4AXWA

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1- 2, form i 2.2a.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 44
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA02
4AQEA 2O72A 3Q2LA 1SUHA 4APXB 2OMUB 3UBFA 4AQAB 4AXWB 4ZMWA 1WYJA 3Q2NA 2WHVA 3FF7A 1FF5A 3LNHA 4ZMNA 1L3WA 1NCHA 2V37A 4ZMPA 2QVFB 2WBXA 5CZRA 2OMYB 2OMZB 3K6DA 5CO1A 4NUQA 4AQEB 4ZMTA 2YQGA 3K5RA 2X2UA 1NCIA 3K6IA 3Q2WA 5DZVA 2OMVB 3K6FA 3LNIA 1ZXKA 3FF8A 1WUZA 3MVSA 4ZMLA 1Q1PA 5JYLA 3Q2VA 4ZMVA 2A4EA 1OP4A 3QRBA 2QVIA 4AQ8C 3PPEA 1ZVNA 4NQQA 4ZI8A 2EE0A 4ZT1A 4AK1A 2YSTA 4NUPA 1NCJA 3LNDA 3UBHA 4ZMYA 3LNEA 2OMTB 4ZMXA 3UBGA 4QD2E 4ZMQA 4OY9A 4AQ8A 1NCGA 2OMWB 3LNFA 1O6SB 4XXWC 3LNGA 4ZMOA 5JYMA 4ZMZA 3K5SA 4APXA 4AQAA 4AXWA 2OMXB 4ZTEA 2WD0A 4XXWA 2WCPA 1EDHA 5KJ4A 4NUMA 2A4CA
chains in the Genus database with same CATH superfamily
1KB5A 1UQSA 4LHUA 4KXCA 3PWUA 4GW1B 1TQTA 2OK0H 3CTTA 3O0RH 2P52A 5LCVL 1S9WA 3LIUA 1K5WA 1WPCA 4LSQL 1DJZA 3TYFA 3LKOB 2Z93B 1AR1C 2FHBA 4ESKA 3F7PC 1Q8MA 3QFDB 5I8EA 3QZWA 5ISZE 1ES0B 3PV6A 2VM4A 3HRZC 4U1KA 3UJTL 1UM5L 2WYIA 5A2FA 2WZAA 1EEYA 3W5MA 2J8UA 5CZKA 5DC2A 3N06B 1DQML 1G7IA 4LCIL 2ZOUA 4YNYB 1D7BA 1GOHA 1UC6A 3U6RB 3MBXL 2B59B 4BQ8A 1PEWA 3TXAA 5EBLA 1UG9A 3WLBA 4Y8DC 3I2CL 1R3JA 3GTTA 3K4ZA 3HI1B 2NT0A 2ENPA 4YLQT 4HG4K 4G42A 1A3ZA 1HHHA 2YSSB 1Z2KA 1OSPL 3QEGL 3H42H 2Q3ZA 4ZPTB 4MXQC 4J8RA 3CQQA 4UU9A 3QIWA 3ZYIA 2ID5A 5D8JH 7CGTA 1XXDC 2IH1B 3KM1A 3ATBA 4RAVA 2DI8A 2F1BA 1CL7I 2OR9H 3B3IA 3KWVA 3GXFA 3FB8B 5D4IA 4NQVA 2AABL 4ZS7H 2ENYA 4XNAA 2CGRL 4MDIA 3MREA 1EAJA 1DO6A 1W16A 1WAAE 1TO4A 3V0VB 2OV0A 3CSTA 2JI1A 3QB7C 1ZLDA 2E47A 2BVPA 4Z7WB 4OFYA 2XY2A 3RGVA 3U0PA 2R59A 4S2SB 5E5RB 1TOXA 3CUPA 2WLIA 2VDKH 2MPAH 2CHNA 1VCBC 5CFHA 3WS6A 1W8EA 3GJFA 3LN4B 3QAZB 3TV8A 4GKNA 1D5IH 1JV5A 4W6XB 4XCFH 4L8CA 1ND0B 4JPSA 4GB9A 2ZX7A 1ZTXE 5L8KB 4QOKE 2V5RA 2XFGB 3FTUA 4ZNEA 2DH2A 5MP6L 5AVVB 4AYGA 1WBYA 2BZ7A 4NPJA 3T3MF 4KV5F 1KCWA 3HTLX 1PLGH 3TS8A 4L1SA 3LKNA 1GPOH 4IRZA 1ZT4B 3KPQA 2EIZB 4IBUA 1UCBH 1B90A 3ZY7A 4QHNA 4BH7B 5CLYA 3W81A 1UVQA 1CURA 1H9VA 1TNNA 3QCTL 4HGWB 1A6PA 1KCLA 5TF1H 4RGND 1OLLA 1RIUH 3TBYB 4JZJB 2WC7A 2XBDA 4LCWE 1S8DA 3RWCB 4O5LH 1Q9OA 2X7LA 4HC1L 1EBPA 5GRXG 4ECNA 2E56A 1KIQB 3T77A 4GQZA 1NLBL 2CDGA 5CUSL 5E1HB 2UZXA 3B3BA 1DBBH 5F9OL 3PCYA 4NAQA 5TE7H 2K45A 3ARXA 4LP8A 1RZPA 1T5KA 5EORH 1UCTA 1RZIA 5K59E 1L7IH 2IDUA 1X9QA 4QY8B 2VR4A 5A16A 2DQTL 5T1JA 3NA4A 3TL5A 1C08A 3SO3B 1E3XA 1BD2B 4JPIB 3HEIB 1KXVC 2TSAA 1J5OH 1G0DA 1IIIA 3BE1L 3VRIA 4M61B 1OPOA 5IVXE 4PYGA 4HWEL 5DQJB 4KZDH 4ZMPA 1BFVL 5AB9A 4NQDA 3QR2A 1VEMA 1NAML 4OAWB 4BZ1L 2HVKA 3EYOA 1BZOA 1M05A 4I48B 4WI4A 2O93L 5B4MC 4Y5VB 1XF4B 2DKUA 4QI3A 5I5JA 3TJEL 4XNZB 4YHKH 4Z95H 3TZVA 4E41B 2X1PA 3LNIA 1QFOA 2NUPB 3GIZH 4DK6A 3BKML 3MNVA 2GJ6A 5F96H 3O2DH 3ULVE 4L4VD 1JXKA 5HDOA 5JQHC 1X9UA 3KGUA 1WD8A 4HV8B 4KKAC 1I4FA 2BY3A 3BP7B 3MKGA 2H3NB 1NIEA 1UWXH 2IWFA 2E6QA 1DN0A 2YRPA 1Z9SA 4NKIH 1IVLA 1ZT7B 2B3IA 5JORA 2GBTA 4U1IB 2R2EB 2BSSA 1AS8A 1E4XL 1J11A 4LOUC 1ZEAH 2NCEA 2YGOA 5TDOA 5DSCB 5HJ3B 2DLFL 1HKLH 4MTMA 1FNAA 1OF2B 3E8UL 3GHEH 6CGTA 2ESVA 4I3RL 2BRRL 3EH3B 5FXCH 3O45B 3L4VA 1AVAA 5AG8A 5IGXL 2HCZX 2KT6A 5FFOA 