4AXWA

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1- 2, form i 2.2a.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 44
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA02
2OMVB 2V37A 4AK1A 4NQQA 4AQ8C 3K5RA 4ZMOA 4APXA 3Q2LA 4ZMPA 2WBXA 4AQEB 3UBGA 4OY9A 2OMYB 3FF8A 3UBHA 3K6IA 2WHVA 1O6SB 4ZMQA 3LNFA 4ZMZA 4ZMYA 5DZVA 4XXWC 4ZMXA 2QVFB 2O72A 4AQAA 3LNIA 4AQ8A 3QRBA 1NCGA 1NCIA 1SUHA 3LNEA 4ZT1A 2YSTA 3Q2NA 3K5SA 4NUQA 3K6DA 5CO1A 4AQAB 3LNDA 2OMWB 2OMUB 1OP4A 3PPEA 3Q2WA 2QVIA 1EDHA 3FF7A 1WUZA 1NCHA 2A4EA 4ZTEA 4ZMLA 4NUPA 4ZMNA 1L3WA 2A4CA 2WD0A 3UBFA 1FF5A 3LNGA 2OMZB 5CZRA 1Q1PA 4XXWA 1ZXKA 4NUMA 2WCPA 1NCJA 1WYJA 5KJ4A 4AXWB 2OMXB 3Q2VA 5JYMA 3MVSA 1ZVNA 4ZMVA 3LNHA 2OMTB 4ZMWA 2YQGA 5JYLA 4AXWA 4ZI8A 4APXB 2X2UA 4AQEA 2EE0A 3K6FA 4QD2E 4ZMTA
chains in the Genus database with same CATH superfamily
1IM9A 1JZ7A 2IGFL 1MCWM 2V17L 5CBEA 2OMVB 4P06A 1JPSL 5IVXA 5FUCE 3SQBB 2DJ4A 5KEZA 4JFFB 3GEWB 3H2WA 2IH3A 2JQMA 4OY9A 1BVNT 4OFYD 2X0VA 4QTFA 5EBMA 4YJZL 4PS4H 3CHQA 1USQA 5LAPA 2WYIA 2VDRH 1S7WB 4A2HA 4DFHA 4B7IA 1MREH 4XBPB 4OTXL 3VGGA 5KN5A 1R3KA 1L9TA 4KJYB 4TOYL 1XF5A 3C2AH 4IRSD 5GS2H 5JQ6L 3SDCC 1U3HB 2Q8BL 4OJEH 4EF3A 5E95B 1AE6L 4UTAH 1QSEE 5IUSA 2NTFB 1DEEA 2YMXH 5JUEL 1MI5B 5ICZB 1NSNH 1FFPB 2F5AL 4X4KA 4AQ8A 1U8JA 5I6LA 3PL6D 2HRPH 2DMBA 4IKJA 3OMAB 1U33A 2CLZB 3S97C 1HOEA 1SN2A 2W9DL 4WVRA 2EXYC 2FO1A 5I76A 1KF9B 1E3ZA 5CIPA 1C5DA 4QJ4B 5KJ7E 1A8JH 1NIFA 3QQDB 1E6OH 3VFUB 2PWGA 1KFAL 3VSVA 2H0PA 3V0VB 1PD0A 4PJCB 4Q8BA 2NY6C 4ZS7L 3TURA 3JYCA 4HWZB 4XCYB 2V4LA 1I1YA 1EMTH 2FWSA 1CE1L 2YO3A 4LCCA 3T65B 3V52L 4NZTL 2D2CC 3A6OA 3SDAA 1BXVA 4PRHD 3VI4B 3K72B 3MR9B 3FT1A 4YDZA 3T8VA 3B5HA 2ZOLA 3INOA 4YS4A 3GS7A 5IJVA 1SN5A 1XH0A 3MRDA 3ESUF 4NPYB 4AEEA 4NT6B 4LPTA 2V7NB 3HG5A 1SNRA 1B4JL 1OAQL 4QMEA 2UZIH 1NAKL 4PJ8A 5CZRA 4PN6A 4YSAA 4DVBB 2WNXA 2HFFB 2FJUB 4L3AA 1OCRB 1Q9WA 1TVHA 5FFGA 3PV6B 1KIUB 4P05A 3IAQA 1K4DA 1DBBL 4E41A 1LEGB 4X9GA 3UYRL 2AV1A 1P53A 1HWHB 2BS71 3T2NH 4RZKA 5IT2H 1R0AL 1NGWA 3RVUD 4D94A 4LIQL 1HHKB 2ENYA 3G3LA 1TMCB 1OAZL 1YEGH 2DWDA 3AB0B 2Y24A 1NPUA 1E9QA 3P73A 5DJ0A 5EN3A 4L18A 3L54A 3TJHC 5D7IB 1UXMA 4UNUA 2ADFL 1ZDQA 2X89D 4OLWL 5HGHA 5C07D 1BWWA 3F2LA 3I9GH 3VFWA 3D39A 3GI9L 4LSSL 1OF2B 3ZMNA 1OAKH 5JNYB 5KS9F 4KKAD 3QEHB 4WENB 4GFTB 5F1KC 1HIML 3OKMB 2V5RA 1FO0L 5F7BA 1JGDB 5I19L 3RUGB 1MQKL 2K3HA 1SMDA 3UG5A 1OGAA 1BXUA 5E1AA 1UD6A 2UZXA 5C0ND 2DZEA 3ARDC 1D7CA 3P0VH 4JFQB 4YXLH 4I48A 3HLAB 1KEMH 3WU1A 2LAAA 4K3DL 5CLTA 1IAOB 3FU9A 1RUQH 1B0RB 4MJIA 1M6OB 1WC7A 3HZMB 5C0BA 1OSZA 1WAAF 3HHRB 1U6AL 1I1AD 3VW3L 3KWTA 4HWBH 2Q3XA 3EH1A 2R2CA 4LP5A 1JGEA 2IADA 4RFNB 4LARH 2I24N 3HB3C 4JPQA 3LEYH 1BAWA 2IF7A 3B34A 2HSIA 1AO7E 1CK0H 2VC2H 2WCGA 3IWUA 4XP9L 5BZZA 3SGDH 1TJIH 4TTDC 4LF3A 3F7YA 1A0QH 2UXTA 4KVCH 2X3CA 2VQTA 3L5XH 4HSQA 2CG9X 1KBWA 4U1KA 4GAAA 5D1ZD 3HJEA 3PHQB 2YEZA 1EAJA 3F7PC 3UDWA 5HI5D 4O58H 4J5VA 4F15C 2FJGA 3QXAA 4P46D 1G87A 3MLZL 4HCGA 1ZHKB 3J7HA 4URKA 1N6QH 1J8KA 2YARA 4U6VL 1T1WA 4F8PA 2B15A 1UH3A 1YC7A 2OMWA 4D8PA 2LABA 2N7SA 5DO2C 2AQQA 4W9IC 5DRNA 3CZGA 2GUOA 4G7YL 1U8IB 4LLQA 2Y7MA 1DVFD 3FT4A 2HT2D 4KMTL 4XE0A 3QI9B 1F1AA 4WDIA 4Y5VC 1QLEH 3NJVA 3GEFA 4DP6X 5D6DA 3KPOA 3L4UA 3DETD 2OFQA 2X4NA 1I8LC 2B14A 4K94H 1UB5A 1EEYA 1MELA 3F58H 5FF6A 3KCPA 4JN1H 2Y07L 1ZSDB 2PPDA 3L16A 3P11H 2F08A 1T83A 2WWMC 4FEMA 3ROOB 3T0EA 4RX4A 3DX8A 2IXQB 1EEUA 4JG9A 2GJ6B 5IY5B 5I1DA 1LEKB 3EJTA 2WWKT 1NFDF 3T3PB 4LQFH 4HUMB 2NDFA 3X3FH 4LVOB 4XRCB 3TCXA 4L0ZA 3VTTA 5ADOH 2F2HA 3LY6A 1EGJA 1SJHA 4W4OA 4EI5A 2PPEA 1DQQA 4IQHA 4LSTL 1SMOA 4XX1E 1TJMA 3IK2A 1MW3A 3MJ7A 4J3VA 4Z7VB 1NMCB 4LPWA 4UDUB 1N2RB 4C59B 3K6OA 4HU8A 2VXVH 3LKNA 4QTHA 3S3CB 2X7LB 5IQLA 3LVTA 1YJDL 2WZAA 1OY3B 3C8KA 2UY6A 3EJJX 4FFYH 1K72A 4B0MB 4CC4C 3UBXG 1NMAH 3L2NA 1ORQA 4X50A 5J6SA 3WNNA 4NC1E 1JYXA 2HJFA 3BD4A 2HPOA 4Y9GA 3QNZB 2PLTA 3RIKA 1W2KT 3VXPA 5LXGL 1NJ9B 3AQXA 4AEHH 5IESH 3B6SB 4NQDE 4O02L 5D1XA 4N9OB 2R0KH 2JIXA 2X12A 1G7PA 3MACL 4M93C 4XO3A 3QEUB 3KPRE 4MAYC 2IAMB 1HSBB 4OFVA 2F54D 5HI3C 3CAFA 1XXFC 5TGBB 3BUIA 1XIWC 1FBIL 3HZVA 4R96A 5LGJB 1IM3B 1JPGA 1EQWA 1QYGL 5LDSA 5CJBA 5CCKH 1QABA 5CUSL 2NYZA 2PR4H 1JN6B 4CSTA 3P0YH 1OTSD 3ULUL 1YEHL 1AC0A 5ECJE 2JV6A 4QF1A 3LRSB 5BS0D 1WD8A 3NCWA 4DKEH 1H3PH 4ENEC 2C4FT 3VDAA 3O9WC 4Y4FD 2BSTB 3FF7A 1EZVX 1XD0A 1GH7A 4JFHE 4JFPA 2QGBA 3NJNA 1DFBH 5EBGA 3LQAH 1NBZB 4XAKE 5BQDA 5I5RA 3LS5H 3VFMA 4OFIA 4P4KD 2CRZA 5C08E 5D2NA 5T3XE 5K39B 5IR1A 1LQSR 1ES0B 2XDHA 2JCWA 2Z35B 1Z9OA 5EPMA 3TL5A 4ZDHB 3TA3A 1TXKA 5FDWA 3QCVH 2MCAA 4C4UA 3V5HA 3JTTA 4F9PC 3SQOH 1AY1L 1JZ8A 2WVVA 4OCRH 1NCCL 5C92A 2OMZB 2VLKD 2NDGA 3A6CL 4HP5A 1NM4A 3HZKB 3QWRA 3PWPA 1UJ3C 3WFZA 1A4AA 3G6AB 4ELKB 3NJMA 3CMOL 4J3OH 1YEJL 3RWDB 1KCUH 4A2EA 1AXIB 3CFKB 2DM7A 4I77H 5IQ9A 3FO0H 2ZWKA 4LSPL 3RNKA 4HXAH 4TNWF 2ENJA 1ZHLB 1IE5A 2A6IB 2L0DA 1NPJA 2D0GA 4N8UA 1C9SA 2C3HA 1LO4L 1OP5K 1YUHB 2GEEA 3HC0A 4KK6C 1U8LA 3QHZH 1BAGA 1MCWW 