2Y7MA

Structure of n-terminal domain of candida albicans als9-2 (pt derivative)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
300
structure length
300
Chain Sequence
b'MKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ-LIKE ALS9 PROTEIN
publication title Structural basis for the broad specificity to host-cell ligands by the pathogenic fungus Candida albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
total genus 70
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7mA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7mA02
4MBRA 5CF3A 4JDZB 2YLHA 5CFAA 3IS1X 4JE0A 3ASWA 3IS0X 3V10A 2VR3A 3IRZA 3AT0A 2Z1PA 2F6AA 4F1ZA 2Y7LA 1N67A 2Y7OA 4JDZA 4MBOA 4F27A 2Y7MA 4LEBA 4B60A 2Y7NA 1R19A 1R17A 4F20A 4F24A 3AU0A 3IRPX 4LEEA 2RALA 2F68X 5IHWA 4B5ZA 4LE8A
chains in the Genus database with same CATH superfamily
5A2BA 2ZUXA 1BBDH 4PY7B 4LARL 2EC9T 3UBXB 1MIEH 4C83B 3DSFL 1TPXC 1ZANL 3BEWA 3MBXH 4HIHB 2C4FT 3RU8H 1OOAA 4OCXL 4K94C 2FZ3A 2N4IA 4CSZA 4QKTA 1AJ7L 2YZ1A 2V2TA 1S7QA 2AEPH 4X9GA 3KYAA 1LO3H 5C6TL 1ZVSA 3FO1A 5BO0D 4FQPA 5DFVD 1AMYA 3B9VA 1PX8A 2BNRD 2FWLB 1S7RA 3QFDB 4WJG3 3SOTA 2V8MA 2X6VA 2ADFL 2IQ9L 1HILB 4A6YL 4Q6YA 5K39B 2H3XC 4IDJH 5JIQA 1NEZA 1QLFB 2UZYA 5F88A 5IVOA 2W60A 4DP8X 1E4KA 3NZHL 3BAJA 4A38A 2AI0H 3BQUA 2VDQL 2RFXB 4X6CE 1KB3A 3TZVB 5E2VH 4QXTB 4JCWA 3L3OA 3KWTA 2J2ZA 3MNWB 1YECH 3U6XS 4LSUL 2CHDA 5EN2B 1TYJA 2EO7A 5EU5A 3BGMB 5C0RH 3EYUH 1H3PL 3EOTH 5IM7A 5AEAA 5HGHB 1XR9B 2CCWA 2GYSA 4WUUB 5E99L 5I2IA 1KPRB 4NP4H 1CPUA 4HALA 4NUPA 3B2MA 2BRQA 1T66C 3FDWA 3HN8A 4XMKL 4ETQA 3O2WH 3LCYA 1XXDC 5C3TA 3UJJH 1REIA 1OT2A 2DH3A 3ARBC 1XF2B 3QRBA 3EGDB 4XN7A 1QWHA 3IDUA 1IM3A 1N8ZA 1G0XA 4MJ5A 3RTLA 4GG6F 2YFOA 2BO0A 2YA2A 3RWGB 3VWKD 3QJRB 2YHGA 1FNFA 2AQ3A 3P2DA 1NIFA 4M1GL 5DD3H 4WHTB 5D4JA 1K6QL 4GRWB 4PN6A 4PWHA 1JNNL 4TQPA 1TKWB 3AQYA 4HK0A 4LMQE 4AGMA 4X4XA 5CWSA 1MG3C 3MLWH 3R06B 2B0SH 1NBVH 1N12A 1L9MA 2VM9A 1YNTB 2EDDA 3HR6A 1LDSA 2HT3C 4JFEA 2C26A 4JRYA 3L6FA 4OI8A 1AFVH 3HC4L 1C12B 4X8JA 4UM8B 5DK0B 1V8HA 4RGMC 3SDDD 3V5KB 3WO4C 4EIGB 4ALAL 2DQDL 3EO0A 2F15A 5HDWA 3BPLC 5AYUH 1JZIA 2AJYL 4GKNB 2HN7A 5JLZA 3N0AA 4HLJA 1TEGA 3IMBA 3AREC 1DVSA 4WHYG 5EHFA 5A6MA 2G9KA 3MFFA 2XWBB 3BDYH 4FNRA 5IG7B 3GK8H 1HH6A 5GS0H 3DC0A 5EEWA 3IFNL 3ZO0A 3TXAA 3ZTNL 4KZEL 4GRMA 2VZOA 3T71A 3QS2A 2HLAA 5F9JA 1S7WA 2UWEB 1RK1A 1KB9J 1S5IH 3F7VA 4QF1B 4LLVA 3QJSB 3CHOA 3EG9B 3ZQWA 1RUAL 1L5GB 4XMPL 4F20A 4NQTA 4ZMNA 3OKNA 2CO1A 3RL2A 1J11A 4PJFB 5AW7B 4B9IA 3QWRD 4A7SA 3OXSB 4GAYA 1JYVA 4LT7A 3BT2L 4KNUA 2W07B 3QDMA 3O8XA 1EWHA 1KY7A 3MLUL 2LQRA 1XB6A 3H53A 1MFVA 1KTBA 1PX3A 3EIFA 5D1QE 1QKZL 2B20A 4LLQB 4K9EH 2E7HA 5A2IH 2VDMB 1OEZW 1U8MA 5IJVA 2TRHA 4N87A 3MRIB 4WKZB 4BYHA 4B9ZA 3LIZA 3WIHH 2CR3A 4RQQA 2HFEA 2DL9A 4ONFH 1QO3B 3GIZL 4I9XA 4ZUVA 3REWA 1NSNL 2BS71 5E6IA 3RZWA 4WZ9A 1CFTA 4HA1A 2DMHA 1QBMH 5KSVA 4IMKA 4R90H 4FNSA 3CMOH 4NZRH 1FWXA 1W6WA 4UT9L 5BV7H 4RFNC 2CD0A 3NIFB 3T2LA 3HN3A 3SDYH 2CJUH 1SYVB 3CZEA 3NSYA 1X7SA 2X42A 2BSDA 1T03H 3STZA 2Q2EB 2D7TL 3FU3A 3ME0B 4F8NA 2CHWA 5K9JH 1SXSA 5DQ9B 4O51B 4XNQB 4NQXA 3BWAA 2DEYX 3TCXA 3WUWA 1V7MH 1A66A 1ED3B 1TZOA 4W9KC 5ELIA 1PLGH 3PUUA 1MCPL 1O5DT 3RWHA 1ES0B 1FL5A 5DEGB 4NPYA 3B7UX 1IQDB 1P2CB 1QLRA 3HI1A 3BIBX 1XGPA 1Q9OA 5EDXA 2GJ6E 4ANKA 1WBXA 2OW7A 3WN5C 5FYLH 1PZ5A 4HFWB 3UTZA 1CE6A 3MRDB 4R8WL 4YPJA 4IIZA 3VFOB 1G43A 2FTAA 1ZSDB 1EMTL 4OCSL 4YL4A 4AV4A 3V9EA 5DS8A 4IRZL 1HCFX 2XXFA 4O9HH 2YXWA 1AG6A 3C5SB 2XTJD 3QUXA 1CDJA 4NDMA 5F7DA 4IJ3B 3MRFA 3LKSB 3LXUX 4N0RA 3ZHDA 1IBZA 3CBRA 2VE6B 4P2OB 1RL1A 2R39A 1CR9L 4BV1A 3FULA 1FVCB 3APMA 4R7NB 5TTRA 5AW4B 4P4KC 6PAZA 1PZ3A 3PUCA 3B7YA 4JDVB 3II1A 4YH6A 3BRGC 2J6EA 2XA8H 3ES6A 4J6IA 4CN4A 5D8JH 4DEPC 1QBLH 3WMQA 1XVSA 2QMJA 1J18A 3GZOA 5K93A 2OPCA 3HTLX 5DSCA 3ZHNA 2NY1C 2DQEH 4XNUL 4L8DB 5JXAL 1V5JA 4KMTH 3DX8A 1N7MH 3CFTA 1NMCC 2F8OA 3PWPB 4JO2L 1M7UA 1HWWA 4JY4A 2YIHA 3U7YH 4LMQI 1MFAH 3PFQA 1ERNA 4AOFA 4P4RB 3F85A 3PNRB 1GC1C 2OMBA 4BK5C 3D33A 3S5LB 4LPCA 2I27N 1L6XA 4K23L 2I7OA 1G9EA 4G8AC 3TS8A 4WUUE 4W9LC 1RJLA 4XCCL 5FB8B 2KZKA 3J27A 1JGVL 4MAUL 3QEQD 4NQDD 3OZ9L 1DN0A 2UX7A 2ZICA 5CP3A 1UCBL 2B1AH 1G7HA 4ZTEA 2AHIA 5DF0A 1FYTB 1RERA 2LVEA 3MUZ1 3V52H 5KVFL 1U8LB 5DK3A 3WEXA 2JTYA 4D9QE 1WO2A 5IREA 4G6AC 1G0DA 1NCCL 4U1JA 3TO4B 3L48A 4XXCA 3HR5B 1OM3L 4MQ7A 3VW3H 5LUMA 4GRWE 1DL7L 3MJ9H 4ZUUA 2OXGA 3GSVA 5GZNC 5EOQL 2Q6WA 3E1ZA 1VGKA 3MV7A 2P5EA 1PZSA 4Y4HB 1UKQA 4R4BB 3QPQD 2NXZC 5DCCA 3TBTB 3PV6B 1MJ7H 4AQEA 1GGBH 2OMWA 4AUYA 4AVKA 3JBG7 2JKIS 4WEBH 4ZD3L 3QI9D 2EYRA 5D7LA 1S78C 3BYTA 4XI5C 5CZXC 5FAAA 4J3OF 2ZOLA 3UCQA 4XC1H 1I31A 4PCSA 4XNZC 3RZCB 2H6UA 1D7FA 4HS3B 4YAQB 4LKXB 1BFVH 1S9VB 4OF6A 4BZ2A 4C58B 3HBQA 3MBWB 2ZG3A 3FTUA 2YLHA 2Z35B 3TV3L 2GSGA 3QUZC 4P9ML 4Z7WA 1LDPL 3BEVB 3GEFA 3EYQC 5F70A 3ZL1A 3SE9H 4CN1A 2ZXWB 4TOYL 2QHRH 4RISL 1VAHA 4L05A 3L4CA 3JV6A 3MNVA 4WLCA 1MRCL 1E9OA 1U95B 4LDOB 2VN5A 5DUPH 2UWEE 2EDOA 4LCWD 5CJXA 5JW5A 1M2VB 3SE3C 1FZOA 4J1UB 4ALAC 5FUCE 1KB5H 2HWZH 