2B1HH

Crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug29 peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
226
Chain Sequence
EIQLEQSGAEVKKSGESLKISCQTSGYSFSDYWIGWVRQMPGKGLEWMGIFYPGDSDSRYSPSFEGQVTMSADRSTNTAHLQWSSLKPSDTALYYCARLGGDYEDSGADAFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 2219, light chain
total genus 40
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1hH01
1EVTC 2E7HA 5HHNA 4ZNCD 4NJAL 4K7FB 2XZCH 2OZ4A 3I3DA 3L3DA 3EHBD 3WFDH 4XB7A 4LBEA 3GJFH 2NW3B 5L7XH 1N59B 1CU4H 4IOFD 2XY1A 3EYUH 2A6KB 1FNSH 1NL0H 3B8YA 4KK9C 4OKVB 4XP4L 4YNYB 2W0KA 5IK3A 5I1EH 4QOKA 1MEXH 4IM8A 1I85C 1LO2L 4L4TE 3VMPA 3PWNB 2HG5A 3BWAB 1BBJB 2Z92B 1YEEH 4KAQH 4HV8B 5AUMB 2UY7A 2NNAA 1F3RB 5FKAB 4N0FA 4YGAB 3D2UD 4JN1H 3QIUA 5DDHB 2VZVA 3TYFB 1IKFL 2VIRB 4PY7A 4ONGL 2WBJB 1F6FB 2DLGA 4AL8H 3NCBB 2FGZA 1ZLSH 2CGRL 5I73B 4OCXH 3UJJH 2AK4B 3TA3D 3FN3A 5IP4A 3DGCR 4L3AA 4OZHE 1T89A 3PJSB 2WBWB 5IVXE 4LAQL 2IADA 1LE9A 3H42H 3OAYK 3NIFF 4N8PA 4UOW1 4LU5L 4TULH 3MJ9L 1G7JB 3PWPE 4F3FA 2VLRE 1TQBC 1XIWD 2QR0A 4WY7L 4C56E 4BK5A 5SWZE 3IJYA 3TVMB 4X83A 1XGTA 4D9LH 3FO0H 3HE7B 1I3VA 2QQLH 3DX7A 5IV2A 4KZEL 1LGVA 5JOPE 2EKSA 3JTSA 1FBIL 1QRKA 4PREB 4WWKB 1MHCA 2PW2A 4WI8A 4XPBL 1U8NB 3FO1A 4LCWE 4Z0BH 1QUNA 2VZ3A 4OGZA 5TQ0H 4JY4B 3MRNA 4KH2A 1CICB 2VLJE 3RX8A 3BP7A 4PB0H 4LEXH 3MNZA 2R1YA 4IMKA 2WBJA 4G6AC 2ICEB 3ROLA 1CLCA 1JNLL 4HWBH 3IFPA 3MA9L 2HKHH 3HUJB 2I9TA 1SY6H 3MNWA 4XPFH 2IMNA 4KUCF 3V4UH 3K80A 4N0YL 3FB8A 3MRLB 1C16A 4H8WL 4XPTH 1E27B 2HLAB 4WEBH 3KXFB 2JE8A 1U8JA 5TF1L 2ZUQC 3B2VL 4AM0B 2Z8WC 3HZKA 2GJ6A 3GSUA 4IRJC 5GZOD 5TDOA 1A6AA 2YUZA 5DK2B 1KN4L 43C9B 5HY9A 3MNWB 5E99L 2A6KA 3GMMA 3JTTA 2D7MA 5D7JB 3MRHB 5CD5C 1GHFL 3L3GA 5C71A 3IDMB 4LIQH 4MAYA 2AAVA 3I6LE 5LGHL 2WAHA 1XGYL 1S5HA 5D1ZD 5BXFA 1JUFA 4OTXH 5GRVK 3NABH 4EOWL 2IALB 3FONB 1QP1A 1CD1A 5BS0B 4ODWA 1OAQH 5E6IA 1Q94B 5K9KA 5CLWA 4XRCA 1ZT1B 3S97C 3HAEB 4DOHB 1FGNH 2EKSB 5EWIL 1L0YA 1Y6KR 2ZG2A 3W9EA 1WITA 2MJWA 4P3WA 1T2QL 5ESVA 1BVKB 1IAKA 1P7QA 1YN7B 3CFKA 4NQSB 3X3FH 3BKJL 4Z7VF 3CLFH 5ADOL 1YQVH 3SY0B 1NCNA 5BQ7A 2VC2L 1ZTXL 3G5ZA 4KKCC 3VXSB 4ZOEA 1QHOA 5CSBA 2HT4D 4HK0A 3SOBL 5HYEA 3WN5C 3AREA 1KELL 4GBXB 4MYWB 3BW9A 1CFVH 5T5NG 4CMHB 4M9OA 5ENWA 2J88L 1JNNL 5CKGA 3TBYB 5ID0A 2OR7A 1DN2A 4YXKL 4OFVA 4E5XA 2CK0H 3S37H 2D0FA 5TGBB 2DN7A 1DANT 3QDGA 1DLHA 1BQHB 3CAFA 4D94A 3VU2A 4KK8D 2J8UF 4YHNA 2EDBA 3KJ4B 3B2VH 1Q9WB 2WQRA 3T65B 5JPMB 3B5HA 1X4YA 4H26A 2GY7B 4X0KA 2EXWC 1QSFD 3DURA 5JXAL 4BFBD 4RMTA 4GRMB 5CWSA 5HBBA 3D18A 1Y0LA 2DQDL 4WW2A 2QADC 1RUML 4OLZL 3TH3T 2MHAA 4ZUTA 1ZS8B 5L7XL 3MA9H 4HWBL 3IDXH 5H94B 1N5AB 3MRQA 4GG8B 5E7BA 1ED3A 2H9GB 3ES6B 3MUJA 4RFEA 4HH9B 1W8NA 3OZ9H 4V1DD 1CFNB 1YYLH 5ACLA 5FYLE 8FABB 2AV7B 3WLBB 5GSVA 3EYVB 4P5KB 4AZ8A 3U2SA 4WGVB 4DKAA 4L8BB 3BDXA 1IM3B 3DBXA 5C0AB 1GGIL 2FATH 3HS0B 4YDJB 5J1AB 2XV6B 3WNMA 5CCKH 2CMRH 4LGPB 3MRIA 2BMKA 4NOFA 4XVTH 3KLSA 4TUJB 3LY6A 3T0VA 1AE6L 3GFUA 1FH5H 3VXQA 4KPHL 1S5IL 1T7XA 5IB4A 1KTLA 5HVHB 1NCWL 4I0KA 5F9AC 3MACL 3MRMB 3NVQA 3X3GH 4KK9D 5LWYH 1JJUA 4MHHI 1OPGH 1OD9A 1JV5A 2W0LA 5SX5K 1CD8A 1RUKH 4YZFF 1TZGH 1G0DA 1CD0A 1F5WA 2PO6D 4P0DA 3MGTA 4QTHB 4PJBB 5F96L 5C0BD 3BDBA 3UO1L 1MFDH 1P9MA 2XN9E 1U8OA 3BE1L 2DM3A 4JFOB 5CIPB 2DI7A 1XGUA 3EOAB 4JG1L 4FQXA 2DYPB 4HX1B 1KC5H 4PD4K 2GTWB 1XGQB 1F4XH 3HRPA 4JRYB 3H9HB 3ARDB 1IQWH 1MIEH 3GK8H 3VXUA 5I6XB 2ZP0T 4RGMC 5DTFB 1ETZA 4CN1A 5HYQA 4GBXD 2WBJC 4LCIL 4GMTH 1CFQB 4PLJC 5EU6A 4A2LA 5I8OH 3O0RH 3CH1A 4K3HA 2EH8H 2WUCL 5C09B 2VDPL 1P84K 1T1WA 3GSNB 1F45A 3VFNA 3FT2A 1T22A 1HCVA 3C5ZC 4M7KH 3VRLF 4ZPTA 3RNQA 2P7TA 1EXUA 1S7UB 4XH2A 4XCFH 3S5LB 3HG1E 1KIRA 1KGCD 1FRGH 5F1KC 1FC1A 3RL1A 3RVVC 1VPOL 4RBPK 3DRQB 5CZXD 5F21B 1JPSL 3CCHA 1T5WA 5C0RL 2R29L 5FUZL 4L8SA 5F6IC 1I7UB 5I1DB 1KPRA 4S1DD 2PCPB 1HHHA 1DBBL 1AP2B 3K0WA 5FYJU 2V5MA 4D9QD 3V5HB 1II4E 3HA0A 4GKSA 3WNNA 3DLQR 1JCKA 3K74B 1S9XB 4LVHB 5E6IC 2EDXA 4KJPD 3PABA 2Y7QB 5A2LH 5CD3A 3FZUD 4QNPF 3JV4B 1MFNA 3O3BA 4XNQB 2BNRE 3A6BH 5HI4C 2V9RA 1BQHG 4WWKD 3HE6C 1JN6B 2CO6B 2E9WA 3MMEB 4NKDA 4Z78B 1TITA 4EI6B 3BHBA 3BUYB 2Q87A 1D6VH 3CFJB 4RFNC 5E2WL 1OTUD 2PYEA 4KKAC 1D5IL 3AREC 4IJ3C 4Y1AB 5E8EB 1T0NA 4OLVL 4Y5YC 1U0QA 1XF3B 3GMNB 2OJZH 1MCFA 1NCDH 5DRXB 4ZMAT 4MZ3A 2DTSA 5MHSD 2YBRA 4Z7WE 3MCLL 5GGTL 1EGJL 3MRDB 5F9JB 1NGZB 3DROB 2VL5B 5HYQB 4NC2B 2V2XB 4WI3A 4Z95H 4ZUUA 2CK0L 3U0PB 4PR5A 2YZ1A 1LE5A 4XZUB 3RBSA 2VR4A 3ARBA 3P77A 2VISA 4J1UB 4PJ8C 3LHPH 5DHYB 4M7JH 2ITCA 3CMOH 3RGVD 3VXOA 2XTJC 3P0YL 4G6FD 2XPGA 5D8JL 5DSCA 1ZEAL 4L4TD 3RKDC 3KR3H 1CLYH 4XB8A 4CVXB 4DQOH 4UB0L 1AGCB 4K7PY 5E94A 4KI5E 5C0CB 2AQ3A 1U58B 2PYED 4MSWA 4H1LB 3BH8B 4OF0A 4LHUG 4TSBL 1N6QH 3KPOB 3O11B 1P4LA 4R0LC 3ILPA 1EO5A 1QO3B 2CDFB 2FEDC 3R1GL 3WHXB 2O93L 3HKFA 4ODVL 5EORL 1QEWA 3MV9E 4NNPH 1LP9F 5EIIA 3U9UB 3QO1B 3IYLW 3ZKMD 4ZQKA 4KROD 5F1NB 3HNSL 2Q1EA 4LCIH 4PJEF 1MNUL 4PJEB 4RDQF 3QFDA 4Z0XB 5I1CL 2HFEB 3MV11 3QG6A 5DVKA 2F53E 1DFBH 3NCCB 4HGMA 1A6TB 4MNQE 4JFFB 