2Y7MA

Structure of n-terminal domain of candida albicans als9-2 (pt derivative)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
300
structure length
300
Chain Sequence
MKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ-LIKE ALS9 PROTEIN
publication title Structural basis for the broad specificity to host-cell ligands by the pathogenic fungus Candida albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
total genus 70
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7mA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7mA02
3ASWA 4MBRA 2Y7NA 4F20A 3V10A 5CFAA 2YLHA 1N67A 4B60A 2Y7OA 2F68X 2F6AA 3IS1X 5IHWA 4F27A 4F1ZA 3IRZA 4JDZB 1R19A 3AU0A 4LEEA 2Z1PA 2RALA 4JE0A 5CF3A 4F24A 2Y7LA 2Y7MA 4LE8A 4JDZA 4MBOA 3IS0X 3AT0A 4B5ZA 2VR3A 1R17A 3IRPX 4LEBA
chains in the Genus database with same CATH superfamily
3KPOA 1E9QA 2X9YA 1FCGA 1QBLL 3HG4A 1ZLEA 4TVUA 5D9SA 5DTFB 2DMGA 1YJDC 2K6YA 1XGUA 3LZOA 3EDFA 1D2OA 3N9GL 1I3VA 3QZMA 1EFXA 3A4FA 3C9NB 3CFKB 3OKEB 5EC2B 3WJJA 3CH1B 4AJYV 5IB1B 3ULUC 1G1YA 1I1CA 1JZDC 1KZYA 4OIFA 3QQ9D 4UTBL 1NGQH 3SDDD 3TBSB 4JPQA 4M7JH 2GK0B 2VMDA 3VH8B 4DUWA 3O9WD 5EO1A 2C3VB 2OI9B 4XCNB 4XPFH 1X5IA 1SQMA 3C5SB 4ERSH 5AD0B 4Y1AA 4JVPA 5C9KA 1AG6A 3QEGH 3GBMH 4BYHA 4PV8B 3V0IA 4WFFD 1O7VA 3IJYB 3ZHNA 3MAWA 4U2ZA 3FTYA 5AB1A 2H3NB 3DX8B 3BWAB 4OJDH 3WEBA 2DKMA 1V3MA 1NGXA 5C0JA 3VE0B 4ODUB 2R4RL 4X6DA 3QA3B 3PHOB 5AUMA 5A2LH 2AF2A 3MREB 2Z31C 5EU3A 4YJZL 3EGDB 4OAWA 4V1DA 5KEZA 3BKYL 2XFXB 3DURA 3Q8CA 3MUY1 2GY5A 2FT7A 5D7JB 3WHXA 5J1TC 4PJFF 2FR4B 2H4EA 2FQFA 2JSFA 2WTRA 1VFBA 4QHMB 1HL9A 5D1QE 2QPEB 4NHUB 1RJZA 1II4E 3ZHKA 3FN9A 3UJJH 5D6CB 5AVXB 1DTUA 2Z31A 1WFMA 1B4JL 2D9QB 4LHQB 2PO6C 1R9FA 2I5YL 3O6KH 4NKMA 4E9TA 3US0A 5LVEA 1JCVA 1K3ZA 4HJIA 3QRLA 3T3PE 3LRSA 1XH3A 4K0OA 3CXHK 1KCRH 4U1SB 3BP6A 1KG0A 4J8RA 5FW6A 2WTOA 3U7WH 1KBVA 4OI8A 4OLYL 2H3XC 1F6LL 3ZE0F 2P5WB 4GFXA 3MV8D 5E8OB 2O61A 1R6VA 1I3UA 2VDML 3HG3A 2EKSB 4G8GA 1KACB 4XBMA 1JK9A 4PM1A 4KPHL 4FFVD 1CTNA 1KCUH 4FE9A 1TLKA 4HQQH 4S1SH 4BHUA 5J11C 3VXSA 4UDTB 1MQ8A 3OPZH 4Z76A 4OCSL 2YEQA 3DX9A 5ID1A 3WE6B 2F7IA 1FFNA 2JK5A 4OM1L 3LQMA 3ZMRA 5IEKB 4N0YH 4IEFA 4B97A 4XNQB 2BOBB 4YC2C 4ZUUB 5AVSB 3VB8A 3GM0A 3OXRA 2YPLE 1VPOL 3I75B 3IU4L 2LVCA 3WFEL 3FU7B 3BGMA 5FUZL 5BZWA 2YXWA 1JERA 5E03A 1SXBA 2ZF8A 2CZNA 3SDYL 1KJMB 3QORC 2WSDA 1AHWA 3NCWA 3OJVC 4GMSH 4N6QA 3RZCB 3WIHL 5C0DA 3O41B 1UWEL 3L3IA 2XX1A 4XNBA 5F7LB 2CCLA 4ZTPH 4M8RA 1A6UL 1U8NA 1N0XH 4X5PA 1DVUA 4GQRA 4H8PA 1B88A 5DJCA 2CK0L 4PWGA 3CSPA 4RDQF 5BJTA 4OI7A 2E75C 1HAWA 4CVZB 1A3LL 3U0TB 4JFHE 4YGVB 1FNAA 4LSSH 4DP7X 4PJBE 3SN6N 3TT3L 1HXYB 3BZDA 4YDVA 5IQ9A 1WQVT 2B20A 1BEYL 4PREA 2QADB 2QZ5A 1S7UB 3VRJA 1RULH 3BH8A 2QLYA 2GSIB 5FYLL 4QLWA 3MX0A 1JZ5A 1F00I 2EDFA 1C12B 5C2BH 3JTTA 2I85A 1I7UA 3TN0C 5AOLA 4PW4A 1JWMA 3IMTA 4G43A 3RYMA 4R9HA 1GRWA 2D2OA 4UTCA 5F1OB 1MJ7L 4U4IA 2WVUA 5IGXH 1WT5A 1ZK5A 1FVEB 3UBHA 1INQB 4DW2H 4PIRF 2ZE0A 3A6CH 3MRKB 1CPUA 1IGTB 4G82A 3KW8A 5J5EA 2QQLL 2BIHA 3MFFA 1D5XA 4IBTA 5B38G 4HJEA 2NY4C 3AS1A 4PY7B 3IDMB 4UM9B 1P7QB 1WZLA 3OZ9L 1UM4L 1LK3H 5FF6A 2CLRA 3KXFE 3PABA 1KNOB 1TNNA 3KVPA 3V8CA 3UH8A 2E3VA 3U1SH 4Y2OB 4AYSA 3BJ91 3EOBB 4H8VA 1MCJA 1E4JA 2DTMH 1MEXH 2NCEA 1AACA 1RLWA 2JKNA 3H9SB 4LCUA 1TLMA 5FCUH 1J10A 4LCYA 1LWRA 2H32B 4RSYA 2YPVH 4BFBD 2CNZA 4BZ2A 4G2AA 4P3DA 5KVDE 1JK8B 3VSVA 2OBGA 5A2JH 3BIBX 1T2QH 3ZL4H 3NTCH 1TQUA 5M7QA 5DFWH 2O5YH 3APDA 4LLVA 4XT1C 4Y1AE 3O2WH 1Z9NA 4A63A 3LZNA 3HPJA 5F88B 1OAXL 1T2XA 5L2KD 2B1AH 3QG7H 4FQQB 4NWUL 3E1F1 1S9WB 1TCRB 3QFJB 2GBTA 3UBGA 3OKKB 4PBVC 1WBXA 2IAMA 3K8MA 2M83A 1N5YH 5E6IC 2HRHA 1KBKA 2VDOH 1UTDA 3Q6GH 3DNKA 4F2MB 3VX1A 4LPCA 4XO4A 3GSVB 2YUXA 4QXVA 3VD4A 2FX9H 2NYYD 3SDXE 1OK0A 1MCEA 4V1DE 2WNGA 2OTWB 4Z18A 5IG7A 2V5TA 3BAXA 4HJUA 4JE0A 3VCLB 2XN9B 3A0OA 3QO0B 1TG8A 4GRLA 2Y5TA 3D9AH 4IBZA 1S8DA 1XH0A 5F9DC 1RL1A 2QQQA 2E7LC 3TBCA 3P9WB 5DLMH 3BP7B 1JXKA 2BX5A 5ADPL 1RUQH 4ZUTA 5BQDA 1R3JA 3HLAA 2F58H 3UBXB 1Z1WA 2YLHA 4H2CA 1KGXA 1NBQA 3ARED 4FRWA 4L3EE 4AZUA 3VFSB 4AGMA 4LQFL 4KVPA 1OM3L 2VR9A 4BFRA 1MFAL 5AAMA 1ET5A 1AAJA 2Z1KA 4NZRH 5D7KD 1CGUA 2NY7H 3H2PA 3JQOB 3SYCA 2HTLC 3V9CA 5EDSA 1TJIL 5DVOA 1NCGA 4U3XA 4XCCH 3A67H 3M07A 2HRPH 2IVFC 4HS3B 1RPUA 1NBVL 3UC0H 1ADQH 3PIQA 4FFZA 2XRAL 4JVUA 4HT1L 3QIUC 1UOWA 3TFKD 2ZNXA 1P2CA 4Y88A 3B9EA 3UTQA 5GIRB 3ZKND 4ZMZA 5BVJB 4GSRA 1WFTA 1INDL 3Q44A 1B2WL 1QA9B 5HYSB 2Q86A 4Y8DC 4GT7A 4BHUI 5KZCB 4YNYB 3WEXB 1IAOB 5EO9A 5FCSH 4OB5L 3H56A 4PJ5A 2NZIA 1VRSA 5B8CB 2EDXA 4FZ8L 2RH0A 2IMNA 1Y7VA 5IQMA 5DQ9A 3EO0B 1EAPB 1QFWI 2PP7A 3J8F7 5FW8A 2J4WH 2BRQA 5LCVH 3O2VH 4NZFA 4AIXA 4OFIA 4LQ1A 3VGHA 3TWCL 1OM9A 4QRRB 5CU9A 5F9JB 3F2LA 3DOSB 4I3RL 1IV8A 1JJUA 2WXGA 4PG2C 4K71B 4WKZA 3MBEC 4FI6A 4P23B 2RGSA 4M61A 3VGGA 1KLUB 2A5UA 2DQFB 4U1IA 4UV4H 1NLBL 3EZJB 2HPOA 5IMLA 3QYCA 1OGSA 5BW7A 4JPKH 4E9XA 3AMLA 3L3HA 3WFCL 4WU7A 2P52A 5CP7A 2OMXB 2BHZA 3CN4A 3MZGB 1IU1A 4PG2A 2WXFA 4JUSA 4GKZA 2Q3XA 3GJEA 3CDCA 4NZJA 4PJAE 2NNAA 4QHNB 4U3CA 