2Y7MA

Structure of n-terminal domain of candida albicans als9-2 (pt derivative)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
300
structure length
300
Chain Sequence
MKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the broad specificity to host-cell ligands by the pathogenic fungus Candida albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
molecule keywords AGGLUTININ-LIKE ALS9 PROTEIN
total genus 70
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7mA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7mA02
4JDZA 4LEEA 1N67A 1R17A 5IHWA 2Y7LA 2Y7MA 3AU0A 2F6AA 4F27A 4MBRA 4JDZB 4LE8A 4F24A 5CFAA 5CF3A 3AT0A 4LEBA 1R19A 3IRPX 2RALA 2F68X 4B5ZA 4MBOA 4JE0A 4F20A 3V10A 2VR3A 2YLHA 4F1ZA 3IRZA 3IS1X 4B60A 3IS0X 2Z1PA 3ASWA 2Y7OA 2Y7NA
chains in the Genus database with same CATH superfamily
2J8UA 3OF6D 1IKOP 1AD9A 1IILE 1R3HA 3CWGA 4R2GD 4APQB 1R0AL 3P0GB 4PJHA 4RWHA 2BY3A 2DTSA 3BEWB 4B9PA 4YFEA 1MW2A 1MJUH 2ZJSL 3QG6B 3IMWA 3JWNG 5B38A 1BIIB 4ZTEA 3GRGA 3O6FD 2B4CH 1N5YL 3D0LB 3DUSB 5C6PB 3W11C 3KLLA 3U1PA 1MG3C 2ZOLA 3NGBC 3TFBA 3ZQXA 2VUYA 4MLIA 2WSKA 5D71L 1BEXA 1KGJA 4M7ZB 3MR9A 4NN5B 2FRGP 1PW3A 3IJEA 2G3XA 3I6KA 4MD0B 4QJ4B 3O3BA 2V3EA 4GSDH 1HCYA 1YPZE 3NZSA 2I7OA 3B9AA 1X5HA 1WRFA 2ED7A 5E1HB 4BZYA 3THMH 1J5CA 5BXFB 3BWZA 4RMTA 4HK3J 3S8WA 1AHWC 4J3UA 3DUUB 1NDMB 4AL8L 3ARVA 4DP8X 1DTUA 3L5XL 4KXAA 5F89B 1RMFL 4WJ5B 3SGJA 1LK2B 5ALCH 4XE0A 3ZE0B 4TQ8A 1J8HB 1Q4NX 4BCYA 1ZT7B 1I9IL 3DHMA 4FFWD 3LTVA 1N9PA 1FZJA 1KENH 3NJNA 4KV5E 1UM6H 4LCWD 4QWWD 5BRZA 2VXQA 4JJHA 4F7EA 1R3LB 5E56A 4JY4A 5J1SC 3POCA 4IKIA 4X98A 5I71B 4TYUA 1FH2A 4UNVA 4MMYB 2CO7A 4PJ5A 1TSRA 5IF0B 3AT9A 3NPZB 4ACPA 2HUHA 3V0JA 1EO8H 4MQXC 5EU6E 4U0QB 1MCOH 1UACL 4OB5L 4F15B 1IC7L 2EVJA 4YWGH 3LZPA 4P23D 5LCVA 2Q10A 3IJ9A 2WXPA 3GDBA 1A9VA 4M8UA 4PLJC 4J3VA 5AFAA 5AB2A 3I9PA 4TL4A 3B9EA 2KZKA 3PWPE 1EJOH 1PKQB 4OIAA 3RB7A 1FL5A 3E8UH 2RQ8A 1D6VH 4RNRB 3POHA 6PAZA 4MCYB 4FX5A 4WK4B 4APXB 2CNZA 4UQDA 4JE4B 4YAQB 2CNYA 5I1EL 2DQTH 3K3QA 5ID0A 4WFEE 2TSAA 2ZF8A 2A99A 2W0FB 1KCRH 2BRRL 1J87A 3UTQB 3CE1A 1J8HA 4WWKC 4LCCA 4BFJA 3M1OA 2YRLA 3OD3A 4TTGA 2X1QA 1ORQA 4ZXBD 4JEGB 4DO6A 3QJFA 5LUMA 3A4EA 4AENA 1H15B 1M7DA 1OP4A 3VFVA 3WAJA 1RXLA 5IK3A 4XX1G 4LASL 2K4AA 4M61B 1AGCB 1AS8A 2MCMA 1B9KA 1QAWA 1MRCH 3S2CA 4Y1AE 1WF5A 5DS8B 1BJ1J 4F57H 2SEBA 3HG2A 2E6PA 2IDUA 4M43L 3SE4C 4EUPG 4FNLL 2J5WA 1FH5L 2ZUUA 3HMXA 4UMGA 5C92A 2W9DL 4NQDB 2VITB 3ZE2F 5E8OB 3O6LL 3CZFA 2NNXA 3EFFA 4ZX4A 4X8GA 1S7SB 3B9DA 3BVNA 5T3ZL 4A7TA 1EERB 3K71B 3FFCE 3PFUA 1IIIA 1UWEL 4HWZA 3QUXB 3LB6C 4MA3B 2FIKA 3EYFB 2C9UA 3L5WB 5KJRH 4GO6B 4PP2A 4MB3A 3GI8L 5HHOB 4QRQA 1PYWA 5BZDB 4LT7A 1M7XA 1H3VA 3CMGA 5IGXH 2BVUA 3I3EA 3OAUH 1EMTH 4ODTL 5IV2A 1Q8MA 5H94B 1B0RA 2EE6A 4PJEA 3T1FA 4YO0A 4UQBA 5T33L 2G4GA 2CJSA 1BVOA 4X8JB 4PMEA 2LR4A 3QZWA 5DJAA 5GGSA 1TLMA 4LBAA 4R9HA 5AL8A 4NZTH 2FO4B 1KGCE 4Z7QB 4CW1B 1OPOA 4Y9FA 2WUBL 1N7ML 1KENL 1KXQA 5TE7L 5CFAA 1I8IB 2DEWX 4H1LA 5CF3A 1JTTA 2VAJA 4PI2A 1UWGH 4XXCC 5IB1B 1ITBB 2H0EA 3K4AA 4CSTA 4ODUA 4U05A 4E9RA 5I1IH 2B3IA 4IRSB 5IVNA 2X5PA 1KIPA 4XHJC 4ODWB 1T4WA 1DJSA 1GYAA 2YSSB 4R7DA 5IJVA 4YWGL 4PJ6A 1A14L 2GJJA 3FCGA 4EQ2A 4E5XB 3MLUH 1JVLA 1YY8B 1AS6A 1ZHBA 3ROLB 3AITA 2R1XA 5MENB 2WB1A 2CBPA 3CHSA 3DJTA 3PCYA 3QC6X 4X5XB 5FA4B 3ZKQD 4PGEA 5GS0C 1B0GB 4Q89A 2CE6A 1T20A 4LFHG 1EQWA 3VG0H 4XI5D 3RKDC 3T1FB 2DRUA 4JR9H 1X7QB 2R9HC 2DQTL 2R2EA 2A77L 3CDGA 5D7LE 1D2PA 2XX1A 5L9DH 4H26A 3S88L 4CVXB 3IVKB 2JJTA 1Y07A 2ARJA 2BSSB 3AY4A 3KNBA 2HKFH 4J8QA 4M5YH 2F8VA 1BQHB 1JNHA 3EYQD 2EZ0D 3RGHA 3HI1B 2J1KA 1EZVY 2GTQA 2BIOA 1JGIA 3TV8A 4UB0H 4ODUB 2JMRA 5LN4A 4LSQL 3F5WB 1B2WL 1KT2A 2WIMA 4KKCD 3UAAA 5FYJL 5HDQL 3JWDC 3T77A 4AT6A 4RGND 3C60D 4P5KB 1T1YB 1R5WB 1U3ZA 3FZUC 2NXYB 4GXFA 1OWRM 4WUKL 3LDBC 4L9LC 4WJG3 3S7GA 3VAEA 3OPUA 2VZOA 3SDYH 1YY8A 3IETA 1QSFD 1CXHA 1G7HB 2BP0A 3ARFA 4IBLT 1NQBA 4FXLA 4LKXB 1S3KH 1BAFL 2OJ1A 3EYQC 4O2FB 3MNZA 2HP4A 5C0AA 1UWEH 1F58H 1G6RB 2FJFA 3WS6C 3DOSB 4ZO6A 1A47A 4DN3L 1YC8A 1EZUA 4HWBL 1IX2A 4R5VA 2L7QA 35C8L 2XYCA 2W0LA 1UKSA 4FGMA 3SEPA 2JH2A 1OOAA 2MTPA 1JGVH 3K8MA 3PYCA 4H0HB 5F9WB 1RSYA 4CNIB 2XWTA 4LQFL 5CSZB 2BSSA 3H2QA 4KXCA 4FN0A 1JG9A 3ISWA 1E4HA 5T33H 4FQHB 5JHMA 4ZFGL 5EF3A 2WZ0A 5D7LD 3MRBB 4MZ3A 1IL1B 1JPFB 4KJPD 4BHUA 1E5CA 3C08H 4R3SA 1JCKA 3QCVL 2EACA 4TQHA 3SYOA 3ZL2A 3T77B 4XN8A 3RL1A 3EBGA 3RQ3A 4MMXA 4WY7L 3L1EA 5DD5L 3HG3A 4NKMB 1JD9A 3FC8A 5IR1A 1QUNB 3ME0B 4G6JL 4DQOH 5TDPB 2WYHA 4ZMVA 5KEZA 1H5BB 4XWOC 4L8BB 4H4NA 5CCGE 5KSAB 2J1WA 3ILPA 5AKSA 2FSDA 5MEND 4S1RH 4N85A 3TURA 4U3XA 2NXZB 3TPUA 4CU7A 4LK4A 3MLTA 2R56H 3US0A 3PXHA 2O30A 3QJZA 3BKYL 3QWNA 4ANUA 5D1XC 2R15A 5DDHA 3QI9B 3OWRA 2E46A 4UIKH 2C3VA 2H3XC 5I16B 2EIBA 4F8OA 3AU0A 4PU2A 5LGHL 3CLEH 4ZMZA 4YHKH 1AANA 4CU8A 4I18A 3LN4A 1MNUH 2DQJH 1WH0A 3FT0A 3F83A 4YSPA 5IJBC 3V0FA 3Q6GL 3SQRA 4NZDA 2X1WL 3F7VA 5T1MB 5GS1A 2DAVA 2ICCA 3ZDZE 2F5BL 2CK0H 4JO2H 1AQHA 1JN6A 4K7PX 2NDFA 3ESVF 1O9VA 2V37A 2W0KA 4PJDA 3SDCD 