WLZA 5IQ9A 5ISZB 2VXTL 1JHTA 1FNFA 2XKNA 4DCQB 5D9SB 2H32H 1QFWI 1CN4A 5HI5D 1RZ8B 4ZAKA 3FT2A 1LP9B 3HE7B 1IM3B 3K3QA 2QQNL 1WCQA 1DBJL 3QDAA 4JY4B 1ITBB 1GGBH 1YMMB 2VQUA 1Z9MA 4OLZL 1NAMH 1CF8H 4JFEE 4U1KA 1BFVH 1UWXK 3O3EB 4X6DF 3T3PF 5DFTA 4GUPB 4LDLB 3V0VB 4C54A 2PCPB 1KG0B 1S7SA 1GAFL 3M8OH 3QUZB 1RUQL 3H3BC 2EYSA 4HIIB 3TLRA 1G7LA 1XF3B 1CS6A 3ECBB 2ZSWB 3DHMA 2D0GA 1VKXB 3KPSA 1I1RA 3K46A 3UTPD 1BOYA 4JQXC 1CLOL 1MPAL 3MRHA 4HJGA 1KJ3H 1D5ZA 5HYQB 1NMAL 1CICD 3RZWA 1RZIA 3FTGB 3GHEH 4LCYB 1M6OA 3ZKNC 3QP3A 1R3IH 4YGVB 4GRWB 2IGFH 3CSBA 2FGWL 4NWUH 3FB7A 1XIWC 3O45A 2Q76B 3GSQA 1J18A 5T5FL 2PXYD 3C60B 4XPTL 2F5AH 2NQCA 4AT6B 1YC8A 3I75A 2XY1A 1SEQH 1U3ZA 2EYTA 3NZ8B 4XAKD 4NQDA 5D1QD 2D03L 3HCVB 4GRMA 4P4KB 1BFOA 2NZ9D 2YWYA 1MCKA 4OF0A 3REWB 4NT6B 1MHCB 4RSVA 4ERSL 4AENA 5EBLA 2E9WA 4G3YL 4KUCF 3RUGF 2DMCA 3HE6D 2N1KA 4JJ5B 5KANG 3UTPE 5EZOH 4D9QE 2IALB 2OS7A 2G60L 4PJXA 2A73A 4Q6IC 4ZTPL 3TYGL 4ZPVB 3KPSD 1U8KB 4TTDD 4M6OL 1EJOH 1T6VN 3BKJL 3HG1A 4HKXB 1F3JB 2ZCKL 3QIWC 5J11C 1FNHA 2XN9B 4CDHA 3GIVB 2AJ3A 4G7VL 4K7PY 3NTCH 2ZJSH 5EU4A 5DRNA 4M9PA 4Z6AT 4Y4KD 1MRFH 3QUYD 2V5YA 4KV5E 1UXWB 4LPWA 5KW9H 4KZEH 2ATKB 1G6RB 3BT2H 1SVCP 3THMH 3QDGD 3MUGA 2ZKHH 4HK3N 1BX2A 3CDCA 4ODSH 4WV1A 2VLLA 1RZKL 3SKOA 3UDWA 3WS6C 4M5YL 4Z77A 4XVJH 5HY9B 2VZTA 4U6VL 2Y06L 4DZBA 3D69A 3GSWB 5DMYA 2VLJD 1T1XA 4APQD 1V7ML 4YZFF 5HTSA 5EH1A 2PO6D 1H0DA 2HAZA 5JORB 4XGZB 4PJ5D 2Z92B 1DUYB 1QYGH 1ZT4B 3B9DA 2JELH 1T20B 4MSWA 3TT1H 1S9WB 3C6LD 4ZO9A 4PJ8C 3Q48A 3T0ED 3NFNB 1WBYB 5BMFH 2ZNWA 4U7SA 1TITA 1ETZA 1RULH 3RA7L 2Y72A 2IBBA 4PP2A 1ZS8A 3KDMB 3QRGL 5IGXL 1MJ8H 4M3KB 1JFQL 3TBSB 1FL5B 4K3DH 2EDHA 4HUKB 4NKMA 3EDJA 1GAFH 4XT1C 4NRZA 3WUWG 4CVZA 1A6TA 1ZLWH 2BMKA 4JRXD 5FYJU 5ESVA 2Q6WA 3RUGA 3HMXA 3RL2B 2BVEA 1K2DB 4LPVA 1LO3L 2VKXA 3QDGB 1CF8L 2C3VA 4LLAA 3S6CA 3OAYK 5DWUL 4M7JH 3KYOB 1DE4A 4A2MA 1G1YA 5IIEB 3KPMB 3ZYZA 1SBSH 4LCWB 4PRPA 5E8OA 4ZAKD 2FWOB 1A6UH 3W0WB 3BZFA 3MZGB 1VGEL 3IDJA 4CMHB 4ISVA 4NZUL 3ZTNH 4Y5VA 4WFGD 3LEXB 2BK8A 4X6DB 4PGCB 4UAOB 1RK0A 4NO0D 5JPNA 3UJJH 1TVBA 2FYYB 2A6KA 4MQ7B 4YFLI 3WDJA 4O9HL 3QCUH 3B2VH 4G7YL 1FFOB 1Q9OB 3BUTA 4Z7VA 1MF2H 4NNYA 3CNKA 5F96H 2EE9A 3WSQL 5I9QC 1T2XA 4OZGA 3GSUB 3V6OA 4BA8A 5H2BA 5IEKB 3U30C 4NN5C 3L95B 4ALAL 4WO4B 5GRVK 3FFDA 4HLZG 3MR9B 4M93C 5CD5D 1R3KB 4JHAL 4NJ9H 4K2UH 1W72H 4YDJB 2YEZA 3W0WE 4QXTB 4EVNB 1NLBH 1MRFL 3U46A 2IMMA 3ESVF 4L9LA 2IAMB 1YNTB 2FGWH 4NWUL 1U3HD 3N1QC 1XGRB 1TENA 4D94A 1T1YA 1IL1B 3VRLE 3T08A 1V3JA 1JP5A 1X6LA 3IFNL 1WIPA 4JREC 4S10A 1QLRA 3AMLA 4DAGL 3LIZH 5IBUG 3IDXH 3Q1SH 4CKVX 3QJHA 4UZGA 4WHTB 3FZUC 3N85L 5IEHB 1D9KB 4XI5D 5IR1B 2M1KA 4Y2DA 3VXSA 1U8QB 4WY7H 4YXHH 5I1AA 2YPLB 3S5LA 3J8F7 1TZIB 4U6XB 2VTFA 1MJ7L 2VXSH 2DQHL 1S9XB 5DZOA 3KPQA 4PJAA 3VDAA 1F5WA 3A6OA 1MWAL 5GJSH 2XQBL 1PBYA 2X7LB 3RAJL 3C6LA 4FG6C 1UB6B 3CUPB 4P3DB 3BT2L 5DO2D 2C3XA 4JB9H 4OI8A 3FJTA 3VA2C 4PJAB 4QXUH 3KPNA 4KTYA 3DVIA 1A9EA 4JHBA 5GGTL 1S9XA 3ARUA 2Y07L 1LMKA 3MGOA 1TZIA 3ULUD 4DUXA 1WFNA 3TPUA 2RCSH 4YC2B 4XB8A 4Q58C 3TNNA 3WFDH 3RWEB 1D9KA 4U1GC 4LGRB 4BZ1H 4NNPH 5IVXB 3QUYA 5TQ0L 4Y19E 1DP0A 1AKJB 3T1FA 3TWCL 1JZ6A 3C5ZB 5EUOB 2BDNH 5EFIB 4PJ9B 3TGXA 3BH9B 3DURA 4XNYH 2BXZA 5T1LB 4FQHA 2CKNA 4ZFOL 3L7FA 4MD5A 2JK5B 3L6FB 1ZT1B 4YWGH 4H8WL 3WFHB 4E41D 1NFKA 3UTSA 2UVFA 1HN1A 2YEZB 4PGJA 1A6UL 1A0QH 4HKZA 5F9WC 2XICA 5C8JB 4XPGH 3SHSA 2NY4C 4LEOA 3M45A 2VDNL 2DYPB 4G8EA 4KI1A 3BD4A 3EOYG 5IEKA 1E0OB 1EERB 1HSAB 1I9RL 5B39G 4G5ZH 1XZ0B 2CIIA 4AK1A 5A40E 1C8PA 1Q9OA 2NR6C 1SVZA 4KJPC 1EEYB 1JF1A 4LRIA 2VQ1B 3Q6GL 2CLRB 1KN2L 2Q86B 5J56B 4GW5B 4JGUA 1DANU 4OM1L 4PGCA 5T3XE 5C0IA 1A7BA 1SBSL 2ZUQB 4FG6D 2AABL 5IW1B 3MBEC 3O11B 3SKNA 3BZEB 1FH5H 3S36L 1QBLH 2DBLH 1RMFH 3QFDB 3VFTA 1JHLL 2YXMA 1DJSA 1NMAH 2FHBA 5T1LD 3QDGA 2ZUVA 3CX2A 4NOFA 25C8L 4K3JH 5DHXB 1YEFH 2F53D 3QG6B 4YZFE 1SJVA 2I07A 5DSCA 2VABB 4U7KA 1FL5A 4PJGE 5DF0A 5CSBA 4PP2B 5ALBL 4PJBA 2HFTA 2R69L 4CVUA 1ZGLB 5FYJL 4RMTA 2DQHH 3PE9A 1ZEAH 2OLDA 3VH8A 1WBYA 5BW7C 1A2YA 3ARQA 1E28A 3LKPA 1DUYA 1ZT4A 2VDOH 1YEEH 5L9DH 4P9MH 2X5PA 1A3QA 3EZ8A 2EH8H 2FR4B 3UXFA 4L4TA 3SGDI 2CKBB 3HRZA 1UM4L 1CGSL 3QXVA 3EOAA 4OV6F 5F9OH 1U8PB 2AK1L 1XEDA 1X5JA 1SEBB 