3FQXB 5LBSH 1YNTA 3A21A 5LNEA 1TVBB 1IM9D 5AKVA 4UIKH 2AJZA 1YYMH 3RZWA 5LQBL 3Q06A 2ZCLH 4BFKA 1CU4L 4DGIH 1MHPH 2YC1A 3S5ZA 4O2CB 2NOYA 2R0LL 1G9MH 4P9HH 5I66A 5FX3A 1SGKA 4H8HA 1TT6A 1P7KB 4KFZC 5KYYB 2IXQB 5F8QC 1L6PA 5ID0A 3IXTA 2A9NH 5TE6L 3UADA 1S9VB 4JCMA 3F7YB 4OCWL 4IJ3B 3D7PA 1G7LB 4NO2A 4GSQA 2BJML 3ZDZB 4CBPA 3FAWA 2C9UA 1QNZH 4MJJA 3W9EB 4WK2B 4NPYA 2FIKB 5J1AA 1OO2A 2X6BA 3DVGB 4QOKB 4JW3A 3LPWA 4JX0A 2G2NA 1J8HA 1EZVY 2QZQA 4L2LA 3BESR 5ES4B 1PDKA 1IM3B 5DCCA 5AFAA 3VD1A 1JUFA 3NJHA 4MSWA 1XB3A 2DKSA 5DRZA 1S9XB 5I6MA 3CC1A 1PD6A 4GXUM 1CXKA 1E65A 1WBYA 5I75B 1FRGH 1JPTH 2D7OA 5FHBL 3SJVB 2EDOA 3EJUA 3UYPA 4IKIA 2Y7QA 4ZD3H 2XZAL 2JJUA 1IAMA 2CO2A 4ZFGH 1NMCB 4LHUG 2WHVA 1H8LA 4W70A 4JFPA 4L4VB 1CLZH 3GBNH 3GO1L 3U36B 3PREA 3WD5L 5I5MA 4AKQA 1TEFA 3L1EA 4QPEA 5IMKA 1BWWA 3PJLA 3S4SA 1MFDH 4KVCH 5EEWA 3BQUD 2IOMA 4FJYA 3LB6C 4B7LA 1S9YB 1J1PL 3D87B 5I8KL 4MCZA 4NQSB 2JE8A 1OP3H 1TPXC 3MXVL 4WNQA 4YS4A 2VJ8A 5GSVA 3QE5A 3SOTA 2XT1B 2WJ7A 1Y18B 5DWPA 5B39G 1GPOL 5I18H 5CEZH 4Q4EA 3LN4A 5C0AB 3TT1L 1U8HA 2ALWA 2CDFB 2C1OB 3B1UA 3HG1A 4PU2A 4LMQE 2A0LD 5AVZB 3CU1A 4LVHC 2ZPKH 1RUKL 2UYLA 2X4SB 1B2YA 1DBBH 3KS0J 2WYZA 1QRNE 4NHCL 3MR9B 4Y19D 2VZVA 4J4PD 2OYLA 1SJHB 2P80D 3NRQA 3ZKMC 3O0RL 3UYOD 1ASQA 2NY0D 4XN5A 4YVNA 4R0LC 1OAQH 2EXYD 2VDPH 4GKSB 1AZUA 4HXAL 3DPBB 2R8SH 3LEYL 3OKMB 3QJOA 4OFPA 4GW1B 3LPGA 4PGBB 2Z7YA 1H0DB 3PHAA 3FBKA 1PMYA 5KUMA 1AZCA 3W11D 1R3LA 2Y07L 2FE0A 3RLSA 4J6RL 4DZBA 1VGKB 3JWNG 5D55A 1KC5L 3BKMH 2PPFA 2AVGA 3GUFA 3C60C 4JY6A 5BV7C 3LS4L 2R1WA 4AUYA 2VDLL 5IW6A 2LU3A 3I9GH 2XG4A 4EI5D 4GINA 2D7TH 1SXSA 3SCMD 1XEDA 3R1GL 4KRPC 1HOEA 4OCXL 5DMGC 1ZDSA 3AW5A 4ZW5A 2HJFB 2OZ4H 3PGDA 1G7HB 4GAAA 4BA0A 4PJ7A 2AXGA 3RJDA 4FI7A 4P4KC 3D07A 5MI0B 1VFAA 5AW0B 5E0FA 3E1ZA 1F3DH 3C60A 2EIDA 2OMUA 2G2PA 4YHIA 2V7HA 4OZ4A 5KN5B 4ODTH 1P6AB 1V7NL 4X98A 3W9DA 1CBVL 2H0JA 4K8RL 5I76A 1KB9K 2UY6B 2PCFB 2WO4A 3KW7A 1B0RB 2APFA 3P4MA 2BW5A 5CEXB 5HP5A 4GS7C 1WCBB 5HHMB 5HVWA 3QCVL 1EV2E 5FWQA 4ZMPA 4OGYH 5E2VH 1MAJA 2ZOKB 3TCXA 4WSGA 4XC3L 3ZRCC 4AITA 3KNBA 4ETQA 1T2JA 2BXZA 2RA1A 4TQEH 5ICYA 4KUZL 4H20L 3HC4H 1PZBA 3QZPA 2DLGA 5FYKL 3W56A 2BRRL 2PPEA 2KUTA 2DV6A 1MREH 2OCJA 4ORGB 1KY7A 3ARDA 1UXWA 1Z66A 5HDRA 1UXSB 5DJDB 5JXEC 2FO1A 5DZ9A 1BXUA 4XP9L 1E8ZA 1T5WB 1QP1A 2XYBA 4FFYL 4FKHA 3REWA 4P3CL 4NP4L 1Q72L 2DIJA 2Y9RT 5GRJL 4IBVA 1XWVA 2P7TA 3KLAB 2Y5QA 4LIQL 2B4CL 1WLHA 1OOWA 1N7MH 2HT3C 3GSRB 4R97C 4KZCA 3TC9A 1OCRB 2I60L 4OUUB 3V0JA 4AE0A 3VDBA 4BH8B 3VXTB 5JXEA 1N8ZA 1UZ8A 2R23A 3FB7A 1A1MA 5C07A 4JCWA 3OKDB 3BUYB 3D1MC 1MFUA 3AFLA 4PRDB 3GSUB 4XX1G 1J8HE 1SUHA 1I7ZA 3QPKA 4WSJA 1QASA 1CFVL 3DXAA 4B9FA 1BGXH 3ULVH 2YMXL 3ZW3A 2DW5A 1AGBA 2FJHA 1MUJA 1FORL 1PLGH 5JPMC 2WSKA 5IBUG 1OQOA 3CXHJ 3IDIA 5EB9A 3GSWB 2P5PA 2IG2L 3EGXA 4HS6B 5T3XH 1ZS8B 4KO9A 1OAUL 3FH7A 3X2QB 1TMQA 2XQBL 3K71A 2CLZA 5K9KB 3W81A 4P5TB 3MXWH 2FHCA 3D18A 4LSPL 2BZDA 1OGAE 1O0VA 4DIXA 1CC3A 1BIIB 5I1CL 3IDUA 4MJ6B 5E7BA 4F3FB 4XMLL 1IGMH 3MHZA 3FOLA 3MO1A 1W8OA 2PWDA 4OV5A 2VOTA 4OCLC 2VITA 4YSUA 4CJ1A 5E4AA 2QLVB 4HIQA 2V5MA 4K07A 1ZSDA 2ID5A 2X09A 3MNZA 4NNXA 4FKKA 2CA4A 3FHAA 3ZYOA 1XF2B 3QUZD 3A22A 4K4KA 2VUKA 4U0RB 5A6IA 2KHAA 3LH2H 3FF8A 3B6SA 2AK4B 5ERWA 4OGXH 3HG0A 1XGZA 2HUEA 4DOHE 1LEKA 1YC7A 3ZE1B 3PL6B 4ACPA 2EUZA 4XOEA 2BSDA 1N6QL 1FAIL 4WI2A 43CAB 3FQ1A 3HG1E 3RFZC 3TVMA 2BERA 3JWOH 1JGUH 1F13A 1MIEL 2AGJL 3E9UA 4FTDA 4PN6A 3T04D 1XL4A 1I4FB 4EIUA 3HR5B 1HCVA 3R06B 4HJ1A 4Q9QH 3L45A 1KBBA 1YEDB 5KSBB 3TBTB 1UWXH 3CLFL 4MZRA 3T65B 2IC2A 1S7RB 5D5MB 1JPSL 5AOIA 4JFFB 1FYTA 3P2BA 4KK5D 4ONFH 4U0QB 4Y4FC 1KENH 3O45A 1ZPLA 3MRNB 5I82A 3D51A 3RWIB 4DEWA 2LW3A 5E6RB 2UZXA 2ICEA 3HKZA 5LAXA 1IGIL 4GEIA 4I1PA 1OSPL 5E1AB 5DJAA 5DQDL 4ZFFB 1BA9A 2P26A 4PS7A 3SKNB 2PYEA 3MUGB 4AM0Q 2F1BA 4Z78B 3NCCB 1R3KB 4ZNEE 1XD1A 4IIQA 5ICZA 2XVBA 4KJQD 4WFHE 3TNNB 4GSUA 5HHOA 1R3HB 4WWKD 2DRUA 5HYJB 1NFDE 4M1DL 1JV5B 4QWWC 1EDHA 1AGEA 1NJ9A 2BLFA 1V55B 5LB1A 4ANXA 2QQKL 3F5WA 4GG8A 2WZPD 1C5CL 1MFEH 2JB6A 5BRQA 1P6FA 4WWPA 3MRMA 1IGCH 4V2CB 1E43A 2SEBB 4UINH 5DK0B 1ANUA 4ZPVA 3VWJC 1KFAL 4PJ7E 4FTVA 2CK2A 3UYRL 3STBA 4DP4X 3LN5A 2H6UA 5I73B 1E4WH 2L7JA 4TS6A 5KAQF 4WEBL 4PLKC 4RFNB 4HISA 4B95C 4EEEA 4U2YA 4R7NA 2GFBB 4L48A 2VDNH 3SE3C 3ZO9A 2CO6B 3N1MC 2OMWA 1HDMA 4LCWD 1L9SA 5ALBL 2OXHA 3K46A 4W9ZA 4XWOD 1T03H 5JHDB 1YG9A 1NM9A 4B9CA 4HD9A 3DRTA 1FCCA 2UZIH 1EHLL 2FJGA 4TUJB 3H42L 3GM8A 4PCSA 4IJTA 1FZKB 1A4CA 2EYRA 4WZ9A 4M5ZH 3ETBF 3O6FA 3VFTB 2BVQB 2R2EA 3ECVA 1EO8H 3RILA 4J2QA 4XMKL 3LNIA 3MCKB 4N0UB 2WZ0A 1LO3L 4BK8A 3DGGA 2N7SA 3CTTA 2GT9B 1T04A 5GGTL 4U1LA 3S2AA 1X9UA 1RJLA 1DVFA 2CO3A 4XRCB 1A4JB 3MODH 3RWDA 3MNDA 4Z8FH 1IBYA 4G6KH 1JGLH 5GS2H 4GY4A 3ZRFC 1VZGA 4AIZB 5IOPA 4U1MB 4L4JA 4CN4A 3B5GA 4I1NB 4X7DC 3C08L 1TU2B 2K1MA 2L4OA 2DLIA 1XBDA 3BZ4B 4TNWF 5E8NA 3F6LA 3T3ME 3K91A 1PIFA 5JIPA 3P9MB 1RZJL 3NP4A 3RGBA 1CL7L 3D0AA 4RA0C 4AGPA 4QF1B 5EA0H 4ODHH 5C07E 1VJSA 3QNZB 1T6WA 4ICXA 5T1KB 3OG4B 2N1KA 2WPGA 3FFCB 5G5DB 1F58L 3DXAE 