2X4QB 4F2MB 4X6CA 2N0KA 3APCA 3G3LA 4LSDA 1IAIM 1OSYA 3B2MA 3TNMA 2O93L 1SBSL 3RZCD 3RPKA 3N06B 1GGBL 5DRWB 5C3TA 4P2QA 4PW4A 4GSDL 2ITCB 4ZX6A 4J28A 3GHEL 5MP6H 4PJGB 3RI5F 2CDFB 5CEZD 4DHLA 4NO0D 2G5UA 2WLMA 2ADFH 2Q7YA 4N0UA 4AVKA 2MPAH 3ILDA 4TTDC 5AEAA 3ZOAA 3BRGC 4Y2NA 4F37K 2R29L 2HT2D 1A1NB 4PJ7A 2I26N 1I7RA 5B1CA 5HY9B 4MMZB 3SQOL 1CD8A 3WTWA 5I1GH 3VGHA 4BDVB 3DVFA 1OGTB 2H3NA 1I9IH 2X3BA 2XXCB 2Z91A 3JWNE 1OQXA 1JK8A 3M86A 2VCOA 3QDMA 4K5NA 3V7AE 3DYPA 1BVLA 3ETBF 3KJ4C 3LN4B 3B1UA 2VXTL 5D7LB 1MVFA 4HCRH 1XFPA 2YEZA 4YXLH 1AZUA 2G9KA 1C5BH 1AZVA 2AKRB 1RULH 2IBBA 4KZ0A 3U0TA 3BI9X 5KYXB 2L7JA 1R24A 1USZA 2B1AL 3C5ZA 4AOFA 3OGCB 4L0ZA 2EVGA 5FB8B 1IC7H 5DUPH 2BP3A 3TBTA 4K94H 3CDFA 3DSFH 1FUNA 4DGWC 2ZKHH 5JNYB 4RRPA 5J11B 1X9LA 3DDFA 4Y4FB 2A4EA 2FWLB 2YQBA 2H26B 3BSHA 3L5HA 3SE9L 3CHRA 1YSOA 4A63A 2D7OA 1NM4A 3RWJA 3X1EA 3ECUA 4MDRA 4UOW0 1H8OA 1A22B 3P0YH 4HJJL 3TZVD 1AXSB 4LVHB 4BZ1H 4GW1B 5JZ7C 1PZ2A 3O9WB 2XKNB 3RYMA 3PGCA 5HY9A 5EO0B 1QI4A 3GZKA 3GSNH 1KPRB 2BRRH 2DQEL 2OZ4A 3NCXA 3RJQB 1P6FA 3QIBC 3NOIA 1WS8A 4ZTPL 2VDQB 1A3ZA 4J8RB 3HBQA 2JB6A 3FRPG 4QIRA 3SKUD 1LE5B 2ESVE 1XF5A 2OTUA 1E5ZA 3W82A 4OUOA 2XVBA 4YSEA 4K7PH 1HHJA 2VZ3A 1M56B 5HI4D 1WPCA 4AGLA 1FNAA 1U8CA 3QDGA 1CFNA 2O6FA 4W6XB 4D8PA 5BJTA 4ADJA 4ZI8A 3ZQWA 4KITB 1MNUL 4MHHG 3EO1A 2DQJL 3LNEA 4AXWA 5HDBB 3LZFL 1HS6A 2CXGA 4XCEA 1QO3B 1UWFA 3O4LB 4PVLA 4G82A 3VW3L 2RH0A 4R7LA 3FO1B 4WUUD 5ITFA 1UXMA 1HESA 4XCNA 5FYLH 1AHWA 1BP3B 4IHOA 4FFYH 4R26L 3HAEA 2VLJB 5E94A 3UBXB 4OIIL 4OSUH 43CAB 5L8KB 2XACC 2ATPA 2V17L 3OWEA 1Q0EA 4JKMA 3ARBA 4LB8A 5DS2A 4Y1AD 1QZNA 5DVKA 3AM8C 4TULL 4KY2A 3I2CH 1H9VA 1Z9NA 4HCRA 3VXRA 1MI5A 4B9JA 4XPFH 4K07A 2ZSVB 3CC1A 3NFSL 2J1YA 2CHZA 4FMVA 4IRJB 4WU5B 4BBWA 5F3BA 2FO4A 4FG4A 1JOIA 3V7AG 2G9HB 5EEYA 1XF5B 2OTUB 1N18A 2R69A 2WQVA 2K78A 4HPHA 3ULUD 4O2CB 4NRZA 1OAZH 2WLYA 4ENEC 4ONGL 1TVHB 4G7YH 3TZVA 4PRHE 3PREA 1T6VN 5GS2H 4JFDE 4PWKA 4Y19D 3BYTA 3FT9A 4ORZC 3UGXA 3C6EA 4LCWA 4N2HA 3ECBB 4AI7A 5E95B 3FO0H 1G9NL 4G72B 2ARJQ 3BQUC 1RUPH 4YDIL 1O9ZA 2ERJB 4WHDA 1NANH 3GSNA 1DCLA 3QWOA 4K8RD 1GL4B 1T1WB 2CLVA 2R0LH 2XG5B 4N68A 5JW3L 1AYOA 3MV7B 2VAAA 3P73B 2VZ1A 3L4TA 3V0WH 3F7PC 2ZWYA 2BC4B 3NZHL 3P9LA 4IMLB 3QI9C 5IB2A 4F8TA 4IS6A 1Q72H 2AJZA 4RRPM 5FKPB 2FL5A 4YHLL 3QXAA 4DEUA 4CBPA 5MHSD 1PX4A 2WO4A 1TQTA 4TNWK 2ADGB 3QPXL 4K3DL 3VSUA 1JZ3A 1G6RL 5EORH 2EYTA 2BPBA 2FEEI 1L6PA 3L9YA 4RIRA 4QHNA 3KNBB 3B7RL 4M29A 2Q86A 3P2TA 2WBJD 5AW6B 2ZWSA 4W9DC 4BFNA 4DEPB 1JVOA 3Q06A 1QA9B 5HHMB 1KBVA 2DLFH 5TQ0L 4ANXA 5E6SB 2IH9A 1U4FA 1F4XH 5D5MA 4G8GB 5EOCL 4AMKL 2VR4A 1CU4H 5L88H 1R3HB 2QV4A 3D1MC 2DQUH 5CILL 1FBIL 5DZVA 1I75A 3GXNA 1N5AA 3SZKC 2EDTA 2ED8A 3DMMA 3ZUCA 5IM7A 1T21B 3QFDB 2D4FA 4PTUB 4R90L 5DHVH 4DN4L 2JKXA 1XIWD 4MAYB 3DOSA 1M3IA 4LRIC 4KJPC 2VDLB 2BXYA 3ULSB 4G9FA 4DN3H 5IEKA 2WXMA 4JFWA 2G2PA 1BF5A 2A6JB 1JF1A 3C60A 3DGGA 5I17B 3QQ4B 4PRIE 4RZKA 4N0YL 2Y72A 5DVNA 3D18B 4A2MA 1V54B 3LEVH 4FQXD 1G7PA 1U8JA 4I8DA 4JFFE 4PJ7F 4TF4A 1S7UA 5BV7L 2R2BA 3DUHA 3O81A 3T0ED 3PHQB 4JHAH 4J3SA 5TDOB 1PD1A 4MCZB 1CICD 1VEMA 5FUOH 1VFUA 1MCRA 1OSZB 3DJRA 2ID5A 1WA1X 3EIFA 4I2XE 3GZOA 5ACMA 1YEKL 3LRKA 4MZRA 2OP4H 5JW4N 4IIQB 1FL6A 2W8CA 1S9YA 1ZAGA 2YAQA 4OD3H 5IM7B 1M7UA 4F7PA 3GXTA 3RNKB 4YK4C 3FHAA 2OTWB 3GGWA 4X6EA 4XN9A 2YSTA 1S5HA 1R0AH 4M48H 3ETSA 4DQOL 3DX1A 3SN6N 1G87A 2X4TA 4C56B 1TF4A 3HS8A 1E3XA 5DK0B 2EYRB 3CC5A 4WVRA 4ZX3A 1DN2A 1A4AA 2HFFA 4YDIH 5EPMB 1KXHA 4W9LC 1PSKL 3UG3A 1ETB1 2XWDA 2Z92B 3H42L 1F0LA 2OMTB 5IQMA 1TNMA 3WEMA 4YFDB 2C1PA 1GAFH 2HJLB 1ZT4B 1TETL 3GBNH 4QRSA 3B5GA 1LWJA 1ZT1A 4RFEB 4X6BA 3ZKNC 3OAYK 3KLHC 3HE6D 4ODXB 1NCBH 1CIUA 3Q2CA 3A3YB 4LAQH 3INUH 4I77L 2AVFA 2XRAH 1C8PA 5I1AA 3GO1L 1SOXA 1OSZA 2VH5H 2J43A 2CKBB 4CDGC 2VLRD 1A4JA 2AAAA 5D96B 1NEZA 1R3IL 4XBEH 1E2VA 4NZ8A 5DQ9B 1ZD6A 2CDEA 3PHSA 4L9LA 1SEBB 4MXQD 2I9TB 3MUJA 3FBKA 1DL7L 3NABL 4MA1B 4AMKH 4DP9X 5IB5A 2MFNA 3GC3A 3U0WH 4F5CA 4PGBA 5I6OA 1JJUA 1S5HB 1SXAA 1ZANL 4KJWC 3CZLA 4DGYH 2NY6B 4HDIA 5GGQL 5AB1A 2Z8RA 3U6XS 5F1NA 4QO1B 3ASWA 1RUAH 1ZVYA 1UXWB 4YHNA 2E9BA 3QIUA 5E1GA 4NLHA 4JHWH 4R2GB 3GHEH 1XBRA 4LQ1A 2GSGB 3EBHA 3HHMA 2B0SH 2OX5B 1U42A 5E23A 2CLRB 4P49A 4G80A 4EOWH 2XA3A 3BAEH 3NCMA 5MHSE 4U1MA 3A23A 3IKCA 3ZZSA 5DC0A 4WI0A 4L3EB 2D7NA 3V8CA 4GW4B 4FKEA 3RAJH 4OZGF 3QIWA 1ZSHA 1INQB 2H1PH 3PP4H 2WXIA 4Z7OF 3VA6A 4R4ND 3HRPA 4RDQF 5EWIL 2BNUA 1PLCA 3I50L 3GLDA 4HAGA 3TYFA 1FDLL 1KFAH 3QEHB 3TBVB 1F4YL 2QQLH 2UWEE 5DRZA 4HIEA 1U91B 2Q8BH 4UU9B 5F97E 1I8KA 4E9XA 1SY6A 3NMEA 1C5BL 2VDQL 3UAFA 3KBFA 4FXGA 4L8SC 4JQIL 3W5NA 2NCMA 3U9WA 4KFZC 2ZX5A 4DW2H 2M2DA 2NTSP 4YX2H 5C70A 5IB5B 4P4KB 5ISZB 4EDWL 1H0DA 1NGWA 3JZYA 4J3OC 2XN2A 4IK7A 1KGXA 1OLZA 2ADYA 4MDIB 1BD2D 5JUEH 3LPWA 3IFNL 1W91A 1FORL 1T2QL 3EYSH 2WQUA 3G6JF 4X6FA 5IESL 1CFTA 5FIEA 4P5SA 3DO7A 1KJMA 3MCLL 1DSFL 1R17A 5F3HA 4L1BA 4M48L 3NSFA 1SXCA 1W16A 5ANMA 1U8KA 4FAAB 2AEPH 3IN2A 4PWEA 4L3EA 4I0PC 4Y5YB 2X0UA 4HBCH 3C5SB 1A7NL 1EEUA 4NJ9H 3VXOA 3RFRA 2H45A 