1QBAA 4WW2F 2N7SA 4NQEA 4XNYL 1ZGLP 1S7UA 1X9RA 4FA6A 2WC7A 1I7ZB 4XXDA 2FVNA 3M6DA 4HV8B 4PG9B 1FQ9C 3HE6A 3FFDA 1NFIB 4HISA 4U6HA 2V5RA 4TL5A 3KJ6H 1E6JL 3GM0A 2Y72A 4PJXA 2OJZL 3MYJB 5KVDH 4KRMB 1RP8A 4MJID 5HVFB 1XF5A 3V9CA 1WCBB 3BXNA 1F4AA 5A2KH 3N40P 1TQBB 2ATPA 4PGCA 4LHUB 3D3VD 2XV2A 3AVEA 3FRUA 2Y1VA 4JJHA 5TJWK 4OFYD 3S37H 5D7IE 1P7QA 4A2DA 5IEKB 3TOPA 1QNZH 1KIQA 3CN2A 3BUPA 3GBNL 4ICWA 3NDYE 1CD8A 1LHZA 3T2NH 1LK2A 3ARDC 1OK0A 4FXTA 2YMTA 4Y88A 3EGSB 3NIFE 4OLYH 4R6UA 2P26A 1FH5H 3W82A 2F6AA 3GMPB 3HZMA 3UBXI 3SPIA 2VAAA 1J1OL 3VI4F 2J44A 3UMTA 3IXTA 2F18A 5DC9B 1VCAA 2YD4A 3TASA 4Q52A 3SBPA 1KTCA 3PWJA 4UT7L 4NNXB 3BVUA 3T8VA 3APFA 3MBEA 3V6FB 1DVQA 4XZUB 5E5RB 3V6ZA 4FEMA 3L13A 5J11B 2WGNB 5C0BA 2XBZA 3ALWA 3FCTA 5T3XD 2R0WL 1J1XH 4Q9QH 1CT8B 2ICEC 4PWEA 5DD5H 5IQ9B 2Y5EA 2BP0A 1NAKH 1K4CA 4EI5B 1SLVA 2ZX8A 1UD2A 1XGQB 4H0LC 4G7VH 4PJEF 4R26H 3WIAA 4GKZB 1CLCA 1ZHNA 2CGZA 1R3IL 2YPKA 1FGNL 2F54A 4HJTA 4HS8H 1XIWD 4NI6A 2O5YL 2AMGA 2PP8A 2C1OA 2J12B 1JDCA 2F8XC 1CICA 1ETB1 1S9YA 1U8OA 1PDKB 3VFWA 4Z3IA 2H8PB 3L3JB 5BV7B 3BCDA 4OJFH 4DEWA 3EOBA 5IJDC 2JKJA 4HOZA 5A7EA 1GOHA 5BQDA 3WV0A 2WYZA 4XP9H 4MQXC 1S46A 2RH0A 3VG0L 2D7QA 3CXFA 3RHWK 2OZ4L 3S34H 3KNBB 5F89A 3ZW3A 1BOGB 2AABL 1CDUA 3L5XH 5A2FA 5IVZB 1Z2KA 2FD6H 3CDCA 2OCCB 3DYOA 3LN9A 2FDBP 5DGQA 4P5TA 4N90D 1JZ6A 2CE6A 1FFOB 4LPTA 3O2VH 5DC0A 4Z7QB 5JDSB 3QIUA 3PWPE 1MCOL 1WFNA 4HQQL 5FA3B 5KYWA 1DDHA 4Y9BA 3BPCA 4X6CA 4ORGA 5I74C 5ITBH 3D2UA 5J89A 4N1CA 1UKTA 3C60A 4PYGA 4QGYA 3BSGA 4HT1L 4ZX4A 4G7QB 3E38A 4P5KA 4UOW0 3TVMD 5E8NB 3UMNA 1MRFH 3HNTH 3UGUA 1X4ZA 1Z9SA 3KDMB 1Z9OA 2PYED 2EDFA 1J1PL 1YEJL 2BOBA 4LKCB 4YSOA 4RAVA 1JPST 3U82B 2QKIA 3EZJB 3FUMA 3PG2A 1JGLL 3WFEH 1L7IH 3CFBB 1FYTE 3ESMA 1JHTB 1UHVA 4RMTA 2D0GA 3O6ML 3CZNA 3GJFK 1ZLWK 1QTPA 4OM0H 1BG1A 4C4KT 3OHXC 4EE2A 2C1PA 2AITA 2ZYIA 4QDGA 1PY4A 3KHQA 1A14H 2R29H 5JPNA 2BHUA 3Q3GA 4U1NA 5BQ7A 3Q5TA 4Y5VA 2ADGB 4BCZA 2MCPH 1QQDA 4XP1L 3ZZLA 2VDNL 4KNSA 3N50A 3VH8B 2AP2A 5C0IA 1PNDA 3HZVA 4HAGA 3V5HA 2NLJB 1M71B 5LXVA 1DQIA 4PY8J 4RAHA 1YYLL 3BWSA 1P7KB 3NFPB 1R9FA 3LDBB 1ICTA 1TTUA 1PJ9A 2P1YA 5EG6C 4ZNEE 3LTVA 1NM4A 3WS3B 2A74C 2EE6A 2GABA 3JWDL 2E7BA 1A1MB 2F74B 3LPWA 5LJYH 4GG8A 1BW8A 3MUHL 4TVPD 3OF6A 3OL2A 5F7EL 1IGYB 1RZIA 1SJHA 3P40A 1U36A 1TCMA 1PIFA 1P1VA 1DJWA 1K8IA 4MXVE 1NGQH 1AHMA 4LSQL 4B3VA 1JMXA 3DJSA 5L8LB 2KKQA 3SDCC 1BXVA 2F7IA 3L7FA 2NXYB 4WI0A 4AKOA 4GRLC 4PLKD 3VD2A 3ZE1E 5DO2C 2BOCA 5LGKA 1WLHA 3NSJA 2BP5M 2HSIA 1EEYB 1LE9A 1TMCB 1OGPA 4H8HA 4J8RA 6CGTA 3W39A 3U6XA 4YE4L 1AE6L 3O0LA 2P7TA 3VVVA 1NGYA 1TUPA 2DQJL 1IBGH 4IK6A 4KKLC 3EJCA 5EUKB 5JHMA 2UYLA 2V5SA 2YS4A 2E9GA 2X3CA 1ODAA 1ECYA 5IJKC 5D1QA 4DUVA 2V9RA 2CBPA 4GIPD 5LN4A 1J88A 1QWUA 1T1ZA 2VDKL 3PU7A 1CDBA 2JQAA 5IMKB 2CXKA 3ZE0F 3WXVL 2XOTA 2BS8A 5FIEA 2UY6B 2K8MA 4WWKB 1OV8A 4X7TA 1YO4A 1E4XL 2V2XA 4Z7NE 1A6AB 4V33A 5LB1A 1KXVC 2APBA 3AT9A 4ANWA 1HI6B 1JXKA 3CFJA 5DJZA 3UPRB 4KJQC 2GTQA 4QAMB 3BUDA 1CXKA 5DLMH 5DHYB 1TQSA 2I26N 3ABMB 3LZRA 3RX8A 1KB5B 5KYUA 1HT6A 2A73B 3V0WH 2Z6FA 3BPOC 2M26A 4YPGB 3O9WA 2HRHA 3CDZB 3L16A 3HMXH 3TFBA 1AXSB 2BWQA 3PJSB 4KKAC 3VX0A 1QABA 4KKBD 5CLXA 3JTBA 3NCWA 4F58H 2GJ6A 3L9YA 1F56A 1KCLA 4WAFA 3ZBMA 2BVUA 3MACH 1I7RB 3WJJC 3AY4C 3GHBH 8CGTA 1UZ8B 2GJPA 3TEYA 3P0GB 3VG9B 3PHOB 4PY7A 3UBXA 2JSFA 4C83A 4HIHA 3TCTA 4X0KA 3GJFH 3WEAA 2ICWJ 4KQ4L 1D9KB 2HTLC 5FO7B 1I1AB 1IE4A 1LO2H 1Q38A 1Q1JH 1C7TA 4ERSH 2DTML 3QFDA 4TRPH 3W5NA 1NLBL 3IJ7A 2ZYHA 5EORH 3SYQA 3KCWA 4AQAB 4M43H 5KANG 4Z7QE 3GSRB 3BSZA 3C8KB 3NP4A 4L3CB 3B34A 2HG0A 4XX5A 2CGRH 2RFXA 2F8IA 2PP9A 3CVDA 4GBXB 2JK5B 1Q72H 3F7LA 4PJDF 3TZVA 4X5XB 3KBPA 4GAAA 3GSUB 3MNWA 4ZFOB 3VFNB 5D1XD 5EN2A 3UL4A 4ZMWA 3DECA 5EU4B 5IWLC 3BGMA 5E1QA 2V5TA 4UOW1 5EBGA 3VXTB 1ZE3H 5ACZB 4LCIH 3MXVL 5HGHA 2WUCH 1XR9A 4APQB 4WUUA 3ZL2A 2UZIL 1KPRA 4LCUA 2VCOA 2UVEA 4F92B 1N5AB 4M00A 2NY5L 4YHNB 2ETWA 3S2AA 5L7XH 4CJ1A 5B8CB 2GSIB 1OAKL 2NX5D 5DZLA 5EOTA 2G3NA 5LQBH 1XF2A 4J5VA 1AZCA 3EGDA 4OIIL 1QLEL 4DW2L 3IVKB 1GZHA 5I1IH 3RWGA 3NTCL 4OLZH 4Z77B 4M02A 1RIVH 3O3UN 2WTRB 3QGVA 4WHTA 2WNWA 4MQSB 4ILDA 4J28A 3TIEB 3S36L 3EYVB 5CZKA 1TKWA 3BO8B 5C9KA 4BE5A 4I88A 1R3KA 4FXGC 1NCBL 5E5MB 3FQ1A 4JMNA 5E1GA 3R06A 4GW4B 4M6NL 5SV3A 5I30L 3MRNB 4KJWD 3ILEA 2IPUG 2O4EA 1UENA 3IN2A 1UG9A 1YNTA 1MFBH 3TYGH 5LAPA 4OFKA 1C12A 2KH2B 3O2DL 5DGRA 5B1JC 4OLWL 3AWEA 1X5GA 3WAJA 1QMUA 4HZ1A 4EOWH 6FABH 4U0RB 3UERA 3I3BA 4BQ8A 2F58H 3CZKA 4FULA 1WH0A 4JFZL 3ECUA 4IGBC 4POZC 3DOHA 2Y7SA 4MYPA 3T0XA 1T7VA 2WQXA 5IG7A 4P46D 2RA1A 4YBHA 2YPLD 4RRPA 2OTUB 2EXWD 5EZOL 3VGHA 3C5ZD 3MPCA 3UG5A 2UWEA 2OMTA 3JWDC 2QVFB 4QRUA 5J13B 4AGQA 1JTTA 1UWEH 1UD3A 4JCMA 4KO6A 1L5GA 4OIBA 3WJLA 3NABH 2RHEA 2CUMA 1VDGA 3UBHA 1PCXA 3CZSA 4LSSH 4XP6H 2P8PA 3D39D 3H42L 4I3SH 3O11A 4E9QA 1J8HB 4LRNH 2W07A 1QBBA 4PP1D 1DVTA 3IPFA 1MW3A 3MXWH 4XNMB 1MI5B 2Y6TE 3P0VH 4P04A 2VT0A 4UTBL 2EADA 5DK2A 4EMZA 4UTAL 2DIJA 4WKZA 4MB5A 3FSWA 4JFWA 1N0XL 1CFSB 1R3HB 1IL1B 4Q4IA 5D7IA 1QO3A 3QRGH 3U9PL 4AV0A 