4XNUL

X-ray structure of drosophila dopamine transporter in complex with nisoxetine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of Drosophila dopamine transporter in complex with nisoxetine and reboxetine.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
molecule keywords Integral membrane protein-dopamine transporter
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuL01
3VI3F 2Y25A 4JFOB 1QLFA 2ZSVA 4HPYH 5A43C 3QSKB 2BNRA 4P23D 4Y1AB 3RKPA 3V0AC 2A0LD 4PRPD 1UB5B 3UPCA 4LIQE 4LCUB 4YQXL 3GRWL 2IC2A 3D39D 4NHUB 2CK2A 4XH2B 5E8NA 4O5LH 3QUZA 1H3TA 4YK4B 3KHQA 2AK1L 3KHOA 5HD8C 1NANH 3G6JF 4XCYB 3IGAB 4FQHA 5BJTA 3ARGC 1L6XA 4NCC2 5BXFA 1ZWIB 3QRGL 2J8UA 3PWPB 3DVNA 4NO0B 4U6YB 3VFTA 1RHFA 1S5IH 2GJ6D 1FP5A 1RZJL 1T5XA 4OZHE 4KKCC 3EYQD 1PAMA 5SWSD 2CO6B 1I1FB 2EDBA 1OF2A 1RZJC 3IKCA 4GRWB 4I2XA 1LE9B 1A3LH 5TJWK 4Z7VE 3QJFA 3DYPA 4MMXC 1MIEH 2JJTC 4GRWH 3WFBH 4FHBD 3L3GB 4G6JL 1HCFX 3MOBL 5C08D 4XRCA 5E2JA 1NCWH 3HRZB 1K8IA 5FFLA 3UJIH 4JM2F 3IJHB 2VZOA 4P46A 1S7XB 4F9LA 2R0KH 5E9DB 3U2SB 3ZKXB 4OTXH 4XPTH 1NFKA 1HHHB 3C2AH 5EA0H 3MMEA 3TT3H 1H15A 1M7DA 5KSVB 3JZ7A 4KUZH 5MENB 2F9BT 4PTTA 1OP9A 3FQNA 1AGBA 3U7WL 5F9OH 1JWUA 4KK9C 4JAMB 3MV9E 5C0BA 4QXGH 1NMAL 3NBNA 1HIMH 1F4WH 1JYWA 5TE6L 3D39E 5DRXB 4UB0H 5I8KH 2PR4H 4RX4D 4NJAL 3GBNH 1W0WA 3KPRB 3D18B 3X12B 1KJ2H 3GMQA 4MCYB 4PBXA 3LKQB 1V7NH 4KTYA 4BH7A 3VWJD 1EAPB 2X09A 1GGUA 5FYLL 1SHMA 1T0NB 2X9WA 3DGCR 3RWJB 4RAVA 1LE5B 2YSSA 1WIPA 4LSRH 4CMHC 1NC2B 3PWVB 2VDRH 1F13A 3D2UD 4G8GA 4OLVH 1CGSL 1N8ZA 5JOPE 3C5ZB 2H9GA 4Y4HB 4N8CL 4BH8A 4G9FB 1NC4A 2Z31D 4DVRH 2P47B 2CKBB 5DUMH 4M3JA 2DAVA 4N0RA 4OFDA 5C0BD 5DWUL 5J9PA 3KPSA 1JZ5A 1T22A 2NX5E 5DRXA 5HYQA 3N50A 3BKMH 3GO1H 4Z0BH 4N9OB 1S7VA 3G5XB 4PJ5B 4X7EC 2B1AL 3V9FA 5FM8A 5IMLA 3N06B 4WTXA 3NZ8A 1BMGA 3GRWA 2L7JA 3TNNB 4XTRD 4Z76A 5DFVC 4JQVC 4NUJA 1FDLH 1F3RB 4LCYA 2EKSB 1DBKH 4JFED 4R97B 1N64H 1LDPL 2AV1A 4GMSH 5FOJA 4HWZA 1A22B 4CVZB 2CIKA 4LSUL 1XCTA 5D7LD 4OF8A 3MRRB 4F9PC 2G2RB 4NN5B 3VFUB 3K1KC 3QA3A 1CFNA 1RZFL 4KVNH 3FTGA 1VPOH 2B39A 2BSSB 1OAUH 1HQ4B 4KV5F 1QRNB 2HVKB 4EKXA 3OKDA 4K7PH 1MI5B 1KT2B 1QFHA 3P2TA 2FWOB 1M71B 1QHPA 4MAUH 4OZHF 4I0PB 3O4LB 1DEEB 5DJCA 4ZAKD 2EE9A 4MQSB 4Z7VF 3QEUB 5SWSB 2XN9B 4LKXB 3ULVF 4OLUH 3QDAA 2DYPA 1UXWA 3AXLA 2NY4C 2O61B 4WTWA 2O26U 5E8PA 3GSWB 1L4IA 3VFPA 4X4XB 1OT2A 3SGKA 4MX7B 5BRZB 5I30H 4XPGH 1XCQB 5AWNL 4XX1G 3HI1B 5DEFA 3MJ7A 5I1IL 4N68A 5LXGH 1LEGB 5D1XB 4MGXA 4D9QE 4YXLL 4FNLL 2NNAA 4D0DA 3QFDB 2I27N 1H3UA 2WM0A 2AXJA 5TE6H 2FD6L 5TF0A 4PRPB 2NY3D 4JGMA 1HIML 4F3FA 1IC7H 1NMBH 5HGBB 3MRIA 2PO6D 2Z93B 3IETA 1TVBA 2XFXB 1ZVSA 2D0FA 5IEKB 3PWNA 5DTFA 1KUMA 4ZTPH 2CH8A 1E0OB 4LPWA 4XPHL 5EA0L 1BIIB 3C8KA 1A3QA 4HIHA 3BAEL 1I1AB 1GZPB 3ARYA 4JB9L 1QEWB 3MO1B 4CADB 4JR9H 4NT6A 4OKDA 1J05B 3MGTA 2HH0H 2Q20A 2J5LB 4PGDA 4FTVA 3WEXB 1OPGL 4X6DB 5DZLA 4LSSH 1YEKL 3TYGL 3EYOB 1JTOA 2V2XB 5TDPB 5JO5A 4MVBC 2G60L 2X4QB 4KRNA 4XI5D 5B38B 2Q76B 3PP3K 4DGYH 4PRDA 5K9JL 3T09A 6FABL 4X6CF 3LDBC 1A9EB 3RGHA 4ZOAA 1CFSA 4EDWH 4YFEA 1YEHL 3HR6A 2R2EA 5F1OB 5E8EB 3O9WA 4EI5C 1MFCH 3LKSB 3NAAL 4NRXB 5GS1A 2MFNA 4HS3B 5JXAH 4KMTL 3ZTJG 3CDFA 3EO0A 3IAPA 1EEZB 3FMGH 4ZSOE 1BEYL 4XAWH 3WUZA 2AK1H 1CICB 3W5NA 4OCRH 3I84A 3OKOB 1QACA 2YN5A 4X7SH 4FXLA 1A4JB 4JFFD 2V5RA 1KBGH 5C92A 1CQKA 1R3HB 5EO1A 1G7PA 1NAML 1UJTA 3QZWG 1P7KA 5DHYB 3X11B 2D7TL 5SWSE 5DVNA 3HC3H 4ZPTB 1FNEA 4BA8A 1DQDL 3DIFA 4JO1H 1EX0A 2LU4A 2AJZB 4YWGL 5I0DA 3FB7B 5T33L 4YH6A 4EBQH 2BMKB 3CFDA 5D2NC 4LSVL 4JPIB 4U3XA 4P2OD 3FFCA 1BQUA 2J8UB 4WWKC 1C12A 1WZKA 1MAML 1FBIL 2DQIH 4X8JB 4M4PA 2BVOA 2JCCF 2DBLH 3AB0B 3NVQA 1FAIL 5ENWB 2EDFA 5GIRB 2E27H 2EDOA 5I76A 3BT2H 5LGJB 4Q9QL 2LQRA 1Q72H 1XIWA 5KOMC 4YGAB 5JMOC 4TTDD 2ED8A 2FWOA 4MB4A 4G6MH 2IQ9H 1PKOA 2AEQL 5IVNA 3QQ3B 3ULVE 4ZYKB 2OSLB 5DT1L 3DTXB 1W8OA 4KI5F 4J3XA 1G9ML 3RL1B 3KLAB 4ZOEA 3BRFA 5FXCH 3MXWL 4QHKJ 2R8SH 4Q2ZB 4MNQA 4OCWL 5HI3D 2ADGB 2G2RA 4JRYE 1AXTH 1ORQB 3VXMD 2HTKC 2DQEL 2FATL 4DGVL 3RP1A 4ZOCA 3KAAA 4JFXA 5E7BA 1L7TH 5CEZE 1UEMA 1F00I 5EU5B 4BQ8A 1HDMB 3V5HB 1J0YA 4YHMH 1NDMB 2V2TB 4PRIE 4G80B 1SBSH 1MCQA 4ODXB 3L6FB 3DHMA 4RDQF 5CGMA 3KLDA 4GKZA 4YEEA 3PWJA 5IJKA 4XP5H 2C4FT 3RX5A 2H6PB 5BV7H 2XIDA 3MRKB 4U6XB 5CCKH 1KC5L 4Z7UF 1DLFL 4XCEA 5HHME 3VRIB 3F5WB 3HS0B 5H37H 3Q1SH 1L9NA 1FL5B 3ARFA 1CYGA 4XBGB 3VG0L 3DO7B 4A6YH 1BLNA 1YQ2A 1AP2A 1Q8MA 2PCPA 5B3NA 4U05A 4DN4H 5F3BB 2DD8H 2JJUA 3KYAA 2QADC 1FFNB 5FB8A 3P9LA 5DMGC 3MLVH 2GJ6A 5IROC 2J3SA 2JIXB 2AEWA 4LP5A 3FQRA 5FYJD 3RRQA 1HSBA 1OGAA 1WTGT 4X6BA 3PXJA 3X3FL 3MBED 1MWAL 4ZNEA 5D1ZA 5EUOA 2XTJE 1J1PH 1MQKL 1DBAH 4G7YH 3ZL4H 4QRTA 3CAFA 4ODHL 1AC6A 3ULVL 3SQOH 2ESVB 2CRMA 3GMOA 5C08A 4P3DA 4M3KB 4Q58C 4Z78A 3EYSL 5D7IA 2EDYA 2VDOH 5GGSB 2FSEA 4XNXL 3PP4L 1XF3A 4CVZA 3TO2B 4XZUA 3K8KA 2FJGB 1R3KB 1QOKA 5KN5A 1WAAF 4XVUC 5M95B 2P45B 3S96B 1S7QB 1CF8H 1KIPB 1MLCB 1IM3B 1VEMA 3TA3D 1ZLUK 5FCSH 5CSZB 4O58L 2HFTA 5IBTH 3HFML 1INEH 2OQJB 5JZ7C 2A9MH 1FYHB 3QDGE 1B0GB 