4XNUL

X-ray structure of drosophila dopamine transporter in complex with nisoxetine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integral membrane protein-dopamine transporter
publication title X-ray structures of Drosophila dopamine transporter in complex with nisoxetine and reboxetine.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuL01
4N90E 4XPTL 5BRZD 3ARGB 2ZUVA 3RQ3A 3RX8A 1KB5B 3MUY1 4BSWB 1FVDA 2GTWB 1XGRA 2NLJA 4JPWH 4N5UA 1BFOA 4XTRC 1G9NL 3E8UL 1RUQH 5HYJE 5JA9A 1A47A 2ZOLA 5I1IL 2QV2A 4B7IA 2BNUA 5I18L 5EFIB 5T1KA 3L5WA 5TQ2H 3RAJL 3U4BH 3OF6D 3CFDA 1A6UH 5HGBA 5HJ3B 1U8HA 1DZBA 5SX4H 4P2YA 2W0FA 3OHXB 2Q7YA 1WBZA 2DQHH 2IH3B 1GGBH 4YXKL 4JHZA 4HBCL 5JOPE 1YPZB 4P4KB 1WCQA 3RNKB 4F7PB 4TULH 2DQHL 3TZVA 2EYTB 1W2KT 2W92A 2RQ8A 4PY7B 1QZ1A 1AGEA 5C3TA 1U58A 4PJ7A 3MRKA 3KNBB 5HI4C 2D7MA 4MSWA 4XMPH 1AJ7H 2VDQH 2CR6A 5I8EB 1JRHL 1UENA 4OM0L 2R1WB 1NGWB 2BSSB 4JDTH 3U7AA 4TUOB 3WYRA 3QQ4B 3QO0B 4OD1H 1IQDB 3H3KA 1CFQA 4JZNB 2OTUB 5J9PA 2GK2A 4Z7VE 4XMPL 1PY9A 1AJ7L 3TO2A 4F58L 1RZGA 3UZVB 3Q48A 4ELMB 1RQ5A 1Z5LB 1JMZA 4JDTL 5BOPA 3JXAA 3QDMD 1G7IA 3WV0A 1L0QA 1OB1A 4G42B 5AYQA 1EFQA 1XF4B 3RVXC 3WIHH 2YXMA 2GSGA 4PJ9C 4NKOA 1U93A 5DRZB 1UT9A 4CAGA 1B0GB 4FOMA 3G6DH 3T65A 4X4XB 4UIKH 4KMTH 2F8XC 3BD5A 3LB6D 1WITA 2IPKA 2NZ9D 5EZJB 3IAGC 3WIHL 5E1AB 4DKEL 1HYSC 3G6DL 4Z0BL 2B20A 4UIKL 4Z7QF 1JJUA 4KMTL 1V5JA 4XP5H 1UACH 3B5HA 4KK6C 2DM2A 3TBTB 2HJLA 4FZEH 1LO5A 5IM7B 1BZ9B 4XP5L 1UACL 2BNRB 3FQTA 4Z7WE 2QKIA 2ARJA 1D5MB 5ADPL 1Q9WB 2CRZA 5I74B 4FZEL 4X6FB 5D9SA 3EO0B 2ZSVA 1S7VA 4LAQH 3GEWB 1BJ1J 1CFNA 1RJYB 1RHFA 1CLZH 4MA8L 4WEBH 3L7EB 2OMNA 2FHCA 3J7HA 2DL9A 1JHKH 5ACZB 2AABH 2CDGA 4LAQL 4HK0B 2VR9A 1ZXQA 2XN9A 1CLZL 5HY9B 4JFOB 4WEBL 4WW1B 3VXSA 3ABZA 4WTZG 3U2SA 2VQTA 3M45A 4PRAA 4MS8C 3MRDB 2X10A 1PSKH 3RWIB 3DI2B 1GOHA 1CL7L 4D3CL 3C5JA 3G9AB 3R4DA 3MLZH 2GJ6D 3TN0B 2JCCF 4FQLH 5HGAA 5ICZA 3DBXA 1JK8B 1I4FB 4KJQD 1ZEAH 1FVCB 2EEBA 1M7IB 1T03H 3PWLB 2O5XH 1GZPA 5ENWB 5I17B 4Y16C 4XCNB 5DFWH 3QWOA 3MLZL 4NO0B 4PRHB 2OI9B 1ZHLA 1ZEAL 5D71H 4KTDH 1T03L 4IHOA 1TZHA 2B8OT 2W9DH 4OTXL 3S34L 3PWJA 3OKEB 2HFGH 1A7PL 1JGEA 3MBED 4QHUB 1I3GH 2APWA 1PG7W 4WUUA 2LABA 4KTDL 4AT6B 2QQLH 2W9DL 1O0VA 2YSSA 4H20H 1S9VA 2A77H 5D70L 4MNGB 5IJVA 2NMSA 4GLRI 3S5LG 2F54D 1XMWA 3MV9A 5JDJA 3T09A 1T6VN 3M8OL 1T5WA 1JF1B 4F2MB 1HI6B 1J8KA 3U0PB 3ZTJG 3SKMB 2O61A 2QQLL 1PX4A 2WBWB 5ACMA 3TJEH 2HKFH 2I9LA 1EDQA 2AK4D 4K3GA 3T4AA 5KG9B 1K6QH 5FDYA 4H26B 1CF8H 1QUNA 4L4TB 1NAMA 1T04B 3QWQB 3T2QA 1GSMA 4HMDA 1HHIA 4POYA 3TJEL 2MQ0A 4JFEB 3U1SH 1K6QL 2ICWJ 2NY3B 1YMME 1CF8L 2L7UA 3QEQA 1LK2B 3ARGD 2YEZA 1UM6L 2AXHA 4M6ML 1LE5B 1RIHL 1JTTA 1HHJB 3G04B 3LSOA 5B3JF 3B5TA 1ZLUH 3U1SL 4OBRA 5DMKA 3PJSA 1BIHA 3GMQB 5FYKU 4U3HA 3HRPA 1E0OB 4ZPVB 2Z4QB 3VXPB 2CIKB 5FGSA 3QQNA 3RVVC 4J1UA 3GSUA 2C5DC 3DV6B 2C1OA 4YDIL 2NR6D 1DBBL 3DMMA 1XGUB 4K3DH 32C2A 1B6DA 3DWTA 4POZD 4Z9KB 4GOSA 5D72H 1JWSB 4D0DB 3PL6A 4PJAE 1NQBA 1JTPA 3VFRA 1LEKA 5J06A 2UY7A 1T83C 1XCTB 3VD4A 4P4KD 1L0XA 1V3LA 1XF5B 5FUZH 2FSEB 3NA4A 2J8UA 4K8RD 2V7NA 3FT2A 1JP5A 3D5OF 4JFXA 5H35A 1H3XA 2N56A 1PD6A 5SX4I 3D2UB 1SY6H 2ZUYA 4HKZB 2H2SD 2FBJL 2FHBA 1M6OA 5C0AB 4OFIA 1RZKH 1KUMA 4Y19D 4N0UE 2AEPH 5E6IC 4J2XA 3L3DB 3P4MB 5C8JB 4I0KA 4OIIH 4ZD3H 5B8CB 1SY6L 2X4QB 5KVGH 1QSVA 4XP6H 5GJSL 3MV01 1KG0B 3E2HB 4HIJB 3MLPA 1T1XA 1KJMA 2H9GA 1RZKL 2DLIA 2AEPL 2BVOA 1I1AB 2IALA 3AY4C 3REWA 4OIIL 2AQ1A 4ZD3L 1QBLH 4HX1A 1WBYA 1NEZA 3BHBA 4XP6L 3S98A 5EO9A 4LLUA 4YIQB 2UZIL 5C0CA 4ZO6A 3JSSA 3ZO0A 2DYPA 3BISA 3HAEB 3KLHD 4LHUB 3DETD 4M5YL 2VDKH 5JLZB 2RFXA 1QBLL 1TJIL 4QOKB 3HMWL 5D4QA 4O4YH 3IETB 4WW2F 4XC3H 2A6KB 4OLEA 5BVJA 3VE0B 3RVUC 3AS1A 2DQJH 4HFWA 4YHPB 2VDKL 4BQ9A 4O4YL 1K8DA 4XRCA 5DVKA 1D5ZA 4G7VH 5CBEB 2R1YA 2DQJL 3VCLA 4TRPH 3VDAA 4LKXA 5GRWA 1EX0A 4GAJH 3DVGB 1JPST 2BNRD 5IJKA 2MCPH 5CUSL 4KFZC 4RRPG 5B4MC 3UZEA 4KMLB 2HLAA 4Y8DC 1TLKA 4PRIE 4K8RL 3E6FB 1R5WA 2P5WA 5LGHH 2CO6B 3CZFB 4PLNC 3MZGB 4U1HA 2CLRB 3IT8D 3LN4A 3MLYH 2VOTA 4M9PA 1KIUA 2UVFA 4M1CD 1A7OL 1QO3B 3QPXH 1NMCC 2IPTH 2KL6A 1CGTA 4NPYB 2FJGA 4BUGA 1DLFL 2GAZA 5LGHL 1MF2L 3TGXA 3OKDB 2FJHB 1KB9J 4P4RB 5E9DA 3TM6A 3RA7L 3V5KB 5LKNA 3L9RB 1R0AH 1SJVA 3F62A 3QPXL 1UVQB 5GRZA 3G6AB 1AO7B 3ILPB 3TN0D 4IOIA 5JXAL 1HQRB 4F3FA 2BNQA 1ZHNA 5B38G 4LEOB 1OSZA 1X5AA 3BPNB 1ZHBA 2EC8A 3VXRE 3OX8B 2VL4A 4NO0D 4PRHD 1DUZB 4JO2H 1NBZB 1TCRB 4MDJA 3N1GC 1BD2D 4EUPA 5DQDH 5DRXA 5T33H 3SE3A 4DGYL 3GRWL 2JB5H 3DGGA 4XB7A 4JO2L 3GMRB 5JUEH 2F19H 5E8NA 5F7EL 3ZKQD 5C2BH 5IMLB 3RRQA 1BFVH 1LE9A 5DQDL 4HD9A 4K55A 4KHXL 2EDYA 2Y36H 4N5EC 1G6RH 2F53E 3EOBA 3TIEB 1PG7H 3TVMA 1NCCH 1JE6A 1MCPL 3UBXG 1T4KB 5EO0B 1BFVL 1KCUH 2UUDK 3ZT7A 2Y6SC 3BW9A 4EI6B 1G6RL 1JGLH 2PCPA 4NCC1 1PG7L 4YHIB 1NCCL 1H3PH 4BELD 3Q0HA 2R4SL 4L4TD 4CVXB 3QDGA 1KCUL 5IVXA 3U7YL 4JFED 3WJLA 1Z9SA 2CIIA 1HYSD 1JGLL 1UB6B 3DNKA 3CAFA 1VEPA 3NVQA 3LN9A 2NY3D 2ZOKA 1XFPA 1IGJB 5EBGA 3AREA 1V3JA 4KK6D 5BMFH 3ESVF 4Z7OE 4P2RE 1Z9MA 1FVDB 3P11H 