2F19L 1G87A 3V55A 4B27A 4P2RE 2P3YA 4F7EA 4S1RL 1UA3A 3SQBB 2C4FU 3QJUB 4N0FA 2QDVA 1AP2B 4JKMA 1HHIB 4GW5B 1PYWB 1A6TA 1RU9H 2G4GA 1W0VA 2CBTA 5AKRA 4H8UA 1OALA 3SO3C 1BQHA 5KSVA 4OF8A 4IOSA 3L4ZA 2JF1A 4GXVL 1DZBA 1BFOA 3BX7C 4LRIA 4P49A 4HBCL 2PETA 3TNMA 2P5WD 3TA4D 4CBZA 2E56A 3RY4A 5LBVA 3EOTL 4GMTL 5EBMB 3P11H 5DUBA 5CKAA 5EZPA 4OTXH 3SGDI 1Q0XH 3SOBH 5HVFB 3DECA 1IZKA 4QT5B 3X3GL 3PNWB 2VDKB 3Q7JA 4FG2A 3GMQA 5TDPB 4XHJC 5FO7A 2VDKL 4ZW8A 1CTMA 2DTSA 3SQOH 2A6KB 1FGVL 2HYMA 4HCIA 5FDWA 1LEIB 3FUJA 2Z92A 3RUGF 1ADWA 5AKTA 4HIEA 1J8KA 4X4YA 4O02B 3IVKA 1YMMA 4JFEB 5ITBL 1SFDA 1FJ1B 2E27L 4O02L 5KW9H 1JZ3A 4XGZB 5MENB 4ODXB 3OHXB 3H3PH 3N43F 4G9DB 4F7TB 1IKFH 4GUPB 3GSXA 5MERB 1NAKH 5E24E 4FLSA 1WC7A 1JWSB 1F4HA 4DT2A 1LVEA 1VCBC 4KHXH 4TQPA 4AQAA 1FG9C 2FNWA 3Q0HA 4NWTH 4PJIE 43C9B 4G6AD 4C56E 5FUCE 4JFOB 5BOJA 1FYTE 2EXWC 3CGTA 4PRPB 1CDCA 1A7PH 4JM2F 4DGWC 1WE5A 5D1XA 2X0WA 5E5UB 1ETJA 3T6WA 4HOZA 4FABL 4PG9A 2PYEE 3T2LA 4MA8L 3IXAB 3KBPA 2Z91A 4NI6A 3M8OL 5GRUL 2WIMA 3U0WL 4ZDHB 4HMDA 5HHOE 4KZ0A 1KB3A 1DEEB 2CPCA 3LKOA 3NFPB 4YEEA 5AZEH 3ZHFA 4OBSA 3NZ8A 4A7QA 3VW3L 1B0GA 1SBBA 3UJIL 5BS0E 4HIHB 1SN5A 5CD3A 1ZT7A 3GMOB 5E23A 1J11A 3F12A 3TF4A 2ZUXA 4N8CL 2ZXCA 1GAFL 4XNXL 4YSDA 4GRMB 5I30H 1YEGL 5F0JB 3BRGC 1TIUA 2GUYA 2BHUA 3Q8BA 4UM9D 1P7QD 4IBYA 2NXZB 1CICB 2BOCB 5GZNC 2EAEA 4PS3A 2Q8AH 4TTGA 3ZX1A 4LGSB 5A2KH 5E56A 5IVZB 1U58B 1HT6A 1UD5A 4NSKA 1BFVH 4JFWA 4DUXA 4OIIL 1XIWA 4JDZB 1A66A 2EIBA 2ICES 3H9SD 2XKNB 4G8EB 5GGSY 4FQIL 3POHA 1LK2A 4U3SB 4X4MA 2Y7MA 3RURA 1IAIL 2VLKA 1KBPA 1BLNB 1CFQA 3RVUD 1F97A 5F89B 2EVHA 1IRAY 3DDGA 4NS0A 2DM7A 1A14H 2EZ0D 2O6DA 2OL3A 3BVTA 5C6TL 4MAUL 4GI9A 4ONGH 1HXMB 4HUKB 1F4YL 5T8IA 3AWEA 2UVFA 1LWHA 3GKWH 1BD2B 3HI1A 2EXSA 3TJHC 3TPKA 4YFEA 1DBAL 3HI6L 2H41A 4L1DA 4Y9BA 2R0ZL 4N68A 1AQKL 25C8L 3BIKB 4QXUL 4XP1L 2P5EE 4CMHB 1DBML 3QFJD 1PFOA 4I0PA 5CIPA 4X6EA 3VQ1C 2V0AA 1F90H 1I8AA 2N4IA 2V9QA 4XPBL 5B1JA 4A04A 2XACC 4Z7UB 1VAHA 5D1ZC 5FKPB 4BKLA 3B2XA 4IRJC 2AJVL 4OLEA 4XODA 3RL1B 4LSUH 3L6FB 1N9PA 4I89A 3GSNH 4WO4B 5J9PA 3KPRA 4TSBH 2YGQA 1X7TA 2JXMB 1K9TA 5TQ2L 1GJWA 3RA7H 3APCA 2XN9D 5AL0A 5BUAA 2DYSB 3CZJA 3UTOA 3T1WA 4OI9A 1TZOA 5HI4D 3FRUA 1OL0A 3OC8A 4LHUA 5EU7C 3IU3B 1QFUL 1FI8C 2BSRB 2VXQL 2YFNA 1KXQA 5I1AA 3SGEI 2WM0A 4QCIA 4J3TA 4KQ0A 1JHKL 3QXTA 3ZYZA 3K2IA 3X12B 4FQLH 1CURA 2BCKB 4R7LA 5DC9B 2MH4A 1KEML 1WZ1H 2DQJL 2W95A 4EUPB 1MF2L 1F8TL 4N22A 2R2BA 4NP9A 3KYKL 2AITA 1A4BA 2VDQH 3UTTA 2QGBA 3ASOB 3NFNA 2JKTM 4JNXA 5CINL 1WBZB 1JAEA 3ABGA 2YPKB 2OR7A 4YE0A 2EVFA 3CK0H 1YQ2A 2YJQA 5A7EA 3SDAB 1P9MC 1RIHH 3PFUA 1W80A 1BJ1H 3BT2L 4FADA 3LKSB 1AQ8A 3NACL 4EXPX 4R84A 3DROB 4YPGA 3KMDA 5K59E 1NCCL 4R7DA 1F4XL 3UTSB 1GYAA 4B9ZA 5JQ6H 3TX4A 4BFGA 2ZXBA 4WUUA 2GIYA 3PWUA 1MCHA 2AW2A 4JVWA 5KZCD 2DQUH 4EIGB 4FQ2H 3FQ4A 4OKVB 4AOFA 1P9MA 1QFHA 1NINA 2PKDA 3RTQB 3V52L 3T4AA 4A6YA 1XVSA 2D03H 3K6SB 1YNLL 3BPOB 5BQ7A 3BPLB 4I5BA 1X5FA 3ULVF 1ZPUA 4JRXE 4JJOA 1AANA 3GMPB 4IBWA 4M3KB 4KROC 4RISL 3S8GB 2R2HB 3D39B 2FJFA 4P99A 5AYUH 3UGEA 1VHPA 3NABL 4JO4L 1NGWB 2MCAA 3MTXA 4QRRD 3TO4B 4W81A 1E4XI 1KPRA 3WJMA 4MQTB 1KB9J 1PZ5B 4HV8B 5IK3A 1I8MA 2HH0L 4NNPL 1BPVA 1CE6A 4LK4A 5JHLL 2ICWJ 4JZOA 1AZNA 1D6VL 5D1XE 3TEWA 1CN4A 4P23D 1X5AA 3AC0A 4TYUA 2YEVB 2GBUA 1LO2L 3CFNA 2VCOA 3WAJA 4L8SA 2ZUQC 4JFQB 3BP5A 1QHPA 3HE6C 5T1MA 3LV3A 3QDJA 4F8LA 4UTAL 1H15B 4TPRL 4JUTA 5C8JA 5GGVL 4H8WH 5E1IA 2AV7A 2H6PB 2ZXGA 4P59L 3VXME 2E47A 2UWEA 3OR6A 4PMFA 1HIMH 1N12A 3ARFD 1MSPA 2BP8B 2O1AA 4PUBH 5EOTA 4F7MA 3GTTA 2HJKB 2PR4L 5IMMB 3IMRA 2BWIA 2ZOTA 1QATA 1BQRA 3MRPB 4YDMA 1KCSH 1LP9F 4PS4L 2N1TE 4K3DH 4G7YH 1IBZA 1LMIA 2Q7NA 1TXKA 4X0NA 5C08B 3LKQA 1WFNA 5E94B 1FVDB 3ZPDA 1FIEA 4YHML 1FL3A 1J9QA 1E8WA 2BVOB 4Y5VC 1FZMB 5DZPA 5F9WB 1QKZH 5SWSA 4FCHA 4YDLB 2NY6C 4NQDB 5HGGS 3B8YA 2OMTB 2MFNA 5HPOA 3ULAB 4I3GA 2M26A 3DV4A 3BEVA 1CG9B 1SUJA 1EUTA 1M42A 4QOKD 3B3IA 4YHPA 1MW2A 4HALA 1T7WA 4S1QH 1IZJA 1Q94A 5BMFH 2VLKE 1IM3D 2EYTB 4Y5VA 3H54A 3MNWA 3OSKA 4XAKD 5EOCL 5E2UL 5EO0A 4QR7A 3EYOB 1C08A 3FQUB 1IC7H 2G5BA 3CMOL 2E4FA 4K7FA 3SDDA 3VJ6B 2ZP9A 3O9WA 5I0VA 4HKBB 5KVGE 5KSAD 3WUZA 3QRBA 4P3WA 2XPGB 5FECA 3K74B 3SJVD 3D5OF 4FZEL 4EDXB 4IMLB 4MQSB 2DYPB 2NNFA 1S5IL 3KEHA 1OWRM 3N40P 3PHQA 1W6LA 3E8UH 3U2JA 3WXWL 4G1EA 2Z65C 4L4VD 3HNSL 4GQ9L 4BE5A 1PSKH 1YEFH 4QRPE 4M7LL 1U8KA 5I0DA 2FAUA 2R4SL 1XGTA 5CF3A 1M2VB 1S3RA 2FQGA 1EZUA 1NMAL 3TXAA 1I9RH 1JNLL 4D9LH 3TJEH 2YN5A 5DD6A 3TL5A 3DHMA 5DZNA 5D4QA 2LVEA 2VN3A 4L37B 4PRNB 5EU4A 1PL3A 3H53A 1MCCA 4NI3A 2Q7AA 5H2BB 4I48B 3U46A 4JE4B 1RPQA 4RGOH 4ZMVA 1RMFH 4XN4A 4ANUA 1NDMA 1AGCB 3QNYA 4PVNA 3RWCA 3ZQWA 3TYGL 3LVTA 2LTQB 2E7MA 2R69A 3UTTE 4HK0B 2ODIA 3ATBA 5AVUB 4N8VG 3UZVA 3DOIA 2FLRT 3MV8A 5CO1A 5DA0B 1MWAH 5DYOA 1DSYA 1UUNA 3QI9A 3ZRSA 4AJWA 1QBMH 2OXGA 3AU1B 3NCJH 1TFPA 5CCHE 1XB6A 3FMGL 4KDTC 5KVEH 1B4RA 2HFTA 1U0QA 4M6OH 5IUCA 4HK3N 2YRPA 1R33A 5K9JH 2JI3A 4BWTA 4WUUE 3MV7E 4YX2L 1KELL 4BSWA 3ZTEA 4QHKI 3HG5A 2LHAA 3N5AA 3U2SA 3B2MA 1XSKA 1E2ZA 5IR1A 