5BZDB 1O6SB 1A7NH 4MDRA 5B39B 3IS0X 3NEOA 2JKSA 1C5CL 2WN2A 3JVGC 1DLFL 5D1ZI 3MGTA 1ASOA 1G7IB 5D7KD 2ADIB 1YEEL 1KYOK 5AVWB 3KPSD 5J56B 1J9RA 4MS8C 1QVOB 2WAQA 2AJVH 2NYZA 1RULL 2VC2H 2ENYA 5DQ9A 1A6UH 4O51A 1HU8A 4XNQA 2NY6B 4GEIA 1EDHA 3IDGB 4U6TA 1KC5L 2VABB 3ZSTA 5BS0B 1ED3A 3O6LL 3DX2A 3NIGE 4H8UA 2R4SH 4IM8A 1SDDA 2ZXCA 4EVNB 4YSEA 5BO1H 5CHNB 5DEGA 1SLXA 1MJ8L 1OY3B 1IQDA 1P2CA 5KVDE 5FO9B 3BIKB 3B37A 2R69H 4Z7WF 3TA3B 1ETJA 3CDYA 1QI3A 2Y7OA 3NT0A 4FNLH 3NYKA 3OM3B 1K5WA 4AZ8A 4B7IA 4AYBA 2VZVA 4HFWA 3QUKB 1DP0A 2R4RL 1QI5A 1SJEB 1UKSA 1ZHBA 3MRDA 3ZY7A 1KYUA 1Q8MA 1UB5B 2VMCA 3VFOA 4I18A 1ZSDA 1YEIL 5D2NE 5T1DH 3MRJB 43CAA 2VXUH 3GNML 3C5SA 3VGGA 1JPGB 3IJ9A 1U3HC 1GIGH 3IPBA 5IB1B 5AZEH 4N9GB 1QZ1A 2K45A 4ZAKB 5ACMA 2VE6A 4P2OA 2EH8L 3PAUA 2CBQA 1FPTH 2UZXA 4Y1AB 4R7NA 4I5BB 4L37B 3BWUF 1B90A 5ERWB 1FG2A 4JDVA 3LNFA 3I6LE 2AJUH 4LEBA 4XMWA 2LLGA 4X6BA 4PJXF 1X6NA 1XF3B 2LW3A 3QJHB 4OQTH 4FFYH 3RURA 4YNYB 1P84K 1LEGB 5E8DL 4L8DA 5I8CB 1DYZA 1DFBH 4GXUN 2W5PA 4N24A 4LSTH 3PWPA 5F1IB 1IFRA 1SJVA 1JUFA 4LDEB 4P4RA 3V10A 5DFTA 5HYJD 3VNYA 4D0CB 1IGTA 4HSQA 3S5LA 1HYSC 5IHHA 3O4OB 2ZT9C 4JQIL 4YSPA 5FB8A 4XO3A 5I6KA 2B14A 1RHHB 1RSFA 3S97C 3ZDZF 5ESVB 1KEML 2Y5TB 2RR3A 3KPRD 5BRZB 2A6JB 1WRFA 5EZIH 2JIXD 3GJFB 3SSGA 1FYTA 1BGXL 1U8LA 2YD2A 5EU6B 2QPFA 3TO4A 4JY5L 3HR5A 4DQOL 2OJ1A 3V79C 1MFMA 3LHPL 4X8XA 2YUWA 3HRZC 2WKLA 4JL1A 3LPPA 4FFZA 1UACL 5CO1A 1DANU 4R4BA 3WDJA 2OTWA 2YAHA 1PSKH 3FSVA 4HJJL 1WBYA 4OI9A 3PV6A 3MRCB 3TBTA 1NOFA 5CEYA 4JL2A 1KXQE 2DYPD 3LQZB 4JFVA 3I9GL 4PG2A 4NJ9L 3S3CB 1GYUA 1XH2A 4HKBB 4L4VB 4HAKA 4TF4A 4UQ2B 5CIPH 3QIWD 1KTKE 4JPWL 3DRQA 1CE1L 2H0JA 3A24A 3RZCA 4HS3A 4YAQA 4ZNEA 4LKXA 1S9VA 4JR9H 4PRPD 2WZ6A 4WU5B 3MBWA 1TTBA 2Z35A 2W81C 2Y1AA 3VXNB 4XBPB 2XG4B 1YEKH 3NSCA 3TJHD 1WFIA 1XF1A 4JB9H 1R19A 2C9SA 2N56A 1T5KA 4G8IB 5AYQA 1XO8A 4L0ZA 3VFTA 5AFAA 4NWTL 2P52A 3VYNA 4Z3GA 5HHXL 3REVB 1UD4A 3VD1A 4WI3A 5E8OB 1RSYA 4L4TD 5E2WH 3SO3B 3WNPA 4A63A 5ETUB 3WLWD 2PO6B 2JWYA 4R7XA 1O7DC 4X6CF 5EBWB 3RVWC 2IOOA 2NY3D 2ZPKH 4KO5A 3U79A 2XTJC 5GZOC 1I7ZA 4PG9A 3MOAH 1J8HE 2P8LB 4M6OL 1NFIA 3IDXH 4NQCD 5I17B 3C6LC 4N1EA 3CLFL 4F80A 3MYJA 1MI5E 5DRXB 4Z3FA 2OI9C 1IKOP 5LG1A 2P45B 3UAEA 3LZFL 4KBPA 3CFMA 4NT6B 1QYGH 2NUPB 1DE4B 2AXJA 5DZVA 5H94B 3GSQA 1T80A 2WBXA 4Z7VE 4FQHB 3FU8A 7PCYA 5IEKA 3INUH 3OKDB 4WW1B 4DAGL 4DVBB 4WW2C 5CCGE 4KXAA 5C08E 1A21A 4F37K 5C3LD 2QPUA 3AROA 3FU9A 4FE9A 1R6VA 3F7YA 1SPDA 4EZLA 1JAEA 3QW9A 4JGUA 1EEUA 1SGKA 2VZUA 3OKKA 3APNA 1HINL 1N8OE 3N1PC 5HD8C 5DYFA 2VUOA 4X42A 3K5SA 4KGLA 5I73C 5BS0E 3O0RL 1KNOB 4BA0A 1TVHB 5GGVH 4N8VB 3V6FA 4XZUA 3FRPG 4UAOB 2R15A 3B7TA 3P9LB 4X99B 5LDUA 3FO2B 1IAKB 5I5MA 1N59B 1CT8A 2PPFA 3FO9A 3GBEA 4AY0A 3KR3L 3QEHA 4YOKA 5I71B 4R3SB 5B22A 4JBSA 1M05B 1P6FA 4G1EB 4EI5A 1N19A 3AGVA 3S8WA 3VB8A 1GGIL 1NGWB 2HKFH 2BWDA 5SWQA 1C8QA 3EJYD 4NERA 3WIHA 4L8SB 2VO8A 5GIRB 2EE0A 35C8L 4KX8A 4YO0B 5A3IC 1BHGA 1PDKA 2A77L 2V7HA 3Q2LA 4PB0H 5D1ZA 4KX7A 3L3JA 3RKDC 3BAEH 4OLXH 1JZ5A 2ZE0A 4PJ5B 4QD2E 2IVFC 4ZMLA 1MLBB 2CRZA 4FQXD 1M57B 3U0WH 3IAGC 4Y1AE 1Q0XH 5C7XH 3BD5A 5I1CH 3PWUB 5ISZB 4RGNB 4NN5C 1MVUB 2VC2B 2JB6B 1MCKA 3KNBA 3O3AB 4LQ1A 4G7SB 1NOLA 3GIVA 5IVZA 4QHKJ 4L5FH 4YN3A 4DUWA 5KBLA 3FU0A 4MD0B 1FFOA 3EH2A 5JDSA 4ETYA 1FFRA 1E5YA 4W9ZA 4MMXB 2Q86A 5GRVL 3QPXH 2WANA 2CMRL 5FOBB 3FTVA 2H6PB 3T4AB 5AOJA 1MNUH 1OPGH 4FKKA 5FKPB 5HGGS 1ZPLA 2A2QT 3NA9L 4MLSA 2MEJB 5E8NA 4AG4H 1BM3H 1A1NB 1ZEAL 1ADQL 3KDMA 1N6UA 4IBTA 4NZFA 4Q97A 3S2CA 1N64H 5BRZE 3MOQA 3TN0D 4DHLA 5EEVA 2IBGA 3UDWA 1JVLA 3B3IB 3HVDA 3BN9D 3L95B 4X7EC 5F0PB 1C5BL 1JHTA 4Y7MA 3CH8A 2BNUB 3MO1B 4F7TB 2CNYA 2Y7MA 5EU6E 3UTTD 5IFHL 3PAZA 3RWJA 1Q9LB 5HHNB 5T1LB 4EDWH 2VKXA 2A7BA 4GW1B 4YDKL 4FJZA 2A9BA 5I1GH 3T2PA 4Z5RB 1TJGL 1JFQH 4XN2A 3QIBD 2ADGA 2Z93A 4JG9A 1RZ8B 3VH8A 4J7RA 3U36A 3K91A 2JELH 4B3EA 5DVNA 3D4ZA 4DO6A 4X7SL 1Q0YL 3GRWA 5B38B 1M71A 2ED8A 5CJQH 3PJNA 3CXHK 5EOCH 3NFPA 4L4VE 1P7KA 1ZJBA 1Q0EA 3QXDB 1RUQH 4N0YL 4ZTPH 5JUEL 1ID2A 1ILSA 3SOBL 5F7MC 1BVZA 5ILTL 3SE8L 1S9KC 2Z8VC 3WG7B 3WS3A 5FOJA 4OZFG 3VMOA 1U8KB 4OGXL 1G9HA 4DGIH 2L7QA 1T3FB 2F74A 1A1MA 1A4CA 2FHBA 2BMKB 1WT5C 4R84A 3BE1L 1FAIH 3T0WA 1IGYA 4Y2NA 3VD4A 5H37A 4W68A 1R5WB 3BLKA 1HKLL 2NYYD 5T5NG 2OR8A 4L8BB 2QR0B 2H45A 4Y4KB 1MHPL 1XGTB 2TSBA 1IMHC 4LVOB 3V8OA 5T5NF 2J6EL 4NO0D 3VXPB 5C0GB 7CGTA 1FLTX 5DXWA 4PJBE 4WTWA 1XIWC 4F9LA 4R0LB 1QSEE 3MJ9A 3KYNB 1JPEA 2VR9A 3CSTA 1BVNT 3HZKB 3CPLB 1H8LA 5HYSB 1GTNA 2G2RB 2ENJA 2XTSA 3M46A 3QDJB 4I0CC 1HQ4A 1EEYA 1X5ZA 4FQJL 5I8KL 4LARH 1BAWA 4LVNB 2G3XA 2HRLA 1YMMD 1MCEA 3IGUA 4JFOB 3EXLA 4XR8C 1AJ7H 1XT5A 1J5IA 5CIPB 2DQTH 2ATKB 2ENPA 3UYRH 3NZSA 2JKTM 1XD1A 3S48A 5JOPD 4KMQA 2JFCA 4PFEA 4DZ8B 1GC1H 5F6IC 1E4KC 1RJYB 1T20B 3MA9H 4EI0A 1OF2B 2J4WL 3AMKA 3BQUC 4PVMA 1NBCA 1DBAL 2ADFH 2IQ9H 3ZKND 2E74C 5IMKA 4A6YH 2Y23A 1IGFL 2QLVB 3L3OC 4M3JA 4OZIE 1EZVX 2BWIA 2DDQH 2W59A 2UY6A 4JKPH 4WWKA 5I23A 1GCYA 2FT8A 2J5LC 1LO5B 4J4PA 1BFOB 1PKOA 2P3YA 2Y3NA 4GRWF 4UU9B 4H25B 3WXWH 