3DLQR 1XGRB 2NLJB 3FHQA 3LS5L 5BS0E 1BFOB 3QXWA 2DQTL 2C3XA 3TT3H 4K3JH 2KH2B 3GBNH 4XBGA 4M7JH 1F58H 5I1AA 2ZOLB 5TPWL 5BMFL 4J3XA 2BNUB 5T1KB 3P11L 3L5WB 4X4YA 5E5UB 4K3JL 1OLLA 1I8MA 5HGBB 3SY0B 1U8KA 2BSED 4WTXA 2FEDD 2W0FB 2Q7YB 1WBZB 1ADQH 4M7LH 1MI5A 4WUKH 5E5MA 4NKDB 3S97C 3PHQB 3TZVB 3X3GH 3KYAA 4M7LL 1FFPA 4MS8D 5CP7B 3VXNA 1AGEB 3D2UD 1U58B 3AFLA 5F9JA 2HT4D 4PJ7B 1UADC 5C0AD 3MRKB 3D9AH 5IBLD 4MSWB 2E3VA 5DMIH 2IBZY 3X3GL 3MRLA 2CK0H 4JRWA 3PHSA 2QHRH 1SEQH 2AW2A 5DK0B 1TITA 2ITCB 3ZTJH 4NQCA 1G1CA 5J9PB 1F4WL 3NIFF 1I1AD 3BT2H 5JDSA 2CK0L 3TO2B 1RZGB 2EIDA 4PPTA 2QHRL 1SEQL 5IEHB 1G7IB 4YFLF 1OB1B 4DK6A 4KK9D 1JZ8A 3BD3A 1P5VA 1NLDL 4NKOB 1U93B 1I1RA 1TENA 1TCMA 2Q86A 3O0RH 4LHUD 4D9QD 4QOKD 3T65B 2CDEA 5INCA 3O3DA 4LSVH 1SVZA 5C0ND 4M7ZB 3O0RL 5FYJE 3WLWC 1I7RA 1EVUA 4NSKA 3C60B 4YPJA 5DJ8A 4NBZB 4GQPH 2W0KA 1GOFA 3EDKA 3N85L 3RIFF 4Z5RA 2HJLB 1LO5B 4ZNCD 1NUFA 2IANE 4RWYL 2DM4A 3NMEA 1OPGH 3FQTB 2QKIB 3LKNA 2VXQH 3H0TA 2ARJB 4P5MA 5I73B 5D9SB 2ZSVB 3QA3A 1S7VB 4RDQG 3MNWA 1VPOH 1CFNB 4ODHH 3DMMC 3MGOA 2RCSL 5KJRH 4JM2A 3PL6C 3FN9A 2CDGB 2J8HA 4ZOBA 1A64A 3RVVD 5CBAA 2XN9B 2GK0A 1NEUA 3BE1H 4FABH 3VXSB 5KJRL 2YPKA 3U2SB 4PRAB 4WI9A 4PJHF 3I6GA 1AO7D 1GGTA 4G6AC 4JY4B 3AGVA 3C5JB 3UYPA 3VXME 2IG2H 3BE1L 5HGAB 3ZE2F 3DBXB 4PBVC 5ICZB 3OPZH 4TVPD 1TFHA 1GZPB 1JMXA 3SGJC 2IG2L 3QWOB 3MODH 2KZWA 5ESVA 1ZHLB 2E8YA 2VLKE 3TA3A 4XVTH 4HS8L 4WFGD 3IFPA 4TSAH 1TZHB 1LO2H 4HF5H 3PWJB 3MGTA 4OZGA 1JGEB 5GGRB 3O3EA 2BSRB 1UZ8A 4LLAA 4ZO9A 4L9LB 5HYIA 4XPFH 4XVTL 4WUUB 2FH8A 3CFIC 4M7KH 4HF5L 1LO2L 2YSSB 2DD8L 5DURB 1QACA 1S9VB 1J88A 3G5ZA 5IJVB 3T0VA 4NN6C 3MV9B 1I7TA 1YY8A 1FNFA 1T5WB 2A74A 2NXZB 1OF2A 1G0YR 4M7KL 2XA8H 5SWSE 3WDHA 2O61B 4U1SA 2V5YA 1J8HE 2I9LB 3P2TA 4MJ4A 3T4AB 5EZOL 1WFTA 3FB6B 5IEKA 5D7KD 1NAMB 2XA8L 1PGRB 2XIDA 4K23H 3RVUD 1HHIB 5CILL 3V6ZA 2J5LC 1X44A 5JOFB 3JWNC 5A2JH 1NBYA 1LHZA 4XBEL 4R4NC 3QEQB 1ZS8A 2YEZB 5F9OL 4KQ4H 3R0MA 3LSOB 3T0EE 5CINL 5FYLE 1IAKA 5LG1A 5DMKB 3PJSB 5E08L 1CLOH 25C8H 4CU6A 5EA0H 4JVWA 1DL7H 3FFCE 4NQSA 1H3UA 5T1KD 4KQ4L 5B4MD 3FT3A 3EDDA 1DBJH 4X5WA 4J1UB 3GSUB 4AQOA 4TVPL 2C1OB 3ARQA 2YA2A 1NBVH 1DL7L 4OFDA 5C1MB 3MV7B 3AM8C 32C2B 5HGHA 1CDGA 1F90H 2IFGA 3PL6B 1ZKAA 4DKFH 1TTUA 4HK3N 3FAXA 1NBVL 4XAKD 5GRJH 4X9HA 4BQ6A 3VFRB 1FNEA 4X83A 1MLCA 2PR4H 1B88A 2J8UB 3TZVD 2V7NB 1K8IA 5F72S 3FT2B 3BKYL 1ZTXL 3QUYA 3ZT5A 4JFXB 5H35B 1H5BC 4FFVC 4LMQI 1F3DH 4FQIL 1A6WL 3UAJC 4OD2A 1M6OB 4K71C 2H32B 4LL9A 1MVFA 1OAQL 1MCOL 2XWBA 3VWKA 2YWZA 1G7QA 4NM4L 4CKVX 1KCKA 1B9ZA 4GKNA 3TYFA 4XH2B 4AIXA 1T1XB 2QSCH 3IDXH 1KJMB 2H9GB 2P42B 2BVOB 1CICC 2IALB 4UT6L 3REWB 3VH8G 4NRXA 4HX1B 1WBYB 3CPLA 4NNPH 1NEZB 3BHBB 4UV4L 3WIIH 5EO9B 4LLUB 3ZHLA 1EO8H 4PBWD 4OIAA 5C0CB 2DLTA 3IDXL 2DYPB 1IM3A 2ZUXA 3KYOB 5D96C 1NFIA 3NPSC 2MHAA 2RFXB 1OWWA 1QRNE 4KKLD 4NN6B 4NNPL 1EO8L 5BVJB 1B0RA 3NACH 3WJLC 1HH6A 4QF1A 3IFOA 4HFWB 2Y6SD 3IU3A 2NY4C 3VFOB 1K8DB 3KHQA 1D5ZB 2R1YB 3NACL 3OMZA 3BDXA 4MNHA 3VCLB 3T08A 3WNLA 4LKXB 3WD5H 2LTQB 2R8SL 4DAGH 2J5LB 4PJBE 1YQVL 3KHOA 5DMYA 4TSCL 3MACH 1GVIA 4QT5A 2FH6A 2CKBH 3DX8B 4DAGL 3HR5A 2HLAB 5E6YA 3T04D 1QLRA 1R5WB 2P5WB 3IS0X 1HXYA 4G8GE 4U1HB 5A40E 2VLLA 3LMJH 2CKBL 3LN4B 3K8KA 1DFBH 2R9HD 2XN9D 5I6XC 1AE6L 1OAZH 1T7WA 2FJGB 2GAZB 3ZKNC 5C0RH 3VFWA 3FQUA 1PEWA 1KLGA 3S7GA 5E9DB 4MQXC 3FOMA 4F7EA 4MAUH 1CDIA 1HDMA 2X4OA 1B4RA 3I2CH 1OSPH 4RQQA 3UTTE 5C0RL 4QXTA 4IOIB 3EW3B 3X14A 4F3FB 1BQLH 2BNQB 1ZHNB 3V4UH 4KGLA 1OSZB 3SDCA 1ZHBB 4NZRH 1JPSH 5EWIH 1P84K 3B9EA 3NCMA 3DO3A 5KVFH 5FF6A 5D1XC 3G6JF 3B3IB 5J56B 4MDJB 2JJVA 4H25A 4XVSL 1BQLL 3V4UL 4EUPB 5JW4M 1V05A 1BVZA 5DRXB 1T5XA 4K71B 1ZGLM 4BH7A 1NCAL 4NZRL 3DGGB 3QJFA 1JPSL 3IF1A 2R29H 3EJJX 5KVFL 1M05A 1J05B 5E8NB 1V3KA 4BYHA 2GSIA 3P73A 1LE9B 5FYJU 2VDRL 1OQOA 3ULUF 3KR3H 3EOBB 3MUJA 4XNXH 3MV9D 3TVMB 1MH5A 3QUMA 3BOVA 1O5DT 2NXZD 2PTUA 4KROC 3W9EA 4TNVF 4NM8H 1G7PA 4YDKL 3KR3L 3BW9B 2X5PA 4WWID 4UI2A 2PCPB 1MEXH 4XNXL 5D7JA 5D93C 4FXKA 2B7DT 1KLUA 2AI0H 4NM8L 2ATKA 1FC1A 3QDGB 5IVXB 3W5NA 2CIIB 3U9UA 2ADIA 3HNVH 2E9JA 2ZOKB 3SBWA 3MRCA 5C92A 1CWVA 3QEQD 3LRHA 1IAIH 2JTDA 3AREB 4JQIL 1JV5A 3SCMC 3HNVL 4RMQA 2AV7A 3E1F1 3HE7A 4XBGB 4HJ0C 2OXHA 3H8NA 5I1AB 3ZDYF 4U6YA 5GS0D 3WO3B 1IZKA 4CW1A 4X4YB 3UPCA 4XWGL 2OTPA 5IWLA 1S78D 1I8MB 2HKHH 2XTLA 3EJYD 3DMMD 1A3QA 1TVHA 2EKSA 5EN2A 3C5ZC 4URTB 5FXCH 3PL6D 1MI5B 3MPCA 4ZXBA 1FIEA 3HRZA 2HKHL 5E5MB 1GH7A 3OKNA 4KDTA 1CXEA 4MCZA 4JFHE 1ROWA 5FDWA 4RRPA 4TNWK 4YZFE 4MLIA 3DPBA 1QSFA 1U8QA 1FFPB 2BY0A 4JHBA 4XNUH 3VXNB 4LRIA 3SJVE 4FFWD 3TA3C 5TDNA 5F9JB 1MFCH 3RNQA 1NCDH 3PWUB 3MRLB 1EIBA 1DQQA 1W0YT 2WAHA 2Z0BA 3JTTA 4PV8A 4WHCA 3BIAX 4J3SA 4GRWE 5D5ME 5IROA 2D7OA 4FQCL 3T1WA 4OLXH 1YYML 1NCDL 4DZBB 4NQCB 3QHZH 5JDSB 3DYOA 4LSSH 5J0BA 3WO4C 4HAGA 3GZKA 1MCKA 5C0CD 3EO9L 3BH9A 2VLRE 5HHOA 2DYPD 3ME0A 2Q86B 3UBXI 4WCYH 2CDEB 5INCB 3O3DB 4HLZG 4PGJA 2NX5A 4XP4H 1T22A 3W5MA 2VJXA 1I1CA 4KROB 1FLRL 2DS4A 2I9TA 5DHVA 3U36A 1I7RB 4WCYL 1ERNA 2YA1A 