3C9NA 1J9CT 4LEOB 5AAWA 5D93C 2VABA 1PLGH 5FK9A 4OAWA 1SM3L 3HZMB 1MCOL 5MHSD 4KZEH 3IT8D 4Y4KB 4MXVF 3PDGA 4PS4L 1V7ML 2YPLD 3BUTA 3L5WA 1U8NB 4MAYC 4RISL 3CDGA 4U6HA 1NSNL 3GMLB 5EU6B 3GNMH 3UTSE 2AJXH 4ONOA 2Y9RT 3FQUA 2Z92A 4XNUL 5IK3B 1PG7X 3LKOB 4OCSL 1ES0B 1T1ZA 5F7FA 4PJGF 3MRNB 1CIDA 4WHYG 3EDJA 4K8RH 3H9HB 4DTGH 1NCCL 4PJEA 4JZOA 2QKIA 3HI6L 5K9OA 1IAOB 1KCRL 2BRRL 4JQXC 4M62L 3O3DA 4Q6IB 5CIPH 2EZ0D 4P4KB 3GMLA 3GK8L 3DTXA 4TULL 1E6OH 1XGYL 5CILL 4LLMB 2J6EL 1KPRA 1BD2D 4HAFA 1VACA 4NM4H 1Q1JH 2NTFA 5GGSY 3K2UL 3OPZH 3P77A 1U93A 5FM5O 4QY8B 5H2BA 5D5MB 5E94A 2BHUA 1W0VB 1T21A 4V2CB 3U7YL 2VITA 3DO3A 2A77H 4DW2L 4I8DA 1OARL 2QQKL 3JVGC 2XWTB 2B20A 1NCDH 5KSVA 1T1WA 5MENA 3KPRE 1ZGLP 2P5EE 5CP7B 3C09B 2AV7B 3GJFB 2ZUWA 5E24E 3CDYA 3G9VA 5H2BB 3MCLH 1ZEAL 4OJFL 4XNYL 5HVHC 1U8IA 5B8CB 2IADA 4L8CA 3QZWB 4LSDA 4R4FL 3HUJE 5L7XL 3VD4A 1T7WA 2K3TA 5IQ7L 4MB5A 2QTEA 1DLHA 3QWRA 3LKQA 2JELH 4ZTOL 3QP3A 3MLZL 3UZEA 3GM0A 5F89A 2VH5H 4M7LH 4P9ML 4ZUTB 2YD9A 2WZPD 1JV5B 3DV4B 1E4WH 4PJAB 1MHPL 3UEZA 15C8L 3KYNA 2IWGA 4H26B 1EDQA 2NCMA 3ARVA 2CUMA 4NRZA 3ZDYE 5KSAA 1KN2L 2UYLA 4FFYH 2CK0H 3C60B 4KHXL 4HK0B 3IU4L 3TCLA 3NPZB 5I15H 2CLRB 4MNGB 5IVOA 5C09A 1I3RB 2R69L 1B0RA 3FONA 5DMIH 4X0KB 3GSQA 5J1TC 5EBLA 4YGVB 3S96A 3CFKB 5IMKB 2XA8L 1AQKH 5A2LH 1T80A 3VXSB 5CEXA 5EZOH 3QIUC 3V5DB 4NBXB 5ERWA 3QWOA 4GKSA 4M6ML 3O6LH 2EIEA 5FV2A 1MRFH 4CADA 3GIVB 5D6DA 4PJ8A 3U36A 3MRLA 1OWRM 1YMMB 1RUQL 2NY2C 5DK0B 4DKFH 1FRGL 3T0WA 4YX2H 2O5ZL 3VXNB 2NY0D 3GEWB 4ZYKA 4G8FB 2VLRE 3V52L 3RTQA 3QXTA 5D71L 4D8PA 3G6AB 1J0JA 3VXSA 5EUKA 2G75B 3JWOC 4JGUA 2VDLL 3O2VH 2FX7L 3QI9A 4HD9A 5DURB 5KVEH 1XZ0B 1LO3L 3MFFA 5E6IA 4LHJB 4JPVH 1INQA 4YR6B 1N0XL 2AQ1A 1CT8A 1D6EA 2OJZH 4HDIA 5D7LA 4GKZB 2CXKA 4WEUD 5HY9B 2D9QB 3CFBB 4PJFB 2NZ9D 2E9JA 3ZDXF 3FCTB 3OKEB 2CPCA 3H9YA 2AJ3A 3ZDZE 5C0CB 4ZXBA 4OLWL 4H0HB 3L95B 4JY5L 3WN5A 1BBDH 1FVCA 3GB7B 1SY6L 1WBZB 3RUGB 5K33A 4EVNB 3CH1B 5DLMH 4E9LA 3BZ4A 2SEBA 3UTOA 4F58H 3KWWB 2J88H 3W9EA 1DUYB 5D7SH 4GAGH 3KG5A 3QUXB 3AMKA 5B3JE 1MQ8A 1ZSDB 4JREC 4PJGB 1PY4A 3HG1B 3U46B 5E2VL 3MV7D 2WP3O 1CDIA 1BZ9B 4LMQE 4PJDF 5E94B 1BD2A 1SJHB 4MD4B 3U9UA 3GBML 2RAMA 2XY1A 3D69B 4OLYL 1BBDL 5D7KD 5IW1A 1X9QA 3QNXA 3X13A 5H37G 4P46D 1RY7B 3RWFB 3DPBA 3E6FB 3VGAB 3O3BA 3LD8C 4D3CH 2H32A 5IW3A 2IPTH 2AGJL 2DQTL 2IBZX 3DRTA 4Y5VB 2Q8AH 2MTPA 4S1RL 5GRWA 2BNRE 3KPNA 1NEZG 2CKBA 4JPVL 5C70A 1XF5A 3MBXH 1BF8A 2VDML 1OM3H 5I66A 1IM9A 3LAFA 1MNUH 1KIQA 3GI9L 3OKKB 2F53A 2PXYB 3V6FA 5C07A 2XA3A 2BOCB 3OJMB 5SV3A 4KKCD 3U82B 3CUPA 1N6VA 3QIWC 1R5VB 2P7TB 4UQ2B 4NKOB 4BZ2H 4NQCA 3H9SD 4G6AD 5IB2B 4BK5A 3BXNB 1Q94A 3IJYA 4X6CB 4WUUA 4AIOA 3HMWL 3TGXA 2KQNA 1DFBL 1J86A 1Z9OA 1EH9A 4PRAA 4E41D 5JHDA 1NFDB 1SJVA 5HHPA 1TFHA 3G9AB 1CGVA 4NQDB 3OXSA 3TA3A 2WBWB 3RWCA 5JMRA 4JY6A 5EZOL 1IGJA 2HAZA 3QXUA 4YBLC 5F88A 1IEHA 1NFIA 1JHLL 5SX5H 3S5LA 2H8PB 2VL5B 3TT1L 5IB4B 5KVFL 3FL7A 1WCBA 5DMIL 1I7RB 4Y2DA 2NY1B 1F4XH 4U1KB 5I15L 2R4RL 4Z7UB 3UAJD 2WP3T 3I2CL 2ZKHL 1JF5A 5CJ8A 4L8SB 3VFVB 5GGQH 3WLBA 2DJSA 3K74B 5F8QC 3D0LB 4PRPE 2A6JA 4OD2B 3MV8A 5JZ7D 5CUSL 3EYQC 1DUZA 1QBML 2DM2A 1I3GL 5HGHB 1DL7H 5DD3H 4DZBA 4JZNB 1NH6A 2D03H 1AC0A 3O45B 3QIBA 4HIXL 4D0DB 4UNTA 5D4QA 3VRLE 2JCCA 3ME0A 5DS8B 5AYQA 3LVEA 1NCNA 3MRPB 5KAQG 1AHWB 2FYYA 2PCPB 4HBCH 5CJQH 1MEXL 5IQ7H 4RAHA 4JZJB 2VLJD 2CDGB 4NZDA 1LK3H 5GGUA 3ARFB 4X5LA 5C0NC 1MCEA 1RIHL 3P4MB 4PJDE 1G6VK 4N8VB 5ETUA 4LLVA 1WWWX 1HQRB 1K4DB 2I07A 4PJEB 3GHBL 4LLQA 2JCCB 1GGIH 1WBXA 5DQJB 4GLRH 4XXDA 1EJOH 4U7SA 1Y0LA 1QFUH 3VU2A 1LEKA 3HZVB 4DW2H 5INDA 2IAMA 3S36L 1KT2A 3QUYC 5EBMA 1S3KL 1J10A 2IFFH 3HMXH 4IHOA 3ES6B 3DX6B 1R0AL 4NQSA 4AH2B 3BKYH 3I6KB 5DC0A 2R9HD 3ZSSA 5C0FB 3TA3C 5KOVC 4IRZH 4Z7NF 5KANG 4OZFB 4JG1L 1A6AA 1WSST 4F8QA 1KNOB 3U4BL 1GPOL 2B2XL 4OM0H 1K8DA 4LHUG 5DHVA 1ZTXH 2XWJB 3I75B 1B4RA 4YFLF 2BX5A 2DTMH 5IB2A 2X1PA 5DJAA 3QDMB 2VQTA 5HD8D 2YD3A 4KI5C 4P4RA 3K80A 3LQZA 2YK1H 4BQ9A 1A4JA 2FCBA 1IL1B 2NMSA 2Q6WA 4HPOL 5DJXA 4UAOB 1IFHH 3C8KB 4WY7L 2X1XR 1FAKT 1BX2A 2L0DA 1J8KA 1CF8L 1I9RL 1ZANL 2YN3A 2YRLA 5TE7H 5IB3A 2ZCKL 3THMH 3KLHD 3BYTA 4Z8FL 5T1DL 1G0YR 3DYMA 5K9QG 4PJ9B 2OMBA 4XP4L 3TJHD 1OSPL 3RL2B 5IR1B 4LVNB 3HE7C 4KVCL 4LCWA 1YNKL 5I9QB 1JWUB 2X4SB 1P84K 5D2NA 3OTTA 4J4PD 4UUJB 3HE6B 1QYGH 2V5TA 3GMNB 5FUCE 5ILTH 4NQDD 5DDHB 5CGYC 2UZXB 3CC5A 3P9MB 1HK6A 1J1PL 2FEDC 4KDTC 4HUMB 3RNKA 2I9LB 3ZMRA 1T1YB 5BS0A 4Y2DC 1PZ5B 4JRXB 4HCRL 1ZT7A 3VRLF 3PHSA 4PY7A 4N0FB 5F7HA 5HVFB 2D4DA 4N9GA 5C0DA 4RIRA 3TBYA 4NP4L 3SE3A 4D9RE 4GRWF 2GITB 2PO6A 1MAKA 4U33A 1PKQB 1RJLB 2E8ZA 4OB5L 2VR4A 2EYSA 4FQ2L 5GGTH 1JGDA 1RMFL 1S9WB 3UO1H 1CE6B 5C0AA 1AI1L 4GRLD 3L7FA 3LKPA 4OQTH 3JUZA 4O2CB 2ZJSL 3RI5F 5KSAC 4RBPH 4ELMA 3G6JB 2CIKB 4OUOA 1E27A 5CEXB 3UJTH 2VIRA 4ONGH 2OJEB 5IG7A 2UY7A 1S7UB 3WCYA 4AJ0A 4OF7A 3KXFB 1X5YA 4HXBH 4WGWB 4LCYB 2VZUA 2FH6A 1KJ2B 2BERA 5EIVA 3DURA 3P9LB 2XKSA 3ELAT 1INQB 3F6IA 1BVKB 2VYRE 2AXGA 3MLYH 5T1LB 2PO6B 2ZUUA 4OZGF 3MRCA 4FQXD 4RFNB 1S78D 