2Y7MA

Structure of n-terminal domain of candida albicans als9-2 (pt derivative)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
300
structure length
300
Chain Sequence
MKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords AGGLUTININ-LIKE ALS9 PROTEIN
publication title Structural basis for the broad specificity to host-cell ligands by the pathogenic fungus Candida albicans.
pubmed doi rcsb
source organism Candida albicans
total genus 70
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7mA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7mA02
4JDZB 4LE8A 4JDZA 4F1ZA 3IRZA 5CFAA 3ASWA 3AT0A 3IRPX 4LEEA 2F68X 2Y7MA 3IS1X 2YLHA 2Z1PA 2Y7LA 4F27A 3AU0A 4F24A 2Y7NA 3V10A 5IHWA 2Y7OA 4F20A 5CF3A 4MBRA 4JE0A 1R17A 3IS0X 4B5ZA 2F6AA 1N67A 2RALA 2VR3A 1R19A 4LEBA 4B60A 4MBOA
chains in the Genus database with same CATH superfamily
5E5LA 4OGAC 5CCHE 4EN3D 5AALA 1FO0A 1Q0EA 2E9IA 3JWNG 1AKJB 4L8SC 4JM0A 5K1VA 4OKDA 2XX1A 4JAMA 4RQQB 2MKWA 1JK8A 4HDIB 2P1YA 3KPSA 1YPZE 2Q10A 5KN5B 1FNGB 1A3LL 1V7NL 3K0YA 1IBFA 3FAXA 2VISB 1VCAA 3FHQA 1EAPB 3JYCA 1JWMB 3B4NA 1IGTA 1XGZA 2H0PA 2AEQL 2JB5H 1L3WA 3UZVA 4NO2B 4NENA 3U4AA 3EF7A 1E4KA 5CCKL 4HUVA 1QPPA 2XN0A 5C0AE 3F2LA 3EYFB 3LKQA 5C9JA 2HFEB 4HD9A 4UOJA 1BVZA 3KR3H 4TTGA 3GJEA 1JMZA 2W1NA 1TQBC 2LW3A 1B0GB 2AVGA 1SRDA 1IC4L 5T1MB 3LIUA 4LHJB 1IEAB 3RWDA 4FQQA 3DKHA 3EYVA 4TOYL 2HTKD 1YN6A 5G5DB 4LRIC 4P07A 3EDDA 1L0PA 4HS6B 1JXDA 1KPUA 2KERA 2AJ3B 1RUKL 1JZGA 3RTQD 1GOHA 3MBEC 3FBQA 4MAUH 4BQCA 3A21A 3ZL4H 1HWGB 4YFLI 3IRZA 1OF2B 4O4YL 1WZ1H 5CEZD 4DQOH 3GRWA 3M1BB 3ARYA 1SYSA 1VGKA 1QYGH 1BPLB 1AQMA 1YY8A 2OP4L 4X4YA 4FLQA 2VDMB 4GRWE 1KLUB 2ICWJ 1YEDB 3ZRFC 4UDTA 3IDYB 2YJQA 3K7UA 1BW8A 3HNVL 2OLDA 4FGMA 3A0OA 4LCWD 5F9WC 1CFTA 1M7DB 2WLLB 1LD9A 3RI5F 3KWWB 5DXWA 3UO1L 3CZFA 4FA7B 3VFGH 1KDIA 1NANH 1A9BA 3G6DH 4PJHA 4QF1A 1L6ZA 5EBMB 3C09B 3LH9A 2ZUTA 4PJGF 1A7OL 3PL6B 4U6YA 1P7KA 3KPOB 3ZQXA 4EMZA 3Q8EA 5EU3A 4UDUB 3WN6A 3ULUE 4ONHB 1KYOK 5HHOA 5D5MA 2DJ4A 2EDDA 4OGYL 5DQ9A 3HG5A 2BY0A 2R0KH 1E8YA 4DKTA 1FYTE 2ROXA 3ES6B 3KEHA 5MI0C 4GIAA 1XCTA 3AADB 4HWBA 2JCCE 3LZPA 5CZXD 4LCCA 3OKNB 3MLXL 2FD6L 5LNGA 2DQFA 4HMDA 2JK5A 3H0TA 3AWEA 3QIUC 4ZMNA 3VG9B 2DJMA 4D3CH 1W0WB 3TO2B 4AYMC 3FU7A 5DHVH 5FOBB 5D4IA 3BQUD 4EUPG 3QZBA 4G6JH 1B2YA 5L2KE 4WGKA 1T1XB 3QULA 4PBVC 2A6IA 4JKNA 3W56A 5F89A 3MTXA 3QUKA 1X5AA 4HUCA 1EUTA 3KYNA 2VLKB 1UWYA 1ZMYA 3MXVH 4N2OA 1CXKA 4XPBH 5CMAA 2D73A 5B1JA 2J88H 2DYRB 1UZGA 3PWPA 2A74A 4LGRB 1U0QA 1NBYB 1XIWD 2J73A 2EVFA 3RNKA 2ZOUA 5DFTA 4X7TA 4MJIE 5DJCA 3UAJC 3E8UH 3SCMC 1BFOB 3SY0A 4PVBA 1RLBA 5I26A 3FTWA 3R06B 3WFCH 2CLRA 3FTUA 3AC0A 2JJTC 1I31A 3ETTA 4WWKA 4N22A 3DURB 4JFEA 3W82A 5DUMH 4JFQB 4BZ1A 5SWSB 1RFDH 2FBOJ 2VO5A 4NQVA 2WTRB 4IJ3B 4CRPA 1S7TA 5DK0A 5JYMA 2BCKB 3VWJA 2VDPB 2W07B 5IOKA 4FXGA 4GW1B 3NESA 2H8PA 4YHIB 3BRGC 2XG5B 1TQSA 4PG9B 4XVOA 1JZ6A 3ZHFA 1UCBL 2QGCA 3VQ2C 1JZJA 2J8UB 3PGCA 4RMQA 1OZUA 4ODHH 2P8LA 2IGLA 4CBZA 2P8PA 1NJ9B 4I77L 1WT5A 5F96L 5FLUA 3MRBB 3RKDC 4WI2A 5IEKB 4HV8B 4AIEA 1O7VA 1D7BA 5IBLD 2YPVL 4P8QA 1ACXA 1BG1A 4H44C 3IJSA 1KLFB 3QIWB 1GGBL 4MZ2A 5ALCH 1N5YL 2OM5A 1XMEB 3FB6B 4LSUH 3B2DC 2J6EL 2TRYA 4Y19E 1MIMH 1T5KA 2H32A 1YMHB 2VT0A 3BMWA 1SVZA 5D4JA 5K9QG 5C08B 3HPLA 1LO5A 3B7UX 5MENE 1OL0A 4GW5B 2WKOF 2YFNA 3O2WL 3FOMB 1AS8A 3PWJA 4DP1X 3VI3E 4U2YA 2AFNA 1FVEA 2CO7A 2FX8L 2OTUA 4YBQC 1I1AD 2NY4D 2NYZA 3O0RH 4MNQB 5AYTA 1YVLA 5IQ9A 4C83A 2APTA 4HKZB 3QUML 1OP5H 3MBXH 3TV8A 3L17A 4LSPL 3SQOH 1U2HA 1XT5A 3MMEA 4IHOB 2CBTA 2NR6C 3DVIA 4M43H 3V9FA 1RCYA 2H1XA 3OKLA 3JT0A 5DQDH 1U3ZA 1PCSA 1R5WB 4KX7A 4PGBA 3D50A 5HY9A 1M1SA 3NJXA 1RIUH 3OHMB 1H6TA 1BLNA 2GK0B 3KWVA 1DHKA 1OLLA 4L2YA 3KWTA 2DWTA 3S34L 4F33B 4EI5B 1O9VA 3F5WA 4B9IA 4QAWA 4TL4A 4JE0A 1PQZB 2DQMA 4R0LC 3QWQB 2X4SB 4X4MA 4HIIB 3MRCB 5J1SC 2G2RB 1VDGA 5E8NA 2LLLA 5FUZH 1FH5L 3OHXA 3RWCB 1J1PH 3AY4A 4WVRA 1P0SE 2AABL 5L0QB 1T2JA 1A1MB 3C6SA 1X5IA 4XVTH 1ZOXA 3FB7B 1L7TL 3GGWA 2NW2B 4QXUL 4Z0XB 3OM3B 4PJBB 1P2CA 2Q9OA 4G6AD 1X5XA 4TKWA 4EAEA 1I85C 3A24A 5LCVL 3WEXB 5EU6A 1J9TA 5HYQA 1OD9A 1T4KA 2NQCA 2XXCB 3HBZA 3MLSL 4E9YA 4OV5A 2VSMB 5SWZD 4IDJL 2BC4A 3K0WA 2KC0A 2OJEB 5E2VL 5I1KH 4M62H 3OGCB 3ATFA 4RAVA 4F93B 3SGKC 4UV7L 4AM0B 2R2CA 4HWZA 5AAMC 1BSIA 1TSHA 3DSFL 3QFJA 1NAMB 4L4VA 1GOGA 1JVKA 1ADQA 5FO7A 2VZSA 3OSKA 2DM3A 2YD5A 4IEFA 1WBZA 4AE1A 1S7RA 3EAKA 5KEZA 2FIRT 2Y7LA 2EEAA 4NKIL 3ARGD 4XPTH 3FONA 3L4WA 3DSNB 3V5DA 4P4KD 4WI8A 3VFVB 4I18C 2RFXA 2MNWA 1ILSA 3W81A 1FFNB 4ADGA 3CX5K 2MMXA 4X98A 3WHE0 1PYWB 2ZP9A 5E8PB 4YSEA 3QUXB 5E2WL 5LQBL 3LRKA 2EDTA 1U8MB 3PGFH 5DMKB 4TUJA 3SDXA 1FL6B 2AS5M 1F6AA 4X6DF 2JKIS 4OZIE 4HBQA 1NCUA 4XCFH 2E56A 3S36H 2W91A 2FQGA 2JWYA 3ARFB 4JVPA 1KGCD 5CU9A 4DK3A 1UJTA 3BZFA 1TJHL 2EDXA 2YAOA 3H3PL 3ETBJ 1UGKA 2NY6B 3VFMB 1KTKE 5CINH 1X4YA 4YVNA 3TA3B 4J3OC 3OPUA 2EZ0D 5MP6H 2EIZB 2ZE0A 1FDLH 4EOWH 1IRAY 5B1CA 3W2DL 1B4RA 1AQ8A 5C0CA 4Y16A 4XCYB 3SE4C 4JDZB 1RZQA 2CD0A 3S8GB 4F2MA 1T7YA 1AO7B 3LNGA 2Z0BA 2VH5L 1AHKA 