2R39A 4HIXL 1E4WH 2FLBT 4NSKB 5DHYA 2HN7A 5DJ8B 3O6KH 4DW2L 4JQVA 3AS2A 4MYWB 1KEGL 3QJHA 4XP4L 5D93B 5I1JH 5L88H 4Z5RB 4J6RH 3SO3C 3LKQA 1JUFA 1VACA 3RUGF 5DYOA 3V0VA 2P48B 5I1JL 5L88L 1U92A 4CGTA 3LKNB 3H0TB 4R4ND 3EKCA 4P5MB 1W8NA 4LVNC 4EDWL 2UYLA 3LKSA 3QIUC 2FECI 3MNWB 4OGZA 2E6QA 2P5WD 2WUBL 4R7NA 3MGOB 1CDJA 4FQ1H 2JCCA 3MUGA 4JM2B 4X8JA 1MWAH 1T3FA 5DEGA 5KVEH 1UWXK 4B50A 5T5FH 4NUGH 5DLMH 5CBAB 4OI9A 1V7ML 2GK0B 4FQ1L 1F13A 3JV6A 5E9DD 3RBGA 1FP5A 5GGRY 2YPKB 5KVEL 5T5FL 4RNRA 1IM9A 2AGJH 3ARWA 3I6GB 1EPFA 5DLML 3BKCH 1RZIA 4QTHA 4MJIA 3WNNA 1L6XA 3AUVA 4LIQH 2BNQD 1RIUH 2FGWH 2H1PL 3I6LD 4Y88A 2WIMA 2AGJL 4PGZA 4HXBH 2XA3A 1AGBA 4P3DA 4MVBC 4KMQA 3L1OL 5ESVB 4DOHB 3TA3B 4LIQL 4HDIA 1RZJL 1WK0A 4M48H 2FGWL 2DIAA 3IFPB 3NCJH 5DA0B 3MGTB 2BXYA 2Z8WC 2ZNWA 2EYRA 4OZGB 4MJ5A 5I1KL 3O3EB 1UZ8B 5FAAA 4UQ3A 4P2QB 4OQ1A 2VXUL 2D9CA 5IT2L 4FXGA 4CNIB 3QIBC 1K9TA 5I9QB 4W6YB 1YZZA 2NTFA 3G5ZB 3TVMD 4KGJA 5E24E 1I7TB 1YY8B 4O2EA 3BAEH 2A74B 5F9WC 2JELH 1OF2B 2VWEC 1OTTC 1E6OL 3FB5A 4TQEL 3HFMH 4U1SB 1A6VH 1HN1A 5DC0A 4KY1H 3S35H 5FB8A 5KW9H 1RI8A 4YH6A 4RGNE 2EH8H 5ALBH 4X0KA 2JELL 4Y2OA 5IEKB 3QDGD 1JHTA 3HFML 3GNMH 3V6ZB 4LPWA 1A6VL 1FYTA 1U91A 5HTSA 3NH7H 3ET9F 3DUUA 4KY1L 4ODTH 3S35L 2FD6L 4XAWH 5KW9L 1T0PB 4JO3H 2OR8A 5ALBL 4U6XA 1MQKH 4M6NH 3ARED 4P46A 3DI3B 1ZS8B 3GNML 4CDHA 3NH7L 2EH7L 1Q72L 2SEBA 3SO3B 1IAKB 3D69B 5EU6E 1MQKL 4ODWA 4OLZL 4NQSB 3GM0A 3FT3B 5C0BA 3VRLE 4JDVA 4X5WB 1IAII 3HPJB 5LXGH 4U2YA 5BXFA 2VKXA 5D2LF 2AERT 4FQXC 4LSUL 1OTSC 2UV3A 3WS6C 5ECJE 5HGHB 4I3SH 1FNGA 1IC4L 1MI5D 1UM5H 3FQRA 4AEFA 2CXGA 5L2JA 1DQMH 5BRZE 4OCNC 1FNEB 1MLCB 3SDCC 4YHML 1TETH 4MQXD 5IMOA 1UM5L 3MLXH 1FZMA 1KC5H 3QUYB 5C6PB 5F7UA 3EOTL 4EN3C 4JRYE 5D7IE 1WWAX 2H26A 4Y1AA 2AKRA 4L5FL 3Q1SH 1CDBA 5CKGA 4OD2B 1TETL 2WSKA 3BP7B 4O51A 3ZTNL 3QZWG 2GEEA 2XWBB 1TTFA 4Q2ZA 4RISH 3VWKB 4M93B 1D3CA 2WUCH 2X1WL 4GKNB 3B2VH 3JUYA 3L6FA 3Q1SL 3TYFB 5DTFA 2D31B 2Q8AH 3STLA 4HMCA 4NRXB 1ORSA 3SE9H 1TZGL 3CPLB 4HHAA 3ULVF 1U6AH 2WWKO 4NQDA 2E7CA 3LQZA 1IM3B 1AQKL 4Y2DA 4ALAH 3O6FA 1NFIB 2ZG3A 2MHAB 3K74B 2X9WA 5LWYH 1T0MB 1B0RB 4KROD 3DO7A 1ZWIA 1HH6B 5F9WB 4WHYG 4B53A 4QF1B 4H0GA 4JFZL 3IFOB 4ALAL 1AKJA 3IU3B 1TQCB 2E27L 3E3QE 1XIWA 3WJJA 5LWYL 4YC2C 3MREA 4XPBH 3WE6A 4IRSA 2VLJA 4LVHB 4MNHB 4P49A 2WM0A 2IWGA 2XQBL 3QDME 4U1MA 5EU7E 2EXWD 4QT5B 5LBSH 4RMRA 2MPAH 5IWLC 3HR5B 5A16A 1QLRB 2UWEE 4X4ME 2YD4A 2DMBA 3JBG7 4QRRA 1HXYB 2XWJB 1I85A 4HJ0D 4M1DH 1TVDA 2C4FU 3ARDA 2ADGA 4JM2D 5LBSL 2VLLB 3S37H 1WFNA 3N9GL 2P47B 2MPAL 2XQYK 4KDTC 4XC1L 3K2MC 2QEJA 1FAKT 4Q9RH 5DF0A 3OAUH 4M1DL 3VFWB 3S37L 3FQUB 3MA9H 1KLGB 2C26A 1N0XL 3FOMB 1HILB 4F7EB 1HDMB 2X4OB 4LRIC 1YEGH 3SDDA 4F7CB 2BK8A 5IR1A 4RQQB 1XGYL 3OAUL 3X14B 3MLRH 2YD8A 4FFYH 3MA9L 4DJMA 3CFKA 5FO9A 4U6VL 3SDCB 3Q5TA 1YEGL 4P57B 4KJPC 1F02I 4OKVA 4OZIE 5FF6B 3TA3D 3MLRL 3IJSB 4FFYL 4H25B 1EJOH 1T5XB 4JANB 4BH7B 1VADA 3QJFB 1F97A 1KYOJ 3IF1B 4P9HH 1HIML 4HLZH 4TTDC 1YNKH 1M05B 4JR9H 4UTBH 5F7LB 2DICA 3CLEH 4EBQH 2GSIB 3P73B 1AR2A 1EJOL 3WUZA 4OD3H 3GKWH 2GJ6E 1MH5B 3SDAA 1YNKL 3QUMB 2VDNL 2JJTA 4P3CL 4D0CA 3CLEL 3W9EB 1RZFH 4A2LA 1G7PB 1IAOA 2R0ZL 1A14H 5GZND 3QB7C 1QFHA 3BMWA 3HC0A 3FMGH 4OD3L 4JQVC 4YXHH 5D7JB 1YEHH 4FXKB 1U3YA 1IBGH 3BVNA 1KLUB 2ATKB 4OGAC 1LNUA 5EZIH 2NPLX 1A14L 5F7MC 3L5XH 2ADIB 5TFSH 2QSQA 3V6BR 3VH8A 2BC4A 5L8JB 3VRJB 4YXHL 1IGTA 1YEHL 1IBGL 3MRCB 3HNSL 4ODBD 4WGWB 4LSRH 4HFUL 1U36A 3V7MA 4YC2B 2O26U 5GISH 3EYUH 2IBBA 4KI1A 5EZIL 4NDMA 1M71A 3L5XL 2F54E 2FR4A 1PFCA 5DS8A 2AV7B 4Y5XA 3HE7B 5FGCE 4NQXA 2DQUL 3ZSSA 3TYGH 4C4KT 3RWCA 4PB0H 2AK4E 4XZUA 4KI5F 1PKQE 4CW1B 1KCVL 5J12B 2DF3A 2AV1A 1KN2H 5D2NA 2I07A 5FV2A 4X5XA 4LFHD 2YD3A 4HH9A 1MHCB 3HN3A 3GDBA 3SE8H 1TVHB 2EKSB 3ZE1E 5EN2B 4OT1H 1YECH 5T1LA 3BEVA 4DCQA 1B6UA 1GOGA 3IGAA 1YEFH 1KN2L 4ZXBB 3HRZB 3BIBX 3OKNB 4MCZB 1FORH 3SE8L 3TBSA 5AD0B 5KANG 2VRAA 4OT1L 5FDWB 1U3HA 2DJ4A 1GGCL 3QUYD 1YEFL 1A4KA 1QSFB 1U8QB 4WRLA 4YGVA 4W4OC 4PLKC 1U95A 5TDNB 4PRNA 3RNQB 4OGYL 5DD6A 2V2XA 2ADJA 4RA3A 1A6TA 1DQQB 3JTTB 4PV8B 1GPOH 3VWKD 2Q1EA 1XCQA 2B5IC 5IB3A 2ICWI 2AJYH 3TH3T 3CU7A 4GO6B 3QXUA 5TE6H 5AAWA 5DUML 1T89A 3F6LA 1GPOL 5E56A 3CX5J 1QSEA 5CZXC 4OFVA 3U4EA 1YPZE 2WBJA 1JNHA 2AJYL 1NPUA 2LV4A 3JV4A 3BH9B 5HHOB 3QIBD 4NO3B 1NANH 3MLUH 2WQ8A 2EICA 4ZPTA 4XPGL 4R9HA 3PHOA 1MOEA 2NX5B 4LCIH 1T22B 3CSBA 1KJ2A 4P23A 4Y19E 4IJ3C 2K1MA 2I9TB 3EYOA 5DHVB 3U36B 5DD5H 1YEJH 1N2RA 3QIWA 4N0FA 2JB6A 5DHYB 2HN7B 4FNLH 1S7UA 3DVFA 4P46C 3QJHB 2FO1A 1A7QH 1KFAH 1R5VA 2Y4SA 2EDEA 4RX4A 2VIRA 4ELME 1DQLL 1LO0L 3LKQB 1JUFB 3NIGE 1VACB 1YEJL 3OWEA 2HMIC 4ZTPH 3BD4A 5DYOB 2FX7H 3V0VB 1U92B 1A7QL 8CGTA 5FHBL 1XF1A 3HC4L 2EDLA 1A02N 1QYGH 1MQ8A 4JG1H 4ZTPL 3LKSB 4M4RA 4PJHA 1K3IA 1QR4A 2FX7L 4DKDC 2E9BA 4R7NB 4O9HH 2JCCB 3MUGB 4KK5C 2AEIT 4BFIA 4X8JB 1T3FB 5DEGB 1QYGL 1FN4A 1IC1A 5EOTB 4JG1L 3IRPX 1FE8H 1L4IA 2YOCA 5A2KH 4JHWH 1VKXA 4O9HL 1WEJH 1NAKH 2JJWA 3K7UA 1FH5L 3CLFH 4RNRB 3WFZA 1IM9B 2BNRE 1FE8L 1RZIB 4OF3A 3SGKA 