1A6AA 1TVBB 3IMVA 3AITA 4UNTA 4CMMB 1KGYE 3QNXB 4ODVL 1HI6A 2IDCA 3UPRA 1DJYA 2VLKD 4PREB 4H88L 1Y1DA 1JV2B 3D12B 1INEL 1TETL 5DA4A 1YSOA 5GGRA 1V27A 1RUPL 4L3ED 1YNTF 1KB5A 1U2HA 2A73A 2WO4A 1I7UB 3PHQB 1HNFA 2R2HB 3GI9L 4N68A 5FHAL 4YPGA 4BXVA 1JHKH 1BBJA 2PWGA 1U3ZA 3CDZA 1HEHC 1KCSL 2WIIB 1K4DB 4Q9BA 4NC0B 4X6DB 1AXSA 1NCOA 2BSEA 3PJSA 1DVZA 4BZ2L 1QATA 4D2NA 2WINA 3BZEB 3QR0A 4ZW6A 4Q8BA 4AIZB 5FCSH 4F7KA 2LU5A 1U6AL 1UZ8A 4YDJA 3N1MC 2DLFH 3OAUL 2WYHA 4YBQD 1JNNH 5KYYB 1UWGL 2IG2H 3PHOA 3LKQB 4QHUA 3FFCE 3GC3A 4AIXA 5D2NA 2TSAA 2UWEF 2BVOB 2CO7B 3MLRL 1YDPA 4OZHB 5F0LB 2HMID 4PJ5E 5F7WC 4JFSA 4ZO6A 4QXGL 1D9KA 1IFGA 1GTFA 3HNVH 1JXGA 4YDNA 4UZUA 2GK0B 1I1AA 5FO7A 4RGNE 3DXAB 1CZ8L 5ISZE 3NAAL 3AT0A 1NM9A 4JM2B 1NMAH 1EEZB 1UA6L 1ANUA 4BSJA 3JUZA 3HC4H 2XN9B 3NESA 2OJEB 3BQVA 4KI1A 3QP3A 4AQAA 2HFGL 1MFDH 3FCGA 4ALAH 1PZUB 3C8KA 3E8UL 5HI5D 4IBWA 4JJ5B 2O6EA 2AFNA 5IHWA 2HCZX 1F3JB 2JK5A 4GBXA 3CZFB 1I4FB 1FLRH 4GFTB 3AABA 4X5XA 4BSVB 3GSUA 2JKXA 5D7IF 5FUZH 3UZVA 3VFNA 4ZFOA 1RZQA 4L48A 1T2JA 1EERB 5HPMB 5EU4A 3Q9PA 3ZTNH 3FH7A 2WTPA 1MCHA 3LNHA 4QTFA 5KJ4A 4C56D 5HHVL 2YEQA 5E9DD 3NIFF 3EYSH 3FQUB 1KFGA 1AIFB 4YDLC 4APQA 1E4JA 2CDFB 1RUAH 5HP5A 4XMPH 3WO4B 1DQML 3V4VA 2IDFA 3BPLB 3VXOB 5BW7A 4YHNA 3BYYA 4KH2A 3H0TA 4CBZA 3N06B 3AREB 2ZP0T 5B8CA 2GSIA 4WKXA 4C55A 4OAWB 3IVKA 3QA3B 2Y9RT 1FA4A 1ZIAA 4V1DB 3N9GH 4Z77A 4K5OA 4MAYB 2WUBH 5BVPL 5HHOB 4IMKC 4NFDA 5E94A 4MD5B 4G1MB 1WZAA 3TIEA 4BQCA 2HJFB 3CC5B 3EYVA 1H15B 1BYNA 3BO8A 5EIQA 3QFJE 3TJPA 1TJIH 5FYKD 4MZ3A 5E5MA 1PIGA 4GW4A 5MP6L 4EZMA 3MRNA 2FK9A 1KXQA 3FPXA 4UT9H 1RMFL 2L7UA 4PCTA 4A7GA 5D7JB 4FABL 3VE0A 1FRGH 4NNPH 1WTGT 1QFPA 3M1OA 5GGUB 4ZW5A 4GIAA 1QG3A 2HH0H 3LRMA 1F6LL 5H4ZA 3DX6B 1VEPA 1S9XA 4FZ8H 12E8L 1MJUH 3Q6GH 1EDQA 2IPTL 1DCEA 1WAAE 4YX2L 5E8EB 5IEHB 1MREL 4PBXA 1I1YB 1WFUA 4KHXL 5HVHB 4JG5A 1EXUA 4DCQB 3R0MA 3LB6D 1FSKB 3NK4A 3WNLA 5CBAA 1M7IB 4Z9KB 5CD5D 1IU1A 5HI4C 4OJYA 1CYXA 5KVMC 1AGCB 2TRYA 1JF6A 2J1WA 1QEXA 1JNJA 3GZKA 2FWSA 4HPHA 2R29A 5I0VA 2QPDB 3VXUB 4IMLB 2E6PA 3QDJE 3TNNB 5K9OB 3QUXC 1KOAA 3UEZA 4LSRH 5BZZA 2BOLA 4YSTA 1EMTH 1HL9A 2G5BB 5M95B 2YQBA 1RIUH 1W8OA 1DBKL 5GJTH 1JN6A 4JG0H 4DNLA 5KAQF 4NFCA 1BIIB 4K9JA 4YHLL 3SHSA 1J8HA 4WJKB 1E5ZA 1NCTA 4BFBD 5IIEB 1EAPA 4ZMZA 5AQ0A 4B5EA 4QRRD 2A6KB 4XNMA 1I53A 4HUUB 5BMFH 4BJLA 1MI5A 2NQ3A 3MJ8A 2VL5B 1CR9H 1PZBA 2K6YA 1OANA 2Q3ZA 4F8OA 3N55A 3RI5K 7TAAA 3WN5B 1WS8A 4PMFA 3KGUA 3VSTA 5KSUA 4Z7VA 5JR1L 1ZK5A 3CFKB 2HT4D 4Z0BH 3UTSB 4ECNA 3P77B 1CFSA 1IL1A 1TITA 3PLYA 1PPIA 2IXQA 4XN9A 3VFSB 4AJWA 4A39A 4RMBA 5BZDA 1MQKH 5LNGA 5B39A 5J57B 5JXAH 3KLSA 5TE7L 5C08A 2PPDA 3RVVD 1NTDA 2D9CA 5IQ7H 4XPGL 3VFVA 4MJ4A 2KDYA 1G7IA 2ADIA 2R9HD 5L4IA 2HVJB 2AGJL 1UASA 1Z9MA 5DQJA 1F58L 1QVOA 2ZCKL 1BVKB 2GVYA 3LRLA 4XMTA 2VB5A 1KIRB 4P4KB 2DJMA 3BUIA 2X3AA 1JZFA 4FCAA 2VABA 4OLVH 4WUKH 4XCCH 3QYNA 2MQ0A 5BS0A 1OL0A 4HUNB 1XBDA 2JB5L 4G3YH 5EH1A 2FT7A 4FQLL 3OZ9H 1UA3A 4DEPB 1MUJA 5HJDA 4X6DE 2EKJA 4JFQB 4XXCC 4EVNA 4OD2B 5CHNA 1UCBH 1BOYA 3LKPA 5DDHB 3V7AE 5FO9A 3BIKA 1TZIB 4K5LA 1NMCB 4KRPD 3TA3A 5B1CA 3TC9A 3FUJA 4YLQT 5AOKA 1QACA 2A9NH 4GQQA 1MAML 2AQNA 3UO1L 3QUKA 2KERA 3DTXB 2CR6A 5E1IA 1FFNB 2F53D 1SJEA 4TPRL 1UB5A 3LAFA 2FBJH 4MXVF 1X5YA 4A6YB 4ODHH 1G7PB 3P73B 3UYOD 4MNQE 3VWJD 3IWVA 4IKKA 4OZHE 1YPZE 1BZEA 3MRJA 4OF7A 3L54A 3TH2T 4OIAA 5IY5B 1I3UA 5TPWH 3P4NA 5FUOH 5IB1A 4N9GA 4HWZB 3ZE1F 3DXAE 3U4AA 1DVYA 4ES8A 3FSOA 4Y1AA 3T6XA 5C0AE 4I5BA 5IFAH 2ZD0A 3FCBA 4L37A 4TSBL 5ERWA 4QTIH 1TZHB 4NIKB 1YEHH 1NPUA 3WTXA 1CVRA 1W0VB 2H3KA 4NUJB 2BFVH 5B7FA 1AZZC 3QJHA 1Z0NA 3EOAB 4Q4EA 5B21A 3O45B 4YNYA 5DS1A 1LEGA 2NY2D 4M7JL 5I8CA 4M8RA 3VDBA 5HHMD 1WS7A 2RD0A 4P46C 4TOYH 5J7CC 3Q05A 1Y18B 4RISH 3VA6A 1TFHA 2XYBA 2R1WB 5EU7C 5I1HL 2QGDA 1ZVYA 3X1NA 1BWWA 1PG7L 2BZCA 3KWVA 4D0CA 3S3BB 4LAQH 4ZMVA 3N3EA 5JXEA 5LBGA 2YAFA 4HIXL 2XQYA 3Q8BA 3EYFB 1S3KH 3JWNH 2D03H 2PWEA 3BWUC 3HE6C 4YXKL 3WS6A 4Z7NF 1L7TL 4GO8A 2CA4A 3IJYB 5E8PA 3GRGA 1WAEA 1UZGA 5ESVA 2Z31A 1WZ1L 2Y5TA 4M93B 5BRZA 3F65A 4H2AA 4JO4H 3RG1C 4I1RA 1P9MA 2A6JA 1A4JA 5DHMC 2CO4A 3P2BA 4HMEA 4K71B 1CFNB 4OM1L 2X1OA 1KGJA 3GJFA 2XXGA 4JN1H 2WXGA 4OD3L 3QAZC 4WI5A 5D93C 3RIAF 2UXGA 3TH3T 2BCKA 2PN5A 3VDAA 3RX5A 4O4YL 5E00B 5A6LA 3V0AC 5EU6A 1MW2A 4H5SA 3HB3D 1OHQA 4MHHI 3RUGB 3VRJB 1KIPB 1L0XA 3AY2A 5ICYB 4UYQA 1ACXA 3MRKA 1IZJA 3OKOB 3ZYOA 3SDXB 3BAKA 5IOKA 4L5FE 4W9GC 2KLRA 3WDIA 4TSCH 1BM7A 3EH3B 4KUZH 2ZUYA 1OZTG 3GBNH 3PHAA 3MRCA 1NOAA 3VYOA 4M8QB 2AF2A 3DX7B 4OD1L 4ISVB 1OAYH 5GJSH 4B41A 4D7PA 3LQZA 5KVGE 5C92A 4R4ND 3EDJA 3IU4L 4L4VA 1CCZA 4UQ2A 1H8NA 3FTYA 4KI5D 2DKMA 5SWZD 3UABA 3MBEC 1EBPA 4RDQF 4LHJB 4M5ZH 5HDBE 2WZPD 3X1FA 1PJWA 4WU5A 4DK5A 3ARUA 4IBQA 3IB4A 4ODWB 3VXNA 4XBPA 1F6FB 3CFDB 4R5XA 2FCBA 3X3FH 2X6AA 3IS1X 4IBVA 4G8IA 1QRNB 4ONGH 1ETZA 1RZ7L 3MCLL 2R0WH 1L3WA 1CU4L 4N6RB 1QFUL 3REVA 1OP9A 2PTTA 5FYJU 2GBTA 3MRQB 5I28A 3MLXL 2XLLA 4Z7QF 5AVSB 2HLEB 1H9DA 1CICC 1A25A 2LTQC 2EXYC 1QNIA 3BSZL 1IBDA 2H6OA 4I1NB 4S1DD 3VXUE 3MODL 