5ADOL 2VT0A 4AQOA 3MFFB 3T4YB 3GB7B 3JVGC 2X4SA 3MLWL 4NUJB 4PB0H 4PGEB 2BINA 4UOQA 1E7VA 2VDKL 4M8RA 5KSBE 4KKBC 2B4CC 1NINA 2IPUG 2JCWA 1ZXQA 2YUVA 3F64A 4HIJB 4PJAF 5BS0E 3CHXA 1WA2X 3C6LA 2CUHA 3B2VH 3KPSB 3S35H 1COBA 1Q38A 3HW7A 2YBGA 1ZIAA 4GINA 4JO1L 4NQDE 3EXJA 1BZ7A 4OY9A 1JHLH 2ZXBA 3QULA 3SDXA 1F3JB 3NACH 4I0PD 1I53A 5FGCB 1A2YA 1J8SA 4FJZA 1IBYA 4PGDB 4L4VA 4CN1A 4YSAA 5IB4A 3KAAA 1BQHA 4JFEE 2QJDA 3EGSB 1CFTB 4NFCA 5KN5B 4P8QA 3O0LA 1UD8A 2A9MH 1QBMH 3BT0A 2M26A 3Q5OA 1LO0H 1N7MH 4DGUA 5ICZB 4RA0C 1E65A 3BQVA 4A2GA 4Q0XL 2V17H 3SDDC 2JJSA 3UZEC 3O8XD 3U7WL 5ACZA 3X1GA 4PJ8D 5AW8B 4LLMB 4PRPA 3PWJB 5DT1H 1UOKA 1JUFB 2A3TA 1AZNA 4JHZA 2PCPB 1G7HA 2BP0B 2FO8A 3SKNB 1E4XL 2PCFB 1P4BH 4GAAA 2G9HA 4CBZA 1R5IB 5I15H 4MJ5B 4X80H 3V5KA 4KOCA 4KVNL 5ESAB 3TZVB 3ZPDA 3BUBA 3D85D 1ZLVK 5JIMA 3KPSA 3QG7H 3L95B 4GRWF 4R7NB 4LSUH 2EIJB 4JZNB 5AVRB 1A3QA 1L0YA 5TE6L 3D50A 3FQUA 4P4RB 3T0WA 2QQLL 1J9TA 1ERNA 2R51A 1BEYL 1A6WH 1A2YB 2HN7B 1IAIH 3V0VA 5KTEL 4PHXA 1GW6A 5EB9A 4Y2LA 2ZP9A 3V5HB 4M3KB 1IAOB 1NCDL 3WIFA 4FHBD 3B7SA 2FSEA 3OC8A 3SBRA 2XFXA 1EFXA 3HE6A 4NQCA 5IB3B 5EZPA 3W39A 2VSMB 1QNZL 3IJSB 2R0LL 5G4OA 2X70A 4GKLA 2JJUA 1ODAA 5IFJB 3A22A 4Q14A 1B6DA 3L4XA 3UH8A 1ETA1 2YS4A 4PJHF 4DWHA 2XFGB 1N0XL 2CUAA 3QIBA 5GRWA 5DK3A 3SJVD 4XH2A 3LCYA 4A2EA 1IZKA 4QHKJ 2KDYA 5DMGC 3ARYA 1Q9KB 2P3YA 2HWZH 4ABUA 3BPCA 3NN8B 1LEGB 5GRJH 3S3PA 2VR7A 3EGXA 3ILPB 4ZMOA 4GRMB 1WBZB 3FB6A 2FNWA 2YAHA 1WFJA 2FTAA 2OW6A 5ERWB 2H0FA 4YR6A 2F2HA 4GAYB 4AEIL 5DS1A 2BVTA 5HHQA 4OCSH 2I60L 5GGVY 2WYZA 4YNYB 1JK9A 2QMKA 4XPAL 4ZXBB 1V3MA 3OKYA 3HLAB 5GRYA 5TQ2H 3H1ZA 2OMVA 1EZLA 2CM6A 3R8QA 1ETZA 2RIKA 4WFGD 1BAGA 2IAMB 4U3HA 2CHXA 3LPGA 5DZAA 1QRNA 3MRJA 1QLRB 1IGFL 2OL3H 3A4DA 1A3LL 2MKLC 3CDYA 2X9YA 1ZLEA 4JFEA 4YHIA 1MFEH 3H2WA 1PQZA 4HAKA 2VMCA 4BFFA 3MLVH 4XN4A 4BZ2L 3LAFA 3ZE1E 3WS3A 4JMXA 1KCBA 3CFCL 3MJ7B 2FNBA 2NYKA 5T5NF 2BS71 5DI8B 2ZTBA 3MV01 2VJ0A 5GSVA 3QCVH 4MRBA 4UF7C 4OJFL 4Q0XH 4JHBA 5D4IA 4A55A 5KWYC 2OMBA 1OM9A 2YLKA 1PD6A 5K39B 3Q1SH 2JCCE 4JPWL 4UT9L 1RLWA 3IMRA 4NO3B 3VGDA 3N1FC 2HFGH 2IDSA 2BOCB 4HZLB 4OGXL 1D9KD 4F93B 2WLZA 1YRKA 3CH1A 4OLWL 1MFAH 4FQIH 4XC3L 5JPMC 4UQCA 2E7HA 2V7NA 3GWJA 1MWAH 1PPIA 4UT6H 1QFWL 5J89A 2VXVH 4JM2F 1NCJA 32C2B 5TPWH 3CFDA 5A2IH 3D2UB 4XNXH 1NC4A 2VW6A 2I9LA 4YMPA 2HG5A 4I3RH 2JELL 5D7LA 1VCBC 3MRDB 4X4YA 1TSHA 3F84A 4JG0L 1RHHA 3MV9A 1AZRA 3WFCH 4AQ8A 1T0MA 2YQ2A 4HH9A 2TAAA 3KJ6L 3V9CA 2C3GA 3NH7H 4G11A 3FXIC 4N0CC 2VLRA 2WYIA 4XO8A 5F0LB 5FX3A 4NQXA 1SVBA 2XV3A 1JNNH 4WFHE 3TBTB 2C7UB 3ETTA 2GBAA 4OZ4A 3RDTC 3SE3A 4ZO9A 2EXWC 1YPZA 4QYAA 5E5MA 3R06B 3NZUA 3WCYA 4JDEA 1CGSL 2Y22A 5J4MA 2IG2H 3QRGL 4HKZA 2GTWB 2OYKA 4ODXA 2EP6A 3WXWL 4P3CL 3TVMD 2CR0A 2D0FA 4OVUA 3RU8L 2XBZA 2C1OA 2FJHB 2DD8L 3TBCA 1JYWA 5J8OA 1CLZL 2W60A 2WGNB 2I69A 1FV1B 4AYID 4QOKD 5A16A 4FOMA 3AREC 3RY5A 3GO1H 4ORGB 3SGKC 5HYQB 5J57B 3BQUB 3U6XA 5JMOC 3ZKMD 2P28B 4Y9BA 1UGNA 4R2GC 2OSYA 3WMPA 1GMEA 2FVNA 5J3HC 3JWNH 4L29B 5SV3A 1XSIA 2G75B 2J1ZA 1YNKH 3BUYA 3CK0H 4DVRH 4L23A 4KKBD 4N0CD 4XPTL 1A7QH 5IMOA 3SKMB 3JV4B 2Y0SA 3FRPA 4JN2A 1DL7H 3NABH 1GZHC 3EH5B 2CKBH 5J12C 4Z7WB 1ADQA 2VQ4A 5D1ZD 2JV6A 5IQ7H 4ZW5A 1MHHB 4FF9A 4WFHD 1AXIB 2GJ6A 2DEYX 3J2PA 4PJCE 5JYMA 4JMNA 2VN3A 3QP3A 3TO4A 3NK3A 3RUGE 1JRHL 1HTYA 4MJIB 1HE7A 3ULVL 5FCUH 4EZMA 4A7QA 1Z5YD 1YY9C 2BNQA 4WEUD 3QCTH 3VVVA 1KCSL 1PNDA 3H7BB 4JK0D 3AFLA 2DMGA 4I1RA 2C34A 1ZLWH 4IHOB 1QSED 4M6OH 3OMAB 5I0WA 1DQKA 2BNRD 4NP9A 1C08B 4OU3A 2NW3A 5CHNA 2P24B 3NRQA 4KUZL 3H9HB 2BSTA 1DEEA 1X4XA 5ADPL 3GNML 3LOWA 4GKZB 5F1IA 1RIVL 2W94A 5E08L 1BVNP 3QA3B 1MJ8L 4Y16A 1B0IA 4MQ7B 3HNTH 1EAQA 1QQDA 1RIHL 4ELMF 5IMOB 1XH3A 1GZPA 3P11H 4OZFA 3KMDA 1A02N 2ITEA 3S88H 1BW8A 3EOAA 1WWBX 1NFIB 5D72H 5I82A 3RFZA 3HUJE 4PAZA 5L2KD 1KB5B 4P2CG 1FORH 4O02L 3OMNB 2YFNA 3ARZA 1TVDA 4ZS6D 3L4CA 1JL8A 1P4LA 2EDRA 4LLQB 1OCWL 5K1JA 1CWVA 3U6RA 5D7IE 3NH7L 3OTTA 5IOKA 2BSED 1CFSB 3ATFA 1QHQA 2O26U 2ZXGA 1OIOA 1OP5H 3HC0B 2I5YH 2UXFA 2QSQA 4TOYL 2L7UA 2E9GA 1G5GA 1WFMA 5F8RC 3Q2NA 4EI0A 5A2FA 15C8L 2XHNA 5AG8A 4FP8L 1CE1L 2O61B 4ZXBC 1TJGH 3WFHB 1XF2A 1T89A 1ZGLM 3PNWB 1KB5H 1M9WA 4BUHA 2FWSA 1TIUA 35C8H 4PS3A 2DI7A 1TZ8A 4R0LB 5TK2A 4JFPA 4CMHB 1GA2A 3LQMA 4PJ7E 1KV3A 4FQHA 1ILUA 1NH6A 2OK0L 3F62A 4XXDA 2MQGA 3LV3B 2P26A 1A5FL 1YY9D 1XGZA 2VM9A 1HEHC 4LF3A 3FB7A 5G5DA 4ADIA 1TTUA 3DA0A 3QISA 1BZQK 4L3AA 1UZ6E 5B1JC 3OVUB 1BQ5A 3LYRA 3C08L 3E1ZA 3MOAH 4GUPA 1OARL 1TO4A 3JXAA 4XAWH 5FKAA 5DD5H 2NY1D 5HPOA 5EU6A 4QGYA 4XWGL 1ZHBB 4TNFA 2R1XB 3ROLA 5MENA 2CAKA 3LIUA 1UWXH 1D7CA 1UM4L 1M57B 3ZMEA 1NDGB 4LLUA 3CPUA 1KB3A 3MROB 2IXQB 4JB9H 4WI8A 1I8MB 3FU0A 5CP7A 1HL9A 3VD4A 2QMJA 3Q8CA 4L8SA 4S1RL 2AW2A 1DVFC 2LU3A 4F58H 4B0MB 1PZSA 1MWAB 3BXNA 3C60B 1RVFL 4HFUL 1T1XA 4AGNA 5BUGA 4FQXA 1RKRA 1OAYL 2ZCZA 3CDZB 3MUZ1 4TVPL 4M7LT 1P4IH 4Y9EA 5CEZE 2HT2C 1E28A 1QR1B 2FIRT 4YSCA 2FO1A 3FB8B 2VC2L 4GEIA 4HIXH 1QVOB 1JWUA 4MQSB 1R4XA 1KTLB 4P57A 2Z8WC 5D4HA 4LSPH 4AEEA 1BMZA 1DVQA 4CC0A 3VA2C 3H9YA 1Q9OA 