3K2UL 4QTHB 5GS1C 4MJIB 4Y4KA 1RUPL 1AQDA 3SDCD 3U7WL 2XOTA 4J23A 5J1SC 4N8VA 1P5UA 4LDLB 4JPIA 3GHEL 1AGBB 4P3DB 4WW2C 4X5LA 4HDIB 1NGPH 5GZOD 2L0DA 4HWBA 1UCBH 5D6CA 3PWNA 5I2IA 4QWWC 4MJ5B 4APQC 4X6EA 3M17A 3SDXF 4FXGB 4PJDF 1NGPL 5HDQH 5FKPA 3KYNA 1GIGL 4AG4L 3TLRA 2NTFB 4XMLL 5F88A 1JTOA 3CGTA 4XP1H 2H8PA 4LGRB 1FO0A 4O2EB 3EO1A 4PR5A 2PNDA 3S4SG 5HDQL 2WK2A 3Q3GA 4YDVA 1XR9A 3ARZA 3IXTA 2VITA 4MA7H 4PRHE 2VE6A 5FB8B 1NKRA 1AD0A 5D7JD 2DQGH 1JNLL 3RIFK 1FL3A 4ETYA 3W11C 4KKBC 1FFQA 2XKSA 1BD2E 5JQ6H 2DQIH 4X0KB 1JHTB 3GI9H 4E0RA 1AHWA 1ETZA 1FYTB 1U91B 3ELAT 2D4FA 4IJ3B 3MRFA 3DUUB 4YK4C 4MA7L 3CX2A 2DQGL 4IRJA 2Y07H 5I1CL 4GXUM 1S9YA 3CXDH 4TUJA 2DQIL 4U6XB 1EGJH 4JGUA 3NCFB 3O3AA 4PJIE 4JGMA 2XKUA 2AJSH 2SEBB 5K9JH 4NCDA 1VHPA 3HE7D 3CXDL 1I85C 4H1LG 1A2YA 4ODWB 2D7NA 5EORH 5C0BB 3X13A 4JDVB 2AJSL 1JZ5A 12E8H 4WENB 2FL5A 5BXFB 4X9FA 1S7SA 4L4TE 4G9FA 2PYEA 1BF8A 4JFEE 2OLDA 2C7UA 5EORL 3RVTD 3QH3A 1FNGB 3NA9H 3FQRB 4LK4A 5L2JB 4ZXBD 2VISA 4NHCH 1W72A 4ODUA 3LPGA 1HNFA 2XRAL 5F8RC 5DJ6A 1P53A 1W0VA 4A2MA 5IMOB 1QSFD 1FZMB 1DTUA 2E7LC 1SHMA 2H26B 4Y1AB 1C5BH 2AKRB 3QUML 4K7PX 4O51B 4HWEL 4WO4C 4MXVF 3IFLH 4L8CA 4Q2ZB 1QTYT 2G9HA 1MLBA 5DGRA 5TF1H 3VFPA 3A6BH 4Y4FC 3QQ9C 5T3ZD 5DTFB 3EBAA 3MO1A 3STLB 2O5ZL 1V7NH 1ORSB 5TF1L 4HHAB 5LCVH 1QKZH 15C8H 5HHOD 4NQDB 2VZUA 3LQZB 3V5DA 4Y2DB 4D94A 3AB0C 3O6FB 1R3KA 5ESAA 1WICA 4PJCA 2NX5D 1PW3A 3BJ91 4M3JA 4YBQD 5C0AE 3V6FA 3OB8A 1QKZL 15C8L 5E4EB 3DO7B 1ZWIB 5EZLA 1LEIA 4TN9A 4LCCA 1AKJB 3SDYH 5ID1A 2ZKHH 4P99A 4PJEF 4OCXL 1XIWB 4G6MH 3MREB 1NANI 3WE6B 4S1QL 1BFSA 4IRSB 1CFVH 2VLJB 4M3KB 3SQBA 1OTUD 1AD9A 2FNBA 5CLWA 4FMFA 3SDYL 4QHLA 4Y5XC 1QFOA 3F58H 2ZKHL 4U1MB 2BERA 3K81A 4HCRA 5ILTL 4D9QE 4A6YA 2YN5A 5CGTA 2R23A 4QOKE 3QCTL 5E7BA 5A16B 3VG9C 1INEH 5KTEL 3VRIB 4QRRB 5FO8A 3ARDB 1C1EH 1T80A 1WZ1H 1F6FB 5EU5A 3RVWC 4PJXE 2A9MH 5HHPA 3G6JA 4J3WA 2GJZA 5H8DA 1BQSA 4G3YL 1IM9D 4XPHH 1WZ1L 3SDDB 3UDWA 3WXVH 4MJID 5IR1B 5IESH 3C6LA 1FPTL 5CEYA 3MOBH 2VN4A 3CFKB 1UJTA 5FO9B 2X44D 3IDGA 2D0GA 4OKVB 4JREC 5C07A 4XPAL 5DVMA 1I8LC 3CSGA 3MOBL 4KRPB 4OCRH 2C3WA 3CFJA 3VXTA 2CPCA 3SE4C 1VADB 4IMKA 4ZNEE 3OXSA 3X17A 3O2WL 4OCRL 4OZHE 1HSBA 3RWHA 2HT2D 1T2QH 1A4JA 3C08H 3VW3H 3DROA 2V6HA 5IBUG 3SDAB 4HQQL 2AP2A 3VXOA 5CZXD 1EAJA 2VQ1A 4ZTOH 4P23C 1IGFH 4D0CB 2DJUA 2DLHA 4TVPE 1VFAA 3T0EC 1IAOB 1MREH 1T2QL 3HC0B 1FGNH 3C08L 3VW3L 5DMJB 2A83A 4DTGH 1MCEA 1YDPA 2BCKA 4R26L 3BVNB 4X6DF 1IAIM 4WFGE 2DKSA 4AEHL 4N1CA 1LNUB 4DFHA 3RWEA 1FYTD 4XI5C 3R8BB 3R8QA 5BZDA 1K85A 3OB0H 1OAUL 4O58H 2ZCLL 5E00A 3VH8B 2BC4B 3LQAC 1IGTB 4DTGL 1AXTL 1PLGH 4P46D 3NTCL 5JIHA 4XCFL 2YRZA 4ZODA 5SX5K 1OW0A 3VDCA 3WSQH 1M71B 2FR4B 4O58L 4FQQA 5DS8B 1E6JH 4Y5XB 2XZQL 4NQXB 5HI3C 5C0FA 2APBA 1N6QL 2PUQT 4IOFD 3T8XA 3RWCB 3IDYC 5C0BD 4XZUB 1U3ZA 4JFFA 4L8SC 2AV1B 5D2NB 2D03L 2AEWA 1X9QA 4X5XB 2OMBA 4HH9B 5D7KE 3T4YA 3OGCB 3EYQD 4DGIH 5FFLA 3ZDZF 1WZKA 4KK5D 5T1LB 1AP2A 3BEVB 5TE7H 5FHAL 4DCQB 3IGAB 3ZKXB 4Y4KC 4RCAA 4P59L 4UOJA 1J18A 3TBSB 4DGIL 1U3HB 5C86A 1ZT4A 2D7TH 4RMUA 1OAYL 2Q76A 2OTWA 1UH4A 1A4KB 4OBSA 4FRWA 4YGVB 1X5IA 2EEDA 2VO5A 4Y1AD 1U95B 2EDNA 4PRNB 2XZZA 1U8IA 2D7TL 4E9LA 1N8ZA 1YEEH 2V2XB 1OOAA 2ADJB 4HC1H 1ACYH 1A6TB 4PGEA 1XCQB 5DXWA 1FL5A 1CTNA 5IB3B 5DJXA 4JREB 3HUJF 4ODVH 4Y5VC 1YEEL 3NZ8A 2O5YH 2WBKA 4HC1L 1ACYL 2E9IA 2YRLA 5FGBA 4X80H 4QXGH 4TNVK 4XAKE 1QSEB 3U4EB 1X4XA 2WBJB 4QWWD 4XWOC 4X98A 3ZT6A 1JNHB 4GRWF 2DBJA 1QOKA 2C4XA 3JV4B 4NQDD 3GFUA 4ODVL 4Y2DD 2O5YL 5DJAA 4XXCC 3O6FD 3TV3H 1A1NA 4QXGL 4ZPTB 2DTSA 5BOZG 1A7BA 2A73A 3RUGA 1UYWL 3LOWA 3PHOB 4QCIA 4KKAD 1KJ2B 3W82A 4P23B 2HJFA 1IL1A 2HTLC 3OAZH 1BJMA 4MXWH 4C57C 1AKJD 2ZP0T 3EYOB 3H9SA 4M8QA 3VFTA 2EE9A 4RFNC 2VXTL 1N2RB 3RBSA 3QIWB 4N0FB 2JB6B 1S7UB 3S3PA 4H1LH 4X7TA 3W11D 2OK0L 2DQEH 5MHSE 4IRSD 1R5VB 4MXWL 3V2AR 2VIRB 4BFGA 1Z9LA 3WDJA 3T0XA 4JY6A 4GAYA 4LSPH 4ZO8A 2XI9A 1UKSA 5EU3A 4MMXC 4GH7B 2DQEL 2R0LL 2YR3A 4IOSD 4LLYA 3GJFK 2OQJA 3QXAA 5DJYA 1NMBH 3K1DA 5E8DH 1UG9A 4I8DA 4PJHB 4QRRD 3ARDD 4KJYA 4BSVA 1YEDA 1DBKH 3OKMA 2X09A 3CFEA 1FN4B 4QHKJ 3FKUS 3CJJA 1WZMA 3ZYJA 2ESVA 4N8CL 1FZOA 1VKXB 2DIBA 3T3PE 5E5RB 3VG0L 2OL3H 4CMHC 3L5JA 5KANI 3SDDD 5GPRA 4F7MA 1JL8A 4Y4KB 1AQDB 1FAIL 1T20A 1U0QA 5FK9A 1F3JA 2EIEA 5JHDA 1QFWH 2OL3L 2QQKL 5FV1L 5IB4A 2YKLH 4N8VB 4JPIB 5JMOC 3MJ8A 2F58H 3BN9D 1MHEA 1MFAH 4KRPD 3UTQA 3X11A 1QFWL 5HHQA 2J8OA 2YKLL 5M94B 2XN9E 3VFMB 5D6CB 3RZCA 4UV7L 4HW6A 3PWNB 1KCRH 5I2IB 4X6EB 4MJ2A 3HZKA 2HFTA 3ARTA 3M17B 1MCQA 2YPVH 1KJ3L 4Y4FD 5FKPB 3KYNB 2G5RA 3QQ9D 1C5DA 4JO1H 2ZWLT 4BZ2H 3QI9A 3SDAD 5F88B 4ZUWA 5F6HJ 2H8PB 3LKRA 1RFDL 1FO0B 3EO1B 2YPVL 4PR5B 5KVDH 1OARH 4J8RA 3Q3GB 4YDVB 1XR9B 2EDTA 2XZAH 3IXTB 2W0LA 1J5OL 2VITB 1LDSA 2VE6B 3U0TA 3QFJA 1IMHC 4KHTH 4NC1C 1FL3B 2EXYC 4RMWA 3F7PC 5GGTA 1OARL 4E0RB 1AHWB 1ETZB 4QNPE 4NNYA 2XZAL 3MRFB 3ZHKA 2RHEA 1MRCH 4F57H 4I18C 4IRJB 3O45A 4KVNH 4EI5A 4IIQC 4TUJB 3O9WA 4FS0A 2IAMB 3KYKH 5DQ9A 3O3AB 5IIEA 3T2PA 3HZVA 1MRCL 3DXAA 4F57L 1KBGL 4GRLA 