4DP2X 1GPOL 1IBYA 1ILUA 5FHAL 4LOVA 5EO9B 3VWJD 4HH9A 4QXTA 2XVGA 3JWNE 2FNBA 5CJQH 1I4FB 2PCYA 2OR9H 1L9RA 3LQAC 4KH9A 3U7WL 1JF1B 2O26U 5TQ0L 1KTRL 4E42B 3LKPA 3CSGA 2EDHA 3B9VA 1KJ2H 4O9HH 4ZW3A 3E6HA 1WVZA 3DRTA 4XPFL 1DBAL 2Q3ZA 3D85B 3JWOH 3QH3A 3VB9A 2IPUK 1E4JA 3RZCA 5ESVA 4BELD 5HHOB 4UMSA 2B9AA 2GTWB 4PB0L 5EZJB 4YDKH 3NRPA 3HG0A 4UMGA 5F0MB 3JSSA 5F6IB 1UYWH 5LGKA 5FYJL 4IS6B 4D0CA 4WU7B 5TE4H 3S88H 1G7HB 4HA1A 3T4YB 4CGTA 5AB9A 4KX8A 5ALCL 4MZ3A 2I9TA 4JRYA 4KXAA 3PP4L 3HAEA 2N4IA 1IBZA 3VD2A 1TTFA 4FGMA 4HLZH 4A6YH 1F58L 4KQ0A 5EZOH 1TETL 5EU6A 5DD1L 2X70B 3SYOA 2A6DB 3OZ9L 2DLFH 1MJJB 4FQXA 1H8SA 2NMSA 4BFOA 2JKJA 4F2FA 2HA1A 1A7QL 1VDGA 4NENA 5D96B 3MX0B 1UD4A 1QSEB 4JREB 4O2FB 4TUKH 1TT6A 3L9EA 4G9FA 4NSKB 1P9MA 2L3BA 5FW7A 2NY0C 1DUZB 1Q0YL 4TLUA 4U1IB 5IMOB 2EEFA 5L9DL 4J4PC 1G9EA 1YEWA 3O6LH 1O5PA 3HG1D 1AR1C 1KBGH 4M6NL 3NOIA 3V6ZA 5H94B 1SXBA 3BEWB 4L8CB 1S3KH 3L4VA 5F89A 1WIUA 5K33A 1MWAA 4Y4HB 3QJRB 4M1DL 3LEVL 1BZQK 2V5MA 3BIAX 3FBQA 3ZZQA 1SJEB 3MRIA 4K5MA 4PGEB 3JWOC 4WFEE 2W38A 3RTQC 5FGSA 2RA1A 2OK0H 3RDTA 2BCKA 4WHCA 1XB6A 1JTTA 3QFGA 5I73B 1FZMA 4MNHA 4BFRA 5IF0B 3OJDA 25C8L 1JCVA 2ENQA 2X6UA 3C6LC 4HC1H 4PMFA 3TT3L 4Q9QH 3N5AA 4Z1PA 1U95B 4NLHA 3C8DA 2Z92B 2NX5A 4JJ5A 5T1MB 1DVXA 3BVNB 4X9HA 3ULVH 3LIUA 3KWUA 3IXAA 3FFOA 1O7DC 1TQUA 1XR9B 4HHAB 3HC3H 5F9OH 3HUJA 2I9LA 3PQYA 4OKDA 1R3LA 2QSCL 2RJMA 1EO7A 2ZKHH 5AW7B 4KTEH 5I74B 4ZMTA 1EANA 4UU9B 3ZT7A 3NACL 2YXVA 5FK9B 2C3XA 3BAEH 2VAAA 1K8DA 1SY6L 2OMNA 1IT9H 2W81C 4KKLC 3PWUA 4YEFA 3PDOB 3AW5A 5E5MA 4MFHA 4X6FA 2V6HA 4KDWA 1C1EL 4GRLA 3RBGA 3FNKA 4R9HA 4DEPB 5F71A 3WFDH 3X1GA 2EDMA 2O30A 2O5YH 2UZPA 4F7CA 1S7TB 1P5UC 5DZPA 4UBDC 3QUGA 5E6IA 3RP1A 1A25A 1EHKB 2OTWB 3RAJH 1TTAA 3WCYA 4LLYA 2VN3A 5IB4B 1ET5A 1YY8A 4N9GB 4G42A 4WFFD 1O5DT 2DQFA 4R97B 3GRGA 3LNIA 3E1F1 3FCGA 3GS4A 2QTEA 1XF2B 1FN4A 1AHWC 3KLQA 1NGYB 2X42A 4X5LA 1PZ2A 4IOFC 1NOLA 2XCMC 4PY7B 1FORH 5D7JA 4GAYA 2WBJA 2C7UB 4LSQH 1I7ZB 1MDTA 2AITA 3QJZA 2QPFA 4PRHE 4ZW7A 3QORD 2IH8A 5MI0C 4KQ3L 3ULVC 5MEQB 2VDOH 3RKDC 1O9VA 2BDNH 3T9WA 1ND0B 3NQIA 3QUMH 3UBXA 2CJUL 1UCTA 5I17B 3CDZB 1ZV9A 3NJFA 5B1CA 1I85C 1PD6A 1BYOA 2LU5A 2MTPA 4CJ0A 4QJ5B 3RVXC 2NW2A 2V8MA 1J0HA 1AO7B 2W8CA 1UA6H 3MNWA 2Z8RA 4XZUB 1OF0A 4BQ8A 2D0HA 5FCUL 2JELL 1FAKT 2P24B 3BDYH 2XRAL 1MFNA 2Q87A 3WLBB 3NAAH 3KPNA 2GITA 2V9TA 3GTVA 4YSEA 5FYLD 4NZDA 2APVA 2OL3B 5BXFB 1XVSA 3QDGA 4GT7A 1MPAH 3CU1A 3LHPH 2WINB 4P0DA 2A6KA 5CBAA 1FJ1A 2YWYA 5C07E 3S5LB 4ZX3A 1HNYA 2G9HA 2F74A 1FHGA 2XQYA 5FWQA 5JR1H 1FNGA 3MA7A 3MCKB 5JXAH 2UY7B 4PJ9A 2FIKA 2OZ4A 2ZE0A 4P23A 1CQYA 3MKGA 3GTTA 2ZIDA 5DHYB 1U8MA 4WSJA 1IBGH 1CLZH 3QEQD 4XNUL 2W65B 2EH7L 4Y16A 3GTNA 5I1LA 4N0YH 1ZV2A 1WWWX 3AWGA 4R4BA 2HKFL 3BPNC 3MODL 2PTTA 4L1LA 3MRGB 4EUPG 3ULAB 1VLXA 1GC1H 3ZDZF 4C56B 1RUPH 1L6PA 1KC5H 2N7BA 5AW2B 1S9WA 3HE7C 3CPLB 3IGUA 4OBRA 4U05A 1EK3A 3EBGA 4YBLC 3KDMB 4YDLC 4PR5B 4HUKB 2ITDB 4RFEA 4NQTA 2ZKXA 3MXWH 3ZHNA 3EFOB 1HC1A 2IOMA 3WL9B 1A4KA 4WEUD 1J5IA 3V0HA 3IDGB 3RWEB 3SJVA 1ZGLP 4WHYG 1E4KC 3DGGA 1KENH 2H0FA 2ENSA 4FEIA 3PJSB 3C09B 5F0JB 3TFKD 3Q44A 5IB5B 1AGCA 4JG0L 5CGYD 3VTAA 3GHBH 3G5XA 3GSNL 3KLLA 3ZDXF 5EZIL 4JFZL 3MJ8B 3H0TA 1LE9B 2CJTA 2BSRB 2DMGA 2O1AA 2OW7A 4PRAA 1M6UA 2J25A 1FL3B 2DTML 2YSTA 2CKBB 5GZND 3RWIB 3UZEC 2PYEA 1OEZW 3K5SA 1P4UA 1FNSH 4DPBX 3ZW3A 2WTRB 3QIWD 4U0RB 3A67L 4K3EH 4QTIL 4DP8X 1FAIL 3QC5X 4DGYH 1T2JA 2CD0A 1T1XA 4EE2A 3QB7C 1KYOJ 3PG2A 3Q8BA 1XSOA 4NQDB 1V05A 1QSFB 5IJDC 3TU6A 2FX7L 1N3NA 3KVPA 1JV2B 2F7IA 2NY3B 3GMLA 2EKSA 3WNIA 1RZQA 4X7FC 1S7UB 3KPRB 4PY8J 2GCYB 4EIBA 4LSVH 4CU6A 4PJFA 2APFA 1IGML 1KLFA 4P2OB 1KBVA 1IARB 5G4NA 1KB3A 1MKFA 1PZDA 1YNKL 3NJHA 1GC1C 4PGCA 2RCSL 2YPLD 1FCCA 5CD3B 2Z93A 5T8IA 2JJTA 4G7SB 5C0JB 4AE0A 3VXMB 4WWKA 5JTWA 1A6ZA 4D9QD 4PEEA 1DANU 1Y18B 3NGBC 4Z7UA 5FOBA 3SDYL 5K9JL 1TVBA 4AIOA 1YDPB 3KL0A 1BM3H 1HFUA 4YDVB 1WFOA 3GMPA 1U42A 1IL1A 1NBVL 4W81A 2PW2B 3OQRA 3TEXA 3ZKMC 5I1GL 5I6MA 1Z9PA 5C08B 4EXKA 1MCQA 2FBOJ 2VQ4A 4JPKH 3D06A 2M83A 4M43H 3B1TA 3DVIA 4E9VA 4Z7QE 4ZMVA 3MROB 4AY0A 3L5WB 1AIFA 2DQHH 4CA4A 4NRYB 4EPSA 5TE7H 4KHXH 3D52A 5SWZA 4F93B 5J89A 4S1RH 3ZE2F 1VFBB 1NLBL 4RIRB 2CO7A 2VW4A 3MBED 1FVCA 4CILA 3QIUB 1K5NB 1DUYB 3GO1H 3CBKB 2GY7B 3TBWA 2FB4L 2NNCA 2XV3A 2OMTA 3DJ9A 4JY4A 4XCNA 4GKOA 1AP2B 1N64L 2EDQA 4AENA 2UXFA 2W91A 2XA8H 1ODAA 4JM2B 3REWA 2O6CA 3UG3A 3W9DA 2J8UA 4N2KA 2F54E 4JFYB 1R1CA 3G7TA 1BWMA 4KUZL 4LOEA 4NUJA 4K2UH 5E1IA 5D70L 3N85H 5CMAB 3GXTA 2EACA 3POHA 3S36H 2AQRA 4B9YA 5DHEA 2P5WA 5A16B 2GK0B 5BV7H 1BJ1H 3MOAH 5B38A 2EP6A 3F01A 5KOVC 2Z91B 4OQTL 1H15B 1A4JA 1AMXA 4YHLH 1GZHC 1I9IH 1G94A 1HAUA 5BS0E 1H5BC 4MJ2A 1WS7A 2JMRA 1G9MH 5HYJB 3FZUD 4NQED 3MC0A 2J56A 3AXHA 2EABA 2IFFL 4JFXB 3T4AB 1BZ9A 3K6DA 3FCTB 2P49B 2FSEB 4ANXA 3CUPA 4DGIH 1U8QB 2VLJD 5CLWA 3I75A 3Q05A 3MNVA 4KZEH 1X3DA 4DWHA 5ES4B 3IFNH 2Y7SA 3HBGA 5KYXB 3SPVB 4RDQG 4BM7A 3U0WH 2YQBA 5JPNA 4UV7H 2B0SL 3MAWA 5FA4B 4GBXA 4X7DC 2CALA 4KAQL 