4KDVA 3SJVB 1U9KA 4B7IA 1I7RA 1XF5A 5IEKA 2NQCA 5KVMC 1BVZA 4ZO8A 1PY9A 2VH5H 4XVSH 4KY1L 4Y0GA 1N8ZA 3LN4B 2NY3C 3RWFA 5MEQA 1S7VB 1OL0A 3UTOA 5DRNB 2VQ1B 4U0QB 2GSIA 5C0JA 1TETH 1EEYB 1R3JA 2ARJA 5H94A 4C56D 1UVQA 5FA4A 2P43B 4FFVD 3RZCB 1XH3B 3B2UD 3PE9A 4B7LA 2ZCKL 4HK3J 1OB1B 4JHWH 3SGKC 3HMXA 3AMKA 1VCAA 3VFOA 1QFUH 2HWZL 1MJ8L 3G5XA 4MQXD 4TPRH 2AQ1A 4NKOB 5KG9A 3O6KH 1EHXA 4JQIL 3MQIA 4D0DA 4N1HB 5FGSA 1TJHL 3B9EA 5T3ZE 4L9DA 5D93B 5I8CA 2XPGB 4E5XB 2R1WA 3VXOB 3GJFB 3KNBB 2H6PA 3L5XL 2YRZA 3O4OB 2WIIB 3PV6A 4GRWH 2B1HL 3LZFL 3LKOA 1P4BH 4HKXA 1IM9B 4ZPVA 1A3LH 1KJ3L 3FN0L 4ZFGH 1FL6B 3MO1A 1INEH 4K3DL 4R3SB 3L5JA 1F4WL 4KJQD 1TZHA 4GXVL 2RAMA 1RIVH 4MA3A 3C5ZA 1SYSB 1BLNB 1IC5H 2JIXD 1RQ5A 4UOJA 3BZFB 4K2UH 2ERJC 4YDVB 1BZ9B 1KIPA 4RNRB 1UM4L 4FN0A 1BVKA 1P7QB 3QO1A 1Z9SA 2CXGA 2Z93B 1EZVY 1JWMA 1FVDB 2XICA 2ZCLL 5I8KH 1Z5LB 4XP1H 3C2SA 3V5KA 2F53A 1ZWIA 4XBGB 4ONGH 4HJJL 1KCUL 3ARZA 3LCYA 4RAUA 1WAAE 3RAJH 5D2LA 2P1YA 3O9WD 4PBVC 4YJZL 4OGXL 1IGYB 3GBMH 4LKXB 3OWEA 1QRNB 1NFKA 3S4SB 4YHKL 2SEBA 2AXGA 2Q8BL 3HE6A 4KUZL 3VGAB 4P5TC 4OZ4B 5C2BL 2VISB 2OCFD 4FQJL 1LVEA 1PYWA 5DRWB 2P24A 1VSCA 4X9FA 2X1WL 4JQXA 3H9SA 4NIKB 5M94B 1CU4L 2VITB 3DROA 4Z77A 2WW8A 3ZYJA 3U48A 4Z77B 1YEFL 5F93C 3QA3A 2KUTA 3ETBF 3ORJA 4UINH 4X5WB 4QXUL 5DD1H 5HVGB 4NO0A 1IL1A 2B8OT 4NQEB 4QO1A 5FDWB 4U1HA 1WV7T 32C2A 4QHNA 4RGNE 2Z0BA 5DEZA 3BP7B 2XA8L 5I6XC 4GS7C 2EDLA 2EYSB 3RX7A 3TPUB 2PO6C 1D9KC 1INDH 3ARBC 1H8SA 2K7PA 4HPOL 4IRSA 4Y88A 1TLKA 3T8XB 3IDXL 1AD9A 2GQHA 4WTXA 3DX7B 1TETL 1NGXA 2FEDD 3D3VE 4HF5H 4Q6IA 4J23A 4YHYB 2UZYB 4R96A 5FGCB 5GPRA 4PJ9D 5DVMA 1U2HA 2EYSA 3HG1D 3QT2A 4HD9A 1LK2A 1MJJB 1HSAB 4FQXB 5JNYA 2Z93A 4QRRE 4LNRA 3S37L 1T7ZA 3B5TA 4KZDH 2B4CC 4PGDB 3LSOB 3TO4B 5CINH 2C9AA 4XAKD 2HKHL 3DMMD 5I17B 1TQBB 4QTHA 4XAKE 4JKKA 3D69B 4WFGD 3TNMA 1ZTXH 3MV7E 3QDGD 4M8QA 4NQDE 3BRDA 1GZPA 4WNQA 4YK4B 2AXGB 1RUAL 2CUIA 4P2RA 2A83A 3F7VA 3MCG1 4Y4HB 1X3DA 3O2DH 1QG3A 4LPYA 2QADD 5C6PB 3U7YH 3PL6A 5D5ME 4JZJB 3WUZA 4IHOA 2VDML 3MNVA 4MXWL 4Z7QF 3IDYB 5A16B 3PGCA 1FZMB 4YWGH 5H8DA 1ETZB 1BBJA 4YK4C 1F2QA 3C5SA 5I9QC 1J86A 2R2CA 4YBQD 1CG9B 4U1LA 4FQJH 1LDSA 2GAZA 4LNVA 3RZCA 3VRIB 1VPOH 2ED9A 4WDIB 5IMLB 1I85A 1S9VB 1NLBH 1NUNB 2BVTA 3FTGA 5DHXB 3SGKA 5GRXG 3GMQB 2DWDA 4OV5B 4ORGA 4RGND 5DK0B 5EC1A 1ZGLA 4JFDE 1GOHA 2AEWA 5K93A 1N0XH 3CVIH 3ULUE 2OL3A 2QSVA 4HWZA 5AD0A 3VXUE 4NYLA 4OM0L 2YA0A 3CLFL 2CDGB 1N26A 2XQBL 1B4RA 1T20A 4GAGL 3RU8L 4GRMA 1HKLL 4Q9RH 4G6KH 4G43B 5HVHC 1IKFH 4XWOD 2FO4A 3QI9A 4NNXB 2ZCLH 2DOCA 5I8KL 5ALCL 5FB8B 4GG6B 3HMXL 1U8IB 1WGOA 2DDQL 4JANA 5DR5L 3QG6B 1NBVH 3MJ7B 3VCLB 2NYYC 3MRMA 4XNUH 2A6JB 5DO2C 5T1DL 1RJLA 3NFNB 5I8CB 1T89C 2QHLA 4JRXB 4FQLH 1F90L 1RJLB 5IOPA 5EIIB 3MV8B 2CR3A 3QIBA 4OF8A 4L4VE 4PJ7F 3PWUB 5ANMB 2NZIA 3C5JB 3FCTA 2Y36H 3VXRA 3TIEB 3KGRA 3BH8A 3U2SB 3O6FB 2JJUA 4UU9A 5KOVC 3VXSA 3G6JF 3WV0A 1UACH 5EU4A 3GSOA 3P9MB 2AEPH 2OX5A 3P0GB 4JFZL 2H9GA 4JJHA 1FGVH 3RP1A 4JFEA 4M6AA 4N5ED 3VFMA 4Z7NE 1G6RA 5I16B 2ATKA 3GSWA 4WW1B 3CXDH 1QPXA 2NY3D 5BRZB 1KYOJ 3MYJB 4RDQG 2NTFA 5F9JA 5EBLB 2PKDA 3QQ4B 3PGCB 4KQ3H 4YHLL 1E4WH 4HUVB 4JO4L 3I9GH 4Q7DA 1HOCA 4Y16B 4JQXC 4GMSH 4TVPH 1J1XL 3JTTB 4JVUA 4LSVL 1F58H 5E5RB 2FD6H 4Y4HA 43C9A 2B2XH 1EEUA 2ADJB 4HKJA 4UQ2B 1TVHB 5ETUB 1NMAL 3KHOA 5GRVL 3MLYH 3AXLA 5EBMA 1E4WL 3WS6C 1HQ4A 5IHUL 3BIKB 2YD2A 4H88L 4F8TA 5IFAH 4OAWB 1C16B 3KPSB 2R2EB 1CS6A 4FQPA 4MAYC 3QDJB 1RZKH 4JZOA 3RL2B 2PO6A 3BH9A 3S35X 1DBKH 3IFPB 4XHQA 5B3JF 5IG7B 2Y7QA 3NCJL 1X9QA 5I30L 4CVZB 5DSCB 5ISZE 5JNYB 3WE6A 4NHCL 4LVEA 1HEZB 2KH2B 3E2HB 3VI3F 4N68A 4OSUL 5C0EB 1FCCA 1MI5D 2OP4L 4KFZC 2D03L 5GJTH 1KPRB 4RFOH 4JO3H 5GS1B 2WINA 4NRYA 3V6BR 1TMCB 1BD2D 4UT7L 2HVKA 5LWYL 1C5DA 4OT1H 1FIEA 2XTJB 2BSRA 1CGSL 4NQDD 3WIHL 1CLYL 4DQOL 3G6JE 1PZ5B 1ZLUK 1GSMA 3DIFA 5FUOH 5AZEH 2MPAH 3IJYB 4LDEB 3KYMA 4WFGE 1CFTA 2ZUWA 3O3DB 5EFIA 2OR9H 4MDIA 2Z4QA 1DBBH 4MJ4A 2Z8RA 2GFBA 1K8DB 5KSAC 1QZ1A 1V05A 2BSSB 2ED8A 2QHRH 1WVZA 3ESUF 4QHLB 5LBSL 4OFIA 2IQAB 2PXYC 5J13C 4W70A 1F42A 3FMGL 1PKQB 5D2NE 2FD6L 3OGCA 4Y4KA 4X7DC 5I1IL 5IHBA 3L3KA 5GJTL 4Y5XB 4GQ9H 4KHTH 2P24B 3HPLA 5E9DB 3MLXH 4KXZH 4O2FA 2VXQL 1O7SA 2YZ8A 1CR9H 2ZCHH 5AWNH 4QRPA 4OZIB 1DE4A 4FP8L 1FYHB 3V5HA 1XGUB 3EOAA 3PWPD 4HZAA 3RWJB 4NSKA 2FJHB 3DECA 5GHWL 4MNQA 3NCYS 3KPNA 2X9WA 3ILQC 1JGLL 3TT3L 5BZDA 4ZUWA 3SQBA 5ADPL 2NY3B 2G60H 4FQLL 4JFZH 5B39B 4WFHE 4G42A 3RIFF 3IU3B 4ZAKD 3FHAA 4H20L 4YFLF 2AKRA 4NO3B 3WL9A 4BZ2L 3WCYA 1WK0A 3S3JA 5IB4B 1MOEA 3UTPE 3QI9C 4DEPC 2XQYG 3WXVH 2IJ0C 2WLZA 2JIXB 4LRNL 4HUXA 4RWYH 4PJHA 3BPOC 2XFXB 4HUMB 2DTML 4K23L 4L5FL 1RJCA 1CFBA 3RWIA 4Y5XC 4YDJA 4E41A 5IFHH 35C8L 4N5EC 12E8L 1NUGA 1JGUH 2NY4C 2VE6A 4AQOA 3O4LB 1DJSA 3B6SB 3BD5A 4NUJB 4YHPB 5I1GL 4X4ZA 4Y4FA 3WO4C 4YUEL 4DTGH 5EO1B 5L6YL 1XAUA 1JI2A 3O0RL 3PNWA 3V0AC 3GSQA 4BQCA 4BQ9A 5ILTL 5E08H 3TFKD 3MRPB 5CJ8A 1MCDA 1V7NH 5E8OA 4PJBA 2F19L 3PXJA 5IBLC 5D2LE 4OD3H 3FOMB 2VXUL 3H9SE 4P57A 1FL3B 4MQ7B 3S37X 1NC2D 5FCUL 2CRYA 