3GSRB 1G7JA 5FM4A 3RDTA 4HULB 1UKQA 1A2YB 3KYKL 4YNYA 3VI4E 1MVUA 1CVSC 1X5FA 3CVHH 2FL5B 3B4NA 1S7SB 3H9YA 1NCWH 2VLMD 4G9FB 2PYEB 3MNZA 5JW5A 5T1LD 2C7UB 3QH3B 4XNZB 1CXFA 1I7UA 3UDWC 5FYJH 5CJ5A 4X9IA 3QEQE 2VISB 1W72B 2OR7A 4ODUB 1U3HD 2V5TA 5DJ6B 2F9BT 5E2VL 4XVJL 1W0VB 3K3QA 3T2NH 5E94A 1WLHA 4CMHB 3P77A 5D7LA 1RIVH 5JW4R 4Z8FH 2N1KA 3WKMH 4NHUA 3T2NL 1WZLA 2V2TA 1LMKA 2EE2A 4L8CB 2G9HB 1MCJA 1MLBB 3ZLQC 3NZHH 3DHJA 3QP3A 4NN5B 4X6BA 3VFPB 5KS9F 3OQ3B 3PGDA 4MDIA 4NCC2 4WDIA 4WWKA 3WKML 4G8FA 3MO1B 1NCUA 4UILH 1QSED 2AQ3A 1KCLA 2WBJD 3NZHL 2B0SL 4I0PC 3ARUA 3QCUL 4U4BA 2I5YH 2J8UE 4UAOB 5C0GA 3GMLA 3V5DB 5CP3A 4UILL 3NFSL 1IILE 1R3KB 3VFGL 5I1GH 5ESAB 3VFVA 5K59F 4PJCB 3BESR 4FFZH 3CH1A 2G60H 1A8JH 3QBTB 3V6FB 2I5YL 4P23D 5J7CC 5EZLB 2DQCH 3C2AH 1V8HA 2ZZUT 2J3SA 2KQMA 1LEIB 1KENL 2FCBA 3F65A 1JYNA 4KH2A 4LCCB 4QGTA 5BV7B 3QIWD 5ID1B 5MEOA 2F5BH 5I1GL 4I4WA 4HKBA 4NBYB 1EUUA 3PP4H 4FFZL 2O93L 2DQCL 2G2RA 1K4DA 3ROOA 4RX4D 5A2LH 1UWGL 4OZFA 1AD9B 1F2QA 3SGEH 1LQSR 2CGRH 2F5BL 3MRNA 1P6AB 5C0CE 1EXUA 4PFEA 3QR2A 5JO5A 4FQJH 4A6YB 4U1GC 2R23B 4GXVL 3HKFA 1U8NA 2J6EA 4LIQE 4UDUB 2E8ZA 4LPXA 2X9YA 4PY8J 3BPLC 3U79A 4EOWL 2E7MA 5CJQL 5FO8B 1YYLL 3ARXA 4FQJL 5F7HA 4HKXA 5CD5C 4WIQA 5B39G 1LP9F 4E42A 1HK6A 3F7YA 5EU5B 3UJJH 1CE1H 5C09A 2P46B 5HHPB 3TF7C 3LS4L 4IS6A 4EVNB 5KAQG 2GJZB 1NGYA 4UMGA 4UNVA 4GSDH 3UJJL 4Y4KD 1ZGLP 3C6LB 2AJXL 3RKPA 5CEYB 3TH2T 2ORBH 1WBXA 1TTGA 3IDJA 4TPRH 2ZPKH 3UTSE 5HVHC 1EEZA 5FYLH 3RNKA 2VZ3A 3CFJB 1CGVA 1DR9A 3VXTB 4JKPH 2XYCA 1J87A 4TPRL 3GBMH 4RGNC 3GSNH 2F53A 1AI1H 3OXSB 5E9DE 2R1XA 4K2UH 4GMSH 3FO2A 1HSBB 3JWDC 5F93C 1R6VA 4Z0XA 4YBLB 4DQOH 1XF3A 1IC7H 1A4JB 3NBNA 3DROB 3TC9A 1AI1L 2VQ1B 2BNQE 1J12A 1BF2A 4K2UL 4GMSL 1VFAB 3LQAL 3I6LE 4OIBA 1UJ3A 3B8YA 3MYZA 2BFVL 3DVIA 4DQOL 1EV2E 4WV1C 2A83B 5CSGA 2BCKB 3ZMRA 3CNKA 2XNAA 3BJLA 5BZDB 1FNLA 5E00B 1YY9D 3IB4A 2VDMH 3GJFB 2R2HA 2WV3A 1UEMA 3QISA 4OQTA 1L6ZA 5CIPH 2Y7QA 4PUBH 3OJDA 4ZS7H 3BZEA 4POUB 5HYJB 2F5AH 4OJFH 2J4WH 2EC9T 4FQQB 5LQBL 2ILLA 5C0FB 4PUBL 3MGAA 1E28A 1RY7B 3CCHA 3MLTA 5E2UL 4ZS7L 3T8XB 4M4PA 2J4WL 4JFFB 7FABL 2B1AL 3S36L 1IGCL 5FEBA 2YPLD 2Z93A 5DI8A 4G9FD 3STZA 2PYED 1Q9WA 3T4YB 2OP4L 5IVXE 3ARFB 5C71A 1AP2B 4F15C 3QDAA 3P4LA 5D1ZA 4HZLA 2X41A 1T7XA 5KSVA 5DA4A 3N0PB 1GAFH 2FATH 2QLVB 4ZO7A 1ZT4B 4MGXA 3DTXA 5FOJA 1S7XA 2Q76B 2OTWB 1HZHL 1F45A 4JKLA 5DGQA 2H45A 5HHXH 5L0QC 1GAFL 1B4JH 1FO0L 3VD9A 1U8IB 3RZCC 3BRFA 1N8ZB 2YD7A 3D18A 3NAAH 4NRYA 4ODSL 3WS3A 1EBAA 4PS4H 1FL5B 3MJGX 3W0WA 5DJXB 4HUKB 3HE6A 1BAFH 1MI5E 3NZ8B 1JZ6A 1SJEA 4HMEA 3NAAL 3HTLX 3E3QC 4MA1C 4PS4L 4L3EA 2IQ9H 2E6JA 4X98B 3T0BA 4NKIH 4LGPB 5IHBA 5GGVY 1UQSA 1C7TA 4MQSB 4MXQD 1EFXA 3A67H 1I9JH 5EC1B 5DJAB 2GCYA 3OSKA 5GRXG 1M7XA 2IBGA 1A1NB 3RUGB 5FA4A 3NCBB 4QCIB 3PG2A 1A3RL 2HJFB 1IL1B 2BY3A 3O8XA 3VFTB 3H9SB 4M8QB 5GRUH 2B4CC 4JFDE 5I0ZA 3LB6C 1DQDH 5CWSA 5JXEA 3O9WC 2X1QA 1SEBA 3W2DL 2VERN 4S2SA 1MNUH 1CK0H 4X7TB 2WP3O 1UA6L 3OJVC 2BVEA 1AC0A 2PW2A 1ZSDA 4F9PC 4AMKH 4KZEH 3U30B 5KSBF 3RFZC 4WU5A 4ZSOE 5KG9A 1DQDL 4GAYB 4JY6B 3MRMA 3FAWA 5EU3B 5IHUL 1SMAA 1CK0L 5EUOE 4OKDA 2JKXA 4LLYB 4U1LB 2OQJB 1W72L 3QXAB 4AMKL 1OGTA 2GKIA 3ROLA 4LCUA 1IC5H 5DJYB 3VGFA 3V79C 2FB4H 2XKNA 4KAQH 4LPVA 1N4XL 2BRRL 3KPSA 1Z6JT 1F3DJ 4KJYB 4RGMB 4OI7A 5CCKH 4BSVB 1YEDB 3OKMB 5FYKD 3ECBA 2GYSA 3CFEB 4DVRH 4ORGA 2J12B 2IADA 2ESVB 5IW6B 1FZOB 1LDPL 2V5SA 1U8JA 4Y5YC 2FJFA 4ELKA 3TESA 4DVRL 3QDHA 3OZ9L 4LKCA 3IJHA 2A6DA 1NL0H 2D7PA 4F7MB 4ZQKA 3C6LD 1JGUL 1NC4A 1T20B 3MLSH 3V8OA 3SDXA 3LRSA 5FK9B 1F3JB 4IDJH 5JHDB 4PJDA 1JFQL 4OLWH 3ZZ1A 3ULUD 2W0PA 2M2DA 3MJ8B 1K2DA 1FBIH 1NL0L 1MHEB 5C07D 3KJ6H 1S8DA 3MCKA 4UT7H 1LILA 4WWKC 3BDBA 4QYOA 1EO7A 3UTQB 1ZA6A 4RBPH 5DMGC 3X11B 1VESA 3GIVB 5HHQB 1D6VH 3RZCB 3DUHA 1JZ7A 3HZKB 4CN6A 1OP5H 5MP6H 4UT7L 3W9DB 1Z9OA 2DM7A 2FDBP 5DFTA 3L3DA 2EO9A 4GKZA 5EIQA 1C5DB 3NIDF 1ZANH 3QI9B 1DJSA 3FOLA 4UZGA 4A6YH 2OM5A 4ZUWB 5EOQH 1BVKB 4OSUH 3LKRB 3JTSA 3N06B 1MJ8H 2F15A 4OUOA 4I0PD 1IKFL 4U7KA 2XT1B 4J8RB 2CD0A 1ZANL 4A6YL 3U0TB 3QFJB 5EOQL 4GQ9H 4OSUL 2DM3A 1MJ8L 3U0WH 4R8WH 1CFSA 5JLZA 3D85A 1JVKA 4OZGE 4NNYB 5E2TH 4GQ9L 3BPOC 3O45B 4EI5B 3O9WB 1EEQA 5DQ9B 5IIEB 3NFPA 5E2TL 3P9MA 4ODXA 3FFCA 2NY1C 4AK1A 3OAYH 3DXAB 3ARGC 4QRUA 4GRLB 1ZA3A 1G7JB 1T7VA 3RDTB 3I6KA 1TJGL 2YMXL 4YNYB 3C9NA 4ISVA 4NO5A 5A3ID 3FB8A 4DK3A 4LQFH 4JFFD 5DWUH 1MVUB 3OKYA 3V4VH 3ZHDA 4LNRA 3ULUL 2CLVA 5DDHA 4UBDC 3ARYA 5JW5B 4LQFL 5DWUL 4G6JL 5CD5D 2NR6C 3V4VL 1I7UB 1NMAH 1JPFA 4LVOB 2CLRA 2ZCHH 3HMXA 3RPIA 5FUOL 5F96H 2OS7A 2DI7A 3CVIH 1WJ3A 4HXAH 5E94B 4P4KC 3P77B 2BHZA 5D7LB 4HUUA 3P4NA 1MIEH 5E2JA 4M9OA 5JNYA 5ELIA 5F96L 4LCWA 1F00I 4NHUB 4JFYA 2QSTA 4HXAL 2V2TB 1JPTH 4KXZH 5EBLB 1MIEL 1Z3GH 4PJ8A 4X6BB 1ZAGA 3PGDB 4MDIB 4WDIB 2V9TA 3HI1B 4N9OB 1IEBA 4G8FB 4Y8AA 4JEGB 5FOBA 1JPTL 1ZT1A 3AS3A 1KOAA 4I77L 2H41A 1CYGA 2AQ2A 4PJEA 5BZWA 1QRNA 1NGZA 1RZ7H 5C0GB 1UXSB 4PRPE 4HGMA 4PJGF 3QSKB 5L8KB 2NCMA 3RWJA 1FG9C 3F6IA 1IKNC 3VFVB 1CGSH 5JR1H 