4TV3A 2ADJA 4WI3A 2P5EB 3G6DL 2VLKE 2P52A 3UTTD 1MFDL 1RU9L 2KERA 3HLKA 4HETA 4N2NA 2FT8A 3TF7C 1XSKA 4DVRH 3A24A 6CGTA 3I6KA 1YCSA 2BIHA 3BFOA 4D0BA 2O6EA 4JQIH 3DROB 3H56A 5H35B 5DJ6B 1CGVA 2FO8A 2V9RA 1TTGA 3G6JA 1KPUA 4PWFA 3ZKNC 1JJUA 4NBZB 2UV3A 2WLIB 1FWXA 4J2QA 3BP4B 5BV7C 4PP2B 3MRNA 3D0LB 5AAMA 4XX5A 2YEQA 2TSAA 1M1XB 4F37K 5GRJL 4FQHB 4HEPA 4F7EB 4FFWD 2I69A 3L9YA 4Z7OE 4XTRD 4FI6A 1G9MC 3ARBD 3KYOB 5FO9A 4AUYA 4QJ3B 1H6EA 4RESB 4B9CA 1GZQA 1GIGL 1OM9A 4AYGA 4F5CE 3CC5A 1G7QA 4LCVA 3KPPA 4H5SA 2CLVA 3SZKC 3ARVA 4BZ2L 1HXKA 4Y9CA 3HRPA 2EDEA 4YK4C 1SDYA 1XCWA 5DJYA 2OYLA 4OZIA 4MNGA 3MLVH 1T0OA 3FHAA 4CC1A 5A2KH 1VF5C 3GMQA 3TZVD 4ORZC 2X05A 1OLZA 5AW1B 5J13C 4R0LB 3FQ2A 3HI5L 3K6SA 4JMNA 3U2SA 2QELA 1NGQL 4HF5H 1LLAA 4GXVH 5MEOB 5HHXH 4L8SA 4N0UA 5HHQA 3IDYC 1AXTL 2JKSA 3MGTA 4N22A 1KEGL 1MAML 3B7RL 4KV5E 1G6RB 4OI9A 1Q9KB 3SQBA 5HP5A 4AQ1B 3AGVA 3MUJA 1PS3A 1INQB 2CSPA 4HBCL 4PJEE 2A1WH 3PXHA 3EDKA 4Z76B 1PNCA 4ZX6A 3MRBB 1S4IA 1AG0A 2K45A 1BPLB 1G7JA 1S7WA 1Y1UA 4H8WH 3TASA 3L3DA 2VQ1B 3QUZA 5KVEL 1IQDB 2BY2A 3R7QA 3QARA 4JG5A 4MQ7A 1EA9C 1U3HA 2RQ8A 4IRSB 4LP8A 3BXNA 2P8MA 1DCEA 2CDEB 4L8BA 4TVPD 3NPSB 3IJYA 1MI5A 2CGRL 4HZAA 1IKNA 3HFML 2ZUWA 3D33A 5DD5H 3PL6B 3VXNB 2CLZA 1T6VN 5FGRA 2QR0B 4P2RA 3GSRB 3HG1E 4HGKC 5F7DB 1CI3M 1D9KC 1SBSL 3PP3H 4N1EA 2PF6A 1T0NB 3FFDB 4POZD 1A5FH 4CW1B 2Z7UA 4GIOA 5LWYL 1KN2L 2WLJA 4Y19D 1XZWA 4U4IA 3VFUA 3TPUA 4HBQA 4F8OA 1IEBB 3GIZL 4YHYC 3V0VA 4PJCA 5IBTL 2QQNL 4MYPA 4NAQA 4A2MA 2XSKA 4XR8C 2HN7B 4BK4A 3T65A 3JVGA 4L4VB 2EVFA 3O2WH 4NOBA 3VI4A 3K72A 2UUDK 5BRZB 4GP4B 1FYTD 2Y22A 5C8JB 4I2XA 1SVCP 3VG0L 4XBEL 4Z3TA 1KB5H 3CN3A 1EUUA 1JWMA 4FULA 1XGQB 2XTJC 4OLXL 4PHXA 3T2QA 4OU3A 3M46A 5TDPB 4FQIH 1H9DA 3D2UD 4RMTA 1JZDC 3QZWB 1T21A 1IVLA 1X5HA 4DVBA 1YPZF 4H8WC 4MHHG 4X5WA 1A9EB 3NA9H 3PV6A 1KIUA 1MFBL 1AKJB 3J2PA 1H3WM 1LEGA 1L9SA 5DVKA 4PAZA 5D7SL 1YC8A 3GBNH 5CWSB 2CDGB 3B8YA 1HHKA 3BLBA 2EDXA 2EE0A 1FDLH 1MY7A 3RIFK 3GBMH 3SDDD 5FO2A 1V54B 5LBGA 4A2LA 5KVGE 3MLXL 4MNQB 1RZGB 2DWEB 4P3CL 4IBYA 5C07B 4ZMOA 3D5OF 1M9SA 4Y8AA 2YK1H 3WFHB 1VACA 3LKSB 2ZUTA 4LGPB 4FZ8L 1WA1X 3MKKA 5EUKB 4WFFE 3QEHA 4K3HA 1BEXA 4CN1A 3VSTA 5BW7A 1QFOA 2V2WB 2XACC 1NCNA 3RUGA 3CXFA 2QPUA 1EZSA 3ZGHA 4N86A 3KVDD 4JFQA 1T4WA 3AQDA 3HLAA 4WI9A 1IAOA 3US0A 5GRYA 3G9AB 4PP1D 2X6VA 1KGXA 4PJDE 5JORA 4A39A 3HZMA 3DJSA 3RVWC 2AQ1A 3BGAA 3IGKA 1T5KA 4YNYB 2UVFA 3LNEA 4JZNA 2E7BA 2L7EA 3BZFB 4OQTA 4APQA 5GSVA 3BIBX 1RV6X 4PS8A 4NIKB 2WSPA 4WNJA 4I13B 5IW6B 1BQKA 2XN0A 5FO8A 1CD8A 2EDNA 2NY1B 2NW3B 2VDPH 3KGTA 2WSKA 1AJ7L 5IBUG 3VE0B 5LQBH 2YRLA 3BPCB 4U1HA 1VKXB 2OJZH 5C0IB 1HYSC 5C0EA 4NUPA 4IKNA 3PHQA 5FYLE 2XZAL 1DQJB 3BWZA 1K2DB 2KDGA 4XNQB 1AFVL 2G5BA 1ETZB 4PBVC 3BCDA 3BFWA 4Q9CA 5CKAA 1N59B 1MCEA 3DHMA 1ZHKA 4MS6A 3P9LB 1ZEAL 2Y7NA 1CFSB 4HIEA 3MOBH 3PE9A 3T6QC 1QUNB 4MD0B 4UANA 4WTZA 4Y0GA 4DGVL 2JKXA 1CF8H 3JTSB 3A22A 3QI9A 1OPGL 3BISA 4OCXH 5ERWB 3I9AA 3SDCD 3BPOB 3P4MA 4GKSA 3ZTNL 1V10A 1GS8A 3BVVA 3QXDA 4I9XA 4TLKA 3QEQE 3CFCH 4IU2A 3WUZA 4Q6IC 2WLMA 4BGLA 2IH1B 2MEJB 3B43A 3L7FB 1B9KA 2NXYB 1ZSDA 1IGYA 3IN2A 3MBXH 2EXYD 1G7LA 2AJSH 1U91A 2IXQA 4NJAL 2IALB 2R23B 3DOHA 5IQMA 2GJ6A 5JXEC 4H0IA 4H8QA 2AXJA 1M05B 3SN6N 5CD5C 4M8QB 5L88H 5C7ZA 4YHIB 2FLRT 2NY6D 1YN6A 3E38A 4R84A 2CO3A 2V37A 5B3JE 4J12A 4IJ3C 4DO4A 4UILH 4WI2A 2Y36L 4WF7A 3COOA 2DPKA 3QK0A 3FO2B 4UDUA 1N2RA 5CJXA 4OCSL 5AYUH 2X7LA 5AZUA 5K1NA 1IJNA 1CFNB 2YD3A 3ZU8A 3D9AL 1B6UA 4PJBF 3WN5A 2K6ZA 1MCPH 3RLSA 1XMWA 1LP9E 2VO8A 3DBXA 1Z5LA 4OD2B 3OR6B 1C16B 2V3FA 2GBVA 3A6BH 2E27H 3GLDA 5DC4B 3W3BA 5E8OA 3QNZA 3QZLA 1IV8A 4ZPVB 5I0VA 5GS2D 2W0FA 1JVOA 5L4MA 4IK6A 3THML 3NCEB 5D7KD 4ZT1A 1PDKB 2WXRA 1CQKA 3OXRB 5DVLA 5IG7B 2IAMA 1PG7H 3FO1A 1QLFA 3TJHD 1PZSA 2F54B 2ZNWA 5TGBA 5LGJA 2Y1ZA 3HMWH 3V5DA 5LNGA 5FXCH 2D3JA 3S5LG 2YPLE 1JN6A 2CGZA 2KBGA 2MHAA 5DUPH 4D9QE 3LRSA 2IGLA 2VRAA 4XI5C 5GGSY 5BS0B 1T3FA 4X8JB 4YUEH 5CZKA 2IOOA 2NR6C 1U3NA 3PS6A 4GXUN 4PJGA 4W9GC 4Y4FB 1BAFH 4P57B 1F45A 1U3YA 2BHFA 3Q8CA 5I8KL 2XXMB 3GUTB 1SM3H 5FGBA 2AP2A 4P4KB 3S37H 2PCPB 5IFHH 1X5XA 1OAXH 2XG4B 4K9JA 5L7XL 4ZDHA 1TQVA 2AEWA 3MFGB 4LRNL 2OL3L 1P5VA 2ZSWA 3LN4B 3UJTH 5IQNA 5IJKC 2R4SH 2IO5A 3HB3D 1S9XA 3OX8B 5CILL 5JYMA 1UENA 2FD6H 1OAYH 4H13C 5DK2A 2VLKB 1RUAH 4TTDD 4NNPH 3HZKA 2IG2H 2EYTB 4GG6E 4AK2A 3ECUA 4G5ZL 3RWFA 1ZOXA 2PXYC 3FUNA 1OP3H 3ELAT 5I9QC 4NFDA 1UOWA 2XQBL 4NN7C 4XNBA 3QPKA 3PHSA 5IVOA 1OZTG 4RMSA 4NJ9L 2KMWA 3Q2CA 1PZBA 1ZHLA 3RNQB 3ZL2A 3GKWL 4KO5A 4JO2H 2ZP0T 2VR9A 3D09A 4ODVL 1NC4D 1DQDL 2QV4A 1YUHA 4OF5A 1OVZA 5DO2D 1TTUA 2ODIA 3NZHL 4MMYB 1OT2A 4JPVL 5B8CB 2DBLL 4PYHA 1QKZH 1YY9C 4M5ZH 4UNVA 5EO9A 4Z7OB 2I07A 2LAGB 3WBDA 3PWVA 1PVHA 3ZT5A 5I23A 4UDTB 3NJLA 3CZNA 4LHUG 4NQEE 1JZHA 2QQLL 4J6RH 2AK4D 2ZT9C 3BPLB 4YFLF 2QSVA 4LEBA 4M29A 4N90D 1YYCA 3QIBC 4D3CL 4Q0XH 1QASA 2BZCA 2X88A 5HDWA 1FL6B 2OCCB 3GT6A 2WXQA 2WWMD 2GI0A 1NMBL 4XGZB 4PRDB 3MZGB 2VLJE 4S2SA 2F0CA 1NCIA 5E5UB 3D85A 5BZWA 1JIBA 