5ETUA 3VA2C 1IEAB 2OV0A 2PO6A 1QSEA 1O6VA 2ZJSL 4Z8FH 3BKYL 5JIHA 1GGYA 4WY7L 1YEGL 3X13B 2YGPA 4I1PA 4N9OB 1JZGA 2WY3B 3MLZL 4QRPD 5A2JH 2WSDA 3DUSA 4KVNL 3NOIA 4N85A 3I9PA 1ZWIB 2P8LA 2QVTA 2AJ3B 4R97C 5CU5A 5ID0B 3US0A 4IW4C 3CHXA 2EC9U 1DVFD 5TE6L 5I17A 1CDCA 2ICEB 2C4FU 3P4MB 3GS4A 4AK1A 3FU6A 1SXAA 5DRXA 2P5PA 1U33A 1O9ZA 4IBZA 1LO0L 1SHXA 2E7CA 3GHEL 4P23B 4NT6A 4P5TC 3VG0H 1DE4A 2XIDA 3CSYB 2B15A 2EZ0C 1GHFH 3QIUC 4UCFA 3UTSE 4K2UL 4FQHA 2AABH 4AEEA 3HS0B 3OKDA 3DETC 4WW1A 2GG1A 3D4GA 4DVBA 3MI6A 4P2RD 3W0WB 3P30L 1T2XA 5HDQL 3U7WL 3BW9B 4HQQH 4KDVA 3Q8FA 4FXLA 1JGIA 1EHKB 4WDIA 5E08H 4I2XB 4RH4A 2OMVB 3CBJB 4HU2A 2VISB 2QKIC 1F41A 1SMOA 5IBLD 3B2UD 2UXVA 3L3DA 3A6BH 1OTTD 2MJWA 3WLBA 1LWHA 4YHOL 3JV4B 4UWQB 1Q9WB 4LP8A 3OKMB 1UD8A 4NAJA 3G5YB 3P9LA 1P4BL 1OCZB 1Q4NX 3IJEB 2ZKHL 3FO2A 5H37G 4AJYV 1IAKA 1SDYA 2DJUA 4JCLA 5EBLB 2WSPA 4PJ8D 5JPNC 3LIUA 5CFAA 4WCYH 4R3SA 4Y5VC 4OCMC 1M05A 3QEGL 2ALAA 2FSDA 4B95C 4HZAA 4TNVF 2MPAL 1NGWA 2P42B 2EE9A 1SM3L 3GXUB 2HRPL 3ULVD 4UANA 1P0SE 3BP7B 1IGML 1EA9C 4L8SA 5GGQL 5GIRA 3D51A 3VTMA 3F04A 3EHBC 4YO0A 1GJUA 3G9VA 2CO3A 1GL4B 3FFCA 1U8HB 3QZNA 4Z3HA 4RA3A 5EEUA 4PJ5A 3WMPA 1MLBA 3ZHKA 5LLIC 1BVNP 2QFRA 5DT1H 3I02A 4F7EA 4APXA 4IIQB 1IIIA 3NCJL 2VWEE 3PWUA 5ISZA 3BWZA 1MVUA 4OCWH 1IT9L 3GSOB 2JB6A 2WXJA 4W4OA 5J3HC 4ODSH 2FYYB 3TJHC 3TPKA 5C70A 3L3IB 3JWDH 3VRIB 5I1KH 3MX0B 2XXCB 2MFNA 3FQYA 4MD0A 4PSRA 3QISA 1KCRL 2WPGA 3ISWA 4MMXA 5LXGL 5FS5A 4UDTB 5J4MA 4X4KA 4RESB 2H6PA 4Z6AT 3SBQA 2VDML 1E43A 5EWIL 15C8L 4DK3A 3T4AA 4LSQH 1WA2X 2WZ0A 4IRJD 4HPYL 2VQTA 4IS6B 1A1NA 4WHYH 1XH0A 2GITB 2DEXX 1M7XA 2OZNA 3AM8A 5AL8A 4XNAA 5T1JA 2VLRD 4KZDL 2BIHA 2EIEA 4IDLA 3R7RA 2IANB 3B3IA 5GS1A 1J10A 2EXSA 3L95A 4UV7L 1CLOL 2BNUA 5DHEA 1AE6H 3VAEA 2V3FA 5A1AA 2ESVD 2Q76A 3RUGE 3HAEG 4FLOA 1Q9LA 3ORJA 5HHNA 5T1LA 4ZI8A 4IBUA 3GBDA 1MKFA 3WSQH 3NIGF 1BCIA 4XPTH 1YYCA 2NNAB 3SDXE 3SDCB 5IB2B 4Z5RA 2EH7L 3T0ED 3WI9A 3R7QA 4UUJB 1I8IB 1ID5I 2F5BL 1RZ8A 5FGBC 2NY7H 3L81A 4J2QA 1AQ8A 3HEIB 3QFJA 3ECBA 2D3NA 5B38A 5IW1B 2ZCZA 3M88A 3SKJH 1I9IL 3QYCA 4NSKB 2H2SC 2GC7C 4ZMAT 1WIPA 3F7PC 3TFKD 3ULVF 4AWJC 1XD0A 1CS6A 1A7BA 3GO1L 4N20A 5ACLA 3CXDL 3O9WC 1KCUH 1U8KA 3WD5H 1LWRA 1T3FA 4IHOA 2PR4L 5T5FL 1IILE 3HCVA 2E46A 3I74A 3LVTA 1AC0A 2P5WD 2LHAA 4OGYL 4FMKA 1QRNE 3KXFB 1WAAA 4EN2A 5ICZB 1Z5HA 3NACL 3HG2A 3QR2A 4L8BA 2QR0A 3FW6A 2X2JA 3ARGD 1NCWL 1XGTA 5EF3A 4IKLA 2AQTA 3ZU8A 3VXPA 1WIOA 2D7PA 1X5FA 1IC5H 5C0GA 3BP4B 2EIBA 4QHMB 5KJRL 1KZQA 5I9QB 3OMAB 1PG7W 1WIUA 4R0LA 2EVJA 2WK2A 3KYNA 3BJLA 1ETA1 1JNLH 3HZKA 3CPLA 5HYSA 2G2RA 1HDMB 3H3KA 3QDJA 2L04A 3NJKA 3ZT7A 3QT2A 3CNKA 4Y2DB 2VMDA 3BPOB 3T3MB 2MHAB 4FQXC 5DZPA 3B8YA 4LP4A 4EXPX 3KDPB 3N6YA 4B97A 1BIHA 1JDAA 1HS6A 4UTCA 4JFOA 1AY1L 3CHSA 4P5MB 2I07B 1Z3GH 5CIPA 1I8UA 2C4XA 1KF9B 1JD7A 3L1OH 5AKRA 3C2AL 3MFGB 2NUTA 1VZHA 2DV6A 3MV8D 4G9FB 4DZ8A 2B77A 3VGDA 1D5BA 1T20A 32C2B 1MIEL 4N2OA 2Z91B 3MBXL 3RU8L 1OF2A 2VLJE 1YC7A 4LU5H 1GY2A 5JHDB 3TZVC 2QEJA 1PNCA 2A4ZA 4PJIB 1ZIBA 1QPKA 1HHGB 4YWGH 3W0WE 4HWNA 1COBA 4H26B 1DLHB 1CQYA 1LO3L 1XB3A 4KV5E 4I2XE 4UU9A 1GYCA 4H25A 2WXNA 3SYOA 1TVBA 1AIZA 3ZDXB 3QNXA 2ZG1A 4B9KC 4PREA 4IDJL 4DETA 4PAZA 1JV2A 5FW7A 5MENE 4FFZL 1JPTL 2X9WA 4LSPH 1YQ2A 3ECQA 4DFHA 4PI2A 5E2UL 2WLKA 2X89D 4S0TD 4A7GF 4DP7X 5C09B 1I7UA 3PHQA 4LDLB 2R2HA 3PL6D 5AUMB 2C9UA 1A9VA 2Y06L 1H3TA 2DQIH 2VZTA 3B9KD 4NUQA 1P1ZA 4NKQB 1GZHC 2DWTA 1YECL 2WIIA 1K4DA 5D96B 1JZEA 1H6FA 4X6DA 3L2LA 5C0RL 1HWHB 5D72L 1JWUB 5EUOB 3EOTL 2MOVA 2VN4A 2W65B 1KDJA 5E4EB 2R51A 4B9GA 3BZEA 1C7SA 4DW2H 4GYBA 4RCAA 4L1HA 3C12A 1FVEA 4OGAC 2HX8A 3QE5A 1OM9A 4XPHH 4JLRA 3O2WL 4HGWB 2YQGA 3UJJL 4EQ3A 1NBZB 5BNXD 3LKQA 2XWEA 4JPQA 3P3YA 1E40A 4R7DA 4AIEA 1LEKB 4B27A 4D3CH 2BVOA 2CO7A 4MNQA 1O9VA 4OZHA 4X5WA 1YPZA 4XN4A 3I50H 2DWEA 4AJVA 3QORA 3F3HA 4M6NH 2EE2A 4K07A 3BN3B 1ACYH 2GK0A 3HHSB 3DXAA 3DYMA 4XMZA 1XGRB 4JM2A 5DMJB 2D31B 4YDIL 3V6OE 5EF0A 3WCYA 2QVIA 2BSSB 5C0AA 1CTNA 2DICA 1BJMA 4OLWH 4X4ME 5FK9A 2OSXA 2BM3A 2OSYA 2OYLA 1KULA 2AMUA 3FTZA 3Q44A 3RY6A 2FO8A 3OAWA 1P69B 4JJ5A 4LP5A 5C07B 3D48R 1R34A 1UVQA 25C8H 3UGXA 3HBPA 3ZHLA 2ZSVB 3MYZA 4FXGB 1F3JA 1AFVL 4JFZH 4Z7VF 3CZFA 4WO4D 1I4FA 1ZV9A 2QZ5A 2O72A 1FZJB 2Q9OA 3DURA 3WJLC 5FUCC 4RFOH 5HPMA 1P4LB 3CAFA 3QDHA 5EZOH 5AYUL 2X40A 4JO1H 2ZXBA 1U2CA 3SCMB 1O5PA 1DSFH 2XZZA 3FQUA 5LO7A 1LE5B 1NEUA 4JPVH 3NGBB 2CDFA 3K6FA 5GGRY 3IPEA 1EX0A 3BDYL 3DWTA 1K85A 3GK8L 4AW4A 3VFPB 2HVBA 2LGNA 4C4BA 3VXOA 1BZ9A 3GMLB 1MWOA 5K9QG 1QAWA 4Z7AA 3AREA 4NQUA 4LLWB 5DZOA 5T3ZD 2CHXA 3UX9B 4OI7A 5DJDB 2WLHA 3QA3A 1W16A 1INDH 1CGTA 2PW2B 4XXWA 1V3LA 2EDRA 4MAYA 3ZKNC 2FUTA 3ILQD 1HSAB 4S0SD 4UTAH 4G1MA 3ESUF 4B0MM 2HJFA 1JGUH 3CC5A 1H15A 1HE8A 2VXSL 3MRGA 4AVIA 1JL8A 1HL8A 1N2RB 4QKXB 2J43A 2YN5A 1OGTB 3QCTH 1VENA 4K9EL 4I0PA 1N10A 3HI5H 5D7JA 1AKJA 2X10A 4XGZB 3WIHL 4YFEA 5GGUA 4ZDHB 3JWNE 1HOEA 1OCOB 4ONFL 4XBGB 2BNRB 2G60L 2Z1KA 3DX6A 2X9ZA 3K2KA 3QDGE 1QBML 4R90L 2FB4H 2IO5A 3CMOL 3O6KH 4NZRL 4OF3A 2EE3A 2HKAA 4S1QL 5BV7L 