2B1HH

Crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug29 peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
226
Chain Sequence
EIQLEQSGAEVKKSGESLKISCQTSGYSFSDYWIGWVRQMPGKGLEWMGIFYPGDSDSRYSPSFEGQVTMSADRSTNTAHLQWSSLKPSDTALYYCARLGGDYEDSGADAFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 2219, light chain
publication title Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
pubmed doi rcsb
total genus 40
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1hH01
5T3XD 3MBEB 3OAUL 2GITA 1A6ZA 2C3GA 2JCCE 2D4DA 4LIQL 4QOKD 3K4AA 1RJYA 3GMNB 4DOHE 3MUJA 3LN4A 3WS3A 2HT3D 3QUMH 1FYTD 1ZSDA 2YPKA 2PXYB 4XCYA 1U91B 4BZYA 5CP7A 5EBLB 3UZVB 1E6JH 3X3FL 5IMMA 1FO0A 3BO8A 1CXIA 4KPHL 4U6YA 4KAQH 5CD5D 5MP6L 5BW7A 4U6TA 1FBIL 4G9DB 1S7QA 1QFWL 4QRTB 3D0LB 1VEOA 3T4AB 1UQSB 3MYJB 1EERB 2PYFB 5HVWA 4D0DA 3S34H 2ADFH 4PP2B 5A40E 4OUUB 5L0QC 4LNRB 1UYWL 3H9SD 5FDWA 3BGFC 4NNPH 1BFVH 1BVKA 3D3VB 1VKXA 2PTTB 5I1DA 2G9HB 1N5YL 1B88A 3MBEA 4GAJH 2LAAA 4KVCL 1A1MB 3DRQB 4I77H 4S10A 5C08E 3UYRL 1TJIL 3I85A 3U83A 5BV7C 2NY1D 2J8UF 4HT1L 4F9PA 2D4FA 4AIXA 1FRGH 3WUWG 4B41A 5LG1A 1MI5D 3GMNA 1TTFA 2ENYA 2UV3A 3NTCL 4WFED 3GHEL 3QBTB 4Q9CA 4L8SC 3R1GH 2PXYA 4MQTB 2CDEB 2L7UA 4AEIH 1OW0A 1IAIH 1JF5A 2EIZB 3OWEA 4G9DA 3VXNB 5CZXC 4QRTA 5IFHL 3DHJA 4EBQH 1ULVA 3D39D 3OJDA 2PYFA 4EI5C 1FG9C 2FBJH 4OCXH 2NY0B 3BIBX 5HYSG 4Y1AB 5CJOH 5B8CC 2BNQD 3N1GC 2CDFB 3MC0A 4QYOA 2PCPB 2J8UE 3LKPB 3KLHD 4NC1C 2BNRD 3LQAL 1FGVH 3W11C 2Q6WA 3D3VA 4HFUL 2PTTA 4YE4H 1IKFH 3OKMA 2G9HA 5EZJB 1YEFH 3RVUD 3QUMA 3QEUB 3QUZD 1NL0H 4JY6B 2IMMA 3SE8L 3UTQB 1QLEL 1XGYH 1RZKC 4JANB 3QQ3B 4WO4D 4UINL 4AEHH 4PJ9B 3UZQA 2VZVA 4L4VD 1BZ9A 1HHGB 5L88L 4EOWH 2VDPH 2MQ0A 1P5VA 1G9MC 4PR5A 3PWJB 3FJTA 4JVWA 2CDEA 3LS4H 3MFGB 4P2CG 5HHPA 4GG6F 5C86A 1GGYA 1J05B 1LQSR 2EIZA 4K3DL 3INUL 4M93C 2DQJH 1CG9B 1PX4A 4EDXB 4IOFC 3TT3H 3VRIB 3PV6B 3OKEB 2OQJB 5EC2B 5F1IB 1E28B 5CEZD 3S6CA 1LO0L 2VNCA 1MCIA 4PB9L 4RGNC 5GRYA 5ISZE 2CDFA 4P59H 5HHOD 5F6IC 3LKPA 1FC1A 2CLZB 1C5BL 1DQDL 2Q3AA 1EJOL 2HFFB 3ARVA 4P5KB 3IDIA 1KIUA 4ZUVB 2AW2A 5C0JB 4FFZH 4YEFA 1KC5H 1F6FB 1PKOA 4HS3B 1U95B 4JY6A 4LEXH 4NHCL 5E9DB 2EDOA 5E4IA 4PJAB 4JANA 5TE6L 1PAMA 3QQ3A 4LHQB 4GG6E 2Y5EA 4PJ9A 1HHGA 5INCB 2FD6H 3VD5A 3THML 3BPNB 1GGTA 3LKSA 2F8VA 4Q58C 2PR4L 4E9LA 4YXKL 2BERA 3H42H 1CE1H 3B2VL 5KJRL 5GGVH 3H3PH 5IG7A 2HFEB 1CG9A 4JG1H 1BVLA 1J9CT 3O0RH 3VRIA 3PV6A 3OKEA 2OQJA 4AIOA 3LEVH 4WTXA 5L0QB 3UTTB 1KPUB 4W70A 4EDWL 3P40A 4JM2C 4UNTA 3FT3A 3O2WH 3S4SG 3VWKD 3G5XA 2F5AL 5C09D 2PO6B 3SDYL 5C7XH 1R3KA 2HFFA 2WWMC 4P5KA 1TVHB 4F8TA 4M43L 5C0JA 4JB9L 3QUXD 4FFVD 4NZDA 1JPTH 2PW2B 2V9TA 4LBEB 2A6DA 2ADIB 5EG6C 3GO1H 2ZSWB 1MF2L 4XVTH 3O3BB 1QSFB 4Z7VF 5E9DA 3IT8D 4PJAA 3SGJC 2BVPA 1F3RB 2NXYD 3T0EB 1QA9B 3AS2A 4OCMC 2EDHA 5INCA 4PJGF 3SJVD 3T08A 3WO4B 2OJZH 1N64H 1LEGB 5MEND 1S7UA 1RIUH 2E8ZA 5AWNH 4X4YA 4QXUH 4QY8B 2ZZUT 3ARGA 5E8NB 2P5WE 1M7DB 5E00B 2X42A 2C1OA 1GHFH 3TO4D 5D6CB 4EQ3A 2HFEA 3GZKA 5I0DA 3BD5A 1H8NA 1H3PH 2HJFA 2X4PB 5F88A 4NO0A 1FZMA 5F8RC 5B8CB 2B5IB 4KZEH 4LFHD 3UTTA 4OCRL 3PGCB 1Z5LB 3QJHB 2WW8A 1CL7H 4GQ9H 4Z7VE 1RD6A 2PO6A 1U8QB 4JN1L 4DGIL 1TVHA 3EJZD 3H9HA 2P8PA 5TQ2H 3QDGD 2ZUSA 4PJGE 5TE7L 2PW2A 3GSOA 5DMGD 5C0BE 3O3BA 1QSFA 3MNVA 3T0EA 1QA9A 4IBLT 4PD4K 1ACYL 2P5EE 3BKJL 3QWRA 4C4KT 1IMHC 4GKSA 5CILH 4IM8A 1V7NL 1NPUA 4JPIB 1QQDB 1YMMB 5GSRB 4L9DA 5C0RL 1QP1A 4RZCB 4LK4A 2UVFA 4U6VH 4QY8A 1ZLVK 5E8NA 4N68A 1M7DA 1T66C 5E00A 4M5ZH 4JR9H 1LO4L 1KIRB 3CH8A 3DI2B 4HWBL 5D6CA 4F58L 4YFLF 1X5LA 1DN0A 4F7CA 1P7KA 2JJSA 3V7AG 1W0WB 2Z35B 4RX4D 2VXUH 4I4WB 4CUCA 4Z7WE 4YHZL 3BKMH 2DQHL 4IOIB 1N7MH 4FQHA 4N8PA 1YEJL 2H2PC 3PGCA 1MAMH 1OAZH 1PG7X 3QJHA 2YBRB 5TFSL 1ZGLP 2X4SB 4QRPE 3MRIA 3X12B 5CKAA 3TJEL 1MCOL 1C1EL 4NP4L 2VDRL 2DQIH 3V0AC 1QFPA 2W0FA 4OCYL 4BUHA 5DMIH 2XT1B 5FUCC 4YHPB 2OS7A 2O61B 5JQ6H 2GI7A 1YMMA 2GSGB 3GNMH 4RZCA 3NA9L 3QIBA 1DLHB 4LCYB 1IM3A 3QHZL 2ARJQ 5BO1H 2E9IA 1WISA 2LABA 4M8VA 2AEQL 1KIRA 4NQEE 4NJ9L 3ARWA 3QXWA 4G7YL 2E3VA 5FUOL 3S8WA 1W0WA 3BISA 5DD5L 4HQQL 3G6DL 4I4WA 4ZDHA 1UWEL 4WFHE 4KZDH 1S7WB 1XR8B 4IOIA 4OLWL 5I8CA 1T80A 2CQVA 2YXFA 3OHXA 4D3CH 5BJTB 1E4WL 2YBRA 5DURB 3ZE1E 3U2SB 4JLRA 4Q9RL 3ZYZA 2VB5A 2X4SA 1FNGB 1WT5A 4U05A 3X12A 3GIVB 4RISH 4HK3J 1JNNH 1XIWA 2NY3D 4E5XB 2BVUA 2C4FT 2VXQH 2P49B 4D9LH 1KJ3H 1CGSH 3GM0A 2XXMB 3NAAH 3WUWB 3WFCL 2P8LA 3MUGA 4GOSA 5DVLA 1OAYL 3DPBA 2VZOA 3GHBL 4YHPA 2O61A 2H6PA 2L4OA 4GRMB 4POUB 4EEEA 4FQJH 4WI4A 1PJ9A 5AYUL 4DN4H 1DLHA 2IPTH 1QZ1A 3EOAA 3ULUD 1IGJB 1DBJH 4X4ZA 2V17H 1SVZA 5C0CB 2QR0B 5HI5D 3WO3B 4OCWH 2JCCA 3FZUD 4LPXA 3HZKA 5F1OB 1NCCH 3DUUB 5C0IB 5HYSB 1S7WA 2EDBA 3BIKA 1A7PL 1PX3A 5BJTA 5GRJL 5IR1B 3GMLB 2F15A 3FN0H 3HG1D 3GKWH 3L5HA 4LQFH 5FYJL 1F45A 2XV6B 2G60L 4JCMA 1FNGA 5K59F 2FO4B 3C6LC 5A3IC 4JZNB 3VXME 2XXCB 1W2KT 3GIVA 4W6WB 3O9WD 3QI9D 3GSWB 4E5XA 3G5YB 5GS2D 4OCSL 4Z7OF 1CU4L 3BRFA 2RR3A 3WUWA 3C60C 1VB9A 2IC2A 1ORSA 1J1XL 1QNZH 3PWVB 4U1KB 3TBVB 4PV9A 4GRMA 4HBCL 2H41A 1DVFC 2RGSA 