3CH1B 3MRRA 5GGQH 3DETC 2Q6WA 4RFOL 3H9SD 4KI5C 5JQHC 2FX8H 4YHKH 1BBJA 5CGYD 5MEOB 1A7RH 4I4WB 4HKBB 5E8EA 5JR1L 1A0QH 2G2RB 1K4DB 3ROOB 1H3TA 4DN4L 4OZFB 2FX8L 4XHJC 4G7YL 1A7RL 3MRNB 4XPTH 1EXUB 1A0QL 4JZOA 5JO5B 5D1QA 1PQZA 4LPTA 1U8NB 5DJDA 1NBQA 4PLJD 1TQBC 2NY1B 3CZJA 2EDHA 3FRPA 5I74C 5I1IH 5I18H 1KELL 2VWEE 5DEFA 3CFCL 4HKXB 3RAJH 4PD4J 1CT8A 4M00A 5LGKA 3MRBA 5D1ZC 4E42B 1MCHA 1NFDF 3F7YB 2ED9A 2WZPD 3IDMA 3HA0A 2ESVD 1GL4B 2JJSA 5C09B 3V6OA 4NJAL 4M1CC 5F70A 3GHBH 1GXEA 4IS6B 3UTTA 3SO5A 4NRZB 4YXKH 1D7FA 4PTUA 1NGYB 4HBCH 3SY0A 3TCLA 4KV5E 1ONQA 3LKOA 4NGHH 3GHBL 5JHDD 1BVLA 3MLWL 3QEGL 1D9KA 4NP4H 3TN0C 4CU7A 1P9MA 1WBXB 1J0IA 2EDBA 4NKDA 3IDJB 3PHQA 4HV8A 3JWDL 3UJIH 1EEZB 4XXDA 3HE6C 4NGHL 5JW3L 3PNWA 5CP7A 1JRHH 4OM0H 4BKLA 4NP4L 4MB4A 2OI9C 4DUVA 3RZCD 3S8WA 4GKSA 5ADOH 3GMMB 4WI8A 1KYOK 2ZUTA 3UJIL 2P4AB 2F53B 2EDOA 3TIDA 5I76A 2R1XB 4UU9B 5IGXL 3FO2B 4X6DA 4F58H 1HH9A 1CI5A 4PBXA 4Z0XB 3QI9D 4WEUD 1XF3B 5DK0A 5ADOL 4MD4A 4W6WB 5A2IH 1DDHA 2ITCA 4L1DA 4U0RB 1A22B 3DRTA 4IDLA 1WAAE 5CKAA 5KVMC 3K46A 4P2OA 3BQUA 1UJ3B 3KDMA 3ARBA 5IEHA 3QFJD 2BVPA 1U2CA 3GSWA 3RJDA 1DSFH 2EEAA 4DKEH 2JJUA 1CR9H 2XNAB 1KPUA 1R3JA 4Z0BH 1EUTA 2AEQL 3TP4A 3V52H 35C8H 2R15A 1INDL 2R2HB 4EI5D 5FIEA 3O9WD 5J3HC 1DSFL 2Y7QB 4UUJB 3GJEA 5J13C 5BS0B 3OJDB 1CR9L 3BZEB 3ETBF 3C60A 1FYHB 2NY3C 3D3VA 3V52L 3DXAD 35C8L 3GSQA 4GRLD 3ZE0E 4JDZA 4WFED 1R3LB 3RDTD 4N0YL 5ADPH 4I2XA 2IQAA 1E28B 3CCHB 3MLTB 2BSTA 1SBBA 1T66C 2BY1A 4MA8H 1A7NH 5HD8D 1I9RL 2Z93B 4MAYA 1TQBB 5DI8B 3STZB 2QTEA 1SBSL 3I3DA 5DR5L 1DANT 1FVEA 3TJHD 5AG9A 1A7NL 1OAXL 1F5WA 3FN0L 5D1ZB 2ICES 1FZKA 4HZLB 3H9HA 3TPUA 5KSVB 5FA3A 2FEDC 5I66A 5ANMA 2HVKA 4XMKL 3HUJA 5F7DA 3DTXB 1CL7H 4NJ9L 1S7XB 1ZLSL 4D3CH 4DFIA 4M62L 2HG5A 5D7LD 5KN5A 4Q9QH 3O11A 3I02A 4B5EA 3V9FA 4QXUL 3ULVD 3ZKSD 4JY4A 4YDLB 3D18B 4NRYB 2HT4C 1E27A 4YUEL 3WS3B 4Q9QL 5IBLC 4N0RA 4V1DA 1WIOA 3W0WB 1JHLL 2B4CH 4OTXH 4WWKD 1OWRM 3S34H 2P24A 3HE6B 5B8CC 2R0WH 5DMGD 1A7PH 4JVUA 1SJEB 5GGTL 4EJ1C 1CIDA 5ITFA 2VLRA 1KIRA 3E2HC 3CX5K 3RGHA 4L3EB 2BRQA 3RY6C 1I1AC 1U42A 2B4CL 1OGAA 1UQSB 4KXZI 2R0WL 3KPOB 5D70H 1EO5A 1ZVYA 4PG2A 1EFXB 2MFNA 5F89A 2DQDH 2XICA 1WT5A 5GGRA 2BSRA 2NY6C 2GCYB 4GRMA 3M8OH 4KK9C 4L9LA 4PJFF 5FA4B 5CAYB 4J3VA 4GFTB 5TGBA 5CZKA 3O8XB 2DQDL 4G5ZL 2VL5A 5I71B 4YHLH 5IW1A 1EEYA 2HP4A 4Q7DA 5C0NC 5CWSB 5CEXB 3EYVA 1SEBB 4S2SB 3QDJA 3DX6A 2IANB 4D2NA 2PW2B 5CJOL 1VGEL 1ZSDB 4G8IA 3EOAA 4YHLL 4WU5B 4Z7QE 3FB6A 3MRMB 3MROA 1UM6H 4M6MH 3O6LL 5HHOE 5C0EA 1RIHH 4TOYH 5J13B 5JOFA 1OGTB 3ROLB 4LCUB 4CVWA 5FECA 3BWAA 2XKNB 1S9XA 1I7ZA 2NY1D 2L7JA 2NX5E 4ORZC 3PQYA 1P69B 3KPSB 1DP0A 1P1ZA 4TOYL 4ONOA 1PVHA 3PDOA 5K9QG 3ECBB 4U3CA 9CGTA 4YDIH 1L9MA 4ORGB 1DBBH 4L9DA 1VFMA 5C09D 2IADB 3U4AA 1X5HA 1U8JB 1QFWM 4UBDD 1ZGLA 1ZT7A 2FJFB 4ELKB 2PF6A 4LKCB 4O2FA 1N64L 3IYLW 3IJHB 2A6DB 4ZQKB 4AQ1B 3MV7A 4DKAA 1NC4B 4M61A 3SDXB 1CXIA 3LRSB 2WP3T 4PJDB 4WU7A 3CSYA 3UC0L 1BJ8A 3OKKA 1K2DB 3ZL4L 1FZJA 5KZCB 1S8DB 2FBJH 2JCCE 3MCKB 4JKMA 3BPNC 4X9BA 3HI6L 4QYOB 1ZA6B 3BUYA 3P0VL 2FEEL 2HT3D 1EMTH 3AXLA 5EUKA 3H7BA 3ZYOA 5GJSH 2F53D 4K94L 2H32A 5AZEH 1E4XL 3RGVA 4GKZB 1SJHB 4GBXA 1EMTL 5TH2A 3HAEG 3FOLB 4LHUG 1FLTX 5I30L 1RURH 1JRHI 3JTSB 1Q0XH 2MJWA 2UZIH 5IV2A 4XH2A 2R2EA 4WHDA 3WXWH 5AZEL 4RDQF 3RIAK 1H0DA 4M5YH 1KB5H 1TJIH 3HMWH 4S11A 3BP4A 1UH2A 2NY6B 1RURL 1Q0XL 4EQ3A 2J6EL 4LPYA 3WXWL 1C8PA 3KYOA 3GBLA 3LDBB 1CFSB 1E4KA 4R96A 1KB5L 3D85B 3HC3H 4Z7NF 4S1RL 4LAJH 4KI5D 1DBAH 3ZSTA 1MJUL 1NFKA 4OZ4A 1ODAA 5D1QC 4NC2B 4K7PL 4LLVB 3HC3L 3NFPB 1VERA 3BP6A 4KRNA 3VFOA 3P9MB 4ODXB 3FFCB 5CUSH 4XHJD 1DBAL 1LWRA 4JG0L 4GS7B 4QRUB 5FM5M 1ZA3B 4C83A 3I6KB 2WANA 3C9NB 4ISVB 2OR9H 4ONFH 4BZ1H 1NSNL 4NO5B 2VTFA 3FB8B 4I5BA 5B3JE 3S3JA 4K8RH 1YQ2A 4F9LA 3KS0H 1CBVL 4FN0A 1BM3H 4UTAL 2OYPA 3V6OC 4LNRB 4S10A 4B0MM 5MENA 2CLVB 1U9KA 4JKWA 1FYTE 2OR9L 5DDHB 4ONFL 3DX8A 4BZ1L 3T1FA 1A7OH 3WFDL 1Q8MA 1BM3L 1P6FA 1DLFH 1MF2H 5D1ZD 1JPFB 3FRUA 3RA7H 4JRYA 5D7IA 1PKOA 5TDOA 3RPIB 5KS9A 1P9MC 5CJBA 5HYSA 3MFFA 3WNPA 3BPCA 1WQVT 5JXAH 3VXUA 3UCRA 4HUUB 3P4NB 5GSVA 3TZVC 5JNYB 3MC0A 4WFFD 5C0BE 3P0GB 1YC8A 1VA9A 4LCWB 4JFYB 4LDEB 3VMPA 3W0WD 4PJ8B 2VXSH 4YEEA 1CL7I 4ZFGL 1NGXA 3HE6D 3S9DB 4OQTH 2CRMA 4DGYH 3GRWH 1IEBB 1MRFL 3PGCA 4FG6D 3UX9B 5FOBB 1ZT1B 2B2XH 4PB9L 3B3IA 1FGVL 1S7TA 4L3ED 5F7EH 2VXSL 3ALPA 3BQUC 2DLGA 3MA7A 4KHXH 2W65A 4PJEB 4OQTL 5BZWB 1QRNB 1NGZB 2QL1A 5ICYA 3D39E 2LQRA 1FFRA 1J05A 2B2XL 1MCPH 2X4RA 4EXKA 2WNGA 3RWJB 1T2JA 4Q9BA 4N9GA 3MRRB 5EOCL 1OL0A 2Q6WB 3O8XD 2NXYC 4KKLC 4U3XA 1A6ZA 5IB5A 1BBJB 4M7ZC 5JXED 4RGOH 2R4SH 1CGWA 4M6OH 5E8EB 3I9GL 3FT4A 3U7YH 3C60C 4K7PY 2ZCKL 1IQWL 4X6CF 1CDHA 4RGOL 4M6OL 1LP9A 1QP1A 1NH6A 2YD9A 3PWPA 3OR6A 5J3HD 4JZOB 1HINH 5D1QB 3LS5H 2V7HA 1PQZB 2V9QA 2DQTH 3FONA 4XX1E 4JO4L 2EECA 5DJDB 1JWMA 1I9EA 3KPSD 5I73C 5TPWH 5LVEA 4U7SA 5CJXA 2P45B 1CD9B 1HINL 5DEFB 2K9UA 4F8QA 1CT8B 1KEMH 4HJJL 2LU7A 4KK8D 1SYSA 1NCBH 4J3OC 5I19L 1T66D 3MRBB 4LRNL 5AG8A 1CLYH 3IDMB 4P48A 