3KXFE 3LOWA 3MJWA 2NR6A 3QPKA 2I32A 4Q14A 5EEZA 4BZ1H 4PGDB 5E8EA 5IEHA 3SDYL 2CJUL 4PWGA 5CP7B 2A1WH 3VXSB 4DCQA 1BLIA 1FL6B 3O41B 1T03L 1M7IA 4IOSA 1MJ8H 2B1HH 1LMKA 2ZOTA 4F7PB 3NSXA 1THAA 4OKDA 5K9JL 1EJOL 4I18C 3FHEA 3AWFA 1U8IB 1V7ML 1ESOA 3ZTJH 3RFZB 1PLGL 3F01A 3VXUA 4IMLA 1AHKA 3UP1A 5K9OA 2J8OA 3ZJAA 2HMIC 3S36X 1CO1A 1YY9D 4JANB 3W9EA 5DHXB 2G5BA 1TZGH 4P2OC 1N6QH 1UM6H 2VSCA 1IARB 4AC4A 1K72A 3GINA 4QHPA 2H47C 3U0PA 3ENEA 3DDGA 4LLMB 1R1CA 5F6HJ 4NKMB 1B9ZA 1HHJB 2OTPA 2A6KA 4G9FE 4HUUA 3CV5A 1A9EB 2EEDA 2EH8H 1DBMH 3ARWA 5GGSA 3FMGH 2VL5A 5JQIB 1ZHLB 4NENB 4KQ0A 5JHDE 4N2GA 4PJ6A 1Q94B 3WN5A 3DO7B 1DUYB 1MCCA 2AQPA 2P24B 4PJIE 2CZNA 4U0QB 5HI5C 2CIIB 4O9HL 1NKGA 2XV0A 3RNKB 2AAAA 3UTSA 3P77A 4AQ8A 3DGGB 3L3HA 4DEUA 3D52A 3V9FA 3VFSA 4HKXB 2A9AA 1CJYA 1R46A 5E8DH 5HVWA 2XIIA 5FGCB 1VGEH 3ZDXE 4PJHB 4RWHA 4NKDA 2HYMA 2FHFA 4JNXA 3D85D 4XBEH 1JVOA 3S9DB 2XA8L 2LU4A 4N0UB 3H9ZA 5GGTH 5MERB 5D8JL 1IX2A 2HVJA 1CB4A 3DIFB 3WFHB 2IWFA 2VDRL 2XWZA 1BVKA 4DZBB 3SDDB 4XN5A 2DQEL 1KIRA 5C09E 3QQNA 4KMTL 3GRWL 5KBDA 2IH1B 1N7ML 3NFNB 3NFSL 4FL4B 3U7YL 1MFAL 4Q7DA 4LF3A 4YQXH 3TO4C 4OD2A 2FLRT 2PP7A 3BRFA 1FF5A 5I1JH 4PTTB 5DDHA 5EUOE 2H4EA 5J12B 1BGXH 4GFXA 2LU7A 4FN0A 1AD0B 4H20H 3FTWA 1BPVA 4DQOH 1SF3A 2V17H 3DTXA 3FN9A 1FFNA 2B1AL 4CADB 1KWGA 4PG2C 3V52L 1G7PA 1KT2B 1PTZA 3P73A 3TH4T 1H3GA 1HOCB 5JQ6H 1U93B 1E2VA 4PJBF 1ITCA 3RZCC 2X4NB 3BISA 2X2HA 4HWZA 3MJ9L 1NL0H 3LH9A 4GH7B 1MCLA 1L6PA 4JRLA 5GRVK 2ZNXA 1OGAD 2X0VA 3LRSB 3NJNA 4JPWH 4W9HC 1CE1H 1II4E 1TZHA 2CUIA 1EUUA 4XE5B 4NKOB 1MJ7L 3VD0A 4YR6B 5DD6B 2QHLA 4HK3N 3RFRA 4WEBL 2XBDA 3EOAA 3SGEH 3TBBA 3A4FA 1GJWA 3GMOB 4N2EA 2OULB 4XC1L 1Y18A 3EO1B 3LEVH 4R2GD 1BFVL 4KRNA 3BZ4B 2R1WA 3KCPA 5HHXH 4WU7B 2X1QA 4OZIF 3GTNA 5LWYH 5AKSA 1N5YL 3EYFA 1FZMA 5EO1A 2DQUH 4GO9A 4I7ZC 2QHRL 2WOYA 3P3RA 5F96H 2DIAA 4FJYA 1HHKB 4J3VA 3O3EB 1CUOA 4ANXA 3N40F 2AXGA 3ASNB 3B8SA 5GHWL 1CFNA 5KSAD 2LFEA 1WGVA 3DIDA 3IXAB 4M6OH 4OY9A 5I8EB 4M5TA 4QO1B 2CR0A 5E00A 5C0CD 3D05A 4V11A 1KB5L 3BKCH 2HWZL 3RUGA 4YVNA 2C7UB 3VRJA 1EHAA 4LGPB 4EN3A 2B5IC 3LZFH 2MWCA 3JZYA 4CAGA 5ICYA 3ESOA 5T1KB 2J1YA 3UAJA 3OKOA 1PY9A 4EXKA 3SDXA 4Q2ZB 4H8WC 5ABZA 3NJLA 3L17A 3RDJA 2IPUK 5KVDL 4M8QA 5FFOA 1XQ4A 3DX7A 1U3JA 4ZW7A 2XTJB 1S4IA 1RH8A 3ZX1A 4K15A 3O3BB 3IF1A 4G80B 3MLSH 4AM0B 4JVPA 4W6XB 3TBWB 2EC8A 5FYJD 3MVSA 1OAZH 4JO5A 1DJXA 3C6LB 3S37L 2BNRE 4DP9X 2BLFA 1YNLH 2IFFH 3ZGIA 3N41B 2YD7A 3DROB 3T2NL 1BZOA 1Y6KR 3RAJH 2XPGB 1PS3A 2FIKB 4ODWA 3V7MA 3CFDA 4OLYL 1FH5L 3IKCA 1F4YH 3DA0A 1TQVA 4CRPA 4P2QD 5DJYA 4L8CB 4EI5C 2ODIA 1QRNA 4WW2B 1NANH 2J8UB 2VN3A 5IW6B 3MRRB 4K9EC 3DHJA 3UJIH 2GT9B 2VUYA 3ALXA 4N6RA 5E4IA 4JJOA 3KR3H 5LGHL 2PNDA 1HZHL 2BZDA 2G75B 4YUEH 2LV4A 5D1ZC 3UIZA 1GGIH 1WE5A 1TTCA 5L88H 1IEAA 2XKUA 3C75A 4G6KL 5EIIG 4TVPH 5BV7C 5I6OA 4NQDB 3QEQB 3X13A 5DD5L 4Q9QL 2VKWA 3VJ6B 3W57A 1E8XA 1IEHA 35C8H 3QJQB 2VW4A 4FI6A 5IF0B 4ZFOL 1ZWIA 4C59B 1QP1A 4G7VL 1MZZA 4R26L 3L5JA 1IFHL 4YFLI 3HIZA 3W1ZA 2X28A 3P4MA 1IJNA 4HKZB 1TOXA 4HS8L 5AWNH 3GB7B 4P23A 2VH5L 1I8LC 4GPVA 1SXNA 3CSYA 4Z1PA 4P3DA 3V4VL 4PWFA 4KKRA 1OE1A 3ATAA 2VL4A 5AL0A 4WK2B 1W8EA 2X6BA 1YHPA 1JZ8A 2VLJA 3SDAD 4AVJA 4HVBA 2Y1YA 1OTSC 1FNEA 3HS0A 1SEBB 4OJFL 4JHAH 4WEUD 3O4LD 5F93C 4H1LA 4K3EH 3W0WA 5FGCE 4XP9L 1RZJH 4PJHE 3BW9A 3QI9B 2XJLA 4LQFH 5K1JA 1QZNA 2ZZUT 1RUKH 2AKRB 4I2XA 2CO2A 4N0UE 3S34L 2OMVA 4YXLL 3B1TA 4L9DA 3WFZA 3L5XL 2VISA 2FD6L 3LIZH 3T4YB 3INOA 5MENA 2NRDA 1KYAA 3O2VL 3UDWC 4NN5B 4BH7B 5FFLA 4JGNA 3JV4A 1S5HB 4X83A 1M53A 1DQDL 2X7LA 3SBRA 3OKMA 3G5YA 4OVUA 1UUSA 2X44D 1WYJA 3ZE2E 5EBLA 1N18A 5AKVA 1C5BH 3HB3C 1A7RH 2EYTA 2YN3A 1O7VA 3HNTL 2X05A 3EF7A 3DRTB 5IFHH 2MH4A 1WAAF 1F1DA 1T1XA 2YXMA 4NZTL 1KCBA 3WFEL 1L7IL 4X98B 2MIZA 4QXUH 1MF2H 4Y5YB 2NQCA 4PD4J 2IDTA 4R4NC 1OP3K 4OM0L 1U8HA 1Q0YH 4W93A 2CU9A 5CFHA 4K3DH 4XTRD 5CZRA 2R29L 1A14L 1LQBC 4G72B 3GLZA 3D30A 4MJIB 4CNIB 1PGRB 4IIQA 4OLEA 4UIMB 2MCPL 1AANA 1R17A 4Z23A 3V6OA 3D3VB 3GSOA 3RGVD 2IH9A 1BF8A 5CN3A 1WD8A 2FYYA 4I0KA 3L3IA 4OGXH 3VRIA 4XH2B 4KFZC 4X4MA 4TVSa 2EO9A 2ZIDA 3OAYK 2DQGH 2MTPA 3BH8B 4JFFB 2GJRA 2ZP9A 1P4UA 1RI8A 2H1XA 4F9LC 4UDTA 1UFUA 2VUKA 4U3SB 1BJ1H 4A55A 1X7TA 4QT5B 4HS6A 3ROLA 4JG1H 1AGBA 3DX3A 1OW0A 1SOQA 3FK3A 3DBXB 1BEXA 4HIJA 5A2AA 4KH9A 2GITA 2H1LM 3WNNA 1AZRA 4BFJA 3HZ3A 3VXMD 4LOUC 1NICA 4AXWB 4N3UA 1NGQL 2VQ1B 4R4FL 5I8KH 4FNPA 4NZJA 3X1BA 5F3BB 1JZ4A 3BOVA 3S7GA 1MCNA 5IBTH 3CN3A 1ZA6B 4TTDD 5KG9A 3P3SA 3PFUA 4UBDD 3OR6B 1A7PH 1P5VA 2YD8A 3NH7L 5GRWA 2EDKA 3HS9A 3B5GA 2VRKA 3WYRA 1ET7A 4ZW3A 3ZSSA 4WWKC 2NNAA 5KEZA 2Z0BA 4X6DF 4R7VA 4A2FA 3E3QE 4J4PC 1XIWB 1I8IA 4UUJA 2J4WH 4OCNC 1DJZA 4AQ1A 5I16B 1FFTB 5GRUH 4U6VH 1B0GB 3CVIH 1IBGL 2W91A 5IW1A 3MRHA 4HKJA 2XWTB 2DQHH 3QEUB 5FF6B 1ZVSB 1P7HL 3MRBB 3ZGHA 1KY6A 5AOLA 4KNTA 3B2UC 4ODVH 2COVD 3IWUA 5J9PA 1YPZF 4XOBA 1HAUA 3QXWA 3ZL4L 4KK5D 2JKRM 5F88B 3NN8A 3D6GA 3OR7A 2W60B 5F6IB 4HGKC 4PV8B 1AZBA 3QDGA 4WWOA 2ZXEB 4EO5A 3GI9H 2AV1B 4JM2F 3KXFA 4PJ8C 1CFMA 1XCWA 2J8UE 4PBWD 5ICZA 