1PYWA 2B0SL 1JGEA 3AUVA 1KN4L 1PAMA 2Z8WC 4BFBD 3EDDA 3SN6N 1WZMA 3WNPA 2Q20A 1GC1C 1FZMB 4KQ3L 2IADB 4Z7UE 1URLA 1WITA 5B3JE 3B6SB 4MNQA 4XWOD 3KYMB 3GEWB 4NQCA 3KWWB 2IAND 4K3GA 1CGTA 2IFGA 3T4AB 1V8HA 4XXCA 5C0RL 1BP3B 2V6HA 3DRTB 3DX7B 1JTOA 3G5YA 4X80L 3QCVL 2V9TA 1QNZH 4RBPK 2O61B 4GJTB 4Q9QH 5AZEL 1U8KA 1A7RH 3CH1A 1VADB 1R3JA 2A73B 5BS0A 4R90L 1U8NB 3LKNA 1K4DB 3LPFA 3CC5B 2B4CC 5IT2L 4JJ5A 4M62H 4YR6B 2DJ4A 2O5YL 2R2HA 1MCBA 3WFBL 3HZKB 1HILB 4XNYL 4XVUC 5FKAB 3D18A 1KGCE 3LEYL 1KB5A 3R06A 5DC0A 1UACL 1BFOB 3PABB 4JVWA 4YEEA 3RPIA 2H1PL 2VXVL 5IW6A 4W68A 3ZKSD 3I75B 1YEGH 3JWDC 4OLUH 2ICEB 2XZZA 3ULVL 5L8JB 4MA3B 4Y5YA 2VDPL 2ICWI 3FB7B 4FABL 4XMKL 3HZVA 3ARWA 4P57A 3PHSA 5D7KD 3K74B 1YEDB 2FX7H 3X3GH 1D5ZB 2VUYA 1AIFA 4J3XA 3T77A 1S3KL 3G5XB 4JFYB 4P5TA 4YDIL 4Y4FD 5MENB 1VKXA 4KQ4L 4RMVA 1JV5A 4QKXB 4Y2DD 5EBGA 4TTGA 3EJYC 5C0AB 5D6DC 4X4XB 1AY1H 5C70A 1EO8L 2RFXA 2WLYA 4GKSA 4HIIA 1MCSA 3SJVB 1YEIL 2I25N 4CN6A 5HHOE 5KVDL 1S7SB 5GPRA 3GBLA 4GUPA 2DQTH 1ONQB 4OZFB 1P4BH 3BP5A 3UDWC 2A6DB 1C16A 3ZHKA 2H45A 2DMKA 4A6YL 1TQBB 4XTRC 5DQDL 2X4RA 1N7MH 4GG8B 4I0PD 3DSNA 5C9JA 2E7LA 4HCRL 5DJAA 4NDMB 4GAJH 4ODXA 1P7HL 3C09B 5DMGD 4ZAKB 1TZHB 2CDFB 1R5VB 1RZ8A 4G43B 2H2PC 4HJJH 3FO1B 1HIML 1AD0B 1GGCH 2W0PA 2X89A 3GJFK 4H1LH 1EPFA 2FNBA 1R5WA 1FYTB 3PWUB 4U1NA 2R8SL 5EZLB 1FNAA 2K7QA 3SO3C 1FNGB 1J1PH 4D0BB 4Z7NF 1KJ2B 5ANMA 5HXMA 1FYTA 1SM3L 1T80A 5CEXB 4TNVF 4ODUA 5DK0B 2AXHA 4MXQC 4G42B 3OKMA 3VFSA 4MX7A 1PG7X 5HHXL 3QFJA 4OQTL 5FYLL 1HI6A 4GBXD 2EIDA 2NY7H 2VAAB 3OWEA 3HZMB 1FG2A 3OKYA 4NDMA 2VL4A 1A6ZB 2ZOLA 3MRJA 3VRLF 2DD8L 1N6UA 3QQ9C 1BJ1J 1X5AA 2A6DA 3TPKA 3HC3H 4L5FL 3UBXA 1OAQH 1QSED 2DTML 2VL5B 1INQA 4JZOB 4U0RB 1B4JH 3KLAA 1KPVB 4F7PA 5JNYB 4X7SL 4NUGH 1B9ZA 2K1MA 4KXZI 1B6UA 3GRWL 3FFCB 4Z7VF 3MRGA 4QRTA 5F93C 4HJ0C 1CFQB 5B22A 3UTQB 1YYML 4ORGB 3SDDD 4ZO8A 4Q9CA 3VFNB 4XBEL 2CRMA 3AS2A 5ADPL 4M1DL 4B7LA 4QRUA 3B5GA 3IKCA 4UT9H 2P24B 4OCXL 4QO1A 3QQNA 3TM6A 3KPOB 3QXUA 3P11H 3EYVB 3V7AE 4PJ5E 3HZVB 5GJTL 2X70A 4ZUTB 5ID1B 2HJLB 3PP3H 2LE9A 4MS8C 4IRJB 5B21A 4FQCL 4BQCA 2YXFA 2R4SL 3WFBH 4NKOA 5C7XL 2BY2A 4P2QD 3VXUB 1I7ZB 3HZKA 2DQEH 5I1JH 2W91A 3WFCL 1FN4B 3O3AA 4EDWL 1QBLL 1KN2H 4PRHE 3TEUA 3JWOC 3GO1H 1A4JA 4FXLA 1WV7T 5D70L 3HNTH 5C07D 1S7UB 3W5NA 2F15A 1MRCH 4NQED 1C5BL 1F11A 1J5OH 1VACB 2FJFA 4UINH 1MFDH 1QFWM 5L2KA 1UM5H 2WWMC 4KVCH 4PG9B 32C2B 3UYOD 1RIUH 3O2VH 4ZXBD 1QBML 5HDBF 4NQCB 4JO1H 4YE4H 4YNYA 4GW1B 4LF3B 5TF1L 3B6SA 1KCRH 1GGYA 1XFPA 1DANT 1FZMA 2NW2A 1YEJH 1UH3A 3SCMA 4WTZA 3QDJA 4JM4L 3KXFE 2CR6A 5EUOE 5F7WC 5KTEH 1N6QH 3BP4B 1JNNL 1BIHA 1NPUA 3WEXA 4WCYL 4HF5L 4P3CL 3MNZB 2W0LA 4OZHE 4RGNE 5K59E 2Z91B 4PR5A 4U7MA 1T1WA 3KNBA 3U9UA 3IFOB 4WDIB 2VLKD 1IQWH 1PD6A 4ZFOB 4MS8D 4OCLC 3C2SA 2R69H 1IGTB 2R1YA 1WBZB 1XCTB 2WBJD 5J8OA 1GXEA 2W9EL 3LV3B 3U7WH 1HQ4A 2CXKA 1VPOL 4PJHE 4QRRE 3RY4A 3W39B 4KRLB 1O7VA 4HZLB 5HDQL 2J1KA 4YUEL 4GRLC 4D8PA 5GISL 3CDFA 3SDDA 1PKQA 1PEWA 4LLDA 3O41B 5FYKE 2EE2A 1U6AH 1FORH 1FE8L 4BQ8A 1IC5H 4P4RA 4R96A 2KBGA 4HWEL 4P99A 3DYOA 4ZMAT 1L6ZA 2FRGP 3EOTL 2WWMD 1G7HB 4R7DB 3U7AA 5LQBL 1AR1D 3C2AL 3VXTA 2XZCH 1I3RA 1W0VA 1T03L 2NLJA 4PLJD 3CFJA 3L3DB 3SKNB 4IMLA 3BZEA 1CU4L 3V5DB 1HXMA 2PN5A 3L3JB 3ALPA 1NH6A 5FK9B 3GZKA 2BNQD 4BSWA 2KDGA 1MQKH 3PQYA 1DCLA 2WWKO 4JPVH 1JF1B 1P7QD 2VDRH 2GJJA 4LCCA 2YD9A 2R0WH 3QHTC 5IMKA 1YQ2A 1QFWH 5KJRH 2PTTA 1QRND 1NGZA 5HI4C 4TUKL 3T0BA 3QBTB 2G2RB 2AI0L 2HFEB 4XVTH 5C09D 5JQ6L 4KAQL 1OGAA 2E9JA 1WTLA 1VGEH 2X4OA 3BAEL 4KI5E 3CSGA 3TV3L 3QUXA 2R0LH 1CK0L 1JNJA 3VFUB 2YD8A 3BVNB 3DTXB 3VG9B 5LAXA 1NMBH 4XNZC 3JUZA 5D8JH 4MD5B 1I1AC 4PJDE 3T65A 1M71B 4FQHB 4UB0H 3WO4C 1KB9K 5KVGL 2L4OA 3ET9F 2CKBL 3VFRA 1S5HA 3CVIH 5E95B 1AKJA 3T1FB 4FFYH 1CD9B 4LQFH 5FK9A 2E27H 5DRZA 1T0PB 4U6HA 4O9HH 2IGFL 3E2HB 1CE6B 4G80B 4OJFL 2NY2D 3CFJB 4N0RA 2JCCE 4LSTL 2GW5A 2DQJL 3BIBX 4XMPH 3PWPD 1MVUB 5HPMA 1UA6L 4YXKH 4OIIL 1AO7D 3RZCD 1XT5A 3CUPA 4F15B 5IJKC 2J8UF 3ILPB 4XPHH 1C5CH 4YHZL 3JUYA 5BRZB 4PYHA 4WU5B 2X42A 5TF0A 4P46C 4I3SL 5I16A 3TA3D 2EIZB 2XWBB 3AM8A 4RFEB 4MWFB 3V5HB 1N59A 3FQRA 1S7XB 1EZVX 1R6VA 4D2NA 4WWKC 1A5FL 4HZLA 4PJDF 3E8UH 2AXGB 1K8DB 3LN4A 1I7RA 1U8QA 2BSED 5IEHA 5IR1A 1MCOH 