2WXNA 1OD9A 1T0NB 2PYEB 4ELKA 2ATKB 4PU2A 3DV6B 3IDYB 5E99H 4OCRL 4ONFH 1A9BA 4Z3FA 3OLGA 3UZEC 5T1LD 3VVVA 4HWNA 3PP3K 4PLNC 1ETJA 3UTZA 2YLHA 1KB5L 4CC1A 3DXAB 3E3QE 3QULA 1F13A 4HJTA 1SDAB 2VW4A 4Y8AA 5GRYA 3U0WH 1BBJA 5BV7B 4GINA 3ROLA 1UZ6E 5IHWA 2VZ3A 4QNPF 4BYHA 3VU1A 4YHMH 3NDZE 5ECGA 2V33A 4HWZB 3QXAB 1NDGB 3NCXA 5BZDA 4PJ7B 4JMNA 4HZ1A 1NMCB 2VAAA 3G04B 3HS0C 4JLRB 4UB0H 4HZLA 4YUEL 3EYFB 3V6FB 3RZCA 5FM5M 4P5TD 1X5FA 3FT0A 2WUBL 2LE9A 4YBLB 3CZNA 4I2XB 1UH3A 1YO4A 2ZX9A 3VFVA 4JRWA 1U95B 2FK9A 4OZGE 1P7HL 4HPOL 2FJFB 3EJZC 1NGWA 3HBQA 3SSGA 5CLWA 3O3DB 1MPAH 1OEZW 5FAAA 5J12C 4JM2D 3MV8A 4URTB 1YMMD 2E86A 4L29A 3DUSB 1JF5A 1I3UA 2G5BA 4NUQA 2AMGA 4LIQL 1CD1A 3VX1A 2QKIA 2B7DT 4ELDA 1WA2X 3O41A 3IVKB 1XH0A 4TULH 1ZV9A 4KH9A 2NT1A 2FSDA 4YHPA 1HIML 4LVNC 5HYSB 3OAWA 1N2RB 3RWEB 4ES9A 4CU6A 1JXDA 5FA3B 2W0FA 2CR6A 4LF3A 4NO0D 4DGVH 2FGWH 1XIWD 2HH0H 1AO7B 1T3FA 4I13B 1BXUA 5JW5A 3LH9A 4HX1A 4U31A 4YBHA 5FB8A 1VSCA 3I85A 2WXMA 4N2AA 4YOKA 4FZ8H 4M7ZC 4W9ZA 4UYPA 4OGAC 1WFUA 2JIXD 4F37F 3RDTB 1Q9KB 4EAEA 1Z32X 3MU3A 3D48R 5KYNA 4I9WD 1IZJA 4Y7OC 4AQ1A 4PG9A 4N2BA 1ZHKB 1P6WA 4WNJA 3OKLA 4KTEH 1G6RA 2A6KB 5CBAB 3HAEA 3IF1A 2UX7A 3SQOL 1G7MA 3CE1A 1AGCA 3HR6A 5BW7A 2VN7A 1RK1A 2OZNA 4G83A 4JK0D 5ABZA 2BM3A 4N9OB 5CJXC 1R5IA 2ZYHA 5TF0A 1ZHLA 3RJDA 2W60B 3Q05A 4JDEA 4R0LC 3RJOA 1ZSDB 3GK8L 2J21A 3PFUA 1LE5B 3ALXA 3JTTB 3VXRE 4XNDA 1U8KB 5DK0A 4BUHA 1I7RB 1AD0B 3PABA 2P8PB 2X1WL 3F84A 2FWLB 5CINH 5BJTA 4CVXB 2FZ3A 2YD0A 1N5YL 3CVHA 1A7QL 3MJ8A 2IPTL 4Q4EA 1A6WH 5FOBB 4UT6H 3R8BB 5LHDA 3LZLA 4JKWA 5BS0E 2I07B 2FJUB 4KDWA 3BRDA 4NXKA 4Y2NA 4FQXA 4MNQB 5C0AD 3VXPB 3WTXA 3FZUC 5IQNA 4XVTH 1G9NC 2FT7A 2Z64C 2NY6D 4JG5A 3OVUB 5GS1A 1RL1A 2Z92A 1AGDB 3FU0A 2AXHA 2RB8A 4TNEA 5DO8A 4MCYA 5JIQA 3UBFA 1TJGL 1KTKE 3JV4B 1MHCB 2AI0L 3SBRA 3V6BR 1UXWA 3ZE2F 3PWVB 3UROR 1FJ1B 1MCCA 2BIOA 5JXED 4P2RB 3FFDB 1IBHA 1FL5A 4EO5A 2YRLA 3QE5A 2B0SL 1B9ZA 4K15A 5CEYA 5FM4A 1FFOA 3HPLB 1NCCH 1M7UA 1JFQL 1XV8A 3BPOB 3VD7A 2YA2A 4GRWF 3WN5C 4JFFD 1G1OA 3NIFB 3NFPA 3GBNL 3D30A 4G6JL 3N1FC 1OHZA 5DEJA 4TKWA 4JE4B 4NHUB 2GC4C 3I02B 4L9LA 4TS6A 3TTYA 3ZXAC 3G5ZB 3DROB 1T80A 4U6VL 4XBPB 3QUYD 1WEJL 5DZJA 4NLHA 1UFUA 3N85L 4W9LC 2WTPA 1F3JB 1BVLB 2FQDA 4ZMLA 2DIAA 4PRPB 1E9QB 2WJ7A 1V54B 3NQKA 2FH6A 1OCZB 4J4PC 4P9ML 1JNHB 2ZG2A 3RZWA 3WTTA 3U30C 2P3YA 2CLRA 4OGYL 4AWJC 3QZBA 1OW0C 3ARFC 5FUOL 4F7PA 3IAPA 2BW5A 1U42A 3V0GA 1SYVA 4GSDL 3S97C 5EU5A 4C47A 1G9HA 2HFTA 3CN1A 4HCRH 2DDQH 4Q9CA 5A40E 1AI1H 3GBLA 5A1AA 1CLCA 1DJYA 3B2XA 2E9JA 2VSMB 3MGOB 3VWJD 4DGYL 4JAMA 1RJLA 1OT4A 4HKXA 3D85D 1F8TL 2VH5H 2WVVB 2HUEA 5DVPA 5KWYC 3HC2A 4JFSA 1CFVH 4YXKH 5K9JH 3OKMA 3VXOA 4LBAA 1LYQA 4PLOB 1YEGL 2Z7ZA 3NPZB 5CGTA 1A7RL 3JWOL 2ZXWB 3Q6GH 4PRIB 3QIBB 4YQXH 2NNRA 3TT3L 5DCCA 3ZO0A 4KY1H 1QSEE 1HEJC 1J5HA 4YSEA 3FUEA 3ZYZA 3C5ZB 5BNXD 2G3MA 3G9AB 1SJHA 4W6YB 5GGSY 3GSUB 1QBBA 3CSGA 1A5FL 4LB8A 2ADJA 4PP1D 2F8XC 4QRTA 3IU4H 2NY4B 4NT6B 3HC0A 4EI0A 5AAWA 1AGBB 1UT2A 2ICES 5HDWA 1TZHB 3D3VB 4ZS6D 1K4CA 3BDYH 3L3HB 5BRZE 2R2HA 1MH5A 4UIMB 2H8PB 2IDQA 3O2WH 4P23A 1GXEA 2NY1D 4MLSA 1JF1B 4MMXB 3U2IA 1WA0X 2LAAA 4RDQF 4NBYB 3UADA 5E4EC 1G7LA 1PX3A 5KBLA 1P2CB 3DMMA 3EFFB 1BZ9A 