1Q9WA 4LOUD 3MROA 5FKPA 4AQ1B 1RURL 4UI2A 2GSIB 5C0JB 3HAEG 1YJDC 3QNYB 3O3AA 5C3TA 3RWFB 3LN4A 1H3GA 4NHUA 5H35A 2R8SH 2CJUL 1I7ZB 2JIXA 1DUZA 1U3HA 3OAZK 4HK0B 2ZNXA 4MJ6B 1MCWM 3VXPB 3SE9L 1HIMH 3IU3A 4QT5B 4WEUD 3ZT7A 4ZQKB 3K2UH 3RWDB 3IJHB 5C7XH 1Q8MA 4NN5C 2JB6B 2VR5A 4PJ9A 2D9QB 3RIAK 1AFVH 2K1MA 4ZUTB 1UWEH 3GI9H 3TEUA 3CLEL 3UZQA 2OBGA 1ZHNA 3IDJB 4ZO7A 3WUWB 2VC2H 3O45A 3QH3A 5BJTB 1DE4B 1CGYA 2GTZA 1OWWA 4OZGE 4RMVA 3BP4B 2DQGH 5LKNA 4CW1A 5FKPB 5E95B 4PJAF 3OKLA 2RIKA 5IVZA 3KPPA 3X11B 1CK0L 4KGJA 3IDYC 1YEHH 3O6MH 3G5VB 4PJ5A 1IC7L 4XNXL 2OS7A 2IEPA 3HZKB 1EMTL 5CP7A 1ZLWK 2IQAA 2QSQA 1DQJB 2BNRD 5IB3A 5E8OB 1K8DA 1E27A 3GNML 4RFNB 1WF5A 1PY4A 3BAEL 5DEFB 4JHBA 4ENEC 2YD5A 4HJGA 3EO0A 4G6MH 1IGFH 3DUUA 4JCLA 3CUPB 4Q0XL 3DIFB 4FNLH 1K3ZA 3F5WA 2QQNH 4LSRL 1TPXB 1MPAH 5HI5D 3I85A 4ZSOA 5HHMD 4CVWA 5SV3A 5T1MB 3RVTD 3BKYL 1MAKA 1CICD 3GHBH 5T3XH 4XBPA 3RY5A 3O6ML 4KRLB 7FABH 4Y7MA 3FQTB 4NO0D 4XNQA 3UPRB 4JO1L 5IHZB 4U6HA 2I5YH 4QRPE 1KT2A 4S0TD 4YFLI 4NQTA 2V6HA 4NFDA 1K5NB 3ZO0A 5TQ0L 1F11A 1AXSA 4O9HH 2PN5A 1QBML 5J89A 4Y89A 3GHBL 2R2EA 5TDOB 1TQCB 3VH8B 4DZ8A 3WKMH 2NXZD 2X4TA 3ULUD 3U4AA 4D2NA 2G2RA 4ZYKB 1HXYB 4XHJD 2XTJD 4TNVK 4Z7OE 4GKNA 1XFPA 3S35H 4CADB 4KKBC 4GKZA 4X6DE 4OZGF 4OZGA 3EFFA 3QWOB 4NKQB 2R0WL 5TPWL 2OTUA 4PBWD 3JWOH 1EJ6A 1CZ8L 4NN6B 2JKXA 4AIZA 2H32A 4PV9B 3PF2A 3AGVA 2YRLA 1NSNL 4OFPA 3VFVB 1U8NA 1OGTA 3GBML 4OZHF 4PJGB 5E8NB 5JXED 2X5PA 5J6GB 4I9WD 4WW1A 2ATKB 4ODVH 4RQQA 3RGVC 2AJSL 1I9JH 3VXRE 4XMPH 1AO7A 3Q5TA 4QRSA 4KDWA 1SY6L 4ZG1A 3W0WE 2P5EB 2EECA 4BA8A 4MS8C 3HTLX 4NKIH 1MFCL 1QBAA 4GAGH 3RU8H 3OX8B 1DQLL 1JWUA 1YA5A 4CJ0A 5EU4B 1RZIA 4S1QL 4XNYH 2DM7A 1OM3H 3KYMB 1X5ZA 3FB6B 1RZ8B 3D0VA 3HG1A 2NW3A 2VXVL 5FUOL 5AZEL 4KV5E 2WWMC 3RI5F 2EE6A 1C5DB 1QFHA 1FG2A 1R3LB 3GUTB 5E2VL 5J12B 3QO0B 5F3HA 3HFMH 3UMTA 3T2OA 1MNUH 4PTUA 3AM8A 4JRYD 3VE0A 3ZDXF 5FHAL 3QUKA 1JRHH 4IDJL 5BMFH 1A1NA 5GRYA 3TJHD 4F37F 5JOFA 3LZFH 3TZVB 3OXRB 3P4OB 5FF6A 4I2XE 3OKKB 4F7TB 1UA6H 4D9RE 1MF2H 4ZO6A 1EHAA 2EDDA 4S1SL 1ACYH 3K8LA 4ALAH 5JHDB 1H0DB 1L9NA 1A9EB 3C8KA 2F58L 3BAEH 3ZKNC 1ORSA 2FIRT 4P4KB 1TENA 2CDGA 2Y6SC 1DBJH 4PRDB 1JP5A 5EC1B 1T04A 4APQD 4YPGA 5FM5O 1ZGLB 3PWVA 1PEWA 4P48A 2BJML 1RU9L 4HIIB 3GZKA 1IC7H 2IBBA 3BGMB 2Q7YA 3QDMB 3CXHJ 4LHUB 3K46A 4N9GB 3T4YA 1W8OA 4FFYH 5FYJL 3VRIA 1LDPH 2UZIL 2VLRD 1BQSA 4IOFC 3SDXA 1F3DJ 4YR6A 4E41B 3QIBD 4XVSL 2HN7B 3MRQB 1OAYL 2ATPA 5C0AD 1KPVA 2OK0H 2OJZL 5D1QB 1H15B 1KBGL 4XCEB 1XR8A 4P5TA 5CJXC 5I1EL 2O5YL 3LEVH 4TTGA 4UZGA 3L1OL 4FABL 4OD2A 5ESAA 3U36B 2ZUQB 4K71B 3HI6H 1N7MH 4P59L 1JRHI 2O61B 1KJVB 5D7IB 4LLDB 4UDUA 3RPIB 2AV1A 4JPIA 2H45A 4XGZB 5DLMH 4JO3L 3TYGL 2C3VB 5GZOC 1XEDA 4YGVA 5CJQH 3LS4L 1MLCA 1YNKL 3BDYH 3HR5A 1G7IA 3VD4A 4OZGB 3R1GH 5DF0A 2B20A 3MRJA 3QUMB 4ZUWB 1KJ2L 2NCMA 1FDLH 2DQCH 1JPFA 4YDIL 1JFQH 4DFHA 1XGRB 4YH6A 5IF0A 1A7NL 1D9KA 3TN0A 2IPKA 3ALPA 4XNZB 1MREH 5IFAL 1JHKH 1UCBL 1YPZF 1H8OA 4H8WC 1FNLA 1Q72L 4NRZB 4K55A 4JREB 3EOTH 5GXBB 4JPKL 2DLIA 4K7PH 2D2OA 4WO4B 5FCUH 1LK3H 4UUJB 5HI3D 1SBSH 4LSPH 4OIIH 4IRSB 4UV4H 1E28A 4P46C 3KS0H 1OGTB 4MB4A 2P8MB 3F7YB 3T0BA 4NHCH 4O2CA 1TZGL 1KCUH 2BVQA 5JUEH 3INUL 5IMLA 3IXTB 4X5WA 3VG0L 4TSCH 1JZ5A 4NO5B 1JHLH 4KKNA 1BZ7A 3HNTH 4POUB 3H9SB 1QPPA 2XWJB 4P99A 5GS1A 4HLJA 3LKRA 2K3TA 4IOIA 2KZWA 4WI2A 3SO3B 1KUMA 3KYNB 4GAFB 4XMKH 3MFFB 3REVB 4WI5A 3PHQB 1JFQL 2CIIA 3KLDA 5FGRA 5EUOA 1IKNA 1QR1A 1OAZH 3O4LE 4MJIA 4E41D 1SMAA 2AJZA 4P2CG 3T0WA 3CFDA 4C83A 2UYLB 5JW4M 5K59E 3RKPA 4F57L 1GAFL 3EAKA 2FX9L 4PJFA 3EYFA 3MACH 5T33L 1HQRB 4B41A 3WN5A 3NH7L 1AIFA 4MA1C 4EVNA 1YPZE 4DGYH 3DNKA 5DJ2A 5D6DC 5GRJL 1FDLL 5IQ7L 2F54A 4HXAH 3C8HA 3SDAD 2NZ9C 1O7VA 1VEOA 1RJZA 2C7UB 4ZAKB 1V3LA 2W38A 2HFGH 3SGDH 5HPMA 1C5CH 3RNKA 3ZDZE 5IB3B 4PG9B 3JSSA 4OCYL 4XAWH 1AD9B 5D70L 2X2YA 5DUBA 1K2DA 1NAKH 2WIIA 4OF6A 1FL5B 2X42A 4K7PL 4YBHA 1B9ZA 2C4FU 2YD3A 3MJ8B 3BP6A 3VRLE 1X5AA 2VXSH 4WW2C 4D0DB 5DJDA 4X4YB 3HNTL 1R5VB 5D1XD 5IB2A 2P8PB 1P4IH 2OSLB 5C0FA 3TYFA 1ORQA 4HS6B 5IVNA 1SYVA 3EJYC 1LILA 4P57B 3PIQA 1C7SA 3IU4L 1SQ2N 4WW2F 1KXTB 5D2NB 4CL7A 3MLSH 4BH7A 3OF6A 1ERNA 1KIQB 1MHHB 3BGFC 2FWOA 3LS4H 1YNKH 1MFEL 4MVBC 4GSDL 4E9LA 4OCSL 1SEQL 4JEGB 4PYHA 3BIAX 5I15H 2BHYA 3BVNB 2D7PA 2M26A 5SWZA 3UYPA 4NUGH 43CAA 1I9RH 3M8OL 4D8PB 3DSFH 4I0PD 5GGVH 3E2HC 3WLWD 3KJ4C 5GS3A 4PJ5E 2YPLE 5EU7C 1AD0A 2O5YH 3LEVL 4ELKB 4DUVA 3EDFA 2CKBH 4MMZC 3Q0HA 2AGJL 1P5UA 1UCBH 1DDHA 1U6AH 5DJ8B 5B4MC 3NIDF 4UV7H 3MV9D 2IANB 4L3EA 1OF2A 3QDAA 4PJAB 4LSPL 3QHZL 2VZTA 4TVPD 1F3DH 1OT2A 1X5HA 2K7QA 4Z7WF 4RNRA 4CDGC 2AKRB 2CK2A 4NO3A 1TQCC 1UM4H 3ILPB 3JWDH 3T09A 3GMPB 1WIUA 5J1TC 1C1EH 1HI6B 2Q8AL 2I25N 2P5WD 4BM7A 4I0PA 2YD7A 3M45A 3MRPA 2FYYA 1A6VH 3FOLA 4HKXB 3WFZA 4P4RA 5CZXC 1MRCL 4TVPE 5DD6B 1CI5A 1JGDB 3CFBA 4ODXB 1NGWB 2OXGA 3EDJA 1OVZA 4LLMA 1JGDA 4R4FL 3ZSTA 3V6FA 5IFJA 5F7MC 1YNLL 2DJUA 5LGJB 4U4BA 1NBZA 3QEHA 3LRGA 3K81A 1E6JH 3BN9C 4NOBA 4YXKH 3G5XB 3NPSB 3P11H 2RQ8A 1BIIB 3LKQA 2BX5A 2FDBP 2QTEA 