1MFBH 3WL9B 4OF7A 2F1EA 3P30H 1V3JA 2ADFH 3OV6A 2W9LA 4GKOA 4J39A 3JTSB 4MJ2A 5TGBB 1TTGA 4BUQA 4RWYH 1FO0H 2HLFC 5DRNB 4LZKA 1K4DA 3BISA 1BVOA 2Z93B 3BEWB 4QTFA 5E6ZA 3MNMA 2NW3A 3DDFA 1G7IA 1KTLA 3JWNE 3Q8FA 4DTGL 3MRRA 4K7PY 3MRQA 1CGSH 3B5HA 1LJMA 3IDJA 3BH4A 1OLLA 5C7ZA 4HG4K 5A43C 5FKAB 2NLJA 1SZNA 1XAUA 3PWJA 4K8RD 1ADQA 4JHAL 4JKPH 3B43A 1U8JB 4RH4A 1HYRC 2VISA 4WI6A 1P84K 1FPTL 2AQSA 3LIZH 1QW9A 5IBTL 2V2XB 1XD0A 2IMMA 2LLNA 3FONA 5HHMD 4X7SH 5K1NA 2EUXA 4UNUA 1I9EA 5DSCB 2J8UE 1XDTT 3HZVA 3DUHA 3ELQA 3QDJE 4F9LA 5IMOB 5IJVA 5AEAA 4PWIA 1WTLA 5A16A 5SWQA 4FG0A 3S8WA 3V5DB 2UWEE 4HUWB 5DI8B 1COBA 1WHOA 2CJSA 2K70A 3COOA 3QDGB 2JB5H 1NAMH 1J0IA 1MLCB 4P46B 3OR7A 4KNSA 4MZ2A 4DVRH 3GFUA 5E1GA 2HLEB 4P57B 3FQWA 1CZ8H 2IDFA 2ENYA 1A7OH 2AP2A 2NCMA 3PDOA 4HUUB 3EZ8A 3VFOA 4KK8C 1FNSL 1B3IA 3GJFK 5DA4A 3CQQA 2PYFA 1YPZE 3FQ2A 5F3HA 3C8KA 3RX7A 2WKGA 1GKEA 1JPFA 4JQIH 5INCA 3OGCB 1K8IB 2OR9H 2YAMA 4DGVH 3EJRA 4ENZA 4OUOA 5JHMA 1TOXA 5F3FA 2EYSA 1SY6A 4MMXC 3IE9A 4F15C 2XCMC 2Y2YA 5G2NA 4LLQA 3L3JA 5KYUB 1PNCA 4PAZA 2KT6A 3WY3A 2ADGB 3CCHB 4YSCA 3BLKA 3MV01 5HYQA 2LFEA 3CX5K 3G5VB 1G9MC 4NCC1 4QRSA 1FL6A 2R0KL 1YDPB 3GXDA 4P9HC 1T4KA 4X8JA 1YC8A 1SBSL 3PWPB 3VMPA 5BO1H 1IL1B 2NXYD 4WUKH 2IEPA 3B1TA 1FLRL 4U1HB 5GJSL 4EO5A 1MHEB 4D8PB 1NGZB 5C3IA 1TQSA 1IGYB 4MQ7B 3V6OA 2ATPA 3W5NA 1BSIA 4XX1E 1QG3A 2SODB 5L2KA 3LSOA 1UB6A 1QYGH 3TIDB 1T89A 4LAQL 1YJDL 4BK5C 3C2AH 5CP3A 4O5LH 4PHXA 3K80A 3OXSB 1T4WA 4P48A 1K3IA 4ORZC 4XP6H 1MHCA 5A2AA 4UILH 3ULUL 3VXQB 1P5UC 1YN7B 1FV1B 5KBPA 3QC6X 4DAGL 4LSTL 4D9RD 4NRXA 3SDCC 4HKJB 2BWQA 3N1FC 1NCBL 5E8DL 2E0PA 3S35L 1BMWA 2VAAA 3EJPA 4WEMB 1HI6B 1DUZA 1CYWA 4HKZB 3EO9H 4JM2C 3QHFL 1BAFH 1DFXA 4DQAA 3L2LA 2AEPL 1UB5B 3CHQA 5L6YL 2W65B 3FUMA 1JGEA 4F9PA 3STLA 1ZSHA 3F7PC 2H1PL 3G6JB 2CGRH 4N2MA 3BGAA 4G5ZH 4WCYL 3QJQB 3AREA 4MDJB 1AC0A 2C7UB 3SD5A 1RERA 1OARL 4PTTA 1E50A 1HL5A 1S5HB 5AOZA 3TFKC 1ETZA 3HUJB 1E67A 1JRHH 4GB9A 4AYFA 3Q43A 1LEGA 2OTUA 3CHXA 4JFFD 4GKLA 1F18A 4NM4H 2DQTH 3O6LL 4HKXB 1M05B 5J8OA 1SVZA 2FATH 5F44A 1BQ5A 5DHXB 5F93C 4MA3A 3MLZL 5KBLA 2HWZH 5F1SA 3ME0B 1VESA 2PO6B 4LPVA 4I2XB 3V5KB 2VERA 4HSAC 1P53A 5EZJB 2ZOLB 1N18A 3RGVD 1UJ3C 4HETA 4Y5XC 4QAWA 3Q2WA 4ZUSA 4XXDB 3QUXB 4J7RA 2NNRA 1BJ8A 2A74A 2X4UA 3CDZB 3OKNA 4W9LC 5HYJD 1P69B 2JKIS 3HEIB 4U6YA 3RIAF 3IFOA 4OLUH 3KAAA 5IHUH 1KGIA 3S3CB 3HMWL 3GSQA 3JYCA 2YAEA 2GG1A 3NP3A 3OKLA 3V9EA 5JYLA 1QFWL 1IX2A 5J11B 2CUIA 4ZUWB 2CGYA 5IB5A 4DGYH 3HNTL 4XBPA 3W39B 1FFQA 3OAUL 2OV0A 1VENA 3TBYB 3SSGA 3QJHB 1J0ZA 2XKUA 4HFUL 3SYQA 2JELH 2LAGB 2MTAA 3GEWB 4ZYKA 1V5JA 2XY1A 4XN2A 4YIQA 4PJHA 1FL5B 2QV2A 3QORB 1DQKA 4N85A 3G3LA 1MZYA 5JHDD 1T7YA 4KTDL 3MRDA 1UA7A 1YY9C 1ML0A 3L2NA 3SE9H 4GG6B 4QXGL 3H7BA 3PP4H 5AWNH 5TPWH 3V0VA 3WELA 3GUTA 5J3HD 3T8XA 3QUMH 5IF0A 2HG5A 1LO4H 1HQ4B 1YLBB 4APQB 1NM4A 1G7JB 3ZDXE 2HKFH 5BZDA 5IEHB 3TIEA 3DBXA 3ISYA 5J57B 2VKXA 4IU3A 1GCYA 2ITCA 5IFAL 4NO5A 5DJ6A 2KERA 2OX5B 1RPKA 5DZVA 1TJHL 1IM9A 1CB4A 3QULA 3JV5A 4ELKA 5L0QC 2FD6L 2ZG2A 4X5WA 1J5CA 5DHDA 5IT2L 4MMZC 2HKHH 3HE7B 3VXUB 4C58B 4RMWA 1GH7A 3CIAA 3NOIA 3QDME 3O3AA 5JMOC 4NQVA 3R18A 1TZ8A 2WLYA 4LRNL 2L8AA 3ECWA 3GXIA 4U05A 4AKPA 1CYGA 4KZDH 1IC4L 1L9RA 4HIIA 1LO0H 3JV0A 2BIQA 5T1DH 2GJPA 1XTLA 1KTDA 5FGBA 4CNIA 3U4KA 4DQOH 1TMCB 5BRZE 3RVTC 3S3SA 4AQ1C 1ZT4A 5GISH 5HHNA 2BZCA 3C12A 2I07A 4KKBC 4QDGA 4OZIF 4M1CD 1BZ9A 2W59A 3L9RB 2NY4B 3MYJB 4N5UA 3F58H 1N59B 1D5MB 1K2DA 3QIBC 1Z9LA 4UMSA 5FYJL 4L0YA 3UL4A 4MNGA 4GW4B 2P8PB 1AR2A 4RVBA 1AMYA 4Z1PA 3P77B 5IW1B 1T66D 1QI4A 1Y0LA 3SY0B 4L3CA 3JV4A 3ABLB 3V6OE 3RKDC 5C0EA 2WNXA 5I1HL 4F2FA 2P45B 2YRBA 4HJSA 1TJXA 2MHAB 2ZKXA 5DS8A 2X2YA 3VWKD 1A21A 1KJ3L 3ZZSA 5JW5B 1VKXB 4TL4A 5CJOH 4ZT1A 3FT3A 3ULVC 1E3XA 3ALPA 3B7UX 4PJXF 4YLBA 5JA8B 5E5MB 3QQNA 2CIKA 2QV4A 3O6MH 3LZQA 3HCVB 4HCRH 3KWWA 3UBXG 1WIUA 2VNCA 3BQUA 3EYQC 3C5JA 3K6FA 4IS6B 5A1AA 4A37A 2A0LC 4AYBA 3H2QA 5T1LB 1WP6A 4HH8A 4DEUA 4WHYG 1Y07A 5LGHL 5TDNA 2XOTA 1MJJB 4JFED 5JXAL 2B1HL 5MEND 3CXFA 4U1GC 1R24A 1W8NA 1BOGA 1VGEH 3LKRA 3MUHL 4J4PC 4QKXB 3RPIA 1QLEL 2H2PC 1AO7B 2AEWA 2WLIA 3QK0A 3V0WH 5HGAA 1R5WB 3PV7A 3GB7B 3SE4A 2YA2A 1UYWL 4JKNA 1GJUA 2B3RA 3CE1A 4WW2A 3SD2A 4Y1TA 3TASA 4OLZH 5DEJA 3T71A 2IH1B 2J8OA 1Q9WB 2A77H 5L7XL 5D7KE 4Y19A 4J4PA 5DD0L 5DFVC 4OFKA 5E9NA 4E9WA 5AAPA 2P80A 2QFPA 1T1ZB 2ZUTA 5ESVB 1XEUA 2EDMA 4KMLB 5F1IB 1EXUB 4Z7OE 3FN0L 1HOCA 2OP4H 3WN5A 3JWOC 4WGWB 5KVFL 4X83A 3TO2B 3BXNA 4E2OA 1M3IA 2BXYA 1MRFL 2K6ZA 4X80L 2QKIA 3SCMC 4DKFH 3WTSA 3DO7A 4FFZL 2CNYA 4TULL 1CQKA 4V11A 5DZAA 3S34H 1OCZB 2BC4B 2PMZA 1HSAB 1VEPA 4XBGA 3RWHA 3SODB 3OQRA 1LP9A 2DAVA 4UT6A 3X13A 1NFIA 5AW1B 3RQ3A 1QEXA 3ZTNL 1FVCA 5HGHA 5KJRH 5CILH 4QNPF 2ZUYA 3DJRA 2HXAA 4ZPTA 3DPDA 2BSED 4MLSA 1BBJA 4JGNA 4X6BB 3L9BA 4JFUA 2WJ5A 4ODWB 4LU5H 4NFDA 4EI5A 5IJKA 3QIUB 3GGWB 4AENA 3VO0A 2X12A 3QUYC 5ANMA 3ARBC 4B9YA 3HVDA 4FNPA 2FRGP 3FQRB 4FHKA 4WEUD 5CLXA 5EOCJ 2NXZD 1CICD 3VXPA 3OJDA 2WY3B 3LRLA 4JY5L 5D7LB 1AC6A 5HSFA 3PRZA 3CJJA 2FBOJ 2NYKA 