4LBEB 1M42A 2W38A 4GAAA 4KMTH 3PFQA 4RQQB 5HYIA 1KYOK 3LZFL 3QJUB 3EH5B 3OZ9L 5D1XB 1HXYB 4KGJA 2FO1A 3PJSA 2W9DL 1D2OA 4B97A 4HOZA 1K3ZA 3FH8A 1DJSA 1FNEB 1TQWA 1R3HA 2ZT9C 2HT3D 3K6DA 3QUKB 4QRPA 4X7EC 3NTCL 1XX9C 5IOPA 1CLYH 5H35B 4KKBC 1E27B 2QLVB 2F19L 4MJ5B 2XG4A 4N0UE 3VXMB 2GI7A 2JJWA 2I9LB 1MIML 3WGVB 1RK0A 4PJ6A 5C92A 3H7BB 3HMXA 1P5UC 1Y1DA 3HR5B 4PGDA 3CSYB 1XGZA 5A3ID 5F3BB 2RBLA 5AZEL 3OTTA 4KROD 9PCYA 3BMVA 5TD4A 1G6RL 4AG4L 1A4JB 3OKYA 4B5ZA 1JVLA 1IBYA 3BWAA 4R7DA 5MERB 3FO1B 1J0HA 1GAFH 4P5TA 1D6VL 3ULVC 4QRQA 1S7VB 4FQCL 4AI7A 4GAGH 3RVVC 2BY0A 2G9HB 2FIKA 3GLAA 4WK4B 4NQCB 5DU7A 1GYWA 2EJ1A 2ETWA 4EOWL 3HG1E 3QWOB 1V3MA 4GJTB 1DBJL 5EOCJ 1YMMA 3NUKA 4IJ3B 4DK5A 1CFSB 2VN3A 4L8SC 5E6ID 3KS0H 3O9WC 5L2KE 1EO5A 1N7ML 4JMXA 3T0ED 4IRJB 5I5MA 1RUAL 3CVHL 4WY7L 3QHZH 3NIDE 4P2AA 3JUYA 1QAWA 3EGXB 4JO5A 5LWYH 1Z3GL 4XMKL 4XGZB 1OSYA 1I7UA 2F8IA 1TVDA 2OXHB 2V4LA 4WGVB 4NO0A 5AW2B 4N1EA 3HA0A 3IRCA 1XIWA 3GI8L 5TPWL 4OFPA 4PVBA 1TZOA 4MS8D 1TLMA 2ZCZA 4XMWA 2ZSVB 1P4BL 4UDUB 5ALCL 4OLZL 3BUQA 2JIXA 5T1KD 3RGHA 1T0MB 3Q9PA 4X6BB 4HUWB 2VDML 1ZAGA 4KJWD 4G8EA 1ZTXH 4RRPG 2EDDA 1I9IH 5IMKA 4WTZA 3QCUL 4LASH 4XB3A 1JZDC 3KJ6L 3IPEA 1NEZA 5CSZB 3VD9A 1S7SA 4ZUSA 1KTCA 1NMAH 1DTUA 1CUOA 1HHJA 1NIDA 3FTYA 2A1WH 2Y7LA 5KSAD 3VQ2C 5I8CA 5DRXB 5AVUB 3IKCA 3UTTE 4PJIE 4MVBD 2AF2A 4HWBA 4YDIL 3IDGA 4YK4B 3WEXA 1VB9A 2EDOA 5KSVA 4U6HB 2J1XA 2EE6A 3VSVA 5LB1A 3ZMRA 1ZDQA 1NFDF 3TCXA 2HVBA 1ETA1 1WFTA 2OMZB 4G3YL 4L3EE 1IM3D 2X05A 3STBA 4DQAA 3OLEA 2A74A 3LMJL 4O4YL 2F54E 3F7RA 2EYSB 1NFDA 2UYLA 3PREA 3BSGA 1T0PB 1U33A 4UM8B 3O0LA 4X7TA 5E9DB 2Z8WC 1TCRB 2XWCA 2WMPB 4L4TE 4BXVA 1WHPA 3KXFE 4CMMB 4KKLD 4F1ZA 5FKPA 3ULUE 4OIIH 5ENWB 4Y2OA 5D7LB 5C0BB 2VXTL 3O11A 2XWBB 2W81C 2CJSA 3W38A 2AXFA 4M1CD 2IVFC 4NN6B 4F7EA 25C8L 3DC0A 5JXEA 4HJ0D 5J5EA 3DPDA 1AS7A 3IDIA 5I75B 3ROOB 1NFKA 2EO1A 2DQIH 4ODUB 4N24A 4B0MM 4JHAH 5I17B 1U8QB 3UO1L 5KYXB 1BF5A 1SGKA 1H5BA 4JFFA 1HL5A 5IQLA 2N3JA 3WKQA 1FC1A 2B4CC 4Y9BA 3HBGA 4PR5A 1FPTH 1GA2A 4TSCL 3FN0H 4RMTA 1F6FB 1ROCA 3CC5A 1VFOA 2P80A 3A67H 3T6VA 2ZE0A 1M2VB 1QFUH 2WJ5A 2ZIDA 4P07A 3FNKA 2UXVA 3UFIA 3ERXA 3BP6B 3RURA 3QUYA 4IOSD 1LMIA 1HWWA 4Y4KD 1MCDA 4A7GF 4A38A 4JQIA 3GMQB 3GRWA 1W0WB 4DNLA 3BT0A 1RULH 3PQYB 4G6FB 3RYMA 2FAUA 5DO2D 3ZKXC 5B7MA 4PRDB 5FO7B 3C8KB 3V0JA 3NYKA 3SY0A 5IUCA 2EXYD 1A4KB 5DJAA 3FTZA 3IDUA 1HCVA 2EVJA 4YH6A 6PCYA 3QDGE 3V8CA 1AS6A 1AIFB 2BLFA 1QG3A 3R06B 5KVDH 3WNIA 3L2MA 2VAJA 1OCOB 4ZUTB 5I6KA 1GW0A 5H8DA 2RFXA 3WIIL 2HLFC 3VWJA 2DEXX 5JIMA 3KWWA 3HJ0A 3CMGA 4WZ9A 5AOLA 3N44B 4G8AC 2XG5B 2Y1VA 1HXMA 4JB9H 3WUWA 5I19L 5A2AA 3VB9A 3FHAA 3O6LH 3RIAF 1MJ8L 3KNBA 3IWUA 3DLQR 3L3DB 3RP1A 2W9EH 1BJ1J 3WG7B 4JE0A 5GZND 2EIMB 3HMXL 3DX1A 4R96A 4UM9D 5E2JA 4LSUL 2OL3H 3HZVA 5MHSD 4S1DD 2NY0B 4ZW6A 4LU5L 2KZWA 2IAMA 2MMXA 4TUKL 1A14H 1S3RA 1RPQA 4JFXB 4FEIA 4HP5A 4AGLA 2CPCA 4AV0A 3HNSH 3OGCA 4DFHA 2FWSA 3VFSA 2CCWA 4FJZA 3OV6A 5L4MA 3MYJA 1Y18A 1XR8A 4Y9GA 3STZA 2QTEA 2VDRL 3WNOA 2X4NB 3JUZA 3MLVH 4G7YL 3BFOA 1KIUB 5DURB 4HF5L 4GUOA 3CZFA 1T7XA 3W2DL 5JIPA 3BAJA 5GGQH 4IIQB 3P30L 1PZ3A 1NAMB 4P48A 5SWSA 5CIPB 1DSFH 1AMYA 2ALWA 1IFHL 2YR3A 2PPEA 1JD7A 1FE8H 4UTAH 4MCNA 2XV6B 