2H3NB 5DDHB 1PG7H 4Y4FC 4PJBF 1IGJA 1T7VA 3I50L 4O5LH 1KEMH 3X13B 4AEIL 4P2OB 6CGTA 3GFUA 1BPVA 1CXEA 1IAIL 1NC2B 3CSGA 4N0FB 5C0CA 3CVHH 1QRNE 2DIJA 4R96A 1VENA 5ICYB 5EBWA 4EBQL 4NKQB 3DUUA 4LPVA 4CN4A 5C0IA 5HYSA 5K59E 2VSCA 3P4NB 2IWGA 5KZCB 2PN5A 5GISL 3TCLA 3VCLB 3OB0K 4LCCB 4NKDB 4Z7OE 4UIKH 5K9OA 1KCLA 2VZ3A 3ARRA 1ZVHA 2FO4A 1Q8MA 4TNVK 1DUZB 5IF0B 1IKFL 2GJ6E 4XP6H 2QQLL 3HPJA 2ZNWA 3G5VB 4XWOC 2QHLA 3JVGC 1IQWH 1SBBA 4PJBE 5CJQL 5GGSY 3CVHB 1BJ1H 3PWVA 4U1KA 2ZJSH 5GS0D 1BAFH 1JGEB 4K71C 2VDPL 1PVHA 1VADB 3ARQA 3IXAB 2CUHA 4N90E 1R5WB 3B4NA 1MEXH 2H3NA 3TV3L 4PGDB 1Q0XL 4WRLA 1WBXA 1G7IB 1LP9B 2CD0A 5DHYB 1NH6A 3K8KA 4N0FA 4LVOC 4KUCF 4HMDA 1EO8H 3T2NL 2E9BA 5KVMC 4TNVF 2FJGB 2ENSA 2YD4A 4XI5C 2DQJL 2X4OB 1PZ5B 1ZAGA 4AG4H 2VZUA 3P4NA 3FT4A 5DF0A 5J1AB 3VCLA 3BYYA 4X5LA 3S4SB 2C4XA 3Q2CA 4LCCA 1TPXC 4AH2B 3FFCB 2ZUVA 4NKDA 2XN9D 4KKLC 1M6OB 5EU5B 4P59L 3JV5A 4JDZA 1CICA 3LQZB 5CZXD 4ZAKC 4ONFH 2FIKB 1DUZA 2FEEL 5IF0A 4EI5D 2K3TA 2QSVA 3RAJL 4FFZL 2JELL 2RAMA 1FIGL 3G5VA 1PYWB 3QFJD 4LEXL 3JV0A 4KY1L 1RHHB 3CVHA 1T03H 3W11D 4HS8H 2BVQA 5ISZA 4GW1A 1TDQA 1VADA 4QXWA 3IXAA 1R5WA 5TGBB 1IGCL 3R0MA 4F57L 2DM4A 4DTGL 4PGDA 5E6IC 1EUUA 1G7IA 4B50A 2AEPH 4UT9H 4Z95H 2YUXA 4RMTA 1OM3L 1NBZA 4MX7B 4W68A 1RULH 1JFQL 2FJGA 4GG6A 3GSNL 3JWDL 3MLRH 3O0RL 4D9RD 3D85B 3GMPB 3K46A 1FG2B 1ZANH 3EDEA 1XGQB 2IFFL 3S9DB 3S4SA 4KJYB 1MFAL 1BBDL 3FFCA 5DZLA 1NGXB 4AH2A 5EC1A 3LQAC 5I8KH 1ZT4B 1SYVA 1JK8B 3KPNB 1JYVA 4IOFD 4KK8C 2YD6A 2FIKA 4XB7A 5FM5O 1A4JB 2EXWC 1PYWA 4RGND 4G8IB 1O5DT 2W1NA 3ARPA 3PHSA 4J6RH 4RCAA 2CKNA 2VR9A 2NZIA 1G0YR 1JHKH 3P9MB 1EZVX 1G7QB 4M3KB 3VFPA 3Q5YA 4WWKC 2F5BL 4MA7L 4Q9QH 4Y2DC 4QXUL 5KOVC 3QDAA 1YJDL 5IHBA 4X6DF 1URLA 2MTPA 4FQQA 4OIIL 2AJVH 2BJML 2CLRB 3MV8B 3TF7C 1CQYA 4RWHA 5D2NE 3L5XL 4I0PC 2VLJE 3D85A 3GMPA 3FB5A 3MSPA 3CSPA 4HLZH 4KJYA 3QDHA 2CKBH 1NGXA 2YK1L 1EMTH 1U8LB 1UH3A 1ZT4A 2Q8BL 3LKOB 4GQ9L 1JK8A 1RUMH 1V3MA 2P5WA 2Y6SD 3Q6GH 4FQ1L 1WZMA 1CLZH 5TQ2L 4XNXL 5JPNA 5I8OL 3BE1L 1EFQA 1A4JA 4WU7B 1JTPA 3O3EA 2VDNH 2QADB 4PPTA 4QTIH 5JXAH 1Z9LA 4JM2D 2KDGA 4X5XA 2FL5B 3LY6A 3MNWB 4JAMB 4ZPTA 2J2ZA 4X6DE 3P9MA 1JL8A 2WWMD 5I1KH 4TSAH 4UB0H 1G7QA 1WFUA 3MRJB 3VXUB 2YHGA 4PGJA 1GGCH 1U6AH 5LGKA 1Q9WB 4XCFL 3FOMB 2C4FU 1UFUA 3TBTB 4LAJH 4OI7A 2B39A 2DIBA 3NCMA 2FX7H 3SGKC 4P3CH 3HI6L 3IDJA 1BECA 3NACH 1ZLVH 3CCHB 4L3EE 2VXUL 4NQUA 3GMOB 4K3JH 3S97C 5B39G 5T1KB 3BKML 2FNBA 1RJCA 5FGBC 4LAQL 1DZBA 1U8LA 1MAML 3LKOA 4D0CA 3OF6A 1YEDA 4OGYH 1E0OB 2FJFA 1JYNA 3GB7B 1I3VA 2MOVA 5CUSH 4XNZC 2X4NA 1KENH 4P4KB 4WU7A 5FYLL 1CLOL 5F7KC 1VESA 3DXAD 2C7UA 1IGYB 3LD8C 1T89A 2FL5A 3MNWA 4JAMA 1BEYH 3D18B 1T1ZB 2NNAA 2APFA 3ILPB 1CIUA 2AJZA 4OIBA 4D9QD 3MTRA 2VDOL 5MEPB 3P77A 3E3QE 3MROB 4I1NB 1Y6NR 5I1IH 3GSVB 5EO9B 4K7FB 1T5WB 5DQJA 4G8GD 1UH4A 1QVOB 2CKBA 3TVMB 3C87A 4DKAA 4OLUH 3CAFA 3V52L 1HSBB 1O7SA 2HWZH 4DEPB 4DKEH 5I1JH 4M7KH 1I8IB 1MWAH 4I9WD 1FYHB 3IDXH 1NAML 1OGAD 5H2BA 1IZKA 1T66D 2IALB 2XZAH 3UTSE 3DUHA 4KVNL 4M1DH 2FWOB 4BKLB 3PNWA 4YGVA 1CK0H 1CVRA 4G6FB 4ZFGL 4NQEA 4OFIA 4X6EA 4M1GL 2VZTA 5KSAC 2OK0L 5HI3D 4PRPB 5D7JA 1JNNL 4P4KA 2H2PD 2HFGL 4YX2L 1CCZA 1CD8A 1NGPL 3VGGA 1DBBH 3WL9B 3OX8B 3OZ9L 3S35H 1T1ZA 3ILPA 3NA4A 2HJKA 5MEPA 3I6LD 4Y2DB 1AD0A 1MWAB 3GSVA 5EO9A 4K7FA 1T5WA 1QOKA 3OAZH 3LKQB 1QSEB 5TF0A 3L7FB 2IPTL 1QVOA 1NUFA 5GS1C 2ITCB 3F5WB 3AM8A 2A73B 4PJFB 4GRLD 4K7PX 4YXHH 1B6DA 1MJ7H 3V8CA 1HSBA 4OCWL 5C0ND 1KLUB 4YHIB 1W0YT 2AP2A 3FB8B 4RA0C 4IRJB 1NGZA 3WIIH 1WAAF 1I8IA 1NCCL 2GTWB 1CE6B 4IJ3C 3UO1H 2L0DA 2Y9RT 3N0PB 2J1KA 3A67L 2XNAB 3GRWL 4BKLA 2FWOA 2ZCLH 2R56L 4LLMB 4BUGA 4YHML 4M7LH 2DKMA 3VH8G 2CK0H 5F9WB 5DEZA 4PRPA 1AXIB 4AMKL 1P4IH 3WL9A 2IBZY 1CD0A 1JGLH 3M07A 4PRDB 4S0SD 3JWNC 1RK1B 2DQGL 5DC4B 4Z0XB 5TPWH 1ZLUH 1LK3H 1MWAA 1OAXL 2AXJA 3KPSE 1QSEA 3O4OB 3VFMA 3VXMA 4F9PC 1WAAE 2BC4B 1PG7L 2XWJB 4TPRH 2X4UB 1CXKA 3VA6A 2B7DT 4O5LL 1KEML 4NM8H 4PJFA 1DL7L 5CAYB 4YAQB 3IF1A 1OOAA 1KLUA 4YHIA 4QCIB 4IRJA 1GRWA 5K33A 5HYJD 3VFVB 1NMBH 4S2SB 2UWEF 1CE6A 3MLYH 4NRXA 1REIA 5D9SB 3HI5H 2DM2A 1UEYA 3KJ6H 4KK5C 4Q2ZA 5HHXH 1UWGH 4LLMA 5DR5L 1CXFA 4LHUA 2EDLA 3S37H 4FXKB 3EAKA 3IDUA 2YMXH 3IFLH 1X9QA 4JO4H 5FHAL 3FB6B 1XAUA 4FTVD 1KJMA 2DBLH 3S88L 4WUUD 4PG2C 5BRZD 5C0AB 1IQWL 5IWLA 2NX5B 4HKJA 4PRDA 2A77H 3ARXA 1UM5L 1I9RL 1RK1A 1RZGB 3C6LD 3SCMB 4MJ6A 1HNGA 3BP4A 4Z0XA 3P9LA 3AU1A 3VFOB 1U8KB 2BC4A 2UWEE 2XWJA 1D7FA 1U8JB 3C60D 3KPOA 5DSCA 1BOGB 1V3JA 1ZHBB 1CVSC 2DI7A 2FYYA 3U4AA 3PWLB 4L5FH 1HYSC 4PJBA 4QCIA 2ESVB 1MFDH 1DVFD 5I0ZA 4Y8DC 3VFVA 4S2SA 2V9QA 5D7SH 1B0GB 5ILTL 4AG4L 1U41A 4Y4FD 5D9SA 4X9FA 3HE7B 3Q0HA 1F3DJ 3OKOB 4GSDL 3KJ4C 4XNUL 2JE8A 4MA3A 2XICA 1IKNC 2WP3O 5KSAB 4KRPB 4FXKA 1WIOA 5SWZE 4ONFL 3ROLB 5DRZB 5K93A 3HZVA 4JG0H 4K7PH 1J8HB 5C0AA 3GK8H 1F4YH 2VIRB 5CGYC 1OWWA 5IJKA 1XGTA 2Q3ZA 2VXVL 5D4QA 1RZGA 3SCMA 4AT6A 5FYKH 1OB1A 5EORH 1FHGA 1OLZA 3MLUL 4M7LT 3VFOA 4Y7MA 1U8KA 4YDLB 4XWOD 5KVFH 2A6KA 4DWHA 4HH9B 1FFPA 1BOGA 1U42A 1ZHBA 2A1WL 2AEPL 4K07A 4R3SB 