5BOPA 1U42A 5BRZE 2YPKA 2EIDA 3FQWA 5FA3A 5C0DA 1IFHL 3A6CH 1MELA 3IFNL 1F4AA 2FX8L 1L4IA 1MJUL 1HINH 4N0CC 1VERA 1F4YH 4HUWB 4LAJH 3DSNA 3AB0B 3WXWH 5EPMB 3DETC 1T21B 4U1MA 4P4KC 4DZBB 3H3BC 4I13B 3GJFK 1I75A 3STZA 5L2KE 1HYRC 1BGXH 4Y8DC 1KB5H 2YS4A 1N4XH 5HD8C 1ONQB 3RUGF 2ICWI 2GK2A 3V6ZA 3L3OB 3S96A 2W07A 1QNZH 1R24A 4ZD3L 3SDCB 1EHLH 3PABB 3QEQB 3O9WB 1UYWH 1IKNC 1W72B 1S9XA 3GMLA 4PLOB 4ZS7L 4YIQA 2F54B 1SHMA 2CDEA 4GKSB 1HEZA 4LSTH 3WIIL 2NY7H 1F4WH 4ERSL 1UYWL 1QSEA 4WO4D 1XIWA 1LO0H 5JDJA 1UKSA 2B5IB 5KS9E 1IL1B 1MHHA 4NO0B 3TNNB 4XCYB 1RVFL 5D2NA 5JZ7C 1EVUA 3RVWC 4PS4L 2VLME 3NZHH 4NQED 1OLZA 1DQLH 5D6DA 3CFDB 4C83B 3IT8D 1VFAB 1F2XK 5TH2A 4XP1L 4HIXL 2VDKL 4H8WH 5FV2A 2NXZB 5IB2B 1D5ZB 3NA9H 2PYFA 2QKIB 4OZ4A 5C08B 2Z35B 4Q9QH 1TJIL 2PXYD 3HC4L 5DD1L 1WBXA 4FQIH 5F8RC 4GAYB 2B7DT 2UUDK 4JO1H 4U1SB 5D6CA 3K8KA 3CMOL 4PFEA 5I18L 4J1UA 2V9QA 1K6QL 2QEJA 4XNYL 4AMKL 3MXVL 3PG2A 1CXKA 2X10A 3QPXL 1JNHB 4Y4FC 3CU7A 3PGFH 5C2BH 3MOQA 2OTWA 1WZMA 3L5XH 1FVDA 3C08L 4D9LL 5D9SB 3FT3A 4Z5RA 3QWRD 3NCYP 3MLRL 4F15C 4O2CB 5J12C 4H1LH 2NY1C 2P5ED 1I8IB 3GNMH 1EFXA 3LN5A 3MV7B 3QISA 2RFXB 2HWZH 5DQJB 3VGDA 4F9PC 1CZ8H 2XWTA 3BQUD 3FB5B 3TO4D 1BFTA 2GY5A 3OKOB 2AJZB 3C5JA 3FCTB 2IAMC 1BOGB 1KB5A 5DJAA 5EO0B 1S9YA 2BCKA 4X80H 3E0GA 1YY8A 4YQXL 1TNMA 4ZPVB 3EJZC 1CK0H 1HHJA 3E6FA 4WJ5A 5EU7E 3TBWB 5JHLL 4P3CH 4TSBH 5KN5B 5HHVL 3ZYOA 1TCRA 4G8FA 2NY0C 2EDJA 2A6JA 1BFOB 3CVHB 1MUJB 2J8UA 1U6AL 4OZFA 3SCMB 4Z8FL 5FGCE 2GITA 2VYRE 1I7UA 3IAQA 3MLRH 3FB7B 4UBDC 1X5LA 5C0IB 3V6ZB 4HPYL 1B6DA 3D3VB 4L8DB 2WLYA 4NN6C 2VDRL 1ONQA 3ZE2E 5GSVB 1KSRA 1JYXA 3IXTA 1DL7H 4PJ9C 1I7TA 3BGFB 3DARA 4OCWL 3AS2A 3AS1A 1A1OA 2DJSA 1ZHLA 1NFDF 1QOKA 2FHBA 5L8KB 5DYOB 2JJWA 4QRTA 5F72S 4RGNB 3L5WA 5ISZA 4N0CD 4MDJB 4NQEE 3QUYD 3W39A 3FQWB 3RFZC 4XCEA 3O8XD 4LHUD 3TO2B 2CKNA 3D3VA 4YUEH 1BIIA 1KLGA 5L88H 1AKJB 3HHRB 1FZOA 4M9PA 3QIBB 3TV3L 4TYUA 3MNVB 1QQDA 1AHWB 4TQEL 3DJ9A 5FHBH 1NAML 2VJXA 1YPZB 3I75B 4F33B 4QTIH 2A9MH 2PXYB 3NABL 1VGKA 4LF3A 3TT3H 2LTQC 3CFBB 2KBGA 5DHVB 3HCVB 2E27H 3DV6B 3PWVB 1QRNE 1UM6L 3WFEH 4FQ1L 4HH8A 4FQCH 3L9RB 4HWEL 5DD3H 2FO1A 5B8CC 1CFSB 5KZCB 1ZVSB 3GI9L 4HCRH 2FECL 3VH8G 4J4PD 1J8HA 5ADPH 1W72L 2DMBA 1JGLH 2W9EH 4PUBL 4CDHA 2J7LA 1DQML 3HNVH 4TNVF 2ZSVA 1A1NB 4L3EB 3Q6FB 3RVXD 1U8LA 3U7WL 5TE7H 1DQMH 2YC1B 3UX9B 3OL2A 4HQQL 4LLVB 1JUFB 4PB9H 4R8WL 2QSCH 4M03A 3MRCA 4JG0H 1FZMA 1FHGA 1W72H 2HH0L 3VW3H 3GMOB 2EIZB 5D7JA 3MYZA 2ADFL 5I1JL 5D2NC 2V2WB 1ZGLP 4G7VL 3QB7C 5ITFA 3BGMA 4WI7A 3ULUL 2KKQA 2VLMD 4YPGB 5T3ZL 1WFUA 3OGOE 3QCVL 3WS3B 4NRXA 1NGPH 1FYTA 3OKNA 4X7TA 4Y4KD 3MBEB 3MRLA 1BPVA 1WFNA 4YLQT 5J6GA 2I9TB 4KK5C 2J5LC 3F7RA 2CIKB 3MODH 4XXDA 5SX5H 3TJEH 1KFAH 2DKMA 4MD0A 1NEZA 1XIWB 3GIVB 3EJJX 2Q86B 5I2IA 4G8FB 1KPUB 2Y06H 2CLRA 2ICCA 5F70A 1JGVL 4Q6IC 5DMGD 3TVMD 4C58B 3MRGB 5ICYA 2V5RA 1NEUA 1Q9KB 1NANI 4PJ7E 4LKXA 5A43C 5D7LE 3QQNA 4XCNA 4P2QD 4GKZB 5I1DA 1BFVL 3QO0A 5SWZD 3ARBD 5TJWK 3DV4A 1A6UH 1MSPA 3SJVE 6FABL 1GGCL 4JZNB 4WFEE 1A6WH 2JJSA 1MCPH 2NY6B 2F53B 5FGBA 1AXSB 4F9PA 2QR0B 1OAZL 3CNKA 3BPNC 3NIGE 1E4XH 3L7EB 3DVNA 4TUKL 3NZ8A 4U1HB 4Z5RB 3JUYA 1P1ZA 4Z7NF 1CLOH 1U91A 1BWWA 3WD5L 3GBNH 1YUHA 3MV9B 2X1OA 4N8CL 1QFWI 3KXFD 3OR6B 5HHOB 2A1WH 3KVQA 5GGUB 3UDWA 3K1DA 5AG8A 3V7AG 4OSUH 3LIZH 3L6FB 4ENED 1OPGL 4PRIE 4AIZB 4O5LH 3IDMA 5C0CE 1VFMA 4NQUA 4OLZH 3LMJH 5FO7B 1T2JA 3KLAA 4PGEB 5FXCH 1JZ7A 4X9HA 4LLMB 3GMMB 5FECB 4FQQA 1W2KT 1JK8A 3MFFA 5CHNB 4MD4B 3UTZB 3REVA 4RZCB 5FKAA 3RHWF 5MEND 4DKFH 3IKKA 1EA9C 3I6KB 2IH1B 2FNBA 4NZDA 3WMSA 3KXFA 1AGEB 3H7BB 5FM4A 3UBXI 3RIAF 4X7EC 4JFQB 5JIIA 5FYJD 3GMPA 2BY1A 5FYJH 1WT5C 2NY6C 4N0YH 4M93C 5EZLB 4Z18A 1KTRL 1WCBB 1CDIA 3DX8A 1IGML 2YA2A 3PQYD 3G04A 3D1MC 3QUZD 4HIEA 1LP9A 4JB9H 1J0JA 3BP4A 2DRUA 5HHNB 4JO4H 3TH4T 3AC0A 3WNOA 5BJTA 1G9NH 3VRJA 2NY0B 3BKCL 4PJBF 3MRFB 1T1ZB 1FZJA 5K9JL 1I7RB 2MPAL 4PRPE 1P53A 2Y1VA 3HNVL 3I84A 2JB5L 3O9WC 1JPSH 2BNRB 3MRBA 1L9MA 3VG0H 2Q3ZA 3S9DB 3NTCH 3P4NA 2X6MA 4F57H 1HKFA 3KPRD 4HH9A 1UZ8A 3W0WB 1E4JA 2A1WL 5FHAH 5B8CA 1H3XA 4NKMA 4WI4A 5KG9B 3A67L 3F8UB 4LCUB 1AY1L 4AT6B 3TN0C 1MHPH 4JLRB 4FQXC 1QVOB 3E1F1 3BO8A 5CP3A 4GRWF 5CILL 1Y0LB 4PJGE 1XR9A 3KPOA 3OAUL 3WIIH 1HHKB 1XH3A 5GGSA 2DQHL 1NDMA 2JCCB 4NWTL 1OAYH 2LAAA 5GGSY 5A1AA 5LAXA 1Q0XL 2R0ZH 3I6LD 5L2KA 1ZHBA 3SQOH 4MJID 4L9LB 2E9BA 1ZMYA 2GTZB 4P46A 3ARDC 4QLRA 4Y1AD 5DR5H 1BF2A 2DDQH 1FFOA 4ODTL 4WO4C 4O58L 3W2DH 3FOMA 3OJMB 5HI4D 1MQKH 1FG9C 4QOKD 4OCMC 5BV7L 4Y4HC 5TQ2L 1RUAH 4KTEL 5TE4H 4GRWB 4U7SA 2CRZA 3UYOD 2FB4L 3RWDA 4NKMB 4RISL 1MCOL 3GSQB 2W91A 1OSZB 4HFUL 3GMNA 4L8SC 4PLJD 3U6RA 1NFDB 3QJFB 3MX0A 5GS1C 2R4RL 3QDMA 1CLZL 3UXFA 4LSQH 2BVOB 3SDXE 4K7FA 4Z7WA 5IBUB 1DUZB 4MLSA 3PP4H 4NJAH 1F02I 4EI6A 4RCAA 4Z7OF 5I1KL 3O2WL 1JVKA 2XN9B 3UC0L 3MMEA 2C3XA 4DW2L 3D39A 2LVEA 2P42B 4XC3L 4ZFOA 3GO1L 1VENA 2BRQA 1H0DA 5C0CA 1AD0B 1KTDB 3SKNA 2BC4B 2XZZA 2VN7A 1J1PL 2BXZA 2OQJA 1A6VL 5JMOC 4YX2L 1BX2B 2YD4A 3DUSB 4RAHA 4Y2DA 3EDEA 2DQTH 1UEYA 2R9HD 