1C7SA 4XMPL 3OKLA 5HY9A 1BLNB 3DV6B 4XC3H 4DGVH 2FATH 5B39A 1Q9WA 1AXSB 5F21B 3QH3B 1M7IB 1SJXA 4FTVD 4KI5D 3QULB 2ATPA 1JF1B 1G9MH 5C7XH 3LV3A 1UCBH 4FQPA 3EIFA 4RGND 2KKQA 5MEPB 3RVXC 2IQ9L 3EOTH 2A9NL 4XB7A 1VHPA 2C3GA 4R7NA 1MFBL 4UTAH 3O2DL 4Y4HC 3QQNA 3T65A 3SKNA 1DBBL 1GC1L 1JRHL 5FDWB 3ULVC 1RZIA 5GISH 3JV0A 5JW3H 5DJAB 3BWAB 1UM5L 3MNVB 4W81A 1C1EL 2OL3L 3G6DH 5TQ2L 1TNNA 5EULV 1ZLUH 1WC7B 4JPKL 1I3VA 4X9IA 3CDGB 4X5WA 2F54E 3V7AG 1X4XA 5ISZE 1XF1A 2NY7H 4KKBD 4RZCB 4HUVA 2HG5A 5F6HI 3SDYH 3DO7A 3V95A 5A2FA 1MCWM 2GFBB 2P8MA 4EXPX 4K2UL 1UWEH 3AMLA 4K7FB 1PVHA 4Q0XL 3HRZA 1CBVL 3A67L 3RJDA 1X5HA 2NXYC 4XAWL 4HK3J 4L5FL 5JO5B 5TDPA 1XGUA 3OX8B 3KS0J 4BSVB 1H9VA 2WAHA 3IDMB 1LE9A 3PGDA 3BEWA 2BNQD 4E41E 4JFFE 1RJYB 4HX1B 3H3PH 4CJ0A 1BFTA 1I1AA 4ZFGL 4MA8H 4PP1C 1OAYL 2HVJA 1AH1A 4JN2A 4HIJA 3Q2CA 5DFVD 4W70A 3QDJA 4NQCD 3IGAA 2XPGB 3B5HA 3TYGH 35C8H 3KPSD 4I48B 4ZFFA 1B2WL 3RUGA 3OKOA 1CCZA 4N1EA 4MCYA 3RGVD 5FUZL 4JPWH 5BW7C 1XAUA 1T0MA 4FXKA 4P59H 3D25A 3JVGA 1WBXB 3U7AA 2BJML 1A3RL 1JVKA 3ZZ1A 5TDOB 1Z2KA 4ONHB 5DO2D 2A73A 4P46B 4PJHF 3RIAF 3JV6B 5CSGA 4ONFL 4KMQA 4M4RA 1HEZA 2FBJH 2AV7A 4L9LA 2FD6H 1EUUA 3OR7A 3HE7A 4RGMC 5DQ9A 1TTUA 3MCKA 4QXUL 3E8UL 3WO4B 4UIMA 1Q9OA 1T0MB 2VDPL 4GW4B 1CXHA 3AVEA 3D85D 5GRZA 5I1IH 1QP1A 2DS4A 3T0EA 2YOCA 5FYLD 3K4DA 1DDHA 5MEND 2IGFL 4QGYA 1G7MB 4CN4A 4M61B 3MX0A 3SDCC 3VD9A 4P2OA 1I7RA 4U1GC 3LQAC 2J5LC 4TTGA 4XGZA 4N9GB 1HXMA 5HHXH 3LEYH 2BJMH 5D5ME 1MHHA 2JB6B 3A0OA 4P59L 4PJ9D 2HLAA 3X14B 1A7OL 1W72A 1I3RA 2IANE 2YKLL 1VFBB 1XGQB 1K4CB 3QQ3A 3T0EC 3OKYA 4GW4A 4S2SA 4K7PL 3TCLB 4XNZB 4GG6A 3C60A 4H88L 3IRZA 1KV3A 5EIIA 4JHBA 1FO0B 1PZUB 3HAEB 2OX5A 3DHJA 5DF0A 1VPOL 4ZFGH 3QISA 4KVNL 3BQUD 1N5AB 3HNTL 3H3PL 3GJEB 3CVHB 1ACYH 4UQ3A 2XN9A 4FZEH 5J13B 4XNQB 4NSKB 1G7LB 1LDPH 5FGRA 1A7BA 2HJFB 5DD0L 5MI0C 1N64L 1P4BL 2XZQH 3CZFA 1UKQA 5AZEL 4Q9RL 1DBKL 4KGLA 1KB9K 3HN3A 4L8SA 4WFFE 5GRYA 4LL9A 4RQQA 1FC1A 1D5XA 2V2TA 4PUBH 1FDLL 5L9DH 4L3EE 5CP3H 3TO2A 4K2UH 5ITBH 2DQFA 4I3RH 3T65B 1P9MC 1ZA3B 4K94H 4AIZA 3VXNA 5IBLD 4NHCH 3ULUH 3E3QE 3Q5TA 3N0PB 1F4YH 3BSZH 2X1WL 4PLJC 1EHNA 4JPKH 5JTWA 1LEGA 5E03A 3HC4H 4L4VB 2V6HA 4N8CH 1GOHA 4N0CC 1MCJA 2EH7H 1PYWB 3SDDD 4QOKE 1A14L 1UZ6E 5HBBA 5CBAB 2FJFA 4G7VH 3OKMA 5D8JL 1I4FA 3SKJH 4Z18A 4J8RB 3QUMA 5GJTL 3RY6A 1MFBH 3U79A 1YECH 4MXWL 3WUWA 3D3VB 3GM8A 3CXDH 3C60D 5SX4H 1FZKA 2AEPL 3ORJA 1NAKL 3R1GH 1A21A 4ZUUB 3MLSH 3DWTA 2GY5A 3ETBF 5L88H 5HPMA 3WFCL 1D7FA 2FZ3B 4HUXA 3K4AA 3NZHL 1VACB 3MV8D 1ZWIA 5I1KL 4HQQL 4CRPA 2W1NA 3L9RB 3CH1A 2XRAH 2R0KL 1U8QB 5GJSL 1L9MA 5BO1L 4DEPC 3VFMB 2YD8A 2WBJC 2X4UB 2HT4C 1E28B 1MFNA 2FRGP 1O5DT 2R56L 3VE0B 2PTUA 4LDEB 3NIGF 5T3ZL 3QPQC 2YZ1A 3RBSA 5HPMB 3UTZB 4OAWB 3M1BB 3PWUA 2R2EB 1QBBA 4K7PY 5FF6A 2WUBH 3QHFL 2GK0A 4U31A 1QLEH 5L8KB 4CVWA 1EPFA 4NM8L 1YMHB 4U6HB 1BVLB 3ULSA 5TE4H 4PTTB 1QBLL 2NTFB 1AE6H 3O6ML 3QG6A 2RCSL 4UUJA 3UO1L 1D5IL 5GS2H 4NOBA 1HHKA 4FQ2H 1ULVA 3BP5A 3VD3A 2ARJA 5GS0C 5GIRA 3HLAA 1P1ZA 4NP4H 4R90L 1BQLL 4BFEA 1PEZA 1MY5A 3L95A 5SX5K 3B83A 3CCHB 4LRIC 1AO7A 4AM0B 1LHZA 4FTVE 2BMKA 4JO4H 3QT2A 4W6WB 4Y89A 1MHCA 4ODTL 1LP9A 3DOSA 4PGCB 5EOCL 4HFWA 2CKBL 2RFXB 2XNAA 1N6UA 4J23A 5AYUH 5JOEA 5DK2A 5IT2L 1P7KB 5HI5D 1Q9KA 5SWQB 1E4KC 4WFGD 1UH3A 5IWLA 1KLGB 4JM2D 3T04D 3TIEA 3D48R 4A2MA 5IP4A 1RHHB 2L4OA 5F7YC 4GUPB 2PXYD 4KRLB 3KXFE 2ZCKH 3THML 4LIQL 1IAIL 3DI3B 2HLFD 4WWKA 5DRNB 4Y4KD 4OIAA 3WNNA 1TENA 1QKZH 3SJVE 5F88B 5MEOB 3SCMA 2I9TB 4LCIH 3ECBB 1BJMA 3BPLC 4MA1C 1TJIH 4WU5A 1A2YB 1V3KA 1RJZA 4C56E 3EFFB 5I1LA 4BSJA 5CEZH 4XC1L 2ICWA 1ZK9A 5HYIA 1MELA 5H35A 4X4ME 1EK3A 3DX9B 1WAAA 2UYLB 1ZT4B 1C08B 3HS0A 5JOFA 4JFDA 1F45A 2Y6SC 2DTML 5EG6C 5LBSH 2VXTL 5EWIL 3FO1A 1IM9B 3LKRB 2WBJA 4P3WA 3ROOB 1DQML 3MV8B 1UM6L 4LLWA 4OQTA 3QDMD 5HGBA 3T4YA 1EVUA 5IOPB 1JYNA 1CICD 4JG1H 2W9DH 3DX9A 3UTPE 5B4MC 3V5HA 1S7TB 1LO4L 3ZHKA 4QHLA 1BFVL 2YA0A 5E56A 2AJSL 3T2PA 2KH2B 1EBPA 1Z9SA 4QGTA 2BNUA 1JGVH 2KUTA 4HWUA 5F6HJ 4ZS7L 1WK0A 2HFGH 3I6LD 3DLQR 5B39B 2VOTA 1NGYB 3RVUD 3FT4A 1J7VR 3GSVB 2XXMB 4MJ6A 5MHSE 1JNLL 2W07A 3F8UB 1RUMH 2YZ8A 4XHQA 4JFHD 1EJ6A 1IGFL 4OCXL 2VLLA 2HKHH 1BOGB 3S9DB 3GSNB 4TPRL 8FABA 4K94C 5HVHB 1GGIL 3QH3A 2HLAB 3EZJB 3JTTA 4WEMB 5J0BA 1G84A 1H0DB 1X5JA 4KJQC 1MJ7H 2ZPKL 3STLA 2ZSWA 1PDKA 2AKRA 3MJ9A 3VCLA 4DK6A 5LCVL 4OCYL 1CXLA 5ID0A 1I9EA 1H8SA 5KSUB 1IARB 1G9NH 4X4YB 4NBYB 4IRJA 3BGMB 4JRYB 3VDCA 4YDJA 5DJ0A 1T5XB 3JTTB 4HIXH 1RZGB 4U1JA 4URTB 1UM4L 2BSSA 5ADPL 3RIAK 3RZCC 1ZS8B 4JN2B 4JLRB 5FYJE 5JDSA 3WN5C 5EU6E 4FQXA 4FG6C 2P42B 2APVA 2FLBT 1K6QH 4U1NB 4EI6A 2ZG3A 5CMAB 4QT5B 5DHVB 3QUZB 1CD1B 1AGBB 1JYXA 1RZKH 3B43A 1U8NA 4WU7B 3WFEL 3MUGB 4JFZL 4RA0C 3ILQD 3QIWD 2ZKHH 3SGJC 2VC2L 3QCUL 5MP6L 4JO2L 1I1YA 1NPUA 4V1DE 3WMSA 2QSVA 4X80H 1DP0A 2CMRL 4NZUH 5IVZA 1W0VA 5FGCB 4OSUH 1JFQH 2BNQE 4ODWB 3KGRA 3ZHDA 4OFYD 2IF7A 3P11L 4WCYL 1N6QL 4QLRA 5CJOH 1T4KB 2VUOA 3OAUL 4R9HA 2X4SA 5JPNB 2FB4H 2Z92B 5IK3A 1ONQA 4P9HH 4QRRE 4M5ZH 4R0LC 4ZUVB 1A6TB 