4Z95L 3PWLA 1INQB 2ESVA 3DMMA 4EQ2A 5AZEH 3M1BB 2X05A 1B0GA 4FZ8H 4YHKL 1FNSL 2VN4A 2OP4H 2QQQA 5LVEA 3HE7A 1IARB 1NMAH 2DWEB 3OKOA 1HWHB 3RRQA 1MREL 4XI5D 1MELA 1U3YA 4PLJC 2DQUH 5FGSA 2X9YA 1BLNB 4ZFZB 1BZQK 4I3SH 2IQ9H 3WDIA 3C5ZA 3MRDB 3UZEA 4PRIE 4YFEA 3T3MF 4OZIF 2ATKA 4NO3A 2W65A 5EUKB 1R0AL 1Q0YH 3STZB 4UZGA 4ZOCA 4R2GB 4KKLD 3CDYA 4OGAC 4G3YH 3DLQR 4HF5H 2VIRA 4F2MB 4ZAKD 3RGHA 1NANH 1JHKL 4EN3B 4BJLA 5T1DH 3UTPE 2Y1VA 5ALCH 3KLDA 3CUPB 3K81A 4WI8A 3HNTL 4GAYB 1MUJA 1Z3GL 1JIBA 2CJUH 4GAGH 5JW4R 5B22A 2F8XC 1VFMA 4LLUB 2AJVL 3EYSH 1A3QA 1OAUL 4U1JB 5B39B 5L6YH 4YDKH 3S96B 3M1BA 1KJVB 5DHVB 2YPVL 5E6ID 3ARGC 3R8BB 1MCKA 3T3ME 3MOBH 2DM3A 1KGCE 4AJ0A 5DQDH 5JHDB 3DURB 3RU8L 3BP5B 4FNLH 1IAMA 5I16B 1RUML 3HNVH 1BD2B 3L3DB 4J3SA 5IVXF 3NCYP 4WTWA 4ZFZA 2A0LC 5A2KH 3MRCB 3MRDA 3RNQB 4HJJH 1NCWH 5HXMA 3FMGH 1XGPB 4I3RH 5IB1A 1D6VH 1ADQL 4M9PA 1ES0B 1CWVA 1NFDF 3VA2C 4F2MA 1KTDB 5CEXB 3BZFA 2OR9H 4EN3A 4GBXC 3UAJC 1HIML 1XZ0B 2M8XA 2R4RH 4P2QE 5E8DH 3SN6N 1GGCL 4V1DD 1U6AL 5C6TL 4LSSH 3U6RB 3IKKA 1YEIH 3BP7A 4R7NA 3JTSB 1IM9B 5I1EH 5E7BA 3RBGA 4LLUA 3JWDC 3VI3E 1J0HA 1A1NB 4U1JA 3WNLA 5B39A 2J5LC 4WWKD 4J12A 1KJVA 1KCSH 1P9MA 4K3JL 4ZXBC 1HK6A 2Z31B 5EOTB 3KJ4B 1JYWA 3VW3L 3SQBA 3QCVL 3ZSTA 1GPOH 4WJ5A 3DURA 5FHBL 2JJSC 3BP5A 3VXSD 3MLVH 5IQ7H 1NFDE 1BD2A 4QRQA 2FLBT 4I0PD 3V4VH 2M1KA 2J7LA 4QRUB 5DEGB 3RNQA 5IK3B 4EXKA 1I9IH 3UC0H 1KENL 4IIQB 5GRXG 3RWHB 3GI8L 1XGPA 2C3WA 2EH7L 5DJAB 1BP3B 4FRWA 2FH6A 1KTDA 5E8OB 3JBG7 1JTOA 5ABDE 2ZWLT 1HKLH 1MIEH 1YN7B 5IP4A 1DQLH 1W72L 1YJDC 2Z8WC 5I1IL 2BY2A 1AO7B 4P46A 1S78C 4OV5B 3ZKNC 4DAGH 5D2LF 3PQYE 1IM9A 4OLUL 4LGSB 4XBPB 3MGAA 4P23C 1JWUB 2HWZL 4BQCA 2BDNL 5I1JL 1A4KB 3QIBC 4KFZC 4ZOAA 4HPYL 3TJHC 2DQCL 1MHHA 2Z31A 5EOTA 5DA0B 3U4EB 2QLVB 5JR1L 1I1RA 1J0IA 5SWSD 2OTWB 3BWUC 3VH8B 5C2BH 1A6TB 5I9QC 1ZGLB 1NANI 3V9FA 3L3KB 1AY1L 3BEWB 5DEGA 2DQTL 4LSPH 1RAMA 3RWHA 5BVPH 4ZTPH 4PV8B 3ZMRA 3CVIH 4M4RA 5E8OA 4N1CA 3GSXB 3UTSA 1P4BL 1AKJB 1MJUH 4L1HA 1TTUA 4HWZB 3RUGF 2E7CA 1YN7A 2XKUA 1AO7A 3RWCA 4G5ZL 2OJEB 3VFRA 3H7BB 4ZQKA 5T33L 5BOPA 3O2VH 4XBPA 1ZHKA 4XP4H 5IVNA 4G7VH 1IL1A 1MJ7L 4YXLH 1JWUA 4GXVH 1X44A 2F53E 1A4KA 2VLMD 4WU5A 3ZKSD 5BCAA 5IW1B 5LGJB 5A2IH 3O4LD 4HS6B 3UO1L 2XZQH 3L9RB 3UJIH 3U4EA 3VFTB 1C8PA 4JFFE 3CFJA 5FEBA 2OTWA 1RZ8B 3VH8A 1JP5A 2Y5TA 2AABL 1A6TA 2CH8A 4Q0XH 4JFEB 5I1CH 1F8TL 3TBYB 4B0MM 3W81A 3GIZL 3L3KA 5L7XL 3BEWA 3MBXH 3RUGE 2CRMA 4Q6IB 4MJ2A 1CIDA 4XBEL 1YYLL 2MKWA 1J5OL 1X5FA 2EEAA 2IH3A 2W9DH 4RFNC 3GSXA 4GS7B 1L7TL 4GKOA 4GO6B 1AKJA 4NO2B 2VABB 4HWZA 1WJ3A 2RB8A 1TFHA 3VGFA 2JB5H 3DX7B 4JDVB 2HJLA 5I73B 2OJEA 1UEMA 1C12B 1OTUC 3U7YL 2CK2A 4M9OA 1D9KA 2W91A 1CDIA 3P11H 4U1HA 3TN0C 2J5LB 1KYOJ 4YDIL 3KVQA 3O3UN 2CRIA 2UVEA 5IW1A 5KTEL 5KVDL 3BQUC 4UMGA 3VJ6B 4HS6A 5C1MB 5HHNB 1W0VB 3L9RA 3QDJB 3B9AA 2W59A 5GQBA 3DO3A 2P7TB 1T7WA 1RZ8A 1WAAA 3KPMB 4HIHB 4JFEA 3WS6C 5JUEH 1FH5H 4CJ1A 3I6KB 3ZDYF 4NQDE 4I48B 3OXRB 3K4ZA 2ADJB 2H9GA 4CU7A 1EHNA 5HHME 2Z92B 1NC4D 1OAKH 1BM3H 3B5TA 4OKDA 2W9EH 5ID0B 4NO2A 3CFKB 2VABA 3DX7A 1FAIH 1TVBB 5T5NF 1S3KL 5IVOA 2B4CH 1R3LB 2YRPA 3ZL4L 1C12A 3OGCA 3OKNB 4K55A 4KQ4H 4MCZB 1MCNA 3SE3C 1INEL 2XQBL 1MFDL 1T6VN 1MCRA 4XB8A 5D7SL 3CX2A 3VJ6A 5HHNA 1W0VA 3QDJA 4DVRH 5IMOB 2AGJL 3ZDYE 4DW2H 4MNQD 1CTNA 3D5OF 2P7TA 2YN3A 3BWAB 4U1LB 5I17B 2UWEA 3E8UL 5TF1L 3HFMH 4HIHA 4XNMB 1X7QB 2YRZA 1D5MB 2FSEB 1FQ9C 4WUKH 3GI9L 5ITBH 2J4WL 5E7FA 3DV4A 4I48A 4XPTH 2OBGA 1GAFH 4KK5D 1GGIH 3RWJA 2ADJA 2ZOLB 3P30H 4K7PL 2Z92A 3TA3B 1NBYB 3BGAA 5ID0A 1L6XA 3CFKA 5E24E 4G6JL 4P4RA 3QUYB 1TVBA 1H3XA 1CLCA 3JV6B 2R0LH 5SWZA 3VFNB 1MJJA 5D1XC 1Q72L 2AERT 2MCPH 3FN3A 4NKIH 1QD0A 3L3HB 1R3LA 4CGTA 3OKNA 4MCZA 4RGOL 4J1UB 3QR2A 5I1GH 5IEHB 5FV2A 2YEZB 5FGCE 5DT1H 5CMAB 2OP4L 5IMOA 4ZPVA 3DBXB 5C07E 5J06A 1K6QH 4KHTH 1NMAL 3BWAA 5D96B 5I17A 1HYSD 4ZSOB 3PL6B 2CIIB 5E08L 2FSEA 5IB4B 1RZJL 5KSBB 1OWRM 2V5MA 3M8OL 1EBPA 2Y4SA 4LARL 5FYKU 2PYED 1Q0YL 5GGTH 5FYJD 5C0FB 3KPLA 4X7TB 3PP4L 1LK2B 3V8OA 3TA3A 1EK3A 4OZIB 4FQIH 4DZ8B 2GEEA 1VEPA 3QDMD 1BFTA 4EZMA 1FL6B 3FO1B 3QUYA 2HLFC 1WFNA 1HZHH 3MV7E 4KKCC 5ALCL 3JV6A 1NSNL 5EU6D 3L3HA 4ERSH 5I76B 3TN0B 4XC1H 5CGYD 1J7VR 3MJ9L 2RIKA 4XVSL 1PKQE 3LOWA 1MCFA 4BSJA 2HMIC 4YQXH 4JO3H 5IEHA 3TT1H 1I4FB 3VGAC 5DUBB 4M62H 2YEZA 1FDLL 4ODXA 2A6IA 3MOBL 2KQMA 4R4FL 1HOCA 5F6HI 4P5TA 4ZSOA 1RIHL 3PL6A 4FNLL 4XVJH 4GMSL 5IB4A 5TDNB 5F7EL 4QT5B 5EZOL 5DXWA 1NKOA 1NCWL 5IVXB 3FRPG 4R6UA 2D7NA 1LK2A 2WBJB 4MJIB 4YO0A 3ULVF 4HLJA 4KTEL 4U31A 1KBGL 1HI6B 2C3VB 4XC3H 4DKFH 4OZIA 1CGTA 4PLJD 3QHFL 4TULL 4CVWA 4DZ8A 3B5GA 3AS1A 1DSFH 1FL6A 5E8DL 3FO1A 3WFBL 5IEKB 3VFSA 3RP1A 1BGXH 3TWCL 4E41B 1OARH 5L8KB 1A6VH 1D5IH 4UAOC 4PGBB 3IJSB 1D5BB 4LSSL 5I76A 1YEIL 2EIEA 4DUVA 5J0BA 3EYVB 5I1EL 1AXTL 1JV5B 1KACB 5DD1H 4Y5XA 3N9GL 2E5EA 3VWJB 4JFHD 1I4FA 1RZ7H 3S36H 1FNAA 3V79C 5DUBA 1KCSL 2CIKA 4ZO9A 5KVEL 4P2QA 3IDGA 3MRGA 1F42A 5GGTA 1MHCA 2EDRA 1HHKB 2FATH 3OB8A 3TNMB 1XGRB 4WW2B 3MLVL 3P0YH 1A3RH 1N6UA 5I30H 3ARFC 4G80B 4QT5A 