4JRXA 2R9HC 3MUZ1 3QUXA 3UTTB 1KEML 2B1HL 4PYHA 1NCBL 3DGCR 4PTUB 3O4LA 4S1SL 1CLYL 1VENA 2Z91A 1II4E 3MQIA 3QNXA 3TCLB 1NC4D 1ONQB 3LKOB 2BMKA 3WFHA 1BVLB 4OF7A 4ZOAA 3KWWA 1D9KB 3DJ9A 4QRRE 4HV8B 5KZCD 5E99L 2FHFA 4YGAB 3PGFL 4XXDB 2BHYA 2ICCA 1RUAH 4BQBA 3PNWB 1FQ9C 4BKLB 4Y4HA 2OSLA 3AAZB 4GKSB 4TYUA 1JNJA 2PO6A 3V95A 5KOMC 2QADB 4QGYA 3O3BA 1S3KL 3C6SA 2BVYA 3TIDB 4EXPX 1F4WH 3PWUA 5I76B 1RUAL 4PG2C 1EAPA 4X6DB 5F1KC 3GSXA 1HH9B 3S88H 2DWDA 4HWZA 4L9LC 2VDLL 3VGBA 2Z9TA 4MD4B 1DDHB 5MI0C 2Z92A 5HHMB 1RU9L 1NLDH 2CMRH 3DRTB 4DZBA 4P2OB 3BQUB 3IDIA 1A21A 3QXVA 3KDMB 3ARBB 2Q8BH 3S88L 1DUYA 2NXZC 5MERA 2NY6D 4QHKI 3TT1L 2BVPB 3K4DA 4FQ2H 3MBEA 5D6DA 2CMRL 3GSWB 3DARA 1OLZA 4UDTA 2EDKA 5I75B 1KPUB 3D85D 1R3JB 2Q8BL 2VUYA 4BZYA 2NXYB 4UB0L 5EBWA 4FQ2L 1RVFH 1MSPA 3B9KA 3GMPA 3N85H 3GJEB 2X70A 3FCTA 3FFCD 3D3VB 4RWYH 4Q9CA 1JI2A 1SY6A 3GSQB 1OAKL 3C8KA 3QEHA 3GK8H 1RVFL 2AK4A 2EDWA 4JDZB 1PKQA 4YJZL 3F8UB 4HUXA 4I2XB 2IQAB 1ZLVH 2BSTB 1HCFX 2JF1A 2ZUWA 5JPNA 3MJ9H 4S1DD 3GK8L 5I1EL 2RCSH 4N8PA 4MAYB 5DD1H 5GS0C 3DHMA 2K7PA 3VMNA 3INUH 1RUML 4OF6A 5B3NA 1ES0A 1S78C 3LIZL 3O81A 1FVEB 3MJ9L 3EJYC 3ILQC 4HK3J 2YA0A 1FZKB 1TPXB 3H9HB 5DD1L 3DRQA 5F6HI 5FA3B 3TPUB 3INUL 5I66B 4QY8B 5ANMB 4GG6F 2HVKB 3HUJB 5F7DB 2HG5B 5IBTL 4ZYKA 5E8OA 5KN5B 3O11B 3I02B 2CQVA 4YO0A 4C54A 1KT2A 4GRWB 1LEGA 3EZJB 3MYJA 4LCWD 5IHLB 4KDWA 5D5MB 3HAEH 4FFWC 1E27B 2VLME 5BQ7A 5SWZA 4QRSA 2NYYD 4HS8H 5F7KC 3RY5A 2NNAA 4LP5A 4V1DB 2HA1A 2P24B 4AZ8A 1BBDH 1J0JA 5IF0A 4KKCC 3MBXH 1ORQA 3UTZA 5ITFB 1UC6A 2VLRB 1KIRB 3F7RA 5HDBF 4ZAKA 2EYSA 1AGDA 5ITBL 5DK2A 2PTVA 1QRND 1OGAB 5IQ7H 2DD8H 1BBDL 1IARB 4YEFA 4L3CB 2AXFA 2CR3A 3EGSA 3NIFE 3T0WA 5F89B 3MBXL 4GRMB 3EJZD 2FYYA 4P2QA 1ZLUK 5ABDE 5KSBA 4CNIA 3NCCB 5MI0B 1S9WA 5IQ7L 5TGBB 2VDOH 3OKOA 2WIIA 1RZJC 2VL5B 3H3PH 3D25A 5EZOH 3PUCA 5IW1B 1EEYB 3C2SA 3FO9A 1QPPA 4LNVA 3EYVB 3QDJB 3DX6B 5CILH 2LFGA 4KUZL 2VDOL 3CK0H 1UB5A 3QCVH 4G8IB 3EOAB 3H3PL 1QSEE 2W07A 5CGMA 1WF5A 4XBEH 2VUOA 3QAZB 3MROB 5F9OH 4QRQA 4YHNA 3V7AE 2LTQC 5C0EB 5D1QD 1BFTA 3CK0L 3OJMB 5CINH 3G08A 3QCVL 3HMXL 4F9LC 5IJKC 5FECB 5E08H 3BWAB 1S9XB 1I7ZB 1IFHL 1ACZA 4AL8L 3PQYB 4J7RA 1P1ZB 2DDQL 1HOCA 4BM7A 5EUOF 1QHOA 3PDOB 4G6KL 3D69A 4TVPH 4LU5L 4O02H 4H0IA 4LGSB 2LU4A 5J11B 1G6RA 3UTTD 2WLYA 3HPJA 1ZGLB 3FQWA 1ZT7B 3BZDA 3ZDYE 4O02L 4YWGL 4O2FB 2X42A 3KLAA 1GYAA 1PBYA 2GY7B 4R0LB 4M61B 5GS2D 3BKYH 1ZTXH 1D9KD 4YHOL 4WU7B 1I75A 4JM4H 4PJHE 3CSYB 4JQXA 1BOYA 4YQXH 5F1NA 2AJVL 2IMNA 2ZG1A 5HHNA 3OKKB 4FQIH 1A6WH 1FZJB 3QWRA 4CVZB 3ZE2E 1IRAY 5I16A 5I1HL 1OAQH 3BUYB 2Z35A 1MCOH 4X4ZA 4JM4L 4YQXL 3EFFA 3AXLB 1J7VR 1LO4L 4NM4H 4UT9L 4YAQA 5EUKB 4M8VA 2QADD 3H7BB 1J1XL 3VWJA 3MV8E 3SE3C 1NEZG 1AFVL 2G5BA 3BP7A 3H6JA 4UT6H 3RGVB 4GBXB 5TH2B 1VFOA 2XZCH 2X40A 5IHZA 4HUWA 4PY8I 4Z18A 4UV4H 5HHMD 1MCBA 2APXA 5IV2B 4WTZA 2R2EB 3EOYG 3BQUD 4P2OD 2MCG1 2D31A 3UTOA 3TVMC 3NCYP 1P2CA 2Y1VA 1H0DB 2ERJC 1BD2A 1OM3L 4U1JA 2UVEA 2XZCL 3BP4B 5HYQA 3SPVA 1BWWA 5DJ0A 3X3FH 4ERSL 4R96B 1ADQA 1KJVA 2NXYD 1XZ0A 5TF0A 4HEME 1B3JA 4PJIA 1KTDA 1T0MA 3WFEH 2EZ0D 4OZ4B 3P0YL 3X3FL 5HYFA 1FJ1A 2R8SH 3C60D 3QRGH 2HLFC 3BP6B 3D3VD 1YQVH 1N26A 4LASL 3AREC 4Z95H 2PTTA 4PJ9A 2CK2A 5GS2H 3WFEL 3E6HA 4TSCH 2LVCA 4C83B 5SWQA 5E6ZA 1P7KA 3QRGL 4I5BB 1KCSH 4PJCF 3S5LA 2BX5A 3WDIA 4IRZL 4Z95L 4PTTA 3IFNL 1NUNB 1VCAA 4MAYD 5K9QI 2XPGA 1F2XK 5MENB 3T1FB 1KCSL 1ZVHA 1AE6H 2E7HA 2F74A 4YHZL 2XWJA 1I8KA 2LE9A 1G7HB 3FRUB 1RZ8A 5AZ2H 4JRYB 5D7IB 5TDOB 5KS9B 2HTKC 3TWCL 2W9EL 3PDDA 5HYSB 3MFFB 3BPCB 3VXSD 3VXUB 5GSVB 5HGGS 5AZ2L 1HILA 3PF2A 4EUPG 2Y72A 4F7CA 2BOBA 2YPLE 4G9FE 4PJGA 2PYEE 1IGIH 1L0YA 4V1DD 4XVSH 2F8VA 1O7SA 2YUWA 4Q58C 1ZVSA 1WIUA 2XY1A 1NGXB 1BP3B 2LU3A 2HYMA 5F1IA 1NCAH 2MWCA 1HQ4A 2P8MA 4P57A 3VFNA 3O6MH 3PGCB 1MAJA 1T1WB 2VLRD 3IAPA 3UPRB 4FQHA 4Q6IB 4RZCA 3IJSA 1S7TB 1IGIL 4M5ZL 5DJ2B 1CGYA 1OGAD 2VDRH 3MA7B 2W65B 4KZDL 4JANA 4LVEA 5ICYB 5A43C 3O6ML 4MJ6A 3L5IA 2X4RB 4KVCH 4WUUD 2OJZL 1CD1A 4N9GB 4NFBA 4YR6A 4YDKH 3EYFA 4Y16A 3KJ4B 5DURD 5E1HB 1I1FA 1H15A 4M1GL 4HPOH 1A6ZB 2ERJB 4KVCL 5IB5B 4YDJB 3GSOA 4D0BA 3QDJD 4XP9L 5H37G 2VZOA 4C56A 3FT4B 4NFDA 1PYWA 4HPOL 2VZTA 3IKCA 4MX7A 1LP9B 1NFDA 1X6LA 3OR6B 3PWPB 1YN6A 4U0QB 4JQIH 2KBGA 1QEWA 5BVPL 4GXUN 2V7HB 4KRLB 3VRJA 3FONB 2V5MA 3TBVA 1UCTA 1JWMB 1F4YH 2EXWC 3PQYD 2NY0B 4MD5A 3BIKA 4HIEA 1UZ6F 2K7QA 2R4RL 2R56H 4PJXA 1AY1L 4XWGH 1C5CL 2YD2A 1SYSB 2I60L 1F4YL 2EDJA 4NC1E 4JM2C 5D7SH 3U6RA 1N6VA 2R56L 4JRXB 5IK3A 3QUXB 3JV0A 4P0DA 4M02A 4PGCA 2C9AA 3O4LB 1MHCA 3ILQD 2QQQA 3FQNA 2Z91B 3QNXB 3MV7D 4JVPA 5D7SL 3U9PH 4BUHA 3ALXA 2BMKB 3RX7A 3WFHB 4N68A 1CU4H 1JGVH 3KWWB 2AS5M 3LY6A 1H3VA 2J1KA 5AD0A 5CS7A 3U9PL 2GI7A 1LO3L 4NQEA 4KUCF 4CRPA 2IPUG 1CU4L 1JGVL 4Y4HB 4OZHA 2OSLB 3MLVH 1DN0A 1UWEL 4F7TA 3MOQA 2PO6B 3PXHA 4FQCH 1BX2A 3LEVL 3O3BB 1YYMH 3RWDA 3G6JE 3C6SB 1NKOA 4OCSH 3RGVD 1EAPB 1NAMH 3GSXB 3BKJL 4GBXD 1T83A 2DWDB 4HWZB 3MLVL 4KKCD 1CE6A 4P9MH 4L8DA 1ZLVK 3B9AA 5IP4A 2Z92B 4Q0XH 3EO9H 3BRGC 5I9QC 4OCSL 