3HMXA 3D4GA 4TN9A 4PJHE 4A2GA 4PRIE 4CMMB 2V3FA 3K8KA 5I1LB 5KWYC 3QJVB 5I1IH 3GPSA 5ITFB 1G9EA 2TRYA 2BO0A 1ET8A 2E9BA 5G4OA 4JMNA 1IBDA 5CWSB 1A4KB 1NOAA 1T6BX 1ZD6A 2QJDA 3CV5A 4MQXD 4BKSC 3Q2CA 3BVNB 2CBQA 2G3ZA 3DTUB 2JKRM 5DUMH 3CSBA 1J5OH 2YKLL 4PWJA 1HSBA 1N4XH 1JI1A 3L3GA 1KTKE 3CZKA 2H0EA 5M94B 2W60B 3QXVA 3VD5A 5FOJA 3MBEB 1BD2D 3MJ9H 3V7AE 1KYFA 1P0SE 1J7VR 3V0DA 2DQGH 5C09E 2Y1ZA 4NXKA 1OK8A 1DQDL 2NY2B 4LNRB 3WSQL 4Q0XL 1QSEB 3ESUF 3NEXA 4EBQH 1HN1A 4HHWA 3V5HA 5HXMA 1HAUA 4DVBA 3NJKA 4EZMA 1RVFH 5GGSB 3VFVB 1ZAGA 2X6MA 2J5WA 2ESVB 4ZO9A 1UENA 4WO4D 1XF3A 4L8BA 4BFOA 3WGUB 3CBRA 3P9LA 1I8KA 1A5FH 1U4EA 2DLFL 3CVBA 3QEHB 5DHVB 3HKFA 1JXDA 1AY1L 3T0DA 4N0CD 4JFZL 4YWGH 2A4ZA 5DK2A 4Z95H 5IVXB 1I1AC 2NW2B 3ZVVA 4KXZI 1E9OA 1HFUA 1ORSB 4H0GA 3N0PB 3RRQA 2EABA 4MNGE 4OIAA 3AXLA 3D4ZA 2HFEA 1TQVA 4DN3L 2H6OA 1I8UA 3X14A 3VU2A 2XI9A 4UYQA 3FC8A 5EN2A 4ABVA 3AU0A 5J6GA 2HT2C 35C8L 1ZLVK 4JL1A 1JZ7A 3ESVF 1NCHA 2A83B 2EDYA 4E9RA 1OAYL 1ORQA 4JHUA 2LLGA 5LWYL 4RZCA 5T3ZL 4AMKH 4HDIA 2BZ7A 5DJZA 2Q76B 2OAAA 3QIWC 1KCVH 2WINA 4UQ2B 3SDAD 5LXVA 3NIFF 2ZCHH 3K5RA 4KOBA 4OZGA 1Z5LB 2W9DH 3IAGC 4HWBL 2F8OA 3GI9L 3I50L 4WJ5A 2BSTA 5B1AB 1MRDH 5B1KA 3UTSD 1TZIA 4ZO8A 4N8VA 3CDYA 2HFFB 3QUZA 1A9BB 2MIZA 4MB3A 4PJ8D 5AZ2L 2YHGA 2KS0A 3D50A 4FERA 2X70A 3BFQG 4JLRA 3GRWA 1W8EA 4AH2B 3RTQD 2I9TB 3AT0A 1DANU 2A9DA 3O4LB 1X7QB 1AOZA 3UP6A 2ZKWA 4MX7B 4BFJA 3EJTA 5DD1H 5H37H 2WUBH 4HG4J 3GHBL 3D39D 5L8KB 4QHLA 4ES9A 5IB2B 2CCVA 4GUQA 1TPXB 1NCJA 3TO4D 1S7VA 1P84J 2IBGA 2XZZA 3QEQB 4AEIL 1RZ7H 4LPUA 2IWFA 2YUVA 3OQ3B 4D7BA 1YRKA 5EIIB 5C0FA 5CD5D 3Q05A 4JJ5B 3QXDB 1ACXA 3L95A 4ODSH 5JIHA 5BCAA 4E5XB 5I1JH 4Z9KB 2APBA 2VDRL 4LVHB 1UC6A 1UADC 2Y06H 2ENJA 3AG1B 4U1KA 4BV1A 4NM8H 4I4WB 2PCXA 4WWKA 5MEOA 1WICA 3STZA 4R7XA 3DVNA 4MD5A 1QI3A 1GKOA 3D25B 2EUWA 4YN3A 1L0PA 3MGTA 2WZPA 4R0LB 4J2XA 5D70H 2CKBB 1YUHA 4AQEB 3QHZH 1GGBL 3AROA 4LHJB 1F11A 4NQUA 4RLDA 5IKCA 4RFEA 1EO7A 1YPZF 4S0HA 5C08D 3FCTA 5EF1A 5KSUB 3FTZA 4OD2B 2IGTA 2YXMA 4N1HB 2I9LA 2LU7A 1N6UA 5D8JH 4AEFA 5SWZE 2AJ3B 4HSCX 5BV7B 3WS3B 4LCWA 2E7BA 3DUUB 5BV7L 4FL4B 3CX5J 5DTFA 4DHLA 2OI9C 3V2AR 3ARVA 4KRPB 1UASA 2Z9TA 4P4RB 4TNGA 2V7NB 3C9NA 4RNRB 5C0CE 3CFKA 3OKEA 3RNKB 2W0FB 5EC2A 5JO5B 3EDJA 3CH1A 4YUEH 2E7HA 5B21A 4P4KB 1XT5A 1SXZA 5IB1A 3KLDA 4NOFA 2NSXA 2OPCA 4PGDB 1SN0A 4UTBA 3W2DH 1F42A 1KPVB 3PLYA 2XZCH 1GGIH 3EBGA 4KVNH 1AKPA 2L7QA 3TBSA 2GK0A 3VH8A 3ZR5A 1P4BL 1XGYH 4M1GH 2X05A 2C3VA 4Q9RL 4WU5B 2H0PA 4EUPH 4UUJB 2OK0H 3G9VA 4J1UB 2JQAA 1AS7A 4K5PA 4PV8A 5I74B 4GS7B 2VW7A 3IJYA 4K55A 3F01A 4K3HA 1FDLL 4PJ6A 1J1OL 2DYPD 4KH9A 4O2FA 2H3NA 5D7JC 3KWTA 5DUJA 4BQBA 4Z7NE 3BWAA 5DJ2B 1OOAA 2EEDA 3ZSSA 1G7QB 3VE0A 4CC1A 4F2EA 1OE2A 3HFFA 3MOBH 4ODUA 5F7AA 3TLRA 5K1JA 2KPNA 3QA3A 1S78C 5ESQA 3AY4C 5ILTH 4UT9L 1UWFA 3MREA 2BS71 4I18B 5I6PA 3NPSB 5CM1A 4HIPA 1MJUL 3PXJA 3EGDA 4J3OH 2KZKA 4PJFB 4R5XA 3C5ZC 5TFSL 5CZVL 2DL2A 2XFXA 4F8TA 3LY6A 3BDYH 4LSVH 3JVGC 1JNNH 3RKPA 4CAGA 1T1YB 2X44D 5CLZA 4JRYE 1EZSA 2OSYA 4QHMA 2WC7A 4NHUA 2VUYA 1DJZA 4O9HH 1T83A 3AY4A 3BZ5A 4YR6B 1DQIA 5D6CA 4JBSA 1JHTB 4H0LC 5C6WH 3CSFA 1KGWA 3L5XH 4Y9GA 3K7UA 2XA8L 4JJHA 1NCDH 3ZE0B 5JNYB 1KXVA 1OP5K 1W72B 5A2CA 3TU6A 3EH3B 4H1LG 2WQUA 1UM6H 4NRYB 5L9DH 1E6OH 1IO4C 2P5WA 3SPVB 4P2CG 5E8OA 2X4PB 2X4NB 4G8IB 4IBQA 2EKSA 4WI0B 1E2WA 1K72A 3B7RL 4TVPH 4MLIA 2WBKA 5E2TL 2NR6D 4XNYH 3MRHA 4A2DA 5JPMB 1YEEH 1J5HA 5ISZB 4OZGE 2BS8A 1GIGH 1T7ZA 4UDTA 2HPTA 3B2PA 4MA7H 2FEDC 3RZCC 3WE6A 4QIRA 3QPXH 4WLCA 5IEKA 4AT6B 4XPTH 4OFDA 4LBEA 4OFYD 5JYMA 4ZUUA 2BOBA 1ZOXA 2DQDL 3HPLA 3PQYB 3WKPA 3BAEL 3I75A 1PFCA 3GXUB 3NIDB 1V8HA 1MCQA 1ETA1 3FU7A 4CSPA 1NWPA 4G42B 2CRIA 5E4IA 2KMWA 4IOFC 1KJMA 1RUAH 5FO9B 2VR5A 3LS5L 1N5AB 3WIHA 5D72L 1H9DA 4K9JA 3O41A 3AUVA 2QADC 3VYNA 4F7PB 1UA6H 4LEXH 4O00A 4F57L 2F08A 4G3YL 3ZE1F 5DWUH 5GGQH 2VL4A 1UCTA 1ZLWK 2GIXA 2DWXA 4W4OA 4R4FH 3AABA 4PLJC 3VG9C 4CVZA 3U0TA 4YGVA 4BELD 1V3KA 1HXYA 3IETB 4MCMA 3BWUF 1DJGA 4Y4KB 3MCLH 1EMTL 1S7UA 2RQEA 4LEEA 5A7BA 5D5MF 3LEXB 4RESB 3RFZB 2DWEB 2GK2A 4Y2DB 1KGJA 5JW3L 2HTKC 1IBGL 2ZD0A 2WZAA 5JR1H 1CVSC 1IEAB 4X4ZA 3BGFC 4N9OB 1RJYB 4XBEH 2WWMD 1NC2B 3QDGD 1T1WB 4Y9EA 4JO3L 4P46D 3EGSB 4JDEA 4M4PA 5E4OA 2WLKA 3KDMB 1FVEA 4LKXB 3Q8EA 1WITA 4PJEB 2R15A 2HJLB 4K7PL 5C0IB 4F37F 3MRKA 4NZTH 1JE6A 4AG4L 1IGTA 1S7XB 5A3ID 2QFRA 3MRJB 3D69B 5HI3D 3ILDA 1CS6A 1GHFH 1ZMYA 3IDMA 4UM9A 1P7QA 4H8WC 4O2EB 3MBXH 4LB8A 1KNOA 3E8VA 4P2OD 1U3HB 1ZANL 2GTZA 4Y2OA 5HPMB 1RAMA 3EOBA 3AXIA 4LCWE 5DLLA 4LLMA 4FA8A 1U6AH 2G5RA 1EA9C 4FG4A 2Y23A 4JQXC 1NLDH 1USZA 4GP8B 1IT9H 5D7IB 5EZIL 3MTRA 5FB8B 2RCSH 3H9SA 5KYXB 1SDAB 4HK3J 2FGZA 2BNUB 5LNGA 2YIHA 3NCFB 2H32A 5E99L 1DBKL 3H3KA 4P2AA 3VI3A 3V4VH 2NYZA 1JK8A 1U2HA 3MOQA 3R19A 3PWPD 2DQIH 5JIDA 3DBSA 2HN7B 5EBGA 4Z7QE 2XWJA 2ETWA 4LSDA 4FQJH 4ONOA 3G08B 4JG1L 1JDCA 2V2WB 4FQXC 4HC1L 5F88A 2XWTB 3FO2B 4PSRA 4FQQA 3UZEA 5EEVA 4XVTL 3QFJA 5HHQA 1HESA 3OKKA 1PG7H 4R96B 3T2PA 3D30A 4AK1A 2IOIA 5JQHC 3ULUD 4PMEA 2WQVA 4PJDA 3LJ3A 