2J12B 3ARGD 3FQRB 4JKMA 1JGVH 5GHWH 5IVXA 3ARBC 2ED8A 2Z9TA 2WBJA 3EDFA 2QQKL 2V2WB 1C5DA 5EU7E 1HI6A 5J6GB 4O02H 4EI6A 1JF1B 2A0LD 2V2TB 4OSUH 4TOYH 1RJZB 4OD1H 3JUYA 5IEKA 5EIIA 1DQLL 5J1SC 4E41A 3MV9B 1KOAA 1D5BA 4P3DB 1VGKA 2QL1A 3WKMH 1WSST 2EE9A 8FABB 3EYVA 4GBXD 1EHLH 1GCFA 5AZ2L 3RZCC 5L8LB 3VWJA 3BZDA 7CGTA 3BJLA 5D2LB 1KELH 1FVDA 1Z6JT 3EFFB 1MFEH 12E8H 4BSWB 4HZLB 5CJXA 3QIUB 1EV2E 2BHZA 1HHKA 2BOBB 3QWRD 3K74B 2R4SH 2J88H 2W0KA 1MNUL 3TNMA 3CU7A 3D0VA 3TYGL 5CEYB 3WKNA 2X09A 1N6QL 4PY7B 2A9MH 4XGZB 4JQIH 4ONHB 3FQRA 2XY1A 3PIQB 4ZXBD 3BMVA 1UENA 3IGAB 3QFDA 4I0CC 3L3JB 1G7HB 1KTLB 3OAYK 2R69L 2RFXA 4PJ5B 4RAUB 2V2WA 5EN2B 4BSVA 5J6GA 1A7OH 3CVIL 2QKIA 1JF1A 1RZIA 1NDMB 2V2TA 1LE9B 4HKZB 1S7XA 5D7JC 1MJUL 1RJZA 2F54B 4TQEL 1NCBL 4UTBH 4PRHD 5DRNB 4R4BB 3T0XA 3MV9A 3LMJL 4P3DA 3UX9B 3WNPA 2BSED 1AI1H 8FABA 2D03L 3O2VL 4XP4L 4U1GC 4G7VL 3HB3C 4M4PA 1NQBA 4ZG1A 4IRSA 5D2LA 3RVVC 4EUPG 5KOMC 4GXVL 1YMHB 5HGGS 3CC5B 2BRRL 5F3HB 5IKCA 4TSCH 1I3GL 4YDJA 2X9XA 5F1NB 4BSWA 1JGDB 1S78D 4HZLA 1UZ8A 3QIUA 3UJIL 1MLCB 5L2KB 4NQXA 2R2EB 3LAFA 6FABH 4OF0A 1SYSA 4P23D 3WFEH 4D2NA 4PY7A 3QIBD 4XGZA 5HGDA 3NN8A 3TJHD 5EO1B 3PIQA 4AM0B 1C5CL 5EA0H 3L3JA 2F53A 2R0KH 5B21A 4XHQA 2QV2A 4RAUA 5EN2A 4YBLC 3BP6B 3KDMB 4JFFA 2ICES 4HKZA 1OY3B 3MREB 2F54A 4WDIB 5E8EB 1CFTB 1T2QL 3QPXH 4K8RL 4UAOB 3KPRD 4U1MA 4PJEE 4R4BA 2VAJA 3SDCB 1LEKB 4XX1G 3RUGA 3VMOA 1F11B 5F9JB 4XNYH 3QNXB 3DO7B 1MFNA 3L3GB 1XIWD 1CGVA 5E2VH 4DJMA 4OFKA 3ROOB 4OFPA 2MQCA 4LMQI 5F3HA 5J12B 3S3PA 2VUYA 1IC5H 3MOQA 5EBMB 1JGDA 3Q3GB 4XPHL 4FP8L 4KDTC 1KN2H 3ZYOA 5EU4A 3MO1B 1MLCA 4NRYB 4JJ5B 4YDVB 5F1KC 2R2EA 3F58H 2R0ZH 5TDOB 1DP0A 3LSOB 3NABH 3L5WB 1HH9B 5F7WC 4F8QA 3OKLB 5EO1A 1P7QD 4AM0A 4HUVA 4LU5H 2YPLE 2EEDA 4G9FE 3VXQA 4X6CF 4G6KH 3D2UB 2XTJE 2BK8A 4P2RB 2R2HA 15C8L 3EOBB 3KDMA 4X8JA 1IEAB 3LZFH 2W9EL 1JTTA 3TEUA 3MREA 1Q9OA 5E8EA 4OCNC 4JZJA 1CFTA 1FNFA 4LCIL 1DQQB 5IW3A 1EAJA 2QHRL 3L5IA 1I8MB 3MOAL 3VXPA 3SDCA 3C5JB 4JRXB 3V0WL 4H0HB 1YPZB 1ZT1B 4Y2OA 4NN7C 1F11A 1TTGA 5F9JA 3B2UD 3QNXA 1AGEB 4JFQB 4PRNB 2AJXH 3L3GA 3ROOA 3F7PC 4OTXL 4JJHA 4M03A 5I75C 3G6AB 3NCFB 5EBMA 3Q3GA 1A7RL 2O5YL 1OTUD 4Y19B 3RDTC 4XMKH 1YNLH 3FOLB 3DVFA 2I60H 4JJ5A 4NRYA 4YDVA 4NM4H 1NCAH 5TDOA 2IG2L 3HC4H 7FABH 2WQ8A 4HBQA 4Z8FH 2APWA 1TMCB 1BHGA 1HH9A 1INDH 3BQUD 3OKLA 1FFNB 1OCWL 1MIMH 1DANT 4PTTB 4OJFL 4XPTL 3ALXA 5D1ZC 5C08D 4HKXA 5IJVB 4P2RA 4X98B 3EOBA 2DQDL 2X7LB 2G5BB 1KYOK 5C71A 3QNYB 2B1AH 1C16A 3GSUB 2O5ZL 1A7QH 1DQQA 2BXZA 4MSWB 4NWTH 5GGSB 3TZVA 1I8MA 1U8IB 2LU7A 2R0LL 1IEBA 2MCPL 2UZIH 2BVOB 2ICEB 5IJKC 4Q7DA 2R29L 4MJID 3U7WL 1JZ3A 1AGEA 3FQUB 4ACPA 1WZ1H 5GGRB 5GRUH 2XQYG 2LU4A 3K2UH 5DT1L 2XZZA 5T1LD 1K6QL 3SDDB 4KHTL 3ECBB 3OKDB 1BBJB 5LCVL 3DMMC 5D71L 3B6SB 4MLSA 1B4RA 2ARJB 2KQNA 3QXDB 4Y0GA 5DJ6A 3ZE2F 4X5WB 3JTTB 4RMVA 1XF2B 5IJVA 1WEJH 4JPWH 4JQXA 3PHOB 3LB6C 3SQOH 3FN9A 5D7LB 3W0WB 3B9KA 3SGEH 3I75B 4XMLH 4ZFOA 5C07A 2FGWH 2E7LC 2VQ1B 3C5ZC 3QNYA 1NCNA 1MH5B 2IPUG 3B9EA 3GSUA 4MXVF 4NQCE 1FGNL 1JRHH 1U8IA 1EEQA 3KPTA 3VXRE 2BVOA 4K9EH 1CICD 2ICEA 4RFOH 2DTML 5JORA 1PW3A 5TQ0H 3NFNB 1IGMH 3QQNA 1F3JB 2BSTB 3FQUA 5LAXB 1F3DH 1A0QH 2CUMA 2HAZA 5GIRA 3TT1L 2AK4B 3MLWL 3ULVH 1RURL 5D1XD 2VXSH 4LOUC 3ZE2E 1Y6MR 1XEDA 3BPCB 4JREB 4NCC2 5DJ8A 3SDDA 3VGDA 3O6FB 4NN6B 2YS4A 5ITFA 5ISZD 1BBJA 2XA8H 3B6SA 3BRDA 2VDKL 3QXDA 3MLSH 3MLXH 1PKQA 1NGQL 4JKKA 4WCYL 3QP3A 3WXVH 4KQ3H 4L9LA 4OGZA 3FRPA 1SEQL 4X5WA 1L0YA 4M61A 4MXVE 1XF2A 3TCXA 2YWZA 3QEQB 4PJDF 3JSSA 1DQMH 1U58B 2IH1A 2JIXB 2VQ1A 1TZIB 3MA9H 4QWWC 1MH5A 4IMKA 3PXHA 2X70B 5D2NC 4I8DA 3DOSA 5LXGH 1KB5L 4YHYC 3KYKL 1WBYB 1A6VL 1D5IL 2VH5H 4EKXA 2OZ4H 4ZODA 4FABH 1DBAH 1NGWA 3NFNA 5MHSE 2BSTA 5LAXA 1OPGH 1RUQL 5FKAA 5JLZA 2VJXA 5I75B 1MCHA 1EGJH 2HLFD 4TTDC 4KKCD 5DJ0B 4N0CC 3FFDB 1MCLA 4AYFA 1KIQB 5TDPB 3V5DB 4DUXA 1RY7B 4QHLA 1EEYB 5GSVB 1J12A 4RFEA 2HMID 1SJVA 2Q8AL 5DJYB 1ONQB 3IETA 1T2JA 4PJDE 2CXKA 4HXBL 4R97C 4TVPE 3PWUA 4PJ7F 4A2LA 1S5IH 4J4PC 3V6FB 2KZWA 5I30L 3C8KB 3BPLB 5D1ZB 1P6FA 3SE9L 2DM7A 2YKLL 5KN5B 2VAAA 4RMUA 4K94H 4JY5L 1JGVL 3QEQA 3IAQA 1UCBH 2OTPA 5HGHB 2BHUA 2P46B 1U58A 3QXVA 3PDOB 1AHWB 2JIXA 1TZIA 3KPPB 4TOYL 1R3IH 1K8DB 4MAYC 3DGGA 5I6XC 2IANB 3GUTB 1FSKC 3RJQB 1WBYA 4O9HL 2IFGA 1WF5A 2P5WD 3UBXG 3U0TB 3ISWA 3WKML 3MQIA 3P4OB 5E99L 4EUPB 4U6XA 3DIFB 5EPMB 1P6AB 5DJ0A 5C3LD 3QCTL 5CP3H 3FFDA 4PJ7E 4V2CB 4P46C 4BZ1L 2EDXA 1S9YB 3UPCA 5LGHH 1EEYA 3G08A 5DJYA 1ONQA 2J6EH 2R4SL 3HMWH 4X83A 3WD5L 3SGEI 4AIZA 1I85A 1QO3B 5F7DA 3V6FA 2QSTA 2A9ML 2GAZB 2FX9H 4JFXB 3GSQB 1N3NB 4JQIL 5KN5A 4UV7H 1JRHI 1MPAL 4UI2A 1KJ2L 5C0BD 3RNKB 3ARDB 2OZ4A 4KRMB 5HGHA 3SKMB 4ZUUB 2VMFA 3U82B 3U46A 3NCBB 3O6KL 2VLRB 2WAHA 2P5ED 3PDOA 5IB5B 1AHWA 3KPPA 3T1FA 3OAYH 3ARFD 2BVEA 1EGJA 3SY0A 1HE7A 1K8DA 1XF4B 4JFDB 2IANA 3UYOD 3GUTA 1NBVL 3ARBD 2OXGA 1OAQL 4P49A 3OF6D 1AI1L 3P4OA 4BZ2L 1J87A 4L8BB 3AB0C 4EUPA 4A2MA 5I18L 5EPMA 1ZLSH 5IB3B 3MACH 1X4ZA 4CAGA 2F9BT 1AC0A 5FA3A 4JPVH 3DUSB 3HE6A 4UV4H 5JW3H 1UM4L 3OKKA 