2HP4A 1CGWA 5DUBA 3QXDB 4X8XA 3K3QA 3M07A 4P2OC 4U2YA 4WWID 2D31B 2BY0A 5CZKA 2D7MA 4L9LC 4QO1A 5E0QA 3FOMA 2K1MA 3QDJB 3B5GA 2MPAL 4JFFB 3B8SA 1GC1C 4J6RH 1ES0A 2PTTB 5IB1A 3BZFA 2P24B 4NO5B 2M8XA 4KHTL 1K9TA 4KHTH 2HMID 3KPPA 4NC1C 5JPMB 3PE9A 2ATKA 1H15B 5L8LB 1Y18A 2Y1VA 1UH2A 2DKMA 5IM7A 5BVPH 3MV7A 4NZTL 5C0BB 2IFGA 5I1AA 2EKJA 3CFEB 1A9EA 4Z7WE 1FQ9C 1U3ZA 5JW5B 4K7PX 3VXPB 2DWEA 5EIIB 4KXZH 4G9FD 4D3CL 4KUCF 1MLBB 2JJSA 2LTQB 2NY5C 3KJ6L 4LGSB 4G6FD 1PEWA 2YUVA 3GIZL 4NQCB 4MSWA 5FO8A 4LNRA 2CMRH 4PBVC 1IAMA 1JV5A 3QUZD 1HOCB 1L0XA 2B5IB 1ORSB 4JO2H 3LKNB 3CZFB 3SDDC 2VC2H 3T4YB 2ORBH 5E1AA 3VXQB 5HTSA 5IESH 2NXZC 4BQCA 4CU8A 4L1DA 4ZFZB 1RZ7L 3FZUC 3JWDC 3F6LA 5CZXC 4OI9A 3FO1B 4LBEB 5D7SL 4XMLL 4PJXE 2K9UA 3CGTA 4LPUA 4OZGB 1KELL 2VKXA 1IQDA 1NCAH 5DD1L 3ZHLA 1I1AC 1S7VB 3R0MA 4PJ5A 1A9BB 5IIEB 1CS6A 2RGSA 5DJDA 3QHZL 2EXYD 3S8WA 3HNSH 3U6RB 4I18C 3DROB 4QRRA 4UU9A 3EYFB 4EXKA 4ERSL 2YPLB 3BPCB 2VE6A 3RVWC 5F1KC 1U3JA 4D8PB 2WUCH 3RA7H 4LK4A 3LDBB 3CD4A 5F7DA 4HV8B 4WW2A 3REVB 1RV6X 4O2CA 2IH3A 5I16A 1REIA 4DAGH 2X4UA 5JXEA 1VFMA 3U0PB 1OTSD 3H42H 4OZ4A 1RUML 2OJEA 5IG7B 1HZHL 1XCTB 5JIKA 5KVEL 1JNLH 1HILA 5J56B 4UNVA 4GG8A 3HI5H 1CICC 3QCVH 4IOFC 1NBYB 5ESAA 4KTDH 3KYOA 5J12B 1IBGH 1Y6KR 1WIOA 4OD1H 4R4ND 1JWSB 2C26A 2CO7B 4CBPA 5IJVA 2XOTA 4YX2L 2CDFB 3PGDB 5FYKH 1RUQH 5M94B 3JWNC 3F62A 5I73C 4IRJC 5EBGA 4M8VA 3P0YH 3MROB 2F19L 5DGRA 4Q97A 3O11A 2MWCA 1Q9LB 4FTVB 3VXRD 2P5WD 1JPTL 3B2VH 2UUDH 3KPOB 3QUMB 2XQBL 1G9NC 4LQFH 4NGHH 5HYJE 1DBJL 1TLKA 4YHIA 1MFAL 3KXFD 4FQXB 4I48A 1CD0A 2XT1B 3NFNB 2NY2D 2X4TB 3NTCH 4IHOB 4QNPF 5LAXA 1EFQA 1NL0H 5IMOA 1SEBA 4KAQH 5KBNC 4Z7WF 3C6LB 1KSRA 3SE3C 4OV6F 4HS6A 1ONQB 1AD9B 1RUAL 4RFOH 1ADQH 2XPGA 1KN2H 5HDLA 4MS8D 1KTRL 1RZKC 3GJFK 4DKAA 1LO5B 3CCHA 4RGOH 3HB3D 3S4SG 3ZDZF 4ZNEE 1ZLWK 1I85C 1I7UB 4GQ9L 4OIIH 2HJLB 5JW4N 4F7EB 1OAXL 5T3XE 4LRNL 4HIEA 3C2SA 3U0TB 2XZAL 2HWZH 2ID5A 3V5KB 4AEFA 3FN3A 2V2XA 1U8JB 1HHHA 4NRXA 1LVEA 3PJSA 1GOGA 4R3SA 5AYUL 4IOIA 3QAZB 2CKBH 3FHAA 4JRXD 3MGTB 3M8OL 4HG4J 3FO9B 5IKCA 3QCTL 4HEME 1P4LB 4KK8D 4PJXF 4U6TA 1S9XA 1SJEB 1U8LA 4P2QD 3MFGB 2BVEA 5AUMB 3Q6GL 2DLEA 1CXKA 5E9DD 5GXBB 3ZTNL 5F9JB 1E27B 1BQLH 3IVKA 2CLZA 2C5DC 3F58L 1CDHA 3LS4H 3RDTB 5FAAA 3DXAE 4U1NA 4EI6B 1K8IB 2GUOB 3OJ2C 1KEGH 3MNZA 4XCFL 2VLJE 1GGCL 3SCMC 3KLAA 3VFRA 1FVDA 1YN6B 2UUDK 3P73A 3TH2T 3SE9H 4OUUB 1KJVA 1Z9LA 3EYVA 5ANMA 2FEEI 1ZLVH 3LKRA 4JFXB 3OPZL 1VESA 5ACMA 5I8EB 4NM4L 4LOUC 4N5ED 4PJEE 1KCUH 4U1IA 2V5MA 4JRXA 4XCNA 3NCJH 2MJWA 5T3ZH 2ZOLB 1FLRH 3B9EA 5EU3B 2YBRB 1SBBA 1ODAA 1NCTA 3GGWA 1BIHA 5IHUH 3DUUA 1KCRH 2BRRH 4DKEL 3V6ZA 4RIRB 1C5CH 1P7QB 3QUML 1XZ0A 1CK0L 4GSDH 5JIIA 4P4KD 4NJ9L 4MQXD 4M93B 2W65A 2VITB 5IFJA 3TO4A 4B41A 2Y6SD 4JFPA 1NGQH 4PJGE 2WLZA 3O6FA 5I17B 1SYVA 4C59B 4PJIB 5F7NC 4FQ1H 2NX5A 2X7LB 1KPUB 1FSKB 4DOHE 2Z8VC 2VLKB 4F33A 3F7YB 2ERJC 5HGHA 2XACC 1YECL 4WI6A 2BDNL 1INEL 3C6LD 2QSQA 3PABB 4GOSA 5D96C 1JPGA 1KB5A 5D8JH 3D0LA 3WXVH 3GUTA 1G7QB 2EKSA 5E99L 5GGRY 2P5WA 5IGXL 5KSBA 1JNJA 5GGRB 3IS0X 3V6BR 1GGYA 1LD9A 2F8OA 3HC4L 3G5VA 3RPKA 3PHOA 4YK4C 1M1SA 3VXRB 2H1PH 3ULUL 1T2XA 3O8XA 4K94L 1CLZH 1WC7A 1P7QD 2ESVD 1E4KA 4KRPD 2PYEA 2OXHA 5FO7B 1I7UA 3IFPB 4MVBD 3I6KA 2HTKD 3MLVL 4LFHG 1YQVL 1E28A 4POZC 4PR5A 1BJ1H 3O4LE 5DD0H 2D31A 1CU4H 3FO0L 4UILL 4NT6B 1YEGH 4HZAA 4HUWB 1B88A 3MRIB 4YC2B 2CUHA 4A6YL 3HNTH 1QRNE 2ZSWB 3T4AA 2DI7A 5C0CA 4FFVC 5DK3A 5HJ3A 3PHQB 1FO0H 4DVBB 5EBMB 4RMRA 3RX8A 4JRYA 3BPCA 4CVUA 3KPQA 4RFNC 3D18A 3X12A 5ESQA 2EICA 4XP5L 5IMOB 5B39G 1TTFA 4R26H 3SJVD 1TZGL 3UTTE 1DQLH 3LEYL 1PQZA 4PJEF 1RQ5A 5JA9A 5CMAA 1L7TL 4ACPA 3ULUC 3HG1A 4U3HA 2DL9A 4X7CC 2OCFD 4XNMB 3QNXB 3X13B 1SEQL 4ELMF 1B3JA 4E0RB 4NKDB 4E41B 3MRDB 1E4XL 3ARDD 3C60C 3JWDL 5SWZA 3NPSB 2PUQT 1KENH 3L3DB 2H2PD 4G6ML 32C2A 2NR6C 3FN0L 2VDPH 4QXUH 2AERT 3N85H 3TFKD 4P5MA 2COQA 2X4NA 3WE6B 1R3HA 4L4TE 5EO1B 2E27L 3PL6A 2AJ3B 2F74B 4WJ5B 3VFSB 1YN7A 2DBLL 4KY1L 2EDEA 4UI2A 1VKXB 5I1GH 2R0LL 2BP3A 2NLJA 1BM3H 4LARL 1KB5H 3VFUA 1U92B 3QDHA 4MA7L 1KFAL 5JA8B 2Z8SA 1JGDB 4JPWL 4MNHB 4UQ3B 2YEZA 3KR3L 4JY4A 2E9IA 2NY2B 5C0EB 4YBQC 2IQAA 4OGZA 3C08H 4R0LA 5MEOA 2I9TA 3HE6A 4PD4K 4R97C 4XCCL 1C5BL 3F7QA 2B4CC 2HFEA 4QHMB 1WFTA 4U2ZA 3ZDXE 2ICWB 2X1OA 3LN4B 4Y19A 4YHZL 4S2SB 1JPSL 2ZCHH 4F7MA 3QUXD 4C83A 1T22B 4KMTH 3GMNA 1NC2A 2VR9A 3SE8H 1NFDF 5J9PB 1LMKA 1QSEA 1KULA 1WIUA 1G9EA 1PJ9A 3CFDB 3CX2A 4ZOBA 1MJJA 3FKUS 3BP4A 4G9FA 2BRQA 1MHCB 4ZMAT 5LGHL 1YDPA 5FO8B 3OG4B 3HNVL 1P2CB 3A67H 1FN4B 2A6IB 1UWEL 5CD3A 4I18A 5ECJE 2FIRT 3D3VD 5F89B 1IGCL 3FO2B 1OPGH 1XF4B 1J1XH 5B21A 3UTTB 1U8PB 3DX7B 4WIQA 5K9KA 1YY8B 1DLHB 3E1F1 3W11C 4JE4B 2Y36H 2P49B 4JB9H 3AM8C 4U1MA 2I25N 2WNGA 4BSWB 4F7CB 4H8WH 1N5AA 2GYSA 3PG2A 5GQBA 3N1FC 3VD5A 1UM5H 2NZIA 5SWZE 3DNKA 2HJFA 4I77L 4R2GB 1YNTB 4RGNB 4JREB 1IC7L 1NMBL 1A1MA 1DBBH 5TGBA 2X05A 4JM4L 4EN3A 3O2DH 3BIKA 3P30L 1AY1H 4X6DA 2FX8H 1RZGA 3IF1A 4XMKH 2OS7A 1P69B 2J8HA 4P5TC 3MRJA 3UMTA 4EUPB 3FQTA 5I30L 1B0WA 