1Q72L 2H3XC 2I5YL 1PQZA 4WI0B 5HHOA 3WTYA 2GTWA 1RVFL 3MDJA 5EZJA 3X14A 2ARJQ 1F18A 1ZPLA 2W0PA 4BCZA 1AS6A 1S5HB 3MRFB 2CKBL 4IS6A 4PLNC 5HHPA 1DJHA 32C2B 4QRQA 4XH2B 2HFEA 3KPQB 2KZKA 2G75B 1OIOA 4GQRA 3UTTE 1L7TL 1ZE3C 4I0PA 5DZJA 1G7HA 3WNOA 2COQA 4XOBA 9PCYA 4ZAKD 4RRPG 4YXKL 2O5XH 4BXSV 4J3XA 5GS3A 1WBYA 2HTKD 2HG0A 1HI6B 1H6UA 3B3IA 1DJGA 2K6YA 3SO3B 3CVHA 3L1GA 1CDCA 4AQZA 3GMOB 2X70A 2A6DA 1MJJA 5AOZA 4NKQB 3SE4A 4XC1L 4NCC1 4EI6B 4DTGL 3KJ4C 3UCRA 4PVMA 1D5IH 4Z0BH 2H0EA 1ZTMA 2NXZB 3UAJA 4GG8B 3KL3A 3NZ8B 5C0AD 1QSEA 4WEMB 1QBAA 1PZ5B 4HJGB 3MO1B 4IRZL 4NSKA 1FGNL 3NT0A 1FGVH 4U1IA 5AWNH 5F9DC 1VEMA 2AQSA 4AXWB 4PG2C 5JHLA 4HK0A 3HG1B 2EO9A 4NO3A 3AJ7A 4I3SL 5H94A 1XIWD 5GSRB 4NKMB 1VPOL 2HG5B 3HMXL 4PS3A 4LCIL 4Y4HA 1A6WH 1JPFB 1MRCH 3DYOA 4K71B 2XPZA 1SJEA 3D87B 4PGEA 2XFXB 5BZXA 2YRZA 2QDWA 5T3XL 3FU0A 2X09A 5E4EB 3DUSB 3SE6A 2PCXA 7PAZA 2B1HH 2BVPB 2AMGA 1RSFA 1URIA 1H6TA 1LO5A 3HI6H 4Q9BA 1NEPA 4ENED 2X4OA 4F58L 3BH8A 5J11B 1IMHC 1U95A 3O9WD 3A3YB 3UIZA 2WXGA 4DO6A 3ILPB 1ONQB 2VZTA 4MB1A 5T1MA 1QHOA 3SEPA 3BVNA 3RDJA 1MW1A 3H2QA 3MA9L 4M4PA 4G7VL 3BO8B 1NKRA 4HHAA 5D1QC 5F93C 2MQ3A 5B21A 2VXUL 4A7GA 4DK3A 1C5CH 4ZYKB 4ZJ9A 1JHKL 3WGVB 1GXEA 4IDJH 5HGAB 4UU9A 5DJ8A 5KSBE 1L7IL 3LYRA 4RMWA 5E7BA 5FK9A 3BRGC 3N1PC 4CU8A 1HH9A 4XP6L 2D8KA 1W72A 3LNFA 3F00A 1NIDA 4G2AA 5IBLC 3PDOA 2HFGL 3O6ML 4WO0A 3KDPB 3KS0H 1NTDA 5INDB 4JGUA 4JM0A 4TQEH 4YPGB 3GZPA 3PHAA 4TVPE 4NX0A 1HE8A 4LKCA 2CIKA 4TRPH 4Z5RB 5KYUB 1S7TA 1XGYH 3UBXI 3UG4A 3FT3A 3OG6B 1AD9A 4IDLA 2H32B 2WQUA 4IRJA 2OTWA 3IFPA 4TNFA 1RAMA 2R69H 5HYIA 4HW6A 5IB4A 4PJXA 5MENA 5HGBB 5A43C 4OZGF 4AQAB 5F1IB 1CDYA 4BKLB 4Y19E 2Y7QB 1CLOL 3UZVB 3MJWA 1AD0B 4KK6D 2YD4A 2VWEC 2X3BA 5C0GA 5KVMC 2VR4A 1GYUA 5FM4A 1NOFA 4JL1A 4FKEA 2C7UA 2ERJB 2F19L 5B7MA 2PPAA 3GPSA 1D5ZB 1I7ZA 5A7EA 5I1CH 2RFXB 3WUWG 3QNYA 2OSYA 4PJDB 2A83B 4HIPA 3L1OH 1L3WA 1FYTE 4L1DA 4PY8I 2R0ZH 4UB0L 4WSGA 4R2GB 5EDSA 5MEQA 3DHPA 1UUNA 4IOIB 1FVEB 2DQUL 3FCBA 3WO4C 1WFIA 2FQFA 1KJMA 3WTUA 2WJ7A 5I17A 2XZQH 3S35X 1WO2A 4PRNB 1UWXH 2WQVA 2BJML 2ZF8A 2ZWYA 4OGXL 5E00B 1KV7A 5AW3B 4E9XA 1WV7T 3S8FB 1AO7A 2QLYA 4QKXB 1RPQA 2CR3A 2BS9A 1VFOA 2WCPA 1W6WA 2X4PB 3F05A 5EIQA 4A7UA 1E7UA 2P24A 3L9RA 3PFUA 3TVMA 3RY5A 3V5KB 2VDQB 5C97A 1WHPA 2V2TB 5DEFB 4U3HA 5B1KA 2ZJSL 5JIDA 5EIIG 4TULL 4KGLA 1FG9C 5EUOA 4JX0A 3S5LA 3VD1A 5T3ZH 5LBSL 1E65A 1MNNA 1EO8L 3VU1A 4N0FA 4YSPA 2FHBA 2K7QA 3TT1H 3V0DA 1RIVH 3GNML 4OSUH 4JRWA 3D4YA 4G8GB 1U8NB 5DHYA 1E67A 5HI4D 1RD6A 2EYRB 5EH1A 3QBTB 4K5PA 3I02B 4JK0D 4HUWA 1D6VL 4BWUA 2ROYA 2W65A 3BKJH 3QEQB 4BCYA 4JDTL 4P59L 2NY0D 3TONA 3W56A 3GB7B 4JG1L 4KXBA 3WXWL 1E2VA 4KFMA 3CMGA 1O6SB 5E4IA 3ZRFC 4I1PA 3QNXB 4OQ1A 4AV0A 1JFQL 2APWA 1KTCA 4C56A 1JGUH 4LMQI 2EH8H 2IWGA 4LLUB 3DVNB 4NHUB 2ZOWA 4G43A 1KG0B 2HB0A 3D07A 4X4ME 4FFZL 2FATL 1G6RL 4JHZA 4WZ9A 2V3EA 5IHZB 1MFEH 3FL7A 4WFGD 2Z6FA 4LVEA 5CJ8A 3K8KA 2ITDA 5FKAB 2GB2A 1I1CA 4XVTL 3EFOA 3WL9A 4PGBB 4NC2B 4POYA 3IDGA 3EHBC 3RWEA 4YIQA 3U6RB 1QVOA 4HU2A 3PJSA 4MMZA 4M8UA 2ZUUA 1QR1B 4ELMF 3CSTA 4PJHF 1UXSB 3VQ2C 1OQXA 3MJ8A 3W39A 5I75B 3AREA 3HS0C 4OKVB 4Y4KC 4WI7A 5KJRH 4JMXA 2OSLA 3MTRA 4PH8A 5I5IA 1FL3A 2CKBA 3K8LA 4GIPD 3RWIA 1FPTH 5DSCA 5ILTH 4FKKA 1E2ZA 3P40A 1SHSA 5AW5B 3N9GH 2AS5M 3LPPA 3QIWB 3UJIL 4OZ4B 1I8UA 3C6EA 3RZWA 4XNZB 3RB5A 4AYEC 4RAUB 2NY7H 3V6OE 4ANVA 5EU4B 4LGSB 5FECB 1QFUH 1QSFA 4JZOB 3V8CA 4DN3H 2NY5H 1NGXB 3CN1A 1JV2A 3NIGE 4LHUA 1N4XH 4EDWH 1IGTA 1JNJA 2YWZA 1S7UA 3KPRA 4QLWA 2G60H 1GL4B 1BJ8A 4BRJA 1AR2A 4UBDD 5C1MB 2J4WL 4P2OA 4GUPB 4Z7WA 2YAQA 5IFAH 4GRWE 1BQ5A 1GHFH 1S7RB 1DZBA 5CD3A 3DSNB 1JRHL 2VUOA 4JM4H 1QRND 2CXGA 5ETUA 1E9PB 5C0JA 5D7HA 5FUZL 5C7XH 2W9LA 3VXMA 1OB1B 4PBXA 1X4YA 4RGMB 3MGAA 4G6JH 5ITBL 4YAQB 1II4E 3OQ3B 1NM9A 3ZK0A 3R06B 3VXRA 4Q2ZA 4CMHC 5JMRA 1AQDA 3I84A 1YDPA 1HCFX 3CSBA 4L5FE 1SLUA 4KKCD 5E9DD 3KWWB 1T1YA 4RRPA 2QKIB 5GISL 1ERNA 2IJ0C 3IM1A 4M6MH 1UURA 1I7UB 5EOCH 3SYQA 3SQRA 2B3RA 2YN3A 43CAB 1MUJB 3ULVD 5C08A 5LB1A 5MP6H 4FNPA 3RKDD 3INUL 4NRXB 3ZE1E 1IGIH 2IIJA 4U1JB 4NRYA 2WMPB 1YMMA 4JANB 4DP0X 4WWPA 2XBTA 3E8UH 1S7VB 1FCGA 5FA3B 3WXVH 1VFBA 3P3RA 4XC3H 4RIRA 1AZVA 3RVXD 1EO5A 5HDBF 1SRDA 1K5NA 2VSKB 1DUYA 3X1BA 1KDIA 3BGFB 1UZ8B 3ZPDA 2CO4A 3ZUNC 1E50A 4GG6B 5DFTA 2NY5C 3KW8A 1BXAA 1L6XA 1E4XL 5D7KE 2PYFB 4XPTH 2BPBA 3KNBA 3AWFA 3UTSB 4JM2A 2WZ0A 1CL7L 2F7RA 3Q9PA 2UYLA 3Q06A 3I50H 4P5KA 4G8IB 1AGFA 3LSOB 2QFPA 2I7OA 1RY7B 2ZOUA 4HJ0D 4ZD3L 4N8VG 1E0OB 1TOXA 3ARDA 4ZXBB 3IU4L 2WBWB 2ZCLH 4RDBA 1LYQA 3VUAA 3ZE0F 4GQPH 3SKNB 1C12B 1H15A 1X7QA 2OULB 3D3VA 5F7MC 5IVXF 3RHWK 1QBBA 4QRPD 1PMYA 5ID0A 2VXTH 1UM4L 2JXMB 3EIFA 3O6FA 5HYJA 4NQEB 5L8JB 2WP3T 1SYVB 1T1ZA 4HCIA 4F27A 1BQUA 4YBHA 3STBA 4JFXA 2X6AA 4LLMB 3ZRCC 3BKYH 2DDQH 3JV0A 3VM7A 3FCTA 3WE6B 1U8QA 4X5XB 1G43A 3F5WB 1MCHA 3V0WL 2VLJB 1XV8A 1U36A 1P1ZA 3MJ9L 3FDWA 4QRRD 5F44A 3ESPA 4JFED 5KYXA 2VKWA 4HPOL 4RGOH 4J28A 3HE7D 1NL0L 1CGUA 5FA4A 3VI3F 1J9CT 2Y2WA 5I1HH 1KCLA 