3WKNA 4K8RH 1NLBL 3O4LA 4K94C 5ENWA 4L4JA 5DRXB 4Q6IB 4GT7A 1QFWI 2CJTA 1J8HA 5A2AA 5HYSB 1JPSL 3W5MA 2IAMD 3QDJD 1EJ8A 1AJ7L 4XH2A 2XG4B 3ZE1F 1DN0B 1CWVA 1ZEAL 2P80A 3LRSB 4U6VH 1NIAA 3UYPB 1MCNA 1A14L 1A7QL 3QXTA 4H5SB 4EIZC 4FQ1L 3FU5A 3UAEA 4HLJA 3R7QA 5EC1A 5MEQB 5ACZA 1HEZB 1OALA 3ZT7A 3NVQA 4KBPA 3HW7A 3RZCC 2A73B 1MCJA 1UWEH 1Y1UA 2DQEH 3TT3H 3ESOA 3BP7A 3EJJX 4X9YA 5BQDA 2R4RH 2IBBA 2QKIB 1LO4L 2P24B 3CXHK 5GRJH 4BKTC 5DI8B 2PNDA 4IS6A 1KXTA 5F7LB 4ELDA 4XP5H 2ZG1A 2WKGA 2WP3O 1TZ8A 2CE6A 3MLUH 3ZVVA 4TSAH 1RERA 4F3FA 2EXSA 3Q2LA 1VSCA 1AQKL 3WN5A 3BWZA 3R1GH 4KKBC 5J7CC 3VACA 3S98A 4KI1A 4YXKH 4XP4L 2OCJA 2ZF9A 2A0LD 3B37A 4YDNA 2WNXA 2CA4A 1M1XA 4JQXA 4BD4A 4CN4A 4P23D 4ODTL 4OLYH 1F02I 3O8XC 1C7SA 1Y1DA 4EKXA 1PG7H 3BH4A 1HNFA 2LFGA 1NIDA 2BS8A 3GI9H 1HHHB 2YPLE 1VZGA 5DJ0A 4AMKH 2WAHA 1U8PB 1ZK9A 5EF1A 4KRPB 1NLDL 4JO2L 3SN6N 1JE6A 2G5BA 3HC0A 2V33A 3WY3A 3LHPH 4F7TB 4E9RA 3B9AA 1CFQB 4IMKC 5C2UB 3HB3C 5CEYB 4XB3A 3P3TA 1A66A 3BN9C 5DHVB 3GSOA 3HS8A 3JWNH 4XX1G 2D2OA 1SMAA 3NJMA 2GEQA 4YLCA 1MFEH 3TH2T 2R69H 1RJLA 2H47C 3NDYE 3RVVC 3QA3B 1NCDL 2X05A 3C5SA 1T1WB 1DCLA 4XVJH 3ZKXC 4ZZKA 5DTFB 4I13B 3QWOB 2FJFB 5F3BB 3AAZB 5KVFL 3DUUB 1FLTX 1QQDA 1YEJH 1Z5HA 3D4ZA 2VZ1A 4N2DA 3UGUA 2EIEA 3CSYA 3OR7A 1ILUA 4O58L 4KJPD 1M7XA 2L04A 4B0MM 3T0XA 1NMAH 4NWUL 2VJ0A 3UJIL 3EGXA 3IFPA 1KACB 4Q9CA 3TYFA 5FC9A 4NRYB 2X0UA 1RZ7L 3MNMA 4LSRH 2IG2H 3IJ8A 1LQBC 3NCFB 2WMPB 3FTGA 3A4AA 1AZVA 1TYJA 1MRFL 2VQUA 1TZGL 5IMLB 3M7OA 3JWOC 5DZAA 2AAVA 3OSVA 4G43B 1A25A 2CSPA 4Z78A 2PPAA 3MLRH 1N7ML 4M8UA 1X5KA 1NUDA 2VXQA 4Y5YA 3VFNB 4U6XA 3RVXC 3F7YB 4C54A 3CQQA 5JR1H 3DETD 4RWYH 4V33A 3GBDA 2XKNB 3LXAA 4OZFA 3MJ8B 4D7PA 4L3CA 5TE6L 2L7QA 3LKPB 2PWGA 3O3EA 2PMZA 1PSKH 3I9PA 5KVGL 1WWWX 1ZA3B 3PQYB 1GCYA 4HUUA 4NDMA 4XO3A 2BFVL 3P77A 1HU8A 5I30H 3VDAA 4J3OF 5IIEB 2NY5L 1ZHLB 1A2YB 5HVGB 3QI9B 5DRZB 1FNLA 2F7QA 3I6SA 1U33A 4MWFA 4YEEA 5CEXB 5IQMA 9PCYA 1VAHA 3S4SA 4A2DA 1E2ZA 1HYSC 1E6JL 3L5JA 2WBJA 5C97A 2BSBA 1M05B 3NA9H 4JPKH 5GSVA 5C6TL 1MCCA 4TLSA 4NUMA 1RZFH 4NFBA 4P5TA 1RURL 3EJYD 3TN0B 4Q9QL 3NK4A 2XZQL 3VFUB 2VUOA 3RWJB 4HJEA 4YDJB 2BJML 4M29A 2Z7ZA 1TEGA 1ZTXL 1O9WA 2XBDA 3IMRA 3U48A 1MI5A 3LN5A 5TH2A 4OAWB 3U4KA 1EEYB 3WJLA 4NC1C 4E5XG 4NN6B 4JPWH 2IGTA 3GSNL 1N18A 4G59C 4F5CE 1D7FA 1I9RH 1NGWB 5EDSA 4LVNC 2CIKB 5KBDA 4PLNC 4WU5B 3LSOA 2VZUA 4MMXC 2H6PB 1TR7A 4A55A 3QQ3B 4ESKA 3HI5H 2QPSA 3JV6B 4M7LL 1IM3D 1BQLH 1EEUA 1UH2A 2KPWA 5LDSA 2BOCA 3H55A 4P05A 4Z95H 5KUMA 1NGPL 1RK7A 3HRPA 3U1SH 25C8H 2BW5A 3UCRA 1D2OA 5I16B 4PU2A 5L2JA 4PJEF 3GIZH 5DC9B 4PJ5D 3NN8A 1HHGB 3HLAA 4MRBA 4BA0A 2HXAA 1NFIB 2F5BL 2Z31D 3CFKA 4L3FA 1OE2A 3D39A 3JTTA 2QHRH 4TUOA 4MNHA 4EUPH 4I7ZC 1DSYA 4X8GA 3IT8D 4LEOB 2HH0H 1MCIA 5SX5K 1PDKB 3DXAE 1H8SA 1NCJA 2X2YA 2NNXA 1SYVA 2IH1A 5BJTB 4JHUA 1KZYA 1XCQA 3WAKA 3IPEA 2NCEA 5GS1C 1AIFA 2GIXA 1EDQA 3PPEA 2WQXA 1OM9A 4QRAA 5AENA 4PI2A 1YG9A 3S36X 3MTRA 1JPFB 3KLQA 1MREL 3KW8A 3D33A 1EZSA 3KYAA 3DV4A 2VXSH 4IBLT 3UBFA 1SY6A 3MV11 4MD4A 1YY9C 3CXHJ 2NNFA 5B1AB 3MRFA 3KWUA 1U6AH 3IXTA 2HP4A 43C9A 4X4XA 4HOZA 1VKXA 3MRNB 4OUUB 1A6ZB 1T4WA 4N25A 1CURA 3NJHA 4H88L 2VMDA 5KVDL 1ZLVK 3RWHB 4B6ZA 1KCLA 2YD8A 3T2OA 5AW5B 1L9RA 1PY4A 1KY6A 4PBDA 1SQ2N 5DJZA 1R24B 1J8SA 3CSTA 3U30C 3NCEB 2VXVH 3NFPB 4FJYA 5DSCB 1PAMA 4WEUD 2QR0B 1XGPB 3CFJA 4PJBF 1J10A 4A2LA 1QP1A 4ZPVA 5IMOB 1Z9LA 3OQ3B 3ZO9A 3P3UA 3BAIA 5IT2L 2MIZA 3P30H 4W1TA 1WZMA 4GXVL 3THMH 3FQTB 4NT6B 4PV8B 3CBRA 5CSZA 2XZCL 3GNML 4CL7A 4FA8A 5KSAB 2CO6B 2Y7QB 5CFAA 3ULVD 4NOBA 4HGWA 2ATAA 3QEGH 3NG5A 4PP1D 1S9VA 2DQTH 4KK9C 5D7IA 2GY7B 4AQAA 4R97C 1HXMB 2H0JA 4ZSOE 1U8NA 4XI5D 4P46D 1RLWA 4H25A 4UINH 3DOHA 5LKNA 4AWJC 5EDXA 3IU4L 5CZVH 1RKRA 3APFA 3VCLB 1FGNL 3BZ4A 5DUPL 4QAMB 4H20L 5EULV 1YN7A 1WFJA 4UANA 2LGNA 3HBQA 2IDQA 5GGVY 4FNSA 1G7MA 2NSMA 1EEZB 1GYAA 3TO4C 1QRNA 1HSAB 1RMFH 4KFZC 4BWWA 1J0IA 2QPFA 3RA7H 1U8QB 4OFYA 3U0PB 4GYBA 5BO1H 1NCBH 1ZDSA 3VXTA 5F6IC 2PO6A 1GW6A 2GT9B 5DO2D 2CLZB 3IMSA 5FEBA 4BCZA 3SGEI 4OFDA 4F37F 4GRLB 4PWIA 3OF6A 4C57C 3L16A 5A3IC 1AXTL 3L5XH 1LE5B 5FYKH 3OGOE 4H8WH 3U2IA 3Q9PA 3ZZSA 1FLRL 2Z4TA 4KQ3L 4UBDD 4MKMA 4QNPF 2CK0H 4EN3C 4KI5F 4LLUA 5DHDA 2B1OA 4OVVA 4HHGA 1K3IA 3T6VA 2NY0B 3TP4A 4BQ9A 4X80L 5AOZA 3D05A 2EDRA 3OMZA 2HFTA 2IANA 5C0DA 4C4BA 2B5IB 1CFBA 3P4MA 1OAZH 1LXMA 2X38A 1KYAA 3PWUA 4M1GH 5JHBA 3UBXB 1A65A 3FQRB 1T7XA 4R4FH 4PB0L 3X3GL 3WD5H 1SJHA 2K3HA 5E9DE 1BEYL 3IWVA 2F54D 2I60H 2NW3B 3UIYA 4QHLB 2HJFA 1UA3A 3UZEC 2MKLC 2VMFA 1Z7JA 3I6KB 3FT4B 2BVTA 3QJHB 5HGDB 5CCJA 3K6SB 2DQHL 3QWRA 4NCC2 4A7UA 1B9KA 2VNCA 5D96B 4D0BA 3M1OA 3W11D 4ZMTA 2H3KA 4JVUA 4HT1L 1KT2A 4H26A 2B1HH 2DPKA 1MCRA 2ZWNA 4LCVA 4V1DD 4Z3JA 2XZAL 3L3IB 3RDTB 4JRYB 3QHZH 1XFPA 3FO0H 5JIDA 3FSWA 2GUOA 5DUBA 1TJGL 5CN2A 3BC9A 4K7FB 3AS2A 1OCWL 4NNYA 4AEHL 2PCYA 3QJQB 3DVNB 3RVTC 3BWSA 5K33A 4L4TA 4QCIB 2DLHA 2WHVA 1RVFL 1R3HA 2V2TA 2A9ML 4P4RB 1LO2L 3BPOB 1T0MB 4NO0B 2D7OA 3SODB 4BZ2A 5I73B 4N90E 2MOQA 2DYPD 4PCYA 3NJKA 4QKTA 2YEQA 3MNZB 1AHMA 3UYRL 5F7NC 