1EUUA 1OO2A 3S5LA 2VR8A 2C8NA 2ORBH 2DWSA 4XP9H 3OB0K 3QUZD 1JNNH 3M86A 2YXMA 4AVIA 4G7VH 1F3RB 2WXOA 1OVZA 2VABA 3P4OA 3MRPA 5I0VA 2CKBA 1BZ8A 1ULVA 2BK8A 3OMZA 4HSAC 5ES4B 2VCOA 2YQ3A 3JTSB 1P4LB 4CBZA 3D6GA 1NANI 2B8OT 4KZ0A 4UV4L 4BSWA 3UZVA 4XN7A 2AAAA 2EDWA 2AJUH 1IB5A 1LVEA 1V7NH 3O2VH 3TVMA 4K5NA 3LSOA 5A7EA 3CV5A 4NS0A 3BAIA 1G0XA 1IAMA 3GDCA 4XBEH 1J05B 1KJ2A 1FGNH 3BKYH 1HFUA 4OV5B 5EEXA 4DAGH 1MY5A 1FNFA 4P2QE 3I6KB 4OVVA 3D52A 4HWBL 3QFJE 4KO9A 4QRSA 5LXVA 1WZ1L 1EXHA 1E8ZA 4XWOD 3O4LD 4BFIA 3LKSA 1WYJA 4O2CB 4YVNA 3MLZH 1BQHG 5JDSA 3L9RB 3BWUC 5E5MB 2F6AA 3M46A 5GRVK 4RESB 1NBVL 1UH4A 1SOKA 1RIHL 4JR9L 4KJYA 4WTQA 2HFEA 5H94A 1B0WA 1PCXA 4Q7DA 2PCPB 2UY6A 2FO4B 1HESA 4X80H 5D4JA 5IJCC 4H8VA 2DQHH 1KB5B 1CICC 1PZ5A 1UQSB 4FFZA 4LHUB 5CCHE 3RUGE 1BF8A 5T1DH 2F5AL 2XKSA 3IBEA 5E00A 3GTNA 2YBGA 4K73A 4GT0A 4W81A 5AUMB 5IROC 5ILTH 3CPLA 3VRJA 2CM6A 1U8PA 4TNFA 1L9OA 3TYFB 3ML8A 4HIHB 4D0BB 2Z7UA 2TRHA 5IT2H 1U4FA 5EIIG 3L4XA 5FYLH 3PV6B 4ZUWB 1AD9B 3O8XC 4U1KB 1J1OL 1T5WA 1L6ZA 1OE3A 1EEYB 2C1OA 3MRJA 3QSKB 3W39A 2J8UB 3Q48A 3ZE0B 1G7IB 4H8QA 1NLDL 4F8LA 3ZU8A 5C2BL 1MFAL 5I15L 3BP4A 3QYMA 2DLHA 3T6WA 3TA3C 2CO3A 4LHQB 3I50H 4OCWH 4QWWD 2JKWA 1DCEA 4Z3HA 2WWKT 4DN4L 4JJOA 4LXFA 4RFOH 3WLBB 3D4CA 1JHLL 1UXSA 5ESVB 1R3JB 1WWCA 2A4ZA 5KSAA 2ZXDA 4DERA 3I6LD 3TO4B 2BVTA 5LBVA 5FDWB 2BMKB 1NBYA 1FO0A 2QVMA 1WIUA 3I75A 3RNQB 4H25A 1ACCA 4J8RB 4JFTA 3QIWB 3UBGA 1O5PA 1MI5B 4I1PA 3VGEA 4XVSL 4UT7H 3WENA 4RAVB 4NZUH 3K2IA 3B3IB 1X5JA 1G1CA 2CCVA 4JQIL 1TVBB 5FO8B 4X6CE 1INEL 2WPGA 4OLEA 3G6DH 2ZCKH 2GIMA 3MREB 4MDIB 4C56B 1QYGL 4KK5C 5IJVA 2I7OA 4AIZA 5DFTA 1RZKL 4GW4A 2BVPB 4A63A 4QF1A 3RGVB 3HE7C 1M6OB 2CPUA 3WFHA 1XHHA 4JJ5A 2WLIB 3CFTA 2CKNA 4YHZL 1XAKA 4YDNA 1MCIA 3GJFB 5SWZE 4AGPA 4HQQL 4GKNB 5B3JE 1JV5B 4L8CB 5GJTH 1FFPA 3LVEA 1Y6KR 3OZLA 4DKEH 4D94A 4N5EC 1DUYB 4MSWA 1JXFA 4M5TA 4KFMA 5ICZB 1WBYB 1Z9OA 3CZEA 1QFWL 2BS9A 4JFOA 1RZ7L 4MJ4A 4KKPA 5D7JD 5C08E 3KPQB 5FW8A 1IILE 4MJIB 5IBTH 1BEYL 5TE6H 5EDSA 1OP3H 1ZLWK 1UVQB 1FSKB 3T3MB 3AB0C 3D4ZA 4YL4A 2LVCA 1KPRA 1W9XA 1I3GL 4MMZA 1ZLWH 1I9RH 1YEJH 1S8DB 4WJKB 3QWNA 1BZDA 1LM8V 1PJWA 1Q9OB 2HPOA 2X7LB 3NCEB 3NJGA 4PJ5D 3T77B 4F9PA 2W92A 4YWGL 2CDGB 5E1AB 1WAEA 2UZXB 1G7JA 2FBJL 5AOKA 3P4NA 1GKEA 3V0AC 3WJJA 5CD5C 4G8GA 3UOAB 5HYJD 1KTRL 5K5YA 4LSPL 1XQ4A 4EZJA 5AZ2L 3A47A 3MRQA 4E0RA 5F7FA 4F93B 3ZHDA 3FO9B 4IOSA 5CJ5A 1CB4A 4Y4KA 1I1RA 1RZIB 4QHLB 5ERWA 1IBZA 1PZBA 3DA0A 3IS0X 5JUEL 2W0PA 5A16B 3QEUA 1M2OA 1DSYA 3ARGC 5KS9F 1C08B 3L1GA 2MQCA 3VGBA 3KMDA 4FQJL 5C0GA 2EYRA 2HJLA 1P69B 1K8IB 4HD5A 4WEUD 1M9SA 5GZOD 3HUJA 1H9DA 3O6FB 4B60A 3POCA 3VRIB 5GGTA 5KS9A 1TR7A 3OZKA 3FQNA 1KCRL 2LV4A 3D0LB 4JS7A 2P5WD 3ZDZE 3LRSA 1BJ8A 3ZPDA 2YOCA 5FYJL 4F58L 2XZAH 3P11L 3JWNE 3FQ2A 4NQDB 4HH8A 5FW6A 1EV2E 2HVKB 3EYOB 1M05B 4FFTA 4OLXH 5D5MF 1I7ZA 4J12A 2Y6SC 2V2TA 2EADA 4ODSL 1UURA 4AK1A 3UTQA 3TZVB 3H53A 2VXUH 5D5MA 3ULUC 3MNVB 1JTTA 2ZG3A 4ZMYA 3L45A 3N9GH 3OMNB 4PG2A 2CKBL 3MOBH 2WZ6A 1BPVA 3DIDA 3K8KA 3LQMA 1JZ4A 1GSKA 1SHMA 1T1WA 5AYQA 1N6QH 4FS0A 1DCLA 4FAAB 4LCCA 1MFDL 1NICA 5GZNA 2N1TE 3V9CA 3OXRA 4AYID 1Z9SB 1AOZA 3Q7JA 2FIRT 3WFEH 1JGLH 1MHHA 2VXQH 5CJBA 5JORB 4BQ9A 4OZ4A 