3GSUB 3B9DA 1AP2A 2JJSC 3SGEH 2AXJA 4X8XA 5FGBC 5BV7C 1B0WA 4R6UA 3NA4A 3U83A 1DUYA 4TOYH 3QEUA 4Z6AT 2H1PH 4LIQL 5E56A 1JHLL 1T5WB 2B0SL 4M62H 3FO0L 4NO5A 4G6JL 8CGTA 1IARB 1NGYA 3ZKXB 4EUPB 3IFLL 4EXPX 4Y4FB 4H1LG 2HRPL 1T0NB 1N3NB 2NX5B 4GJTB 1RZIB 2NY5C 5D7LD 3RAJL 2VE6B 1A64A 3QUML 1KJ2B 2EYRB 5F1IB 1XF2A 1A7RH 3MJ8A 2CO7B 3QIWB 4PIRF 2XOTA 4BELD 3BXNA 2R0KL 2AABH 2R69H 4GUPA 3TCLB 2PR4L 1MCKA 2QV2A 2P5WE 1H3TA 4WWKC 1PEZA 1UXSA 2D0GA 2ZUVA 2IAMB 3H9ZA 3O3DA 5EFIB 3BGAA 3FRUA 4R0LA 4MQSB 4JN1L 2WBKA 4X6EB 1PZ5A 1QYGH 4OZFG 3ZL4L 3JV5A 2WV3A 3WNPA 4G5ZL 1W0VB 3ARED 4HUNB 4MCYA 1MF2L 1DEEB 4R4BB 2G9HA 5GRUH 3L3JA 3GSNL 4LGSB 2YPVL 1MEXL 1IGTA 5EIQA 3PDGA 1ADQA 5AYUL 2YD9A 2I24N 4OTXL 4EOWH 3QQ9C 1S7UA 3GM0A 5BVPH 1GGYA 1ZA3A 1RIVL 5E9DA 4IS6B 3QNXB 4ZODA 2YPLD 4XVJH 2RR3A 1TIUA 4GRLD 5I9QB 1P7QD 4Y5XA 2O61A 3L3KB 4M1DH 3OXSA 3PHQA 3EZJB 3QAZB 3GGWB 1EHLL 4G9FE 2EDWA 2GW5A 1NGQH 4XPGL 1KN4H 3TF7C 1OHQA 2DJ4A 4GH7B 4OAWA 5GIRB 4KI1A 2HJKB 2ATPB 4NQCD 4P3CL 2NLJB 5CLTA 3VFGH 3E6HB 1XGQA 4HWUA 3QPXH 1OOAA 4O58H 5DUPH 4NDMA 4XMPL 4LMQI 2C5DC 2NY4D 1AQDA 1QRND 4L4VA 1OTTC 1AXTL 2Q7YB 2DLFL 5C07A 4ONFL 1OAKL 3SHSA 4U6YA 4PB0L 4MA8L 1EJOH 1HHIA 3P9LB 1Z3GH 3F62A 2HVKB 4IOSD 3N1FC 4PRHA 1J9CT 4XVJL 4KUZH 4M7LT 4JAMB 4GLRI 1KJ3H 1FNSL 2ZSVB 4XP4H 1D6EA 3FN0H 4BH8A 3N1QC 4CU6A 5F7NC 2WUBH 2WBJD 4WO4A 1BX2A 3DUSA 3LH2L 4M61B 4JFED 3HUJE 5HSFA 5MERA 4NRZA 2APTA 3PGFL 4P4KD 4MB5A 4J2XA 1L6ZA 4UU9B 3TVMC 2VLJB 1HIML 1G7HA 2ID5A 4UT9L 2FZ3A 5DHVH 5IF0B 1ZA6B 2Z31D 2A38A 5LQBL 2XKNB 2VDOH 5IT2L 2BVOA 2YOCA 2DAVA 3ULVD 3TBVB 4LF3B 3SE8H 5IOPB 3VD7A 4GXVH 4DKDC 1CE6A 5E9DE 3W0WD 1CF8L 4LLYA 3AFLA 2IGFL 3RTQD 1M7DB 1TTGA 4C56B 1OAUL 2FBOJ 5J8OA 3PGDA 2NTFB 2VLRB 2DWEA 4MJ5B 1XT5A 4QHMA 5AAMA 1UWGH 3WSQH 3NFSH 5IMKB 2EDRA 1FC2D 2EO1A 3MLVL 1HINL 3G6DL 4OV6F 4PRBA 5EBWB 1PKOA 1XIWC 4NHUB 3BISA 4G80A 3X17A 3ULVF 2NY7L 2YUXA 4H25A 2DWDB 1J5OH 4NNYB 3RIFK 1C1EL 1DEDA 1NCTA 5EIVA 2ICWA 3QDGB 5CBAA 4KKBD 1DLFL 4ESKA 2DQCL 4X4ME 4GRLB 2OTUB 2VKXA 4WUUE 1ZLVH 3TC9A 1K4CA 5MEPA 2XTJE 2YPVH 4MAYD 1UJ3B 1HHKA 5GGSB 5FYLL 3S35L 1IVLA 3FFDB 4HIIA 5BZWB 3TPKA 5D72H 4Y5YB 3O41A 2FZ3B 5F1SA 2DI9A 4PD4J 5C0GB 1G7QB 1M71A 4L4TB 5MENB 1G9NL 2VLKE 3F7VB 4OGYH 5FOBA 3HC0A 1F4HA 4P2RE 4PGEA 1MCQA 9CGTA 5JORB 1Q1JH 4IMLB 3MNZB 5JTWA 1KLUA 5TE6H 5TDPA 1NC4B 1NMBH 2CD0A 4ONHB 4IIQB 4HFUH 4WWKA 4F58L 3U1SL 1LHZA 3TZVC 3I02A 3L3JB 1F3JA 3CFCH 4XNMA 4LSRH 3EJYD 1X5FA 5C07B 3U0WH 2CKBL 3ARUA 2VRAA 5D9SA 5IB1A 5C86A 3ULVH 1IJ9A 4H0IA 5DVOA 4YE4L 4A6YB 4NO2A 2EE3A 1JWUB 5DEFA 3WDHA 3GSXB 4U1GB 4G8GB 3EHBC 1RZ7H 2BOBB 3TCLA 3IKCA 5GJSL 3O3UN 4PP1C 5ALBL 3PL6C 3DRTB 1V7ML 3CFEA 3GSVB 3T8XA 3BD4A 5IMOA 1YEJL 3OJVC 3K4ZA 3IU4H 4NM4L 1GZPB 4WNQB 5DO2D 1IT9L 3ROLB 5I76B 1RZFL 4HSQA 4I9WE 3MLTA 5E00B 1NEZB 3GIVA 2BK8A 1AR1C 3RZCC 4DCQA 4QXGL 3H8NA 2J8UE 1WC7B 5L6YH 5GISH 3NIDE 2X4QB 3LSOA 4GKNB 1KG0B 1NCWH 4BFEA 5IV2B 1A7BA 1EO8H 3TLRA 3V6OC 4P9MH 4PJ9B 3IETB 1GAFH 5K9OB 4F80A 3FO2B 1B2WH 1VEPA 3TM6A 3AM8C 2FX7L 5J9PB 5LCVL 1I8MA 3T2PA 1I9JL 2FB4H 3UTSD 1H3PL 4X98B 2GIYA 3WNKA 1GGBL 5DWUH 1KEGL 2E9IA 2YHGA 4UV4L 5GRJH 4S1RL 4XP6H 3MJ6A 2COQA 3D39B 4BYHA 1T1YB 3I02B 3TJHC 4JFDB 2ZPKH 4M48H 1Q9KA 2DIAA 5F7YC 5KSUA 5ICYB 3SO3C 1JHTB 5D71H 4YBLC 3HPJA 3THMH 4OLXH 4XVTL 4RAVB 2AJ3A 3IVKB 4C57C 4KJPC 1J8HB 2ED7A 4G9DB 2UVFA 1KN2H 1RUMH 3RJQB 5CCKL 3U6RB 3VDBA 2R2HB 4O51B 5CZVL 5C0DB 5B3NA 1J12A 2PO6B 3BH9B 1JI1A 4MQ7A 5F7FA 2B39A 1GIGH 1M71B 2AK1H 4M7KL 3UEZA 3V6OE 3UTTD 5DMKB 2IBZY 4I77H 4MX7B 3CGTA 1JPGB 4S11A 5D5MB 4U6TA 4FZEH 3ZKXC 1WICA 5BZWA 2K9UA 4LSUL 5D7IF 4NQDB 4Z7VA 4OKVA 5T3XE 5GSRB 5TDNA 1N59A 2AJVH 1CDGA 4S0SD 4H25B 5IKCB 5B22A 5F9WC 5I0ZA 5D7JC 1AKJA 2B5IC 3GHEL 4PJCA 2Y5EA 4U7MA 4MXQC 1URLA 2E6PA 1MCWW 4GW5B 1CICC 3Q6FA 5CGYC 3JBG7 4MQTB 1Z5LA 3LKPA 3N1GC 4JFEB 4QRRB 2XTLA 4LCUA 4ODSL 5C8JB 5T3ZD 5DYOA 3ZYZA 3C09C 1FLRH 3LB6D 3WS6A 2APXA 4G3YL 4OF5A 4P23D 4R4ND 1KNOB 4UTBH 1KELH 2GT9B 3MV8D 4C59B 5IGXH 1DTUA 5HDQL 3QXAA 1NQBA 4TQEH 2BNUA 3SKJH 2R69L 3G5YB 3TV3H 4M1CC 2CR6A 4JG1H 3BESR 5J1SC 4D3CL 2A6IB 3TJEL 5DT1L 1J11A 1LQSR 5BCAA 3HI5H 1QLEL 2FGWH 4S1SH 1T0MA 2VZ1A 1L7IH 2P5WA 1KJ2H 4X6CE 1VGEL 2AJYL 3MOAL 4OM0H 1U3HD 1YPZA 5TF1H 2H41A 1QQDB 5HGBA 3CD4A 3QXDB 5LAXB 3PP3H 1IEAB 5DJXA 3QFJD 2J4WH 1KCKA 1DL7L 4L9LC 5F7HA 3D39D 4FQ2L 5HHPB 5KSAA 3SKOB 2RCSH 4AMKH 4PGCA 1I8IA 4YHOH 3VA6A 1BWMA 1HHIB 5MEOB 4CVXA 2XY2A 4JPWL 4X6FA 5A3ID 3PNWB 2VQ1A 5F97E 5CEYA 1S7VA 3FTGB 5EA0L 5FECA 3TBSA 4Y4KC 5C0BB 5CGTA 4UINL 5B39G 3ZTJH 3UTTE 3HE6D 2EDFA 1TTFA 1ZLUH 2DS4A 2FBJH 3SCMC 3S88L 4LQ1A 3LQZA 2X4OA 3QEQD 3IFOB 3KPQB 4L4VD 3SQOL 2YWZA 3DXAD 1AJ7L 2CH8A 5L8JB 4YO0A 2R23A 2VWEC 1AGFA 4I1NB 4ZS6C 1S7XA 4EN3B 3EOBA 2HVJA 3MLZH 3SBWC 2OYPA 5C0CD 2PYEB 1JBJA 1WCBA 3RWHB 4Z7QE 4XVUD 5FO9A 4PJFB 1MCOH 4RISH 3B9KA 4F7EA 1MI5B 3RVXC 1AQKH 5DFVD 4OF3A 1EBAA 1GC1H 4JZNA 1NAMH 1IGTB 1OP5K 1JN6A 1AGEA 3H7BA 4J8RA 4MSWB 4X7SL 2RFXA 3C09B 4FQHA 4WY7H 5FO8B 5IBLD 4OB5H 3QSKB 