1JGIA 3WLBA 4Z7QF 4KGJA 3CPLA 4I0PA 4UILH 1HWWA 5MEOB 1XEUA 2ZONA 3OAYH 3UMTA 3ARUA 3ZTEA 3FK3A 4NNXB 1S7VB 3CLFH 4OZFG 4FYQA 4K3GA 3RWGA 5C2BH 1DBAL 2DIEA 4PJAE 1Y0LA 3HUJE 1TVHA 1A7BA 4OCSH 2VL5B 2C1PB 3TBTA 4KK6D 3A4EA 3DLQR 1EX0A 1QR4A 3RNQA 3U4BL 1MCFA 5GS2D 4GUQA 1E4XH 1V8HA 3GHPA 3W39B 5KG9B 4DTGL 3VYPA 4C4UA 4J23A 1UB6B 2J5WA 2Y72A 2B2XH 4KKPA 4MD5B 3FH8A 3MRHA 3QXUA 1GJIA 2PWDA 4JDEA 5LBGA 2D9CA 2OMVB 4Q14A 3S4SG 3P11L 4DVRL 1JK9B 1ZE3C 5BW7A 1JGEA 4TS6A 1TENA 3LEXB 3QEHB 1P7QB 1KB9J 2WWKT 4Z76A 3LIZA 5HHVH 2KS0A 1N0LA 3KLKA 1G84A 2IPUK 4G71B 3ZU8A 3BQUC 3PV7A 4WW1A 3EG9B 5F7HA 5ANME 3CBJB 5EZLA 4CMHB 3KXFD 3QDMB 2F1BA 3NSXA 4ZUVB 4RDBA 2ZYSA 5CJOL 5AB9A 2HT2D 3B8YA 5B39B 3RGBA 4FTVD 1MJ7H 5J0BA 4KHTL 3HE6B 1T5WB 3D34A 5J12C 2E5EA 3PHOB 4I2XA 3BUQA 2C3VB 3S5ZA 2VLKD 5FA3A 8FABB 3VNZA 2XA8H 4GSDL 3L7FB 3MZGB 1UWGL 4L5FL 1QSFB 1RUPH 4H13C 4ODUA 3CQPA 2QSCL 4FL4B 1D5BA 4M03A 4L3EE 1P84J 5JOPD 3AMLA 1KTDB 3GI8L 2HFGL 1LK3L 4R5VA 5FCUL 4JGNA 1YEGL 4PJ8B 3IYLW 1KCKA 2O5YL 1OAYL 1SHMA 2WLIA 4P2RA 5FYJE 1B3JA 4QXTA 4IIQB 3R8BB 1SM3L 3MNWA 5KVMC 1UXLA 3HAEA 3G04B 3VAEA 4ALAC 1ORQB 1KEMH 1PZSA 3ABZA 4WHYG 1G7QA 5GJTL 3JWDL 1R4XA 4NQEB 1DVFA 5AAWA 5A1AA 3JTSA 4EUPB 1JRHL 3NK3A 5FYLD 5BRZD 3W0WA 4I85A 1K4CB 1IT9L 4M7KL 4XBMA 1ZT7A 1ZHNA 1A1NA 3FZUD 1N5AA 5HDWA 1C1EL 4JANB 5KBNC 4NHCH 1T0NB 1GGCL 2VMEA 5F7FA 1JN6B 5HGAA 4YDVA 3GXPA 3VU2A 3IAQA 4HISA 3CZKA 2ZUVA 4AQ1B 2GK2A 1BXVA 1MFMA 3AB0B 2MNJB 3O6FC 4NN7B 3QIWD 3BUTA 1IFHL 1OW0A 5C07B 1KV3A 2W94A 1Z3RA 4GKNA 2DLFH 5A6IA 1NC2A 3FU9A 4JJ5A 2OZ4H 3Q2VA 2B7DT 2X1XR 4W9IC 4XNXL 1I1AC 2NY4C 1AOHA 5E1IA 5E6IB 4OM1L 4D0DB 3BGMA 3BAEL 1CPUA 1T6WA 1N26A 4O02L 4RFNC 1PKQE 1EBAA 4YHKL 1XF3A 3SYOA 3X14B 3IJYA 3MFFA 5IJBC 3G6JA 5C08D 3VD7A 3EJUA 5IFHL 2ZCKH 2VW4A 1EGJL 4ZFFA 3MYJB 2ZJSL 3K5SA 4HETA 2WGNB 4BSVA 1F58L 1TJMA 4ZTOH 2F5AH 4MNQD 1ERNA 1JPTH 2IALB 3LNIA 3V6ZA 5ITFB 3PJLA 2PW2A 3G5WA 4PJ9A 4QRQB 4GKLA 2WBXA 4AXWB 1IM9A 2ZKYA 1DCEA 2ESVD 4PM1A 1CJYA 4HCFA 4PSPA 1KC5H 5D6DA 2VLRE 2O1AA 2VLJE 5E51A 3UFIA 1QUNA 1CMOA 4W9HC 4QLWA 3UTTA 3T2NH 4YHZL 2Q8BL 3CV5A 3K3QA 4EI5D 1RJZB 2R2BA 1BFVH 3UP6A 1NCCH 5C0FA 1M53A 1S3KH 5IFAL 4NYLA 1JZ3A 3GKZA 1JZFA 3EYSH 3FU8A 4G6AC 2X3CA 1A6TA 3FRUB 1HDMB 2BRRH 3VB9A 2X44D 4GG6F 4FYTA 1RQ5A 4B50A 5LGYA 1H3GA 3D2UB 3E0GA 5IWLA 1DVXA 2IFFL 4NGHL 4OSUL 4UIKH 1ODAA 1RZJH 3G5XB 4HH9A 4P3DA 3IGAB 1NAKL 2GBTA 2X9YA 2ZQKA 3FN9A 2ZXAA 3UPRA 2AAAA 5CM1A 3MRKA 2Y69B 1FGVL 3KL0A 5GZOA 1JGDB 3RWEB 1T89C 2A9NL 3MGTB 1OK8A 5IM7B 2XWEA 4B9FA 5EN3A 3IKCB 3UERA 2OYPA 1OWRM 4CNIB 2EAEA 4G82A 1FA4A 3CFQA 4UU9A 4LNRA 1IQDA 2AVFA 2DIAA 4FF9A 3GSQB 3T3PE 3LEYL 4P4KC 2QGDA 1CDCA 3ALXA 1OSZB 4AKPA 4M1DH 3SEPA 2R1WB 2XTJD 3F01A 2XV0A 2CWRA 4ZS7H 3AGWA 3POHA 5I1JL 3P9LB 2HKHL 3M46A 5TJWK 2DD8L 1MCSA 1UEMA 2XRAH 4NQUA 4ODWA 3EADA 3DUSB 3MYZA 5JW3L 4YWGL 4Y2OA 2CGZA 2BXYA 4XX5A 3J2PA 4U7MA 4LL9A 1FBIH 2BSSB 2W9EH 1B0WA 2P43B 2R0LL 2CRMA 4WV1A 5C0AA 3VXQB 4CKVX 2ENSA 5AW6B 3RIFK 4B9PA 4MYPA 1DVUA 1AZNA 4O5LL 1JDAA 4PV9A 1JZ4A 2ZOKB 4ZXBB 1ADQH 2BSED 5I66A 3NZHH 4JFFB 3QUXD 4ERSL 4BA8A 2JLLA 2J1WA 1W80A 4XRCA 5FYKU 2GJJA 4LCYA 3B9KD 1KGIA 1UOKA 4AGLA 4XXCC 3IAGC 2D31B 5GPRA 1EXUB 3VXRB 2ICWB 1AFVL 2SODB 4Y7MA 3GMRA 1P4IL 4DO4A 2BSTA 3D6GA 2NY6D 1F42A 1WLHA 1K4DA 3QUYB 2VAJA 3AQXA 1JHLL 2BVPA 2WQVA 1AD0A 5PAZA 1W0VA 5D71L 4JAMB 1I7RA 1GGIH 3KPSB 3QAZC 5FHAH 1UYWL 3OJDA 4GKZB 4JZNA 4HULB 1FFQA 3FOLA 3W3BA 3EYOA 1YJDC 2IAMC 4QHKJ 5EUKA 4QJ5B 5D7JA 2IWEA 2VRQA 2OSLA 4PS8A 1IGTB 2ADFH 3MRIB 4KMQA 4N5ED 2F8OA 4DN3L 2BCMA 4PRHE 1BBDL 5IB1A 1BXUA 4NENB 1E40A 4X7SH 5IW6A 3ZGHA 4HUVB 2A77L 3NIDB 4G8EA 2G3MA 4E41E 1TUPA 4HPYL 5C9JB 1OSPH 3ROOB 1FZMA 3JSSA 3AT9A 4WK2B 1VGEH 2F8VA 2OJZL 2Y6TE 4K5PA 4KK5D 3IDUA 2CKBL 4HKXB 4HSAC 4W4OC 1JV5A 3A67L 3M8OL 4OKVA 1Y18A 2CJSA 2VAAA 3R8QA 4J3UA 3RWDB 5DC0A 2RQ8A 4FQQB 2WBKA 1MEXL 3EYVB 1LEIA 1YN6B 1J0JA 3RG1C 1MFVA 3V52L 2EH8L 4ADJA 2WOBA 4PTTA 1LO3H 4FS0A 1GSKA 4OCYH 4U05A 1GH7A 3CHOA 2X6UA 3GBMH 2JCCA 1G1YA 3FUJA 4PPTA 2A0LC 2JQMA 4XP1L 4LZKA 3PU7A 4TUKH 2CUAA 5EUOA 1M3JA 2P5WD 3U83A 1RUML 1QLEL 4UT6A 5I18H 1YY8B 3V6BR 1IC1A 4P23C 5AB2A 1HESA 1ZSDA 1PG7W 3DYMA 1H8OA 4UDTB 3CLEL 3T1FA 2DQUL 3GMLB 4GUCA 4W9DC 4J12A 5L2KA 4F1SA 1C5DA 4R2GB 3MRQA 3ELQA 3T0EA 4UIMA 1CFTB 4J6RL 1LD9B 2DQIH 1KXVC 1AOZA 1ZVSA 5EZIL 3DBXA 4JFUA 3TFBA 2FWOA 4DGIH 2HSIA 5FS5A 4QF1B 4K7PY 5IUCA 4MJIA 5CZKA 1PGRB 2Y06L 4G80A 1K72A 4FFZH 4B96A 4U6YB 4MVBD 1GMEA 2Z64C 3S35H 4WJ5A 4KRPD 3LS4L 3NSDA 5EU3B 1AG0A 1S7WB 3WY4A 1QFHA 1CU4L 3EFOB 4ZTPL 5B38A 3TU6A 5I2IA 3RY6A 4Q4IA 4GUPA 5I71B 4X8CA 4KJPC 5KVEH 4HC1L 3ECBA 4LCCB 4G7VH 1UATA 3K1KC 2EJ1A 3HLKA 1KBBA 5ELIA 3ZE2F 3HAEG 2M1KA 2ZUSA 4FQXA 2YK1H 2JK5B 4HPOH 3AJ7A 1H9VA 3H0TB 3KLSA 3HTLX 3ZHLA 1HJCA 1Z66A 2VRKA 4JPQA 2J6WA 3N40P 1KB3A 4PGEB 1MUJB 5EPMB 2QPDB 3V0GA 3MACL 4EI6A 3QULB 2HWZL 3WKPA 2A6IB 2N0KA 3I3DA 3OC8A 4OIIL 3QUKB 4QRUA 2DS4A 3IK2A 2NUPA 4S1QH 5GGTL 5I0DA 4G72B 2ORBH 4M6OL 2GITA 4IRJA 2A3TA 3DETC 4R90H 3MOAL 3N06B 4U31A 