4M1GL 4PJDB 4G8IB 1S9VB 5C7XL 1RSFA 3MNVA 2C1PA 3MRMA 2Q1EA 5C6TL 1U91B 4PJ8C 3IFOB 3QNZB 5E1HB 1I7TA 3H9SE 4YNYB 3MV01 5I6XC 1FVCB 3MLYL 4JVWA 1JYVA 4QRPE 4BZYA 1MJUH 4Y4KA 2X7LA 3V4PH 5I19H 4PRNB 1BECA 1CFQB 5TF1L 4XPFL 3HI1A 5FYKU 5A2JH 4RAUA 1KPVA 1OAUL 5J13C 3MRJB 3O4LD 4PJFF 3EJYD 3ARBA 1QLRB 4NBZB 5E00B 8FABB 3H8NA 4Y0GA 4G42A 1DVFB 1J8HB 2ADFH 1CLOH 2KZ1B 3HZMA 5DJ6A 3B2UC 4XNMA 3WS6A 4XX1E 1QSFD 5HHNA 3GSRB 1YJDH 1J05A 3I3BA 2IANB 2OK0H 2ADIB 5EO9A 4J2XA 1IAIM 2FEEL 3BO8B 2N4IA 1YQVH 4HIHB 4F15C 2BSRA 4KK5C 4WW2F 3FT2A 4YBLB 2EO9A 3BE1L 4P3CL 4QHUA 4HCRH 2X40A 1X5FA 2B1AH 3V4UH 3EBAA 1F5WA 3QFJE 4HS6B 3HR5A 3GMQB 2R0WH 4ZODA 2XV6B 2Q6WB 2J4WH 3ARQA 4PB9H 4ZO8A 4BFIB 4UOW0 5CEYB 3VG9C 5EC2B 3MV9A 1QPXA 4WI9A 3GFUA 2ENSA 1CN4A 3L3HB 1KXVC 2FLRT 4PPTA 2EIZA 4HH9A 1RJZB 3SY0A 4KVCH 4JCLA 5E8EA 4WI3A 4XP4H 1KXTB 1EA9C 5EZJB 5J57B 3P0GB 4MZ2A 4MNGE 3WXVL 1UWXH 4S11A 2HT4D 5TE7L 4NFDA 3CFEA 3CLFH 1V7NL 4JY6B 5FGSA 4QRSB 4JN1L 3JWOL 5HI5C 1IFHL 1MFDL 4GUPA 2HT3C 4D9LL 1XH3B 4HPOH 4IEFB 5DVKA 4OZIE 4P5KB 2MSPA 4G8GE 2B4CL 3DSFL 1XGRA 1S9YA 5B4MD 4Y19D 3L7EB 3BGFC 4NDMA 4TVPH 2PYFA 1N5YL 1NMAH 4HFWB 3U30B 2MQ3A 4XGZB 1J0ZA 5JOPD 5F7WC 3TIEB 4QTHA 3EJJX 4NKOA 2FIKB 5GS0D 1J87A 1U0QA 4OGYL 4BK4A 3QPXL 4JFDB 2F53B 2PXYA 4XPTL 3TZVA 1X5KA 4UT7L 4M43H 3O4OB 1GPOH 2B2XH 3RL1A 4P57A 4Z7VA 1G7IB 4DKEH 1DEDA 4R6UA 4HWZB 4WV1B 4L1HA 4OZFH 1A2YA 5F9AC 3ECBA 2QR0A 2X44D 1FNAA 2X2YA 1QO3A 1D5XB 4K3JL 2XZZA 3BH9A 3L5JA 2I26N 1NFIB 5ISZD 2A1WH 2ZOKA 5FKAA 1S3KH 3QIUD 1RURL 3TA3B 1OP3K 3WDHA 3BVNB 1S5IL 1NC4D 2Z31A 2AABH 2PW1A 3MRKA 4Z0XA 5DJ8A 4DOHB 1KEGL 4I3GA 1DEEA 5DJCB 5HGDB 2FHBA 3V7MA 3ZT5A 5EPMA 3VRIA 4XPAL 3MLRL 1NDMA 1G6RA 3GHBH 5JXED 1NQBA 1KN4H 4KQ4H 4RAUB 1LO2H 3TV3L 1NLBH 5DD6A 2WWMD 2R1YB 2X10A 4RMSA 4TNWK 1ZS8A 1P53A 3Q6GH 4MJIB 4YQXH 1VDGA 3MRMB 5FGBA 1EBAA 4JHAH 1I8MB 3QBTB 1B9ZA 1OLLA 5ESQB 4MJID 4OF3A 4BQ6A 3NH7H 3L3JA 4OLXL 5C09E 3P4OA 4HBCL 5CJQL 1I7TB 5KJRH 4ODSL 1WV7T 2YMXL 5EORH 4ELMB 4MD0A 1IM9D 3VDAA 1IKNC 1WQVT 4WI5A 4F7TA 4G9DB 5T1LD 1PG7H 3EOBB 1OAXH 5F93C 5LQBH 5EB9A 3TBTA 1CZ8H 4PLNC 5DMGD 2XYCA 5E8DH 1QQDB 5EDXA 5CZVH 1CDGA 5E6YA 1KPRB 4XZUB 5I71B 4ZQKB 4GRMA 3IJHA 4L8DA 4PRHD 3HE6C 1F3DH 2BNRB 1MCWW 2Z0BA 1ZXQA 3DX7A 5F6IB 3S7GA 1S7WB 3VJ6A 2ESVA 3GMOB 3NTCL 1FGNL 2Q86B 1KIPA 3UTZA 3TT1H 4PJAE 3PWVA 4UTBH 3DX6A 4OZIF 1OTTC 2GEEA 2X4PB 1T7YA 4P4KC 3EYUH 3LB6C 2XG5A 3GBLA 5INDB 1G7HB 2EDNA 2XI9A 4KQ3H 1JPTH 3BDYH 6CGTA 4LRIA 4R7NB 2HJLA 1EGJH 3L3OA 3ARRA 3ARGB 2VSDA 4XPBL 2Y06L 2GKIA 2WWMC 2WIIA 4DGIH 3OV6A 1A6WL 3QIBC 3SOBH 2OBGA 4M6OL 4S1QH 5I1EH 1OQOA 1OCWH 1A6UH 1CFVL 1EAPA 1NKRA 5FK9B 1YJDC 4XAKE 2V9QA 3E6HB 1KEML 3A6CL 3CFBA 2RQ8A 4PRPA 3VXPA 3C09C 5IW6B 4QRQB 4EJ1C 1B4JL 4PGBB 3T8XB 3NACL 3DETC 5T3ZD 5T5NG 4YHIB 4LVOB 1V3MA 4LKCB 4AENA 2VDMH 1OM3L 3RQ3A 3MBXL 3ZKXC 2H3NB 1MCRA 1H3VA 2QV2A 5C9JB 3HZKB 4O51A 2YPVH 3FN9A 1MIML 1T1XA 3OWEA 1IT9L 3MLWL 1ERNA 3RAJL 3W2DL 4WJ5A 3D39A 3RDTD 3S37H 4DN3H 4ERSH 4HGMA 3TPUB 4X7TB 2DLFH 5I1JL 2X5PA 3KYMB 4Q2ZA 1KIQB 3TVMA 1TZHB 4OV5A 2QBWA 3HLAB 5TFSL 4HF5H 5ESVB 3GBMH 3UYRL 1H3WM 5J89A 2R2HB 1RK0A 4FQQB 5DO2C 1JUFA 1YDPB 1T1WB 5EUOF 3BKJH 1QSFB 2BHYA 1F8TL 4FQCL 4KFZC 5C0GA 2BSRB 5JW5A 3GSWA 4QCIA 1P6FA 2DTSA 5H8DA 4BJLA 3QEHB 1CFTA 5I1AB 2X4OB 1KPUA 2XKNA 1JCKA 1SYSA 1JGEA 3LEVH 4P2RA 5IMMA 5DEFB 1EO8L 2ORBL 1VFBA 4JFPB 5MENE 3O2WH 1BVKA 4IMLA 1UKTA 4JANB 4N0UE 4OZHB 1ND0A 3G5ZB 1AFVL 3PNWB 1UG9A 1F3DJ 1GAFH 4AK1A 1OW0A 4WI7A 5KVMC 3LZFL 5F7LB 4GFTB 1JGEB 2HKFH 2HT2D 1FVDB 1T03H 2W38A 4C56B 1WITA 3KXFA 1DDHB 1A6VH 1ZMYA 1MUJB 2R29L 5DJZA 2OR9H 2RR3A 4YHYB 3HC0B 2MMXA 4WHYH 2VQUA 1D5BB 4L3EB 2X9YA 4K3DH 4APQD 25C8H 4EIGB 4FFZL 3TPKA 4ZFOA 5DD5H 3O81A 5DD6B 4E5XA 5D7JA 4UV7H 5C0ND 5GRUL 1NJ9A 4FQIL 4TRPH 5KVDH 5D71H 4OGXL 4AMKH 4C57C 2OLDA 1JI2A 5D1XD 4HMDA 2MPAH 1CDCA 4D0CB 4YIQB 3UBXB 1NUNB 5GS1B 3VA2C 5F9WB 2XN9D 5EN2B 5DJ2B 1NANI 1MRFL 4XWGH 1BVLA 1U9KA 5H94B 5BOZG 3SDCA 3V8CA 3ULVD 2VLRD 3O6LL 1DN2A 1U2HA 1MF2L 4JLRA 1JPFB 3P11H 3O8XD 3O11B 4WCYH 2B5IC 2ENYA 2QR0B 4I3SH 4XP9H 3TZVD 1WTLA 2DQDL 3V2AR 2Q8BL 5FDWA 4JDZB 1QRKA 2R1WB 5FHAH 1NMCB 5FYJL 1OF2B 4OSUL 2NXZB 4BFIA 5D7IF 1MVUB 5GSRB 2KPNA 4M7KH 4HWNA 1LEKB 1NJ9B 4RQQB 2NY6C 4HUKB 4NC2B 1P7HL 3QUXC 1MI5D 4AEIL 1Q0XH 2HT2C 2EIBA 3IDXL 4JQVA 3MLXL 3WFEH 3FT2B 4O4YL 5GRJH 2DQFB 3TWCL 4OT1L 5D72L 4KXZI 2NW2B 2WSKA 4ODBD 1DE4B 1FL3B 1XGTA 3QXDA 5E2WH 4ETYA 4X6CE 3SDXA 3SDCB 3D1MC 2JIXA 3VH8A 5D7LB 4OT1H 4O4YH 5GRJL 3D85B 1AR1C 1J8HA 2X4TA 4M7LL 4P9MH 3SGDI 1YEDB 2MNUA 5DRZA 3O6FD 3VGAC 3LD8B 4ZUWB 2PYEB 4M7KL 4LPVA 1TQBB 1R3IH 4OCYH 2XWJA 3F7PC 1WFUA 1NDGB 3E0GA 5FYJH 1I4FB 5L7XH 4OLEA 3ARSA 1I1YB 4XP9L 4Y4HD 4AH2A 4I0CC 4DCQA 1CGXA 2FJGA 1EO7A 3BZ4B 5IEKA 5L2KD 4YDKH 1SYSB 1WJ3A 4M61A 4P57B 4Z7VB 3ZT6A 1U3HA 4XRCB 3BW9A 3VWJB 4POZD 3F7VB 4Y2DD 3VFNB 1KJMA 3D2UB 3K81A 1HHGB 4HUXB 2FZ3A 1MCPL 2OM5A 3U7YH 5CGYD 4AMKL 1VGKA 4MNQD 1UZ6F 1YEFH 4JDVB 8CGTA 1NUDA 2AJUL 4UV7L 2D4FA 5IFAL 2HFGL 1MCIA 1X4ZA 