4KX7A 4QRRB 3WNJA 4HJ0C 2F0CA 4CSSA 2GK0A 1KWKA 1QI5A 3MJ8B 2OR9H 4JPVH 5DEFA 5I30H 3U83A 3W37A 5IBUB 5JPNB 2EXSA 1Z9SA 2VLRE 4UQ2A 4DERA 1Z3GL 2V5TA 4GP5B 3IETB 3UJIH 4M7LH 3FONA 4TVUA 2A1WL 3FB5B 2J88L 3AXHA 4NNXB 2EYRA 3CC5B 4O58H 2P45B 4NEHB 3ARPA 3ZYIA 2XPGA 3EO9H 4KK6D 4NPJA 5IHUL 1NAML 5T3XE 5DJ2B 1K6QH 3CN1A 3KWUA 1JGUL 1H8SA 5IHZA 3QARA 5HJ3A 5KS9A 3BE1L 4PTTA 4PGCB 4EDXB 4YNYA 4LVHC 4FS0A 1I9JL 2NR6A 4OZFH 1EBAA 2GJZA 1FAKT 1XZ0A 2R9HD 2DDQL 3H9SA 1JV5B 4PJ8B 4YBLC 2R29H 2XIBA 3SDXE 2HFEB 3KWTA 4Q74A 4RGNE 3K81A 4PUBL 4F33B 1N10A 2ZPKH 2HG0A 2YRZA 3MV7D 5HGDA 3V4PA 4JANB 1D6EB 1S2EA 2UVEA 1RFDL 2XQ0A 2OL3L 3DURA 4FMFA 1OM3L 2WWNA 3MODL 3NAAH 4YHMH 1X5JA 2DTML 3JWOC 2H4EA 5FOBB 5DD3L 5KVDL 2HLFC 4H88H 1VACA 4IBYA 2XN9E 5IR1B 1NTDA 3FZUD 1F1GA 3QAZC 5HDBF 2FT8A 5T5FL 2APWA 2EQDA 3V6OE 2JB5L 4N90E 4R5XA 5KSAA 1BQHG 3TA3B 1QEXA 2SODB 4YL9A 2HH0H 1HU8A 5SWSB 3EFDH 2WXOA 1TZGH 3UTTD 3H2PA 1E8XA 4Q9BA 4GFTB 2OCJA 4Q6IA 5KVGH 2BXZA 1PVHA 2BZ7A 2VDPB 4M7KL 3P0YL 4HJJH 4B9YA 4DOHE 4U6XB 1RUKH 5CMAB 3VWJC 1B9ZA 2I25N 1SJHB 4G6MH 1A3RH 2LABA 4XI5C 1F00I 32C2A 3CFDB 3OKEB 5LAXB 4HX1B 4Z7UA 1Y18A 1QFWH 4S1SH 2CO7B 1H3PH 2H7WA 3VQLA 4RFOL 3C6LD 2NOYA 2A74B 1PX3A 3WNIA 5AG9A 1RP9A 3FQNB 1VRSA 2XG4A 2XY2A 1OE1A 2R1WB 2CJUH 1R19A 3HZMA 1FO0H 4OUUB 1HI6B 3ZDXF 4I77H 4UIMA 4HIQA 1ANUA 2FLMA 4N6RB 5C0IA 3V5DB 4JFHD 1PCXA 4JUTA 3V4VB 5ISZA 2HJKB 4LCVA 5DR5L 1F6AA 1GTNA 1JNNL 1BAWA 3A67H 3UADA 1JI1A 4A7UA 4KKCC 1NGPL 1EIBA 2OR9L 4JPVL 2Z35B 3VW3H 3QJQB 5BVPL 5HD8D 1ID5I 1GS7A 4NUGH 1PG7L 2HVKB 3SYCA 2APBA 3U0WL 1FE8H 1HHGA 1M05B 2PYFB 2YD4A 3GMOA 4UT7H 4TNVK 2X88A 3T65B 2N4IA 2G4EA 2HFTA 1AZCA 1KZYA 3PIQB 3S36H 2P4AB 4MXVF 4OKVB 4Y4KD 2BH0A 3T3PE 1GRWA 4P46A 4HK3N 4NXKA 3WHE1 5CNHA 1CG9B 1DBAH 3ZK0A 5KVFH 3SPVB 1MDTA 3IS1X 2DIAA 1UJ3B 2MCAA 1UM5H 3DRTB 4H20L 1RK0B 4N2OA 3W1ZA 2DDQH 3JV4A 3SB3A 5C0JB 5GS0H 4MHHI 4PREA 1USQA 5HYJA 1GKOA 4KY1H 4NRZB 4FNLH 4LVNC 2DLTA 2XLLA 3JV0A 4HH8A 4YE4L 1GSKA 3UCQA 3BJLA 4AITA 4FLOA 3PP4L 4LE8A 5EO1A 3Q05A 4FERA 1GYVA 2O6CA 2W95A 5IQ7L 2VRAA 1LQSR 5T1DH 1RZKL 2JTYA 3HZKA 4V2BA 3ZSTA 2LU5A 5CEXA 2NSMA 3QQ9C 4DO4A 2Z6FA 1FNEA 2CO2A 4LIQE 3U36B 1YZZA 4XXWA 4JBSA 1GIGH 5IB4B 1HK6A 3IDYB 5ILTL 3HE7C 4MD5B 2F15A 1T04A 4DW2L 4XNUL 3QWOB 5F0MB 5AVXB 1KCSH 4PP2B 5LNDA 3UZQB 3QIUD 4IEFA 2VAAB 3P73A 2Z3FA 4MMZC 3VI3E 4R83A 4PY7A 3ZDZF 1QACA 4AYMC 3EYUH 4C83B 1TZGL 3NZHH 1YAIA 1UFUA 1D6VL 4CVZB 3NIDE 1KSRA 4N6QA 1NGXB 2BNRE 5EZOH 3WJMB 3PL6A 2NY6D 3SDCB 3BPNC 1QTPA 1MJ8H 2OSLA 4GI6A 4P5RA 2XN0A 3KPRD 2GSIA 2AJYH 3VFMA 4G6ML 2X6UA 4DGVH 5EUOE 2F54B 4QY8B 3KPLB 4KXBA 1LO5A 3UYRH 3ML9A 3FFCD 3L95A 4FG6C 5DZNA 4Z3IA 2L0DA 5KAQG 5LWYH 3ZUNC 5HD8C 2WSDA 4YGVB 3N40P 5PAZA 1J05A 2AQTA 4DTGL 3OKOB 4ZQTA 3MAWA 3S97C 1NBCA 2VN6A 4GP8B 5ESVB 1HNFA 3VFOB 3PABA 3PS6A 2XKSA 3S37L 3UBFA 3VI3F 3VJ6B 2R8SL 3B2VL 3ZKXB 4JO1H 3RZCA 3D2TA 2PP9A 5CGBA 3LQAC 4TUKH 4FFYA 5SWQB 1KCKA 2F53B 2Y7OA 2FR4B 3OG6B 1RP8A 4PJAB 2AXJA 5CGYC 1YEJL 2GUOB 1HT6A 1YMMB 2IWGA 1SLUA 1ZDSA 3AREA 5LAPA 4NKIH 2QELA 3FFCA 3OJDB 2KPWA 3IDGB 1MUJA 4KQ4H 5DUBB 1V7MH 2BY1A 2K3HA 3PJSA 3VXNA 1FG2A 4R7XA 9CGTA 3QIBB 5D6CB 5L6YH 3G08A 9PCYA 1KIUB 1MCSA 3B3IB 1NGXA 5A2LH 1GC1C 2BVPA 3QQ4A 1P4UA 4H26B 4AJVA 1KY6A 5CJOH 2OJZL 2X2YA 1IC1A 2VL5B 3BIKA 4QD2E 4DPCX 3OKMA 4MKTA 2XA8L 4BK4A 1EAPB 3RHWF 1D5ZA 5DMKB 3ZZ1A 2VL4A 1CXLA 4M3HA 3VFTB 4BA8A 1P4BL 2VDRB 1ODUA 2PCXA 2Q76A 3PUUA 1MW3A 2XQYK 4YZWA 4DZ8A 1D5IL 2JCCF 4GQQA 3SPIA 3W0WD 1FL3A 4NCDA 4HJIA 3AACA 3V79C 2WTOA 2D3NA 2DQIL 3VX1A 3S96A 1G6VK 3UACA 4JRFA 5FFLA 4YHIB 2C4XA 4YDKL 4BYHA 3G6DL 4G6FB 1F4AA 3RILA 3SOBL 3DVGB 3FUIA 1S78C 3RX9A 4A37A 4X99A 1HZHL 1BVNT 5BMFL 4R4FH 4JO5A 1NEUA 3G08B 1UZGA 3PWPD 3IJEB 3ATEA 5DQDL 1X5AA 4WSGA 3I3BA 1YNLL 4NPYA 2OMUB 2HKHH 3KLKA 3SJVB 2XU9A 3AZUA 1HSBA 1TMQA 3MCYA 1ZY9A 3BVVA 3WE6B 1UATA 2G5RA 3D87B 1ADQL 1E9PB 1GGIH 2WLIB 4QXUH 1CBVH 1JGDB 4JFDB 4AUJA 1NDMA 3QUMA 1V55B 1J5OH 5DEGA 3JTTA 3MYJB 4FC3E 5D7JD 4YHZL 3FU7A 1C5CH 5KG9A 5D5MB 2VZSA 2VC2H 3P4MA 4M4PA 3L4WA 1XMEB 3L3OA 4P57B 4WO0A 3OKNB 3C5ZD 3CJJA 4PJ9C 5AW1B 1C12A 3NIFB 4FXKB 2IGTA 2WZPD 1A4KA 4ZQKB 2DQHH 4MVBD 5I30L 3CHQA 2KZ1B 5CU5A 2ZCLL 4LU5H 1TCRA 4HPOH 3EJPA 2EDWA 3HR6A 4HSQA 1O75A 1VAHA 4F7TB 4WDIB 3VH8B 3ULUF 2O5YL 5TGBB 1XMWA 1HHIB 1AD0B 4LEXH 2ISDA 4DGYL 2KC0A 2NPLX 2R59A 1TFHA 3QCUL 5CEYB 3RGVB 4D3CL 5HHPB 1CL7I 1F41A 2ZKXA 1K72A 3R7QA 3VB9A 3V55A 2QL1A 2BCKB 3PXLA 2VZTA 2QGDA 4R6UA 1A8JH 2P7TA 3NUKA 1L0QA 1U58B 5EOCJ 1KIRB 5GSRA 4YHKL 3RBSA 2WINB 4APXA 2E7CA 1MREH 2R2BB 2ZOTA 4U2ZA 4Y4HD 3KYNB 4Z3TA 4OZHE 4ENED 3O6LH 4XCCH 4OGYH 4HIEB 3MMEA 1FN4A 1GMIA 1WAAF 5BS0D 3S5YA 3SDXF 3RTLA 1V27A 3S3SA 4WSJA 4NZUH 3Q1SL 1YEFH 4WI2A 1EXUB 2MHAA 1MCPH 3A5VA 3UTPD 1S9YB 2OTPA 3ARGA 4HJEA 1RU9H 3NSYA 3SQBA 4PJGE 4V1DD 1F3DJ 4MBOA 3MLXL 4OCWL 3CU7A 2DY2A 3MRLB 2AJ3A 1NA8A 5C0BA 2D3VA 5IGXL 5K69A 3RY4A 2NY1B 2OMYA 4GEJA 3B9KC 2WIIA 4KNQA 5DS8A 4NO2B 3L9BA 4PLKC 2Y7NA 3P2DA 5GRUL 5FYKE 1TQUA 3EJZC 1TEGA 2Z92A 5AYTA 3IFNH 3MKGA 