4RIRB 2W0KA 3JV6A 4AMKL 4KJQC 4MAYA 1RUAL 5C0NC 5HHPB 3O9WD 1E27A 4WWKB 2R1YB 3HE7C 3IDXL 5HI3C 3QULA 4MYWB 3CLFL 4WI8A 3AREB 3WJLA 4UTAH 1I3GL 1IQWL 5DJ2B 1F4AA 5IBLD 1CFNA 4M5YH 5JHDA 5KTEL 5ICZA 2YUWA 2PF6A 3UCRA 4L9LB 5I6XB 1DQDL 3PQYD 4AJ0A 5IHZA 5BS0D 4QXTA 3WIHH 3O0RL 4YDJA 1CDHA 4HIEA 2ARJQ 3NA9L 1I8IA 3LRSB 4R2GB 1RZ7H 3MNZA 2V2WB 1WWBX 2FIRT 3MR9A 5EN2B 4G6FD 1RZKH 2CGRL 5E9DE 3BP4A 4WRLA 5E5UB 1KTDA 1FAKT 4TVPE 1BD2E 3K2MC 3GSRA 3O2VL 1RIUL 3SGJC 2EDRA 3A0OA 3RL1A 2NW2B 1YEHL 2CJUL 5JTWA 1HNGA 3RGVB 2VN7A 3HUJE 2BY1A 2JB6B 4F9LC 1F8TL 1T4KA 3UO1L 3WNMA 1T83C 32C2A 1RK0B 1WWAX 5C07A 4JFDD 2J7LA 4PJGB 5IJVA 3QAZB 4Y5VB 3H9HB 4R9HA 5FF6A 1U58A 1MF2L 4P46D 4KJYB 3NCJL 5KSBE 1S7UA 5BS0E 2OYPA 3TP4A 5CWSA 5TQ0H 5F9JA 3WFCH 4DKEH 3FAXA 5M94B 4GXVH 1UT9A 2VDKH 3PNWB 1FN4A 5CLTA 4F57L 1KFAH 2XFXB 3G5VA 3RL2A 1S9VB 3RUGB 2ZG2A 2Z8SA 2BMKB 5B4MC 4P23D 4DOHB 4CMMA 1A6TB 5HI3D 3QHZL 4U1GB 4LSSH 4JPKH 4FXKB 3VWJA 4FTVB 3VDCA 4MNGE 3QWRA 1L7TH 3HUJF 2WP3O 1ZS8B 3RX5A 1U8HB 2MHAB 5SX4I 2R29L 3NACL 4ZUTA 5ID1A 1EXUB 3QI9C 4NWTH 4I2XE 4LSTH 3L1OH 1D5XB 1MNUH 2WUCH 3OZ9L 3J7HA 3TBYB 1AHWA 3FQNB 5EA0L 3MA7A 1ZKAA 1FJ1A 5HYSG 1A6WH 3MRFA 4X6BB 5C0EB 3HHRB 5DK3A 5T33H 3QUXC 4I3SH 4H20H 1SJEB 5FEBA 2C7UA 3QJFB 3U4EB 1J05A 1GPOL 2W60A 4OFIA 2I9TB 1FZOB 1PLGL 4LLQB 5I17B 3U0TA 5D1ZC 2FECI 1PX3A 3SE8L 2PYFB 2RAMA 3JBG7 2VDQH 3L9RB 4QRQB 4DZBB 4U1IB 5GRUL 4Z77B 5D7JC 5J7CC 3QWRD 4S1RL 1INQB 2IG2H 1Q72H 4L4VA 4DK6A 4Y4HD 1LO0H 4BK4A 4MJ4A 1Z5LB 2QQQA 3RGHA 5DRXB 3I84A 3Q1SL 4CVXB 1DFBH 4P5MA 1IC7L 1Q0YH 4XCCH 1LK2A 3H2WA 1AGCA 3ARVA 4GAFB 1T5XA 3TO4C 5DMJB 1FG2B 5L0QB 3MRMA 2R1WB 1QFUL 3EJZC 2R1XB 5CHNB 2AJ3B 4G6AD 2F5BL 3BOVA 4DGVL 1HEZB 1RHHA 4E9LA 1EGJH 3HG1B 1LD9A 4GQPH 2GTZB 3REVA 2J6EL 4G42A 5LGHL 4L29B 4NO0B 5DK0A 1N0XH 4NJAH 3GK8L 4WI3A 3QEQB 1D6EA 4GRWE 5DI8B 1B88A 4JKKA 1RUMH 1FNGA 4M6MH 4XP5H 3MLPA 3EYSL 4U1NB 1ORSA 4LBEA 3NZ8A 1NAMB 4AIOA 4QCIB 4PRIB 3H9SE 3FO1A 2DKMA 3MRLA 1R3HA 4AT6A 4RISH 2H6PA 4PJ8A 4CADA 2BVTA 4UIKH 3MRCB 2HKHL 3GHBL 4XPBL 2M26A 4JY6B 5DJAB 4F7EA 2DQUH 1P7KA 5I1GL 5D1ZD 5JPMB 1KBGL 4M00A 2CSPA 4LCYA 5ANME 1VFAA 3MRIB 1ZOXA 2C4FT 1OAKH 1LO4L 3MRRB 3G5ZB 4K94C 3H0TB 5KS9E 1ND0A 4NQCE 2ERJC 3SJVA 5D5ME 2OP4L 2RFXB 2UV3A 3MLUL 4WHYG 4X4XA 2DL9A 2AJXL 2IQ9H 2VITB 1JV5B 3KLHD 43CAB 4XVSL 2DICA 5FUOL 4RFOL 2E7HA 1A3LL 4RNRB 5E4IA 1AY1L 1KG0A 3AMKA 5C0AD 1TQCB 3VI3E 4HS8H 4MB3A 4R8WH 3QNZB 5CJQL 3T0EB 2BHYA 1AC6A 1E4XL 1LDSA 5TDOB 5ILTL 1DL7L 1YEDA 1DUZA 4XPHL 3WDIA 1IM9A 3GSVB 4BJLA 4CBPA 2AABH 1IC1A 3ULVH 4IOFD 2F19H 5F97E 1INEH 1WSST 2BVQA 3MLSL 1GZQB 2ICEA 4KKLC 3HC0B 5AAMA 3PDGA 3I3EA 1X5XA 3I3BA 1NGPH 4X5WA 3RPIB 2OTUB 5KAQF 1WIOA 1MH5B 5FO8B 3PABA 4K8RD 5KS9F 4OGAC 3RFZC 4K8RL 5JOEA 1KB5B 2Y36L 1X7QA 1ZTXL 3VWJC 4OGZA 1QRKA 3KVQA 5F7FA 2IEPA 4YR6A 3IYLW 2Z31B 3DROB 1DQLL 1ULVA 3LKNB 3DVNA 2PO6B 4HAGA 2P5WB 1OAZL 4YX2H 5ICXB 1TIUA 4I4WA 3C8HA 1SJHB 4LLUB 2GQHA 4I8DA 3NCYP 1G7IA 5GGRY 1YDPA 1LE9A 4JFED 3DX7A 1BGXH 3HI1A 2R1XA 3GRWA 3VFGL 3BGMB 4MNQD 3MV8E 5E00B 4NZTH 4A6YH 1Q9LB 3ISWA 3T4AA 2K3TA 2IF7A 5GGSY 5BZWA 3ULVD 1JHKL 5B39B 2LAGB 1JMZA 1DDHB 4N0FB 3W11C 5I1HH 4PLNC 1LK2B 1T2QH 1WFOA 3SDAA 3F7YA 3FQWA 1VERA 1GPOH 4J3TA 3OXSB 3G9VA 1I8KB 3X11B 2JE8A 1C1EH 3TT3H 2B0SH 5H35B 4Y5VC 1D7FA 1IGML 3UJTL 4HKJA 3HNVH 5E1AB 1C7TA 3N1FC 2CR3A 5GS2H 2X10A 4P9ML 4OBSA 5E0QA 2IPTH 5D5MF 5F1OB 3GMRB 3OB0H 2FEEI 4K71C 5CP7B 2WBWB 4R4FH 3U0TB 1UVQA 2R56H 4HUUA 4NBYB 3PP4L 3MACL 4G8IA 4I0PA 3NIGE 2YSSB 1GGIL 2EDOA 4X6BA 5C0EA 1ZHNA 1FJ1B 3RZCB 1DQQB 4QWWD 4P2OD 3RKDC 4ZAKC 4XP9L 3HG1D 4MLSA 3JZ7A 5DURB 4OCXH 4WUUA 4Y4FB 5MEND 1OTSC 4KROC 1G7PA 5IF0A 2P47B 1BFVL 4QOKD 5BJTB 4JHWL 2E7BA 4FXKA 1BZ7B 3OXRB 1GGTA 2Q7YB 2QSCL 4N8CH 1QRNA 5D5MA 3H9ZA 3LZFL 1H3PH 1HCVA 3QG6A 4XCYB 4LASH 3RDTD 4QHUB 2DKUA 4WO4D 1IGYA 3Q5TA 4JN2B 3QB7C 1CDGA 5DVOA 1S9VA 4ZDHB 2FIKA 4H5SA 1YA5A 1OCWH 3PL6A 4N8PA 4MDIA 4ODWB 3VFTB 4PBXA 1J0IA 2O5YH 4U0RC 4ELME 5ECJE 2BSSA 1H3UA 1MY7A 4F57H 2EXYC 2VDPH 1OWWA 4NZRL 3LN5B 2A38A 3P3YA 3QZWG 2JJUA 4LIQL 2OP4H 1AXSA 2BXYA 4F33B 5C0IB 3OL2A 1F58H 2VXVH 4OD3H 4U31A 3AXLB 3IJYA 4X5LA 4EUPH 2VZ3A 3RVXD 1UJ3A 3C08L 3IKKA 5HBBA 1EEYA 2H32B 4RQQB 2VISA 4OQ1A 