5ICYA 3PWPB 2WBWB 3TJHD 4X9FA 4X7TB 1DUZA 1J1XH 1T04A 4DCQB 3P2DA 4HQQH 4Y19A 3SY0B 1QO3B 4YIQB 3GUTB 4IDLA 5EFIB 2BHUA 4BJLA 1DBMH 1HQRA 2CLRB 1T1YA 1SOKA 2FQDA 3PHAA 4WWKB 1X5ZA 5L88H 3CHSA 4JFEB 1Z6JT 4NO3A 4XTRD 1HS6A 4CUCA 5MERA 5MENA 2VM9A 3M17A 4MNGE 3GMQA 2WSKA 4NQVB 4HCRL 3VI3A 2X7LA 2ZWZA 1BWMA 1S7TB 2JB5L 3PQYD 5DK0B 1HH9B 5IB2A 4FQCH 2UVFA 3KL3A 4X7DC 2QVFB 2WXMA 4X6FB 1HHJA 1I9JH 4K3EH 3T0BA 2NZ9C 5DA4A 2JSFA 4PHXA 3EJYC 1RZKH 4OZFH 1IKFH 2AITA 3KR3L 3PGCB 4PSRA 5TGBB 5FO9B 5E6UB 2VITA 4MB1A 2P8LB 3SDDD 1DJIA 2J3SA 1BF5A 2QPEB 5F0MB 4AGOA 3AREA 4NQSB 3BT2L 3RIAK 3SIKA 5DJ8A 1IEBA 2XI9A 5TF1H 3IKKA 3TN0D 1RZGB 3PHSA 4JY6A 1QZ1A 1DE4A 4K71B 5F8QC 1F6LL 5C0GA 4ABWA 1QVOA 1DDTA 3MA7A 4W93A 2ZX5A 1WZ1L 2X4TB 2DAVA 2QQLH 5CWSA 3J27A 2GY5A 3GTNA 3Q6GH 1QYGL 1PZDA 2AEPH 2X1PA 2YKKA 3ATEA 4FG4A 2DI9A 2X4RB 1T20B 4N6QA 3HPLB 1ZANH 1PPIA 4GW4A 3PWJB 2B9AA 1U41A 2EE3A 1NEZG 4CSSA 5IQ9B 4C83B 3PUCA 4HP5A 1TSRA 2APSA 4IRSD 3STBA 3C8KA 5E4EC 1MWAH 2VSCA 2XBZA 2Z35B 5E5RB 3MMEB 2WXPA 4OT1H 3VFGL 3OKLB 1U91A 3D69A 4BFIB 2WYZA 3T5WA 4PGBB 1J5CA 5HY9B 1UUNA 4KKNA 3ARDB 4HCGA 4U1SB 4S0SD 1ZY9A 2X6VA 4K9EH 2EYRA 2AEWA 3F84A 3T0VA 1OP3H 2C9VA 3G3LA 3FQ2A 5DCCA 4LL1A 3U9PH 5DA0B 2WZ6A 5EWIL 4E5XB 1FORL 4HWEH 2R0KL 5ISZB 1NCNA 2BMKB 5E8NB 4Z7UB 3OHXB 2GJ6E 5DFWH 3BUIA 5F7MC 4X6CB 2OMTA 3DYPA 3VTMA 2WXKA 4MD0B 3C6SB 4JM2D 1R3JA 3QXDA 1N64H 2HFFA 2DYSB 2FTAA 4OZIA 3GGWB 1MAKA 1O0VA 4CVXB 4G1MB 2ADJB 4KITB 4OJEH 4MA8H 4RGMB 4E42A 3ZR5A 1BFSA 4N2IA 3LKRA 4PJXA 4UF7C 4D3CL 4B97A 4C47A 3HFFA 4U4IA 5ANHA 5HYQB 4WHYH 1S46A 4G6JL 3SBPA 2YAMA 4M6ML 3WIIH 4OF8A 3LB6C 5ESVA 1UA6H 4QHUA 5D93C 5C0JA 3CDCA 3MXVL 2M8XA 15C8L 2WK2A 3HN3A 2J88L 5EO1A 4HWZB 3ULVC 3MLTA 2A9DA 4JUSA 4LE8A 1CDHA 2VTFA 5FO7B 4YDIL 4DP8X 1GAFH 2EIMB 5I6XB 3WKQA 3E8UL 3BCFA 5JTWA 4Z7AA 5EU5B 5D1QA 1VFUA 2ARJQ 3UEZA 1S7RB 4J6IA 2GSGA 3QEQE 4XI5C 3O0LA 1JTTA 2PP7A 4P46C 4G42B 4XXWA 1ZSHA 1TPXB 3V5DB 5KSAD 1USZA 2RFXB 5ACLA 2ITDA 3L9YA 5LDUA 2BM3A 3MCKA 2YXVA 4ZQKA 2BWDA 4PRIB 1VJSA 4X98B 1RUQH 1RUAH 3T3MF 5KYXA 2IEPA 1Q9OB 1J7VR 1LEKA 3SDXB 1F6AB 2Z34A 3C2AL 3KYMB 1IILE 1PAZA 4JO4H 3FUEA 5F1OB 3ZQ9A 4NQCB 1XF5B 5DO2C 4WCYH 2A74C 3BZFB 2G9HA 1Q1PA 5EIVA 1KIPA 2VC2H 5LXGH 4FHJA 4ODHL 5IHUH 3SE3A 3CHPA 3NIFB 2XWRA 4K8RD 4IM8A 3TBVA 5B3JF 2CGRL 4UBDC 3TL5A 5IJCC 4FQ2L 5HHNA 2PYEE 1VCBC 3Q13A 3VI4B 3KAAA 4Y16B 5ALCL 4JKKA 4TVUA 3ESMA 3H9YA 3B2PA 1L5GB 3TWCH 1QBBA 1RK0A 3PWVA 1L6PA 2V3FA 2C7FA 1MIML 3UCQA 4AQZA 4F2MB 3ZMNA 3CNKA 2AMGA 2AQ3A 3EO1B 2PLTA 1XWVA 3FT0A 5ENWB 4WWOA 1KTJA 4S0TD 4GP5B 4XC1H 4ZOCA 4F9PC 3DV6A 5AYUL 3S8FB 4QTHA 1ID5I 2AANA 3QJZA 3IDJA 4HMCA 1DJWA 3DX2A 2NY0D 5ADOH 1ZPLA 2BZDA 1RZIB 2HLAA 5SWQA 1WT5C 4JFZH 4R7VA 3O0RL 1OEZW 1YUHA 3F6IA 3H9SB 1XGYH 4GO9A 4B0MB 1YEIH 1OTUD 1Q1JH 4PW4A 5FDYA 5ACZB 5IG7A 1CD9B 3SQOL 2FGWH 4M43L 4A2EA 4NC1E 1UWFA 3BP7B 5MHSE 1RIUL 4RMWA 1M4KA 4IS6B 1KXTB 1KENH 3VSUA 2XPZA 2NLJA 3QIBB 2V5SA 4XCNA 5SX5H 4AT6A 1BD2B 2UZYA 1D6VL 5B38G 2CHWA 2JKXA 4ZI8A 1KJVA 4M5YH 4NRXA 1KGWA 3FQYA 5D1ZA 2PW1A 5FUZL 2ROYA 1J1PL 5HTSA 3HG1A 2WZPA 2R9HD 4GKOA 3EH3B 4JRYD 4NPYA 3RDTD 4XVTL 3TV3H 5J1TC 5E2TH 5GRZA 4P9HC 1BAWA 4K5NA 1R0AH 3O6KH 4PRNB 1H3PH 2CNYA 2Y36H 3T65B 4BFKA 1AGCA 3FUNA 4B5EA 3MLZH 4G8FA 1EAJA 3U4EB 1F4WH 3KD4A 3A6CH 4ZS6D 3N44F 4NO0D 4PBXA 4UB0H 5E08H 1B4JH 5DJ0B 5I1KL 1TJIH 3FT9A 4NSKA 4A66A 2EDWA 3ZT5A 5MEPA 4M62L 2G5BB 3HC0B 4DJMA 5BZDA 3SBQA 4QRRA 4BK4A 3JV0A 2QFPA 2Z8RA 4N20A 4PREB 1WITA 3FYIB 2GEEA 1E7VA 2VXUH 3GSOB 4KK6C 5HDBE 4ICWA 1IO4C 1J9SA 2R15A 3QNXA 1AZUA 3VJ6A 4PJHF 1L0XA 3IWUA 4QLRA 7TAAA 3ZDYF 4V2CB 4TSBH 3WGVB 4XPTL 3WI9A 5KBPA 1RJLB 4JFYA 5TPWH 3C09C 1G6RA 1NFDB 1ZCRA 3AS0A 3U1QA 4S1DD 2KI6A 3WFEH 1NWPA 4YR6A 4PJ7F 2O61A 3ZIMA 3NGBB 3WNMA 5D5MF 4Z23A 2VDQH 2FJUB 1ZT4B 3BI9X 3QDGD 4AIZA 3OR7B 3GXMA 2BOLA 5FW6A 3PGFL 3IXAA 2WJ7A 3EGXB 1CFVH 1IGFL 4C56E 3TCTA 5KS9E 4XCFL 4E9TA 3S36L 4N8UA 2X28A 3ARRA 3FTGB 3IJ7A 3P4OA 3KJ6H 3BZEB 1D9KA 3D0AA 3ARBA 3ZTJG 4QUOA 3VQLA 3CFCH 1NGXA 4HYTB 3CZGA 4WO4B 2KDGA 3MV7E 2EKSA 4MFHA 5DMIH 4Z78B 3EO0A 3OB0H 3HMXH 4XNZC 1LEGB 2CPUA 2HT2C 4POYA 3P9WB 1XQ4A 3C6LA 3VG9C 1FDLL 4Y5YB 4ES8A 4U6XB 1L7IH 3C5ZD 4F5CA 3G5VB 1MW3A 4FNTA 2XNAA 4OZFB 2QQKH 5E1HB 1R6VA 1LHZA 3DIFA 1FZOB 4JRWA 4PN6A 5T5FA 2IH3B 3QDMD 3GXIA 5ITBH 4GP8B 4DWHA 5KSUB 4M3JA 4HUUB 4NDMB 4NPJA 3G08B 4OIAA 4CSZA 3P77B 3LIZH 4GS7C 4E9VA 1JP5A 2C9XA 3HE6D 2YQ2A 3RFZB 2XVBA 2KT6A 4P5KA 4YO0B 5AVWB 3K2IA 5CNHA 2NX5E 4Z18A 3PNRB 3HBPA 1ZV2A 4F8NA 1YLBB 4G8IB 2J1KA 4G7YH 4U6VL 3MV8A 1ET7A 5IW3A 1I1FB 1H3UA 5JA9A 3DXAA 3BSHA 4XBPA 3RE0A 2XCMC 1HQ4B 1QSFD 3HHSA 3GKWH 2AK4B 3U25A 1I53A 3DJRA 4P5TB 4PRBA 3TT3L 2W65A 1UWEL 2DQEL 4PRPD 5IW1B 1GC1H 4R8WH 2WO3B 1X9QA 2R4RL 4PJ8D 5GRJL 4NLHA 5DEFA 3V8CA 1MI5B 1E4JA 5TH2B 3V6OE 5AG8A 2IFGA 3PDDA 4NZTH 3VE0A 1NBVL 2HVJB 1NANI 3KDMB 2MQ0A 4LCIH 2EEDA 1OB1A 1MWAB 3MLUL 3U7YH 4FJZA 3LSOB 2V2WA 4X5LA 3R1GL 3EOAA 4ZUWB 4D8OA 4CC0A 4EZKA 3UTQB 2BOCB 1CDBA 2FX7H 1UC6A 4J8RB 3SDCD 3UROR 1ANUA 3ML8A 4LLQB 