1JDCA 3FNKA 5HHPA 2XXMB 5F7DB 4MKMA 5E8OA 4ZMYA 4ATWA 3F7YA 2DJMA 1A1NA 5ANMB 5E9DA 2PYEE 2P48B 3H4FA 2JVUA 4FQXC 2KZWA 4HS8L 1JZ2A 1MWOA 1RI8A 1GGCL 2K1MA 3A4FA 4L37A 4RZCB 4NQSB 2XN1A 3IJ8A 3TP4A 3DV4B 2ZWNA 3AVEA 4D0BB 2PTUA 3APDA 4R4FL 2H32B 1YLBB 2F74B 2CO6B 3T3PB 2XNAB 5E99L 2HMIC 3HFML 5JQIB 3CLWA 3FUJA 4NUJA 3RVXD 2QBWA 5F7LB 1LEKA 1CVRA 2B1AH 2A74A 3TL5A 5DWUL 2X1PA 3RB5A 5I0ZA 5KUKA 5H94A 3T3PF 1B0RB 4PJEB 2ZUVA 5D2NA 1FLRH 3C5ZB 5F1IB 4LSVL 2CDEB 2WNGA 2O5ZL 3LDBB 4L9LB 4AQZA 4YHZH 2VRKA 3GFUA 3VXTA 3ZMRA 2XSKA 3FYIB 1WEJH 5I75C 2NCEA 1NIAA 1I1YB 1UD5A 4PRAA 4ZRGA 4GP4B 5I1CL 3CFEB 5LKNA 5ESQB 2J8UF 1X4ZA 2QHRL 5EN2B 5EULV 4EUPH 4HOMA 1IBBA 2CUMA 5FYLE 2J71A 2ZXAA 5ETUB 4J12A 5HHNA 1KCUL 4RDQG 1YG9A 2PWFA 5FHAL 4PRNA 1AGEA 1YEEL 4WHYH 1CCZA 1FCGA 3GYRA 4TQPA 1EO7A 4FQJL 3P9WB 3S35X 4PJBA 4UQ9A 4XBGA 3SE4A 5D1ZI 1AFVH 3NBNA 1SBSH 2V9UA 1GCFA 5ISZD 3QYNA 5SWZD 3N44B 5GGVL 1XCWA 2QPEB 4B5ZA 1SYVA 2VISB 3HG1B 1OQOA 1P84K 1TZHB 2K8QA 2A9NL 5B8CB 1PL3A 5CZKA 3A6CH 2IIJA 3OKLA 1T5WA 1B0GA 4FG0A 4NM4H 2EIZA 5EIIB 1WS7A 2QPFA 4F3FA 1S9WA 2PP7A 4YXKH 1CN4A 2R2EB 2WTRA 3LSOB 4PM1A 3SQOH 2Q20A 1YHPA 3CXDH 4I48B 4P4KA 5I8EB 4AEHL 4FULA 5C8JB 1IJNA 4WGWB 4FTVA 1FFPA 3A4AA 2ZWLT 2A6DB 1Q0XH 1NGQH 5E2TL 3V4VL 4YEFA 3HI1A 3HE6B 5E94B 43CAA 1VADA 2VE6B 3NA9L 4LF3B 1MEXL 1KEML 1CO1A 2DQCH 2ITDA 5EH1A 4G43B 4KRMB 3HVDA 4FABL 5HHOD 1TQCB 3UPRB 4PG2C 3BP4A 1NIDA 3LPFA 5KS9F 5GHWL 4EIUA 1REIA 1MCHA 2CSPA 3L45A 4DP1X 3LXCA 2X28A 2YD5A 3KYKH 4YN3A 5I8KL 2IBZX 3ARRA 4N26A 5HI4C 3WEOA 1T80A 2A6KA 3V4PL 4K23L 3H0TB 4O2FA 4S0SD 2NUTA 1T7YA 3UTTA 3CFNA 1BYNA 1CR9H 1U21A 3ZYJA 5EIIA 5DZLA 1U95B 1FPTH 2BSBA 2Q2EB 3PWVB 1BZ7B 4GLRH 2QQNH 3E6HA 5D2NE 2VDPL 4HALA 3QVAA 1HHKB 2QVMA 5MEQA 3BDYH 4UTCA 4IBVA 4OGAC 4ZPTA 3B6SB 3LS4L 3GMQB 4HHGA 3MRRB 4IMKA 4L4VD 2NY4B 3BO8B 4GXUM 3D09A 4PWHA 3FB8A 4M1DH 3Q8AA 4XMZA 4U7KA 5DJ6A 3VE0B 1BWWA 1PQZB 2YMTA 3KS0H 5I1CH 2BVYA 3MV7A 5K9JH 1L0XA 3EOTL 3LKQA 1N12A 1OE3A 1YEJH 3FQYA 3GSWB 4WKZB 1KTJA 3B5HA 3KBPA 5C09A 3U82B 4YZFF 4P46C 5IW1A 2YN5A 2E86A 1J0JA 5FKPA 2FL5B 4HPYH 2PR9A 1T5KA 3BT2H 2IH3B 3CLEL 4KTYA 5EU4A 3QZWG 5FA3A 1AHKA 1UT9A 3NT0A 4UQ3A 4PRPD 5GSVB 5CLWA 2ZIDA 4LEBA 1OP3K 4PIRF 3FB5A 1DJIA 1AE6H 5DHXB 5GIRA 1WISA 4OZGE 4EKXA 5J6HA 2W9LA 4PLNC 5K39A 4GG6A 3WKYA 4GG8B 1KCVL 2V7HB 5GGVH 5I1DB 1QNIA 4ACTA 1HSAA 5F89A 4MS8C 4R4NC 4KUCF 1UM4H 4GIAA 1W8OA 2HFGL 1DBJH 4WW2B 3SKOA 4HF5H 2ZOKB 3NCJH 3G5VB 3MA7B 1MLBB 4F7CB 3UL4A 5JHDE 4K7FA 2FSEB 4LGRB 1WZ1L 3CXDL 4I18B 1IEHA 4YHYC 2Y3NA 3FFDB 4WGKA 3FSZA 2J3SA 3CX5K 3IJSA 3BN9D 2KBGA 4F1ZA 4HXAL 1NGQL 1Z9LA 2BMKB 5T1MA 3ZDWA 1JVKA 3ARSA 2HVJA 3BPLB 3HBZA 3IDIA 5DXWA 4ZTOH 3TV3L 4GAGL 3CZJA 2CHDA 2BFVH 2YPLE 5D1QA 5F7NC 4PG9A 1L9PA 1WFTA 3SO3C 4TUJA 4JFFB 3MGOB 4Z7OB 2Z1KA 3SJVA 2GB2A 4FABH 2YK1L 5EC1B 5CLXA 3ESMA 3GIZH 3UYPA 2Z7WA 1ZIBA 3MYZA 3GTVA 3MN8A 3HMXH 1CE6B 2QKIC 1T4KB 1L9MA 5IIEA 5EEZA 1WBZA 4KKAD 3FB6B 2J7LA 5EU5B 3VM7A 4EI6A 2Y1YA 5T3XH 2YQ3A 3VU2A 3MRFA 1U8OB 5DGRA 1XGYL 4NKDA 1FYTD 4W4OA 2Y36H 5BV7B 1I9EA 4HGKC 1S7WB 1VPOL 4AW4A 3OHXC 1IMHC 2YA0A 4PLJD 1QSVA 1AY1H 2AZUA 4PVMA 1BX2A 3H85A 4M93B 4MJJA 1KYDA 2EDFA 4QHKI 1JK8B 3FL7A 4P2AA 4ZPVB 3BUYB 2QQNL 4H8WC 5EDXA 1MHPL 1SPDA 1Y18B 4JFEB 2NYYC 4BZ1L 3KL3A 5D1ZA 5E6IB 4NN7C 5EOCH 4OT1H 4OF8A 1BFVL 1AD0A 4WQOA 1E30A 1MSPA 4MX7A 4HUWB 4NZJA 3BAIA 2WXQA 3QAQA 1C7TA 1I9RL 5T3ZH 2IALB 4XP6L 1BBDL 1EDYA 4JFQB 4N3TA 3U2SB 2HX7A 2D73A 4XOCA 2DWSA 1BOYA 4ZYKB 3ELQA 3TT1H 2EDNA 5KVDH 2UWEA 3ENEA 3ULVH 3MLSL 2NUPA 1U2HA 5FCUL 4MA3A 1BFTA 1XIWB 5EU5A 2VDMB 3BGMA 5C0CD 1BM3L 2XV2A 4KFMA 1UACH 4NO3A 2BHUA 4OB5H 3WN5B 1OGSA 2WBJC 3GTNA 4NC1C 5BZDA 4HQQH 4YLQT 1XWVA 1IGML 5CHNB 4U3SA 1YYLL 4FKHA 4IU3A 5IQ9A 3TCLA 1CTMA 4PD4K 4BD4A 5B7FA 4F8PA 1J0KA 4JZJC 3H9SD 2WJ7A 3AC0A 4F37F 3GHBL 3PQYE 2W59A 4XO5A 4FFYL 1CLOL 5KVGL 4K3EH 5IWLA 4DZBB 2BFGA 4M7KH 4ODSH 4K5LA 1RU9L 3LIZH 4PREB 1MDAA 4CVUA 2NY5H 3MV9B 4WW1A 4ALAH 3GDCA 4KTDH 2YD0A 1NBZB 5D7JB 2F8OA 3X12B 1KCRL 5DF0A 4XODA 4UTAH 1BM7A 4G6AD 5GGTA 5HI3C 2Z8SA 4AXWB 2D2OA 5F7BA 3L7FA 1P7QA 4U1MB 4AX3A 3R06A 4MSWB 2B9BA 3H9ZA 4L37B 2YSSA 4N8PA 4R7DB 4CN6A 3KWVA 2UWEB 5KBLA 1SHXA 3T4AC 4PS4L 1LYQA 4YBQC 5LB1A 4TV3A 2CO6A 3L1GA 3C87A 3VQ1C 3RWDB 2YC1B 5CN2A 3K6DA 2BJML 4TS6A 5DRZB 4EBQH 4UM8B 2RJMA 2J55A 4ODHL 4RH4A 3I6GA 4P23A 3TFKD 2RCSH 3FO0L 2N59A 3OX8A 4PWGA 3T0EA 1MI5B 2CMRL 1CE1H 3BWAB 2ICWB 2PXYC 5T1LD 3GBNL 7CGTA 4FLRA 3K6OA 2G0KA 1A7RH 1XSJA 1BBJB 4X4XA 4AIZA 4M1GH 1FE8L 4G5ZH 2VR6A 2KH2B 4S11A 4HWNA 4JFPB 3CVBA 1CPUA 3QJOA 2QQKH 4IOSA 2W92A 4TQIA 3FRPB 2BW4A 4JN2B 4KMLB 3H9SE 2H41A 2XJLA 3KYOB 3SBPA 4IU2A 3QORC 2I7SA 4N2FA 2EC9T 3MCLH 4I85A 4D2NA 4UM9B 2FX8L 4EXPX 4FQ1L 3TEUA 1DUYB 1P7KB 4NSKB 2OK0H 3WDHA 1JZIA 4OV6F 3EGDB 3WIIL 1CYGA 1L7IL 1BWMA 3DKHA 4HHWA 3IDNB 4Y19B 4RGOL 4MSWA 1JCVA 1W15A 1A25A 5CSGA 5DWPA 5K59F 3BKCL 4QMEA 1BAFH 2CJ3A 5ICUA 1P5UC 1EHAA 5EU6B 3ZN6A 1JZGA 3GB7A 5IVZA 1U8LB 2ADIB 4X7CC 4HUUB 4K5PA 3OKLB 1NAKL 2NQDA 1G6RA 2YD8A 4JQVA 2FBOJ 