2GQHA 3GI8H 3KPRD 4QWWD 4S1SL 3Q6FA 4PBWD 4HZLA 3W5MA 3QRFM 1ZGLA 3REWA 2AJSH 1YA5A 3GJFH 2PW1B 1XGYH 4LNRB 4YXHH 3KDMB 1IZJA 3GMRB 4ONHA 3GK8H 1G7JB 4UIMB 4F7MB 4LCWD 3FT4B 2J12B 4KKAC 2P8PA 1NCCH 3IFLH 4WWKB 3WIFB 4LP4A 3H7LA 5CHNA 4A6YA 3WNMA 4IRSA 5J11B 1TNMA 3OB0H 3RVVC 1LWRA 5ANMB 1WF5A 2VXTH 3D5OF 5DS8A 4S10A 5JHDB 1OWWA 2W9EL 3KPTA 1N0LA 3H3BC 4P2QA 5C08B 3TZVB 3X17A 1AKJB 5CEZL 4X6CA 1ZA3A 1J1OL 3DIFB 1FN4A 2A6IA 3H0TB 5BW7A 1TXKA 3SBWA 2W0PA 4HFUL 4AEHH 1PLGL 5ACLA 5ERWB 4NZRL 4KGJA 4LCIL 4Z7UE 1IEBA 3HHRB 4JQXA 1ORQA 4JQIL 1TDQA 1KTDA 3MTRA 1NBZA 3LB6D 3BKJL 4NUJB 4YHPB 4NO0D 3WFHA 2DM7A 1OW0C 3D39B 3V7AE 4Z7WB 3ARFC 3CVHA 4Y1AD 1WCBB 2UZIH 5MERB 3ULVH 3ULUF 5EOCH 1PSKH 5KSBB 2GCYB 3NA9L 4ODUA 3BEVB 4H0IA 2Z8WC 4XCEB 1JBJA 4OFYA 3OKMB 1NBZB 1MWAH 43CAA 3W2DH 4E5XB 3SJVA 3CMOH 4TSAL 3MLWH 3KYOB 1BIIA 1PX3A 3VXRA 1OAKL 2Y4SA 4ZD3H 1FL6B 1JPGB 5ACZA 1HH9A 2FECI 1OT1A 4R90H 3TO4D 4UV4L 1Q0YH 5T1KA 1I9IL 3C5JA 4W4NA 2B0SH 3FRUB 3IU3A 3CNKA 4HC1H 3VGGA 2DF3A 4AEEA 4JFDE 4NQEA 1ZLVK 1ZVHA 4G43B 3VG0H 2XKUA 1T04A 3GMMB 3Q1SL 1F4HA 1M4KA 3S97C 4EOWL 1KTLA 3VXME 1CDJA 1HQRA 4YDJB 1WBZA 5KS9E 1CL7I 4X4YA 1X5AA 2DJ4A 4S1QL 2GT9B 4MQTB 3I85A 1CD9B 3TVMC 1OVZA 3ARFD 4PY8I 3CFIC 3WDIA 3N1MC 1EGJL 1SBSL 3TIDA 3EZ8A 2VAAB 4PREA 5E4EC 2GW5A 1GZQB 1GHFL 4GAFB 2IANA 4K71B 1RIUH 4HQQH 1MLCA 1F58H 2V7NB 4K8RC 3EO9H 1IAII 5IW1B 2ITCB 3AAZB 2N56A 5GGVH 4XI5C 1FE8L 1JGLH 4BZ1L 5ISZA 5CWSB 1AGEA 4MDJA 1I1FA 1BZ9A 4IMKC 3MLSL 5CSBA 1U8QA 4MA1B 4WO4C 5DT1H 1QEWA 4YHNB 2WBKA 4P99A 1U91A 2AEPH 5IJKC 1FG2A 5IV2B 3CXDL 3NMEA 1Q72L 3WKNA 3RWHB 4H20H 4LVNC 1F3JB 5F97E 3CFJA 3ABZA 2GITA 4QNPE 3HPLB 1CZ8L 4NN6B 3S88L 1T5WA 4X6DE 5LWYL 1KYOJ 1JHTB 4HUUB 5I1HL 1FBIH 3IDGB 4Q6YA 4B0MM 3EOYG 2BVYA 4P2QB 4LCUA 3ZO0A 4LSVH 4JANA 5T33H 1OGTB 4PGBA 4YWGH 1GRWA 3JV4A 4NKDA 4YFDB 5HYSB 3NH7L 3R06A 4NPYA 4CW1B 4NHCL 3ARWA 3CVHH 4PV8A 4ENEC 4JHAL 3KPPB 3STBA 3BDBA 4YDLB 1TQCC 2EC9U 5IR1A 4HIEB 3CPLB 4IIQC 4X7SL 5E7FA 1NLBL 4YC2C 2OR7A 3DUUB 5DFWH 2AXGB 3MLRH 4OFVA 5ALBH 1U8JA 3ULUE 2E9BA 3WDJA 1FJ1B 3HB3C 2YSSB 3VXUD 5IVXA 1MRCH 1R24A 4XWOD 4G8EB 2ZCLH 3I50L 1AGFA 1AD0A 3OAYK 3NAAH 2FIKA 2JF1A 3QUYD 2H9GB 4CL7A 4PLOB 5FIEA 5DHYA 3X11A 3EW3B 1T4KA 6FABH 1YN6A 1MJJB 4L3CB 4NQXA 4ZDHA 3QA3B 1DBMH 5K9QI 2X9XA 2DQJH 2EEBA 4DJMA 2YRPA 4PJIA 4XT1C 2BZDA 1P2CA 4XNQA 3UBXI 3WIHH 1A8JH 3P40A 2VXSL 3UPAA 1PGRB 1A1NA 2EYRB 4NKMA 2RIKA 3TBYB 5C0DB 5IFJB 3S3PA 4NC1E 4R96A 2W92A 3BISA 5DXWA 4UT7H 1BD2E 1DANU 3QPXH 5HHXL 5KS9F 4XPHH 3IDIA 1EFXA 2R2BB 4UQ2A 3QXWA 5CIPA 2IBGA 4PJ7A 3QI9D 1N5YH 4YIQA 1J0KA 5C2BL 4BFGA 3S3JA 3QEQE 4ODXA 4JVUA 3RVTD 3DMMB 3O9WC 4EI5A 3L3JB 5D7KE 4QXTA 1MI5A 4Z6AT 5C86A 2FR4B 3C5ZA 3E8UH 1K4CA 1G7QA 3JWOH 1KLFA 4ZUSB 1CXEA 5J6HA 1DUYA 1TJGH 1JK8B 3MRGA 5A3ID 3ARED 5TPWH 4HV8A 3P4NB 2FBJL 1FYTD 5A40E 4HKBA 4GW1B 3OJDA 1NLDL 3SDAC 4HUWA 3QIUB 3U0WL 2PNDA 3KS0H 2EO1A 4ZFOL 2FDBP 5ISZB 3SO5A 3RVWD 2EXWD 4NQCE 5HYFA 1WEJL 3LIZL 2RBLA 3OR6A 4KTEL 5GZOD 4PRIA 4JFEE 4UOJA 3LIZH 5FUZH 3MUGA 2J4WL 4MAUL 5FKAB 3ZE1E 1T66D 1B2WH 2VMFA 4F57H 1NLDH 4ZQKA 3HTLX 1XGPA 3O3UN 3UP1A 1Q9LA 1W2KT 5L6YL 5BQ7A 1FZKB 5ALCL 2VDQL 3WEXA 5TPWL 3MROA 2DMCA 4NKQB 2DYPD 1YNLL 1DANT 1SJHA 4YE4L 3U9UB 4AQ1B 4MJ6B 4P4KA 2CRZA 2R2CA 4OIBA 2R4SL 4GH7B 1YJDL 3O45A 4GMSL 5HJ3B 4HWEH 4WDIA 4Y4FD 3RKDD 1SVCP 3EDEA 4GJTB 4QRTB 4JRWA 1G0DA 4JPIA 1R3LA 4IS6A 2SEBB 1HN1A 5ADOL 1HH6A 5AD0A 5ELIA 5D6CB 1OGAE 4G6FB 3VXSD 3D6GA 3UROR 3BQUB 3MV8E 1KCSH 3FQWB 5GS0H 4N0CD 3X3GH 3UXFA 2BCKB 4XBPB 5I19L 3DVNB 3V4PL 5ACZB 4HW6A 1C7TA 4X83A 1A6PA 5A3IC 5DUML 4R2GC 1C8PA 1QFOA 3OXSB 1MRDL 3BI9X 3GSUA 2VXSH 4MX7A 1GCFA 1B0GA 2OL3H 3G6DL 3FJTA 3SGEH 1DBML 1EEZA 4TN9A 3IDMA 1IC5H 4OLVL 2DMBA 3IXAA 5DSCA 3R06B 4NPYB 3MMEB 5GRVK 3V6ZB 1FZOA 2Z9TA 4WUUD 1OP5H 1IAKA 5DDHA 4M1GH 1Y18B 4HJ0C 4KJPD 4IJ3B 5C0FA 3ARXA 3EOTL 2FX8L 4XMKL 3D9AL 4NJAH 3QDJD 2YPKB 3I50H 4R4BB 3ARPA 4MLIA 2D7OA 3IB4A 4H26A 3T2OA 2GAZB 3SY0B 1QVOB 4LLAA 1F02I 4LQ1A 4BQBA 4PV9A 5E1AB 3VXQA 4P5MB 4YHPA 3U7WH 2P4AB 3L7FB 1DVFD 3RWGB 2DLGA 3T0EB 3CVHL 3AS1A 5KSAD 4QF1A 1WT5C 4J4PA 1TETH 2AV1B 1HWHB 3OAYH 3SHSA 2X4NB 3FHQA 1DVFC 3WFDH 2Y72A 1KCSL 2Z4QB 2YD2A 1IGCH 4PLKD 2P1YA 1MIEL 2V17H 3S6CA 3QIWB 3EOAB 4I4WB 1NGXA 2GJ6B 3GSXB 4WUUE 1RPQA 2F5AL 3PWPD 2DQCL 4NNYA 3HMXA 4QOKD 3SDDA 1FCGA 2DMKA 4F15B 1H3GA 2AXFA 1QPPA 3O0RL 3JTSB 4PG2C 2V9TA 2W65B 4KJYB 3WIFA 5CS7A 3IDGA 4HJGA 5TDNA 5DURD 5C8JB 3Q0HA 3SE8L 1FFQA 3RL2A 3FZUD 1ZHKB 1WT5A 4Z7QE 3ZSTA 1HDMA 5CKAA 1D9KD 3LN9A 2MKWA 5HSFA 3OKDB 1RHHA 1KTLB 2R0ZL 3QEUA 5SWSA 5ALCH 2ARWA 1MPAH 4NQSB 4KWUA 4OV5B 4ORZC 1C5BH 3MNWA 1ORSA 1HILB 1YMMD 3Q5YA 4Z7OF 1EXUB 2IBBA 5FKPA 2AK4A 2D0HA 4EUPA 4M7JL 4EDXA 1L7IL 1R6VA 4TNWF 1H5BC 1ZE3C 4K8RD 3KR3H 4XVJL 3F65A 2HVKA 4KTEH 4HPYL 5EU6D 1KLUB 3P0VL 2RJMA 1SVZA 4Z0XB 4U6VL 4UDTA 4L8SC 4LSTL 4U0RB 1OSPH 4JVPA 1S9VA 3VI4F 4M6NH 2UWEB 3D87B 3I75A 1CE1H 4KY1H 3RWCB 1ZHKA 5T1DH 3TP4A 3RHWK 3TFKC 3SDXF 3T3ME 3IF1B 1I9RH 5EN2A 4HDIB 3LN5A 1E6JH 