5DFVD 1QNZL 3IFLH 1IBGH 4LU5L 1WFTA 2YC1B 2LABA 2EH7L 4IRSA 4K3EL 5IMLA 4NN7B 4YXLL 3GSRB 1ZTXH 1A7PH 5C0BA 4XPAL 4Y16D 3K2UL 5C8JA 3LS5H 4BH8B 4HKZB 4GH7B 4PREB 1SJXA 3PQYE 3GMPA 2A6IA 5EC2B 5FXCH 4HIEB 5IVNA 4OUUA 1Z3GH 1PLGH 3UTSB 2XZAL 4NN6C 1ZT1A 4D9LH 1OAYL 3ROLA 4F8QA 4DKAA 3SE4C 1CFNB 4H88H 1NAKH 1PKOA 5DJ2A 2NY0D 1WJ3A 1INEL 2DQEL 5I8CB 2ZP0T 2B2XL 4PRAB 2Y6SD 2ICCA 2Z35A 2CMRH 4HQQH 1FL3B 2F54A 2Y1VA 4C56E 4FZEL 5IVXA 1J7VR 5EPMB 4GLRI 5AUMB 1FVCA 1RUPH 3RIFF 4OZGF 3S34L 3S3PA 4NO2A 1J9CT 3QXTA 4Q9RH 1A3LH 3BGFB 4HS6A 4LGPB 3FQRB 4DFIA 1FQ9C 4BZ1L 4RFEA 1YN7A 3JTSA 1GOGA 2COQA 3O6KL 5CJOH 5T1MB 1QBBA 3L3KA 1CICA 5BRZA 1HINL 3C6LB 1S9KC 3MJGX 3PWPE 1YPZA 2YR3A 3WE6B 5HPMB 1LEIB 1MVUA 3S4SA 4KPHH 1OAKL 3U7WL 4MNGA 3NIFF 1YYLL 5DJZA 1NBZB 3FO0L 2XQBH 3EYFA 4U6XA 1JWSB 1CE6A 1RUML 2EDKA 2XXMB 4G80A 3GJEA 4YBQD 2YPLA 3G6JA 3T0DA 4JRWA 5IBTH 4IRJD 1XF4A 5DRZB 3RX7A 4G8FA 4PP1D 4ONHB 4GG6A 2JIXD 1JJUA 1IGJB 3UTSD 3VGBA 5MI0C 4KJPD 4HG4K 4DGVH 4HC1A 2KKQA 1QKZL 1YNTA 2YPVH 1T5WB 5JHDD 3G6DH 2XA3A 1T21A 4HH9A 3SDXB 1JNNH 5DQ9B 5LGJA 4EN3C 5FGSA 4LSRH 5GRYA 1OAXH 3EO9L 3O9WA 4J6RH 5JO5B 3HA0A 3GKZA 4JE4B 2ZKHL 2CIKB 4GKNB 2PW2A 4NZJA 4RAUB 3QIWB 4POZD 3WNKA 5H2BB 3W2DH 2HLAA 2UZIL 3DX8A 2BJML 3TJEH 3DVFA 1Q1JL 3BKCH 3LRHA 5IMKB 4F9LA 5FYLE 1OOAA 2PR4L 4M6NH 4IRSD 4NSKA 3WFDL 1MWAA 3PWJB 5E08L 1IAMA 4P2RD 5IB4B 5A3ID 4JPVL 3VWKB 4KK5C 3VFWB 1U8MB 5E8OB 2QHRH 3KPRD 3U4BL 1RU9H 4HMCA 4MXVE 5IHUL 4U1SA 2MNUA 5C9KA 1JFQH 1YJDC 5D1XC 3CSPA 4DVBA 4KVNH 4XMLL 2A77L 4F80A 4P4RB 2W9DL 4HHAA 4K23H 1KC5H 4CU7A 3VD3A 5JW5B 4R26L 5A43C 4LQ1A 1TMCB 2B4CH 3F7QA 4WW2A 4UT6L 3X12B 3Q0HA 5I2IB 1LO3H 1UM5L 4O2CB 3QUMA 3D9AH 1OAUL 2YUVA 3RIFK 5T3ZL 1W0WB 1UYWH 5DS8A 4XAKE 4WI2A 1A8JH 4AM0A 2R0KH 2IANB 4KRPC 5CMAA 1ETZB 1SYVA 2Z93A 3CXHJ 1FZJB 4XMPL 1EMTH 4G9FE 4PV8B 4D0CB 3UAJC 1R5IA 2FO4A 3LY6A 4Z0BL 2B1AH 1II4E 1N6QL 3MZTA 1F6AB 3IDMB 3VG0H 3MV7E 2B2XH 1D5MA 3KNBB 3U9UB 1ZLUH 1T1WB 2XRAH 1CXEA 3P0YL 3IDNA 1F4WL 1ZXQA 1M1SA 2VXQL 2VO5A 1N64L 4LK4A 4LPTA 5D8JL 1WZ1H 1A14H 1L0XA 1XF5A 3TZVD 1MREL 5ACMA 3PIQA 4QYOB 1BX2B 4X83A 1IVLA 1CGVA 5E2JA 4NBXB 4LVNB 1OPGL 2VLRA 4K2UL 4P59H 1MOEA 1RUKH 3MV9D 4HGWA 2X1WL 3HTLX 1G6RA 3OR7B 1J8HA 4HUXA 2EH7H 1UXWA 3LRGA 5JOFA 4KH2A 4DOHE 1JYVA 3S34H 4PRNA 1V3KA 4G9FD 3U0WL 1MHPL 2BCKB 5CSZB 1CFBA 4PG9A 1HZHH 4FTVE 5J11B 1QD0A 3BESR 2FJFB 1E6JL 1F11B 3PG2A 4WUKH 2NMSA 1K5NB 3L3IB 5EBWA 1F3JA 1IEBB 3DECA 3IFPA 5CCKL 2A9ML 3HR6A 2XTLA 1TJGL 4UDTB 3GIZH 4NBZB 4PJXB 3PV6B 1KEML 2BC4A 4IMKA 2CJUH 4JFQA 4ODHH 5LBSH 2WBJA 5FA4A 3DARA 1TPXC 5EBLB 5FGCE 4AENB 2DQFA 2X6MA 3VXUA 1TTUA 4AEHL 3U82B 3TNMB 4LCWE 1T6WA 2QV2A 3QRFM 4K3EH 3BPCA 4TRPH 4IRJA 1EHLL 2CDGA 4ELKA 2NZ9C 5BVJB 2Q76A 4OD2B 5ESAB 1TZGH 4FTVD 1CXHA 3IRZA 1BZQK 3PUCA 2XQYK 4F9PC 3RGVC 1RZIB 3FTGA 3KPOA 3RVWD 3SBWA 5B38A 2D4DA 1GHFH 3PGCB 3LQMA 2AGJL 2V9QA 2QL1A 5C0CD 2LVEA 1G7JB 2E6JA 2Q8AH 3MSPA 3UROR 5C6TL 4HV8A 3KPSB 3D6GA 4QRTB 3VXPB 3CXDL 1RI8A 5T1KA 1VFUA 2D4FA 1NFIB 3Q2CA 3SCMD 4JN1H 1NEZG 1G7LB 1JF5A 3OHXA 5EULV 4JZOA 3WHE0 2AJSL 3B8YA 4OZFH 1LHZA 3V0VA 4I1NB 1ZAGA 3Q5YA 2AJZB 4HQQL 4OLWH 1I7TB 3OKKA 4GMTH 4LOUD 4FFYL 4UNVA 2XOTA 1T22B 2DN7A 3JV0A 2VLKA 2YK1H 4GKZB 5KVDH 1J0JA 2X2YA 3T8XA 2DF3A 4X6CA 3QPXH 1D3CA 1MPAH 3FFCE 5DJYB 1U95B 4WI9A 2IBZX 1TJHH 4NO3B 4R2GD 5DDHB 3DO3A 4RMQA 4U33A 5FHAL 4N9OB 3ZDYF 2V2XB 3DV6B 5ISZA 5DTFA 4L3ED 5FCSH 1BLNB 2O5XL 4N1HB 4HIXH 3BZDA 2CDEA 1KJ2A 5ANMB 1JYWA 4PTTA 3MV11 3RWGB 4D0BA 2DM3A 2YZ1A 3VW3L 1MCIA 4WEUD 2CRYA 3T0EC 2ZCKH 3PWUA 3AFLA 2EEAA 3S98A 8FABA 3RWFB 3VI4F 3U48A 4LPUA 5TDNA 3JSSA 4BUHA 3ILQD 5JXEC 5KSAA 1OY3B 1QEWB 2WAHA 3E0GA 4R0LC 2R2EA 3MV8A 3AREC 4PGBA 2GY7B 5F89A 2C5DC 3CPLB 3O2DH 5EIIB 4G6KH 3S96B 5C0FB 3CX5K 5C0BE 4JFPA 3T3PE 5MEPA 2G5BA 1TCMA 3VWKD 4JCLA 1JPTH 2DI8A 1C16B 5A2FA 1SEQL 4XXCC 2AK1H 4NN5B 2HWZH 2VZUA 1ONQA 4OZFA 1P9MC 1DN0B 4NQDD 4XXDB 3EYUH 2J6EH 3Q6FA 1WWCA 3CFEB 3K1DA 1IFHH 3UYRH 3STBA 3BUYA 4M9OA 3DRQA 1KV3A 4TUOA 3QH3B 3O6MH 3LHPH 2HT3C 1HHKA 1G6RL 4XCNB 4JM2F 4OFPA 2JJTC 3D25B 1CLZL 1JGVH 1XGTB 3RA7H 5CKGA 4D9RD 4I3RL 4JR9L 4O2EA 1OB1A 4IOIB 1KT2A 1KJ2L 3ARFD 1RK1A 4RWYL 3VD4A 4IEFB 3DXAB 1RUQH 4PRHA 4OZHB 2VXTH 2FX7L 