3UTPD 3IDIB 1NAML 4GLRH 3ULUE 3S36X 4MA3A 1KIQA 3BH8A 1DUYB 4P9ML 5MERB 5C07E 4U1IA 2WMPA 1HHGA 4Q0XL 5E6IA 3MBEB 1V3MA 3TNMA 4NN7B 5GZNC 5B38A 1FLRH 2DBLL 4NO3A 4YFEA 4UDTB 4Z7VF 3L5HA 4HIXH 1I8IA 2A2QT 5DC9B 5GS0H 4DW2H 1OVZA 5EBWB 3DECA 1KEGH 3AY4A 3B9KB 3GMPB 4GMTL 3BYYA 3JVGA 5GS0L 2X70B 3TNNA 3FCTB 3GIZL 2P43B 3C8KB 3QEHB 2AK4B 1PKQB 4BFBD 4HUXB 3QUKA 5EH1A 4EDWH 5JPNB 2YUXA 1MJ7H 2Z31A 2WUBH 4WI6A 3UBXA 3GO1L 2EE6A 2Y23A 5C0DA 5L2KA 2X1OA 5MEND 2ED8A 2ENSA 1BZ7A 4OF5A 3AU1A 1CCZA 6FABL 5BW7A 1QR1A 3G9VA 4AYFA 2H32H 1ES0B 1V7MH 4OUUA 1MJ7L 4R4BA 1KPRA 4Z7WF 3DRQB 2XFXA 3SKOA 1JGDA 4JRYD 4W70A 5EOTA 4K07A 4JQXC 2GHWB 3CD4A 4ZYKB 4JPWL 4AIZA 5I8KH 3VXUD 5E8OB 2JE8A 5DJZA 1QBAA 1BQHG 5GRVK 2UUDH 4YO0B 1RUQL 4HH8A 4YBHA 1KT2B 3CMOH 3LH2H 3QUYC 2H1PH 4NQUA 4JFFE 1LEGB 3MYJB 4LCYA 4LP4A 3WHE1 4Z77A 1U2HA 2NY2B 5TQ2L 3CC5B 5I8KL 3VWJC 4P3WA 3L1OH 5BQ7B 5SWZB 4QRSB 3U4BL 4TUKH 4PJFA 5GXBB 1RZJH 2NNAB 3LH2L 3CMOL 1A6UL 1GGUA 3AMKA 3MMEA 1J9CT 1DEDA 3VWKC 5IF0B 4M93C 2VB5A 3U48A 4G9DA 2XWTA 5I1KH 1ORQB 3UTZB 2VXUH 4ZAKB 1GGBL 2EYSB 1AGDB 3X12A 5IT2H 4TUKL 3HG1A 5DK2B 3B43A 3GSVA 3LN5A 2KUTA 2CKBA 4JCLA 2AXFB 2RIKA 2EIZA 3EGSB 4TULL 2P5EA 1IJ9A 4Y19B 2FYYB 5KSBB 4LHQB 1S9WB 1E6OH 5J1TC 4IBLT 4TQEH 4EKXA 3AS0A 3LEYH 3KXFA 1Q9LA 5I1LA 1KNOA 3OKOB 2WIIB 2VDQL 3D25B 5LJYH 3FO9B 1LGVA 1CGXA 2X7LA 2VR5A 1JIBA 4BA8A 3LEYL 4OD1L 3M1BA 3C09B 1TQCC 1UB5B 4U1NA 4NUJA 2FD6H 3SQOH 2Y5EA 1HNGA 1NJ9A 4LVHC 1L7TH 1Z0NA 3PWPD 4QRQB 4YHNB 2EH7H 3BFOA 2ZUQB 3CUPA 1Q72H 3G08B 4R6UA 1AXIB 2HLFD 3SQOL 1Q9KA 3RUGE 3AC0A 2NY0D 3I75A 4OLZH 1L7TL 3KPLA 2E7BA 5HI5D 4LFHG 1HOCB 1ZV5A 4R2GB 3H9SE 3KAAA 4DEPC 4U1KA 3DOSA 2CUIA 1VGKA 3ES6A 4LSUH 1Q94A 1RJCA 2CRYA 3R0NA 4JRXD 2QHLA 3QUXD 1IC4H 1G6RB 1JCKA 3BDYH 4EUPH 4HS6A 1EEUA 3FQWB 4ONGH 3BO8A 4U7MA 4EIGB 4K7FA 3O4LD 1DN2A 3JZ7A 4R4FH 4JFPA 3JWOC 4YHMH 3KLAB 2W59A 4X7DC 3BDYL 3FN3A 4HGWA 2HTKD 4ONGL 2ZG2A 3EOTH 1H3GA 5F1NB 5SV4A 5HHNB 3CDFA 4R4FL 2QJDA 4L5FH 3RU8H 5I16B 1M7DA 3ZTNH 1C16A 4D9RD 2Z35B 5FO7A 4Y4HD 4PRDA 1RJLA 4XCEA 1JHKL 3EFFB 4YAQB 2AABL 4PJAF 2ESVE 2PO6D 2V9RA 4LOUD 3RU8L 5GZOC 3VWJB 2ID5A 4WGVB 1J0ZA 2X2YA 3AMLA 2G5BB 5DK3A 4MB3A 4JB9H 4JN2A 1TZGH 1PSKL 1J11A 3LPWA 4HUWB 5IHZB 5H37H 4NQCD 4Z7UE 5JHDE 2NQCA 4FQLL 4N0CC 1AQKH 1KXTB 2XG5A 3LAFA 5EDXA 1P2CB 1NDMA 1BD2B 4JB9L 2O5XL 4U1JB 1WFUA 5HYQB 1D5BA 3RWGA 3SPVB 1URLA 4ZUTA 4DN3H 3PWVA 4JFZH 5DJ0B 4XGZA 2A6JA 5D7JC 5D71L 1KJVB 3Q6GH 4NZUH 1S9KC 5DVNA 2E27H 1XZ0B 4K3EH 3GUTA 1J1OH 2HFGL 4PJIB 1KTDB 5A1AA 1I3GL 3B9KD 6CGTA 4R97C 1MHPH 4PRBA 5T5NG 4PJ5A 4DN3L 1FJ1B 1Y6KR 3Q6GL 2XQBH 4NZUL 3SBWC 4K3EL 1J1OL 4H20L 2A77L 2PTTB 4PJ9B 3RTQA 1TDQA 3E6HB 4LF3A 1MHPL 4BJLA 5SWQB 5F9DC 3J8F7 4RAHA 1P7KB 1G84A 3HE7C 3S5LB 3QFJE 1JN6A 2HKFL 2D2OA 1IGYA 4PTTB 1IE5A 5C0IA 5F3HA 2XPGB 2E9WA 5J12C 3N9GH 1VEMA 5JHLH 4XC1H 4DEPB 3VRIA 3NGBC 2F74B 5K9OA 1G0DA 5D2LE 1I8KB 3RVTC 5MEPA 2MKWA 2A1WH 1N0XH 1RZ8B 3OGOE 2YS4A 3OJ2C 4CADA 4TSBH 4ZXBC 5JHLL 3DXAE 1AIFA 4WFEE 3DIFA 1XGYH 2IJ0C 1F42A 1NCTA 2A1WL 4DWHA 4U6VH 4TSBL 2NY2D 1DQJA 2IH1A 2BOBB 2P8PB 3EIFA 5KSUA 3ZDXE 5L8LB 4PJGB 5SWZD 1ZVSB 3VDBA 1VDGA 1X5GA 5F1IB 5JTWA 4K3DL 1HQ4B 2P8MB 5EO1A 5CMAA 3VFNB 1HIMH 5IROC 3S6CA 5D72L 2R69H 4FQHB 1GHFH 4ZAKD 4RZCB 3QFDA 4Z78A 5GGSA 5FUZL 4MJ6B 5D7LE 2VDNH 2R69L 4P2QD 1GHFL 4P3CH 4AENA 2A0LC 1CD1B 4X6CA 2XTJC 4YR6B 3EYFB 2R0ZH 4Y16B 4X7SH 3SGJA 1SM3H 2YHGA 3ULVE 4L8BA 1T2XA 1MWAA 3QPQD 2HAZA 1I1FB 1YN7A 1H15B 5EC2A 4WTWA 1R5IB 4YBQC 3DX9A 1OP3H 3GSOB 4D0BB 4HS3A 3VGHA 4X7SL 5KVGL 1SM3L 4C56B 3JVGC 5EBMA 1PYWB 4G8EA 3U83A 2DKUA 3HNSH 4EQ2A 1H3WM 3IKCB 4MX7B 4HFUH 1NFDB 1OTUC 1YN6B 4R97B 4KWUA 3RP1A 1QEWB 5IB2A 1D5XA 2Z31C 3REVA 3TBVB 1UEYA 4KDVA 2DQUH 5F9AC 3KYMA 3LD8C 4MD5B 4XC3L 3BIKB 2BXZA 2FWOA 4HIEB 5BW7C 4R2GD 2AK1H 1KCVH 1RV6X 1MCNA 4PJXB 4AEIH 2V17H 4G80A 4PD4K 5CD3A 5F7FA 5C9JA 4X99A 3GI8H 3U6RB 4G7VL 2AK1L 4Z7OF 5IK3B 2XV6B 5HHVH 4AEIL 2V17L 4PGCB 1PDKA 1EK3A 2OCFD 4TRPL 3OV6A 3OGCA 4GAJL 4Z6AT 3FQNB 3NGBB 5GGUA 4WHTB 3GI8L 2MCPL 4AEEA 4XTRD 1GGCH 3UTSA 5HHVL 2J88H 3B6SA 3UO1H 1QLFA 3OTTA 1P7HL 3TFKC 3QWRD 4LQ1A 4OGYH 3KG5A 2Q20A 4NQEB 3N1QC 2J88L 1MCSA 3MLYL 4OZHB 3UO1L 5CFHA 3AM8A 5IMKA 2KKQA 1DN0B 5C09E 3VWJD 4F7TB 3DYMA 1BX2B 2IPTL 3RWDB 2W1NA 3QQ3A 1GC1C 5DUMH 3TBWA 4NWUH 1A9EA 1CE6B 1R0AL 4L8DB 1REIA 2FIKA 4O5LH 1KSRA 4JE4B 1MCWW 2HT2C 1A1OA 1H5BA 3A0OA 4RAUA 1QLEH 3C8HA 3FQXA 3G5XA 4XPGH 4MA3B 1KIQB 3BH8B 1I9IH 2I27N 4NWUL 5HI4D 5ISZA 4U1IB 4O5LL 1HHGB 5E6IB 1OP9A 3TNMB 5B38B 2XTJB 1QLEL 3KPRA 3L7FA 1I8IB 1I9IL 3S96A 5T33L 3P4OA 3OBAA 4Q74A 5LGJA 2JB5L 2X4UA 1CICA 4LSDA 5JUEL 2F19L 1DQLH 1LO0H 4C59B 3FB7A 2ICWA 5C2BL 2M1KA 3Q5OA 1YJDC 3RVXD 3KPTA 3TNNB 2Y36L 3GGWA 4PJ9D 1T7YA 3HLAA 4JKKA 1R24A 5FHBH 3HC4H 5TE4H 2BVQA 3D48R 4JLRA 1BHGA 3QUKB 4GG6A 4HWUA 1JYXA 3H3BC 2Z31B 3UBXB 2OXGA 1MY5A 4IOFC 1H3PL 5C0DB 5L2KB 5TE4L 1BZ7B 3LD8B 5KSAA 3AU1B 1X5LA 2JIXA 1QR1B 4KI5E 4OUUB 3HI5H 4UIMA 3EYQC 4R4BB 4HG4J 1KPRB 2XFXB 1A1MA 3SKOB 1JGDB <