4OZHA 3UTTD 1R3KA 3BIBX 4U1MB 1LQSR 4ZAKC 4Y5YB 3GKWL 3MO1A 2YK1L 1TZIB 1I9IH 4M8QB 5C2BH 1YMMA 3OBAA 1FIGH 4UV4H 3DJ9A 1MH5B 1LGVA 3MV7E 3QUXA 4NKMB 4Y5XC 4NWTL 5E2UL 3TH4T 4DEPB 3RTQB 1TJHL 3T2NL 4LLMA 1OAKH 2OP4H 5BMFH 4K23L 3QG7H 2FSEB 3LPWA 2BVTA 3ARUA 1X5ZA 3HAEG 1OLZA 2YR3A 2QADD 1HHJB 2APTA 3GSNL 4HX1A 3BGMA 1OSZB 4B7LA 1PSKL 3MREB 3U4BH 3T4AB 3PABA 3MRNA 1JNHA 4X6FA 1I75A 3D3VA 3EJZC 4LAQL 2DQJL 2Z93A 3IETB 5EH1A 1AGCA 5GS3A 4LHUA 1BQSA 5CINL 1I7ZA 2V2WB 4HMCA 4XAKD 3BMVA 4KJWC 3RWIB 3OMZA 4F9LC 4LNVA 1R0AH 5KSBE 2IFFL 3HMXL 3ZT7A 4TOYH 5I2IB 4NZRH 2F8VA 3LRGA 1NC2D 1NUFA 3VGBA 4UINL 1MRCL 3VMOA 4Q7DA 1TPXB 1K8DB 5I1CL 2H2SC 4JDVA 3P3YA 4GRLB 3KWWA 3W9EB 4FQQA 1RK0B 3KPLB 1QBAA 3BZFB 1TVHB 4PTUB 1JZ7A 1F6FB 1WZMA 4MWFB 1EHXA 5JQHC 4TVSa 2BC4A 1IEAA 1LK3L 4EI5D 1JHTA 4M6AA 3VFTB 5IVXB 2PW2B 4BM7A 2Z91A 1JZ3A 2BNQA 3DBXB 2E7LC 3L5HA 1FSKC 1A1OA 4PJHA 5I74C 3BRDA 2DI9A 1U3HD 4I2XB 3P73B 4GRLA 2ZZUT 3MBEC 4IRSB 1AGDB 4FXGA 2MQ0A 3S5LB 5I1HH 2W9LA 4C4KT 3BD4A 5ITFA 4AENB 3FONB 5EU7C 3T0EE 5KTEH 1YMME 5F6IC 2HLFC 2BDNH 3LV3B 5D2NE 5D7JC 4Z9KB 2YEZB 4KMLB 5J7CC 5HHOD 3TBSA 1IVLA 1GSMA 1WVZA 1KF9B 2NPLX 4KZDH 3LS5H 2EDWA 3SDXE 3T3MF 3TNNA 5T1MA 1F4XL 2GHWB 1JGLL 1TVDA 4MNQE 1G0XA 1FE8H 4XP1L 5K9OB 2XICA 4PJHB 4OUUA 4WGVB 1JHLH 4TUOA 3QIBB 4NJ9H 1RIUL 3O8XC 4LASL 2OL3A 2IPUK 2D9CA 1GHFH 2BY2A 3B9KA 1M71A 1S9WA 1VGKB 4JO3H 5A16A 1AO7D 5EU5A 5HDOA 3PL6B 5E5MB 3UDWC 1MCNA 2XTLA 5FOBA 3RWEB 1RFDL 4F80A 3UBXG 1GGBL 1KCUL 1R3JA 3MRFA 2C3VA 3W0WA 3PV6A 4Y2OA 4CDHA 1UQSB 4PRHA 4BZ2L 1EMTL 2HN7B 3FT3B 3GJFA 1B6UA 3LOWA 4DK3A 4C54A 2GTWA 3OX8A 5IUSA 3R4DA 2HRPL 3IYLW 2I24N 3GI9H 4LF3B 4APQC 3IFPA 3HZYB 2B0SL 1U8MA 1YNTA 3ZYZA 1ZAGA 2NW3B 4QHNA 3LS4L 3V4VL 3ARZA 4FP8L 5KSBF 4L4JA 3OL2A 4PB0L 5BZDB 4KPHH 1OGAD 4TUKH 4F7TB 3I9GL 4ZD3L 2Q8AL 5E5MA 2Q8BH 2OZ4A 3CMOL 4NQEB 5L0QB 1CVSC 3BQUA 5D7IB 3U0PA 1OD9A 3V6OE 3EFDL 3O3EB 2Y23A 5DC9B 3K2MC 3BP6B 43C9B 4OQ1A 4JDZA 1KB5B 3P4NA 1JGUL 5JHLL 3LY6A 4WDIB 1CI5A 5JW4M 4U1LA 2MHAA 4UBDC 1KACB 1AIFB 2DQGH 2XZAH 4N5EC 1YYML 1NGZB 2Q3AA 2VXUL 2IPKA 2VUYA 4ZUVA 5BRZD 3P4LA 4GRMB 5ANME 1FVEA 4LSPH 4RGOL 4FOMA 4HWBL 1HYSD 2APWA 1B0RB 3UAJC 5BQ7B 4MS8C 3RY4A 1ADQL 4Y5VA 1IKFH 4HFUH 4HLJA 4DQOL 4OBRA 3VJ6B 1J1OH 4IMKA 2NX5D 3PDOA 3C9NB 1NL0L 1A6VL 1UZ8A 3QPQD 4OLWH 1S7QA 4UDTB 3BH8B 4PJBA 5HVGB 4P2OB 3A6BH 3LEXB 1BJ8A 2RB8A 1D5MB 2XQBH 2A74B 5FGCE 2YRZA 3OF6D 1QSZA 5F7KC 2ZUTA 4CVXA 2FGWH 5T3ZE 2OJZL 1ZSDA 1MY7A 4PJGA 1AFVH 2BC4B 2F19H 3QJFB 3NFPB 5DR5H 2XFXA 3DBXA 3BH8A 4J1UA 2FX7H 2YA2A 3HZKA 4O51B 1RVFH 3DXAB 1U8LB 5HHOA 4HWBH 5F9WC 1IBGL 5KVGL 2AJUH 1YEFL 4GXUM 2YPLE 3V52H 4WW1B 4UT6H 2VXUH 2QQNH 2VAAA 4QOKA 4YUEL 2DQGL 4UBDD 3MRDA 1C5DB 2O5ZH 4HS8H 5K59E 3LN4A 4N0FA 5JHLH 1A6ZA 4HF5L 2Z35A 1PFCA 3W39B 1S9XB 1W8NA 2Z4QA 1WZ1H 3WKMH 1NMCC 2Y7QA 3GSOA 4YDKL 1ZGLM 2ZUXA 3UJJL 2Z31B 4QY8A 2VIRB 3RGVB 3IDJB 3KYNB 5HHPB 1ZHNB 5IB3B 2OZ4L 2A6JB 4LU5L 5JIPA 3HUJA 1NBVL 2OI9B 3QEHA 1MIMH 5C07B 4XCNB 3NCBB 4TUKL 3RZCD 2R69H 5HHOB 4FP8H 4RGMB 1QFWM 3WO4C 2CR3A 2YXFA 4FZ8L 1S7UA 5JNYB 3ARBC 3HPLA 3IXTA 3QXAA 3QJHA 3BGAA 3EYVB 2EC9T 1KELH 3BPOC 4J3UA 3G04B 4MJ4A 3NCYP 2E9WA 5BZDA 5JOFB 5FGBC 3DETD 5IOPA 3EDDA 3WXWL 3HCVA 1FORL 3Q5OA 5AZ2H 5F96L 5LJYH 5D72H 2CQVA 2NY4D 3HG1D 3V5DA 1UJ3C 4I5BA 4WVRA 1YC8A 1A6UL 3TBWB 1MLBA 3OR7B 5GGVY 4I9WE 3TNMA 4FMFA 2CLVA 2EDLA 3H7BA 4LLUA 3LQAH 4DGIL 5I18L 3GDBA 5IFHL 2E7MA 4JO3L 1YPZE 1FV1A 5LG1A 2UWEA 4GG6B 4OGAC 3BJLA 4XXCC 5ENWA 3GIZH 4XNZC 4ZFOB 4ODVH 5EZIH 3V8OA 1IEBB 4OJFH 4XNYH 1B6DA 1W72L 3V6FB 3BUYA 4QTIH 3VGHA 5DGQA 4NZTH 5LGKA 4MJ5A 2F15A 2VLKA 4GW1A 1J5OL 3Q3GB 2MQCA 4XP6H 4LLQB 2C1PB 3BP6A 1XMWA 2PF6A 5D6DC 4TUJB 3L3OB 5E8DL 2X42A 4N0UA 1DSFL 4IRJB 5GZNC 2VRAA 1M7IA 5LQBL 3PWLA 2A6KA 1Q1JL 2W0FB 4Z5RA 4NHUA 3KYKL 3QO0A 2CDGA 2AKRB 3VCLB 3FRPA 1WUNT 3IKKA 3BIKB 1XGPB 4LKXA 3WUWB 3M45A 1R5WB 1U3HC 3SKUD 5J11C 2GTZA 1BQHA 2P5ED 5C3LD 3IRPX 5KJRL 3B9DA 4Y5YA 1FNHA 3TBTB 1D6VH 4X4XA 1KPVB 1T03L 4L3AA 2NY0B 4Y1AE 5CSZA 3GSRA 5HDBE 3T2QA 4DTGL 3F5WA 1KG0B 5DJ2A 1HI6B 3SGKC 4PJ5D 3UZVB 3FAWA 3NIDE 1IGMH 1N6QH 4OI8A 3DUSA 1QQDA 3QO0B 1WZLA 1A7QH 1UXSA 3MGOB 3IKCB 2CDFA 4WW1A 4QT5A 1NSNH 5C3TA 1LILA 3HRPA 1DQTA 3ILQC 2N1KA 5BV7C 1QZ1A 4O2FA 1CDYA 4UINH 1RZIB 2PYEE 4JFZH 2D7PA 4FG6D 4TOYL 1VCAA 2NR6D 4JM2A 3WBDA 3E2HB 3HFMH 1N26A 1TZHA 4Q6IA 5D7IE 5F3HB 1F8TH 3F7VA 4FQCH 2QKIB 2GK2A 2CJUL 4RWHA 2A74A 4K3JH 5AAMA 1IRAY 1EFXD 5T3XD 5I1LB 4YO0A 1RULH 2V5YA 1TIUA 4IBLT 1EEYA 3FFCE 4WFED 2ITCA 3BKCH 4HXAH 2X1QA 4WV1C 2X4OA 3SQOL 4WFHD 4OKVA 1MQKH 1CIUA 3FQXA 4G7YL 3RDTC 3S37L 3VRJB 4QRUA 5FA4B 2P24A 2A0LC 3RAJH 2MHAB 3K46A 4J3WA 5IM7B 2ZG1A 1IT9H 3SKMA 3SO3B 5CD5C 3GGWB 2VL4A 3SCMB 4LPCA 2V7HA 4HH8A 5JPMA 1YPZF 4L3CA 3NCFB 4NQXB 4ZDHB 4M7ZB 2ICEB 2H26B 3QR2A 3CFCH 1JHKH 2WWKO 2Y5EA 3U4EB 3GKWH 4ZPVA 4PJ9A 4YXKH 4M03A 1B4JH 4HH9B 4CMMB 4QF1B 3DV4A 4PJAA 4D9LH 2DM3A 3I6GA 4HSQA 3MXVH 4KH2A 3VFNA 3TVMB 5CEYA 1BGXL 1E6JL 3AY4A 5E6IC 5KANI 2GUOA 3SE4A 4EIZC 2WV3A 