2CKNA 2EIZA 3ARZA 5EB9A 2P5EA 3QO1B 3R19A 5TPWL 1W8OA 5ABDE 3UTTB 5JPMB 3DX1A 5SX4I 4NN6B 4ZOBA 3KXFD 5E8EA 4F57L 1TLMA 3FAXA 3DO4A 3ESMA 5E9NA 2WNGA 3O0RH 2EDTA 5IROD 3DROA 3O4OB 5H35A 2NYKA 3BVDB 3MBWB 4DN4H 1DDTA 4I18C 5D71L 1OT4A 3ABMB 3OL2A 3BQUC 3MLWL 3S48A 5K1VA 2WLIA 1HVXA 2YSSB 4FTVD 4M4RA 4ZS6C 3I6SA 1ITCA 1EHNA 2ATAA 2Q6WB 1LD9B 3MREB 4JGNA 4YEEA 1JTOA 1M1XA 1RP8A 4FQHA 4PJAF 4F7EA 3WUWA 5TFSH 2Q86B 3KYOA 4N3UA 5LBSA 4J8RA 2V5YA 2X4TA 2EO1A 2XG5B 2WW8A 4NQQA 4XN1A 4FHBD 2AK4E 4JRXD 2Y9RT 4U1SB 4DK6A 4MQSB 3EJUA 4N90E 1QLRA 3OHXB 4Y5YC 3U1SH 3QULB 1B2YA 3EH5B 2O6DA 5BNXD 1HN1A 1GKEA 3QFJB 2HMID 3RA7L 3VFSB 3KEDA 3D0VB 1S6NA 4JDZB 2IEPA 3IJSB 4JFDD 12E8L 5MEOA 1I7TA 1T89A 2LV4A 4M7JH 4K4KA 1HSAB 1Y6MR 4X6BA 4U49A 3ATFA 2WXLA 2WWOA 2Z0UA 3P3TA 1W0WB 2WKOA 1Q9KA 1UZ6F 5CIPH 1F4AA 3WG7B 5EIIA 1IC0A 4M48L 5KS9A 1INQA 3Q2NA 1G4RA 5T1JA 4H44C 2KKQA 1NCWL 5EU3B 4BFEA 1MNUH 5E7FA 3EUDA 4DKAA 4Z76A 2OTUB 3OHMB 5KSBB 3MRBA 4G71B 4NIYE 4KKRA 5TQ2H 4QT5B 4PWIA 4IOSD 4TQPA 5HVGB 4CVXB 1E90A 2ZONA 3LPWA 4ECNA 3FB5B 4E9TA 4Q58C 5T1KD 2VOTA 2Y23A 2DKUA 5C0AE 2CDEA 1DTUA 4L3EB 1KXQE 2X4QA 3DXAA 1QTPA 5GJSH 1IFGA 1ROWA 1MCNA 4PU2A 3VXNA 1HJCA 4XNDA 5LHDA 1Z3RA 4Z77A 4WJKB 1BEYH 4KK8D 3AVEA 3QRGH 3GSRA 1LE5B 3BUQA 2GTZB 1QNZL 2DIEA 4QRSA 1WAAE 2Z8SA 5F7DA 1M7UA 3FFDA 4GAFB 1UD3A 3ZOAA 1B2WH 4JZJB 3ROLB 4BZYA 1ECZA 5DVMA 4Y19B 4IBUA 3EJCA 1IEBA 3P4LA 4FQ2L 2DBJA 5KOMC 1C5BL 3NEXA 3DURB 4GPVA 1H8NA 1TEFA 4QRAA 5D5ME 2HJLB 2HKHH 2HN7A 1IGFL 4FYTA 3IU3B 2EXWD 1U0QA 4X99B 4L4VA 1TO5A 2XKSA 1U8OB 1RJCA 1PY0A 2E9JA 1GOGA 4KKBC 4OF7A 4OLZH 5BRZA 2WTPA 2VZ1A 5C8JA 1FYTB 3RFZC 3GXUB 3GSUB 3H42H 2D9QB 3MJ6A 1LHZA 2BC4B 2ZICA 4TYUA 1XGQA 3V4UH 4ODTL 4F9PA 4AYSA 5ALBH 4IBZA 4W6XB 5EOQL 3D2UB 1RL1A 4L0YA 2JNZA 2CK0L 1SF3A 2ED6A 3P30H 1D5BB 3FOMB 1A9EA 4OGZA 2ZNXA 4LCCC 5HVFB 4PPTA 1AKJA 3SDAC 1JHLL 2VITB 1B0GA 5F7EL 3QJFB 2YAEA 1E3FA 2CDGA 3MUUA 4OB5H 5GJTL 1MIEH 5DMYA 4XVSH 3FO9A 4RLDA 1BZOA 4EKXA 4FG4A 2NZ9C 1JUFB 4OLUL 2GBTA 1VSCA 4OJFL 4LFHG 4NUGH 3SDDB 1HX0A 3WEMA 4MNQA 4HDIA 1NFDA 4O5LH 4M7KL 4PJ8C 2DWEA 5C07A 1D5RA 3S7GA 1K5WA 4N8PA 1A47A 3O3BB 3WFHA 4Z3HA 1KUMA 4X7SH 4FG2A 5EUKA 3ZKND 5B3NA 3FMGH 4HSAC 2JVUA 4F7PB 4WY7L 4JY6B 3P4OA 5IHWA 2GFBB 3VH8B 2Q7AA 1A7PL 2E76C 4OM0L 3IF1A 4XPGH 4XNMB 3KGRA 2IDSA 1F13A 3Q6FB 4ZUWB 5C09D 4F24A 1QHQA 1TU2B 2QHRH 1IIKA 2VH5L 3H7BB 1SHWA 4JL2A 4YC2B 4MSWB 2C1PA 1T6WA 2VL4A 3BSZA 5A6MA 2ICCA 1Y6KR 2XIDA 2FBJL 1DQKA 4FLHA 3BZFA 1NANI 5D4QA 5IHBA 3N1QC 2B2XL 3KWVA 1U8KB 3TP4A 2EE6A 1XQ4A 3ARFD 1VZIA 2G0LA 1T2QL 1ZLUH 2VZOA 5IW6A 1DJSA 1I82A 1W91A 1TG8A 3VGEA 1BGXH 2F1BA 1BD2A 1E5YA 1HQRB 2LHAA 1P7QD 2AJYH 4HJEA 4G5AA 4XNXL 2C3WA 4YDJB 3VE0A 1VKXA 3BPCA 3B7UX 4KRPC 1JBJA 4M6OL 4YL9A 4BZ1H 5CCHE 3R1GH 3MJ9A 2JE8A 1JDCA 1RZIA 1GVIA 3HFFA 1BQLL 1DQJA 1BF5A 4ZW5A 5KYYB 4IKKA 5E2TL 1K2DA 4B95C 1MHEB 2CO1A 3NN8A 1N59A 3UZQA 4MAZA 4EO5A 4N8VA 1HL4A 1EGJH 3MV9A 3P9LA 1CFSA 3N3EA 3LXCA 3ZT6A 4LB8A 4MD0A 1RHFA 2MNUA 1P4IH 1OTUC 1PIGA 4QRTB 3EG9B 3FQUB 4Z8FL 2E7MA 4X6CE 2XNAB 2AFNA 3OD3A 3LD8B 3T2LA 2BZDA 3L9BA 1BBJB 4CN6A 3O11B 3NIGB 3CFMA 1U21A 5FOJA 3UDWC 3WJLA 1MF2H 1JZFA 2QGDA 1UWEL 1SYSB 1P1VA 2IH1A 4XP5L 1L5GA 4I3RL 3CFJB 1BF8A 1PAZA 2V17H 5F8RC 3RTQA 3HNVH 4GRWB 5FAAA 1D9KD 4J1UA 3ZBMA 2IALA 2R23A 1GJUA 1WGVA 3KLAA 3C6LA 1U8HA 4M8QA 2PP9A 3H4FA 4WFGE 3VACA 2W9EH 4FNLL 4YHIA 4ZNEA 1DJZA 2BFGA 4NXSA 4PV8A 4AUUA 3ZVVA 2NY6B 4X4YB 1CD9B 5D6DC 5FUOL 1UD8A 3X3GH 3CLWA 4BFIA 5C2BH 1JFHA 4X5PA 1O7VA 1CICC 3RURA 2W5PA 3X17A 1GAFH 1H3VA 3BVWA 4TOYH 3DO7A 4NO5A 2F18A 2FJSA 4EDXB 4GI6A 2Y1VA 4ZFGL 3ZE1B 3VVWA 1DCLA 3GSXB 1O7DE 1UT1A 2YD9A 4JDEB 1ZDSA 4WW1B 2XTJD 3ZDYF 1OTTC 2YPVL 3FC8A 5T5FL 3U36A 4RVBA 3W11C 5HYSG 2BNQD 4XBMA 4KRMB 1TCRA 4OD2A 1D7FA 2C9SA 2Z31D 2XXGA 3OR6A 1EX0A 4PG9B 4RWHA 4W4OC 3VXTA 2X41A 4EI5C 4NN5B 5KVGL 1A14L 1BFOB 1GYWA 4C4BA 1P5UA 4ZPVA 4YSQA 1MHCB 3BN9D 3TN0A 15C8H 4I4WB 4N6RB 1PDKA 2K78A 5K93A 1Z5HA 4HJSA 5F1SA 1GGYA 4ZUTB 4KROC 3K0WA 5DRXA 5IG7A 3NK4A 3NSFA 1DL7L 3CFDB 4HUCA 5AKRA 2ZP8A 1NCBL 2DKSA 1AHWA 4MX7A 3DK0A 5IKCB 1NGPH 1O7SA 1TR7A 4JPIB 3GI8H 2QMKA 3UP1A 4K0OA 1INEL 1SXAA 1X4XA 1KIQB 1QRNE 1PKQE 1OO2A 5DD3L 3EJZC 4FNSA 4AJYV 4LPXA 1G1YA 5EA0L 5A1AA 2XJKA 5EEXA 5FCSH 5GGTA 4B3EA 4X8JA 3II3A 3GXIA 3V4LA 1JNNH 4JHAH 1F4XL 1GSMA 3DA0A 4P57A 2F58L 3W0WD 5E9DE 3QXWA 4YOKA 2GG1A 2YKKA 3CLEH 2UWEE 1PGRB 5CGTA 1RZKL 3ASOB 3GUTA 3RVWD 3ULVE 2KHAA 2PCPA 1F4WH 3HE6B 2F8XC 2VDQL 2XG4A 1AQKH 3TV8A 3LN4A 3AU1A 5FYLL 2HH0H 1XBDA 1X5IA 1YEIH 4MB5A 3V6FB 4Z6AT 3HB3B 3OX8A 2W95A 3U4EA 3GI9H 2WKLA 3BAYA 2BCMA 1HINH 1R4XA 3O45B 3IXTB 1A65A 1DQLL 1EJOH 2BXYA 1EZUA 3O3AB 4K7PH 3WS3B 1CLYH 1VADB 4FADA 1ADWA 3JWDH 2ADGB 2Q76B 4ZFOL 1GGCL 4MHHI 4QXUH 3TA3C 2F53D 1PLGL 1BVLA 3RNQA 4F15B 5FHBH 2YUWA 1VHPA 3UFIA 4FG6D 5DWUH 2HVKB 4H2AA 5ABZA 1NC4B 2JF1A 1U92A 1A6VH 1WWAX 1FP5A 3F12B 1GGUA 1FFNA 3BMVA 2Q20A 3T0BA 1RUML 1BJMA 4HHGA 1FZOB 4JO4H 5B8CA 5C0CB 3OF6A 1MCCA 4MVBC 3QS3A 