2EVIA 4CC0A 4OJYA 2CG9X 2V5SA 1ZE3C 4NJAH 5TDOB 1X9RA 2HRLA 6TAAA 4Z7OE 1KJ2L 2ZP8A 3UTSD 1PD1A 2D3VA 1BVKB 2VN6A 5KBKA 2EIJB 3D0AA 4CKQA 1JGIA 1FG2A 4N87A 1MAMH 2ESVB 3VW3L 5CEXB 5D72H 4PJ8D 5CD3B 1D5MA 4IBVA 3QZPA 4U3CA 1L7TL 2IBBA 1DFBL 1HHGA 1YAZA 2J6EH 2QTVA 2VJ8A 2ZOWA 2AEQL 3DRQB 4H88L 1N6UA 5GGRY 1IQWH 3V55A 3WIHL 4ZSOE 2ZOKA 5HD8D 3T2OA 2EDRA 2XU9A 4OJCA 2A77H 1A9BB 1FZKA 3QJFA 2X6AA 4LQ1A 2UZPA 3CK0H 2BWDA 1YUKB 5C1MB 3UTZB 4FFZL 1SY6H 2NQCA 3SDCB 1HT6A 2AJVH 3M1OA 4S1SL 3QULB 5IVXF 2GSIA 1IM9D 1JK9A 3CC1A 4G7SB 2APVA 5CR1A 3QUZA 3CVDA 3TNMA 3OAYK 5I5IA 1BBJB 4UAOC 4KHXH 3VG0H 1ZOXA 3ROLB 3VG9C 5C8JB 2FATH 5I73B 5JHDA 4AQZA 3OAYH 3F7VA 5ANHA 3RVXC 5BZDB 1MY7A 5HGHA 3EYSL 1UJTA 2HX9A 2VAAB 4B6ZA 2EUXA 4PLKC 1YCSA 3QT2A 4M1DL 2XN9E 1KBGL 4Y7MA 1TCMA 2YAQA 1YNTF 3R7RA 3VFVB 4RMQA 4K9EL 3ZYJA 1I9EA 1VKXB 3MCYA 3GS4A 4HJJH 1DL7H 3ISRA 1NUDA 1RMFH 2ZAHA 5D7IB 1DANU 1NGWB 5DUPH 3S34H 5C0FA 4HHAA 2HJKA 3IFNL 4DP1X 1WAPA 2HXAA 4U6YA 4GIOA 3MV8B 5I1GH 1HSBA 4L29B 3U1QA 1FO0L 3BT2H 2EUWA 3TN0D 3O4LA 1CD1B 1SN5A 2QKIB 2UWEB 4HJGB 3O41B 4D8PB 4N2MA 5CLTA 4AM0Q 3OF6D 5MENE 2XT1B 2EE9A 3NACH 3K2UL 3CFEA 3MLSL 3MV9E 4YSCA 5H37A 4GI9A 4YHPB 1FRGL 1IEAA 1QNZL 1K8DB 3LNEA 2W0FB 3GZPA 4KX7A 2ZUQC 4LF3B 4ONOA 4ZMXA 5KVEH 1YEKH 3MLXH 4N9GB 1T3FB 2NXZC 3HW7A 3IJYA 5DVKA 3S98A 3CZLA 2AJSH 2WTRA 1KTBA 1XEUA 1H19A 4DJMA 4AGOA 4NFDA 3ARRA 2AITA 2HA1A 2NUTB 4X8CA 5HI4D 4HIEB 2LHAA 4U1HB 4RGOH 5GRJL 4XMPH 5CN3A 4IGBA 5EA0L 4YLCA 1G7MB 3PE9A 4K3DL 1LQBC 2EIBA 1RK1B 1N0XL 4GRLC 1R5IB 4F24A 2A6JB 1NCWH 1MW2A 1F4YH 3ARBD 1BXVA 1ZE3H 3F65A 4JDEB 1JF6A 2ICWI 1OGTA 1JGDA 5E9NA 1PKQE 3BKJL 3V4PA 1BGXH 4Q14A 5F7AA 3KM2A 3PABB 4AX3A 3QRLA 2NCMA 3S35H 5BJTB 4OZGF 3WL9A 1TQVA 2FZ3B 3T1WA 3CVHB 4JUSA 3RILA 1ZDSA 3MJ8B 2ZKXA 1MCNA 2BFVL 4AEHL 4LL4A 2W91A 2L8AA 1QTPA 4JCWA 4NSKB 4Q6IA 1CGVA 3QRGL 4UINL 3EJYC 4DESA 5GS1B 4LRNH 2YUWA 5IHZA 1F6LL 4WNSA 3K5RA 4MCYB 4MXVE 4YXLH 2DYPD 2CLVA 5D6CA 2VDMB 3GXNA 1TU2A 2X70A 2XDHA 1UXWB 3CDZA 4CNIA 3F6JA 1JK8A 3K4AA 5IREA 2A9CA 3RFRA 1FL5B 4HSQA 4TL4A 2OP4H 3ES6B 4WK0B 1CDCA 4H1LA 5DJ2A 3D69B 4ZUUA 3H8NA 1FFOB 1IKFL 4MASA 1YEEH 5CEYB 3RNKB 1EIBA 2C7UA 5EF1A 4PV1C 5DHVA 4PRHD 3NFPB 4IU3A 2F7IA 4Q2ZA 4J3WA 1NGQL 3RA7L 3D4YA 1RZFL 3MJ9A 3QGVA 5CKGA 4L9LB 2O6FA 3BSZA 2V5MA 3VFUA 1AKJD 4K3JL 4RGNB 3GMLA 1G7PA 4U3XA 2E7CA 4NKMA 2A6DA 1PYWA 1F1AA 4PJ5A 4LNVA 5F70A 5I75C 3TYGL 5K9OA 4KRMB 2AQTA 1WS7A 4MQXD 5TDNB 3L1FA 1JERA 4ZO8A 2UZIL 4FC3E 1PNDA 2X4TA 3HB3D 2OJ1A 2XXMB 4KVPA 3WJLA 3P77A 4F2EA 4TPRH 2CLRB 1ZCRA 2DM4A 1R3KB 1NAKH 5IVOA 4F7PB 3WY2A 4YXHH 4R4BA 3LN5B 4RFNB 4BRVA 5EU5B 3UBXA 4AKPA 2B1AH 5GZOA 3DOIA 1NBCA 3CFKA 3KL3A 5EC2A 3X12B 3CQPA 1PG7X 1QLFB 4M62L 3GSOA 1RP9A 1IGMH 2AK4E 1A1OB 2FB4L 1RJLB 1AZZC 3MLRH 4HXBH 2Z0BA 3WTSA 4HKXB 4PJCE 4KJQC 1A9EB 3BP5A 1CE6B 2ILLA 2P5WA 1KJVA 3CFUA 5D7KE 1T5XA 4IHBA 3OKMB 3NK3A 3VXOB 4YSDA 5F1KC 2OSLB 2OZ4H 4V1DD 2BOLA 5GGUA 1N64H 3LEXA 2G3XA 3VH8A 1CDHA 1QRKA 3CVBA 3FUDA 4WEBL 2J25A 4UYQA 2EXTA 3MAWA 3WE6A 4L4VB 4FRWA 1NGPL 1SJHB 3I74A 4GP5B 3LS5H 3CCHA 3FQYA 3OSKA 1JWMA 4RLDA 4J8QA 2WP3O 4K8RL 4JM4L 5FECB 4QRTB 3U4BL 3FU5A 3VQLA 3NK4A 4C4KT 1RZGB 3DGGB 2N7BA 3HC0B 3KH3A 3R4RA 4KBPA 