5I5IA 4JW3A 3VFUA 1PS3A 2Q3ZA 3L5IA 4D0CB 3R4DA 1ZLDA 1HQRB 3BC9A 4HXBL 5CN3A 4U1SB 3TN0C 4PR5B 1BJMA 3AU1A 4NQVA 1L5GB 4ZK8A 1TQVA 5F3FA 2J12B 4ZOAA 1RVFH 3I50H 1QR1A 3KLAB 3B9KA 4V1DB 1HHHB 3EYUL 3OKMB 4L2LA 4OLEA 3GLEA 2FT6A 2WY3B 4CMMB 4DGIL 5KSBF 3L1FA 4FHKA 4PYGA 1TZAA 2ZG3A 3EYVA 4NKOB 2VLKD 4XRCA 1RUML 1NGYA 2CU9A 2DN7A 5CLTA 3BZFB 4BGDA 3RIKA 4JR9L 2HRPL 5D2LA 1L3NA 3NFPA 2X1OA 1NPUA 5F7YC 1EJOL 3GI9L 1H3GA 1IFGA 1FGNH 2QGEA 3BH9B 3LN5B 4JM4L 4F9PA 3FT3B 1FL3B 2QDVA 5JQ6L 3JZ7A 3DMMB 1Z9SB 2CHWA 4Y5VC 3T71A 4QRUB 5HGAA 4G83A 1T3FB 1XXDC 5FC9A 3NSDA 2FECI 4KX8A 1H5BA 1SNRA 1FNHA 5ESAA 3UJTL 2ICWJ 3HJEA 1AOZA 4D0CA 4ZNEE 4O58L 5C0EB 1QWHA 5AW5B 5HI5C 2DWTA 3CSBA 4NYLA 3S5LB 2ZXQA 5MEPA 4A6YB 4CVXA 3I6LE 3IVKA 4BFKA 2DMCA 1HSBB 5E8NB 5BQ7B 3GMQA 1IIKA 4NN7B 5I16A 1OW0A 4PV9A 5CCKH 5TE4L 3TBSB 3ARQA 1EFXB 3LEXA 5IY5B 3MU3A 3D4YA 4PUBH 1LILA 3NIDB 4GXVH 3ZDZB 4YSUA 4Y1AA 4NO5B 5DC2A 3NJFA 3BZFA 3KCWA 4DKDC 1KPVA 4MZ2A 4MCZA 2VXSH 5AW4B 3UPAA 3MGTA 1MHCA 5J7CC 5B1AB 1FRGL 3L08A 4FI7A 4LPXA 1VACB 3WLWD 4X2UA 1LDSA 5C6TH 4JX0A 1RZQA 1B0WA 5C0FB 1MVYA 5E6ZA 4N2BA 4DKFL 3KDMA 1WDAA 5GISH 1LEGA 5MP6L 3SGJC 2J72A 2B8OT 5IVXA 2CQVA 4Z77B 1JZ5A 2X4PB 4NRYA 2HFFB 4G8FA 1EEZB 4UBDD 4QTHA 3OJ2C 3K6SA 2JCCB 4YR6B 3TBWA 2O6PA 3APNA 2MQ0A 5DQJA 4WY7H 1R9FA 2YO3A 3I85A 4P2RE 2C1PB 4P4KC 2B2XH 4NZTL 2CGYA 1UEYA 1FC1A 2WXNA 3FTWA 1FA4A 2HPOA 2AANA 3F58L 3G6AA 1G7IA 3WTYA 5GGQH 2Q1EA 4HS3A 1JTOA 5CBEB 4Y4KC 3PNRB 2N1TE 4IGBB 5LQBH 4X80L 4MWFA 2CWRA 4N2AA 1BIIA 4LLDB 3RX8A 1RZIA 2VDKB 3I9GL 5L2KA 1MH5B 2OXHA 3L3JA 1LP9B 2PLTA 4PG2A 3NEOA 3T3ME 1NEZB 1ONQA 2XWZA 3UAEA 3W38A 3N04A 3MRMA 4LPCA 1M1XB 3HFFA 1NAMA 4QRFA 3VFNB 4BQ8A 5TFSL 3WJJC 1B4JL 4LLYA 1Q0YH 5TDPA 2K0RA 3O8XC 3AWGA 5AZ2H 3SDAC 3GSRB 2PYEB 4ADGA 3UGEA 4RQQB 4NOBA 4JPWH 3OZKA 4WWKA 4LCCC 1AKJA 4ZO8A 3QUZD 1AXTL 3MLTB 4KKLD 1M4KA 2BVOB 4OD1L 4YX2L 5F7DA 3ZTEA 4OCYL 4BELD 1S7WA 4OAWA 3PWPA 2EDBA 3FKUS 4UT6L 2NR6D 2V7NB 4GBXC 3WKPA 1LEIA 4IMKC 2LLLA 4LVNB 4B7LA 3IF1B 1INEL 1DSYA 2Z4QA 1G9ML 1S9VA 4Q2ZB 3V0EA 3D0VA 1B2WH 5KAQF 1SDAB 4FFVD 4XN1A 4UDTA 1OTSD 1MCWM 4N2NA 3ZY7A 5EU3B 2NY2B 3EJRA 2Z9TA 3DDGA 4D8PB 2XN9A 3VXMD 4PJDB 5I1JL 2X4QA 2UWEF 1TVBA 1FVCB 4F2MA 4M8QB 2LT9A 4XMTA 3VXTB 3JYBA 1KNOA 3QORD 1PKQA 3C5JA 3O3UN 2P5EA 2IOIA 3GSRA 1DVXA 3QB7C 4GAFB 4YSDA 3LXBA 5FYLL 5DRWA 4HIIA 5ESQA 2EDDA 2GTZA 2F18A 3ECWA 4N9GA 2PMZA 3HZVA 2MOGA 1NCAL 3GRBA 2H9GA 1N6VA 4MTMA 2EIMB 4G1MA 4NFDA 4YIQA 1QSFE 3DX9A 1YN6B 3BQUD 2IMNA 4DAGH 5TDNB 1QKZH 2UXGA 1U8KB 4LQFH 3U48A 2DJ4A 4ORGA 4X7FC 3IMTA 3TEYA 3U9UA 4XBGB 3R4RA 1SJHA 1FF5A 2CRZA 2X44D 2NY3C 4HKBB 1I1RA 5F7KC 4ZFGH 3AW5A 3FULA 3NCWA 2G75A 1DN0A 2WXKA 3PHOB 1M2OA 2NXYD 4HX1A 4Z7UB 5ALCL 4HUVA 1QBML 2EEFA 1V7NL 4HAFA 4DSYA 2A9AA 2VKXA 4BKTC 5FHBL 3MRHA 1UQSA 2E74C 2F9BT 2UZYB 3Q0HA 5CR8A 2UUDH 3C6LB 1E0OB 2MOVA 3HHSA 3OGCA 1EHXA 4IOFD 3VI4F 5IFHH 2FJGA 1KJ2B 2IC2A 2YMXL 4LCIH 2DM4A 5LCVL 2K6WA 2ZSWB 4DIXA 2DI8A 3ES6B 4ZDHB 2X6VA 3OKOA 1URZA 1MCOL 2GIYA 2XDHA 4ZOBA 3CVIH 4TSBH 3MNDA 1HIMH 1U8IB 3RWFB 4GAJL 1C5DB 1AG6A 4P5TD 4W4OC 4G1MB 4YIQB 5HHOA 1NCCH 5JXEA 3D9AL 4YDZA 1OHZA 1F8TH 3N9GL 3PIQA 2JLLA 4GG6F 1E3ZA 1TMCB 3WFZA 3F85A 2YAEA 5E7FA 2AEOA 1FG2B 2WOYA 3X13A 1N0LA 5IW6A 3JTSA 3S3CB 1KTDB 2CR3A 3TA4D 2V6HA 3HG5A 4B3EA 4QT5B 4LOUC 4I0PA 2Q6WB 3I75B 2GBUA 3GBEA 2BOBA 2NTFB 5HYJE 1FIGL 5DFWH 4EI5A 2Y7LA 3VFRB 5L2JB 1S9XA 1E9QB 3DIFB 4Y7OC 3TA3D 1KELL 1UUNA 5GS0D 1U8PB 1QA9A 2XA8H 4PWJA 5KSUA 2FJGB 1KJ2A 5F1KC 1THAA 2Y25A 4OZHA 2HLFD 2UX6A 1FNEB 1WTGT 4KI1A 4YHPA 2ZYSA 4IRJD 2J73A 4XTRC 3X14B 3WS6A 4YXKL 2P8PA 2WLJA 2JJWA 1HL4A 4ES9A 4HGWB 2H1LM 2XT1B 4IOIA 4NQCB 5IB3A 2FD6L 5I18L 2MQ3A 2WBJA 1PZCA 3KJ4B 4G8IB 1YEGL 5A2BA 4HJGA 2ENSA 4ZUWA 2JE8A 1RJZB 5A40E 3IE4A 5C0DB 5FECB 3F12B 2KQMA 2LW3A 5DLML 4X99B 3CZGA 1EAOA 1P0SE 4NRXA 5MEOB 3SIKA 4FZEH 1KJ3H 4C83A 4FI8A 2HVBA 1NCWH 1MEXH 4IRJA 1QUPA 1E5BA 3AG4B 2YXMA 3BP7A 2YD1A 3NPSB 5CKGA 1YEHL 2GIMA 4I0PB 1U0QA 3JVFC 5BV7H 3CX2A 3GXIA 4K4KA 1U9KA 5JO5A 4GRLD 2UXTA 2AXGB 1DLHB 3TT3H 5CBAB 1U8PA 1WGVA 3RVUD 3JTTB 3RL2B 1J1XH 3BAJA 5KW9H 2YKLL 3NFPB 1EK3A 3JT0A 1A6TB 4PJIB 4LEOB 4XMPH 4BXVA 4OQTA 4X6DA 3RY6A 4NNPL 3MRQB 2CCWA 3OLGA 5FCSH 4ZOCA 3HS0B 1NC2A 4I3SH 1NCNA 5D72L 5AALA 4NP4L 1MY5A 4XOAA 4GRWB 2PPDA 5FECA 1RJZA 4FRWA 4HP5A 4FZ8H 5C0DA 1N6UA 3LS4H 3T8MA 5D1XA 1NDGA 2VQTA 3T0EC 2X4RA 4O02H 4P05A 3LNGA 3GSNL 2DQEH 4OI8A 1O6VA 1OAJA 3QXAB 1TETH 4UT9A 4GUQA 4O2EA 3H3PL 8CGTA 4DVBB 2VABB 1F8TL 2XWTB 3N9GH 3QEQB 1MF2L 1J88A 3BWSA 4RIRB 1IC5H 1G4RA 4A04A 3GEFA 3QORA 2H0PA 3W0WE 3F05A 2CK2A 1S5IH 3GJEA 4GMTL 1RPQA 2E47A 1U8OA 4KKPA 5GPRA 3ULAB 1WFIA 4WJ5A 4NO5A 2IBGA 5BS0A 1EXHA 4XBEL 4AQAA 3LIZA 3LZFH 4PJFE 3F01A 1U93B 1FIGH 3C6SB 4Z5RA 5F88A 4OGYL 1FZJB 3RPIB 3GJFB 3S98A 3NEXA 5IVXF 3VMNA 1IGCH 3ZL1A 3VO0A 3I9AA 4IJ3C 2Z65C 4LHUA 2J88H 4JY4B 4Y5XA 1N4XL 4OFQA 3RWGB 3H53A 3HE7D 3W81A 5AVWB 2HG5B 4X4YB 4N5ED 3MRLA 3VQMA 5E6IA 4NRYB 1AQ8A 4YZFE 1ZTXL 3EH2A 1AIZA 5DTFB 2WVTA 2XV0A 4QRPA 4CJ1A 