4LASL 5ICXA 3SPJA 4XPBL 5GHWL 3SY0B 4M5TA 2WQXA 4QRPE 4UDTA 4Y5VB 1BLIA 1LK3H 3N44B 4P5RA 4UQEA 5F2FA 1WWBX 5F7KC 1LMKA 4DESA 1XF1A 1FLTX 1FL6A 3C12A 3SBRA 5IEKA 1CG9A 2EEBA 4PJIE 4NKIL 3JV4A 4QRRE 1CD1A 4JFEE 4WWNA 4WI0A 5CD5D 1I1RA 2A6JB 4BHUA 3MLZH 5T33L 3AM8A 1UEMA 3MRFA 1UD2A 2FGWL 3E2HC 4PCYA 2VC2B 3NVQA 2VABB 2BWIA 4U6VH 4WK2B 4XH2A 1JNLH 4ZSOE 3KPQA 1R46A 2G75A 2RMNA 2OPCA 2C5DC 2HLAB 3MGOB 4LEXL 3OB8A 5BUGA 3KXFE 4FQLL 3L4WA 4ZAKB 4NO0A 4P04A 4XNYH 1MWAH 3JWDC 5JHDD 4P2AA 4NQCD 2YD0A 1HI6A 3GMRB 3ZL4H 1FZKA 1HHJB 1X5AA 1NAML 5LGHL 1KCRH 1ETA1 3GMOA 1IIIA 1P6FA 5DJAB 3TIEB 4AVIA 2EICA 3NABL 2WXPA 2X4SB 3IMTA 1FFOA 1OE2A 4YHNB 5L2KD 2H4EA 1H9VA 4ADIA 5EU5B 4ZTOL 2E9GA 3IDUA 1ETB1 2CO6B 1PZ5A 1J1PH 3MO1A 5IB2A 1CB4A 4J3BA 3ULUF 1MJUH 5DS8B 1QLEB 3FSAA 4M93B 2Y7OA 4Y1SA 2MCPL 4P5MA 5IP4A 1TFHA 3BWAB 4N2AA 4FZEH 4WEBH 4LSTH 5DO8A 4AXWA 3N40P 4JRXE 1QACA 3CFBA 1WZAA 3GM8A 4QIRA 3SKMB 4UQBA 5GSRA 4NKMA 5A6IA 4FQXC 2HG5A 1ASQA 4QRUA 1AGEA 1Z3GH 3T3ME 3QG7L 2XFXA 3W37A 4JO3L 2Q8AH 5D5MB 1V3KA 3ISRA 3AC0A 5I15H 1P9MC 2J72A 3SPGA 3FQWA 3V7AG 1J1XH 3OPZL 4JFDE 4QHMB 1UQSB 2NR6D 5C0DB 1TQSA 3O9WB 4LU5L 3IN0A 2K9UA 1ONQA 3B2UC 3ILPA 4YDMA 3PGCB 1M42A 2BSSB 1WSST 1G0XA 5GRUL 2H7WA 1A6UH 1WZ1H 5BVPL 2BK8A 4DERA 1ZA6A 4ZYKA 2GSIB 4HXBH 4NI6A 4WRLA 3ILEA 4IIQC 3UYPB 5HGAA 3VCLB 3RDTC 1KGWA 3IJHA 4X7EC 3JT2A 2ZYIA 4Q6YA 1UGNA 1FBIH 4RCAA 3EO0A 4ICWA 1QYGH 1OWRM 3H6AA 3CSPA 2X0WA 3ZDWA 5E6SB 1BVZA 1FLRH 1E28B 1ICTA 3O6KL 4YHZL 4JR9H 2PCFB 2PO6B 4IBLT 5CO1A 2X2JA 4Z5RA 5KYUA 4MWFB 4BK8A 5EN2B 5DT1H 2H32A 4KTDH 5ACZB 3NJIA 2Y2TA 1NDMB 4N24A 5IUCA 2XWDA 1MXGA 2R1WB 3L1FA 4K7PY 5CXPA 2BNUB 4QXGH 1QQDA 1TQTA 3CN2A 1BBDH 2R29L 2AXWA 2E9IA 3UIYA 3UZVA 1YJDC 4GRLC 4GQ9H 3MV8D 1F90L 2DYPD 5TE6L 4CBZA 3MLRH 4H8PA 5J1AB 2P42B 3Q13A 3QEGL 1NIEA 3VX0A 4AYFB 4DKFL 1YY9D 4JHBA 3J8F7 1EHXA 1OT1A 5E6IC 1J8SA 1IBFA 1CYGA 4Z7NF 5BVJB 1MVUA 1GW6A 5F96L 2A83A 2H3NB 4CVUA 4NGHL 2ARJB 4BA8A 1QFWM 1R3JB 1FVEA 4MD4A 2YOAA 4E5XB 5HYSA 3SB3A 1I8MA 4U1LB 1YEJH 1EBAA 2OZ4H 3NJGA 1UADC 1XB3A 4KFZC 1A6AB 4UM8B 5FYJU 5MEPB 2D0FA 7CGTA 3RVTC 5D7JC 5KG9B 2WBJC 1Q1JL 3F6JA 3IBOA 2R8SH 2IPTL 2X4PA 5H37A 4TTGA 3D4ZA 3NESA 3ZHDA 1KJVB 3V5KA 4PJFF 3ULUC 1YNLL 4AI7A 5DEFA 4I8DA 5A2IH 3U0TA 4JFSA 1WA0X 5IGXL 4XWGH 1BCIA 2F15A 3DGCR 4B96A 5DUBB 1Q8MA 3CN0A 1XO8A 5K9QG 2Y06L 2DI8A 3HC4L 2B1AL 3LXBA 3NIFF 3LDBC 1UWGL 5DDHB 1ZRUA 4P07A 5E99H 5EO0B 2Z64C 4HFWA 4Z7UF 4KZDL 1Y0LA 1DVYA 1NC2D 2ZXGA 2WLYA 3N43B 4G8GA 1HZHL 1U8NA 4X6CB 4K5OA 1J8HA 4UT9L 5LCVL 2MMXA 2B5IC 2IV8A 4H20H 5EORH 3QE5A 4XPFH 3I02A 2FEDD 3N41F 1WPCA 5C09E 5DD0L 4MCYA 1G9NH 3QEQA 4IMLB 4QHKJ 1KTJA 4FNTA 4ISVA 2O6PA 2NY0B 2DH3A 4HJUA 4K73A 1YAZA 3VWKD 3DO3A 2CA3A 1MJ8L 1NEZB 1O6SA 3RBSA 3QNXA 4QXWA 4PSPA 5I66B 1CXLA 2NRDA 4LLUA 4PJ9C 1XH3B 1KG0A 4M03A 5HDBB 2FZ3B 2YGQA 4DCQB 4KK5C 4P23C 3VXOB 3CZUB 5IHZA 1QW9A 1KJ2B 3ZE2E 2ZSVB 1XCQB 1W80A 2G3XA 4U2ZA 1S5IL 3ARGB 4Y16C 3S35L 3U6RA 4YQXL 4X80L 3FOLB 4L8DB 3WNPA 5I8EB 3C6SB 3CU7A 2OP4L 2X44D 4DAGL 1QR1A 2KLSA 4ODWB 5D7LD 4BJLA 2LGNA 3MUGB 5BRPA 5KUMA 5E8DL 1I9RH 3CIQA 1J9TA 2Y7LA 1ML0A 1YEDB 4OKVA 4XODA 5DRWB 5D1QD 4TVPL 4LAJH 1ED3A 2IQ9H 2WIMA 4RMQA 1L0PA 3W9EA 4Z18A 5I1EL 1ASPA 1BOGB 4Y89A 4IMKA 3N0AA 3S36X 1YYML 4CDHA 4KHTL 5FECA 4OZFB 3V8OA 5BQ7B 3QHTC 2QVKA 4KKZA 3ZYOA 1YEKL 1ZLWH 4HIXH 5ADPL 2VXSH 1G9NC 4WFHD 3MRHB 5IHUH 1MXDA 3FSVA 4HKXB 1A1NB 4PD4J 5C9KA 4GUPA 5AVZB 4ODSL 3C60D 1UH2A 4S1SH 3PABA 2J8HA 1PEWA 4P9MH 5L6YL 1S7RA 4NFBA 2CAKA 5AAWA 4AL8H 3TBVA 1B90A 2E7LA 1QRNB 1PKQB 2WB7A 2FWOB 2YBRB 1S78D 4PRPA 4KI5F 1OB1A 5EWIL 3SKJH 4YSUA 3GGWA 4OFQA 2HJKA 2ORBH 3T6XA 1OARL 2ZZUT 3ILDA 4UZGA 1YECH 4UINL 4H88H 2MCG1 5EZLB 4F2EA 2H3KA 2DQEL 4U6HB 5E9DB 3V4PL 1JZ4A 1L3NA 1I7UA 1SEQH 2ZAIA 4ACTA 2UWEB 4JN2A 2J5LB 5FM8A 1N0XL 43CAA 5J4MA 1R3IH 5K59F 3N1MC 5JW3H 3ZIYA 4NRXA 2XWEA 1QAWA 4LSUL 2VR7A 4N26A 4WWKC 3B8SA 2WMPA 2F68X 4AV5A 1USZA 4JFWA 3GRWA 3I85A 4PJAB 1E5ZA 2BNQE 3CX5J 2YD2A 3VFNB 5FA3A 4BK5A 1IU1A 2EE9A 2X9WA 2XA3A 4W93A 3APMA 2YD8A 4GRMB 4I5BA 2EDDA 2H1XA 2P4AB 3O41B 1S7SB 1EVTC 4CKVX 3DJRA 1J1OL 2PMZA 5ESAB 1FRGL 2ZCKH 3DARA 4V2BA 2PYFA 3FS9A 3UTSA 1V7NL 3LEXB 3L3JB 3QC6X 2BERA 2YBGA 5A2BA 4QHUA 2RAMA 4R83A 4AGNA 2O6FA 4XVUC 3KLKA 1MJ7H 2XBDA 3NIDB 3WHE1 4G8IA 1MLBB 3DI2B 4K3GA 5DHMC 4XVOA 2LTQC 3M07A 2ZKMX 2PPCA 4AL8C 3QZNA 1NLDL 1OSPL 4YGVA 3WFBL 4XN7A 3MZTA 1F8TL 4HUVB 4ZXBA 4PMEA 3ZKXB 4HGMA 3SKNA 3S34L 3DOSA 3T0VA 2DLGA 3U48A 4CJ1A 5C0FA 2OZNA 4QRPB 5JHBA 4XXCA 3VFTB 5E2VL 4MXQC 4RSVA 1AS7A 3HCVB 4L29A 3VSUA 3W0WE 1HCYA 5JLZB 3U9PH 3FRPB 1F3JA 3FH5A 3QUYA 4LLMA 1ILSA 3WE6A 3BPNB 5JDSB 2AQ2A 4X5XA 1ZJBA 1ZLSL 3T77B 4PJIB 3GUFA 5T1DL 4M7ZC 1CGSH 1WITA 4L1SA 1K6QL 3QUMB 3LXAA 3SE9H 4MJ5B 3HNTH 2R56L 3HE7B 4W9ZA 2JI3A 4YBLB 4KQ4L 4JGMA 1K4CB 1ZVSB 3QO1A 2B08A 3WIHL 1DO6A 3FPXA 2FK9A 2ZWZA 3B9DA 4FQ1H 2ZOKB 4K5NA 5SX4H 1WAPA 1P4BL 1RUKH 3DECA 1JMZA 1TIUA 1Y1DA 2ZTBA 1NDTA 3ZUCA 4R8WL 1AMYA 4YPJA 2VJ8A 4ADGA 4S0HA 