5EC2A 5TDPA 1U3HA 3QHFH 5HHQA 3HAEH 2VDOH 2D9QB 3BP5A 2HJLA 4HUWA 5BV7L 1KCBA 2YQ3A 3HLAB 3NQKA 4P59L 3EBAA 5E4OA 4L37A 3W9DA 1PY9A 3JTTB 4QRSA 1LMKA 1R17A 3QJSB 4MNHB 4TUOB 1NIBA 3GI9L 5I0WA 2G0KA 1FZJA 4MX7A 4KXDA 4Z5RA 4CGUB 5I1LA 4AMKL 5BVJB 2PF6A 3WUWB 2XQBH 4EIUA 1XCQB 2UZIL 4FLHA 5C07D 5AB1A 4L18A 3ECWA 1AIFB 1KLGA 3SBRA 4ZX3A 5CP7A 2DWDB 3HEIB 3LHPL 5FECB 1KTCA 4ISVA 1FYTD 4DAGH 3HFML 4YXHH 4H0LC 2NXZC 5C6WH 3O81A 4YQXL 4ODBD 1XL6A 3P0VH 2R2EA 2R59A 3EYQD 1XF2B 4ZSOA 4O2FB 2QLYA 3DV4B 2I25N 5CEZE 3VYNA 4TVPH 4MD4B 5AL0A 4AL8C 3MRFB 4IIZA 1KB5L 3FC8A 4XVJL 4X4XB 2QVMA 4PY8J 4M9OA 4KZCA 3E9TA 3WTWA 1VKXB 4ZZFA 4EI5C 1YEJL 2FT8A 2O5ZH 1A7PH 3SQRA 3RI5K 1PL3A 1HIMH 2PWFA 3REVA 5IQNA 4NWTH 1IAII 3HCVA 1L9SA 4KH9A 4LSQH 2MOGA 3ILQD 5IVXE 5DJZB 1EDHA 4LSRL 4PLOB 4A68A 2QV2A 1ET8A 4C4KT 1T66D 2VR8A 1MCWW 4GOSA 5D7KE 4R7LA 4ZPVB 1KBGH 4KHXH 4WKZA 4E68A 4UM9A 2BVOB 2JXMB 3WOVA 5ICXA 2J21A 1XF4B 2DMCA 1DQJA 4TRPH 1MOEA 2AGJH 5IHBA 3S9DB 1WA1X 3HPJB 3MLRL 2A6JB 4G1EA 1KTLA 5CSZB 4X5WA 4Z7NE 5JR1L 3D2UD 1GTNA 1PZ5A 1YAZA 5AVUB 5ICUA 4RWYL 1K2DA 4FNLH 3IGKA 1JVLA 2VQTA 1MFBH 2VC2B 4RGOH 2WVUA 4P2OB 1T3FB 5FXCH 3IAPA 1S9VB 1ACYL 5K93A 2CKNA 1PSKL 4OZGB 1UA7A 2LFEA 3ZW3A 1U8NB 4ZYKB 5FV1L 3GLEA 2Q5BA 4RBPH 5I30L 1IBYA 2CUMA 2FYVA 2XTJC 4N9OB 4GPVA 4HHAA 3BH8B 3BZ4B 4A6YL 3B5GA 2Q6WB 4X6EA 1E4WL 3P2TA 1G7MB 4XPGH 2JQAA 5JW4M 4QRBA 2FSEB 2X10A 3BMVA 4N26A 1AS7A 1OAKL 3H6AA 3NA9L 3CVBA 4JPKL 1E28B 3CUPB 3SDXF 3VMPA 3VXTB 2PO6B 3NAAH 1T6VN 1RZFL 3EJTA 2CAKA 3QRGH 3HZKA 3QUXC 4MQSB 4NP4H 4WUUB 3FXIC 1TTUA 3HS9A 1MF2H 4JZJB 1GGUA 3B9KC 1CE6A 4JFXB 5JA8B 4M5TA 3UP1A 3K8MA 4P9ML 4FDWA 3SO5A 4XN4A 4IKJA 4H0HB 3HG2A 2ZUQB 4JPWL 3NIFF 1MH5A 2BVYA 2L7JA 1NPNA 4ZXBD 1I9RL 2NY6C 1TMCB 4FFYA 5DD3H 4JY4A 3KPNA 3FO2A 4LLUB 1MPAH 1F8TL 1JDCA 1ZJBA 3TBBA 3HI5L 4WFGD 4U1JA 1XGQA 3JUYA 1SBSL 4Z95L 2V5MA 2PWEA 1KIRA 3U1SL 2WBJC 25C8L 2IANB 4BKLB 3Q06A 1SXAA 3GIZL 1DVQA 3PWUB 1MCPH 3QUYD 5LGHH 4BXVA 4E9XA 3A5VA 1J11A 3I02B 1OCZB 5IK3A 4OF7A 2QHRL 3N1PC 2YXMA 5KJRH 2HJFB 3QQDB 2HH0L 2FBJH 3KZ8A 1LQSR 3SOTA 5EBLA 3G9AB 3OKYA 3N1FC 5EMYA 5I5MA 1EAOA 2CHDA 2WVTA 1WPCA 4PJAA 3RIKA 1JYVA 3IGUA 1A6AB 4D0BB 4PV1C 3CFBB 3FQ4A 1M6UA 4H26B 4Z7WE 4JDVB 3GS7A 3KLAB 2KYIA 1M71B 1NDGA 1IL1A 3VFOB 3ME0A 2NSQA 4JHVA 4E9WA 2VXSL 2GUOB 2WQAA 2W38A 1BQHG 3DHPA 2W9LA 4G7QB 1U6AL 5HGHA 1I1YA 5IVNA 1KFAH 2BY1A 3TBYA 3BLPX 3EGDB 4L4TB 4LLVA 1QBMH 2XQ0A 3WFHB 1DVTA 2V2TB 1CD1A 2VIRB 4WNSA 4KGLA 4ODXA 1HKLH 4E9SA 5HBBA 1FNEA 2AKRA 4NJAH 1S7UB 3VWKD 4FC3E 2JI1A 2VJ8A 4MJ2A 2VXVL 3DUHA 5KBLA 3LN4A 4MMZC 5AZEH 1HWHB 1L3NA 2VDQB 2WWKO 5ANMA 3K91A 1URLA 3P30L 3ULUH 4HU8A 1HT6A 2ADGA 3CPLB 3THML 1JERA 3FSVA 4QOKB 4AEIL 1UM4H 2D0FA 3CH1A 1A1OA 3TGXA 1EHLL 5JPNA 1YEHH 4XBEH 3S97C 2EE9A 2FJGA 3ELAT 4R2GD 5CFHA 3TBTB 4MVBC 4F7EA 3QEGL 5EIIA 3IVKB 3RNQB 4KRPC 1QD0A 2DQTL 3VDBA 4QIRA 1YNLL 4O00A 5GRYA 4OD1H 4F7MA 3UACA 5T1LA 5FM8A 1YC7A 3NCYS 3MRHB 3QPXH 5CZVL 1COBA 4L3EA 4DPAX 1X5JA 5KZCD 3WFBH 1T83A 4LBEA 4I1RA 1KYDA 4O2EA 5J06A 3ETSA 4EEEA 2FIKB 1RMFL 4GI9A 2UUDK 4LDLB 1DBKH 2X3AA 4IBYA 5EN2B 1ONQA 2MPAH 2NDGA 2G2NA 2B1AH 2KZBA 3RA7L 4Z76B 3NTCH 1N0LB 1NCBL 4W81A 4AM0Q 3DNKA 2PCFB 2V37A 4WW1B 3U36A 3ZDZE 3FO1A 1MVYA 3L5XL 1FWXA 2OI9C 5BZWA 3C12A 5FYKL 4X83A 4D8PB 4M61A 2Y9RT 3CSFA 4H8HA 3X11A 1K85A 4L8SA 4B3EA 3H8NA 1A4AA 2H4EA 3K4ZA 1X5HA 3TJHC 4A39A 3PAZA 4KH2A 2QJDA 3AG2B 2CK0L 4NNPH 2ATPA 2X5PA 3PWNB 4JFDB 5IVOA 2WXNA 4NOFA 5EORH 5IHZA 1MCEA 1E5CA 4XNMA 4ZNEA 3CFDA 4NQQA 3BGAA 3UBXI 2K6YA 3V4PA 5BVPH 1CR9L 3F7PC 3SOBH 4XTRC 3TBSA 1HCVA 2BO0A 1D5BB 4LP4A 1AE6H 4M1GL 2Q7YB 3BGFC 3RJOA 1KGCE 1RD6A 3UZQA 1A47A 3BKYL 4R4FL 1HL5A 1DQQA 2X4OA 4LQ1A 5HI5D 3WD5L 5HYFA 3DYOA 2I60L 2XBTA 1A6VL 4FYRA 2WLIB 1PKQA 4P2RB 2D4DA 2PABA 3NSCA 5KVGE 1PFOA 4QXTB 4HALA 4YSPA 4BH8A 3MNWB 1P1ZA 1EAQA 2D0GA 3HAEB 4MA1C 1D5RA 2VDOB 5SX4I 1JF1A 4Y9CA 2X89A 3SDDC 2WKOA 1G7QB 1FO0L 2XDHA 1TLKA 5HYEA 2B1HL 1DQDL 1FNSH 3JTSB 1AQDB 3B3BA 5IMKB 3OAUL 1V54B 3TEYA 5J11C 5EO9A 1D5MB 2YBRA 3MBEA 3O11A 1QFOA 2C5DC 1JF5A 4DPCX 1ZT7B 3KPMA 3FO0L 1ZHNB 1Q90A 3PABA 3TN0C 1N5AB 4AV0A 5CCKH 3ROLA 1WTLA 2CXGA 3TX4A 3SD5A 3HVNA 2VLRA 5HGAB 4RX4D 4YDVB 4LF3A 1TTFA 4NQDD 5DS8A 1QG3A 3ILEA 3QDJE 4RRPM 3MJ7A 4P3CH 4F57H 4ZMAT 5FAAA 4G83A 2Y7SA 1CN4A 1ZTXE 2YPLD 2WUBH 5G4OA 4D94A 2HX9A 1IC4H 1OWWA 3C60D 1BQRA 2GCYA 4TOYH 4Y88A 2AV1A 4JJ5B 4PCSA 3J7HA 3BPCB 3LMJL 4X8JA 3VXNA 3RWIB 2ALAA 4G8GA 2B16A 5I74B 3BAKA 3ZTJH 1RUKH 2ODHA 3BGMB 4IRSC 4JPIB 1T21B 3IJYB 4UILL 2CALA 3FSAA 2CG9X 3G6JB 3L2MA 5GGUA 4O4YH 4H8QA 5C2BL 2IH9A 3BPNB 1QI5A 2AF2A 2IPKB 2GSMB 4FTDA 2ZOWA 1MLBB 1IE4A 3CG8A 3KNBA 3QCTH 1MW1A 5CZRA 3T8MA 2P8MA 4HLZG 2PW2B 4PJ9B 1JYXA 2HMID 3GRWL 4TQEL 2VQ1A 3MA9H 1IM9B 2E6QA 3HNVH 4KVCH 2LR4A 4BZ2H 2N1TE 3GPEA 3P0GB 4AKQA 4XMUA 3D5OF 5A2IH 2XWDA 4XNUH 1BWWA 1KGUA 4KXZH 1XGTB 3VVVA 4JK0D 3VTTA 3OXRB 4DZBB 1TO5A 5DYFA 2KL6A 2P48B 3QIUA 3ARDD 4JM2C 4S1RH 3IETB 2AXFA 3CD4A 4FEMA 4N6RA 4PWKA 4ANXA 2SEBB 5FF6A 3JUZA 1ZGLA 1RPKA 2YARA 1UH4A 4JDTH 