1T20A 3DV6B 3PS6A 3ASNB 4F2MA 3R8QA 3FB8B 4KO7A 5LO7A 2C9XA 4JHZA 3IPBA 1I7RB 2OR8A 3D2UB 4DKEH 3S3DB 3VCLA 2XN9A 3QH3B 3FJTA 3QO0A 3ZE2E 1SEQH 4N2AA 1MAMH 1ZTXH 4XXWC 1KIQA 3IS1X 3P2TA 4QGTA 2DDQL 2G3NA 1W6WA 5EUOA 2CHDA 1G1CA 2EVIA 3BP7A 3QCTL 1M3JA 1HHHB 4IOIB 2XG5B 2CO7B 1FE8L 4PB0L 1R5VA 3UBXA 4ICWA 1C7SA 3WHE1 1RZKH 3HC3L 4ZTOL 5EFIB 5CJXA 3OKOB 4Y9FA 5B7FA 2Y7LA 2C3XA 3VFSA 2JTDA 2XWRA 2KC0A 4K3JL 2GJ6B 5JORB 1E3FA 3ZTJG 1MXGA 5DZJA 4NDMB 2P5WE 1G6RB 1CK0H 2D4FA 4TSCL 2WVSA 5I26A 3GWJA 1RIUH 1J8RA 4KBPA 2DS4A 3EJJX 3PV6B 1UZ6E 2PXYC 2AKRB 4HS3A 2CG9X 3BKCH 1EXGA 2PO6D 4ZQKB 2VM4A 1HTYA 4XWGL 5ECJE 3SZKC 5B8CC 2LLLA 4PWKA 2WUCL 1E28B 5GIRA 5BVJA 2WWKO 5DJ0B 3AM8A 5HYSA 2PCPB 2EINB 5CGTA 1EGJL 4YNYA 3WEXA 1IAOA 1UT2A 3R0MA 3QJXA 4YHZL 4HU2A 2Y1AA 4YL9A 2DB8A 3ELAT 5B8CA 2O5XH 3IGFA 1BZ8A 4MJHA 4ES8A 4K71C 1PLAA 1QBBA 3WKML 3BVVA 3CFBA 3NPZB 5ICXB 3WNOA 1NC4B 3UJTH 1EAPA 1H3WM 3P0VH 5D2NE 5LG1A 4PWFA 3WFDL 3SHSA 2ITDA 4PBXA 4GAGL 3VG0L 2G75B 4M3JA 3E2HC 3BZEB 1ULVA 4JDTL 2JCWA 5F9JA 1QPKA 4M9OA 4QRRA 3L4XA 5L8JB 4IKJA 1WVZA 2WIIB 2XYCA 1WHPA 4FNLH 4YSQA 1F4AA 4GKNB 1AZBA 1AG0A 2PTTB 2XHNA 3QORD 3MVSA 1DVQA 3GRGA 4P23A 1T1XA 1BLIA 5FYLE 1O9VA 3QCUL 1KLUA 4NO3B 4BJLA 2I5YH 2DQFA 5GRZA 3FN3A 5DQJB 1OCWL 2Y7OA 4W9DC 4LEOA 3QFDA 1L5GB 1I85C 5CSBA 3VFMB 2FCBA 1D7CA 4APQD 4DK5A 3CZSA 4NQXB 5CN1A 3LCYA 2OM5A 2MMXA 2ZONA 4Y2NA 2GTWB 3ARFA 2X3AA 3FQXA 2ARJB 4AEHL 2B9BA 4R8WH 3NCXA 2XV6B 2Q2EB 4S2SB 2APVA 4FG6C 1AQDB 2IWKA 3RX8A 4O2CA 3VXUD 1X6NA 3SKMA 5MHSD 2OW7A 1R0AL 5AZUA 5EU6B 3TN0D 5A2IH 2IXQA 3S36L 4OJFH 4AXWB 2YWYA 3REVB 1RIVH 1S9VA 2PW2B 3WNJA 3ZTCC 1KZQA 5HJGA 4X0KB 3DSNB 3LIZA 1A6WH 1G7LA 1XF4B 2FZ3B 2OZNA 3SDYH 4PRHB 1T6VN 1L7IH 3W9EA 5M95B 4YFLI 2MQ3A 1KN4L 3H9SE 3CVHH 3DVGA 4QOKA 3RY6A 1UCBH 5FYJD 2NY4D 2EE2A 2BSCA 4E42B 1IM3A 3VI3E 1QPXA 1BFSA 2CK0H 3DI2B 3OLIA 4JK0D 1BVNT 1DLFH 2WAQA 4UOW1 3MMEB 4WFED 1F6AB 4NYLB 3BVUA 3I3EA 2N59A 1S9XA 1NL0H 7FABL 5KSAA 3IWVA 2OL3L 2BIIA 1UEYA 2NDGA 2IQ9L 3SJVA 2J43A 3LN9A 4KXCA 5IB3B 4FHJA 5FK9B 1A65A 5AOKA 4B96A 3FPYA 3QFJE 4U6HB 4WWOA 3T0XA 5BO0D 1GY1A 4OKDA 4L4TB 3MJ7B 1IC5H 5K93A 4NC1C 4PJDE 4GI6A 5LUMA 1T0NA 3N44F 4F2ME 4L4VA 3U36A 4OLVL 4HEMA 4DPBX 3WTUA 4OM0L 5K39B 2VH5L 4PW9A 4DPCX 4RX4D 3OZLA 3QRGH 1RZPA 4Z7UF 2LE9A 3KL3A 2DWDA 1S9YA 1A6ZB 1KYDA 2P43B 1XSOA 2YXVA 2XN9E 4KUCF 3SBPA 5EBWB 1MI5D 4A7GF 1Y18A 2GI0A 5E6ID 3I9IA 5EUOE 5D1ZB 1RURH 2X40A 4IRJB 2CDFA 2Z8VC 1T0PB 2C1OA 3HN3A 3LNGA 4PPTA 4OD3H 1GZQB 3ZHDA 1CF8H 4XVSH 5A2FA 1EEYB 1NGQL 3NUKA 4M7JL 4UNVA 3AGWA 4JHWH 1U8CB 3HIZA 2X4SA 4KKLC 4XPFL 1CDHA 4ERSL 2R9HC 3B7YA 3UBXI 5F70A 1SXCA 5LBGA 3QEGL 3GBML 1DYZA 3MR9A 3UPRB 2EDEA 5EEUA 1AKJB 1WS8A 4DP5X 2X89D 4NQCD 2AAVA 1SJHA 5DO2C 5F7FA 5JUEH 1WAAA 4R3SB 1TTCA 4GKSA 3V95A 2XTLA 1RSFA 3DPBA 3ZZQA 5AB0A 3Q8AA 1KPUB 2C5DC 2MRYA 4GW1A 4HX1B 5CR8A 1H0DA 3G6AB 1O5PA 1JTOA 5DDHB 1PLCA 4QI3A 4LP8A 2F7QA 5DT1H 5A2BA 4J3OF 1ZLUH 4ZX4A 2GCYB 3HHSB 2F74B 4YOKA 2HTLD 3CH8A 4Y0GA 5FLVA 3KPNB 3QNXB 1WG3A 2BVYA 2Z34A 1OGTB 3KEDA 3IFNH 1U8QB 2X87A 1S2EA 1EQWA 3MUUA 3QIUD 3UJJL 2CBMA 3QQDB 5AOJA 3K5SA 5AVVB 4EIBA 1TJMA 3DK2A 2HJFA 3MSPA 4MJIB 1E30A 1G7HA 2AQTA 5LG6A 3IGUA 2PPCA 4ZXBC 3VRLF 1KCRL 1AD0B 2K4WA 5CCGE 1KV3A 2GJZB 3HN5A 1GOGA 4QRRE 5D7LD 3AXHA 1V05A 3U7WL 3IRZA 2AZUA 1HEHC 1AIZA 4HVBA 4IW4C 4UIMB 1PKQE 3KL0A 1UKQA 4LVOB 5FA3B 4RDBA 2UY6A 2PCFA 5ADPH 5KTEH 1B0RA 5CEXA 1WCBA 5DRWB 3CVIH 2YRLA 1KCUL 4KROB 5F7NC 8FABB 4S1SL 4HQQL 3PPSA 5ECGA 4UV7L 2ZOKA 4CKQA 3CZGA 2BNRE 3OPZL 5GJTH 2FWOB 4A55A 3V6ZB 4XCFH 2M2DA 5DVPA 3RDTC 4G6FB 3LHAA 2JTYA 4N0YL 4KXAA 2IQAA 5TJWK 5I2IB 2XN0A 1L3WA 3MBED 4ORGA 2WXKA 1INEL 3RTLA 4TNVK 4CVWA 2X9ZA 2X38A 5DJDA 2YAHA 3IDYC 2DY2A 1I1RA 2Z8WC 4JAMB 2D7PA 2VERN 3ESOA 1T5WA 2ZUQB 4F93B 2VXSH 2X7LB 3HE6B 5JPNC 3TESA 2XA3A 2BNQE 2Z35B 4HGWB 4ZTPL 1N0XL 1PGRB 1ZHKB 3KLAA 1HL8A 4K3GA 3GSRA 1EHKB 1VACB 4OUUA 2ESVD 4BH8A 3VXTA 2WV3A 1XH2A 3NJXA 4F5CA 3IJ9A 4LSSL 3ZDZE 3I6LD 4JZJB 4PB9H 2C9AA 5D1QB 4AQ8C 5F6IC 3BUYA 1P1ZB 4YXKH 4PRDA 1MKFA 4QOKE 3D05A 3QQ3B 1RULL 3U1QA 1RLBA 4P5TC 2MQCA 2WXNA 3NA9H 3OG6B 3TJPA 3FTVA 5C9JA 1A7QL 1UZGA 1OIOA 3FRPB 5C2BL 4MZ3A 2ENPA 1BDYA 1ZJAA 3GSWA 2HA1A 4L8CB 4HHAA 2ZKYA 5ETUB 1KYOJ 1ZS8A 1HX0A 2NY6B 4MXVE 2EH8H 2CD0A 4M48H 4TKWA 2ZX5A 3K2MC 3SJVE 5ACZB 6FABH 5K9KA 5T3ZD 4NJAL 4DW2L 3UACA 3A6CL 5CBEA 4L5FH 6PAZA 1BIIA 4M29A 4OIBA 5E1QA 1EHXA 4I9WD 4MJ6A 4F3FA 4CSSA 1P7HL 4U0RC 5IQ7H 2Q8BH 4OGQC 2E9IA 4GAFB 5E08H 1BM7A 1LK3L 4JY4B 3PL6C 1W16A 3BC9A 5G4NA 1MG2C 1NH6A 5TTRA 3ZT5A 1MCRA 5GGRA 3U1SL 4KJPD 2FGWL 1MVYA 1OAZH 2ZXAA 3CFEB 4H1LA 3T6ZA 1H3TA 5DXWA 1B9KA 2PPDA 4WHTB 2ZWYA 5I1DB 1XF2A 1U93B 2DTML 1MEXL 1QO3B 2VZ3A 4NJ9H 4KITB 2VZUA 2VXVH 3BWUC 4EN2A 1ZCRA 4XP5H 3MJGX 3MLRH 2HMID 3O4LD 5FCUL 3N1QC 3VGEA 4UM8B 1KV7A 2YPVL 3ZLQC 2H8PB 2YAFA 43CAA 1AR1C 1TO4A 4LLDA 1IFHH 1WA0X 3AMKA 5H35B 3PDDA 3O2DH 4FX5A 1BP3B 3T1FB 2DJMA 1I4FA 1T2QL 2WLLB 3NTCL 3HR5A 3R06A 2MTPA 2O5YL 2YQ2A 3GRBA 4PJBB 3ARGB 1CDIA 1YEDA 3KBHE 5KSBA 2NPLX 3NSJA 