3FTGA 3KH4A 3MLYH 1W0YT 3OWRA 2Y6SC 2KT6A 4AYFA 5E6YA 5DLML 1B9KA 5CS7A 1FHNA 2Y4SA 4KK9C 3ZDWA 1HXKA 3VG9C 4QHMA 3TVMB 5AZ2L 3ULVC 3PJLA 5D2NC 5I2IB 1OTUC 1FC2D 4KKCC 1BYPA 2PYEB 4RFEA 4NQDE 3QEQE 4AYID 2CLRA 3P3UA 5HYEA 3JWOL 1HDMA 1D9KC 2VLMD 3OAUH 1IEBB 4FNUA 1HIML 1INQB 1T7XA 1UWGH 4Y2DA 2BC4B 3QRLA 2YD3A 2MHAA 3M17B 1S6NA 4GINA 5IBUG 4F15C 3D08A 4F58L 1KCWA 2WJ7A 4RZCB 2PXYA 4QXGH 4P5MA 5E1AA 3MACL 2I07A 3LD8B 4HEPG 3HE7D 2HKHH 1U4FA 5JA8B 1CZ8H 3FQXB 3VGEA 3NAAH 4G9FA 1Y6NR 4QNPE 4XP5H 1M9WA 1N67A 1E5AA 2Z91A 1IGJA 4PWIA 5IQNA 1OAUH 4GBXC 2WKOF 5JHDA 4PJIA 4N2IA 3VCLB 2A0LD 1HHGA 2HFGH 5DD1H 2YRLA 2KPWA 1XH1A 4A7VA 2ADYA 4H26A 1DLHA 2K7QA 4PVLA 3OKLB 1LO2L 1E4WL 1Q1JL 4ERSL 2O6PA 5AW3B 4AEHH 1A4AA 1AS8A 2YARA 4TRPL 3FU5A 4IRJC 3D69B 4APQC 5EORL 3OSKA 3QZWG 4YSQA 5HYQB 1WBZB 3BMVA 4M43L 3OMIB 4DGYL 2JJTA 3TESA 3FB7B 3DNKA 2V9UA 4JFUA 5HHVH 3OAYH 1VF5C 2CGRL 5GPRA 3QQ3A 5C09A 4AITA 5I5RA 1YN7B 2H1PH 1Q72L 4NC1E 5ENWB 5AUMA 4YHMH 5F7YC 3W9DA 5JW3L 1DQMH 2VMFA 4KUCD 3S96B 5HDBF 4YSRA 4MA3B 2IGTA 1RJZB 2CJ3A 3FB8B 5E6RB 4RSVA 1NDGB 1JWUA 1JXJA 3LN4A 5EUOA 4LCWE 2DBLH 2W65A 1HCZA 4LCIL 3ZZQA 4IEFB 4LLVB 4L2YA 2J7LA 2B8OT 2PYFB 2EP6A 3ESPA 2LE9A 4KU1A 2K70A 1S7TB 3OSVA 1D6VL 3RL2B 2Q7NA 4Y4HD 1FP5A 5L7XL 1ZS2A 1H3UA 1NBZA 4YDLB 3EH1A 1LEKA 2WKGA 1D7DA 2P80A 4BCXA 4OLUH 3W11C 4OLZL 5MP6H 1RCYA 4MJIE 3ISRA 2Z8RA 4TLUA 2FX8H 4NCDA 2YXFA 1U8MB 3HHSA 5K5YA 5HXMA 2NNRA 3N42F 3PCYA 1WGOA 1XGRA 2D31A 3D3VE 4PJDB 3CZJA 4AYMC 3VI3B 2BSSA 3GDCA 5L2KD 3K71A 4ZUVB 4LOVA 12E8H 4HGMA 3BKMH 3SE6A 4YDMA 3TV8A 2YGNA 4AE0A 3QHFH 3CGTA 4K5PA 3TYGL 5B1BB 4LCYB 1J9QA 3DUHA 2R23B 1URZA 4ZMXA 1HH9B 1TXKA 3IDIB 4FMFA 2ZSVA 3O81A 4FXGA 5F44A 3V95A 3J07A 4Q9RH 3SGJA 5I1EH 5J13C 1A6ZB 4UYPA 1FZJA 4F37F 3RIFF 1JGDB 5F3HB 1TTAA 3TBYB 1OSZA 4EOWL 4RX4A 4P3CH 1OE2A 6FABL 3RP1A 3BWAB 5HHPB 1A6VH 2OMYB 4B96A 3SCMA 2F58L 5D4IA 4FJ6A 1LE5A 1CLZH 5B1JA 4ZS7H 3RWHB 5IKCB 5DZAA 1FL5B 4NPYB 4O2EB 3VUAA 4B53A 3QAQA 1XCXA 3VM7A 5T3XE 5I6XB 2FQEA 5M7QA 1QLRB 3HI1B 1T6VN 3VFPA 1XGPB 3GXTA 2X9YA 3GMLA 3GRBA 3X2QB 5CLTA 2A9DA 4ZJ9A 3ZIYA 1L9OA 2E6QA 1KBGL 4N2CA 1UWEL 2PW2A 4O58H 4LHUD 3CBKB 3AMLA 4UQ9A 3MV9D 4CVXB 2M1KA 1HSAA 3FL7A 1MPAL 4XP6L 3N85H 5JR1H 1YN6B 4LRNL 3QUXB 4NDMB 4LFHD 2I25N 3MXWL 1OGTA 1HQRB 4LL4A 2XY1A 4B60A 5GS0D 1HCVA 1B3IA 1RZFH 5CSBA 3V2AR 3KEHA 3WE1A 3L08A 4BKSC 4DT2A 3PWLB 1F2QA 4J3WA 1YJDL 4ZDHA 4DWHA 4XN8A 4NO2B 2BNRA 3B43A 3HA0A 3QRGL 3CDFA 4RMVA 3PL6C 1F4WL 4YMPA 4N90E 4BE6A 5B3JE 4BSWB 2X12A 1CN4A 3VSUA 4PGDA 1XEDA 2OQJB 4CSSA 5CP7A 2F1EA 5GGVY 4L2LA 4TM9A 1FL6A 3O41A 1WF5A 4F7PA 2AJVL 3II2A 2H0EA 2VC2L 4OFIA 4L0YA 5D1XB 3JVGA 3VU1A 3TM6A 5DVPA 1U8IA 3S3SA 2PYEE 3ARXA 3RFZA 2GBUA 3UO1H 1KPUB 2AXWA 3TT1H 4OBSA 4PBVC 5F7LB 4YBLB 3CX5K 5KUKA 2PCFB 1FN4B 1NGPH 4JANA 2V2WB 5SWSD 2EQDA 1EH9A 2Y3AA 4CA4A 1OP5K 1NGZA 1A5FH 4FNLL 1HNGA 1T83C 4MQ7B 4LLMA 4P48A 1I8KA 4NKMA 1G5AA 1HHJA 4PJCE 3VDCA 3OJDA 3GSVB 1A9EA 3VWKA 1JP5A 4UZGA 4UB0H 2GW5A 1ZHLA 2P5EB 4NENA 4TSBH 3QRFM 5T1DL 2RACA 5EC2B 1Q94A 3DO7A 1DUYA 2D9QB 1NUNB 3JWOC 1NDMA 2TAAA 2VXUL 2CIIA 3FXIC 3RNKA 4AQEB 2OMWB 4K3JH 3GGWB 3RY5A 1GIGL 3DGGA 4MRCA 1AP2B 1K3IA 4MB1A 4HKXA 3RUGF 4K7PY 1GJIA 2W9EH 1EQWA 1VB9A 1BPLB 4N8UA 5JXEC 4XNXL 4JVWA 4K3HA 5TH2A 3VYPA 3SDXF 2ZOLB 4MVBD 4PJHA 5L2JB 3I9AA 4U1MA 3O4OC 1AMXA 1ND0B 3KL0A 3WS6C 4LFHG 4GOSA 2AJUL 4N0UA 3RLSA 3WOVA 2AQQA 3ZKQD 3CLEH 1LILA 1PG7H 2Z31C 3DIFA 3DO4A 5FYLD 4HJSA 4JPKL 3WFHA 4DZBA 4F8QA 1P9MC 4HIXH 3SDDA 4Z7WB 3COOA 2AK1H 4HHWA 4TVPE 3RRQA 1QFWH 1I3VA 4NM8H 1TJMA 2IH1A 4WFHD 3NFNA 4M9PA 4YXKH 1V05A 3SBWC 3PS6A 1MVYA 3U30C 4PJ9D 1EIBA 4GSUA 1WZ1H 3EUDA 1URLA 4JZOB 1E9OB 5DTFB 3D5OF 4PTTA 3IMRA 2F19L 4P46B 2YUXA 3CHRA 4FHKA 3QWNA 2YPLB 4KK8D 4MKTA 1JYNA 5FLVA 1EFXD 1U21A 4YK4C 1YQVL 1AD0A 4XMLH 1FZOB 1D5ZA 3OKEB 3ILQC 3RVTC 5I5IA 3B6SA 3TJEH 4PP2A 2D8KA 1S7UB 4BRJA 2O1AA 2QV4A 2E8ZA 4CADA 3D06A 2HVKB 2WSKA 1JI1A 3FFDB 2X38A 1HOCA 1HX0A 2MCG1 2X70B 3QWRA 3D39B 1J8SA 4PWJA 2X53A 3SODB 2H41A 4UOJA 2X4NA 4OD1H 1J9SA 3HKFA 5D93B 3IU4H 1KBBA 4A2GA 1Z32X 4PJDE 4JFDD 3VI3E 5LBSH 1P7QB 4HBCL 5GS3A 4IKIA 4GXFA 4A2HA 5DMIL 3KBHE 5PAZA 5GGSY 4NKOA 4ELKB 1AR2A 5DD6A 4YR6A 4NHCL 3VFGH 4NAQA 4EIBA 1NFDE 2I69A 5EZPA 4ZMQA 3MA7B 1GS7A 3GMOA 4H1LG 3EO1A 3ZDZB 4OZFH 4GSRA 3P11H 3SGEI 3SO3C 1QW9A 4JR9L 2PO6C 4WU7A 4LVHC 3DVFA 1U91B 3KPSB 3C9NB 2NXYD 3AG2B 3UC2A 3LS5H 1U3NA 3BSZH 4KV5F 3MODH 2ZWSA 2P9RA 2ZJSH 2KLTA 3FZUD 5I6PA 1F97A 1HHKA 3FCTB 3O3EA 4KTEH 2DLIA 4DUXA 2GKIA 1J0IA 2XWXA 1KXTB 1XCQB 5K1VA 4D0DB 2J20A 4P57B 1K4CB 3AADB 3IXAA 5E2WL 1BA9A 4LIQE 5I8EA 4AEIH 5TE6H 5T33L 2E47A 4QO1A 1TNNA 2WWKO 3KPPB 2YPKB 4Y16D 2C7UA 2APVA 5HSFA 2ZWNA 2ZPKL 5BJTB 1IBHA 3ULSA 2VW6A 3S3JA 2MSPA 2JLLA 3L8QA 3QHTC 4HJ1A 4Q2ZA 3VFWB 4CMHC 1OP5H 3IDXL 2A4CA 4FP8L 2F5AL 3EBAA 3H56A 1AR1D 3EOBB 3QG6B 3O3BA 1QYGL 4AM0A 4S2SB 4F8LA 2ZNWA 3TBWA 1IKNC 2DEWX 3LMJH 4PQXA 5F89B 4QWWC 4GSDL 1PG7X 1BVLA 3INUL 4D9LL 2QPEB 3DROA 2OLDA 5KTEL 2XPGA 5I18L 2WXOA 2FIKA 4E9RA 1M7DB 4ZXBD 4I9WD 