4MA3A 3T0WA 5IHUH 4N9GB 5IK3B 5IP4A 5C71A 3S88H 3H9SA 1Q38A 4ZXBC 1CXKA 4MJID 3GHBH 4XPBH 5E4EB 2ADFL 4PJ9C 3O4LE 5B38G 1MCWW 2DTMH 2R39A 1XGQA 5DGRA 2FH8A 3DMMA 4XVJL 5DEFA 5DZLA 2HT2D 1SY6H 2V7NA 3AGVA 1HWGB 1S8DB 5GGQL 2R2HB 3LD8B 4PJDB 3GMNA 5DJCA 1C12A 1IGFH 5BS0B 2AQ3A 2HLFD 2F8XC 1NCUA 3U2SB 1DBKH 4PJFB 1XAUA 1CDUA 3L3GB 4OTXH 1HHJB 3QXAA 4J1UB 1J0HA 3C5ZC 5F88A 1UXSA 3ARPA 3DRTA 1CDBA 4X4YA 4EXKA 2YD3A 3BDYH 3PJSB 1FFNB 1ERNA 1EFXB 1BVLB 4ZO6A 1EDQA 4U3CA 1V5JA 3UEZA 5SWSB 1MRCL 1P4IL 3OGCB 4MNQB 1RZJH 2V17L 1NC4D 4QLRA 4H8WC 5DHYB 3LEYH 1JK8B 2G9HB 4FQXA 3NH7H 4XRCA 4K7FB 5HGBB 5L2JB 1HHIB 2GK0A 4WTXA 1T04A 3I6GA 1PYWB 1JNHA 1EJ6A 5HGDA 3OR6A 1U8PA 1OP3H 1HH9A 2EDEA 5EOTA 3PGFL 1FL6B 3CZJA 1X5YA 3TO4B 4L4TB 2FR4A 3GJFA 2H2SD 1KXVC 1L4IA 4JG0L 5F7LB 5JIIA 1EGJL 3C5SB 4P9HL 3L3OB 4NZTL 1NCWH 5D71L 2EKSA 3TO2A 1KENL 2HT2C 1CD0A 2XTJB 4EI6B 1NCBL 3MGTA 1MFNA 1ZA6A 1WT5C 3N1GC 4M7LT 1IILE 5F7DB 4PRHD 4QXGL 3QQ3B 1AJ7L 4QRPA 1I7UB 3S5LG 5I1KH 4JQIL 4ZOBA 3MMEB 4NQEE 4CN4A 3BEVA 2DQGH 3HUJB 3F5WA 3T04D 2W0FB 3TT3L 4RWYH 3T0VA 2B5IC 4P2RB 1EO5A 1OF2A 4NNPL 2WQRA 3QYCA 2X44D 2MKLC 5EOCH 2I60L 1B4JL 2YS4A 1Q9KB 2XIDA 3DX9B 2Y06H 1WISA 3UMTA 4L5FH 2NYYD 2JIXA 1P9MA 5I19H 1U41A 5C08E 2W1NA 2XY2A 5BRZE 4L4TD 5CIPB 3CCHB 2VQ1A 2WNGA 4G6MH 4JGJA 3JWDH 4O02H 35C8H 4XX1E 4GRWH 1OW0C 1U3HB 2CIIB 4FHBD 5AYUH 2VAJA 5A16A 2Y5TA 1UCTA 2ADJB 3TBVB 3RUGE 3QIUA 3GK8H 3DGGA 3D39E 4AEEA 4M1CD 5I76B 3SDXF 1I4FB 4LEOB 4EOWH 4LFHG 3WXWH 2NY2C 5KANI 3V6OC 4R3SA 5J1AB 4Z7NE 2HJKA 4X99A 4GRLA 3D0LB 2XV6B 1OSZB 5IFJA 4OGXH 3VI4E 3WFHA 1OSPH 3P4MA 4QRRD 4FP8H 2Y9RT 2FEDC 3TH2T 1LO2L 3BDYL 1XR9A 1HCFX 2QQKL 5JLZB 5C08B 3DHJA 2WBKA 2X4QB 3TN0C 1T7XA 2EYRB 3QUYB 4OD1H 2QSVA 4JVUA 3U83A 1CQYA 1IE5A 1A7NL 1N5YH 5JZ7C 4EN3B 5FB8A 4U6YB 3TPUB 5B8CC 3STZA 2JJSC 3D39B 3FO9B 2YRLA 5C0ND 3SDCA 1MCOL 2EDJA 3MJ7A 5GS1B 4LEXH 3KPNB 3C8KA 2ZG1A 1M05B 3ZYJA 2HRPH 1S7RA 2YD7A 5EO1B 4KKAC 3BGAA 4YEFA 1KEGL 1BWMA 2IQAB 1F90H 3OKOA 3HB3D 3QCUL 1JGLH 1XIWD 3WJJC 3B9KB 1A1MB 1FP5A 2XZQH 1XR8A 3HAEG 1X4YA 4HS3B 3SY0B 1QR4A 2GCYA 3AAZA 5ITBL 3O0RH 2FJHB 3VFMB 3RTQA 5HYSB 3TJHC 4OLVL 5BVPL 4HUWB 3QUML 5J12C 2UWEF 4OCWH 4MA7H 4UQ3B 4QXGH 4RAVA 2NNAA 2VSCA 2EH8L 3LAFA 4S1SL 3BP7B 4K7PH 1YUHA 1HINH 2J4WH 1XGYH 5GGVY 2AQ2A 4PGDB 3QI9A 5MEOB 2GTWA 3IFNH 5J6HB 4YO0A 5K9KB 3PGDB 5JR1H 4V1DB 2JTDA 4P9HH 1JPFA 4HFWB 4LKXB 1NL0L 3CFKA 2GUOB 1A7OH 4UV7H 1ZE3C 3BHBA 3JTTB 4OAWB 3BSZH 5GS0C 1RURL 2C1PA 2J3SA 3BGFC 4Y4KC 3FFDB 2ZUSA 4WO4A 3ZMRA 3N50A 3L95A 4LKXA 1KUMA 5F9WB 3MA9H 5I30H 4QF1B 3MO1B 5K9KA 4OZGB 3VA6A 4KRPB 4LPCA 1GH7A 3EO0A 2GIYA 1ADQA 1JPSH 4DAGH 3I9GL 4G8GD 4Z7VB 1FFOA 1P4LB 2NPLX 3BQUD 4U4BA 4MQ7A 3OTTA 3MBEA 2A6KB 5E8EB 4X7FC 2VDRL 2ADFH 2ZUWA 2WANA 3FO2A 1CYGA 1MFBH 4ISVB 1NFDB 1PFCA 2D7TH 4XPGL 3WDHA 1RV6X 3BPNC 4X4ZA 2J8HA 2NTFA 4L8BA 4V1DE 2OSLA 5F44A 2OXGA 1ZANL 5DD0H 1H5BA 1HYRC 1XMWA 5H37G 3S7GA 2E8ZA 3SGKC 3KPMA 2YMXL 4M4PA 4TUJB 2FECL 4Q9BA 3MLTA 4XVTL 4J6RL 1RJLB 2NX5B 2QHRL 1I1AA 5F8RC 2ICWA 3EO1B 1F97A 2KL6A 1CLCA 4Q6IA 1BAFH 3DYPA 4FQ1H 1LO5A 5D7SL 2VKWA 3WUWB 3C60D 1BQLH 4KKBD 4N8VG 5EBMA 4S1DD 4PJEE 4O51A 25C8H 4NKMB 1J8HE 4AEIH 3F12B 3V0AC 4XBPB 1WWWX 5FM5M 5AYQA 4MQXC 5IV2A 5L88H 4HWNA 2EYRA 4PUBH 1KLFA 4J3WA 4KDTC 3W2DL 2E27L 3MRPB 1IZKA 3L3HA 3FOMA 1BQHG 5BV7L 4MQTB 1KIQB 2P8LA 5J12B 1HDMA 3BRDA 5I15H 5E03A 4U2ZA 5GIRA 1YPZE 3C2AH 4NM8H 3RY6C 5I71C 3GSXB 2Z31C 2OL3H 5FYJD 2BVPB 5ITBH 4HIJB 1T1XB 3K4DA 3O6KH 3TCLA 3ZTJH 1CFSB 3NMEA 1KGCD 4WGWB 5HY9A 2ZPKL 5E5MA 5C1MB 5E8PB 4CVWA 2P46B 4QGYA 1OP5H 5ACZB 4R26H 1P7QA 1J8HD 1YY9C 3CVIL 5D1XB 1JMXA 4QHLB 3G04B 3VXSD 1U3HA 3EOBA 3MLXH 2MPAL 1BBJB 1LE5A 1N3NB 2D2OA 4K7PX 4AMKH 3CFIC 1FZKA 2HJFA 4YAQA 1KTLA 3LKRA 1WCBB 2HFFA 5D7IF 1U92B 4QEGA 4Z8FH 4Z7WB 3RBSA 1S7WB 2AVGA 3TV3H 1JL8A 5CD3A 2XN9A 5CP3A 4APQB 3U7YL 4HKXA 4GMSH 4YHLL 2VB5A 3VGEA 2FL5A 4JVPA 4XC1H 4P5TD 4J7RA 4LSRL 1RZ7L 3VFPA 3QO0B 3MMEA 4XCCL 5JOPE 5KN5A 1CDCA 4GXUM 5C0JA 5GZNC 1FRGL 1DBBL 2DKSA 1JN6A 1M7IB 1LEKB 2HVKB 3LEVL 1ZA6B 3MGTB 2X1XR 1MLBB 3C6LC 4KGJA 4CU8A 1MRDL 4JFFB 1LEGB 1GRWA 3BXNA 3T0XA 1MI5B 3VXRA 1ZANH 3C60A 5DD0L 5GGUB 1YPZF 2EDNA 4PJAE 1X5HA 4B50A 3L3OA 3CFDB 3QDHA 3B9EA 2WQ8A 