4FNUA 4KO5A 3TBTA 3TGXA 3T65A 3M86A 1S7RA 1TQCC 2B1AL 4JFFA 2ZUWA 2GUOB 3QG7L 3QEQD 3FKUS 2RQ8A 2ZG3A 3P3SA 2AJXH 4HPYH 3SKOB 5EWIH 4L1TA 1DN0B 3GI8H 4HCRA 4K23H 2NNXA 4PYGA 1XZWA 3NN8A 4RAVB 2C9PA 5E1AA 3UO8B 3VFRA 2VDOL 1HWGB 1UD8A 3Q6GL 3WIFA 1KIRB 2JCCF 1J86A 3BVXA 3SKNA 4ZFFA 4H40A 3MUGA 2GW5A 2O6EA 3RGVA 3VTAA 2VL5B 3MLYH 4EI6B 1R3KA 4Z78A 2FX9L 1E27B 2HVJB 3WDHA 3T09A 3WDJA 3TNNA 2JJTA 1R3HA 5HYJA 3I74A 2NT0A 2RIKA 3G6DH 4QRAA 1ZGLA 3CZFB 1JV5A 2OSLA 3GTVA 5I73C 3X1BA 2EVGA 1IJNA 1NEZG 2XZAH 2ZJSH 3UG3A 3H8NA 3ZKMD 3D9AL 1MLBA 3DHJA 5DS1A 1UWYA 4JFYA 1NA8A 1GS8A 5I24A 5D2LE 1ZLSH 4P5KB 5DLML 3B2VH 1RV6X 1ZV2A 1RUQL 2SEBA 5DK0A 3X1FA 3EAKA 4WI7A 2F58L 3PUUA 1G4MA 2WQ8A 2VLRE 2A9MH 4ODBD 2ZF9A 1J1PH 4FOMA 3HZMB 3KPOB 3NZHH 3P0YL 1QSFE 3DO4A 1EERB 4QTHB 2GFBA 5D9SB 5IFJB 2A73B 2CO6A 3T0AA 1JRHI 4RQQB 1AGFB 1CGXA 4NZRL 4ENEC 2NY7L 1EFXB 1XF5A 8PAZA 1KBWA 4XCCL 1JNJA 3A67L 5JHDA 2HRPL 2DQCH 3V6BR 4JL2A 4B7IA 4KRPD 4YSSA 1ADQL 5DMGD 1B6UA 4TUJA 4APXB 4E9LA 1FZKA 1JZHA 1CWVA 3JV6B 4ZBJA 3VFTA 4P4KD 2BVQA 3VTMA 4AM0A 1R5IB 5EO1B 5FYKE 3KWXA 6TAAA 4Y1AB 3MCKA 4N0UA 2JJSC 4TNWK 3VFPB 3M17B 5GGTA 3TBBA 1LE9B 1I82A 4Z7WE 3VYPA 5LXGH 2XWZA 4MJ5B 5CLYA 4XRCA 3KJ4B 4RGNE 1A4JA 2NY3C 1NPNA 2AJUL 3BP4B 4JO5A 3OAZH 5HYIA 5CSZB 1ZHBB 4U1MA 3LRKA 4XR8C 4PJCF 2XQ0A 1EDQA 5DC4B 4YVUA 5J56B 4LIQE 1TU2A 3K8LA 3MOAH 5DEFB 3SDXB 2J4WL 1VFUA 2EO7A 3BZ4A 2CKNA 4Y89A 5LCVL 4OCNC 2UX6A 3O2VL 1U21A 2MPAH 4IHBA 1A0QH 2EKJA 3FUIA 2GHZA 1UACH 2GB2A 1BZ7B 4I77H 4FA7B 4QF1A 2W8CA 3D4CA 2BPBA 2VZSA 2VDLH 1T66C 1AQMA 3CFTA 5CZXD 5BOZG 4IMKC 4CSTA 2EEBA 1PF3A 1P6WA 3R1GH 4LLUB 5T5NF 4D7PA 1ZV9A 3CFJB 4UV4L 1SY6L 2EILB 4GUOA 3F7KA 1F1GA 3SQBA 1O9WA 4G6JH 3FCBA 4XTRC 4ELMF 4L3EB 3QDHA 2HT3D 3WNNA 1KG0B 4ZZFA 1OPGH 1HHIA 1J9TA 3QWRD 1NCUA 4YZFE 1PYWA 4GO6B 4QXWA 4M03A 2H3KA 1CBVH 4X6CF 3UAAA 3CZNA 3MV9B 4MMXB 5FA4A 5LBSL 3WYRA 4F15B 1JK9B 3CLWA 4UIKL 1YYML 4XMUA 3HI5H 1AHMA 4X50A 3VWKA 1L9NA 2GI7A 5EBMA 3FYIB 1G9ML 3DX7A 4QD2E 3KYAA 1PQZA 3DX9B 4P9HL 5ISZD 4NEHB 2J21A 1H3UA 1SOXA 1OY3B 2VXTH 3OHXC 4D9RE 3PNWA 2A9NL 3OLGA 5C92A 1OWWA 3RUGB 5K9QG 5TDPA 2A6KA 1FNEB 4YLQT 1BVNP 5EUKB 1LEIA 1A47A 1AGDA 2BW4A 1QNZL 4I3SH 5F1NB 4MBOA 4O02A 3PQYD 3QS3A 1IQDA 1AHWB 3N43B 4JFEA 4XO8A 1FJ1A 3VGFA 4OGZA 5JOEA 3L3IB 4XGZA 5MENA 2VN4A 5IM7B 4ODXA 5JHBA 4FXKC 4CDHA 4GUPA 2ENSA 5DJCB 4DO6A 3MRCB 3WUWB 5MERA 3SDCB 2CKBH 5BJTB 2QHLA 2ZKHH 1JWSA 1NICA 2APWA 5CCKH 2BDNH 1QUNB 4KO6A 1FC1A 1X5YA 4KDVA 2W9EH 4ELDA 3G6JF 4Z3IA 2ZXDA 43C9A 5KSBE 4PIBA 2G60L 3F7RA 1FRGL 1JPTL 2CRYA 2HP4A 2JV6A 4JFOA 3UC2A 3F05A 3RX5A 3W0WD 4ZD3L 2COVD 2P4AB 5IROD 1OP3K 2YWZA 4PGZA 4M6MH 3HAEB 4ZMNA 3FUKA 3EYFB 1CLZL 2FBJH 2FEEL 3GBNL 1JWMB 4H13C 4Y2DD 3PE9A 4JO8A 3WKQA 1BEXA 3IXAA 1A7NL 1CJYA 1IC1A 4PJAB 1MFDL 4N2CA 1SHMA 4KVCL 5DHYB 5FAAA 4K2UH 2EE3A 4YBQC 4ZDHA 2P47B 1NC2D 1DEEA 3NFPA 1ITBB 1N2RB 4Y4FD 5F6HI 3R7QA 3ZKQD 2NXZC 1CFNB 4G7QB 3KR3L 1Z5HA 1H19A 4FS0A 5CJQH 2BSEA 3GMOA 5CEZL 2YN3A 2AMUA 1ITCA 3PABB 4LL9A 4Y5XB 2VLJB 3LVEA 5I1GH 2V3DA 4KMQA 3S96A 4DEPC 4MQXC 4A2HA 4BFIB 1CICA 2BOCA 3NIGF 4QRTB 2ZPKL 3OWRA 4R26L 3BZFB 3KGSA 4X5XB 2XQYK 3GZKA 1U3HD 3KCPB 4QWWD 4RETB 5IVZA 1LDPL 2YUZA 3D2TA 3SGKC 2UX7A 4YE4L 4JDZA 2C3GA 2C1PB 1DBJH 1OAQL 3F85A 4GUCA 2VDPL 3V4PH 3VWJD 3GMRB 2R8SL 1D5BA 2KLRA 1IKOP 4F1SA 4CMHC 2WOYA 4PGEB 1TVDA 4P8QA 4B9KC 1HINH 3O3EB 1BLNA 4POZC 32C2B 4FC3E 5F89A 4A2EA 1MRCH 4N0UE 1Z9MA 3V4UH 3S6CA 3BKML 4GG6F 1VIWA 1CVRA 4IRSC 4IDLA 3K1DA 1BD2A 2AK1H 4P5SA 4WO4C 2YQ3A 2HT4D 3I9GL 5JW4M 5B1BB 5HHVH 3VGAB 2D7TL 1J1XH 1EBAA 3KYOA 4B53A 4D3CH 2OZ4L 4Z7UA 2PUQT 3RL1A 2BFGA 1A6VH 1SHSA 5IG7B 2CJUH 1QLRB 3G9AB 5DMJB 4WO4A 5F7EH 2D3NA 4GRLB 4KQ3H 2Y5TB 3L5WB 2QQKH 4N2IA 1SJXA 4ODTL 3SYAA 2X1OA 5HDWA 3D2UD 2JXMA 1AI1H 5D7SL 3NT0A 4A2MA 5HD8D 3BMWA 2P8MA 3NMEA 4OQTH 2VXQA 1YECH 5H4ZA 1UM5H 4MMZB 3ATDA 3IU3A 3EFDH 2CMRH 2BSRA 3QISA 3BAKA 4HEPG 2ZP8A 5E2VL 4PS8A 1Q1PA 2EC9U 4WEBH 3B83A 1U3NA 2BCKA 4TQEL 3SDAC 3HC4L 3QR2A 4CILA 3X1NA 3IKCA 1NCNA 4ODVL 1QRNB 1BQSA 3E3QC 2VZOA 4G9FB 4J3OC 3U6RB 4QHKJ 4IBLT 1MREL 3BUBA 2EDTA 3RDJA 4AQ1B 2GJ6D 3L3OC 3HC2A 2P1YA 3ILEA 2AEOA 4HIXH 1RK0B 1Q8MA 4X42A 1X44A 3BCFA 3L17A 1WBZA 1PX3A 2ZCKH 2YPKA 3QIBB 1DQMH 3UTQB 1MVUB 3SDAA 1HJCA 3RTQC 2Q3AA 3NJFA 3X3FL 1TTRA 2WN3A 3DROA 2KYIA 1N7ML 3BPOC 3BPLC 5EO9B 3S3PA 4Y7MA 1GW6A 3BE1L 5A40E 4OZFB 3UTSA 5IIEB 4H5SB 4OGAC 3NJLA 3A6BH 2NZ1A 3U9PL 1UH2A 3RWEB 4RIRB 4PJ8A 4JPIA 2G0KA 4JFEE 4TLTA 4OKVA 1KBGH 3UEZA 7TAAA 1UT9A 2CHXA 2YARA 3C08H 3TO4C 3RTQA 3K6SA 2MOVA 2FX8L 1BGXL 4E9YA 3ULVL 1IKNC 2D0HA 2IPUG 4GJTB 2BMKB 1PLGL 1RZ8A 2J44A 1MN4A 1NC4D 2ILLA 3FFOA 1MCFA 1ODAA 4XHJD 5IJDC 2JKLA 3D39A 3EIFA 3DX0A 4WKZB 1NGWA 4KZEH 3TO4A 4KMTH 1X5ZA 1PZ5A 4HV8A 5JHLA 4IKKA 1F58H 3MXWL 5D96C 5KS9F 1FF5A 3IBEA 2DWYA 1FFTB 1CD8A 3KBEA 4N5EC 5LGYA 4AZ8B 1HE7A 1IGML 2X4TB 4DF9A 3G5YB 3IMWA 3KPMA 4JFQA 4UTAA 3K6DA 1H15A 2NNAB 1GOFA 2WLHA 4S1DC 2H6PA 4GXVH 5EF0A 2GABA 3MDJA 4OFQA 2ED6A 3IJSB 4HWEH 5JMRA 4LVEA 2EXWD 4YMPA 2AJYH 4X9HA 