1JN6A 1CE1L 4WFEE 1CFVH 5CCKL 4M1DH 2VAJA 2VDNL 4CU6A 4M6OH 4K71C 4ZPVB 2EDRA 3QO1A 2B1HH 2IPUG 1NGPL 5CHNB 4F37F 1IILE 4PY7B 3BDYL 4KQ3L 3IJSA 1CXIA 4WI4A 1MJ8H 1RU9H 3K4ZA 4G3YH 2Q3ZA 2VZVA 4PJAF 2OTWA 1WFOA 1INDH 1NCBH 2DQUL 4P23B 5GRXG 4RX4A 3U48A 4P3CH 4Z5RB 1J12A 1MPAL 3ROLB 3TJHC 4KJWD 4LLDB 3QIUA 1A7RL 3BPLB 1WICA 2YS4A 4YHLH 2QSCL 4ELKA 1UA6L 2ICCA 3BX7C 4WW2B 1AJ7L 3REVA 5SWQA 3MV9D 4DUXA 3BIAX 5JR1L 2ADFL 4PJ5E 4UDUA 2E7HA 1IAIH 5T1KB 3QYCA 2CD0A 4MJIE 3RUGF 5D7LE 1YEEL 1VGEL 1MAMH 2V17L 4XPFH 4M48L 4JZJA 3CLEH 5CIPB 4YDLC 5IT2H 3SPVA 4ODSH 43CAB 1TETL 1XCQA 1F6LL 3QULA 5EOQH 4NN7C 5HGAB 4OLXH 4ODTH 3WJJA 4QHNB 1N7MH 3EOBA 5E8PB 4JG0H 1YEDA 1KBGL 3KVQA 2HT3D 4XVSL 4Z7WA 1KN4L 2A6KB 2W0FA 5AG9A 4WU7A 3EJYC 1KGCE 4YNYA 1A5FL 1FYTA 1GZQA 1I9JH 1TCRB 3O6FC 1NUGA 1PQZB 2WK2A 3GB7A 5ID0B 3QNYB 4HMEA 4OD3H 3MNWB 3FAXA 1W0YT 1QBLH 3DI2B 3BP7A 4ZXBB 2MCPL 4FXKB 5C09D 4YDVA 1JTTA 2A1WL 1OHQA 4U1JB 3OKEA 4FABH 2XZCL 3TC9A 3CSPA 4QYOB 3FQRB 2WUBL 2EEDA 3SGJA 5EFIB 4I77H 2IH1A 1IC5L 2WBJD 4GBXA 2JJWA 4LSSL 3RX7A 3VXSE 3NA4A 2R56H 4C58B 3ARBD 2OTUA 3NIFE 2R39A 3FB5A 3MJ7B 1FNSL 1N59B 5I8OL 3NN8A 4UIKL 3TEUA 5BO1H 4MJ5B 2JJTA 3FQTB 2DN7A 3LQMA 1EIBA 1QR1A 1MFEH 2OQJA 3BEWB 3S35H 4RGNE 1UZ8B 1J1XL 2H41A 3GZKA 3H9SA 1U8OB 3VXUA 1FFOB 4ZTPL 2WW8A 5KN5B 3GSUB 4PJCE 5F72S 3DMMC 3O9WB 4FFWD 4P2CG 1IC4H 1JTPA 5KAQF 1N2RB 2ATKB 2DRUA 5LGHH 4ZG1A 4Y4FC 3RKDC 5DSCB 3V5KA 2FBOJ 2Q76A 3RY5A 4YXLH 4G5ZH 2QQLL 3TH3T 1LP9B 4LHQB 1SMAA 1X5IA 2DKSA 1MFDH 4V1DB 4YE4H 1DCLA 4ZFZA 3KPNB 4ZSOA 1YNLH 5GJTH 2EIDA 3MA7B 3SKJL 3HCVB 4WI2A 1AKJA 5L6YH 4HJ0D 3ZYOA 1FPTL 4L8BA 4G8EA 3BW9B 5F1SA 1A02N 1QSEB 4F57L 2APXA 2EH7L 3T0DA 3MGOA 2NTSP 1W0WB 1IAKB 1OD7A 3QXAB 3GJEA 1FG2B 5IV2A 1FZOB 4M9PA 5DA0B 3UTSA 2DLHA 4H0GA 4L9LB 2AK4D 3ILPA 2EDXA 3L7EA 2OR8A 1VA9A 1T21B 1VEPA 5C1MB 3V4UL 3TBSB 2EC8A 3U0WH 5ITBL 2R0LH 4TSBH 4W4OC 4UOW1 4YPGA 4ESKA 1I8IB 2Q7YA 5C0JA 3FFCB 4KUCD 3CSBA 1TJGL 1RZFH 4Q9RH 3N85L 1ZHBB 4HLZH 1JZ6A 5GS1C 3U0TA 4PJBF 3TBVB 2OK0L 5HYSA 2C3WA 4OFIA 4FZEL 3JWDH 3L3KA 1C12B 1O7SA 5FA3A 3QHTC 1IJ9A 2Z91B 4K9EC 4WENB 5EU4A 2IBZY 3FRUA 3IU3B 3S35X 2JB5H 4KROB 5INCB 4Z0BL 5TF1H 2C1OB 3C6SB 1S7RB 1HHGA 1A0QL 2I60L 1MJUL 5DJ8B 3MRGB 1LP9E 2AXFB 5HHVH 1ZV5A 4R26L 5HDQL 5GGTA 3SDDB 2EECA 2I60H 1ZA6B 1PD6A 4L4VD 2N7BA 3RZWA 1CGSH 2JB5L 2VDRL 1UXSB 2AEIT 3T0VA 2F8XC 4P2RB 2NYYC 1KJ2L 1ZHLB 4K55A 1AIFA 3FO0H 4UILH 1XF4A 2NXYD 2CDEA 1ZOXA 1AY1L 4KRMB 4GAYA 4PJCF 4EQ3A 4MYWB 4JM4H 4LLWB 3Q3GA 5DYOA 43C9A 3RU8L 3VE0A 5D1ZB 4ONFH 3O3EA 5TH2A 4OI7A 3H2WA 4N0UB 4YGVA 4KUZL 4HKBB 3TT3L 2F58H 5T5NF 5BJTB 5BXFB 2F54A 1EEQA 3MLUH 5E6ZA 1KXQE 2AVGA 5E8OB 4PJ7E 2MKLC 4OF6A 3LRSB 35C8L 4LGPB 1BP3B 3ULUD 2BVQA 3L5WB 3DVIA 2QL1A 1YPZB 5LWYH 2EE3A 4HUVB 4I0PD 3HNVH 4CNIA 4WEBH 3PF2A 4H5SA 5C6PB 2OYPA 5E9DA 3U2SA 1A6AB 1GOFA 1FC2D 4YPJA 5EOTB 3EO1A 3K7UA 2BCKA 1PBYA 5HHMB 4WRLA 5D1QC 3K1DA 2GSIB 1FZJA 3AREA 4DFIA 4WHCA 3VWKC 4PRHE 4L5FH 1F2QA 3HE7D 4NO5A 4I13B 3NCMA 1CLYH 4X6FB 1MREL 1IC4L 3VG9B 3S4SA 1X7QB 4Q0XH 2IEPA 4RFEB 2FGZA 5IF0A 4JFEA 1JI1A 5I75C 3ARGA 4U0RC 4YFLI 5EO9B 2KZWA 5D1XA 1TVHA 4PTUA 3MC0A 4JFQB 4UIKH 4RRPG 1KFAH 3QI9C 4AM0A 5I8OH 1K2DA 1UYWH 1VFOA 1UC6A 3NCYS 1KCKA 1BM3L 3DX8B 1FLRL 4HKXA 3QNYA 4JHWH 4HT1L 4EN3C 3WUWG 3NCJL 3LH2H 4M1CD 4U6YA 4Y16C 1MCFA 2Z35B 5GISL 3W39A 5I1GL 5JW3L 1P1ZB 3O41A 1ZLSL 2R1XB 2YD5A 4RNRA 4U1HB 3DRQA 2XZCH 3AROA 1UWGH 4DCQB 4FABL 5C0EA 3BGFB 3KPSB 5GSVA 3QWQB 3SE9L 5DMKA 2YBRA 2C3HA 3D85A 3FN0H 1HEZB 1GGCH 3ZE0F 5E95B 3RTQC 1BD2B 4PV8B 5JHDD 5DRNA 2CGRH 3KPQB 4HC1L 4Z76B 4NC0B 4PG9A 5CBEA 5T3XH 3UTSB 1JNNH 4ZUWA 5D2LE 2A73B 1E4XH 1UVQA 4X8JA 4GT7A 1FZMA 4JFQA 5HYQB 4B7IA 1T6WA 1S7TA 1SEQH 2BNQB 3L3HA 4CJ1A 4XVSH 1URLA 1Q9KB 1CFBA 5FM5M 4TSAH 4IRSD 5F1NB 4HKXB 3VXTA 1U42A 4JG0L 4YHNA 2P8LA 3L1OH 4O00A 3Q48A 5CD5D 1DQLL 4UZGA 3RDTA 3OZ9H 1KGCD 4MHHI 5EOQL 3BJ91 3QDGD 5JW4Q 2UZIL 1M6OA 2GIYA 5E70A 3ZKNC 2CKNA 4HXBL 1RUKH 4PJXB 1FNLA 4M48H 2QJDA 4MNQB 5D2LB 1VGEH 1YEEH 5F7EL 1QSFE 3G5YB 4GBXD 2DM4A 4MNGA 1FO0L 3IDYB 5DJYA 2GJJA 3BUYB 4JRXE 3BP5B 5FUOL 3T3PF 1U8KB 1NFDA 5BVJB 4MQ7A 1VADB 3EUUA 3N1QC 2AXHA 1UA6H 2DQHH 4NNYB 4NCC1 1QFWH 4YHLL 1QNZH 2GSGB 1RUAH 1BJ1J 1RMFH 2XTJD 4WNQB 1OP5K 4GG6F 5HGAA 4OB5H 3BH9B 2UY6A 2VISB 5MEQB 5A2IH 2J6EA 1EV2E 1I8KB 4AIZB 2VDKH 3PIQB 3WNKA 4B5EA 2BVQB 1NCBL 2DQUH 1INDL 2P5EB 4X6DF 4BKLA 5F44A 3W9DB 1CLZL 2EDQA 3MBEB 4J4PC 3I3EA 5TH2B 1MJ8L 1RU9L 2BVPB 3T77B 4Z7QF 2H1PL 4O02L 3IFLL 1R3LB 3B2VL 5E08L 3STZA 1QYGL 3AUVA 4WO4B 1RK1B 5J6HB 4K9EL 2B1HL 3PWNB 5DTFB 5ICYA 1CDBA 1XF2B 2VDNH 4G8IA 5E99H 1WWCA 2GCYA 1FCCA 1U8MB 1NAMA 4LLUB 2VLRA 2P5WE 5H35B 1QSVA 3MXVL 3KJ4C 4X4MA 3OSKA 4X7FC 5D1QA 4PRID 5CJXA 1X5XA 1HHIA 3W0WD 1Z0MA 4K7FA 2YUXA 1U8HA 2VXQH 1CWVA 1DQQA 2B8OT 4OCMC 2M26A 3O8XB 3WJLA 4DAGL 4FQ1L 3UC0H 3L5XH 4QKXB 1UB5A 5HXMA 2J8UE 5JUEL 2ZUQC 3EKCA 1UADC 5ICXA 4BSWA 1NGQL 3VFSA 2B7DT 3MRHA 4EVNA 1FNFA 5DJ0B 2R1XA 4RNRB 1ACZA 4CN1A 4LVEA 1ZTXL 5L2JA 3V0VB 2FEDD 5TQ0H 4Y5XA