3MN8A 1A6TB 4MJ6A 3LKNB 5ISZD 3CAFA 1YYMH 2NQ3A 3EH2A 2LABA 5HHVL 2EDBA 1MHCA 5ILTH 4XOCA 4LLWA 3TT1L 1WZLA 1IJ9A 1J9RA 4HH9B 1LLAA 3S5LA 4BFFA 2E27L 3UPRB 3NFSL 3MRKB 3CN4A 4MDIA 4PWGA 4QYOA 4UYQA 1NEZB 3UAJA 3SCMA 3T8VA 5KVDE 2BXZA 1ED3B 4Y1AD 2JJWA 4EZJA 4NZRH 1YNKH 4GMTL 1MJ7L 1Z2KA 3M7FB 3QC6X 1WIPA 3L9RA 1ZAGA 4HWBL 2NY2B 4UU9B 4LNRB 5F3HB 5JORB 1CGXA 3DTXB 2ZX7A 4MQ7A 2BP0B 3H85A 2XA8L 3U1PA 2A99A 3U82B 4N0UE 5KSAC 3WTYA 4NIYE 2OL3A 2DKSA 5D7IF 3EFFA 1RUPL 1FZKA 5CF3A 1P4BH 4LAJH 1OCOB 3BIBX 2YZ1A 4XVUC 1I8IB 3V0WH 3IF1A 4ODWB 1L6XA 4LEBA 3Q2WA 4OJDH 1I4FA 4PRHA 3RKPA 1TU2A 4Y2OB 3VU1A 3F65A 4E41A 5C0AB 4N8PA 5D7EA 1UOWA 4OJAA 3WIFA 1UG9A 2J1XA 3AT0A 5FGRA 3DDFA 4PRID 5I66B 3LKOA 3GINA 3X13A 2GTQA 3LD8B 2RMNA 4XRCB 3MCLH 4LCYB 2J12B 4GFTB 4Z7VE 4OZ4A 3KLLA 1R9FA 3UYOD 2J2ZB 3DMMA 5HGBA 3EJZD 4NQCD 3SKJH 3PXJA 1CQYA 2KQNA 3T9WA 2BSTB 4FFVD 4NHCL 1IU1A 4BZ1L 4U1GC 4UT9A 2CDFB 1UCBH 3T4AB 1BIHA 2ITEA 2DWEB 3GD1C 3R4DA 5A7BA 1UOVA 4JO5A 3OJDB 4I77H 4JZNB 4WDIA 3RB7A 4OGQC 5F96H 3FOLB 5FGCE 2YHGA 2G4GA 3MROA 4UAOB 3RUGE 5EUKB 3NDZE 3E2HB 1W2KT 5D7JB 1Q9KB 2NY0C 2DLFL 2OZ4L 3GEFA 1SJVA 1DVFC 1AGEA 1GGBH 2NR6A 4LSTH 5IB1B 1UGNA 4G8EB 4BE6A 2B5IC 3RDJA 2HVBA 4PJCF 3L95B 3D18A 4HJ0D 5B7FA 1JZEA 2RD0A 1FZMB 2ZCKL 3L3OB 4YOKA 5EIIG 1C9SA 1O7DC 5DDHB 5DJ2A 4ZTOL 2F5AL 5GJSL 1B90A 1ULVA 4R0LA 4OKVB 1Y18B 1JPTL 2VAAB 2N01B 3H9SD 3ZZ1A 3AS3A 1NQBA 1S9XA 4LOFA 5BNXD 3DX7A 4MJ5A 3OKDA 5FW7A 4DEPB 5D96C 1EHKB 1FUNA 4Z7IA 2V4LA 1OW0C 1XMWA 3WFZA 4PTTB 3K72A 2APWA 2D7TH 2VN5A 3MRGB 3S37H 2PR4L 3T8XA 4N0CD 4PJ5E 2R9HC 3RDTC 4N8CH 4ENED 4F8QA 3T2NL 1I85A 4IKNA 2OMYA 4ZPTB 4EE2A 1A3RL 3HJEA 3OD3A 3QIBD 2WWOA 1ZVHA 1Q94B 1BD2D 1NCCL 1ZHBA 5EUOB 1S3KL 3TLRA 3X1BA 4CVUA 2BOBA 1MIEH 1ZSDB 1S7XA 1SJEA 2EINB 4JRLA 4JUTA 2BRRL 3S34H 5K9OA 3PV6B 1JGVH 4HS3A 5HSFA 3T1FB 3QVAA 5BCAA 4ZS6C 1E5BA 2V7HA 3SGKA 1NL0L 3ESUF 2ZAGA 3MRQB 1FHNA 4FNPA 5DWUH 5AAMA 1WEJH 3CZNA 4UIMB 3T0EB 1PLBA 1MCDA 3CPUA 1R19A 4WFED 1LWJA 3UTZA 3VRLF 4C55A 4NI3A 1MXDA 3EJCA 2B20A 3L1FA 4P0DA 3L3GA 1E30A 1XH3A 1Z9MA 4LVHB 2VDLH 5BOZG 3BDXA 1C8QA 4G80B 3D85A 4JY5H 2OR9H 3HZMA 3BDBA 4XWOD 5JIMA 1AYOA 5J89A 2P28B 4L1BA 4YSAA 5E2VH 1G7IA 4ZUSA 2ERJB 1BECA 4HVBA 4ZD3H 4ZS7L 4MNGA 4UM8A 1VEMA 4J3SA 4XN9A 5AW9B 3BVXA 5AVXB 2VLMD 2XRAL 4Y2DB 2F7PA 3X1GA 2AQNA 3WO4C 1QZNA 2IWKA 5GZOC 4FQXB 5JPMC 1AHWB 2W9EL 4Y9FA 1MVFA 4MS6A 4BFGA 2YSTA 4NKIH 4QXVA 4NEHB 4LASL 2CIIB 3LRGA 3PAVA 4N9GA 1ADQL 1S3RA 3BYTA 3NZHL 4IHBA 5L8JB 3ULVE 3KBEA 1TNNA 2GB2A 2ICWI 2NUPB 3SE4A 4AW7A 3ZE0E 2YD4A 2FUQA 3U0TA 4IRJB 3ZYOA 3C5ZC 1PEZA 5ICYB 4Z7OE 2FL5A 2DKMA 4BFBD 1DUZB 3K6NA 1T04B 2CM6A 1UVQA 1H15B 2L4OA 3D06A 2FHFA 3IFOB 4LAQL 5I8OH 4WO4D 5LWYL 1CIDA 2OA9A 4UQIM 3TBWA 1CF1A 1ET5A 2EXWD 3FFDA 4ONFH 2UZXB 2YPKB 3H3PH 1GGIL 4I0CC 1T1YB 4LLDB 1XBRA 3ABKB 2AHIA 2E0PA 4NO3B 4F37K 3M17B 3DTDA 3SSGA 1CYXA 3LS5H 3N91A 4K3HA 3V8OA 2X7LB 2ADFL 3ZDXE 4HOMA 2CK2A 3QO1A 3RZCA 3SKNA 3IMBA 1F4YH 4PWEA 1HHJB 2YOAA 2WB1A 3KVDD 4LCUA 5DVPA 4I5BA 2ZUWA 5D7SH 5FO8A 5JYLA 2H0FA 2WQRA 2AI0L 2CBMA 5GS3A 2G60H 4PJ8C 5T5FH 4JFVA 1JNJA 1TZIA 5D6CB 4F7CA 4J39A 1W91A 4N24A 4WW2C 1I7TB 1ZEAH 4X9BA 1A7QH 1IEBB 2AK4D 3FULA 4ETYA 3DROA 4JY6B 4FQ1H 4WI0B 2J4WH 2GIYA 1DE4B 4J3WA 1QVOB 1LO3L 2GJ6A 3MA7B 4OCYL 5AUMB 1J05B 1E4XI 3BDYL 5H4YA 3GBML 5BUGA 1G87A 3SDCC 1Q8MA 5FUOH 4AVJA 1BVKA 1WFIA 1EMTH 5CWSB 4RMTA 2J8OA 3K1DA 4FNQA 1WBYA 2F54E 3IJEA 5AKRA 4XMKL 5F21B 3JV5A 2WLMA 2ITCA 2MTPA 3ORJA 4YZFF 2WCGA 2UWEF 4RGNB 3VXSD 1YECH 2PCPA 3LCYA 3S5LG 2VMCA 1N2RB 1UEYA 5JXEA 5HYIA 4JZOB 1HHKB 1AQKH 3U2SA 1CBVH 2VJXA 2DIJA 2GFBA 4NN7C 4XN2A 1EANA 2DQIL 2NY1D 3C8KB 2FAUA 1J0KA 4J27A 4XP4H 2IGFL 4MXVE 1A02N 5EO0A 1V27A 2KUTA 4JO3L 3N1MC 1G94A 3N41B 2ADIB 3L4UA 1U91B 2BVQA 3D69B 2PETA 1YDPA 5IR1A 4FFZL 3LDBB 1NGYA 4X4ZA 2EYRB 3MZTA 3H4HA 4AIXA 1E65A 3FL7A 3PYCA 2HRLA 4X8XA 2OXGA 4GQ9L 1CLCA 2OJ1A 4JO2H 4DT2A 3X12A 2OMTB 1YCSA 2DWSA 1IBZA 1F5WA 1R3JB 2OMZB 3QXDB 2HFFB 5KVEL 4AKOA 5LBSA 5K59F 4KQ4H 2ZP8A 2ICEB 2YK1L 4HPOL 3GJFK 5H94B 4E42B 2ZCLH 3T0AA 3LKRB 3WUZA 4PJXB 4PWFA 1U8OB 2BNQB 1NCDH 1P4UA 2XKSA 2YXFA 2FH8A 2V8MA 4JL2A 3WBDA 4P2QB 4OGZA 4QGTA 4S1QL 1W0YT 4RFOH 5KVFH 4BWTA 4QHUB 3SPVA 2VWEE 5C0JB 3CFMA 4O58H 3FF8A 4Q9BA 5JNYB 2K9UA 3L8QA 4R90L 4X9GA 3LQZA 3SO3B 4CAGA 1LP9B 3MLTB 3VNYA 4ZMWA 4JX0A 5CBAB 5A2LH 1J1XL 1SPDA 2IH8A 4HQQL 5D1QB 1PZ2A 1UURA 1H0DA 1SHXA 1TCRA 5T1KA 1DBML 1AD9A 4F24A 2Y7NA 4YHOH 2HUHA 3MFGB 3VGGA 5L88L 2ITDB 4AYEC 5JHAA 1NMCC 1KPVB 1N7MH 1A4KB 1NOFA 3CHQA 1SDDA 3FQUB 4P2OD 4HS8H 4ZQKB 4Z3FA 3UEQA 5KYXB 5ICZA 4JFSA 4H8WC 3P54A 5J6HA 2Y4SA 3S37X 1RHFA 4ZBJA 4FNRA 2VXQL 3KXFE 4K3EL 1MRDH 2VR6A 2ETWA 3BQVA 1RZKL 2G9HB 3Q44A 5HJ3B 2CBPA 1KIPB 3WS6C 1IGJA 4FTVE 4E2OA 4FP8H 3FCSA 3WDJA 3DGCR 2IXQA 3TEZA 5GIRA 2R8SH 4HLZH 1DLHA 3D3VB 4MMXA 2VLKE 2VE6B 2PTUA 5HHNB 3QT2A 5TF1L 4WUUD 3PUUA 4L8DB 3IDMA 4M1CD 1S2EA 3INUH 2AXGA 3CK0H 1KOAA 2ZG3A 1RURH 3KYOA 2QQLL 4PRAB 4UQ3A 2BJMH 3EJSA 5DZOA 3DV6B 5I0ZA 2HLFD 2AEPL 3F62A 4TNWF 5FX3A 3QUYC 