3I6KA 3QUYB 3KPNB 3RQ3A 1T7VA 5ESQA 2BSTA 2VDMH 1B90A 3V4UL 3HFML 4KJYB 2WZPD 4BFIA 5IWLA 4PGBA 1U36A 2Y9RT 4LLWB 3DXAA 5ACZA 1BJ8A 1LP9E 3O6LL 2OTWB 4Q9QL 1A0QL 3O9WA 3HZMB 1F4YL 3MSPA 2RCSL 4U1IA 4Q9BA 4XPBH 2I60H 4PJHE 4AL8L 2ENYA 1ZANL 3PHOA 5E99H 4S2SA 2IG2H 3DRQA 4HS8H 3T0DA 2IQ9L 3S36X 4KZEH 4XPHL 5FYKH 2UZXB 5E1HB 4L1HA 1WBXB 1XMWA 1MY7A 3BYTA 3EIFA 3L7EA 5KTEH 3DHJA 3QCTH 4M8VA 3K7UA 3MGOA 3S3PA 1RZJL 3MJ9H 3JWNC 5TH2B 4YHZL 3T1FB 4ZAKC 3OPZL 1NGYB 2YWYA 4JFFE 1UGNA 4FZEL 1IQDA 3VXSD 4I4WB 5I8EB 1LO4L 3JV4A 4NN7C 5E8DL 1IEAA 5IEHB 2IF7A 1QSEB 3KDMB 1BJ1H 2JJTC 4OFKA 5ITBH 5IUSA 3U9PL 4JCMA 4U31A 1G7LB 5CSGA 4DK6A 1EERB 2IPKB 3IRZA 3GMLB 1QRNA 4M5YH 5DD6A 4BFIB 4ZUSA 1PLGH 2W1NA 3Q3GB 1YEGL 1FIGH 3QULA 1MCEA 4M1DL 3KPSA 5E2UH 1T20B 3O3EA 4U05A 1YMMB 4Y5VB 4DVBB 4EJ1C 5KVDH 3IRPX 4M43H 4MA1B 1INEL 3BFOA 4K3DH 5JPNA 3L3HA 1A02N 3EYQC 1IRAY 2VSDA 5IM7B 5C09A 4WFFD 2BY0A 5HYJE 3SDDA 1K6QH 4JVPA 5C8JA 3GSNH 4DJMA 3WFDL 2GAZB 2R23B 4EKXA 4GSDH 4YO0B 4JQIH 5MP6H 3BN3B 2HLFD 3DOSA 4MAUL 4GAJH 4XBEL 1BQLH 5FK9B 5HJ3A 5C07D 1NBQA 5DD0L 3NA9L 3WEXB 3O8XB 1CT8A 4YR6B 5DD5L 4P2QB 3GBNL 2ZZUT 2QL1A 2Z91A 1Z9MA 3GJFA 3KNBA 4GOSA 1H8NA 1WJ3A 3SDDB 4DGIH 4LPVA 3OKYA 5EU5A 1RVFH 4LPWA 4L9LA 1OARL 1QLRA 4QXTA 4OUUB 3TWCH 4NP4L 2FWOB 5BW7A 1I7TB 3DMMA 4X9IA 3MRKB 4LHQB 4BH7B 5L0QC 4P4KA 4QEGA 5F1OB 1DZBA 2G5RA 3D18B 3TIEA 5E9DD 4H26B 5I75C 3H0TA 3P73A 5HHOD 4YEEA 2DLHA 3QXDA 5DHVA 3NIGF 1AFVL 4HDIA 4F7CA 1L0XA 3KWWA 5B8CB 4HQQH 5SX4I 1LEGA 1D7FA 4JFDA 4MA7L 4ODHH 4KI5F 4P9HL 1N5YL 1A47A 1JYWA 2M2DA 3O4OC 5J1AA 5JIHA 3N85L 4JFFA 3UTSA 4ODBD 3ECBA 5IGXL 1RZ8A 3D0VB 3HG1B 1NCCH 3LD8B 2H3NB 4FQIL 4F58H 4NYLB 3MV7A 43CAB 1D3CA 3V0VB 3V5DA 2AJXH 3KPLA 4WHDA 1NMBL 4JN2B 5C09E 5DJZA 1MCCA 4ORGB 5DK0A 3RA7L 3X14B 5ILTH 4MXVF 5K9OA 1ED3B 5F44A 1AGDB 4GG8A 32C2B 2DMKA 1G9MC 1FNEB 4YDLC 1MCSA 4KWUA 5JDSB 2V2TB 1ZS8A 3C60D 3HAEA 2QQQA 1P4LB 1HSBA 1H3WM 3QHFL 1V3MA 5HYSA 1L7TH 4L8DA 1KCVH 1F90H 5DMIL 1B2WL 3NN8A 4KVNL 3QRGL 5CEXA 4GQPH 4CMMA 1ORQB 4R9HA 4NGHL 3CVHA 1PYWB 5A16A 5E00A 1MCIA 1EGJH 3DXAE 5I1HL 4DVRL 1R0AL 4FFWD 4HHAA 4U1SA 1QBLL 4AH2B 2O5ZH 4AH2A 1QNZL 3OQ3B 5FCSH 4EUPH 5FO7A 1S8DB 5I8OL 1A1MA 1QBLH 4PJBE 4MNQD 4G9FD 4H20H 1VFAA 4PR5B 15C8L 2GCYB 4IJ3B 3LKNA 5I1HH 1MIMH 5DMKA 4QY8B 4MD5A 1NGZA 4B53A 3R8BB 5SWSA 1ZWIB 4NO2B 3B83A 1MI5A 3DX9B 4KJWD 4WV1A 5AG9A 4MNGB 1UWGL 2BVQB 1AGDA 3IAGC 4MNGA 3WN5B 1A2YB 3WIHH 5KW9H 5IESH 4JN2A 5GRWA 4BK4A 2E3VA 3RA7H 1NDGA 4QOKE 3KJ6L 1RZFH 1A7NH 4MA3B 1T1YA 1A7OH 2ZG3A 3QQ9D 2UYLA 2BXYA 5KW9L 1A5FH 3JTSB 3TIDB 5BXFB 4TTDC 3UTSB 2X40A 5IQ9B 2D4FA 2VDNL 4U6VL 3FQXB 4LFHD 5JXEC 5SWQA 4XCNB 1INQA 5ALBH 2H6PB 3VXMA 5GHWH 4HJGB 1ZT7B 2QHRL 1KACB 2AI0L 4KVNH 2E7LC 4QHNB 3UTTA 1KB9J 5FDWA 1Z2KA 1I1FB 3MLXL 3W11C 2FSEA 2WUBL 5CP7B 1Y18B 3ULVL 1K4DB 4GQ9L 4PG2C 4JB9L 5MHSE 2W0PA 2AK4A 2O5ZL 5SV4A 1PAMA 3RL1B 1FYTB 1BJ1J 3A6BL 3ZZ1A 3PDOB 3P2TA 5D7KD 2HMIC 1MY5A 5H37G 2R1YB 3X14A 5CJXA 1YYMH 4JY4A 5T1KB 2OL3L 5KS9A 4JFHD 4ODXA 3CH1B 2Z91B 1FSKC 4WHTB 3UROR 1A9BB 1EX0A 5INCA 1BD2A 1OWRM 1DBAH 2IH3A 1UZ6E 1OTSC 2A6IA 3HC4H 1J5OL 3PWJB 5GGVL 3VXSE 2NY5H 1CR9L 2ZCHL 5AWNL 3OF6D 5BW7C 4NPYB 1KNOA 1I9IH 1X5XA 4MJ6A 2X05A 5HHMB 3ARXA 1QEWB 4HUWA 5JHDD 2WUCH 2X1PA 4DOHE 2VKWA 1S9WA 1EFQA 3REWB 5KANG 3WFCL 3PJSA 1S5IH 3NFPB 2ORBL 1SYSA 1YECH 3OG4B 1UT9A 1MCBA 4PBXA 4M6NH 2HKFH 4ONHA 2Q8BH 3FN9A 4R3SA 3VWJD 4JKPL 2MCPL 1U58A 1Z3GL 1K3IA 1NBZB 2P46B 1ZLWH 5LGJA 3AUVA 3QIUD 1KIUA 3DV6A 3AU1A 5I74C 1H3VA 4PRID 3OKKA 4PRNA 1U3JA 1VGKB 4JR9H 3U36A 3K4DA 4OD2B 5ESAB 5DRZB 3OZ9L 1XR8B 5EN2A 3QCUL 3UTSE 5ITBL 4XZUA 3ZE1E 2FYYB 3FOLB 4I18A 3U9PH 2VDLL 4GMSL 1CF8H 3UJIL 1M05B 1P7KA 5IROC 3ZHDA 5DEGA 4QOKB 4LL9A 3H9YA 1ES0B 2EEAA 4EI5C 4JGJA 5EO1A 1WUNT 5DQ9A 5J11C 4I3RL 3BI9X 4HS6A 4Z7UE 5HDBE 1SBSL 4MNGE 2N56A 5E4EB 2PETA 4GXUN 5KVDL 3OX8A 4QRPD 1M7XA 5EO9A 4R2GD 3GRWA 3L3IA 1X7QB 2HRPH 5MEQB 1N5AA 3U82B 1BF8A 1EO7A 1X4XA 1NKRA 1OP5H 4MNHA 4R4FH 3VGAC 2PNDA 3S88H 3BMWA 3X12A 5E24E 3TT1H 1H9VA 4X0KB 3RNKB 4X6DA 1JNLH 3OXSB 1F58L 5EC2A 4WVRA 5J6HB 1G6RH 4F7PB 1MFDL 3OJDA 3OXRA 5CMAB 5J9PA 3PWPB 4S1DC 4OBSA 3ZT5A 4JG0L 5ACZB 3DXAB 3FO2A 2XIDA 3A6CL 3MJGX 4OZHB 4PJGF 1JE6A 4L8CB 1OQOA 1GC1C 2D7TL 1TJIH 2AK4E 1DQQB 3MLUL 5CS7A 4K3JH 1G7HB 5DFWH 1VDGA 5FYLD 1A7RL 1P69B 3PP4L 5FYJE 4HCRA 1FORH 4WU5A 1G1CA 1AGCA 3NZHL 5E94B 5HTSA 3QZWG 1AQKL 1R5VA 3L95A 3ZTNH 2NXYC 3P0VH 5JW3H 4LPUA 2AGJH 2HT3C 3UDWC 1A6ZB 3FHQA 4J3VA 3TH2T 3HI5L 3O81A 2NMSA 3JXAA 4QRSB 2MKLC 1YMMD 4JY5L 3ZE1F 1AGFB 3MLZL 5JXEA 3F12A 4HUUA 5F6HI 4FTVA 5EU6B 3M8OH 5ID1A 4LSTL 4K8RD 1F00I 3M17B 4JY6B 5IB5A 4NQXB 1W0WB 1CD1B 2CGRH 2VLKD 2I27N 1EJOL 4LSDA 4NP4H 1F8TL 3BSZL 2E7LA 1B0RB 1V3KA 3W5MA 3LN9A 1I1AA 3P4MA 1JMXA 4NQVB 5LG1A 5CINL 1GOFA 3IB4A 1LO3L 2IQ9H 4V1DB 3SDYH 2ZNWA 5KSBE 4XCCH 3CMGA 4NDMB 5CEYB 1HKLH 3I2CL 5DS8A 1YNTB 3C6SA 3J8F7 2VAAB 3B3IB 2F5AH 4U0RC 4K3GA 4NT6A 4PJDE 3ZTNL 7FABL 2G2RB 5GGVY 1W0WA 1BHGA 3C8DA 2B4CH 1C8PA 2HLAA 3SDDD 2CKBB 2EH7L 