5DFWH 2Q8BL 1UM6L 3LH8A 1BVZA 4YSQA 2OMYB 3KVQA 2DM2A 5AVRB 1K4CB 2R2HB 1PS3A 3N04A 2ROYA 5D2NE 5CGYD 3L5WA 2FSEA 4XE5B 4FFWC 5AAMA 1QLEH 1WBXB 4MZ2A 3NZ8A 4WHCA 3QDME 4U7MA 3MLWH 3UTSA 4BD4A 2VDNL 1G7LB 1OWWA 4CC4C 4P9HC 1PFOA 3LD8B 1WUZA 1NCUA 1BZ9B 1MQKH 2GJRA 4PJ8A 1LXMA 2A5UA 2WUCH 2EXSA 5CFAA 2X1OA 2FJGA 4JQVC 4KO7A 1FAIH 1IGJA 3QK0A 5DF0A 5D70L 4D8OA 3ZBMA 3EUUA 4ORZC 1R3HB 1D5BB 4UUJA 2VMFA 5F7EH 2WY3B 5T1LB 2QHRL 3RVTC 5ITBH 2XG4B 5L7XH 3C6LC 5DK3A 3KLAA 1SXZA 1RK0B 5A43C 2YK1L 2PPCA 2BVYA 2OMTB 5LBSA 4OJFL 4X5LA 1T1YB 2MNUA 3JWNC 2OQJA 4FYQA 4PGDB 5D71H 5GHWH 3UDWA 3MRKA 5TH2A 3BUYA 4M7LT 4RAUA 5KW9H 1CXLA 4XTRD 1OTUC 2BXZA 2VIRA 4PAZA 1K5NA 3QUXC 2JKJA 3BWAB 3EFOA 1BYNA 1JZFA 4NKQB 4P5TB 4EMZA 3C09C 3QXDA 3PGDA 2XJLA 1PG7L 4QRQB 3TJHD 3ALWA 3BI9X 2FIKB 3N0AA 4HMCA 3MUGA 4UNUA 1EGJA 3SJVD 5KN5A 1ONQA 2VDRB 3ECVA 1KXQE 4WO4C 1Z5YD 4X42A 4QIRA 4JG1H 1JZJA 4HCFA 3CLFH 3PP4L 1R5VA 2P26A 2OJZL 3G9VA 1VRSA 4JM2B 4PI0A 5GIRB 3V4PL 1YMMB 4A1RA 1PZDA 2WNWA 3TA4D 3IPFA 4FD0A 3SKUD 4Z7WE 2J73A 3TN0A 3QQ4A 3GRGA 1EANA 3FONA 3OF6A 4MZIA 5DFVD 1H3UA 5ITFA 5DS1A 3CX5J 1OAXL 4ZAKC 3K6NA 1I1FA 4XVUD 1CDJA 1JZHA 2WAHA 4I0PC 3AG4B 4NO0B 4W4OC 1CXFA 1WQVT 3FSVA 5H2BA 3N43F 4KVNL 4HPYL 3RB7A 3T8MA 1XIWB 3FF7A 2KHAA 1NC2D 3QQDB 1ZLVK 4BK8A 5C2UB 2P1YA 4P46D 5DQ9A 3BZDA 2JJSC 3AY4A 1GJUA 3SBPA 4ES8A 4TNWK 3B7TA 4CKVX 4DEPC 1JYWA 3SDAA 2JIXB 4J3SA 4MXWH 4GFXA 3V6OC 2Z7WA 1LHZA 4NO5A 2MSPA 5DC0A 2C9SA 4IBTA 2EXWD 3QYNA 5EWIH 1Y6MR 4MNHA 1NEZB 4KXBA 1S7SB 4ZUSB 5I1AA 3FQUA 1FP5A 3MODH 1CU4L 4B95C 1HHJB 4LEOB 3ZDYB 2WO2B 3K1DA 2CJTA 4XNUH 5I8CB 4QXWA 3TWCL 1Z5LA 2VJXA 1F3DH 3MJ9L 5D1ZA 3NA9H 3IDGB 3BSZL 1KY7A 3ARBA 3CD4A 3O81A 3WEXB 3AGWA 2VE6B 4N6RB 5GISH 3CFQA 3TASA 1MRFH 5JPNC 2AXGB 1OAKH 3MBEC 4WUUD 5ANMA 1HH9A 2IPUK 4P9HH 1B3IA 1BD2E 2O5XH 2C4FU 4AMKL 1XZ0A 2A74B 4GG8B 3H85A 5I9QC 1TF4A 2QVKA 5DD0L 5DMGC 2IG2L 3LVTA 1NFDB 2UYLB 4M7JH 3B9AA 1EBAA 1FV1A 4RGMC 5B39A 5E6YA 5C6PB 2A9ML 4N2LA 2PXYC 4X7TB 4A6YH 2VN5A 5ESAA 2B14A 4BZ2A 1U93A 1QBMH 1YNLL 4X4YA 3L7FA 5IFHL 2YD5A 3BGFB 4JNXA 5C0AB 1UUNA 3OKNA 4AQ8A 3K2MC 4PS4L 2VDQL 5EG6C 4KZEL 1DQVA 1JZ6A 2NY6B 2X2YA 4WI8A 2ZXGA 4Y2OB 3SPHA 1SMDA 4JKMA 5E6RB 4OF8A 1GGBH 1UXLA 5FV2A 1H15B 4X6DF 3O11B 4AIOA 4WTWA 4NRZA 2R9HD 2DYPA 1OK0A 4ELMF 2CD0A 4YIQA 3H7LA 3JWNH 5L2KA 1FH5H 1FORL 4BJLA 3T8VA 1PY0A 3DJTA 4LRIA 4EIZC 3ARDD 4X6DA 5DHDA 4F7EB 1IMHC 3AQXA 3S8WA 2M8XA 2XX1A 4Y1AD 1T83A 4YDKL 5CZVH 5AOIA 4YGAB 1YEIH 4ELMA 4NO3A 1E4XI 5KSBE 4PJEF 3QI9D 5HGAA 5BPPA 4G11A 1D9KD 1EUTA 1LWRA 1YJDL 4WUKL 1H5BB 4JFFB 4J3XA 4PRHA 4U6TA 3VTTA 2HP4A 4PJEA 5CSBA 3BEWA 1GRWA 1ZANL 3KH4A 5G2NA 4PR5B 5C0JA 3NJFA 1KB9K 4ALAL 3CLEH 1AKJA 1QBLH 3FOMB 1XDTT 1OQXA 2DL9A 3QUYB 1PF3A 4LVOC 4N2HA 3P3SA 1EO8H 5ICXB 2ZKHL 4O58H 2VZTA 3OKKA 3QO0A 8FABA 4PWEA 2BVQA 1MKFA 4PJIF 1EHLH 1JDCA 3SPIA 3NGBB 5DJAB 1BIIA 4PFEA 4Q97A 1CQKA 4N26A 3DX2A 1NL0L 2HTLD 3BHBA 1LO0H 4KQ4L 4LMQI 3PF2A 3R19A 4FI7A 3JVGC 1F45A 3OR6B 5I1LB 3DXAE 1OAUH 2RFXB 1MUJA 3VWJB 3IJSA 2B2XH 1QHOA 5HHOD 1X6NA 3D85B 1J1PH 3QPQC 1HQ4B 4QRRD 4CMHB 3FK3A 2O61A 3DTDA 1HXMB 1KN4H 2LTQC 3WUWB 2WNXA 5J6HB 1KG0A 3NEEA 1X6LA 3KNBB 4W9DC 5DC4B 3UX9B 4N25A 1QWHA 5AW7B 4KI5D 