4QTHB 4WW2F 4G8AC 1ZANL 3QQ9D 3IJ9A 3LQAL 5INCA 1OTSD 3IDJB 1FE8L 3O4OB 1KF9B 4MBRA 5AOIA 5SWSE 3PP4L 3UABA 6PAZA 2BSRA 3S3BB 43CAB 3UO8B 5GS1A 1GOFA 2HLAB 4GRWF 2WXLA 4JRFA 3WHE1 1C12B 4ELKB 3DOSB 4XNBA 4OFIA 4PRDB 5I0YA 5BRZE 3GSWB 3GRBA 4XCCL 2NXYB 4WK0B 4FFYH 1OP5K 5DJYA 4Z6AT 4HIPA 2J8UE 1K8IA 2VLJD 2WLJA 5CLTA 4MYWB 4YN3A 4Y4KA 4N5UA 3VXOA 1E3ZA 4WTZA 4K9EL 4NRZB 2NLJB 1CZ8H 4XCNB 4ZUTA 4AT6B 4LMQE 4Y8DC 2UZYB 3U9PL 2RALA 4NRXB 3ULUF 4D9QD 4KPHL 4CU6A 4F7KA 2PW1B 2VDLB 3EXJA 4XE0A 3Q01A 3SDAD 3KS0J 1FL5B 3HG1B 1E6OH 5DYOB 2WO4A 1A8ZA 4J3OG 1N64L 4U1KA 3VWKC 2JCCF 4C56A 5I15H 2I32A 1MREH 4LKCA 4ZQTA 5KS9A 1AGCB 4PW9A 3S6CA 5C08E 5DD6B 1H5BC 4G8FB 1ES0A 4XO4A 5D7LD 3TIEA 1XHHA 3HC4L 3MV7A 3WIIL 1LWRA 1HE8A 1B9ZA 2YAPA 4MNQE 4MAYC 2I26N 4QKXB 2XWXA 4NSKB 3VG0H 5MEPB 1SY6L 3BO8A 4LHUA 3TJEH 4N2LA 5BZDB 1HH6A 2CLVA 4OLWH 4QRRB 5BS0A 3OJ2C 4JNXA 1IQWH 1UT9A 1G1CA 2ESVE 5I75B 3QNXB 3IFLL 5D8JH 3MSPA 3R0NA 3X3FH 1G7HA 2XV2A 1EZVX 5C8JB 4J1UA 5E56A 4QOKD 2WZ0A 2GTWA 4QJ3B 2QGEA 1BM3L 1UXWA 4PVLA 4R4NC 5IT2H 1MJJA 1AMXA 1JXGA 1QACA 1LGVA 5IJVA 1QABA 4N2EA 3TO4A 2UXGA 3FFCB 1RH8A 4L9DA 1OZTG 4YR6B 5D1XB 1QPXA 5CIPH 2XZCH 1BQHB 3GNMH 1ECYA 2UYLA 5HHXH 1KYUA 2C1OA 2G75A 3EKCA 4JFHD 1FVDB 1RUQL 1RUAL 4YPGA 5DT1L 3QRLA 1X7QA 4NAJA 2YA2A 1QW9A 2FJHA 4JG5A 3RGVC 3IXAB 3RPIA 3RVUD 3WEBA 4YE4H 5B8CA 3N2JA 4JO4L 5F93C 2W92A 4XODA 4CVZA 2Z1KA 1NC4A 3TF7C 1KIUA 4IMLA 5EA0H 1DQLH 3HE7D 1EDYA 2Y22A 2YIHA 3IDGA 3QFDA 4KTDH 1WRFA 4WCYL 4A1RA 2EUWA 1N68A 4EN2A 5B3NA 3KE0A 2VC2L 3KL5A 5E70A 5LXGL 5IHUL 3RWFA 1NGXB 3IU4H 3I74A 3OAWA 3CLWA 1FGNH 5DUPH 2EKSB 4EN3A 3V6OA 4H20H 2RQEA 4RMBA 1NMBL 2DICA 3C6LB 4F15B 4HIJA 2ZAIA 3VH8A 5A2KH 2NYKA 2JI3A 4AYFA 3TURA 5EU4B 1CGYA 4OCWH 4WTQA 3CZUB 4L29A 3H7LA 2XTJE 3HC3H 3L4YA 3B3IA 4OF0A 3FSZA 5AOMA 3VB8A 1CL7L 3MPCA 4J8QA 3S3SA 1AXTH 4XC1L 2A83A 4KO9A 4P5KB 1CYWA 4JFDD 1OKEA 1FLRH 3OMNB 3O2VL 3AY2A 3F3HA 3D52A 3SJVB 3AM8C 5ADOL 4KJYA 5DRWA 1Z0MA 3MV8B 1C5CL 5AOJA 4QI3A 2IBZX 2ZOTA 2ODIA 4ANVA 2AJZA 4UQCA 3VI3F 1XGYL 5IROD 1YEIL 2MEJB 3QORB 4NM8L 1Q1JL 4X80H 4NPKA 1EBPA 2FGWL 5CBEB 3F05A 4PRBB 4ETQA 3JQOB 3IBEA 2EICA 1MCHA 3V0IA 3RTQA 1VF5C 4H1LG 3GSRB 2ZX6A 5DEFB 3II2A 4F91B 1KENL 4QNPE 1BZOA 3V4PH 3GXUB 1OB1B 5E94B 1S78D 1XEDA 2ENPA 4A67A 1A4JA 4M5YL 4QHNB 4XZUA 3AWFA 3FYEB 5GGRB 4A7GA 1N6QH 2V2WB 1PZCA 3Q8BA 4F8LA 3TV3L 5ID0B 3GHBH 1JZ8A 1QSEA 3PFQA 1WBXA 1U3HB 1XD0A 4KO6A 4LCWA 4ZO7A 3SE8H 5HHQB 3C60C 1R0AL 2NMSA 2B4CC 3O6KL 3P4NB 1D5IH 3WTVA 3EHBB 4HUWB 2NSXA 3MLZL 4K55A 5C0EA 2YZ8A 4UOW0 3W9DB 4HX1B 3K71A 1CTNA 1BREA 1F4WL 4F7PA 3A6CL 4MX7B 1PX4A 5E08L 4C4KO 3VX0A 1LO2H 4H0IA 4K07A 2IDUA 1NEPA 4OD3H 4XC3H 5CP7B 4JPSA 1UT1A 3VRIA 4Z1PA 2VXUL 1RP9A 3MJ9A 3ARQA 3HZVB 2HMIC 3KBHE 4UT7H 4W9EC 5I9QC 2JQZA 1DZ0A 3N41F 1Q4NX 4HIHA 1Z0NA 3SKOB 2I5YL 2P49B 4TSBL 3LZFH 2C3GA 4ES9A 4BRJA 5CAYB 5TPWL 2F53D 2P5WE 3MCYA 3WFEL 2DI7A 5C9KA 3GXDA 1RZJC 4LPYA 3ZSSA 1YEFH 4PJIE 3DRQA 4PJ9D 2VDQL 1U92B 5I6PA 1VFBA 2VM4A 3BQUA 3HCVB 5IOPA 5ESAB 1XH1A 4KDTC 4PB9H 5FA4A 1CFVL 7FABH 3U4BH 4DF9A 3K8LA 5F7YC 2OFQA 4OZIF 2YRBA 1ZKAA 3SQBB 2Q86A 4ZAKD 2E86A 3ASOB 3F58L 4WKZB 2MCAA 1DLFH 2BIQA 3RQ3A 5ICXB 3CFCL 1GSMA 1UFGA 4XMPL 3S48A 4A38A 1INQB 4X99B 4G1EB 1KTLB 1AXSA 4A7SA 4X5WB 1J0ZA 2YMTA 1A7RH 3UH8A 1L7IL 5HDQH 1S9WB 2YS4A 4HK3J 3NQIA 1FSKC 2AJVH 5E0FA 3O3AB 1K2DB 3WO3B 3AQYA 4H2AA 2QQKL 2O6CA 5G55A 2J5LC 5CKGA 1VADA 3BJ91 2W60A 4NCDA 4PVNA 5L9DH 1I3RB 2XV3A 3Q2CA 5ITBL 5AZ2H 4BH7B 3WIHA 2Y7MA 2YLHA 4ELMB 1HI6B 4YSSA 4ANUA 3LIZL 1NUNB 1CFNB 6TAAA 5F3FA 3N42F 3TM6A 2VW6A 4HHAB 2DLGA 5H2BA 2XT1B 2I9TA 2NY2D 3ARBC 2BHZA 2DV6A 3UGEA 1SJXA 1W72A 2EYTA 3EXLA 3P2BA 4KHTH 4G7YL 5E6RB 4FG2A 4YUEH 4M00A 1INDL 2WANA 4TNVF 3UC2A 3AWGA 3GMPB 2R7EA 2OV0A 5DC4B 3CMOH 1Z1WA 3GKWL 2VZ3A 3HZKB 1TQTA 3NUKA 3BT0A 1UWXH 2UY6A 1UD4A 4DP0X 4Z7WA 1KTBA 4R8WL 4WTZG 1CE6B 1P1VA 5E4IA 3GSVA 3GXTA 3MI6A 4O2CA 3EJZC 3AABA 1ICTA 5K5YA 4OCLC 2OL3H 1T1ZB 1T6BX 3MRRA 4PUBH 4FXLA 1HVXA 1G7JA 1MH5B 4LCIL 4WTXA 4YSRA 4FFVC 4QEGA 4B60A 4JY4B 3KPNB 1SM3H 3O6FA 3A6OA 1E50A 2YGQA 3FO2B 1FFPB 2EIJB 1DUYB 1JV2A 1P6WA 3LKSA 2JE8A 4P5RA 1KSRA 3NPSB 3DX8B 5DQJA 3PXHA 2FX7L 5F2FA 3GPSA 1KIRB 1I1AA 3PQYE 3M88A 3QHFL 5DMGC 5D2NC 2OR8A 1MG3C 1NCWH 1DFBH 2VDOL 3D4CA 3I6GB 3P0YH 4GXUN 5IY5B 2EXTA 1CGTA 3TTSA 3J8F7 4MDRA 5I19L 1C7TA 5IK3B 1LWHA 3UBGA 4K5MA 4Y9GA 4LNVA 3L7EB 3C5XA 4ZX6A 3FU3A 4HJ0C 5EBLB 3E7JA 4N3TA 1HHIA 2BIPA 2F2HA 1HEJC 4X6BB 1FAKT 2AXJA 5JW4R 4UT9H 4QY8A 2EH7H 1QPKA 4DAGL 4YXHL 1JZ2A 2ZXBA 3V5KA 5A2BA 4KKCD 4N2NA 1Q9WA 1A6PA 3KHOA 4FABH 2R23A 3P0VL 1O6TA 1NDGB 1IL1B 4NCC1 4AIOA 4XNXH 1F86A 3ME0B 2FEDD 1VIWA 4HFWB 4OM1H 4R4BA 1OANA 4TVPL 3WHXA 3BAEH 4O02H 1HOCA 2FZ3A 4KAQH 1ZRUA 5ECJE 1I1YB 4N0CC 4ENEC 5T3ZD 1UENA 4X5XB 3Q2NA 4LLVB 3I75A 4N87A 2HRPH 1EHNA 4PJGB 1HXYA 2E7MA 3QIBC 3N55A 4XAKD 1F58H 3TIDB 2O5ZL 1A7PL 2XVKA 1RAMA 1HIML 1FNEB 4NWTL 2AKRB 2EUXA 2B08A 2ADYA 5SWZA 3PP3K 5KTEH 3LN4B 1T89A 4IOIB 4PCKA 5CIPB 1P5UC 3OMIB 1KBGL 4KHXL 1OE1A 3Q6FA 4OR1A 1ZS8A 