5L2JB 5D8JH 4YHMH 4UUJA 1NC4A 4UIMB 4FTVD 1ULVA 2FEEL 3VWKD 1K5NA 4YDKH 2EIEA 1LEKB 1EAPA 3C87A 4UBDD 1X5GA 3OKLB 2CIIB 2J4WL 3P40A 1LEKA 1X4ZA 1T5XB 4U3HA 4WU5B 4EN3A 1CICA 4OCSH 3VXQB 3OAYH 3O2DA 2B4CL 5F7DB 2P49B 4XBPB 2X9YA 4KTDH 4U2ZA 1VGEH 2AJYH 3MOAH 4GW1B 1FYTE 2BMKB 4F7MB 3WYRA 2G75B 4OZFH 2XWJA 5HHVH 1PLGL 3O2DL 3LQZB 1VA9A 3ULVE 3U0TB 2MQ0A 3N06B 1QYGL 5CJBA 4B50A 5DS8B 3E3QE 2HAZA 1JPTL 2DI8A 1RK1A 2GUOA 1IAIH 3MZGB 4J3OC 3SE3C 1F8TH 5B4MD 1T22B 1KXVC 3VXPA 4X6FB 1I1YA 5EBLA 3BOVA 3VFPA 1NAKL 4KVCL 2XA8H 1GYAA 3VI4F 3SGJA 4PJIA 1IILE 1E28B 4YHKH 5I16A 5ID1B 1QLFB 5GGQH 3QDHA 4Y16C 3QIWA 3DURB 3WLWC 3FFCA 3ARFD 3QUMH 2WP3O 4CNIA 2H2PC 3NCEB 2APBA 3QCUH 1RZKC 5IROA 5TGBA 2R29H 4IDJH 5BMFL 1UFUA 1WWWX 1XGPB 2C1OA 1RD6A 4XPHH 3K4AA 5E0QA 3TBYA 2O26U 4M7ZC 2IWGA 2YD6A 4A6YH 5EU6D 2FHCA 3F6IA 4HT1L 4G8GD 3SOBH 4R4NC 2IAND 5KVGL 1HI6A 4WUKL 4DK3A 4K9EC 2DBJA 1MH5B 2LAGB 4KTEH 1ZLSL 2EDTA 5FOJA 4EQ3A 3OJDB 1FBIH 5JOEA 2GSGA 4NC1C 4JPIB 1DBMH 3VCLA 3QUXA 2XZAL 5D7IA 4NUJA 3HZYA 4LPTA 4UT6H 1KTLB 1DN0B 3NCMA 1V7MH 2KQNA 3BEWB 4Q0XH 4F8QA 1U8KB 1U95B 2VR9A 2XNAA 3IDIB 3HRZB 3LPFA 5E6IB 2XN9A 1LO0L 2XFXA 4PRHE 1KPVB 4PJHB 5BS0A 2VUOA 3SBWA 3T4AB 3RZCD 3LRSB 3GKZA 1MFAL 2NW2B 1LO2H 2KQMA 4R7DA 4H0HB 5E2TH 2KZ1B 1BP3B 3B9KC 4YAQA 1LP9B 4MAYB 2ZCKH 1CGVA 3T0EE 1EMTH 3AS0A 5I1AA 3VMOA 3QEGL 5DK2A 2VZSA 1FL3A 4OZIF 3VD9A 4JFQA 3VXME 2LQRA 1AJ7H 1EDQA 4KHTL 1TJHH 1KFAL 2X4PA 3VXMD 5B39A 5JR1H 4M6MH 3RBGA 3NTCL 1AXIB 2VOTA 1S9KC 3JWDC 4LVNC 5CZVH 5GIRA 1MI5E 1AO7D 4O9HL 2ADGA 5E6ZA 1A9EA 2ESVD 5K33A 2FLRT 5GISL 2H8PA 1YJDL 3EYSH 5HYJA 5ISZD 4LCWD 1HXMB 1SJEA 4OD1L 3LDBB 4BSWA 5EOCL 4F7TA 4POZD 4KMTL 1T03H 1IC5L 1BQHA 2YN5A 3L6FA 4KRPB 4X6BB 2AEQH 2X4SB 5IJVA 1UQSA 1MRFH 1JHTA 1IT9H 3HMWH 3EFFB 2ADFH 4DEPB 5I1JH 3B43A 3VXRD 3CZFA 2UZIH 4MWFA 4PJCE 3NFPA 4NNPL 1RHHA 2L7JA 3ZHLA 2GK0A 1HXYA 1HHGB 1NLDH 3UTTB 2D7QA 2XKUA 1AKJD 3ZSSA 4BUGA 2Y6SD 5C0BE 2C7UA 4ORZC 4ZAKA 4X98A 5ERWB 4X4XA 1H5BB 2D9CA 2ZPKL 4M48L 2IAMA 1S7SA 2VQTA 4LARH 3B8SA 2NY5L 4F3FB 4TULL 3VGGA 4XT1C 2D0HA 4HIHA 3G6DH 4LAQH 4GUPB 4PJ8D 5BZDB 2NY1B 2JJTA 4ISVB 4KDTC 3LPGA 2G75A 2OZ4H 1PSKH 4DN3L 4EN3C 1CN4A 1A5FL 3QJHB 1ZLVK 1R5IA 5ICZA 1KPUA 4LDOB 1YEJH 1IGCL 3C6LB 5IG7A 4U1NA 5HYJB 1WISA 2PTTA 3DX9A 4YC2C 1A6AB 4JZJC 3OV6A 4J3UA 4OGYL 4P23B 5IMOB 2CKBA 3NOIA 4L3ED 1YMME 2X4NA 3MTRA 3SDDC 1I3RA 5C7XL 4N0UA 4KK8C 2W65B 4LPXA 2Y23A 3GSXA 1C5BL 3FB8B 4RZCA 1NBYB 2LU3A 3WFCH 4HZLB 4WHYH 5FYLH 1PSKL 1ZAGA 1QSZA 2P48B 3AROA 3MOBH 3NACL 3ARTA 2GYSA 4R97C 4ACPA 3MLSL 5C70A 2X44D 1PBYA 2LV4A 4JFEE 1X5YA 4NNYA 1IZKA 2F8OA 5IHZA 3UPRA 3QQ4A 3FO9A 1QSEE 4LLVA 3T4AA 2WINB 3WUWA 3OR6A 3JWOL 3MPCA 1U8LB 4MA8H 4RMWA 2CSPA 4FTVB 5C0EA 1HSBB 2EKJA 2AERT 4M3KB 1CLOL 1PZUB 1UM6H 3H7LA 4ISVA 1LNUA 3S7GA 5JQHC 5IR1A 2NYYD 4GLRH 1FNEA 3DMMC 4Z8FH 1FP5A 5A2FA 2DWEB 2UV3A 4MJ5A 3HC3H 3WSQL 3GSOB 4QT5A 3BZFA 3KPLB 5EH1A 2W92A 3JVGC 5I0DA 4S10A 3BQUC 3KAAA 1HH6B 1ITBB 2XG4A 5M95B 4ELMB 5KVGH 3K1KC 5A2JH 1G0YR 2AQ2A 2XKNA 1WSST 5AYQA 3QUXC 1NJ9B 4UAOB 3CZFB 1OTTD 4K71C 5D7SL 3FMGH 5HGDA 4YXLH 5MEPB 2C1PA 1IEBB 2FX9H 3T2NL 5CBAB 1N5YH 3PWPA 4I3SL 1FO0A 4F2MB 3RPIA 2ADIA 1FPTL 4TSAL 1VFBA 1NLDL 1X5KA 3BZDA 4TTDD 3QIUB 5DDHA 4J3WA 3D39E 4HAFA 4M00A 4DGIL 4UTAL 4BH8B 3ARGA 3TO2A 4Q58C 5INDB 4Z9KB 1CGUA 3U4BL 1IGFL 5D1QA 3OHXA 5D1XA 4EIZC 2QJDA 2HG5B 3BWAA 2I60L 3STLB 3WS3A 3VFPB 2X4PB 2I07B 3AAZA 4LK4A 4PJFE 1BQLL 5DJZB 5MP6L 4FQ1H 5ITFB 3IJSA 1RUKL 2PYEE 3RWEA 1J8KA 1G9MH 5IT2H 3QR2A 4B5EA 5FDYA 5I71B 4JFXA 3CIQA 4MJIE 1R5WB 5J06A 4LBEB 2BVYA 4NCDA 4U1LB 4P2QA 5ALCH 1D5MA 3WIFB 2C4XA 1D5BB 4XCFL 4BSVA 2HFEA 3VFUB 2J8UB 2LFGA 5T5NF 1FO0H 1UXWB 1J1OH 5H35B 4GXUM 1ORSB 3H3PL 4HUXB 5IHLB 5KVEH 4HGWA 3EYOB 3BEWA 3EYQD 1SMOA 1RI8A 1BBDL 1MWAL 3I50L 4Z7VE 5E8PA 1G7MB 1T83A 4XXCA 3V79C 1EEZA 1ZA3B 4GMTL 5KJRL 2OMBA 5HGAB 5BO1H 1FFNA 3SEPA 3WFBH 1FH5L 4NM8H 5GRZA 5TFSL 5I17A 5I19L 2DKUA 4JDTL 3DMMB 4HWZB 3TWCL 1DEEA 3IDNB 3ZDXE 3REWA 1S9WB 3VFRB 3S98A 4HPOH 4MD4A 1T1XA 1NFIA 2F74A 5IW1B 2X4RB 2ZWLT 5C0NC 3FKUS 3HUJF 1AHWA 2AVGA 4ZXBA 1E6OL 2FLBT 1CXIA 3TZVD 1YEIL 2WWKT 5DZOA 3IFNH 4Y4KB 3KYOA 1YMHB 1UACL 1IQDB 2ESVB 3QZWA 4K94C 2J8OA 5INCB 2XWBB 4M5ZH 5DRXA 4NJ9L 4Q97A 2E9JA 1U91B 3MGOB 5I19H 3BKYH 3OG6B 4I48B 4OJFH 3VFGL 3QDJD 4RA0C 2VLKB 3V8CA 4PG2A 5MENE 1OP3H 3QUZA 3BYYA 5A2KH 3V6OA 1A3RH 1WT5A 3PDOA 1FORL 2UWEB 4WI9A 2I9LB 4U1GC 3U4EA 3VD3A 2W59A 1T2QH 1CQYA 3F6LA 3QULB 1BBDH 1G7PB 1NPUA 4XNUL 3W5NA 3T0XA 1VFOA 1LO3H 3I6GA 3HR6A 3S5LG 3GDBA 4HJJH 3CDGB 3WNLA 1BFOA 2BNQB 1I3GL 1ZV5A 3LD8C 3RY6A 2CRMA 3QNZB 2DQHH 3KDMA 2AABL 1VADA 3EO1B 2NY2D 3HPLB 4PJ5D 4YQXH 3MUHL 1CQKA 3B9VA 3V4PH 2VSCA 5EZIL 1KYOK 4YZFE 1KCSL 4JFHE 4JREC 4BZYA 4K8RH 3MREA 3QDJA 1T3FB 4PRAA 4GO6B 3JV6A 4Y19B 1FNGB 3WIHA 4KTDL 4QCIA 3AXLB 3JVGA 3GIZH 4ZFGL 3VA2C 4OGAD 4NT6B 4BSJA 4U49A 1YNLH 4DN4H 1A2YA 3RVUC 2Z4QB 1HCFX 4U1MB 2MMXA 2J8HA 4UIKH 4NQEA 1J8HE 2V2WA 4YDKL 4KXZI 1T66C 4PV8B 3DUHA 4ERSH 4MMXC 3J7HA 1KV3A 5GZND 