3MBWA 4Y4KD 2F53E 2P8PB 3WNLA 3ESVF 4AQEA 3CLFL 5JPNC 3MLUL 3AS3A 4YHKL 5T3ZD 4PJCF 4GBXC 4M8VA 3UC0H 4OF8A 2LOEA 5C9JB 5KBDA 1J0IA 5E0QA 3L5HA 1XGRA 2Q6WA 1DR9A 3ZIMA 3VI4F 4Q6IA 3IGLA 1HXYA 4EQ3A 5AUMB 2MPAH 4ZW8A 4M5YL 2PWEA 4E9LA 1D7BA 1G4MA 2XG5A 1T4KA 2AMUA 1FH5H 2BS8A 4AW7A 3OGOE 1IC4H 5JXEA 3P77B 4U1SA 5A2FA 5F3FA 3OMNB 4JRXB 2R2EB 3TWCL 1CC3A 2XC8A 3OHXA 1EEQA 4L5FL 4XAWL 2NSXA 1J88A 2W07B 3QULA 3U2JA 3U7YH 1MG3C 3R8BB 4HZLA 3L95B 3IETB 3KMDA 6PCYA 3T3MB 3QFJA 3SOTA 3VFSA 5AAMC 2CM5A 3M1BA 3D0VA 3SKOB 5DJDA 3ELQA 3EGXB 3WKMH 4JFDB 1OW0A 3VFGH 3VFRA 3NP4A 5ICYB 1IEAA 3VD9A 3IYLW 1HSAA 1E3XA 4PS4L 3HVNA 4X5QA 5D7IF 2AERT 3L7EA 3QR0A 5I6OA 2VDRL 5TH2B 2XHNA 3SGKA 1MREL 4ANUA 1PD1A 3PPEA 2VKXA 2Q5BA 1EWHA 4L4TA 5JHDE 1KXTB 1IVTA 5B1BB 4NQCE 3HPJB 3TBCA 5EU3A 1CXHA 4ZMLA 1B0WA 1A1OB 2GUYA 4UTAL 3MRMB 5KSBA 4TQIA 2YMXL 5JOFB 2XIBA 1NSNL 3RUGF 4WHYH 2HRPL 3CBRA 1DE4A 1YNKH 1CFTB 3RPIB 4J23A 4PM1A 4MA1B 1OWWA 1RZ8B 2N56A 1JRHI 1UKTA 3UO8B 5L2KE 2QMJA 3TEUA 5JIPA 4HOMA 5MERA 5CM1A 3LRMA 5FC9A 4L3EA 1WFMA 4IU3A 5C3LD 3VRLF 3GBEA 1B88A 4E9SA 1T5WB 3S3SA 4GUOA 3EF4A 3O8XD 3QDJD 1E40A 1N67A 2C3VB 3CIAA 4X7TA 3WTTA 1UVQB 2GTZA 3E3QC 3WTSA 3BIKB 3KVQA 1EMTL 4NO2B 4G8AC 1X9QA 4I3GA 4JZJA 1XX9C 4DP1X 2BM3A 5F7FA 1U3HC 1DSFH 4PVLA 2HRLA 2L4OA 2HJLA 3X13A 4ZFFA 2YFNA 3DIDA 3RL1A 3IU3A 4X99A 1CE6B 1QA9B 5KSUA 2ATPB 3ASWA 3QWOB 1U8OA 5J8OA 1QI3A 1IAMA 2UZIL 2Z7WA 3DX7B 3US9A 4UIMB 1CTMA 4W4NA 3GSUA 3QNFA 5E2JA 2BC4A 3EDJA 4XO9A 1RZJH 3IT8D 5HDQH 4BUQA 3EO1B 4P99A 1WFJA 2CMRH 2VMCA 5J6GB 3T2NL 5IT2L 1XF3B 3IMSA 4ES8A 3D2UA 1RK1B 2IH9A 4QOKA 4ETYA 1LWJA 3VQLA 1YEGL 4WNQB 2OMYB 3F65A 4PSRA 3NK3A 3X11A 1QI4A 5LN4A 2EDJA 4JPWH 2CIIA 2VITA 2PXYA 3JVGC 4KUZH 4M61B 3QJFA 1IAII 2WVSA 1HT6A 3VDBA 3I9GL 3RWCA 4R90H 1OAKL 2MOQA 1RHHA 4V1DD 3RGVD 3OKOA 4OQTH 1BQSA 3ECVA 3UPRA 2VLMD 3MRLB 1HHIA 5I6XB 4XWOC 5B7FA 1X44A 5E51A 3T3PF 3O3BA 3H3PH 3GSQB 4B3VA 2WXFA 4YSCA 1SJVA 3BQUD 3P0VL 3QUXB 4YXLL 4F7PA 1KEML 4MCZB 4C8XA 1RUQL 5DC9B 4Y2DD 4ZS6D 1AVAA 3MV8E 4WHDA 5BV7B 3AB0C 3Q6FA 3PP3K 2YA1A 2J55A 1TU2A 4Z7VF 4CN4A 5C09B 2EUWA 5KBMA 3L8QA 3QIBA 4HWBL 3ZHFA 4U1NB 4HS8H 1XCXA 2MPVA 3LMJH 4LCWB 4HHWA 4LDLB 3EJQA 2MOGA 5H4YA 3EYUH 3NEOA 1VB9A 3LEYL 1C8QA 1Y7VA 1AAJA 1CK0L 2VC2L 4YSRA 2N59A 3STZB 1JGIA 1NANH 2B8OT 4OJYA 5BW7C 3HHSB 1A0QL 1U8PB 2OI9B 4KVCL 3BD5A 4Z78A 1D6EB 2VDLH 2BIMA 4Q9RH 3NCYP 3L5XL 1OLLA 3ARFB 3L3IA 5DJZB 1KMGA 2W1NA 5E08H 3LN9A 3SCMD 2WOBA 1HQRA 4O58L 1WDAA 2GJRA 4IBQA 4YDJA 4NUMA 2C9QA 3BYYA 4ERSH 1F02I 4MYWB 1I8KB 4HKJA 1H0DA 3DX2A 3IDYB 4LDOB 4WW2B 3G5YA 5I24A 1A66A 3TO2A 1X7TA 1YZZA 3PNRB 4OCNC 2WZPD 4APQC 3K71A 4OFPA 3LKOB 1MHEA 4RFNC 3LIZA 4GSXA 1PG7X 3WIHA 1I7RB 1R5IB 1U8CB 1QLEL 1M7IB 3TGXA 1FE8H 2OXGA 3ZQWA 3BKMH 5C2UB 4JHWH 2X2UA 3SIKA 4K94L 2XX1A 3EG9A 3FQUA 3OM3B 3F58L 4QD2E 1TEYA 4JN1L 1IM9D 2AK1L 2YAPA 3P11L 4HAFA 4WNSA 4UOQA 5HYQA 3K0YA 5DI8B 1BBJA 4ELDA 4WI4A 4DEWA 3O11A 3L3GB 4HG4K 2FL5B 2APXA 4X98B 4ACPA 4LQFL 1SYSA 1NGQH 3X3FL 4AZ8B 3L4CA 4NRZA 4LNRA 4QAMB 4JE0A 1A9VA 3VD0A 3T0AA 4GLRI 4Q14A 2VXQA 3S37X 3QI9C 4HBCH 3WAJA 4UNTA 1T04A 4P3DB 5IM7B 3NJXA 3C08H 3D18A 2AJXH 3IPEA 5LG6A 3AXIA 3QCUH 2VUYA 4UM9B 1NDGB 4BSVA 1DJXA 1ZIAA 5L8LB 4FFYL 5AVWB 5DC0A 5KVEH 2KZBA 1NMAL 4KKBD 2V2XB 4U3XA 4H25A 5D7LE 3FQXB 4EDXA 4TNGA 1AQHA 2ED8A 3QPXH 2MRYA 4ZFQA 5FO7B 4TNVK 4KKQA 1H8LA 1KTDA 1MRFL 4WW1A 4JDEA 3II2A 1RJLA 5D1QE 4AEHL 4NQVB 5IESL 1PJWA 1X7SA 3TH2T 4LXFA 2R0KL 3GSWB 1LMIA 3JV6B 4PG9A 2BNQB 4NQXB 4N25A 3SDXF 2Z31B 1KULA 1HNGA 4OUUB 2FECL 3BCFA 2QGCA 2IQAB 3SOBH 3GIVB 3SDAD 4WV1B 5F0PB 1KN2H 1MHCA 2NYYD 4MRBA 2BVUA 1NMCC 4GQQA 3V95A 5CJXC 4ODXA 1ZLEA 5CCKL 3IE9A 3DTXA 4FMVA 2WWNA 2PR4L 5JIIA 1CVSC 4ZUUB 4BIKA 3WN5C 2KLTA 3P0YL 4WFHE 1KZYA 4ILDA 3RE0A 1OOAA 4XPAL 2WYTA 4F2ME 1WUNT 4MTMA 5GGRA 3S96A 3ZTEA 5IKCA 4U6XA 4PJ8D 1EAQA 1NBQA 1H3PL 4C4KT 4EVNB 4R7NB 4W9LC 1A7NH 3WEAA 4O2CB 2HXAA 3WMPA 2WV3A 3O3DB 3OKKA 4E41D 1G7IA 3IDMB 4M3JA 4FHJA 1DFBL 1AGBB 3B37A 1F6AB 2XN9A 3LS5L 3V0EA 4LL4A 3AG3B 5LO7A 3WIAA 3GMNA 2VWEE 4RGNC 4NM4H 1E27B 1JV5A 4IJTA 2WXHA 4QEGA 2IAMC 5LAXB 1GMIA 1QSVA 3OAUH 3APFA 1CTNA 2YZ1A 1CFQA 3AXLB 2AJUH 4JHUA 1IB5A 2R51A 5D7SH 3O2DA 4DP7X 1CYWA 3D39D 3SQOL 3CXDH 5DZOA 4BQ6A 4OCRL 1RERA 1NEZG 4IM8A 2IANA 3HE6A 1KELH 1HZLA 2P80A 3I6LD 4GI9A 5LNEA 4CNIA 1DLFH 2V9UA 3FBKA 3V6FA 1MQ8A 3V0GA 1KCUL 3EF7A 1OGAD 5FR3A 4I77L 4MLIA 2BH0A 1VA9A 3FO0L 3LPOA 2EUVA 1SVZA 3BZEB 1XCTB 2AQPA 3O45A 3CHXA 8FABA 4HXAL 2RIKA 1IQWH 4K8RH 4MJID 2BY1A 5C86A 3WS3A 4ZMYA 1AI1H 5C0BD 5JMOC 4HQQH 2EINB 2VQUA 2J20A 3LN5A 3QHZL 3U30B 2DW5A 4XCEB 5AENA 2A3TA 4HVBA 3MPCA 1U2HA 3QUKB 4BHUI 2NY4B 4FX5A 5CJQL 1EFXA 2NUTB 5FYKH 2Q0ZX 2OR9L 4O51B 5C6TH 2AEQH 1FZOA 2VSDA 3D25B 3ULSA 5C0CA 1HHGB 5GGVH 4QHLB 2B59B 5HPMB 2DQJH 4N2HA 3SY0A 1X9LA 2CLRB 3K80A 4OZFG 5GS0H 2VRKA 1WE5A 1KJ2L 4A7GF 3JWOL 5IMKB 3CVHH 3BC9A 3VJ6B 4YDKL 4ZUSB 4GAJH 5HJBA 2YAOA 3B9KD 3GJEB 1UYWL 4WO4B 1G0YR 3WDIA 3O3EB 2C26A 5E23A 