3C8DA 1NKRA 4TRPL 3NACH 2NTFB 2AGJL 3BW9A 3R18A 3D7PA 4OFQA 3VH8G 3ZHKA 3QEQD 1U4EA 1PLAA 3CH1B 4UWQB 3HMWH 4P4KA 1OTTD 3EOBB 2O6EA 3H7BA 4G70B 2FJGB 4FNLL 1C08B 5F9JB 1ORSA 3HS0B 1MFBL 5FM5M 3T0ED 4F7EB 5BQ7A 2X3BA 4JGUA 1USQA 1NGQH 1UXSA 4NGHH 5HHMB 3BRFA 1EFXA 3ZKQD 1KCVH 2PPDA 3TVMB 1S5IH 3VFWA 4NAMA 4F7MB 1V3LA 2K1MA 5GSRA 4HEPA 1FP5A 3LNDA 4L3EB 1KNOB 2QEJA 3NZ8A 4QXGL 4LBEB 3BD4A 4O2EB 4FLRA 3QYMA 4XPGL 1B0RB 3KJ4C 1ESOA 1PW3A 3QEUA 3D0VB 4RA0C 2OBGA 2VABA 2EEFA 3VXUB 5FLVA 1CICB 3NGBC 1ZK5A 1PBYA 3ARWA 3CBKB 2OXHA 4XXCA 3DO7A 3PXLA 3NAAL 1RU9L 3FQWB 3QRGL 1JFHA 1LTXA 4NP4L 4B9ZA 3KLHD 5HJBA 2WXGA 1OQXA 4Y2DD 5HI4C 5IESH 2WAQA 1MF2L 3QXAA 1AC6A 5FDWA 5BUAA 2DD8H 2VKWA 3VFSB 3X11B 4L8SB 4HOWA 5E9AA 1WFNA 2XUWA 5DD3L 2ATPB 4WO4C 3UXFA 1MPAL 1TYEB 2AQQA 2IAMA 3QDJA 2J25A 5IHZB 1WJ3A 4RISH 3BD3A 3FAWA 3KCPA 3LZNA 3CFDB 4J3OH 1K8DA 1QEXA 3T6WA 2AEIT 2JLPA 3L48A 3WNNA 5I8KL 3ZZLA 2B8OT 1J5OH 1G9NC 3APNA 3QJFA 2LV4A 5LGHL 1BYNA 1N70A 3UZQB 1AC0A 1P4IH 1HK6A 2BS71 1DQQB 2X4OB 2ED8A 2IWFA 4GRMA 4LSSL 3GQFA 2YA0A 3DARA 1TQBB 5KJRL 1FFTB 1JHLH 4W4OA 1R5IA 4M5SA 1P1ZB 3BESR 4NBYB 5D71H 2IIJA 3TS8A 2WLKA 3DO3A 3V7AG 5TF0A 2CXKA 4UMGA 3QCVH 2KZWA 2OSXA 3ZKMC 3TEWA 3HNSH 2DJSA 3IMVA 5DRNB 5EH1A 2Z0UA 5EO9B 2YBRB 3OZLA 1H19A 1NDMA 1RL1A 3KPMB 5DC2A 3WKMH 1O5DT 5KYYA 1MFDH 3MV01 3ARVA 1VB9A 4HPYH 2XJKA 4LF3B 4P23A 1KFAL 2Q3XA 4J28A 4ZFOA 4M4PA 1QBML 1QHQA 3MJ7B 4QRPB 2X87A 1XX9C 2OJZH 5IKCA 5KSVB 1HKLL 1IGMH 4Y5VA 4NJAL 3V95A 2X2UA 1U8CA 2FRGP 3TH3T 4EDXA 4IU2A 5LGJA 3A4FA 3ABLB 2O26U 4CKQA 2W0FB 3VXNB 5DZNA 5F9AC 5AZEL 5JO5A 2ENYA 4G8GB 3V52H 2EH8H 4KV5E 3ZKNC 3G5ZB 1J9QA 2ICCA 2IOMA 4AW4A 2NY1C 1O7DE 1ZA6B 3ULUL 1MFCH 1P7HL 3WTTA 1P69B 3OAYK 1QLEH 1YEHL 1HL8A 2Z65C 5LG1A 4XBEL 3ABMB 2X1QA 2JFCA 3KNBB 3AU1B 3MV9A 5TDOB 4PAZA 3H2PA 3T6ZA 4FG6D 1E5UI 4OB5H 4CA4A 4MRCA 2VQ1B 2WTOA 2K4WA 2P5EB 2AQTA 4ZMPA 1G9MC 4UT6L 4JRYE 1MCBA 1TDQA 2R2HB 4ZOBA 5K9KA 4OD1L 1N59A 3MRJB 3QPXL 3TFKD 5EZIH 3GK8H 3WFBL 1JXFA 1ASPA 1TEFA 1VPOH 2ARJA 4TQ8A 3JWNE 3M07A 3BOVA 4RESB 5FF6B 1ZXKA 4GBXC 1ZIAA 1DBKL 4MJ6B 2MPAL 2B1AL 2O6DA 1MHCB 3LS4H 5GXBB 1N8ZA 5JPNC 5C3TA 2F19L 5BOJA 2NY7L 2OX5B 2JB6A 4FD0A 2Y7OA 2V7NB 3S5LB 3ENEA 2WZAA 1LO0L 1Y7VA 4MDIB 4Y4FD 4H1LH 4X6DB 3ABGA 2ZWYA 3SCMB 4KTEH 3I2CH 4R96A 3WL9A 3ZYZA 5BXFA 2BNQD 1T83C 3L9RB 4HJTA 4NNPL 1OHZA 3LEVH 5JW5B 2NX5D 1FFOA 2BY3A 4P2QD 5ETUA 1GVIA 4DOHE 5EORL 3JWOH 4JLRA 4NZ8A 2R83A 2OMWB 4HKJB 2OL3B 4OIIH 1C16B 5GGTH 4ICXA 3SOBL 2DBLH 3RUGA 1WDAA 3LTVA 4ORGA 4PGCA 2AQ2A 1DEEA 3BEVB 1JTPA 1AE6L 1KGXA 2F18A 2YN5A 1GZHC 3IF1B 3A47A 1W16A 1DL7H 1I4FB 4B3VA 4KNTA 3O9WD 4E41B 1XSKA 1U95A 2H6OA 3WIFB 2DQ6A 5T1DH 4YSUA 3GM8A 2ZSVA 4S2SA 2E9JA 3FCUB 3LKOB 4ZW7A 3ZE1B 4RNRA 4FX5A 3K8KA 5B4MC 3QUZD 4P3WA 1FNSL 2Z9TA 3UGXA 5KBKA 4HCRH 1AGBA 5HGBB 3QDME 1IM3A 3FUHA 4M1CC 3MUUA 1XZ0A 3AXLA 4G9FB 4ZO9A 5ESQA 4GAAA 5HHPA 4PCTA 4PJ5A 3VUAA 3A22A 5I1HH 2Z31A 4F57L 4P3CL 1M42A 3D3VD 3STLA 4KROD 32C2A 2WUBL 4KOCA 3ARPA 1JS4A 1XGUB 4R5TA 1P7BA 1CUOA 2XYBA 3PRZA 4BSJA 1L0YA 1WZAA 4ABQA 3BT2H 4O02B 3KS0H 5BMFL 1OTSC 1QSFE 4OCRH 3REWB 2CZNA 35C8H 1PVHA 1BJMA 1TQVA 3V6FB 4L0PB 5CD3B 3E9UA 3F7LA 4P57B 3HZYB 5LHDA 4PRPE 2X9ZA 4ZO8A 1JUFA 5AOLA 1F2XK 5ERWA 2YEVB 4KNUA 4KDVA 3DRTA 3NCMA 2K0RA 1BZ9A 3L9EA 5DJ2B 4R0LB 4CJ0A 3QCTL 4PJAF 4Z8FH 2VERA 4F27A 3P73A 1S9XB 3DX7B 4JREB 3MA9L 4KVCL 4HEPG 4BZ2L 2IO5A 3BZDA 1NUGA 2LLGA 2ICES 2VQ4A 4XNUL 3K72B 3B6SA 4ODSH 4B41A 1SQMA 4R3SA 4GAYA 3SDAC 5FWRA 3VD0A 4RMSA 5AG9A 2ZT9C 5D7KD 2XICA 4S1RL 1MN4A 4APQD 2ZYHA 3V4VA 2HTLC 1REIA 4OY9A 1II4E 4AENB 3HI6H 3L4VA 5F88A 4AVKA 4WK4B 4CBPA 3IRPX 2BOBB 3GEWB 3EF4A 4KUCD 4JDTL 1JMXA 4XNAA 2WQUA 1KJ3L 1YYML 5K9OB 1U2CA 5CN1A 5ILTL 5C07E 4PJ7A 4KY1L 1MJUH 4FCHA 5DVNA 4PLKD 1E9OA 5E5UB 2V7HB 1FORH 5EWIH 4B53A 1OCCB 4G9DA 1Q72H 2GJZB 1MZZA 1UD2A 3H9HA 5I1GL 2WWNA 4HAFA 1ID2A 2WQSA 1QATA 1THCA 4NKMA 4OVUA 1BXAA 4NZRL 1ETA1 3OX8A 1YNKL 3L3GB 3M86A 3GJFH 4P46A 1XH3B 1MFAH 3OKOB 4WI3A 3P9MA 1QEWA 1CC3A 2EEBA 2WY3B 5I76A 4I18B 1FV1A 2P44B 5BOPA 5T3XH 4BSWA 1K3ZA 2Z93A 4N0RA 4UUJA 4M6MH 1DJYA 5JOFB 1G7IB 1NM9A 5LNEA 3CDGB 1P4BL 1I3VA 4KJWD 4UM8B 2BVUA 15C8H 2KLRA 3V0WL 2CDGA 1WS8A 4NI6A 1YMMB 4FNUA 3COOA 4YDIH 1OAQL 2HT4D 1CD8A 2D7MA 2R51A 2B0SH 1G7PA 3QDAA 4HMEA 5DVMA 5HDOA 3L1GA 3FFCD 3HE7C 5D1XD 5KBMA 2Y1ZA 3P4LA 4MJ4A 4N9GB 1E3FA 4OQTA 4JW3A 5C0IA 1ZXQA 1R3LB 3MCLL 3OR6A 2FWSA 2Q76B 4IRZA 1QBLH 3FTVA 4UAHA 4LQFL 2BWIA 4HIEA 5C0BA 4JMNA 1K5NA 1U58A 1UASA 2YMXH 3SKJL 4U6HA 4ZUUA 5A6MA 2QLVB 4K3DH 3C2AH 2FL5B 3MR9B 1U8KA 4WF7A 4F9PA 3CVIH 2WINA 3TBWB 3FFDB 3GLAA 2GVYA 5FYKE 2B59B 2F54A 2VN6A 2VL4A 1KEGH 2MCG1 2A6KA 2R1XB 3HKFA 3ZOAA 1FNGA 2HPTA 4CW1A 5T5NF 2CGRH 5KN5A 2R1YB 5TTRA 1XTLA 1GL4B 4A37A 4GP4B 5DEGA 4FQ2H 2X41A 3B5HA 5E6ZA 2C9PA 3QO1B 4FKHA 3RZCB 4LSTL 1CS6A 3SKNB 1KCUH 4V1DA 5IROC 3DMMC 2CKBB 5D2LA 1CD0A 3QZWA 4PJEB 4NBZB 4X5PA 4I5BB 2FECL 5FO8B 2E7LC 3MOBH 4LLMB 3SJVD 5I5IA 5AVZB 3NIGB 4TLTA 5FW8A 4P2CG 4IGBD 4Q52A 4WEBH 4WU7A 1HC1A 4JFFE 1UQSB 5AYUH 1B0GA