2BP8A 1KWKA 4ABWA 2AZAA 4L3FA 3LH2L 4GMTH 1SN2A 5F9WC 3A5VA 2HJKA 4OGXL 5IMMA 2FWSA 1ZVYA 1G9NH 4YDLC 3GTNA 3MRPA 4Q4IA 3EADA 3IXTB 3EYVB 2VMCA 5C08A 3JWOL 1ZE3H 1JGUL 4NT6B 3KYMA 4U33A 5E94A 1FGVH 1FVDA 3ES6B 5EU6D 5TE7H 4NO2B 4ZMTA 5C1MB 4L05A 4LFHD 4Q9QL 2J5LB 1NGYB 2BVOA 4NUGH 1FZMA 3GMMA 4KFMA 2VAJA 4UBDC 1TQBB 4ONFL 1OW0A 1KENL 2K0RA 4KXDA 1JWUB 1L6XA 4PRHD 3FFDB 3T0EE 5INDB 1UVQB 1TVHB 3IPEA 2HX9A 1CG9A 3WO4B 4EE2A 1FH5H 4Z7VF 5EULV 2XZQH 3QUYB 1JUFB 1IVLA 3ARBB 1JBJA 4MSWB 1SJEB 1OGPA 5GZND 4RMUA 4YSRA 2QBWA 3RWGA 5H94B 3FQUA 5G55A 2JI1A 1IAII 4C4KO 3VJ6A 1I1YA 1JV2A 1O7DC 1OGAB 1VSCA 2EACA 1BD2E 2XPGA 5E8PB 3TONA 4I88A 1BHGA 4HUXB 1MFEL 2Y6SC 4EDXA 4IMLA 2DYPA 3VM7A 1IGCL 4PW3A 4W6WB 1EJFA 4UINL 4LCCC 5IMKB 4JPSA 5HDQH 2MOGA 4GH7B 3IMBA 1PCXA 3VFWB 1NDGB 3VMOA 1IILE 4GYBA 2JFCA 5I6OA 1E4WL 5AQ0A 1KJ2H 2RFXB 2VDNB 2VJ0A 3PU7A 3SBRA 2VDNL 5GSVB 2P46B 1BVLA 3DHPA 2H9GB 2ERJB 1E5ZA 5CR1A 3WHE0 1P4IH 1A1NA 2LTQC 1XGRA 2NDFA 1THAA 3CIQA 3LN4B 2ARWA 4KY1H 4N8CH 4U1JB 1GAFH 3GXTA 3KPLB 1T03L 2C8NA 2WQSA 4RCAA 4Y5YC 3ZBMA 2UZIL 4AJVA 1RHHB 5C0NC 4PRNA 5D1ZD 4RBPK 4IRJD 2FTAA 5F72S 1L9QA 2F9BT 2L04A 4M5ZL 4NFCA 2GBAA 4JG0H 1URIA 4I48A 4XC1L 5H2BA 1EO8L 4MAYB 1MY5A 1YEKL 2NR6C 1NBZB 2YAOA 4KHTH 3H9ZA 4KI5E 5B4MC 3FF7A 5I1EL 1QOKA 3PWNB 3PPEA 4HK0A 3MODL 3EH4B 2DKUA 2QHRH 3BYTA 2FECL 1JGLL 1I1AB 4QAMB 4DKTA 4Z8FL 1AKJD 3ZDYF 3VDCA 4BZ1H 1WZMA 4LVNC 1HH9B 2AQRA 4EOWH 1ZK9A 2NR6A 5EORH 2N56A 1S4IA 2X3BA 3TEYA 3FTSA 1BF5A 1RZKC 3I6KB 2DLTA 5DRXB 5AAWA 3LQZB 1NFDB 1JYVA 4OF3A 2FUQA 3Q5OA 3EG9B 1BM3H 4MB5A 5EA0L 4ODHL 2R1WB 2R0ZH 4FQCL 4OFYA 5CHNB 5IW6B 5T33H 3PAVA 4FQ1H 1HQRA 1IEHA 5JW4R 3FCSA 3EBHA 3WL9A 3QIWB 3PGDB 3W57A 3ARSA 4I87A 1M7XA 3JTSA 1YN6A 5TGBA 4MRCA 2WXRA 1SJMA 4U7MA 4GXUN 5DRNA 4AK2A 2Z93A 3BEWA 3ETBJ 1URLA 3EYUH 3P4OB 1MCWW 4JQVA 5EIIG 1RU9L 2DD8H 3D39E 4YHKH 4X98B 1E90A 3W9DB 4HXBL 2BFVL 3TFBA 4WO0A 5I76B 5IFHH 3SGJA 1RZIB 3KZ8A 4XPGL 5FKAA 1JZ6A 2CHZA 2Y7NA 1U8JA 1QBAA 3VFGH 3L8QA 4PV1C 1BAWA 2ORBH 4P46C 3U9UA 1H8OA 4BM7A 3I85A 2V2XA 4IHOB 2EDJA 4OTXL 4OLWL 5ICYB 1Q0XL 4KROD 1HL4A 3SOBL 1UG9A 1MF2H 5IMOA 4YQXH 2A4EA 3LZPA 3H4HA 3EFOB 2KH2B 4PRBB 3FSWA 3V5DA 4G6FD 4HUWA 5DI8A 4B3EA 1W15A 4L3AA 1ZA3B 3QDGA 4Y16C 4X7EC 4CGTA 1MLCA 4P46A 4J3WA 5KW9L 2IANB 1Z9SB 4Q2ZB 3ROLB 4P57A 3FHEA 1ZA6B 3BT2H 1JTPA 1YYCA 4TVSa 3H3PL 4TF4A 2P7TB 3ILPB 4O51B 4HUUA 4M7KH 3T3MB 2B2XH 1YVLA 4HZAA 4PQXA 4F58H 1NAKL 2OCFD 3EF4A 2K7QA 3QG6B 2DL9A 4L1HA 3HE6D 1EZVX 1OZTG 3KPPB 1AYOA 4KHXL 1VADA 3OTTA 5CMAB 3OGCA 5FYJU 1K8IA 4M6AA 4NWTL 4FQPA 4P2OA 3GXPA 2NT1A 2O5ZH 3HZKB 4ZRGA 4UOW0 1DJXA 3DXAB 3N55A 2B08A 2XETA 4P2RB 1A7PL 4ZFOB 3EDKA 3F7VB 4ADIA 1QHOA 1NUNB 3CCHA 4ZFOL 4L0PB 4KKCC 3PHSA 2E6JA 1FH2A 3FTWA 4AVKA 3NABH 4YAQB 3B3BA 3PWPA 1BZEA 2XWBB 4AV0A 1WJ3A 4U1HA 3IFPB 5D93B 1NGZA 1XTMA 2NY6D 1IGYA 2RR3A 2C4XA 2JMRA 1N8OE 4JGMA 5AZEL 1MFNA 1I9IH 2A1WL 4TUOB 5E8EA 3BRFA 2X6AA 4UWQB 4ACTA 2I24N 3TIDA 4JEGB 3RI5F 3WJLC 1JYNA 3S37H 2ZIDA 3T8VA 1RY7B 5I30L 3OXSA 3CD4A 1ONQB 3AVEA 3ZR6A 2Y3AA 3MRGA 1GJIA 2WLJA 3DJZA 1YN7A 1FV1A 5JIQA 2IGFL 2XPZA 3MUJA 3EH5B 2QPSA 3IGKA 4DERA 1HI6A 2VWEE 3C6LC 1BFVL 3QR1A 3ZIMA 3LQAH 4G6MH 4HKZA 3N40F 1JDAA 3TOPA 3HRZC 1PAMA 2FT8A 1TZAA 1UB5A 2W65A 4E41D 2YD4A 4LSRH 3INOA 2F8IA 2HRGA 3G6JA 4JN1H 3EHBC 4D0DB 2ED9A 4PJIB 3EJCA 4C56B 5T5FH 4U4BA 4MDJA 2C7UA 4FXGC 3HRPA 3O4OC 4FQHB 4ONGL 1S5HA 3C5ZB 4M7ZC 2F5BH 3HUJA 3ARGD 3IE4A 3CLEH 2EH7H 5KYNA 2ICEB 2PNDA 2A9AA 3ISWA 4N6RB 1CMOA 1J9SA 1FIGH 4K5NA 5EG6C 3FS9A 1ZRUA 3QUXC 3TPUA 1M05A 3FU8A 2PYEB 5MEPB 1F90L 1XCQA 4JHBA 4ZOCA 4NKQB 4MYWB 2OYPA 3RIAK 3ME0A 1RCYA 2PO6A 2BIPA 4IIQB 4YHOH 5ICZB 3V5KA 3KG5A 2DEYX 2JIXB 5DVMA 4LSUL 3GSNB 2ZOLA 3WNMA 3F64A 3GSNL 1AGEB 3MRFB 1T0MB 3H6AA 4ZO7A 4RDQG 3SE8H 5BS0B 4XXDA 3RVWC 5EF2A 3BHBB 4IRZH 4TSBL 4A2LA 1SDDB 3MA9H 4OR1A 3CDZA 3RA7L 3N41B 3CSYB 4MDIB 4PCKA 4CVXB 4Z77B 1O75A 4HBQA 1YAZA 2WKOA 4E9VA 3WXWH 2KQNA 5HY9A 4GQ9H 3KBFA 1DSFH 1GGCH 4KDWA 2OJZL 2EDBA 5E9DE 5JTWA 3NIDF 5DYFA 3U79A 4FQLL 3EO1B 4ZUWA 5DU7A 2FSEB 1WZ1L 2PLTA 5IY5B 3W39A 1HDMB 3Q01A 2KPWA 2OXHB 2VDQB 4W9EC 3Q1SH 3TBYA 1XGQA 3QJHA 1TQWA 2VDQL 3BN9C 5ENWB 1RD6A 2VGLM 4APQC 5B38B 2FJGB 1FL5A 1JL8A 1WIPA 3G04A 3K6IA 3LKPB 3QORA 3APFA 4YHNB 3B37A 3CK0L 3LZLA 3O6FB 3IDXH 2HLFD 5B3JE 1RIHL 3QEUB 1H3XA 3TYGH 4PVMA 3RWFB 3E80A 4WNJA 4NFBA 2YD9A 2R29H 2MNUA 1HQ4A 1T3FA 5I1KH 4APQA 3HE7C 5IEHA 2DH3A 1F3DJ 1NZRA 3QDGE 1G7MB 3VG9B 3HBZA 3QT2A 4AYEC 2P44B 4GRWE 4KGJA 2DQUL 3OAYH 2P5EB 4FQ2L 1LO5B 4PWHA 4LOEA 3PAYA 2EICA 3T2NH 2D03L 3L5IA 3VAEA 5I0ZA 4Z3JA 2B0SH 3MJ8B 3K0WA 2C9SA 1T21B 3BGFB 3MGOB 3MGAA 3VXUA 3NBNA 3M1CA 2XNAA 1F02I 1DVXA 4PJEF 1WV7T 4WNSA 4DJMA 4JMXA 3TN0A 1X5HA 5AYUL 2OW6A 3VACA 1NFAA 2I7SA 2F15A 5J6SA 3T4YB 3VXNB 3S0PA 1DLHB 2YD7A 2DMHA 4OZIB 4XH2B 1IQWH 1FC2D 1KT2B 3HB3C 1DJSA 4KK8D 1WZKA 3MYJA 3MLWH 4LKCB 1N59A 1D5MA 3X11B 1IE5A 3P40A 2WW8A 1N70A 5D7IF 3WI9A 4B6ZA 3P0GB 3IRPX 4L3ED 3ZQXA 3FO1A 4OJEH 4GW4A 4H8WL 2P8PA 2WYIA 3QXUA 4QO1A 3P77A 5IW1A 1UXMA