1Q9LB 4X9IA 2NY5H 4ZO7A 3S3SA 4M5YL 3IU4L 3RZCD 1QO3A 5J89A 1PEZA 1RUPL 4QRPD 2KUTA 3RWGB 1QLRB 4JFXA 3GSQA 1N3NA 3C5SB 2W92A 4M6OL 5K9JL 3SPVB 3RNKA 1MHEB 3ARDA 3SKMA 4PREB 3VRJB 4ZUUA 1H5BC 5J7CC 2IAMC 4LCWB 3AREC 4OZHF 2D7TH 2VLRA 4UILL 1K8IB 1B6UA 5CP3A 2H45A 1IGTB 4JFDA 1II4E 25C8H 4FFYH 4OLYL 1IC4H 1DANU 1F4WL 2GCYB 1TETH 1N26A 2J6EA 4NQED 5T3ZL 4JQVA 1H0DA 3V4UH 1JPGB 4ZO8A 2DDQL 5D7JD 5IB3A 4FG6D 4WFHD 1UG9A 1NMCB 3DUSA 2QBWA 4C56E 4K23H 3MJ8A 1D9KC 1WTGT 1Q9LA 3F58L 3HB3D 2MWCA 3QRGL 4OZHE 3RVVD 1MFBL 5ENWB 3V4PH 1QLRA 1GOFA 4L4TE 5IIEB 2FZ3B 4LU5L 3SPVA 1A9BB 2ERJB 1MHEA 4G6KL 4M6AA 3U48A 5GJSH 4LCWA 4Y5VB 3QCUH 1NCTA 1FL3B 4P9HH 5IHUH 5ALBH 4X6CB 4MAYB 2VLKE 2R1XA 4OLXH 1IGTA 1TZGH 1J0YA 3H9ZA 4GH7B 1KT2B 5DUML 3D9AH 1BREA 1MRCH 3JWOH 1YUHB 4OM0H 3EO0A 4YC2C 2VC2L 2YPLA 4JZOB 1Z0NA 5HYEA 4G9FA 4U1IB 2FECL 5CCKH 1FNHA 4QRRB 3QXAB 1QFUL 4N5EC 4ALAL 5EB9A 4TRPH 5DJZA 2AEIT 2X89A 4MS8C 4FOMA 4KXZI 3PWPB 3LPWA 1XF5A 5ANME 4MXWH 3X3GL 4GKNB 5MERA 1T0NB 5JO5B 1G9NL 4XMKL 4LNVA 2XWBB 1U3HC 3CFBB 3ARSA 2CUIA 3PV7A 7FABL 3SDXB 1A8JH 5ENWA 3VXMD 2FR4B 5GJTL 3T8XB 4JRYE 3G6JB 4ZTOL 2FZ3A 1BZ7A 1M1SA 3EHBC 4E42B 4ZD3H 4A6YL 1GIGH 4XMPL 5J11C 3A6OA 2F74B 1VGEH 1Z9MA 5KW9L 5JNYB 4Z9KB 4K8RC 1MJ8H 3SDAA 5GS0L 4X6CA 3WJJA 3MGOA 4I2XE 2B1AL 4J7RA 3K4DA 3E6HB 5IGXH 1TNMA 1A7QL 2R2BA 1KT2A 4HPOL 2FJHA 1YUHA 5CD5C 1YDPB 5TH2B 1LEIB 1OSPH 2H32B 4LHUD 3CSBA 4JZOA 3MCKB 5DRXA 4U1IA 3LS5L 4FZEH 4HWEH 3ARYA 3QXAA 1QRND 4OIAA 2AXGB 1Q1JH 1YY8B 3DTXB 5LQBL 3W39A 2ZUXA 4ZS6D 5BS0B 2G75B 2Z8SA 4HWUA 5J3HC 1QHOA 3CFDA 3BKYH 5JO5A 3G04B 2WWKT 4CN1A 4FQXB 2WUCL 4JFPA 5EZLB 4KROB 4S1SH 3CFBA 4EXPX 5FM5M 1F90L 1U8PA 4FFWC 3SDXA 3LEYL 5FO9B 3MFFA 3KXFB 3T8XA 5H35B 2GJ6D 3G6JA 4C59B 3I2CL 3RGVB 1GGUA 1UJ3C 4JGUA 3RDTD 1KTKE 1RUAL 5HGBB 4AQOA 4ZNEA 4KV5F 2F74A 3HR5B 4LL9A 5CLWA 3SKJL 2FGWL 4LLDA 4R8WH 1YZZA 2EIDA 2D0FA 4LVHC 1TCRB 4LGRB 1OTSC 3QQ4B 3RTQC 4N90D 3IDNB 1H3UA 2E7MA 3FO9B 1YDPA 3G5ZB 5C0EB 1RZKL 2ZKHL 2AJYH 3S98A 3A6BH 5TQ0L 2AXGA 3N85L 1T5XB 4O2CB 1X6LA 1A0QL 1YY8A 3DTXA 3IS0X 1IILE 1WITA 4LFHG 2AAVA 4U33A 2VXSL 1JGUL 3ZTNL 4LEOB 3G04A 5DS8A 1JPSH 1RU9L 4JO1L 4FQXA 5EZLA 2XWTB 1EHXA 3VXRA 3NCJL 2FHBA 4KV5E 5FO9A 3UP1A 5CWSA 3RVUC 3MLXL 3QISA 4PUBH 3KXFA 4R90H 5H35A 1SM3L 4WO4C 5I8EA 4ELKB 2AJUL 3HR5A 1DQML 1T0MA 3DMMD 3SE4C 2E7HA 5T3XH 4LLQA 5FCUH 3V2AR 3X11A 4QF1A 2DYPB 1JJUA 4KUCD 3W2DL 3QQ4A 4CVUA 3IDNA 4OFVA 1LE5B 4YUEH 5LXGL 4GT7A 4ETQB 2X4QA 4YC2B 3UBXB 3FO9A 3LB6D 3G5ZA 4PS4H 4PY8I 1F58L 1I75A 1S8DA 3QEGL 5KAQF 1KCVL 5JXEC 3WJLA 5ACMA 3C5ZD 4MA1C 4X6FA 1T5XA 5J13C 4POZC 2D9CA 1TITA 2ZP0T 5FV1L 4BFEA 3D3VE 4BH8A 4LEOA 2AJSL 3T0WA 5ETUB 3GGWA 4GUPB 1R5VB 2XWTA 2WMPA 5DWUH 1G7LB 1KPVB 1MCPH 2JJTC 2PF6A 1MCEA 4H1LH 1FZOB 1U3JA 1JNJA 4JHAL 4LOUD 3CZFB 4QOKB 5IHZB 2WIMA 1UCBL 4YIQB 1A9EB 3KYOB 1UXSB 3RKPA 1FYTB 2DYPA 3OSKA 3O3DB 4PJDA 1R3IL 3I3BA 1QR4A 1A6UH 5SWQA 2WZPD 3WLBB 4ETQA 1FP5A 2Z0BA 3UBXA 2YC1B 3VG9B 4F15C 4AK1A 4G43A 4JO2L 4WV1B 2BY1A 4JFOB 4Y1AE 5DUPL 3DNKA 3L1OH 2DD8H 1B2WH 4FXGA 1TQBB 2VLJD 1XT5A 4X7SL 5IROA 2AV7B 4IRZL 3H9SB 2G2RB 3K7UA 3VWKC 5KAQG 5ETUA 5LGHL 5AD0B 3LEXA 1VACA 3NFSL 2C3XA 3V5HA 2A83A 4KU1A 4AZ8A 3RL2B 1G7LA 4RMWA 3BKCH 3CFIC 4TTDD 4LSQL 4FFVC 4N0CD 2NY1B 2EYRB 4GRWB 1UJ3B 2HVKB 3PUCA 5CJXC 4R0LC 1QACA 1U8OB 4QOKA 4UV7L 1MI5B 1HQ4B 3FHAA 5IHZA 2HKFL 3OR7B 4LSUL 4PJAF 4TUJB 1A9EA 3KYOA 4KKBC 2ZCHL 1EEZB 4PFEA 1JPST 1UXSA 3OPZL 5DJCB 4J4PD 3IDYB 1R24B 3O3DA 4LPYA 1TZHA 1KN4H 5HYFA 3WLBA 2EH8H 5IMKB 4HMEA 3UBXI 4NGHH 1EFXD 4WY7H 4WV1A 3D39B 3U9PH 4B7IA 4JFOA 4ZUTB 5I71C 3O8XA 1UB6B 3SEPA 4L3ED 1I7ZB 4H1LA 4RWYH 2BNQB 5MI0C 2AV7A 3QG7L 3U0PB 3O11A 4LRIC 5D7IB 2G2RA 2BNRB 2FEDC 1AQKL 4XPFH 3KNBB 4HCRL 5AD0A 4OGXL 2DL9A 4PYGA 4QHNB 2OL3H 5ESVB 5HVHC 2ICWB 4IRSC 5E9DE 4L8DB 5CBAB 4F37K 3VD4A 4PJAE 3QUZB 1WWAX 4G6AC 4P46D 1MQKL 2HFTA 4HC1H 4WO4B 1MI5A 4L4VB 1HQ4A 4H20H 3V0VB 3NOIA 3OR7A 4XAWH 5DQ9B 3QA3B 3T2OA 5H94A 3LDBB 2NY7H 3C9NB 2F19H 2VYRE 3P4MB 2P4AB 43CAB 5B4MC 1I8LA 4JHBA 5IMKA 3IVKA 4M7ZC 2DLEA 4MJ6B 4RRPA 2GUOB 4F37F 4ZUTA 3UTTE 4FQLL 1JHLH 4Z0BH 2NY4C 4G6MH 1UB6A 1FFOB 1I7ZA 2O5XL 2BNQA 3AY4C 5D6DC 3C09C 5HHOB 3U0PA 4M7JH 5D7IA 4Y88A 3IXTB 1LDPH 2CLVB 2BNRA 3KNBA 4N9GA 4UBDC 4NBZB 5ESVA 3UTSD 3IAGC 2NY2C 1QSFE 4L8DA 1J1PH 3QUZA 3T0EE 4DN3H 5EIQA 3V4PL 1B4JL 3DSNA 5ADOL 1JNLH 3L95B 4Z5RB 3CSYA 2BY0A 3T1WA 1JMZA 3DHMA 2Y07L 1CFSB 2NCMA 4Q74A 3KR3L 5DQ9A 1JWMB 1T04B 2UY6A 3KPQB 4CMHC 4O4YL 5F96H 4DVBB 1KCRL 1WUNT 3SGDH 1G7MB 1BWWA 4JHWL 5LBSH 3AVEA 5DTFA 3JWOL 1LD9B 3F8UB 3NGBC 2OL3A 2GUOA 2QSCL 3LQMA 2IAMD 1PQZB 3KG5A 3ARED 4NN5B 4ODTH 1GZQA 4ODSH 3MJGX 4QEGA 2W60B 4JZJC 1G6RB 3FB7B 2DWDB 3MUHL 4MNHA 4HC1A 3VWKB 2AKRB 3E6FB 3IXTA 3NPSB 5C09B 4XTRC 1SJEA 2P48B 4Z7NF 5FOBA 1ZXQA 4CU6A 1NLDL 4WGWB 2HRPL 2IPKB 2NY6C 3O81A 3QUXB 5DZOA 1IQDB 2ICWI 2DLHA 4XT1C 4KK9C 5HDQL 4NNXA 1N4XL 2NXYB 4Z5RA 1DUYB 4O2FB 3ES6B 4XPBH 1YMME 1CFSA 2X4RB 4YNYB 1D9KD 2YZ1A 3SJVB 5DYOB 3V5KB 2YOCA 3KPQA 1VGEL 5FO7B 2BY3A 5MENB 