3MJ9H 1RULL 1A1OB 5LCVL 2QR0A 4NP4H 1HNFA 3PWVB 3DO7B 5K93A 1MJ8L 4LNRB 5IBUB 3GI8L 4EOWL 1D6VL 4LLYA 5A2KH 5K9QG 1F4WH 4X0KA 3OKDA 4IOSD 4BFEA 4C55A 6FABL 1HH9B 5AD0B 4JKPL 3ECBA 1DQDH 5HGDB 4NO5A 3MRQB 4FQ1L 1GVIA 2EYSB 1OPGH 4LSSL 5SWZE 4WFED 5DQJB 5FCUH 3QIBD 4KXZH 5D72H 5KSBB 2DQTL 1KFAL 3SQBA 3D2UA 4ZFGH 1YMMA 4PYGA 2FZ3B 3BWUC 3PJSA 3TH4T 4D9RE 5JXAL 2P5EE 4M43H 5DJ6B 4FZ8H 4RMUA 1NAML 4OI7A 1I1FA 4JPIB 1HHJA 3FB8A 2B1AL 1W8NA 4PY7B 4YQXH 4UTBH 1KELH 2ED9A 4GOSA 1IC4L 1RIVH 3I6LD 2R23A 2ZUTA 4KY1L 4AY0A 4L8SB 2VDLL 4HBCH 3FOLB 3V52L 5I1EL 4LLMB 5T3ZH 1XGQB 4PY8J 4LVOC 4Y89A 3CDGB 4OLUL 2J8OA 2DQCL 1NUNB 4JFHD 4Y4HA 3TVMA 5C2BL 1UEMA 1RIHH 1KC5L 2AP2A 3GI9L 3MREA 5DGQA 1DEEA 4HSQA 4PJEF 5DUBA 4XP4L 3F8UB 1K8IB 3BW9A 3MCG1 1B6DA 4MGXA 1LNUB 1N5YL 4M5ZH 4QWWC 3FRUA 3G6AB 2J5LC 3FQUB 1BWWA 4MA7L 3T0AA 1RURH 1QSFE 3P77A 5I8EA 5IKCB 1QPXA 3DRQB 4KGLA 3JV4B 4H0GA 1G7QB 1A9BB 4UIMA 1F4HA 4HLJA 1MHHB 1OTUC 4BUGA 5I30L 1S9YA 3KYAA 3ES6B 4OT1H 1HIMH 3HR5A 2J2ZA 1I9JH 3CFEA 2R2CA 5I1HL 1DN2A 2BVYA 2Y07H 5FKPB 2XI9A 4UILH 3HC4L 3RVUC 2FSEA 3N1MC 2QR0B 3P9MA 2G5BB 5F9DC 4YLQT 5E9DA 3CD4A 1QO3B 3B9KD 5FM4A 4JFDA 5ALCH 1GGIH 1WT5A 1T1ZB 1K8IA 2F8VA 4HPYH 5DUBB 3PHQB 4J3SA 3BXNB 3V4UL 2BY3A 4JDTH 4P46A 4NPYA 4R4FL 3SKMA 2NY7L 5F3BA 1UZ8B 2DIAA 4HH8A 4O2FB 2HVKA 5C6TH 2Q8AL 1P4BL 1MCLA 5SWSE 1IGMH 4XBGA 3WIHA 4BSVB 3D87B 1MFAL 1CD1A 4LP4A 1MLCA 4ZUWA 5C7XH 5GISH 5EO0B 4YHYC 5K59F 4P23A 2AJXH 2CDEB 2R23B 1WEJL 3MBXL 3PP4H 4LSPL 5DTFB 2QKIA 2ADIB 2XYCA 3H6JA 3DV6A 3NAAH 3GNML 2A2QT 4KK9D 1MJJB 3FB8B 1IQDA 4QHNB 5ILTH 5CD3B 4ZOEA 1F6LL 1S7WA 4X7SH 2XACC 5H94A 5F1KC 4DGIH 5L7XL 2HFFB 2NY1C 1U95A 3ULUE 3TZVB 4X6CB 2ICES 3D3VD 3N9GL 4OB5H 3SBWC 4GKZA 3BRGC 2ZSVB 5CINH 4XBEH 1BQHB 3G04A 2WV3A 4UUJB 5I8OL 3AY4C 1HHGB 4G7YH 1KLUB 3DUUB 3X13A 2R4RH 1JUFA 2JF1A 4PB9L 1CXIA 5DD6B 1CT8B 2N4IA 5JUEL 5E5MB 1E4WH 2XN9D 1NEZA 5D2NB 1KJ3L 1D5BA 3KYKH 4RGOH 5AD0A 1CFSA 3U4AA 2KQMA 4MHHI 2BVPA 4FQCH 1KSRA 1KOAA 2IANE 1XGUB 3KYNB 5EU5A 3IDYC 2EO1A 5MENE 3IT8D 2EZ0C 4FMFA 3EJJX 3DO7A 2ICWJ 5B3JF 2NY6D 5I74C 1IZJA 2DQDH 5CJQH 3PWPA 1TCRB 1ADQH 3EJYD 1WAAE 5ESAA 4YBQC 2NXYB 5TGBA 3JVGC 4F7CB 3HNTL 4IIQB 2YA2A 5I75C 3F12A 2IQ9L 2DDQH 2IPUK 5FV1L 1LEGA 3B8SA 1DLFL 1V3MA 1T66C 2ZUXA 3BJLA 2Q3AA 4FZEH 1M7IA 3TNMA 5HYJA 5GGQH 3WNNA 4IDJH 4GW4B 4DTGH 5I75B 4Q6IB 3B4NA 4NQVA 5C0JB 2SEBA 3FQTA 3V2AR 1IM9D 3B3IA 5HHVL 1N4XH 3QO0A 4ONFH 4JY5H 5FA4B 1NSNL 4GAYA 5A1AA 4EI5A 5ETUA 1ACYL 3MLTB 5J0BA 1R3LB 3L5WB 5DMGC 4ZPTA 3QG7L 2FL5B 3BJ91 4M48H 4JDTL 4MMXC 3P40A 5D7KE 3ALWA 1K5NA 4QHKI 4APQA 1HSBB 1UWEL 1NFDA 4E5XA 1INDL 4WCYH 3FO2B 2X05A 5DMKA 1I9JL 1FZKB 2EDLA 2A6JB 1Z9SA 2DS4A 4WW2C 4EEEA 2FX9H 2AERT 1J8HB 4TSBL 1RUPL 1FLTX 1JZ8A 4JG0H 4OZFG 5D96B 3GBNH 3QNYB 4CL7A 5D1ZB 5CEZD 4WU7A 1L7IL 3SKUD 3MO1A 4QF1A 2AK4D 4X8XA 5ACZA 2F58L 3H9SD 4OKVA 1CDYA 4DN3L 5E8PA 1E6OH 3QFJE 4BKLA 5EO9A 5IFAH 4QHKJ 4YXHL 2E3VA 2C1PB 3LHPL 4EJ1C 1B90A 2BERA 3KPLB 3QI9D 5I66A 4K9EH 5IMOB 3DMMD 1D5IL 4L3EB 4GQ9L 5J6HA 4UI2A 4FA8A 1EHAA 4JZJC 2DBLL 3W9DB 4I48B 4J4PD 3VCLA 2R56L 5ALCL 4HC1H 4LIQE 3WFZA 4JANB 4ZD3L 5L7XH 4HUVB 5I8OH 1OCWL 1KIQA 2P8LB 3O4LA 3PV7A 4XH2A 1QTYT 3MGAA 1T7VA 2VLJA 5AAWA 3P30L 1OP3K 2EKJA 1MCRA 3SDYH 1JPGB 3QUKA 3QDGE 4YPJA 2H3NA 5DS8B 4G8GA 2ATPA 4MNHB 5J1SC 2VDNH 3DI3B 3KJ6L 3MC0A 1J12A 3BPLB 5FO7B 2CRZA 4ELMB 2GCYB 3RVTC 4PB9H 5IFHH 4LRIC 3HNSH 2F54D 1QSZA 2AKRB 5CEYA 2YRZA 4ONOA 2OTWB 2IQAA 1I1AB 4R90H 1BIIB 5CEYB 3JWNC 3L5HA 4UTBL 4P2CG 4OTXL 1S7RB 1L0YA 5AZ2H 2OJZH 4TUJA 4XNQA 1UM6H 4JLRA 3U6RB 3VXMD 3SDCB 5GRXG 3ZSSA 4EUPA 2J88L 3DETD 3D39A 3HE6C 4L8BB 4NRXB 3VFWA 4K94H 1Z2KA 5INCB 4FFWD 5FB8B 1UFUA 1AGFA 1JPGA 3QUKB 4BH7B 4LVNC 1H3PL 3E8UL 2C4FU 5C0CB 4P4KC 2X4QA 2DJSA 3BYTA 5E2WH 3BP6B 4X6FA 2OMNA 3VGGA 3RTQD 1H3TA 2MCPL 3P9LB 4OT1L 1G9NH 3QDMA 4I18B 4KK6D 3QO1B 4OIIH 4JFFD 3QNXA 4ZYKA 5ALBH 5FUCC 2EXWC 3DSFL 1AGEB 4X99B 4R3SB 4MNQE 4OAWA 3HPLB 1XCQB 5I9QB 4Y8AA 1N2RB 4BKLB 1H3GA 4P2QA 2A77H 3CFKB 3SGEH 5AZEH 1F2XK 1RUAH 3TBVA 3P4OA 4YO0B 4KMTH 4YFLF 4U1LA 2GTWB 2IC2A 2FCBA 1CWVA 3SDXA 4PGDA 2C26A 3OQ3B 2OM5A 3FMGH 1P5UA 5LBSL 4AG4H 4O5LH 1PG7W 4F37K 2P8PA 3GMMA 3BP7A 3RVTD 1YEHH 2PXYA 5IVXF 3RRQA 2YN5A 