4B41A 1KDIA 4PB0L 5IBLC 5KOMC 2ENJA 4NWTH 4R96B 5B1BB 4XAWH 1T0OA 3HZVB 4R90L 1OP5H 1JDDA 4XXCC 1K6QL 2X09A 5AVWB 1AZNA 5KYWA 4FHBD 4EUPA 4Y5YA 1D7CA 3T4AB 1WFIA 2ZCHL 3ZRFC 1LEKA 3RY6C 3BN3B 2H0FA 4P2OC 4UBDC 1A7PH 3IMUA 3OGCB 1X5HA 4IRSA 2DTSA 2ZKWA 3QQ9C 3VFSB 4XPBL 4L1DA 1L4IA 2WVSA 1BFTA 4LARL 2NNAA 4JHBA 3L3KA 5CN2A 3SDYL 2ALAA 1CI5A 2BSED 2NY1B 5FHBH 1SXCA 3NAAL 1YNKH 3DSNA 1AO7E 2AJYH 5IY5B 1MDAA 3FO2B 3BZ4B 3CZFB 2X6UA 3OAUH 5EFIA 5TDPB 4JY4A 4U4BA 4YSRA 5BQ7A 4QKTA 4CA4A 5GGSA 1BP3B 5J3HC 4M6OL 3ETTA 1A4BA 1CGWA 1OPGH 3EUDA 5IBUB 1G87A 3FUNA 3S5LB 5IWLA 2QZQA 5J57B 1E5YA 5IB1A 3ARED 2WN3A 1SRDA 5EIQA 4PTTA 4F91B 3P4OB 2VABB 3MRPB 2CKBB 3LIZH 4IOFD 2APBA 2XWTA 1OP9A 4ORGB 4FX5A 1KYUA 5HP5A 5GGVH 2C4XA 3FU7B 3R18A 4P04A 3VD4A 2IH3A 1NH6A 2DWXA 1B0GA 1FF5A 2XY1A 3O4OC 4JO1L 4K23L 4BSWB 3MLPA 1HAUA 1SMOA 3BH8B 2X6MA 3P69A 4N8VA 3SB3A 4KROB 1NCOA 4WGWB 2IWGA 3NSDA 1C9SA 1JGUH 3TNNB 3AT0A 3TVMB 1CXEA 3LSOB 1WVZA 5AYUH 1KJ2B 4KUZH 3C2AL 2AS5M 4AENB 3QJTB 4ZMTA 3DIVA 4AL8C 4O9HL 1QNIA 4QRSB 4YHLL 3DI2B 2X2UA 1AHKA 4MA8H 3WFCL 4TYUA 1CLOH 3A3YB 1OALA 4BFIB 4LEXL 3LKSB 4UZSA 1N10A 3G6AA 2IPUG 2HB0A 1BZ7A 4FLSA 1U3HC 5FO9A 5E5LA 3F85A 3WY1A 4KKAD 5L6YL 2RTTA 5E6IB 4JDTL 1J0KA 5IJKA 4KJYB 2E9IA 1HHIA 3RU8L 5H94B 2J2ZB 4NQXB 3T0EB 2Y24A 5JHBA 1K4DA 1FDLH 2UY6B 2VZSA 4X5WB 5D2NC 3RL2A 1CLZL 3ESUF 4XWGH 1PZ5B 4BZ2L 4LVHC 1BDYA 2P5ED 2WBJD 4KZCA 4KMQA 5E00B 1XL6A 3ZKNC 4F92B 3WKMH 3U46A 2R0ZH 5TFSH 3CPLB 4YSSA 2Q7YB 1U8PB 3B2PA 4JFZL 1NC2A 4MS6A 1MAKA 4D7PA 3MTXA 3F05A 2ZJSH 3JWNG 3PYCA 4P46A 1IGFL 2XCMC 4PD4K 3NIFE 1T5WB 1X5YA 4WFFD 5T1KB 3P2BA 4YE4L 2C1OB 3MRJB 1NCGA 1G4RA 4LPXA 5IB4A 3IJEA 2NTSP 3DOHA 2GABA 5IEKA 3MV7A 5FDYA 2Z31D 1QRND 3KLDA 4AE0A 1IAOA 5DJZA 1NMBH 4B9JA 2JTDA 3C60D 3PUCA 4L3FA 1BWMA 5EPMA 1E5BA 1J5IA 3B37A 3FTSA 3APMA 4L2YA 2NW3A 2CO7A 4J3OC 4PRPE 4PVNA 5KSAB 4KNTA 2CJUL 4K2UH 2VYRE 1UATA 2AFNA 2UVFA 4Y2DC 5DD1H 1E8WA 4WCYL 4B3EA 1NBYB 3CHXA 3MXWL 3S4SG 3ARVA 3O6ML 1FO0B 4JFHD 4KRLB 5LGYA 5HBBA 4H25B 3O3EA 1OQOA 4XC3H 3GKZA 4TLUA 1GC1C 2VC2L 2WQRA 1JNLH 3U36B 2D7NA 4WUUA 1M1SA 4JFPA 1ACYL 5C70A 1IM3B 1L9SA 1QHPA 3OD3A 3VXSA 4JO4L 2VLKD 1QR4A 2DOCA 1CG9A 3CHOA 3S3BB 3TH4T 1KELL 1UUSA 4AIZB 1PMYA 1WRFA 4GW4B 2ISDA 3UYRH 4HPHA 4QF1B 3KLSA 3UYPA 3WFHB 3QVAA 2D2OA 2N0KA 4JJ5B 2H6PA 1YN6B 2XYCA 1EEUA 1BM3L 4BV1A 5L8LB 1EAOA 1A21A 2AJXH 4PRIE 5EUKA 2FX7L 1JV2A 3A4FA 5DLMH 2V2WA 4A37A 2NZIA 1FL3A 1I1YA 3QAZC 2OCCB 4ODHH 1RVFH 4NGHH 2AGJH 1JSYA 2HKFL 3EBHA 4JFOB 4M7LL 3QISA 4XPFL 3ZYOA 5HHQA 3CMOL 2ZD0A 2P8MA 2RCSH 3I84A 3ARDA 3WAJA 3JV6B 4OIAA 4DKDC 1SVCP 1BQKA 1QP1A 3K6FA 4CJ1A 3GHBH 3QI9A 1KPRB 3SE9H 3K6SB 1D9KA 1NM4A 4ZOEA 1T6BX 4ODVL 4EDWH 5IR1A 1AZBA 3E1ZA 3DUUA 1XMWA 3D3VE 4X0KA 4AL8H 3US0A 4JZJC 1PSKL 1D5ZB 2FX8H 5G4OA 1G7JB 4JG0L 3O3AB 4TRPL 3ZDXF 3IK2A 3GSWA 1RURL 3FTGA 4R5XA 4AW4A 3MRQB 3OBAA 4E0RB 4KHTL 5F7BA 3TESA 1AY1H 1VPOH 1AR2A 1NCAH 3KGRA 4Y4KB 5DJ6A 1Y1UA 3UJIH 5ERWB 2B3RA 5EU6D 2BCKA 3H3KA 5D1XE 2G0KA 4UQIM 4WI2A 5C0GB 2EYRB 2HJLB 3HNVH 3HHMA 3BZ5A 3HUJB 1JUFB 1KT2B 5TTRA 1DEDA 1I7TA 4HETA 2A9DA 5KS9B 4IHOB 3SO3C 2D3JA 3FQNB 5D93B 3UG4A 5AD0A 3I9GH 2P46B 4X6CF 3LRSB 2Y72A 3VXME 4XPHL 1ODAA 3QG7H 4PRBA 