3ULSA 5DJ2A 5IHZB 1S7QA 4FADA 3EG9B 3WY4A 1AGBA 4ANWA 2G2RB 3KPQB 5CU9A 4U0RC 3G5XB 1XZ0B 1XD1A 1DLFH 2YD3A 3WFBL 5L0QC 1WQVT 4ODBD 1QLEB 4HKJA 1A1MB 3DTUB 2AK1H 1MAJA 4JFFD 1G1OA 1IM9B 1JXJA 4OFYA 4ONGH 5IFAL 5JHLL 1JWMA 2A9BA 4L1TA 4M6NL 3C5ZC 1H8LA 2ZG2A 3Q48A 4D8OA 4JB9L 4L1LA 2FHBA 5EEWA 3UC0H 2CALA 3DURB 4GSRA 3LD8B 3HFMH 3QHZH 3L3JB 2ZCKH 5I75B 4F58L 2WAQA 3ZYOA 4E9WA 5C86A 2C8NA 5GS1B 4OGZA 3MOBH 4PV1C 3N91A 3SE6A 4AYGA 4XVTH 1FO0B 2KQNA 2VLLB 4YXHL 1ZLSH 3VFNA 3P4NA 4HULB 5C2BH 5AAMC 3FJTA 4UILL 4ZODA 1M6OA 3N41B 3DV6B 1BD2B 3UOAB 1ORSB 2FEEL 5SWSD 3BAKA 2N7AA 1AGCA 4KK6C 3K91A 4PJDE 5I76B 5KBMA 5EN2A 1WC7A 2YUZA 3X12A 5ADPH 3TBYB 4M7JH 4C4KT 4MJ2A 1DVZA 4D9QE 1AGBB 1NOFA 1PZ3A 2V9TA 1F6LL 2AXFB 2EH8L 3ESPA 3QWQB 3T8VA 4ZNEA 4AYDC 3N40F 4PB9L 1W80A 4CVWA 2XIIA 3J8F7 4HBCL 2UX7A 4JFZH 4K9EL 1QSFB 3O2DH 1KN4H 2FIKB 3MJWA 3VXOB 5A2KH 3KPPB 4CILA 3CXHK 1SJXA 3WEBA 5AUMB 2EABA 4Z7WF 4M4RA 5T1LA 4KROB 2EADA 3HN5A 3B9VA 1JD7A 1L9RA 2EIZB 3WNLA 2XG4B 4FFTA 2J5LB 4EOWL 4Y88A 1JHLL 1BZ8A 1G0DA 4OCLC 1ZJBA 5LGHH 5I6NA 1CT8A 2ZNWA 4F57L 1W8EA 1J1OL 2AQ2A 1UXSA 5DRXA 5C0CE 1N3NA 2VDLH 3T2QA 4LLAA 5D7KE 3SQBB 1MG2C 2O5XL 3KYMA 3U7YH 3PV6A 3LZRA 4ZMXA 1S7TB 4M1CD 2DBJA 1IAKA 2QVTA 3KD4A 3F7QA 2WIIB 3MRKA 4OGAD 3EJJX 2Q8BL 4X4ME 3UBXG 3P1VA 1N8ZB 1PEWA 4WI4A 1LO0L 1VADB 2VE6A 4HVBA 2TSBA 4JAMB 1F6FB 2YKKA 3VGAC 3LKRB 2GBTA 4APQC 3DSNB 3IDJB 3PJNA 4OBSA 3RWHA 1PY9A 5KVEE 1VENA 2YZ1A 2EKSB 4WLCA 4HK0B 5FM5M 4G42B 1AHMA 1PEZA 4DOHB 4E9LA 2F19L 4GG6E 4Y4KA 1M71B 4WI3A 2X09A 4H20H 2X38A 3SE8H 2X6MA 2KZBA 5JUEL 2XNAA 3MUUA 2WCGA 5J6GB 4J6IA 4M4RB 2ICEC 1ECZA 3MV11 5HJGA 3UTTB 3MLRL 2H8PB 5HYJB 4XBPA 3WEXB 3NGBB 1DSFH 2V2WA 3A6BH 1DO5A 4UUJB 3IWVA 3QDGB 1CFNB 4BM7A 1SN2A 1SUHA 3FT1A 3HI6L 1TKWB 4MASA 3QI9D 1KXTA 3BLKA 4MA1C 3O8XA 3LMJH 5J0BA 1NFKA 1EEQA 2GPZA 3ABLB 2YMOA 1Q9LA 2DMBA 4LCIL 4WJKB 5J5EA 2VWEE 3T2PA 2K9FB 1XGTA 1QPXA 1R3JA 2VDKH 4KNSA 2GY7B 1PSKH 1SF3A 4H0IA 1UA6H 5CP3H 3ORJA 4NFBA 5FEBA 4UM9D 1XH0A 3IS0X 3LKRA 1LE9A 2AFNA 1HILA 5E2UL 2MCPL 1PBYA 3LKQB 4AV4A 4M6MH 2Y69B 1X5ZA 1NCCL 4R97C 1IQWH 3ARWA 1QBAA 4ENZA 2UZXB 4GBXA 1N59A 2ZSVA 2ALAA 1I1FA 1QLEL 5FKAB 1X9RA 3L3DA 4XMKH 3VG0L 5F6HI 3D4ZA 4GFXA 2XYBA 3RIAF 4MA8H 1E27A 1Y6MR 4P9HC 3UEZA 4OM0H 4NUGL 1PG7H 1T5WB 2WNXA 3FQ2A 1QBLH 1X5GA 4GRMA 4F15C 4TSAH 5IZ7A 2V9QA 4WW2C 4GG8A 3AABA 4QI3A 1CFMA 4TQEH 3OB8A 3E2HB 2H5UA 2IWKA 3ZKSD 2MJWA 1NPNA 2XVLA 5KSUB 2OKMA 3IGAA 4KKAC 5C9KA 3BXNB 3U7WH 4JY5H 5FO7A 3VU1A 4WRLA 5CD5C 1J05B 1LQBC 4PRIB 2FWOA 1MLBA 4F7CA 2R23A 2APFA 3CFQA 2BWQA 4HXBH 3BGAA 2E7LA 3DHPA 3HB3C 1P69B 3MRBA 4HEME 4N5UA 4YE4H 2P8MA 3DHJA 4AV5A 1YMMA 1RURL 4PCSA 2XQBH 2H3KA 5IMLA 2LTQB 5TE6H 4KHTH 3BZDA 2CO4A 3QHFL 2BC4A 3P9LB 1VESA 1ED3B 3T0VA 4JZJB 3T2OA 2CH8A 1DEDA 5EZJA 4GKNB 5CJ5A 1FNGB 2PO6A 3HMWL 4NUPA 4XOEA 2HRPH 4TUJB 2BVPB 1J7VR 5DHMC 3O3BB 4JHVA 2A6KB 1JZEA 4L8BA 1WP6A 3D06A 2D7TL 4I7ZC 3HC4H 3HB3D 4KDWA 2KYIA 1QNZH 4Z8FH 5G55A 4TVPE 4S0HA 1X5YA 3FS9A 2WQWA 1DLHA 4L0PB 4ANVA 1O7VA 4EN3C 1VFAA 3FQUB 2E3VA 1O9WA 2GAZA 4JFHE 4PQXA 2BZCA 3IN0A 3MBEB 1AO7D 3CLFL 4PRIA 4PJ8A 3PAYA 3D4GA 5HP5A 5CBEA 2HT3C 1MHEA 1ZSDA 5AW2B 3UMNA 1SRDA 3CTTA 4Q4EA 4NUMA 5E4AA 3ZKND 2DI9A 5B39G 2FX7L 1NMAH 3ZT6A 5D6DC 4ZG1A 4MMYA 4CJ0A 1UXLA 2Y7SA 3WFCL 4CADB 5JXEC 1RLBA 3VYOA 4P5TB 5B7MA 1X6NA 5EIIG 5F1OB 2FB4L 5HHOE 4EN2A 1XR8B 1HCZA 2X9XA 2VN7A 2ATAA 3BAWA 3VWKA 2W07B 4G9FB 2Z31C 4BH8A 5IEKB 4S2SA 1BFVH 4JN1H 1ZHKB 4BUGA 2XZCH 3S37H 2EEBA 5FA3B 3QUKA 1N5YH 2R69H 3O3AA 1IGFH 3T1WA 1J8KA 3H3PH 1NEPA 1EPFA 4P3CH 2XJKA 2OSXA 4R4BA 5J6HB 4OZIF 4XMKL 3EUDA 1MFCH 4YUEL 4MAYD 4NKIL 1T5XB 1XB6A 3G5ZB 1U3JA 3L54A 2D9QB 1F45A 4UQAA 3BD5A 2FZ3B 3FUDA 4OIFA 3QH3B 2QKSA 5DJDA 5KJ7E 1HINH 3F65A 5CEZL 4U3SB 3THML 4NT6B 3GM0A 1A7PH 3APFA 3P3UA 4OZIE 2G60L 4B41A 2VR9A 5ABDE 4RGMC 3K6NA 1YNKL 4QRRD 4BXSV 1Q94A 5K9KB 3D39D 3QUHA 1XEUA 3C9NA 1BVLB 3RWGA 1CU4L 5L88L 3D51A 2HLEB 4X9YA 1WG3A 1KLFA 3H6AA 3ARDB 4UT7L 1N64H 4ZBJA 3F58H 4XMVA 2BWDA 1QASA 4UDTB 5LXVA 3QCUH 43C9A 3QBTB 4UAOB 5LNGA 8FABA 4X5RA 1EEYB 1DQQA 3LY6A 2YUXA 2ZAIA 3QUXC 5D1QB 1CIDA 1SDDA 2GT9A 3AUWB 4R5TA 3VYNA 4POYA 1LM8V 4Y2DB 1XCTA 3VFWA 2OBGA 4OJEH 1FYTE 1P2CB 2FGWL 2HJKA 1P7QB 3RWCB 3FQRA 1SXBA 3NSXA 2XXFA 3VRIB 5I73B 3UYPB 5IMMB 2R83A 1A1MA 3V4UH 2BNQB 3T2NL 3OQRA 3OSKA 1CGYA 2G3ZA 2IANE 1B4JH 2CRYA 5CR1A 4MCNA 5GJTH 1SN5A 3NG5A 4N28A 3MLZH 1OAXL 3NYKA 4M6NH 3KJ6H 4N8VB 1SLVA 4OKDA 1KF9B 3CV5A 3H4HA 5AOMA 1T0PB 5TDNA 2MH4A 2D8KA 1LO4L 3GXPA 5E5UB 4BKSC 4OFPA 1RPUA 1JF6A 4ZPVA 3BJ91 1X5IA 3ZRCC 4HLEA 5M95B 2JKIS 4OCYH 1AQKH 4CW1A 2XQYA 4FQ2L 4PPTA 5I76A 1OP9A 3O0RL 3RDTD 2GJRA 3DSFL 2EXWD 4HDIB 4URTB 3RX7A 3FUEA 5DHVB 2QR0B 4JZOB 4HH9B 5EO9B 1BGXL 1EJ8A 1NBYB 5JMRA 4UNTA 3GM8A 3DX6A 3MGAA 3DJZA 2HLAB 2XTSA 5M7QA 1SDDB 2FX8H 2ZUQC 4MNHA 5D7EA 4Q58C 5KZCD 4FCHA 2VWEC 2NW2B 4ZDHA 1QO3A 3O4LA 1MCJA 4Y4FD 3GF8A 1LO3H 3WIIH 4KXZI 3OKDB 5IMMA 4XPTH 4HT1H 3MJ9L 2UV3A 3DV4A 4Z7IA 2YOAA 4OLZH 1RZJL 4D0BA 3FTZA 4JVPA 2RAMA 1XIWA 2EINB 4NPKA 