3QQ9D 2UY7A 4WFEE 5JW4N 3SEPA 4M4RA 4JFZH 1DBMH 3QXDA 3K2UH 5FIEA 3G6JB 1ZHLA 4XB7A 1MCCA 3IU4H 1CK0H 3CFBB 4K07A 1WAAF 5FECA 1I8MB 5CBEA 3ZKMD 4M03A 4YBLC 1YPZB 3BEVB 5L2KE 1L0QA 3L5XL 1FCCA 1KJVB 3PDOA 2SEBB 3FQTB 3SDDC 3L3KB 4UMGA 4DKEL 2UWEA 4NQVB 5BQ7A 3M17A 1PZ5A 4YDLC 3C8KB 3RJQB 3MJ7B 5GS1A 4NQDE 2F9BT 4KRNA 5F7DA 1NL0H 3LD8C 4GRLD 1MFAH 3STZB 1PDKA 3BO8B 4ZUVB 1KCVH 2YPVL 3RKPA 4J2XA 4BQ6A 4ZTOH 2EXWD 3DJ9A 5M95B 1EEZA 5A2JH 3D85B 5HYFA 1HOCB 4TVPH 4HXAH 3DOSA 3ROLB 1GJIA 4NKDB 3GM0A 3F62A 3MJ8A 1YEKH 4TPRH 3INUL 4KI5D 5IFJB 1OSZA 4K71B 1G9MH 1KCLA 2BNUB 3MODH 2JB5L 1HWHB 1JNHB 2OL3L 4Y1AB 5C0BB 1CD8A 2ZCHL 1CLYH 1WICA 1JZ5A 3ESUF 4RZCB 4PUBL 3OAUL 5I76A 4U6TA 1KLUA 2YC1A 2ADJA 5A16B 3K0WA 4P3WA 4AEIL 4LHUD 4RQQA 4EKXA 1N26A 2WMPA 4JM2C 4NOBA 3NIFE 5SWSA 5CIPA 2R0KL 4NM4H 4M7KH 1FIEA 1RU9L 2JIXB 1QFOA 3TZVA 3QEUA 5H94B 1AXSB 4F33A 1FCGA 3B5HA 1UXSB 4PPTA 2KZWA 5EZJA 4KU1A 4J1UA 1MI5E 1F90L 1GHFL 1MJJA 4PJFA 4O4YL 2QADB 5TE4H 3FB6A 3VGAC 4XHJC 4P2RA 2WUCL 3L1OL 3SDAD 4PJDA 4P23B 2A74B 1OAUH 2HRLA 1MHEA 3DUSB 3OPZH 2WSKA 3VU2A 3VJ6A 4PY8I 2FIKB 1WZ1L 4IRZH 4JO2L 1RJYB 4XCYA 3EAKA 3R0NA 1JWMB 4OCRH 4KZDL 1QRNB 1I1CA 3OXRA 4XX1G 3P4NA 2XRAL 4EI6A 3R8QA 1LO2H 1VA9A 4L8DB 1CG9A 3TFKD 3MYJA 2HT3D 4YHML 4Z7QF 4QTIL 5HGHB 2P42B 4JFDB 4M6OH 2OI9B 1OB1B 5HHNB 3S37X 1KTKE 1DQQA 3P9MB 5IMMA 3D25A 1TJIH 4NCC1 5EZOL 3NTCL 3UC0H 3GFUA 4MJIB 1QYGL 5FKPA 1WQVT 5GRZA 1A6PA 1EJOL 3IETA 4TUOB 4GG6F 4XC1L 2EECA 1NJ9A 1YEJL 2JJWA 3U0PB 4W81A 2V5RA 3ES6A 3GMRA 1S9YB 3QRGH 1NMCB 4OQTA 3RWJB 1A9BA 4UIMB 5HPOA 5CGTA 5LXGH 1ZT7A 4UT7L 4N0YH 1CGXA 2XZCL 5HVHC 2MQCA 1JYNA 4K7FA 4RGND 3FONB 4X8JA 4F9PA 2E7LC 3LKSA 5DHYA 5JHDE 4RA3A 4AL8L 1EO7A 1G9NL 4JFDE 4ZQKB 4ODVH 5IB2B 4OCWL 1D5IH 4OCYL 5F1SA 2NY3C 3MLRH 3S96A 4DGYH 5C0FA 1G9ML 1Y6KR 4JKWA 5EIIA 2K9UA 1Q9LA 5BV7H 5F89B 3TN0B 4XNXL 5C09A 3L3GA 2OZ4A 5MP6L 1CL7L 1A1NB 1VPOH 3OAYH 4RX4A 1U3JA 1A47A 3U2SA 1SJHA 3CDGA 4M1GH 5DWUH 5IROC 3DVNB 5DJCB 3GMNB 4LLMA 3CXDH 3WS6A 2O26U 4I3GA 3MBED 5IUSA 1S8DA 1EHLH 3FOLA 1MUJA 4XCEA 3AS0A 4PTTB 3HC3L 1H15A 3P30H 3AM8C 1K4CB 1B0RA 5FO9A 3WD5H 4E41E 5FO8A 1FO0A 1ACZA 2IAMD 5IGXH 1KXQE 1NFDF 2VQTA 3HFML 4PBVC 3KJ4B 3H9SB 3I2CH 2VOTA 3QHFL 2Y7QA 2JB5H 3HC0A 3MV9B 2YUZA 3LS4H 3DX6A 5DJ6A 1VFMA 2ENYA 4YIQA 5J3HD 3BDXA 4W70A 4DKFL 5F96L 1KACB 3KPSE 4G9FB 1P1ZB 4OLYL 2J88H 5E2VL 3ZYOA 1IBGL 2DB8A 3D2UB 4JJHA 1IM9B 3GSVA 4N0UB 4QOKE 4O2EB 1CFTA 3ULUF 5KSBA 2UUDH 2P49B 1BEYH 5TH2B 1MCPH 3T0EA 1IEAA 3CFCL 3MUZ1 2XKUA 4NUGL 1HHKB 2DTSA 2WINA 2Q87A 3NN8A 4HWZA 4RNRA 2CUIA 1HK6A 2C3GA 4PJ5A 2VLMD 3BUYB 3MRQA 5JW3L 3SE3A 4NO5B 3NH7L 2EIBA 2XZAH 2ADGA 3OX8B 1QLFB 3VRIA 3UZEA 1UQSB 5ID0A 4QTHB 5HYIA 3H0TA 5DMIH 4X0KB 5EORL 3L5JA 4LPYA 2GFBA 2YHGA 2NY1B 5TF1H 2R0LL 3VFOB 5CAYB 1KJMB 3GMQB 4KV5F 2VLJE 2EE6A 3HE7D 4GXUN 1I8LA 4JFPB 1P7KB 5KVEH 4N0UE 2GT9A 2IH3A 3GO1L 2HYMA 4KHTL 2QSTA 3VGFA 5BVJA 3ZKND 1OVZA 5GGUA 4XAWH 2C9AA 2VXSL 1KIPB 3D85D 4XCFL 1I3GH 3FKUS 2HVJB 1F3RB 4PRIA 1MLBA 1NAMA 5KSAB 4PJ7F 4EXPX 8FABB 1JN6B 3D1MC 1OL0A 1ORSB 4GLRH 5JW4Q 2XG5A 3TVMD 4LVOB 3HMWH 5SWQA 3VXRE 3ZE0F 2CK0H 2YBRB 5J1TC 1M7XA 4JFQB 3QDMD 5GGVH 3PV6A 4FQIL 4UDTA 5D93B 3REVB 2V2XA 3KXFA 3ZLQC 1A6VH 4I3RH 4JR9H 4DVRL 5DT1H 1CLZH 1JGVL 5HHME 4OZIB 5DJYA 1DQJB 1F6FB 1X3DA 3A6BL 1Y6MR 4MJ5B 3RP1A 1MVFA 3OR7A 4HGWB 3ZL4L 5EOCJ 2VLRB 2OJEB 1JRHI 4ZO7A 3RVVC 2IH1A 2P7TA 4MDJA 1P7QB 3LH2H 4XP6L 5JZ7D 4M02A 3OHXB 3VXRD 2CLZA 1BGXL 3IAQA 3V6FB 4JO3H 5GGSA 1IKNA 5M7QA 5DD1L 2VC2L 3TJEL 4KRPD 4GBXA 4HIJA 4X80H 1J05B 3U4EA 4XPAH 4JRYE 3O8XC 3WXVH 5IG7B 3GSXA 3IDMA 1NC4B 1BD2D 1NUGA 3RWCB 1LDPL 3PGCA 8CGTA 4LCUA 4FXGA 3GI9H 1OQXA 1BFSA 5KAQG 1G84A 3TBYA 5GRJH 4QNPE 3MRPA 4JZNB 3BEWB 5KS9A 1NBYB 3PXJA 4OD2A 1KYOK 3C08H 2H9GA 2QBWA 1RZJL 5EUKA 1P4IH 3T0EE 1F42A 4XTRD 1RJZB 5TE6L 3F7PC 4FNLL 1T7ZA 1AP2A 1MAKA 5I2IA 4YWGL 1CICC 2AK4B 4YHYB 2Y5EA 3PWLB 5JW5A 3T4YB 1W2KT 4IOFC 3ZE0E 3C87A 4HEPG 1CU4H 1BECA 3PNWA 4N0CD 3V4PL 1XF2A 2EDFA 4U1SB 1KYOJ 5A2IH 4TULH 5ADOL 1YJDL 4Q0XL 1IEBA 1U58B 3ULVE 1ZSDB 1DTUA 2X4UB 3CZFA 5B3NA 5IB4A 1YN6B 4L3EE 1F45A 2AXFB 4NRYA 5E8EA 3SE4A 5DUPH 5EWIH 1KENH 1JNLL 2DI9A 3KS0H 5FYKH 1C5CL 4YHZH 3NCEB 1P4LA 5FDWB 1NLDH 1EAJA 