5B1KA 5KYWB 5CGTA 2VJ0A 3GZPA 1TNMA 1I3RB 3L4TA 5D6CA 4L8CA 4X6CB 4OCYH 1M1XB 4ZG1A 4WW2A 2ZKHH 2J8UA 2Q0ZX 3HC3H 4H0HB 2P4AB 3MRRA 4PJAE 4G8EB 5D1XE 2DI9A 2CRYA 1TZAA 2GT9A 3NCMA 3KVDD 4WK4B 4F2ME 5HYJB 2Z0UA 4L8SC 1VFBB 1YJDC 1NANI 5A2LH 1NLDH 3IRZA 4OF8A 2G75A 5GGVL 4DKDC 1F18A 3HNSH 5TK4A 4CBPA 3HPLB 4QTHB 1IVLA 3PQYD 3STBA 2X4QB 4NQDA 3QEQA 4MJ2A 3VJ6A 2Y2WA 1OE3A 1GGCL 1M9SA 2ARJB 4HLZH 4X9IA 2JIXB 4C8XA 5IF0A 1IC1A 2NX5E 4RGNC 4RMRA 2DD8L 3VXRD 2XACC 3OB0K 2EICA 4W4OC 2HKFL 2C1PB 1E30A 2MQCA 3MNDA 5K69A 5DEZA 2EDNA 5JPNB 4HKZA 4BD4A 3Q3GB 3QHZL 5LG6A 4U1NB 2WXRA 4KJPD 3NCJH 4Y5VB 2QGEA 3MCG1 1NWPA 2XV3A 4MMXC 4XMVA 5CEZD 2NZ9D 4OLXL 5DZNA 1WA0X 4YGAB 2HT2C 1J48A 3U1PA 1KBKA 4BZ1A 2J3SA 3U0WL 1QSFD 3EHBB 3ZTDC 1Q0XL 4NGHH 2XX0A 1KCRH 3QI9A 4DKEH 4PM1A 3RWIB 5KYXB 2AKRA 2QKSA 2OMNA 4QJ3B 2IH8A 3FT2B 3WNOA 4K7PL 15C8H 1N70A 3AM8C 4XOCA 4BK8A 1E90A 1W8NA 4GG8B 3T4YA 3FRPB 2W95A 4PRPB 4L5FL 5E6UB 2XFGB 2EDJA 3TEXA 1ZAGA 5F9WC 3AACA 5HI3C 5KANI 1S5HA 5CMAB 1MFNA 3GQFA 4RBPK 3VSQA 3QPXL 3BFWA 4MB4A 1YEDB 5KVGL 3KLHD 3FB6B 1MNUL 2YGQA 2NY0D 2K3TA 3TLRA 3IRCA 1SHWA 1UADC 2YPLE 4AG4L 1CLOH 1E28A 1BM3L 3Q5OA 1KFAH 3U83A 4LCWA 1N64L 3HBGA 4L4TB 4KK6D 2ZKWA 4OJEH 3ARFD 2ROXA 3MV11 4WQOA 2D2OA 4M7LH 2NY3B 4X98A 1H5BC 4ZPVB 5CJ5A 5DZ9A 2AK4D 4UQIM 4Y5YA 3W39B 1F02I 3D39E 2BVPB 4HC1H 1OCWL 4EDWL 3B9EA 4NQCB 5IROD 1KYDA 5I1GL 1ROCA 3E9UA 4MJIA 1Y0LB 4CNIA 1JFQL 5GGTA 4ABUA 4UIMA 1RK0A 1YEFH 3QUYD 4M5YH 4FD0A 4TNWK 4U1IA 3MLPA 3GO1H 1L9SA 1GY1A 2JELL 3CXDH 3D3VA 3K2IA 1G84A 2ID5A 4OFYA 3VTAA 2PR4H 4XH2A 5CJQL 2IF7A 3K74B 4FFTA 2D7MA 2DLHA 5EOCL 2V2XB 3IFOB 2X2YA 4XAWH 3KLAB 3RI5F 3G3LA 1HSBB 2HLFD 1GS6X 1UURA 2JKWA 4UM9D 3KGTA 5ADOH 3ULUD 3KE0A 5D7HA 4R0LC 2ZAIA 5D7KE 5TK2A 4PGJA 4U3SA 3QNZB 1JV5A 4PJIF 5C9JB 2W38A 3KPSE 1ZD6A 1UOLA 2GUYA 4ZMTA 4B5ZA 4EF3A 1FAIL 4EZKA 3MUY1 1GZQB 3DBXA 4MBRA 5KJRH 4N5EC 4LVNC 3O9WB 3RIAK 1PU0A 4XB7A 2CBOA 1OP4A 2WMPB 3ZDXF 4M7ZC 1WHOA 5AVQB 2BY3A 1I9RL 4AXWA 2GC4C 5IB3A 4XPAL 5EZLA 5F3BA 1OO2A 1E6OH 2O5NA 1DJSA 4BHUA 4LPUA 4ZOAA 2C9AA 1UA7A 1ZA6A 4IYKA 3OR6A 1AY1H 1NCAH 4WNSA 4YFLF 1FE8H 3QWOB 4D8PA 2UUDK 3C2AH 4EDXB 2EVHA 1CDIA 5BXFB 3MKGA 3FUIA 5K1NA 2ZKXA 4O02H 4WTZG 1XIWA 3DLQR 4E41D 4MTMA 5EUOF 5KN5A 5I16A 1D3CA 4X0KB 4YEFA 2Q10A 1WC7A 4H44C 2VIRB 1B0GA 1FNHA 2DQTL 4DTGH 3I75B 3OB0H 3UYRL 3TCLB 5FF6A 2XWTA 3QEUA 4OZFB 4FQXB 1G9MH 1GC1L 2HJKB 1OAQH 3MRBA 4GY4A 3MA9L 1KXHA 2OKMA 4TLKA 4OSUH 1PZCA 4FFZH 3D0AA 1JPTH 2DDQL 2ZTBA 4JKPL 3FAXA 3P4OA 4GUCA 3K3QA 5E2UH 4RMSA 3AZUA 2NCMA 4PV8A 1XB8A 3MOBH 3KYMA 5GS2H 4FYRA 1VZGA 2AQ1A 5EO9B 2AV1A 1N26A 4JHVA 3WXWL 4NRYB 2Y06H 3RA7H 3ATBA 5E6SB 2I85A 3STLB 5HYJE 4ZS6C 2DLEA 5D72H 3HG5A 2X4SB 3FN3A 1HEJC 3TVMA 3CC1A 1ZLEA 4RBPH 3PP3K 1JHKL 2PYEA 3LS4H 4WSGA 2KL6A 4LCUB 4KKQA 2CG9X 3KPRE 3QORC 3TN0B 2E9IA 3NJVA 1IEBA 1KELL 1I82A 2XUWA 4RWYH 1INQA 2APXA 5IQOA 1SHSA 3KL3A 2BC4A 5EOTB 3NK3A 3M17A 4JM2C 2NYKA 4JHBA 4KQ3H 3LRHA 4RZCA 3CG8A 2CJSA 4PI0A 4ZAKD 3UTTB 1JS4A 3N44B 3T8XA 2DQFA 5AB1A 1EBAA 3EBHA 1KTJA 3L4VA 2DLFL 4OB5H 3RGVC 3FQXA 1AI1H 1AYRA 1BD2D 4PJCA 2IG2L 4FFWC 4U31A 4YDIH 3RY6C 1JRHH 4FQQA 3DOIA 1CFVL 5DHDA 2DMBA 1R3KB 3QIBB 1WFTA 2AQ2A 3EXJA 5C0DB 1MVFA 4JM4H 2AVFA 1NCHA 2GY5A 3VCLA 3MV01 1ECZA 4AYEC 1S9WB 3HNVL 2H2PD 4BFOA 3OKLA 4LL9A 3JT2A 1NMAL 4M4PA 4X6FB 1CXEA 4PWKA 4KROD 2FJFA 4E5XG 4KGJA 3D69A 3B5TA 4JRFA 4PRPE 3DTUB 4Y4FD 5HYQA 3LRKA 2LLNA 1WBZA 1MFDL 2CCVA 1DSWA 5KWYC 1ZLUK 1IM9D 3FB7A 1SLWA 5IP4A 5TGBB 1XSIA 1YN7A 1B2YA 5ENWA 4H8WH 2R0ZH 1FLRL 4X4YB 1BZQK 5FUZL 1QHOA 4TNVK 3S96A 2PF6A 3LQAL 4MA3A 4XXWC 3U4KA 1E42A 4MAYC 1RJZA 3FB8A 1EGJA 1NDGA 3S3DB 2OMTB 2YO3A 4NO0B 4L4TE 3EYSL 4QRUB 4IEFA 4X7CC 2QVKA 5KJ7E 1JTPA 5I1LB 2PYFA 3WTYA 5JA9A 1WITA 1S7TA 4HIEA 2VRAA 3IFPB 1ZDSA 4K8RD 1NUFA 2P8PB 1TU2B 5B3NA 5JPMC 3O11B 2WWMD 4I0PC 4XZ4A 5D7JC 1X5MA 2EDEA 3DGDA 5AVRB 1AH1A 3DVNB 2VXSH 4NQCE 5CJOL 5SX5K 1YMMB 3N9GL 4LRIA 2WUBL 2XN2A 2UUDH 5DK2B 3G6DH 2NR6C 4PJDA 5MI0B 2OYKA 3GSXB 3VI3A 5D7IB 1TJIL 5HVHC 1M1SA 2K0RA 2G60H 1FSKC 1VKXA 4PTUB 3T0BA 3S35H 3BRDA 4OQ1A 4S1QH 1NFDA 2EDQA 4LCYA 2R23A 3GLDA 3MGTB 5D55A 1FRGL 4NNPL 1HH9A 3IDIA 5E5UB 4Z3JA 4TUOA 2EO1A 4BA8A 1SOSA 2HH0L 5CLZA 1A6ZA 2VLKB 1JGDA 4FZ8L 5F3HA 4GI6A 4ABVA 1CGVA 1EJOH 1RKRA 3TBYA 5AB9A 1J5OH 3LXAA 1MJUL 3Q6GL 4MCZB 5HHPA 3IDJA 3ZQXA 1AKPA 2HA1A 3MCYA 2OMYA 4L3EB 1JZ2A 4PJHF 3ZR5A 5DO8A 1VEOA 2HX7A 1SDDB 5IKCA 2WVSA 1AHWB 4O2EA 4PLNC 5ABDE 4FI7A 3IT8D 3SPGA 1JPSL 2B59B 4XHQA 2C5DC 4IRSD 3AWGA 3I6SA 5DFAA 4Z7OE 3MLTB 1BREA 1EO5A 3HE7C 4TYUA 3FQRB 4AZ8B 2AANA 4H8QA 4PLJC 2CHNA 4AQ8C 3EO9L 1ZHBB 3FNKA 3PP3H 3LJ3A 3QO0B 1AZNA 3G5ZB 3LQMA 3QVAA 4I18B 3NJIA 4LSRL 4ES9A 3M7OA 3ZE2F 1ASPA 2ZUVA 1XF4B 2ZP8A 3UG3A 3CUPB 3VMNA 5DYOB 1RIUL 4CVXA 43CAB 5GJTL 4JG0L 1ORQB 1YN6A 5JW4R 1K3ZA 1WSST 2XYCA 3IGKA 5ADPL 3LKNB 3IJHB 5BMFL 1M56B 1HQRA 2UZXB 1BZ7B 1A8JH 4GUQA 4YSCA 1B0RB 1FG2B 1F13A 2IBBA 3TIDB 2YPVH 2FECI 3PWLA 4Z0BL 4X6BB 4JW3A 4NO2A 1TSHA 2DM4A 2VDRH 4ZOCA 1FNSH 2R0KH 5IJBC 1MQKL 2X4RB 5CSGA