4ZFZB 3EGSB 2A74A 3P0VL 5JW3L 5TF0A 4LQFH 3UCRA 3ARDA 3O6LH 5IB5B 4R7NA 1OGAA 5H2BB 1GOGA 1YDPB 3F12B 3SDAB 1FFOB 1FIGL 4HKBB 5DJ0A 3T3MF 4I18C 3PQYB 2SEBB 3ARGC 3CVHH 4FRWA 4IRSD 5JW4Q 3LKSA 4HIXH 4LEOA 2NX5D 5D1XC 4DW2H 2YA1A 4MQXC 4JGMA 3THML 3PWLA 2C4FT 1A8JH 4K2UL 4FQHB 3VFOB 5F88B 3O45B 3QH3B 1YEDA 1XZ0B 3V9FA 3UBXG 3LV3A 4X99A 4YX2H 1NGQL 2RGSA 3KPSD 1NL0L 2BDNH 1ITCA 4XPAL 1G7MA 2ARJB 2HJFA 3CXHK 4DUWA 1WFOA 2VN4A 4KU1A 4OT1L 1WFTA 2X70A 4MXVE 5JW5A 1MCRA 5SWSD 4PJIF 3I75A 4TUJA 4KUCD 2EH7H 5CMAA 1VKXA 4FFZH 3QAZC 1T0MB 4KC3B 5J6HA 3MRIB 3MGAA 3MOBL 1D5MB 1FLRL 2PW1A 5JO5B 4Y2DC 5K59F 2BY2A 2N1KA 3RY4A 2D7NA 3VFSA 4G9FB 4X8JA 5EA0H 1IGJA 3G6AA 3QFDB 5C0BA 4JQVC 1YEKH 1OSPH 2OL3B 4G8GE 5AD0B 2GT9A 2HMID 1HWGB 1F6AB 5F9DC 3GHEH 1TZIB 3GSRB 5JW5B 4WCYH 4HDIB 4F7CB 4PLKC 3WFBL 1S9VA 4QKXB 1UJTA 5F71A 1CGSH 4U0RB 5C07E 5EZLA 2ZJSH 3MA7A 2HTKC 1OB1A 2NR6C 4BZ2H 2ICES 2YPKB 3PIQB 4X99B 5LJYH 4LSVH 4FNLL 1SEQH 5J11B 4X7FC 5F88A 3VXUD 1I1FA 3C6LD 3T65A 1UVQB 4EZMA 4OZFB 3SCMA 5JPMA 4WFFE 5HYJD 4O02L 5HGBB 3FQRB 1QLRB 4M4RA 4HKZB 1A14H 5KN5A 1TZIA 2R1XA 3LEXB 5D7JD 4LCCA 1VESA 1T4KA 4P2RB 3ARRA 1QLEH 2P5WB 1QTYT 2FGWL 4D9QE 3MXWH 3AU1B 5ENWB 1YDPA 5E2JA 4G9FA 2B0SH 3SGDI 2EDHA 2Q20A 4PG9A 4X9GA 4WU7A 1LE5B 1MJ7H 3EGSA 4NCC2 3OB0H 1I9IL 1LWRA 2BZDA 1NCAL 5FFLA 5T3ZH 1LEIA 4UTBL 3HN3A 1RJYA 1OTUC 1CWVA 3BRGC 2NX5E 1IAKB 1YN7A 3HLAB 4WUUB 4HXBL 5F9OL 5BV7B 3MV7D 3QDGE 3WHXA 3VW3L 4LKCB 2BHZA 3BQUB 1I1CA 4JPWH 1Q94A 4GW5A 3LHPL 3ARWA 4KMTH 1T03L 4XHJC 4Q6IB 5J3HD 3O3EB 1T80A 4PRAB 1WZ1L 1JF1A 1NCBH 2WIMA 2MFNA 3DV4B 4HXBH 2Z31B 4LSQL 2CLZA 3LKSB 3MRHA 3KPRB 2FJHA 4D8PA 1BFVH 1VEMA 4GAYA 3GJEB 4C4KO 3TPUA 4M6OL 2F9BT 2UY6A 4HZLA 4FQQB 4M6ML 2J12B 1ZKAA 3KPMA 3DI3B 5F9WB 1MCNA 4R2GC 3P77B 4LLQA 5GS2H 5D5MA 5D5MF 1HHHB 3TNMB 2PCPA 3UTQA 3K2MC 4EEEA 2X4QA 4ZFZA 4DGYL 3CPLA 1TDQA 4TUKH 5HI5C 5EB9A 4KQ4L 4NZJA 2DBLH 5HHXH 3QUXD 1EPFA 2EC8A 1EXUB 4XH2B 4ZPTB 5ICZB 3DVNB 1BVLA 5EOTB 6FABH 5IVOA 4D0CA 3WJJA 1A6UL 3S4SA 5JQ6L 3HMXH 5KSUB 2MTPA 1INQB 3U30C 4GRWE 2O5XH 4PY8J 3EW3B 1NCCL 1NGXB 4HULB 5C6WH 1J1XH 4M1CD 3G08B 2QLVB 5LGKA 1H3PH 3BZEA 1E4XL 3CVIL 3TVMA 1K8IA 2GTWA 1YC7A 4AG4L 1FPTH 4TSAH 3ABZA 4A6YA 4MA7H 4ODHL 3STZB 3OB8A 4FXKA 1B88A 2C26A 1BVLB 1NFIB 1BFSA 2CLRB 2F74B 5IW1A 5CIPA 4AG4H 1AIFB 2JCCE 1QFUL 4YXLL 2CIKA 4XXDB 4IRZH 2Q6WA 5CJ5A 1F3JB 1Z0MA 3PHSA 3MRJB 3QUMA 1WAAF 3CPLB 1H5BC 1ZVHA 5J57B 1TZHB 5HYFA 2BY3A 4MXWH 3V95A 4RX4A 1FL6A 5IJVB 2LABA 1A6PA 2FJFA 3QEHB 3VFTB 4XX1E 4WHCA 3DO7B 2AK1L 3MLTB 1NC2A 5DJ6B 3RWHA 2D31B 3BPLB 5EU5B 1RUQL 2R1WB 3OKMB 3SDCD 1L7TL 3KYNA 2HFFB 4X80L 1GXEA 3KPRA 1RU9H 3ET9F 2EIZA 3FQRA 5F3BA 3JZ7A 3LKRB 4PRPB 2J1KA 3M1BB 4PGZA 5JW4R 4I0PB 1H3UA 1FZOB 3QFJE 2APFA 3WEXA 1B6UA 4RAUB 5CEXB 3WIFA 1U8HB 1UM5L 2X4OB 2W9EL 2LU4A 1IM3A 4MAUH 4XX1G 3WHE1 4JHAH 4XP6L 4R26H 4HC1A 1U92A 4LPCA 2HJLA 1PJ9A 1WWCA 4RFEB 2VDNH 1UWXH 3LIZL 1MRDL 3SPVA 3ZE0F 5B38G 4YFEA 1UG9A 3VWJB 1N8ZB 3MBED 4NFBA 2MHAB 4OCWH 2H3NA 4P9ML 3O6FA 1R3KA 1FFNB 3GKWL 3L9RA 2EDQA 1OY3B 3HC3L 4LCCC 4PJHF 4J12A 4UB0H 5IMKA 4ELKA 4OD1H 3VXNA 2A9ML 4UQ3B 3U46B 2EEDA 5DJXB 3QUXB 4OQTL 5C0RH 3VG9B 4PJEA 4UT9H 3TZVA 3BVNA 4LCCB 5MENA 2YUVA 4PRIB 1A7QL 1LD9B 1Q9OA 1PGRB 2I26N 3T0EC 1LO5B 1D9KB 4V2CB 4OFYA 3MJ7A 4BUHA 2CQVA 1RULL 1C08A 2BNQD 2VWEE 1S9YB 2EH8L 4GW4A 2F53D 1EHNA 1Q0YH 4YEFA 1YEDB 4JFXB 4MDJA 4FFZL 1PFCA 3D25A 3RWCB 2FL5B 1EAJA 3ESVF 5D1QD 1R3JB 5K9QG 1S3KL 3CFKB 1ZHLB 1HNGA 4DFIA 5C9JA 1HYSC 4WI6A 5JLZB 5IHUH 1I9EA 1U92B 4G80B 1BD2E 1MWAH 3I50H 2B1AH 4LRIA 1FE8H 4YPJA 1UA6L 1U93A 1CGTA 4P5TB 3QFJA 4HMCA 1GCFA 3U0PA 1U8HA 3WO4B 1I1RA 1KB5L 3ZE2F 3BP5A 2H32B 3MXVH 2IPUG 3SDXB 3GBLA 5F96H 3UO1H 3NBNA 4P2RD 2FRGP 4M5ZL 1HH9B 3ARDD 3E6FB 3OKMA 1NFDE 2A83B 1RHFA 5F8QC 1NBYA 3F58L 4GBXC 4AEHH 3CXDL 3ZE0E 1SM3L 4EQ2A 2E6JA 2BSTB 3OJ2C 5EU3B 3L3HB 3DO7A 4RGOH 4AM0A 3CSYA 4PRPD 5EULV 5F7EH 5BVPL 1RZJH 4F7MA 2ITDB 1FGVL 2X4TB 3LV3B 1HH6A 2W60A 1PG7L 2XWTB 4P23A 4O2EA 3PP3K 1E4XI 5BQ7B 3ZHKA 3ZLQC 2Q6WB 1T5XA 4H0GA 4PUBH 4YHYC 4XCYA 4PS4H 5HYIA 1U41A 4G9DA 4N90E 2IG2L 2VO5A 4UIMA 5GS2D 5DJ0B 3ARGD 3Q1SL 2BVEA 4KMLB 4M7ZB 5CSZB 4LU5H 3VE0B 4X7CC 4ZS7H 1U2CA 4ZXBD 3KPQA 2G9HB 4QGYA 1F4XL 5EZIH 4L3EE 4U1KA 3C6SB 3D85B 4AEIL 1BAFH 4XPTL 4OCXL 3UJJL 2CJUH 3GI8L 4YXHL 2NTSP 1AI1L 1KENL 1YZZA 3W9DB 4RMRA 3VFWA 5ERWA 5C08A 2QKIA 2AS5M 4KKAD 1R3HA 3IETA 4W6WB 5CEZE 1AI1H 1ZSDB 2P5EA 4CVUA 1I3RB 1U8JB 2A77H 4Z0BL 5HHPA 4NKDB 4Z78A 3QA3B 3VWKB 4LVOC 5DC4B 3MUY1 1T3FA 2YK1L 4Y2OA 4EBQH 3T77B 1UB5B 1V8HA 5DTFA 4A6YL 1P6FA 2YKLL 3FAWA 1MVUB 1J05B 4Z76B 2FIKA 3QNXA 2WSKA 1NUDA 1DR9A 4X7SH 1N3NA 2NX5A 1XF4B 2RHEA 5KOMC 5JMRA 3GIZL 2CDEB 2EO9A 4YIQB 4NZRH 4NJ9H 3SE4A 3LQAH 3ULSA 2XZCL 2Z31A 1DUYB 2NR6D 3PWNA 3T2NH 1T2XA 2UWEA 4AY0A 4WFHD 4P3DA 4N9OB 4TOYL 1E4KA 4FMKA 3RNQB 1U3YA 5FO9B 1J8HD 1UXSB 1A22B 2OJEA 3F65A 1N6UA 3VFNB 1CIUA 1JWMB 4NWUL 1PD6A 5CGYD 5E8PB 1ADQL 4Y2DD 5HDLA 3KYAA 3C2AH 4M7JL 3GKWH 1J7VR 5T1LD 5FA3B 3BXNB 4WGWB 4A2MA 2Y07L