4NWTL 3WN5B 5J9PB 1N4XL 4ONFL 4PJEB 2DDQL 5GXBB 4YPGB 4NQSB 5TFSH 5MI0B 3BH8B 2AJVL 1KELL 3V5KB 1W72A 5KSUB 4X7TB 2CMRL 1NCWL 5D71H 3CDYA 3FB5A 1S7VB 2MJWA 5T33L 1L9MA 3IDIA 1OTTC 3ARBC 3BHBB 3JTTA 3NGBB 2JCCB 4HWBL 5JA9A 5JO5A 2DWDA 4V1DA 5C07E 1QVOB 5LWYH 4TOYL 1QSFB 2BSTB 5TDPB 3QI9B 4HH9B 5MEOA 4UAOC 5ICZB 3W0WD 3KHQA 1QFPA 5FHBL 1R5IB 2FO4B 3AREA 3C60C 4WI7A 1YUHB 4OZIF 1YY8B 1YQVL 3JV6B 3ZO0A 4AM0B 2IPKB 3H3PL 4G8FB 4R97B 3U36B 3GMOA 4NQXB 2H1PH 2OL3B 35C8L 2AXGA 3L5IA 4N0CC 3WKML 4PJCB 2AV1B 4JEGB 4JFEB 5IQ7L 1NBZA 3V4VL 3QUMB 4O2CA 3AAZB 1WIUA 4MNGB 4JDZB 1UM4H 3MNWA 4HS3A 4WW2B 5I16B 4F7TA 1XR8B 2GJZA 3B9KA 4DN3H 1X4XA 3OKOB 4U49A 3UBXG 3STLB 5DEGB 1CICB 4NJAL 4N90E 4DVBB 5EO1A 1BEYL 4F7MB 4W6WB 4OCMC 1KN4H 1YN7B 3MOAH 2PETA 4HS6B 3DV4A 4ZUUA 3SE3C 1H8SA 4U6YA 4EN3A 3VWKA 1FVCB 4ORZC 4ZUSB 2X9XA 1AH1A 3P4LA 4JG1L 5D4QA 4S1RH 1S5HB 3UP1A 2LU4A 3HI5H 4WHDA 5C0DA 5D2NC 3VH8G 3ARDD 2FH6A 1G9EA 4MZ2A 4PV9B 1NCDH 3DX8B 4NNXB 2HLAB 2X4TB 4Z78A 3D9AL 3QIWA 4PREA 3RI5K 1L7TL 4WFGE 3C5JB 5J1AA 4NM8L 2D31B 3VE0B 4NIKB 2G2RA 2HFEA 5IMLB 3MLUH 3DGGB 3NIGF 4MD4A 3HG1E 4NFCA 1UM6L 1JNLH 1NBQA 1U8JA 2DMBA 2P4AB 1CCZA 4PRBB 4WFFD 4D0DB 1EAPB 4XP1L 4X7DC 1NANH 2VE6A 4ELMF 4FQLH 4YDVB 4EQ2A 4OF3A 5ICYA 4LSQH 5F8QC 2NXZB 3VI3F 3MRNA 3PQYB 4I5BA 4KQ4H 1G7MB 1EEQA 2DLTA 4JFXB 4Y16C 4RWHA 4OLWL 4GG6B 1BPVA 4ONHA 2B4CL 4GKOA 1Q9KA 4DUWA 3L3JA 1Q94A 3MV7A 4G6FB 4Y4KA 2B8OT 3V5DA 4RISL 1OT2A 1C5DA 3AS1A 4YHNB 3VD5A 2LTQC 3S4SB 1LDPH 5JHLH 1FFPA 2MWCA 4XHQA 2XA8H 1KEMH 1CZ8L 5DXWA 3ARFC 3FZUD 4XI5C 3QQ3A 4RA0C 2QTEA 2E7CA 2HN7B 3GBML 1RY7B 3OGOE 2Q7YA 2ORBL 4XCFH 5IESL 1BZ7A 1OM3H 4NO2B 3LKOB 1DVFC 3EHBD 1PY9A 3GMLA 2YK1L 4GS7C 1DFBL 2ITDA 4DQOL 3GUTB 1A14L 3H42H 1FL3A 3HE6A 4X7CC 2PTVA 4GS7B 1UJTA 1ZHNB 1IC7H 3ULUC 2IFFL 5I8KH 2D03H 4WDIA 3T2NH 4D3CH 2O5XH 5L0QC 2BVOA 4OZGE 4ZODA 1HYSD 2Z91A 4PR5B 1UVQB 5E8DH 1AXTH 3D0VB 3O3BA 4OI9A 3QUZC 5F6HI 1G6RH 1T3FB 4HDIA 4M8QA 1T04B 5J57B 5E1AA 4WI5A 4LSDA 5H35A 4POUB 4Z0BH 3V0WH 1TDQA 3U0WH 3FRPA 3FQWB 2VISB 1AQDA 5EC1B 4JFOB 3VG9C 3BZ4B 1WLHA 1YMHB 3IJSB 4LCIH 1FO0H 3AXLA 2EDQA 2FJGB 2WW8A 3O4OC 1X5LA 3CMOH 5CEZL 1ODAA 2AQ1A 4X98A 4LLWA 1U42A 3GRWH 1RD6A 4WHCA 1ZWIA 4HPOL 3BGMA 1VACA 4NM4L 4JQVC 1AGDB 3UJIL 3QXAB 3NZHL 1Y18A 4OV5B 2ESVB 4JAMA 2GITA 1E4JA 4I0CC 4J4PA 2I5YH 4MB4A 4FN0A 4I4WB 4XP4H 5EUOF 4E0RB 1C12B 1OHQA 4TQEH 3UTTD 3QHZH 1IFHL 3NIDE 5I0DA 1DVFD 3EHBC 4AH2A 2UY6A 2EIEA 4H5SB 3GKWL 4URTB 3K81A 5F7UA 3SKJH 4XVUD 4X9GA 3QCTL 5D5MB 5ABDE 1MH5A 2NY0C 3UJJL 4EDXB 2BNQB 2B39A 5DJ8B 1T89A 5C09E 3V52H 4HT1L 4I0KA 4UV4L 2UYLB 5IK3A 4KAQH 2BOCA 1G7PB 3QDME 1FLRL 2I24N 3WNOA 3DXAA 5GZOC 3O6LH 1RMFL 1RK1B 1L9NA 1DUZB 1UG9A 2CO7B 3QUZD 2I26N 3V9FA 5CILH 3V6OE 1BAFL 4AIZA 3ZHLA 5HHMB 1Y6NR 3QNZA 1IEHA 3VFNA 2YSSA 4JHAH 4NJ9L 1OP9A 3UTQA 2QEJA 5K9OB 3VW3H 2VITA 4LU5H 3MRGB 1BBDH 3D5OF 4R0LB 4EDWH 1K6QH 2NYYC 5I1JL 3K80A 3BD5A 3EBAA 1WZLA 4JB9L 5GQBA 3S3JA 4XXDA 2HP4A 5CZXD 3NA4A 1F4YH 2VLRD 4NYLB 2X9WA 2XT1B 4LHUA 1J5OL 1IC5L 2XTJC 2AEQH 2DM7A 4B0MM 4PJCF 4N8VA 3IU4L 3ELAT 2ZOLB 1G1CA 4M1CC 1DDHA 5B39A 1X5GA 2JJTA 1BMGA 4ZTPH 4JY6A 5C6WH 4I0PC 4UQ2B 1FH5L 1CVRA 3TZVC 3MV8B 1V05A 3QFJB 4YK4C 3ZE1E 1LVEA 4QCIA 2UZXB 1R0AL 3OKMB 5E94B 5LXGL 4LBEB 4LLUA 3RAJH 1JGDB 4HPYL 5ICXA 2H2PD 4QGTA 2PO6A 1EFXD 2MTPA 2YA0A 3FQXA 4K3DL 4X6EA 2FEDD 1U9KA 3TA3B 4JGMA 4JFHE 4LHJB 3MJ6A 5D2LB 3TA3A 4P48A 2ITCB 1D6EB 4MLIA 2V5SA 3SJVD 3OAUH 4LCCC 4PJIE 5F1NB 3T1WA 2AK4E 3CJJA 5D7JA 5CIPH 5E94A 4X5WB 4HWEH 2VZ1A 2GTZA 1UCBL 1AD0A 1QHPA 1R5VA 4G43A 4OJFH 1AXTL 3F7VA 4M6NL 1FBIL 1FO0L 2GHWB 2B5IB 2QADD 3MRMB 2HMID 3GI8H 1V7MH 3K1KC 4V2CB 2R0WL 5INDB 3UC0L 1AGCB 4YHOL 1G0DA 4YC2C 4P5MB 2GYSA 1KCKA 1CZ8H 1OAYH 2EDWA 5TDOA 3UTSE 1HQRA 4OSUL 1H8OA 3SO3B 2AJZA 5EU7C 4AEFA 5GSVB 1QG3A 4LDEB 5CZXC 5T3XH 1AO7B 5J13B 3IAPA 5D2LE 5E99L 2BZDA 4GKSB 1JPST 2XTJD 4WUUE 3OKLB 4Q2ZA 2YPLD 3BKML 1QFWL 4WFHE 3VXPA 4WTZG 3F58H 4NQEA 1ND0B 2C3HA 1G0XA 2C7UB 3DBXB 2LU7A 2EEDA 1SJEA 3WLWD 1FG9C 3T77B 3WKNA 1SY6A 3MV01 2F53A 1XIWA 4TQEL 3MA7B 5ITFB 1AHWB 2VDLH 3UAJD 5JPMA 3WIHL 5EIVA 2R9HD 4UBDD 1ZHKB 3UJIH 1I3UA 3VGAB 3OB8A 3F7RA 1KCRL 1MQKL 3KYKL 4RGOL 1U8HA 2MHAA 2VR4A 3QCTH 4NZRH 2H6PB 2BOCB