2ZPKH 4DGVH 5D1QC 1E4XH 3BSZH 3EZJB 1MJ8L 1G7MA 3K2MC 3MRKA 2HTKC 3WHXB 3TO4B 1I1FB 5IGXL 3KPSD 1AFVH 4WI7A 1DLFL 3P2TA 1GC1L 1OSPL 4HIXL 4RDQG 3WIHL 1U8NB 3WN5B 1PQZA 4Z7NE 1YNKL 1UXWA 4FZEL 5DVNA 4HUMB 3IFNL 1G6RA 3FQWB 1Q1JL 4J8RB 2DWDA 3TZVC 1KFAL 2HKHL 3STLA 2AKRA 1J10A 1QBMH 1P5UA 5C09A 1E4KC 4NCC1 3SBWC 1AH1A 1YEHH 4CVZB 4JM2F 4D8PB 4KDWA 4UQ2B 3U30B 4XCEA 3QDGB 1S7RB 5M95B 1G7PB 2IPKA 5DD0L 1SEBB 3HC3L 1BOYA 3VXOA 5LWYH 1RMFH 1IQDA 4LCUB 1PBYA 5ACZB 4MS8D 4MAUL 4XPGH 5HVGB 3U4BH 2B0SH 4N0YH 3FO2B 1DUYA 4O2FA 5HDLA 3ES6A 4XCCL 2X4RA 2E27L 3SJVA 5DYOA 3VFWB 3V5KA 1U3HD 4HV8B 1A7NH 3HTLX 5FO7A 1FNLA 4R8WL 1PDKA 3WHXA 3TO4A 1I1FA 3EHBD 2XRAL 1X5IA 3TIEA 3B9KC 5FF6B 5C70A 1IT9H 1BX2A 4NFDA 4YHOH 3WN5A 3H7LA 4L29A 2AJYL 5GS3A 1HHHB 5DJDB 5IT2H 2VLLB 4K8RD 2EDDA 3FQWA 4GQPH 3C09B 1T7YA 1Y18B 3LKRB 1G9NC 2VL5B 4RMRA 4TVPL 3FCTB 2NTFA 5D93C 5B38G 4D8PA 3CXDH 3PF2A 3QDGA 1JMXA 4XP1H 1J1OH 1DBKH 3UTOA 1SEBA 5ACZA 5CLTA 1YEGL 1T7XA 5IQ9B 4PUBL 4R90L 4KHXH 3SGDI 4YR6B 5J3HD 4NZRH 3MZTA 3LHPH 1OD7A 1CZ8L 3GBML 2VE6B 3C08L 4HV8A 2R1YA 4CMHB 5GS0C 2V5YA 5CHNB 4FFWD 4KDVA 2NXZC 2N4IA 4NZUH 4E0RB 4Y5YB 3QO0B 5IFAL 2W0LA 4L9LC 5IESL 5C0CE 3OBAA 1I9JH 1NGYB 3BEVB 1SJXA 2OR8A 4Y8AA 5A43C 4C57C 5FF6A 4Q6YA 4PS4L 4XAKE 4RX4A 3NMEA 3RZWA 3NH7L 1HHHA 3CMOL 2VLLA 2Q20A 4U6HB 2YWYA 3MRMB 3U7AA 1OTSD 3ULUH 3RTQD 1U91A 5EBLA 3LKRA 4MNGB 2DQEL 1X5ZA 3WFHB 4P57B 1T1WB 3GJEB 3IKCB 1RPQA 1MRFL 2ZUYA 1P2CB 3FKUS 3D0LA 3QIWC 1JI2A 3T4AA 2NY3B 1UQSA 2VR4A 4HX1B 1OGTB 3MYJA 43C9B 5F72S 3HZMB 1CT8B 1E4XI 2RCSL 5IQ9A 4NQSB 2KPNA 5J4MA 2DOCA 4PP2A 4YR6A 4PRID 1MCWW 4OUUA 2ED9A 2OI9B 4LNRA 1N5AB 4JPKH 3HMXH 2YSSB 1HHIB 4M6NH 3W82A 2DL2A 4CMMB 5CHNA 4OZGF 2EYSB 5GS2H 4D0BB 1A1MA 3DRQA 1NUNB 5FO8B 4Y5YA 4E0RA 1EUTA 3QO0A 5EZIL 3UTPD 4PTUB 4CDHA 1OL0A 3E2HB 2ZUTA 3C8DA 1G7JB 5E2WL 2YUZA 4QXGH 4P5TD 5D70L 5EUOB 4WEBH 4JGJA 3BVNB 3GMRB 1LP9F 5DZNA 5DI8B 2R9HC 2DRUA 1LO2L 4U6HA 5BMFL 2R1WB 3MRMA 4I18C 4ODBD 2DMCA 4MNGA 3UDWA 5IW6B 1I1AC 5ERWB 1OVZA 3WFHA 3AS0A 3MXWH 3HG1B 3FQXB 4P57A 4PJ8C 5F7FA 4CADB 1T1WA 2C5DC 1BMGA 1KGCD 3VXNA 1P2CA 4JKPL 5JXED 3LRGA 3O9WB 3QI9B 5KVGH 4HX1A 4N1HB 1K3ZA 4R26L 5EU7C 43C9A 1NCDL 4POZD 1MRDL 4XP5H 5DGRA 3BKCL 2WUBH 4NQSA 4Y1AA 4LSRH 2D7MA 2VDMH 2VXTL 1JZ6A 2PCPA 4C55A 1BIHA 1VPOH 4LVNC 4CMMA 1I85C 4GMTH 5EZJA 3TLRA 3Q1SL 4NSKB 4OFDA 3T77B 1LP9E 4TN9A 5FO8A 3QEUA 4P2QD 4PTUA 2Q86B 5JOEA 1KN4L 3UTQA 2ZCKH 3MX0A 1G7JA 4XXCA 1PSKL 4X6BB 1FZJB 2FCBA 3QAZC 3BVNA 1YEEH 2EYTB 1X5YA 2GT9B 1IBGL 2R1WA 3FFCE 3PWJA 4JM4H 5I74C 5BV7H 1UA6L 4APQC 5F3BB 5JDSB 2AJ3B 5IW6A 4RWYL 4U3XA 5ERWA 1C08B 1J05A 3WLWC 3HG1A 4GJTB 3FQXA 4CADA 5BZWB 3HMXA 5AAMA 4YBQC 5DC0A 4XPFL 4EDXA 2Y6SC 2OL3L 3BDYL 3O9WA 5I1HH 1P7HL 1JN6B 2MPAL 1KEGH 4X9HA 5EC2A 1RIVH 3VGEA 5F1IA 1CBVL 1E28A 1S9VB 3HE6C 2CGRH 3BGFB 4S1QH 1I9EA 2CLZA 4H20L 3EYUL 5FAAA 4WI6A 4ZUVA 2I26N 3NIGF 4NSKA 5E6ZA 3CK0L 3P0VH 3T77A 5BV7B 5E5UB 4HS3A 1U95A 4TYUA 1WBZB 3HPLB 1H15B 1EX0A 2OYPA 4X6BA 5FXCH 1LO5B 2P42B 3PQYD 4IMLB 4KKBD 4L8SB 3EYFB 2VDQH 3EO9L 3WFZA 3VDBA 2GT9A 3LN5B 3AXLB 3VFGH 3CDGB 3SOBL 4G6ML 1EAPB 1LHZA 2AJ3A 3OG4B 2XN9B 1C08A 2V5SA 4UTAH 2LQRA 4M7JL 2E6QA 5DLMH 4OZFG 4PG9B 1G9MH 2VZ1A 4EI5B 1JN6A 4FMFA 4PGEB 2EE6A 3TGXA 5M7QA 1J1PL 5ESAB 3QFJB 4QO1A 3FO0H 1KPUA 1G1CA 1S9VA 2CRZA 1JNLL 5DVKA 1SHMA 4KH2A 3CLEH 5E2TH 4NPYB 2FEDD 5SX4I 1I7TB 1JYXA 1CLYL 1IAKB 4P9MH 4IRSD 3MODH 3HI1B 1B9ZA 1EO7A 4LBEA 2F8OA 2ADIA 4G6AD 4Y4HC 3V7AE 2ZSWA 1WBZA 3HPLA 1DQJB 3QUKB 3MV8E 4M6ML 1A6WL 1AP2B 4ONOA 1A5FH 1K9TA 2NW2B 4NZJA 4L8SA 3EYFA 5DD3H 2PNDA 5EOCJ 3RY6C 3LN5A 3AXLA 1LEGA 3WV0A 5IB2B 3CDGA 2XIDA 3FQNB 2XN9A 2F53D 5FUZH 4JEGB 3JUZA 3CLFH 1CXLA 2FGZA 4M93B 5B4MD 4L4JA 1K4DB 1IGFH 1P4LB 5DD6B 5DJ2B 5E1AB 4JFFD 4I3GA 1MHPL 2XTJC 1DBMH 4HXAH 3ZDZF 4EI5A 3CH1B 1PD6A 1ZLWH 3LPGA 2X4PA 5EO0B 2NY4D 2N56A 4RGNB 5HI3C 4PGEA 5ESAA 4UDUB 5B8CA 3EIFA 5F6IB 1Z5LA 1FO0L 4LVNB 4XPBL 3NVQA 3VXUE 4UBDD 4AEEA 3VG0L 5BZDB 1IAKA 1U8QA 4HJ0C 4KTDH 2NY2D 5E4EC 1LGVA 4OD3L 1I3RB 4F33B 3L7EB 3BSZL 1TVDA 1KUMA 1DQJA 3QUKA 4KJQC 4GG8B 3LIZH 4U3HA 3QAZB 3ZT6A 2FX8L 4ISVB 4GRLC 1AP2A 2NW2A 4JPIA 5C0NC 1QQDA 3SDAC 2K7QA 4N8CL 4IDJH 5GSRA 1UC6A 4OT1L 3WJJC 1XR9B 3ZDZE 3PE9A 1CDUA 3FQNA 1G0XA 1ZEAL 4XCNB 4XNQB 5J56B 5B38B 3BHBB 2AXFB 5DK2B 1QBML 1MAKA 4J3VA 3RX5A 1K4DA 1P4LA 3C2AH 5DD6A 4OAWB 5DFWH 4KWUA 2Z35A 3CH1A 1YYMH 1RSFA 5HYQB 1S7TB 2R0WH 4WEUD 4JM2B 1IZJA 1M05B 1FLRH 3OR6B 4NQDD 4PB0H 5J57B 5KG9B 4XTRD 4OM1H 3Q6FB 3MRRB 1XF1A 3C6SB 1E6OH 5HHMD 4P9HC 4XVUC 2AK1H 2NY6D 2Q7NA 5I19H 35C8H 1QLFB 1CQKA 1I3RA 4HIEB 1F2QA 4KK9D 5IBTH 2ZG2A 4BH7B 3BZEB 3MRNB 3JWOC 4H8WH 1O0VA 4ISVA 1ZTXH 5EOQH 4PIRF 3OAZK 2DIAA 3WNMA 3EKCA 3PP3H 5D1QD 2GSGA 2UUDH 4PJFF 1XR9A 4XHJC 5F6HJ 3QUML 4LCYA 2HTKD 3DVGB 3H0TB 5B38A 3O2DH 1E6JL 3RA7H 1H3GA 1M4KA 1X5JA 4LLWB 2EO9A 1KLGB 2XZCH 5T3ZD 4J3TA 4KAQL 4ODWB 4PJXB 2MJWA 4PRPE 3E0GA 3CXDL 1CDCA 1L9NA 2EKSB 3DXAB 5JPMB 5EH1A 1WZLA 1XR8A 1CR9H 4JM2A 3TZVD 1M05A 4OBRA 3S34L 2ADFL 4KHXL 4LDEB 2NPLX 