3MV8E 4JN1L 5AYQA 4QJ5B 1MFUA 4YAQA 3O2DL 1XVSA 2BNUB 3QEGH 2DZEA 4LESA 4WV1C 4OCSL 1G9EA 4O5LH 2E5EA 3VD0A 5KVEL 4YDJB 4X5XA 1P5VA 5L4MA 3ARBB 4FDWA 2NZ1A 3QS3A 3RTQB 4A7SA 4LCUA 2Y1AA 1W8NA 3VFUB 1FFNB 1SLXA 3ZTJH 1ID2A 2X89D 3AAZB 1XAUA 3A47A 4RX4A 3KCPA 1T0OA 4FQCH 1WEJL 3GI8H 2J2ZB 1CK0H 3FRUA 4IJTA 3VXSD 5HPMA 4X9HA 4MA7L 1PZBA 2RTTA 5L4JA 5BW7C 1YYMH 4N1CA 1MFEL 2ROYA 1IM9D 2VGLM 4M61A 2IMMA 3QYCA 2DF3A 3DJSA 2G60H 1FFOA 3RZWA 3EOBB 4V11A 3B9KB 4V1DA 1A5FH 5KSBA 1DVFD 5FHAH 3SDDA 1V7ML 4M02A 1A6PA 4LAJH 5EC2A 5GZND 4XP1H 3B5TA 3HKZA 2H6PB 4NBYB 4MLSA 5FM8A 5DGQA 3QUGA 5MI0B 3ULVC 2WQXA 2BIPA 4JVUA 3IBOA 1S4IA 5C0BE 3G9AB 5F7AA 4NQEE 4JHUA 2E9IA 2AHIA 1A9EA 3GMPB 4LEEA 4PRBB 4Z7UF 2X4NA 4ZS7L 4CU6A 2DYRB 4Y4KB 4OGQC 3GBMH 4BQ9A 3C5SA 2Y2TA 4B0MM 5JA9A 2EUXA 5H37G 3TBBA 2ZOWA 2VISA 2ZCHH 3HG1A 3ARFB 3T2LA 1LO2L 1NMBH 1KDJA 3NJXA 4FYSA 5GRUH 3ZBMA 1CQKA 2JKTM 3UZVA 3LVEA 1P5VB 2BSRA 3MNWB 3M1BB 4QJ3B 1HXYB 4HA1A 1AP2B 1QX1A 3HE7A 4ETQA 4DKTA 1CI5A 1MPAH 2IO5A 3WGVB 3CVHB 1AGDB 1MWAL 2WNKA 3IXAB 4XPBL 5TH2B 5D6CA 3M6DA 3CMOL 3SKJL 3SSGA 3DXAB 2WTRB 5AAMA 1WLHA 3GJFK 4OZIB 2ADGA 1T1XB 3ETBJ 1XF4B 5CJQH 1TNNA 4OZFB 1FFPB 2W0PA 1CXEA 5E99H 3EF4A 2JIXA 3L2LA 3SOBH 2QADC 2VC2B 4BFIA 1AACA 3MDJA 1UURA 1EAPA 2DQCL 4P2RD 2NT0A 3AG2B 1KJVA 1D3CA 1KB5L 3QZNA 1K3ZA 4DZ8B 3MGTB 4X0NA 1E42A 4WI6A 4MB1A 2JQZA 4DP7X 3TS8A 2UZXA 4GBXB 5IJVB 2GI0A 1XGRB 4XNQA 5CD5D 2WMPA 1CFSA 1HKLL 1EANA 4AJWA 1CBVL 4POZC 1A4CA 1S7RB 2QZ5A 4K3JH 5AENA 4FNTA 4XVOA 3EJYD 2PCFA 4AVIA 3BUDA 2NLJA 4JDTH 4H1LG 1HQ4A 3Q3GB 4LBEB 4MA8L 5G2NA 5BUAA 4G9DB 4FA8A 4OCRH 5ALBH 1OEZW 1F2QA 5E1QA 1XX9C 5B4MD 3GIVA 2DQHL 3IGAB 4IBZA 3RLSA 2W38A 1YEGH 4F80A 1A6VL 1F18A 4NPYB 1Z5LB 1HNYA 4Z7OE 4UOW1 4KGLA 4QLWA 4MAYC 2QHLA 3GRWA 1G7JB 3V5HA 4G8GE 1V3KA 3SCMB 1XF3B 1UCBL 1S7UB 5IBTH 4WFFD 5BO0D 4MA7H 3KR3H 3FU7B 5KG9B 5EZLB 2G5BB 1ZA6A 4TSCH 4BIKA 5B8CC 3D85B 1AOHA 4PH8A 1MCBA 5EEVA 4JM2C 1PX8A 1BFOB 3GZPA 5EOQL 2AS5M 4UQIM 4HPYL 5IFJA 4JPQA 3E0GA 4TLTA 1OTTD 2H32H 4AKOA 1D9KA 5HJDA 1OAYH 1YQ2A 1P4IL 1QFWI 2VLJE 1UZ8B 1L9QA 1YECL 2ED9A 2AMGA 1P5UB 2VJXA 2VXUL 1SFHA 4B53A 3SYQA 1HDMA 4NHCL 5F9OH 7TAAA 1H3TA 5TFSH 3S8FB 2A83A 2HH0L 3TIDB 4LLWA 5HI3D 5FW8A 2FJFB 2V3FA 4IK6A 4ELMB 1RZFH 2HRLA 2I07B 2H6UA 3N3EA 1VZIA 3NQKA 4QRPB 4WGVB 5JXED 4AY0A 3M45A 4UTBH 3I02B 1KB9J 3ZRSA 2NQCA 2BVOA 2NY5C 5DURB 5MEPB 5I15L 4JHAL 4A6YA 5SV4A 1GJIA 4WTXA 5CMAA 4KQ3L 1MPAL 3SYPA 5CCHE 2VDMH 2R27A 4Q7DA 1UH4A 1NPJA 4BE6A 3RA7L 5C3LD 3SKJH 2Y7MA 1QLRA 1XGQA 4PHZA 4PWFA 3T0EE 3KLQA 1JPGA 1MF2H 4CADA 1I31A 4UIKL 3QDHA 1FN4B 3WL9B 2RA1A 3NSCA 3ZR6A 4A38A 1UFGA 4DEPC 3N85H 4JL2A 2YWZA 4XCFL 5DQ9A 3RVWD 3HUJB 1V8HA 3MJ7A 5KYWA 1BFSA 3FTVA 4JCMA 4GKSB 3ZDYB 3Q6GH 4K3HA 4NENB 1CXFA 4QEGA 2A83B 4YBHA 3VXSA 1U4EA 1EFQA 2DWYA 3WDJA 1J1PL 5BO1L 3I84A 2WC7A 3Q2WA 2DQGH 3CN3A 4HJUA 4NERA 1XXFC 4QO1A 4HS6A 1NFDB 3D07A 1YEDA 3OHMB 1JTPA 2H9GB 3MRCA 3P77B 2VDOH 1CD9B 1BECA 2CLRA 1P9MA 1RQ5A 4K8RH 1JDDA 3PV7A 4HZLA 3MV8D 4YVUA 1BF2A 1EWHA 5EIVA 3L6FA 1JV5A 3BT2L 3AS3A 2PWEA 1MVUB 3PPSA 5FYJD 3OZLA 4BSJA 4OJDH 1XQ4A 1GZHA 1ZS8A 4PMFA 4X6CF 5TTRA 2X2UA 3GEWB 1PG7W 1UYWH 2MPAL 1XCQB 2M1KA 4UAOC 2WVUA 3HZYB 1L7TH 4O9HL 1SY6H 5JIPA 1A6VH 1J86A 1TYRA 3QWRA 1SJMA 3S4SA 1JPGB 4I4WB 5CS7A 4NQEB 1LEKB 1IGTB 3FBQA 4Z95L 3WJLC 4LHJB 3QZOA 1LP9A 3ZGHA 3DETD 5GZOD 5EO1B 1AFVL 5TE7H 4JRYB 4C54A 1VGKB 4QTFA 3MBED 4HF5L 3NCJL 5HHVH 3ROOB 1X44A 4YXLL 4OZ4B 1TO5A 5SWZA 3QHZL 4Y89A 1WBXA 3WLWC 1HWGB 3HPJB 4B50A 4CN4A 3ZDXB 2Z0UA 4AQEB 4MCYA 1C7SA 5JDSB 2QKIB 3EDEA 5C0CB 3O3DA 1FZMB 1GH7A 4ODVL 2PYED 2X3AA 1QFPA 5C9JA 4NZFA 1U8IA 3RWFA 3IU4H 3DYMA 2FQEA 1A14H 1DJZA 2Y5TA 1BXAA 3H56A 1KJMB 3MLUL 4WWKD 5LVEA 1S3RA 4FLSA 3L48A 4ZTOL 1EVTC 4N2EA 3SJVE 1THCA 3QUZB 1ML0A 3L3HB 3RWHB 3GUTA 7PAZA 1KACB 2NX5D 2RD0A 4UZGA 1ZLUH 3IFPA 3KPSE 4N1HB 1I85A 3DYOA 2F58L 3S34H 3FN0H 4KI5F 1GKEA 4PJEE 4DP6X 4M56A 4ZW7A 1KEMH 4Z7QE 4I89A 5LGJB 2ZYRA 5GS2D 5EZIH 1F90H 5KVGE 1KEGH 4S1DC 1SVCP 1XGYH 3MREB 4B9FA 4ICWA 2OM5A 1XCXA 1S9XB 1E9QA 2VJ8A 1K8IB 5JOPD 2TRYA 3S36L 4CKQA 2XN9B 5DC9B 3LEYL 3B2PA 2K45A 5IESH 4RWYL 4HUNB 1DBAL 4YFLI 3SPCA 1CYXA 3L7FB 3ECBA 5F7UA 3K71A 4K23H 2DICA 5D1XE 2FQGA 5D2NC 5ESVA 5F7EL 3KPMA 4AQEA 4AL8C 1FVEB 1Y7VA 1Z1WA 4CKVX 4JFED 4PWIA 5AVSB 4HOWA 1WHPA 3BVWA 1J1OH 1TITA 4N9GB 1BLIA 4QXTB 5D55A 4UTBA 3ARXA 3EDKA 4OLZL 4ABVA 2Y5TB 2VIRB 1WGOA 4G8IA 2RCSL 2OSWA 1XV8A 1Q90A 1CLCA 1HILB 4WWID 2DYPB 1RZKH 3O9WA 3OJDA 2XKNA 3QIBD 5KVEH 4J3TA 3ULVD 2X4OB 2K9UA 1YO4A 3IRPX 2ICWA 1X7SA 4ONHA 2L04A 1PZ5A 1Y1UA 4P46B 3T3MF 5I23A 3CFMA 3O11A 3AQYA 2QSTA 4PN6A 1KIUA 4Y16B 1ROCA 1OV8A 4GUCA 1NGZB 4MQ7A 1ILSA 3QRLA 3VXPA 1FFTB 4I0KA 4JUSA 4N2KA 4HWEL 3JUYA 4TULH 3WFEH 1F02I 2VQ1B 4L4JA 4FA6A 4ZUUA 3E1F1 4PJ5D 2UVFA 5BJTB 2E7BA 1L7TL 1OSEA 2XICA 3ISYA 3HZKB 1QW8A 3FMGH 5AVTB 2BZDA 2JXMB 2GI7A 3JBG7 2Y6SD 2NX5A 2GHZA 2CBTA 3MZTA 5KW9L 2CIKA 1EUTA 2BVQA 4K0OA 2FWOB 5DUJA 3ESNA 1P7QD 3WIFB 3NJLA 1ZVSA 2ZT9C 2DKMA 3PP3K 5CJXC 1L4IA 2BP5M 3HS0A 1YNTA