2A9DA 4GSDH 5TE4L 3VFPB 3S88L 5EEYA 1ADQL 1ZWIA 5B1JA 2BLFA 3IFLH 1INDH 1NCAH 2PWDA 5EEUA 1X9UA 3MN8A 5KW9H 7PCYA 2XU9A 1J9SA 4PRIA 2AW2A 3V0AC 4G6MH 3BHBA 2GC4C 2JCCE 5EZOL 1PYWA 4K8RC 5JHLH 3EO9L 2HLAA 2DLFL 4UYPA 4ZAKA 3ZSTA 4OZGA 4HALA 3B5GA 3T0ED 4LL9A 5JHDB 4OD1H 1AZNA 4NQCB 5E8NA 4O2EB 4IK7A 1SEBA 2Q7YA 2FQGA 3DVGA 4TUKL 5IOPA 1Z1WA 1OTTD 1MCOH 3W11D 3TIEA 4F8QA 5T3ZE 2IBBA 2EIEA 3ZQ9A 3TNNB 1OP3K 3U0PB 4H1LB 4EI5D 2IGTA 3O6LL 4YHNA 4ZOAA 2R1YA 1KGUA 3K1KC 5EU5A 4EAEA 4Z7NB 5L2KB 4FERA 4AUJA 1KBGL 4RNRB 2CO6A 1E43A 2MKLC 5I16B 1FVDB 1M56B 3ECQA 5JW4R 4JAMA 4TL4A 1S3KL 1WEJH 5ECGA 3E80A 1MFAH 2IVFC 2FE0A 2LVCA 1BQHG 3DUUB 4B6ZA 3WKPA 1C08A 2OK0L 1W0VB 4TSBH 5AALA 1I9EA 4QAWA 3SKMA 3BJ91 4LVNB 3Q2LA 1W72H 3SE4C 2Z1KA 5EF3A 1E6JH 2NNRA 1T03H 3UAJC 2V33A 4JREC 2D73A 3EJZD 3ULVL 1KIPA 2WQSA 5D1XD 4ZO8A 2JIXD 3HC3L 1OV8A 2APTA 1L9MA 1RK0B 1OGTB 3G5ZA 4XMLH 2ZKHL 3EBHA 4KTEL 3NFPA 4L9DA 5C0DA 2JJVA 1ORSB 4N2IA 3PGCA 3DV4B 4H26A 2BSSA 4QHKI 1IT9L 3E1ZA 3DK2A 3QJHB 4P2QB 3HKFA 3MLYH 4Y4HC 3THMH 3TXAA 1OOWA 3PPSA 3C8HA 5E6RB 2PR9A 2V5SA 1OCCB 2BO0A 1Q94B 4KMLB 3LZLA 4X7CC 3UYPA 2IMMA 4HCRA 3WFDL 5I73C 2O5YL 2YRBA 3SPCA 1JHTA 2OMUB 3H9HB 1ZANH 5E8PB 1CXKA 1F4HA 3RAJL 2MOVA 2VGLM 1CMOA 3QO0A 4A7TA 2MWCA 4OI7A 2PO6A 1VEPA 4BQ9A 2BY3A 3VGAB 2VZ3A 1TNMA 2LU4A 5JZ7D 3P9MB 5EN2A 3WKQA 5I74C 3U79A 5ACZA 4M1CD 2QQKH 4NN7B 2LU7A 3TA3D 1FORL 4AJWA 1TZAA 2R1WA 4JFTA 1REIA 4LSQL 1FNEB 4UF7C 1I3RB 3LZRA 1M71A 1RCYA 2XIIA 2JFCA 3EOYG 5I82A 3MV8B 2DYPB 3K2UH 3QWRD 2CCWA 3PWPD 3E6FB 4MKTA 4ODUB 5J1AA 4DEPC 4ELMA 5L7XH 4PJHA 1W16A 2BDNL 2G9KA 2XYBA 3V0FA 3QUML 2E7DA 4GAGH 5BVJA 4KDTA 5J1SC 4IRJC 4LBEB 4PI2A 2QKSA 5FX3A 2DQIH 5GGVY 5IHHA 5JW5B 1UA6L 1R3JA 5DGQA 3BAIA 4U1LA 2GTQA 3BDYL 4W9KC 5MEPA 1A6AA 1JXKA 4UM8A 5B7EA 4B5ZA 2X1XR 3KPSA 1AZCA 1HEZB 2NCEA 5KG9A 3D2TA 3UYOD 2AQTA 1VJSA 1MPAL 3MTXA 4ZNCD 3LHPL 3QQ3B 3DX3A 3K5RA 4AMXA 3UABA 4PJ7E 5JR1L 3NZHH 4I18A 3REVA 4V1DE 4ODBD 2ZXAA 4OZHE 3WIIH 1CR9H 2FX8H 4E9WA 1OE1A 3HI1A 1LXMA 3IDIB 3S2AA 3MRJA 2VLME 3IGAB 2VN5A 3VGBA 4MDIB 2FVNA 1A3LH 4U1GB 3RZCD 2OR7A 3PWLB 1IBGL 4UQAA 1BVNP 2ZUQC 1CLZL 5CU5A 5I8CB 3GD1C 2BOCB 5DDHA 5EO0A 4D3CH 2WYZA 4N0YL 2ZXDA 4RWYH 5AVXB 3LH9A 4X6CA 2ADIB 3VXUE 3WS6C 3CZFA 4FYSA 5AW0B 1GC1L 3CFUA 2ED9A 1NCGA 1RUPL 4RFOH 1KC5L 2ZUSA 1MHHB 4Y5YA 1BVKB 2A5UA 1N6VA 5AW6B 2H0JA 2ALAA 3AY2A 4JRYD 3VWKB 4YHOH 4LVHB 5CEYB 1KPRA 1NEZA 1YLBB 2X5PA 3IMBA 5IK3B 3MXWL 5I66A 3GRBA 2QADB 4HS3B 3TBYB 5IREA 4FQXD 2FZ3A 2XI9A 2WVUA 4XB3A 3TH3T 1H8OA 1KXVA 3VRIB 3VXOA 4MB3A 1R33A 4DZ8B 1Z7JA 3OXSB 1NFAA 4AYMC 1XCQA 1JZ2A 1GCFA 4MXWH 3I2CH 4G9FD 4U1MB 3ARGA 4ATWA 1A2YB 1DJIA 4L8DA 3QG6B 2XWTB 5DJCB 1HCVA 5GRWA 3FUMA 3L3HB 3ETSA 1O75A 3K1DA 4XC1H 5D2LE 1UWXK 2XX0A 3EUUA 3KPLB 4QCIB 2B7DT 2DLIA 5D7LB 3AQYA 3B2UD 3UBFA 4K3EL 5CSBA 3MUGA 1ADQA 1ZTXH 3GJFB 1TUPA 4DGYL 3VXSA 1CBVH 5DRWA 1IC5L 5DD6A 4YE4H 4FL4B 4RH4A 1FSKC 4LLDB 4EMZA 1VIWA 4M1GH 2DLEA 1HCZA 1R5VB 3Q8FA 3DX4A 1WCQA 2E9WA 2AANA 1KACB 4PJ5B 3FUFA 4LSVL 4G6AC 4ZTPH 2WK2A 3PF2A 3NPZB 4PV9A 4BH8B 3C09C 4MMZC 1KTLA 2WXKA 2E0PA 2NX5D 4OZFA 3RX7A 4XXDA 4KJPD 2Y69B 2VE6A 5I18H 3KR3L 4NHCH 5KVDH 4UUJB 5GGQH 3AREC 1OKEA 2N01B 3AAZB 3PQYD 4HIJB 1A1NA 1LO0H 1N5AB 3GSNB 4HKXA 4F2MB 1T0PB 3NFNB 3T8XB 2LR4A 5AKVA 2B3IA 4JRFA 3D12B 4MA7H 3C60B 2WC7A 5DC2A 3VI3A 2AEPH 4NC1C 3OPUA 4U0RC 3TV3H 3TCLB 1TSRA 1RJYB 2J1XA 1U30A 1BM3L 1QRNA 2UXVA 2FWOA 3DJTA 4G7VH 4QYOB 5LBVA 2VXUH 2VISA 4GRLD 1SJMA 1AYRA 4DPRA 5IIEB 2YGPA 2NY3C 4PREB 4UIKH 3RFZA 2MQ0A 3UBHA 4FJYA 4RQQB 1IGCH 3STLB 1W9XA 4H40A 5DJXB 3TNMA 3K4AA 1F5WA 4U6HA 4X6EA 2DQHL 1X5YA 5B22A 5E70A 3ZX1A 4P2OC 5E6ID 1T66D 2HUHA 5TE7L 5IEHB 1QW8A 1QOKA 1ZD6A 3DMMA 4S1RL 4DKTA 3BP7B 1NUNB 2BHZA 4OV5B 3RI5F 4K07A 4AG4H 1F11A 3GO1L 2WGXA 4XNAA 3BUYA 3T0XA 4DUWA 3IAGC 4KJQC 1D2PA 1MFMA 4Q6KA 1M2OA 4PJAA 3HC2A 3F8UB 4HX1A 2XA8L 3RVTD 5EC1B 5D7JD 1XFPA 2X9YA 2P8LB 1TZGH 2GYSA 2WBJD 5JOEA 4GRMA 4S0SD 5AVSB 4LCYB 2HTLC 5DVPA 1EAPA 3O41A 4QPEA 3RPKA 3FN9A 4D9LH 2VMJA 4QO1A 3DTDA 4TUJA 4HLEA 3K4DA 1BQHA 4K2UL 1BMZA 3N85L 3F85A 2A74B 5B39B 3S36L 3LEXA 3NG5A 1S3RA 5M7QA 2WZ5A 3L3JA 1NGZB 5BV7L 3MOAL 1IFHH 1TEGA 3GBDA 4TS6A 4GEJA 1TPXB 4FFVC 4YHLL 1I9IL 1V27A 5PCYA 5LNDA 3QAZC 1G9ML 1WBXB 2CR6A 1ZHBB 4M3KB 3C5ZB 1P7BA 3B9EA 3L48A 4L4JA 3BKCH 2TAAA 3VSQA 4OCWH 4E41E 4UQ2B 4UWQB 5J3HC 4IHBA 4DGIL 5CFAA 4KZEL 2WKOF 3HAEG 4PS7A 1ODUA 4JM2C 1AZUA 4OGXH 3IFNL 3VFTA 3N40F 4X6DB 3QDGD 3U0WL 3VFOB 4UV7L 3FRPA 5I2IB 3CVIH 1NKGA 1UZ6E 3ECBA 3D39E 1VCAA 3OGCA 4GXFA 5CN3A 4PJ9D 1YEFH 3AG2B 2E6JA 3QUMA 3RJOA 4AGQA 1DQMH 4GI8A 4KK5D 3VNZA 3OR7B 3I6LE 4P23D 4XP4H 2G2RB 3SODB 5I6NA 3IB4A 4DVRL 3S3JA 1HOCA 1CLCA 4XVJH 2ZX8A 1KN4H 1A3RH 1DHKA 1QATA 1OGAE 2P47B 3SYCA 1K4CA 3FTZA 3JWNC 3O6FC 5LBSH 3T1FA 4YBQC 3FAWA 5LUMA 2C1OA 4Y16D 1RIHH 4N2CA 3VO0A 2XUWA 5FWRA 2ZOKA 5D6CA 3X12A 4MJIE 1E4WH 1LTXA 2QDVA 3EDDA 5C0BE 5TJWK 3TYGH 1CLVA 2E47A 3AWEA 4NWTH 4U7MA 5KWYC 2AQ3A 3HS0B 1PLCA 2K3TA 1RIUH 3GSVB