5H37G 4NZRL 1OP5K 2YD9A 3U2SA 3Q6FA 2ZUUA 1S7SB 3C6SA 4L1DA 4NNPL 1BFVL 1QSEE 1QLFA 3O45B 5AUMB 1U8HB 5A2JH 2XPGB 4G8GB 4GAJL 1FE8H 4I77L 4P99A 4LPWA 4PJFE 3SGJA 1T21B 4BH7A 3BZEA 1HCFX 3MRNA 3IU3B 1ZE3C 1GC1C 1ZGLM 1Q38A 2VDLH 1FRGL 4X8XA 1ZLUK 3RFZC 4NNYB 5HJ3B 2FLRT 3I9GH 1B3JA 1QFOA 3NIFF 4X99B 4CRPA 4U0RC 4PJCB 1SY6H 4QGTA 1OGAB 4QHKI 4KC3B 4MDIB 3R1GL 4HGMA 4MJ5B 4OCLC 3H0TA 4PJIB 3T0VA 3B9KD 4LLWA 1KLGA 4Y16C 2BFVH 2HA1A 4YHLH 4ODWA 2QR0A 4HUWB 3EOTH 1NEUA 3WJLC 4H88H 3MNZB 2ORBH 1DEDA 2EKSA 2XOTA 1CGUA 3DXAA 1TQCC 2FBJL 4OCXL 1A2YB 3ESVF 3T4YB 1FAKT 5CJOL 4MMZC 3VFUB 1PG7W 5IR1A 3GMLA 4GKZB 3TM6A 4JPKL 2YD5A 5E94B 3HUJB 1ZVSB 1FGVL 5ICZB 4JZNA 4YE4L 3O45A 4QXTB 5AUMA 3ORJA 1U8HA 4XH2B 1QBLH 1YEFL 2XPGA 3GSWA 4UT7H 3G5YA 4G8GA 2VO5A 3NIFE 1AD9B 1T21A 2ZSVB 3IU3A 1NL0L 1WFOA 3MV7D 3O2DA 4GRLB 4OZGB 1UKQA 1XGYL 1NAKH 4WHTB 3TBVA 4AEHL 1RZFH 2BNUB 4WEBL 4NNYA 1ZHNB 4X7CC 3VD3A 4EOWL 2NXZD 3QPQC 5HJ3A 5HSFA 3WHE0 4X99A 1GGBH 5DDHA 2ATPB 2DICA 4MDIA 2YN5A 3CFCH 1KPRB 5GGRY 3LS4L 2NR6C 1G6VK 3B3IB 3X13A 4P2OA 1T4KB 2XFXB 1NC2A 4HUWA 1A1OB 1UB5B 4OQTH 3D69B 3RWDB 5ICYA 1ETZB 3MNZA 3TT3L 2FB4H 3REWB 4O51B 3WYRA 5C0AE 5E2UH 3EFDH 1A2YA 2NX5E 4U2YA 3T4YA 3PDDA 4OZFH 1RFDH 4LSRL 2VDML 4PP1C 4GKZA 1LO3H 4WFFE 4NOFA 3HUJA 2BXYA 1ZA3B 1M71B 1ZVSA 3K3QA 3MZGB 3QIWD 3A0OA 5ICZA 4QXTA 4GMTL 4XH2A 3U36B 1SY6A 3LH2H 1KC5L 5DRWB 2ZSVA 4OFYD 4OZGA 2ESVE 4Y4KC 2VR5A 1F5WA 1JGEA 2HP4A 5HYJB 2BNUA 5FECB 1ZHNA 1R6VA 2FD6L 2WINB 3BH8B 2BSRB 4F7EB 1FVCB 5C0GB 1IC7H 1KPRA 5IUSA 3X14B 4OZFB 3H42L 1K4CB 1LP9A 2GFBB 3B3IA 1EZVY 3QQ9C 1T4KA 1CE1L 5DHYA 4BK5A 3IB4A 1R3HB 5GGVL 1A1OA 2OXHA 3D69A 3H3PL 2YUVA 4ODHH 4NUJB 2GK2A 3RWDA 1ETZA 2X4OA 2R9HD 3M45A 3HAEG 4JG1L 1PZ5A 3O8XC 1F6AB 3O6LH 1J8HE 3REWA 4FTVB 5J1AA 5CGMA 2YD1A 3LEVL 1I1AD 4WUUB 4DK3A 5BRZB 4PJ8D 1M6OA 5EU5A 3W5NA 1MSPA 3O2WL 5I66B 1FL5B 3C6LB 3LQZA 5MEQB 5C7XL 1ZA3A 1M71A 1CFQB 2CMRH 2R8SH 3U36A 4OUOA 4F9LC 2R15A 1HYRC 1JPTL 5DRWA 3C60B 3GO1L 4YLQT 4P5MB 4XVTL 3MCG1 5KS9B 3I3DA 3D25B 1RHHA 4OQTA 3KWWB 1DVFB 4OZ4B 5FECA 1T6WA 2OJZL 5TGBA 1N64L 4Y4FB 1QPPA 2CO6B 2BSRA 4F7EA 4XXDB 1FVCA 5IVZB 4LIQH 4DK6A 1RIUL 5C0GA 5AWNL 3ARUA 4OZFA 1K4CA 5FYKE 1B90A 4UTAL 1GHFL 3ZDXF 4MX7A 5JW5B 4NUJA 1JWSB 3S35X 5FOJA 3I02B 3X3FH 1FG2A 1F6AA 1H3PL 3DYMA 4KPHH 2EXYC 4YH6A 4AL8H 4APQD 5MP6H 4OLZH 4FTVA 1XGQA 1FBIH 2AVGA 4WUUA 3WLWD 4KZEL 4OF7A 2E9JA 3CXHJ 3CLEL 1CL7L 5E2TL 2KZ1B 1FL5A 3C6LA 3QULB 4YBQD 3KPNA 4HK0B 5DGQA 3V6OC 1WIUA 1CFQA 1DEEB 1X4XA 1NFIB 3CDFA 4XWGH 2AS5M 2E7BA 3ZT5A 1UYWH 5HVFB 3C60A 4G8IA 1OP3K 1DTUA 3HE6D 2VSDA 5KS9A 1N5YH 4K71B 3KWWA 4N0UB 4KVCH 3QO1B 5JIIA 1TJIH 1DVFA 5CILL 3ZDXE 5E5MB 3MR9B 4HT1H 4YJZL 5IVZA 2EE2A 5JHDE 4U6VL 3OL2A 4ZO6A 2HN7B 4LVOB 1BD2E 2PTUA 3NTCH 3GHEH 4M5ZL 4JR9L 1IGFL 2CLRA 3MV8A 3HKFA 1JWSA 1Y6KR 4HXAL 1BVZA 3I02A 2YD7A 5JHLH 1TPXB 4DZBB 3EYOB 1N7ML 5IMLB 5IFHH 1OAZL 4X9GA 1CFVH 4ZAKB 3QULA 4GXUN 3KHOA 1AE6H 2EIBA 4KKAC 5HI4C 4H26B 4NJAH 1BQHG 2DQIL 1G1YA 4U3CA 4M48H 5H37H 3LQAH 4UT6H 1DCLA 4HFUH 2FRGP 5DMIL 2ICCA 4N0UA 4YHNB 3VDAA 3UPAA 4WI9A 5IBLD 3MRJA 3VXUA 4DGYH 3SE8H 5E5MA 3MR9A 1HINH 1QLEH 5E6IB 4LPTA 3S37X 1Z9OA 1OLLA 1U36A 4Y4HD 3GNML 3DRTB 1Q9WA 4QRSB 2AEWA 3FOMA 3EOYG 3TBTA 2JJWA 2YA0A 3HRZB 4UDTB 5EULV 5BO1L 2W9LA 3KS0J 2DF3A 3C2AL 2XY2A 3CCHA 3QXTA 2C9AA 4LF3B 2BMKB 1GVIA 3GMOA 3RJDA 1S7VB 2E6JA 5T1KA 4KZDL 4DZBA 1S5HB 1LNUB 3INUH 4K3GA 3LRSB 5IMLA 4K7PY 2I9LB 3REVB 1HN1A 3EJYC 1BFOB 2YPLD 4D3CL 3PGFH 4G9FD 1QBAA 2XTJD 1E6OL 1AO7E 1LO0H 4PB9H 3GB7A 4WFGE 2X89D 4V1DB 4RISL 1T22B 1IGYA 2VXQL 4D9LL 1KJ3L 1C5BH 4FQPA 1CGSL 1DQDH 2BSSB 1EJOH 1O7VA 3NAAL 4F7TB 1NDGB 1A22B 3D18A 4HJ0D 4OV6F 5EOQL 1KNOB 4WWKB 2YD3A 4NHCH 5HHVH 3MROA 5E6IA 5C9JB 4FQJL 5TE6H 4HHAB 3DRTA 4DN4L 3MLPA 4KJQD 3IRPX 4YK4C 3GM8A 3TVMA 3HRZA 1KG0B 1I8KB 1DBJL 1QFWI 3VXSB 2V17L 2H1PH 4C83B 2WWKO 4I0PB 4CJ0A 3SDAD 4BQ6A 3CPLB 1SMOA 4CKVX 3B2VH 2ZOKB 1S5HA 1LNUA 5IFJB 3REVA 2IALA 5CIPB 4MB4A 5BW7C 1BFOA 3FN0L 3GKWL 2DJ4A 4LQFL 4NC0B 2P8MB 1OP5H 4RGMC 4EDWH 2ZUQC 1T22A 2F5AH 1FE8L 3DSFH 4YZFF 1AGBB 3SDYH 2BSSA 5EBGA 4F7TA 1NDGA 3OX8A 2OMNA 4JB9H 3Q5OA 1QNZL 4ZFFB 4XVUD 1KNOA 1CF8H 3MBEC 3EDKA 4Y2DA 1UKSA 3G9VA 3LKQA 1T20B 3F62A 3L7FA 1UCTA 2ITCA 3F5WA 4JFEE 5SWSB 3F7VB 2A73A 2DLFH 2BFVL 3MLTB 3GJFH 5GRZA 3CVHL 2DBJA 4I0PA 3FB8A 4J23A 2RJMA 4XHJD 3GDBA 4ELMB 1N8ZB 2PXYC 2GTWA 2ZOKA 4H25B 3KYNB 1KLFA 1OW0C 2XNAA 4YZFE 1BQUA 4FS0A 1A02N 4UIKL 2A9NH 3PWNB 4LGPB 3RWIB 1FVEB 4XNZB 3N1QC 2P8MA 1QKZH 3LD8B 4XP6L 4RIRB 2KBGA 1U93B 2AI0H 3QG6B 2P47B 1GOGA 4JN1H 4NQCD 1GH7A 4DGIH 1GOHA 3KAAA 2EDWA 1NAKL 3GJFB 4HGWB 3V6ZB 3VXRD 4ZFFA 2ZJSL 5IM7B 2BCKB 1BAFL 4PJHF 3QDJE 1FIEA 5J6HB 3O4LB 1GGBL 1MEXL 3UPRB 2X4UA 3SGKA 3CFCL 4WHYG 1V7NH 3BAEH 5SWSA 4WI2A 5DJXB 4FA8A 5SX5K 3T65B 1SJHB 3MLTA 5C0RH 4YAQA 4Z77B 3HAEB 1EO8L 1PY4A 3ZTJG 2HH0H 2VITB 3H6JA 5FGBA 1LO4H 2FB4L 4HWBH 3KYNA 4F58H 1CDGA 3QNZB 1RFDL 4Y16D 3T09A 1N0LA 3PWNA 3ZYJA 4PGCB 2DQHH 3RWIA 4L3AA 1YEJH 3L3IB 4CDGC 3LRHA 2NY0C 4BFGA 4JDTH 3CGTA 4RIRA 5TFSH 5F21B 3FB6A 1U93A 5M94B 1F00I 3QG6A 4DCQB 4PLOB 4FQCH 2HT4C 4LASH 1XF3B 2BOCB 1WGOA 1MCOH 2NX5A 3HLAB 3GJFA 4WI5A 3V6ZA 4WGVB 5IM7A 4LVEA 1T03L 4HS8L 5F1SA 2GITB 5A1AA 4OCYH 2CPCA 4RMQA 5MHSD 3O4LA 5GS1B 4YK4B 2EEBA 2Y23A 5F7HA 1IC7L 1U8JA 3KHQA 4BQ8A 4XXCC 2E9WA 2ZNXA 4PJ9C 3T65A 2EE3A 4UT9L 3SHSA 4Z77A 3HAEA 4MB5A 4I5BB 1RULL 2YR3A 1LDSA 3QPQD 3GBLA 4IJ3B 5CP7B 3ZT7A 2AEQH 4C54A 3MLRL 1FO0B 4NJ9H 4TVPD 4U6YB 2Z8RA 4G7YH 1FN4B 1ZANL 5FUOH 2NR6D 5DD5H 1S7QB 4HQQH 1NC4B 3G6DH 5KSBF 3QH3B 4ZYKB 5I8KL 1IAOB 5BXFB 5KSAA 3I84A 2N7AA 2WQRA 2CMRL 3L3IA 4HUKB 3ROLA 5DHVH 5DRZA 4N5UA 1E4WH 5F71A 4FXLA 4P2YA 2BOCA 1J8HA 5D5MB 4PP1D 1BVKB 1VKXB 4J6RL 5I1DB 1RK0B 2P45B 2WSKA 3WFCH 1J0ZA 4KI5F 4HWBA 5GS1A 3WIFB 4Q9QL 4KJPC 4MNQB 3CDCA 1OAYH 3GHBH 5FYLE 4HH9A 1BQSA 4ZSOE 1I1YB 4Y4KD 4R3SA 5AYUH 5KSBE 4I5BA 3BPNC 1INQA 4M8QB 4NFCA 3QZWG 2IJ0C 4AL8L 4OLZL 1FN4A 4OZIE 5CKGA 3QQ9D 2DWEA 1NC4A 2I5YH 2CKBL 3ZKMD 1EMTL 2X5PA 3QH3A 4ZYKA 3OJDB 1IAOA 5CJBA 5BXFA 3TIDB 2DJSA 1ND0B 3Q6GL 5F7YC 1BLNA 3O8XD 1BQHB 1CLZL 4XWGL 3LV3B 1A7PH 4NKOB 4JE4B 5GRJH 3B8YA 4QYOB 5EUKA 4KI5E 5FYJH 3STZA 2VDNL 2G60H 4QTIL 5JXAL 5D5MA 2Q6WB 2PO6C 1RK0A 3OKMB 4EJ1C 3BN9D 4OCSH 1OP3H 5I1KL 3QUMB 1CU4H 4TSAL 4UB0L 5D7KE 3ALPA 3CUPA 4DUWA 4LHJB 3WIFA 1J1XH 4MNQA 4M1CC 3MV01 4GW4B 4GAYA 1ODAA 4KJWC 3T0EC 1BZ9B 1I1YA 3CD4A 4HBCH 2FX7L 4P3CL 4PR5B 3WO4C 3RHWK 3NACL 2PETA 1J88A 4M8QA 1F2XK 3S96A 3I50H 3T0BA 5DHVA 5HHPB 5IVXE 5JHLL 4WW2F 4MJIE 2PYEB 4ORZC 1AQDB 5JHDA 1CFVL 1X5GA 3CMGA 3TIDA 4LLVB 5I16A 1K2DB 4PLKC 5GISH 3L3DA 3QDMB 4OGYL 1ND0A 1BQHA 4FHBD 5TE4H 4E41E 1AE6L 3MRCA 2HT2C 3LV3A 4NKOA 4HULB 2EXYD 2X10A 2B5IC 5CUSL 4EIZC 5EU6B 3N1PC 4NJAL 4PG2A 3KLSA 4M48L 4UT6L 1UKTA 1ES0A 3IDIB 3BH9B 3RHWF 1BEYL 5CEXA 2QQLH 1XZ0A 5F44A 1X4YA 4DGYL 2VKXA 2J3SA 1HINL 5CJQH 3K80A 3O41B 3WDJA 4GW4A 3OXSB 3UEZA 3U6RA 2OM5A 1K3IA 1U2CA 2D9QB 3JTSA 3CXHK 3AFLA 3TV3H 3LKSB 4C56D 1Q0XH 1A1NA 4RQQB 1QSZA 4PBWD 4DKEL 4PRBB 2CXGA 4M7KL 1MWAL 2PYEA 4YEEA 3IDXL 3T2NH 5IG7B 1H3WM 3JZ7A 1AQDA 2XZAL 1IKNA 4L4TD 1BVLB 2IQAB 4M1DL 3PGFL 3WMSA 4LLVA 1K2DA 3QDMA 1CK0L 2WK2A 1VA9A 3MV9E 2MNUA 4QRUA 5IK3A 5EU6A 3FT3B 5GRVK 4IIQA 3G5XB 2FDBP 2VLKD 3IFOB 3SKOB 1R3KB 5EOCH 4K2UH 5DJAA 3BH9A 3PXJA 4LMQE 1DBBL 3RAJH 5D2LE 3S35L 1WT5C 2JELH 2OR7A 2V6HA 1FIGH 1QSVA 1OQXA 4KKAD 2A6DB 1XIWC 3BYTA 5HI4D 4NT6B 3QEHB 5HHVL 4KY1H 2BVPB 3O41A 3IRZA 3OXSA 4OV5A 3FAXA 1A64A 4X4ME 1IGCH 2OTUB 4YXHL 4F57H 5HPOA 4F7MB 4GLRH 2H1PL 4DTGH 3DETC 3VXTB 1S7UB 4RQQA 1AR1C 4X4YB 1GJIA 3ARGB 4PRBA 4HGKC 3WIIL 2M2DA 2C1OB 4WHYH 1WWCA 1OM3H 4PJ5E 2NZ9C 1JFQH 1CN4A 5CGTA 4JRYD 4R4NC 3GSNH 3JWDH 2IQAA 2D2OA 3ZTJH 2ZCLL 5BVJB 2F54E 2HJFB 2V5RA 5F88B 1ZGLA 4NO0B 1FZMB 4M7LL 4PY8J 2IFFH 2PKDA 2MMXA 1MFAH 2CK0L 1BBDH 2A38A 5GRWA 1IJ9A 1ZVYA 3DSFL 3EJYD 3IFOA 3SKOA 1ZV5A 1P4IL 3H9HB 2P8PB 4GBXB 4PV8A 1JGLL 2K9UA 3B2UC 3GSOB 1CF8L 4NT6A 3QEHA 2D7QA 5TPWL 1LK3L 3MNVB 1WWBX 5L2KE 1IAII 1ZMYA 3H7BA 4GKSB 4TPRL 1CS6A 3NPZB 5CZKA 3GSNB 4KUZH 2DLFL 2F5BH 2OTUA 4MA7H 3QXUA 4NM8L 4F7MA 3VXTA 1F4HA 1N59B 1YJDH 4ZXBB 5JIPA 1WK0A 5LGJA 1F13A 1NMBL 3N1MC 3MLYL 4OIIH 2BJMH 3HI5L 1DN0B 3VFTA 4F7CB 1P7KB 3KJ6L 2C3HA 3L5XH 5CJ5A 4IOSD 2DLIA 5HHXL 1UWGL 5BVJA 5HGAB 2VN7A 2I25N 2A9NL 3H3BC 3IFPB 3UJJH 4PGZA 4YGAB 1OSZB 1J11A 3TBYA 3S37L 3MRLB 4FQHB 2X1QA 1QKZL 2YK1H 4J3WA 4PRHB 2YMXL 5E0QA 2RQ8A 3IFLL 4OLVH 4JO4L 2Q8BH 4H8WC 1QRKA 4Q6IA 5E1HB 2AI0L 5T1MB 4FQ1H 4BK4A 4Z7WF 2DBLL 3MRIB 4XNXH 4GBXA 5I8OH 3BE1H 5JW4N 4Z7UB 2A77L 1DR9A 3HRPA 1ORQB 2W0FB 1YPZF 1FJ1B 4JDVA 2VQUA 5C6PB 4KI1A 4LDLB 3TH2T 4O58H 2OSLB 3BAEL 4PJHB 1PZUB 3GSNA 4P23B 1WLHA 3QIBB 3MBED 4L5FL 4XCFH 1N59A 2HH0L 3LVEA 5SX5H 2NYYC 1IM3B 4ZXBA 3WDHA 2MKLC 1MCBA 4P2RE 3HI6H 4P2OC 1TENA 2DN7A 1JUFB 5DFVC 4KMLB 5I9QB 1HEZB 4ZDHB 3KPMA 5HGAA 3NBNA 2FEEI 3IFPA 5D72H 1OSZA 3MRLA 5I8CB 4LAQH 4PRHA 2PXYD 3KPRB 3I6KA 1AGCB 4JRXE 3OHXB 4JDTL 4LCCC 1YPZE 3S36X 3OXRA 4JLRB 5T1MA 4JG0L 4FQCL 2EDYA 4LASL 1CICC 3Q48A 2WIIB 3GK8L 1F4YL 1M7IB 4Z7UA 1D5ZB 1XIWB 1CLOH 5FYLH 3UYPA 4GLRI 1ORQA 5FYKL 3ZE1F 5EORL 1HH6B 3QWOB 1FJ1A 4Y19E 4I0KA 1FC2D 2P8LB 3MUGB 5KVFL 1AXSB 2OSLA 4PJHA 1FPTH 2H6PB 2VDOH 4P23A 4WW1B 3D3VD 5JDJA 3ZKXC 3QZWB 1NLBH 3EOAB 1P7QB 3WHE1 5AZEL 1KCKA 4KRLB 3JXAA 4FZ8L 4HLZG 3V52H 3HZYB 2IF7A 2X44D 2JCCB 1JUFA 4QKXB 4U1LA 3HZKB 1HEZA 2MFNA 2I07B 1VFBB 4XNMA 1X7QA 4DOHB 1D5MA 1NAMH 2DQUL 3BIKB 1MY7A 1SMAA 4I3SL 3KPRA 1AGCA 2IQ9L 4KVNH 1K5NB 3WXWH 4L3CB 5E6YA 2ZOLA 4ZFGH 4M1GH 2WIIA 3ZO0A 4RFNB 2OK0H 4G3YL 1NBYA 4HF5L 1ZT7B 1M7IA 1D5ZA 3FHQA 4NCDA 2HFGH 4YX2H 1V8HA 2LE9A 2NY0D 1NGPH 5T1DL 1HH6A 4FMKA 3QWOA 4Y1AD 1X5XA 4LLAA 3OZ9H 1ORSB 3VFNA 4Z6AT 4JHZA 2HT4D 4PV9B 1MFCH 1AXSA 3PG2A 1G9EA 2CJUL 3R8QA 4GAGL 4WW1A 4OQ1A 5LJYH 4J1UA 3CFEB 4OLEA 5FM8A 1NAMB 3EYSL 1XFPA 3QZWA 3W9DB 3BQUB 1P7QA 3D48R 4YDKL 5L6YL 4W81A 3QYCA 2BX5A 5D7LE 1X5KA 5GGUB 4U0QB 5C08B 3W0WE 3HZYA 5CMAA 1CL7I 3DBXA 4R96B 4PJ9D 3F7YB 2I5YL 5DQDL 5EBWB 2I07A 1VFBA 3OJVC 2CIIA 3HNVL 3TCLB 3A67H 1G84A 5KSBA