4JN2B 3TF7C 4M4RB 1Z66A 3RPIA 4FTDA 5HHOA 1I7ZB 2WKOF 3ZQ9A 1K9TA 4QRRA 3VQMA 3UTQB 1A7OL 3LZPA 4OLYL 3I9AA 4GKZA 2WKOA 3NPSB 3LEVH 1SBSH 5B3JF 4XNZC 5A6MA 1I1AC 3A21A 1E9PA 1TJHL 1T1WB 4FQ1H 4J3OH 4WEEA 2VMJA 4LCCB 4EPSA 4FOMA 5DD3H 3CU7A 1FZMA 5BVJA 3OXRB 4UM9B 2BHZA 3BIAX 4L5FL 1BPLB 4NQCE 1NCNA 4OD3H 2X44D 5EZOH 4RWYL 1NKGA 5ALBL 1SOQA 4OZ4B 4YPJA 4AY0A 1IVTA 4D3CH 2A38A 3SKJL 3B1TA 3Q5YA 1VIWA 4AJWA 1Q90A 3THML 3FN9A 5GJSH 1WBZB 2CO6B 2V7HA 3FU3A 1KFAL 3MFGB 1XSJA 4MDRA 5KVFL 1HNYA 1O7VA 4L0YA 1DBKL 1BYOA 3CDCA 3L1EA 4QXGH 2KDYA 4L3AA 1RZJH 2OPCA 2VR3A 3KVDD 1ANUA 3KPLA 2WQSA 3O0RL 3QQNA 1D5MB 3INUH 2W07B 5EN2B 5ISZD 1IT9H 1NIFA 2K70A 2ZOKB 2VUYA 2VOTA 2P5PA 3NQIA 3SOTA 5MEPA 2EH8L 3MBWB 4TNVF 4M5ZH 1FZKB 3QJFB 4F8QA 4E5XB 3IDYC 1BVNP 2WGXA 3QIUA 3WNJA 1T04B 2YGVA 4FXTA 3PAZA 2GSIB 4FFYA 1AFVH 3AAZB 1IUZA 3QUZB 3D05A 5GRWA 3TFBA 3TNMB 3AREA 1CR9H 5DHMC 4R7XA 5FKAA 1DQJA 3NP4A 4FDWA 1GHFH 4JQXC 2WNGA 4HEME 3F7VB 4HIJA 3H42L 4EDXB 4Y5XA 2EE0A 5HGHB 3PU7A 4YO0B 3ZE1B 1RH8A 4TXVB 5KJ7E 1CYGA 2JK5B 3VD2A 1DO5A 1NMCC 2ARJA 1MCQA 2OR9L 3FRPG 4LEEA 4W9CC 5LO7A 4ZS7L 3ATDA 1FIGH 1XTMA 4YBLC 5C0FB 5JMOC 4QAWA 1PGRB 3EYVA 4HHAB 2VLME 3HKZA 4PGCA 3Q9QA 1L0XA 2ENSA 1IKNA 3BVNA 4U6YB 2VDNB 4TTDC 1JHTA 1VHPA 4LLUA 1HSBB 4ZMZA 5E9DE 3O4LB 2VDKL 2MPAL 4NUJB 4P49A 3FUMA 1R46A 4XHJD 4QOKD 4XCFL 1T20B 2MRYA 5FPIA 3CFEB 3ISYA 4N0YL 2VDOH 1HVXA 4GH7B 5D7LE 1IEAB 3KL0A 3V2AR 1E50A 4NPKA 4LSTH 2WWMC 1PLGL 4XAKE 2EVGA 1GPOL 3IJYB 4PJDF 4ZXBD 1JE6A 2ADGA 4HS3B 2WLMA 4WKZB 2WTRB 2Q3XA 3G6JF 4YFDB 4N2KA 5EOTA 2WBJA 4J6IA 3NT0A 1XF3B 4RISH 3VD5A 3DVNB 3QA3A 4JRXA 1BFOA 1JZ5A 4PJDA 5TF1L 5C6WH 1RIUL 1MCWM 1QTYT 3G6JA 3MMEB 1B9KA 1S46A 3DVIA 3LB6C 4IEFA 4O5LL 5AKRA 5EU4B 4C58B 1ZLUK 3IM1A 4ZX4A 1CIUA 2E3VA 4YDZA 1T7YA 1BA9A 3OHXC 3HC4H 1N8ZA 1DBBL 4GS7B 1O9VA 2CH8A 2YN5A 3G5VA 2OMWA 2YD2A 2XA3A 5TE7L 2EH7H 5EORL 4UT6A 3B5TA 2IXQA 1DP0A 1QRNA 2VDPH 2Z31A 2CAKA 4XB8A 4ZW7A 1BG9A 3C60A 1JWUA 4YE0A 4PY7A 3VYNA 4A2HA 3PQYE 1UASA 3GSNH 2VW6A 1OGTB 3C2SA 1CFMA 4U7KA 1JGDB 5F88A 3IXAA 3UYOD 2ZUUA 1GR7A 4CJ0A 4X7SH 1OL0A 2WWNA 1RP8A 3U1SH 5AVZB 2TAAA 4UF7C 1ZKAA 3WEOA 1NEPA 3WL9B 4KZDL 4HCGA 4W9KC 1SQ2N 4G9FD 5FGSA 3KDMA 43C9A 1FAKT 3DVGB 2C1PB 4GLRH 1RU9H 1ZA6A 2NLJA 3BZEB 4Q6IB 1X4XA 4EQ3A 1RQ5A 1C5CH 4YHKL 4Z95L 5C9KA 2D7OA 4G6AC 3SBQA 1AQDA 3GIZL 3REWA 4MMYB 5F96L 3QDAA 5IHZB 3L4ZA 4KK8C 5CGBA 2CLVB 2FQEA 5EHFA 4XO9A 5D6CB 2VKXA 1TU2B 5G5DA 3BUBA 2X70B 4GQPH 3DGCR 3BPLB 1DUZA 3CG8A 4CNIB 2EKSA 4PJHB 3LV3A 1JK8B 4AJVA 3HE6D 3O9WD 5F21B 5M94B 4ZUUB 1V8HA 4UT9A 3U1PA 2C7UB 2YBRA 5DHVB 1ZEAL 4IU3B 4J3OG 4Q2ZB 4XBGA 5D6DC 4GXUN 3WJMA 2V3FA 1C12B 3BPOC 1IE4A 3ESPA 3Q43A 4HLZG 4XODA 3PAVA 3DBXA 1HKLL 4RMVA 1WCBB 3KPRD 4FNLH 1A7NH 3VFUB 5IQMA 4Z7UB 4F3FB 3GHEL 4HCRA 4IDLA 4UNIA 3GMLB 1G7PB 4Q52A 1LP9A 2A6DB 4ZX5A 4XN4A 3TEZA 4PJ5B 2ZXCA 4X50A 2AC0A 1E2ZA 2F7PA 5DRZA 5CCJA 4XI5D 2CUIA 5K9OB 1SEBB 3BUTA 5HYQA 2EQDA 3OAZK 1FGVH 3QG6A 4GNKB 4LLYA 2J88H 5GS2H 2UZYA 2X4TB 3OAZH 3PIQA 3RDJA 4F7CA 5KJ4A 3P77B 5E99L 5EZLA 4ONFL 1C5BH 1CQYA 1FYHB 4GP4B 4XPGH 1RUPH 4PYHA 2N1KA 2AVFA 2O5YH 1EZSA 5EU6A 3UBXB 2XQYA 3IN2A 2VDQB 4OZFH 3CFKB 4Y2LA 3TBVA 2JSFA 5E08H 3HJEA 3ILEA 3U0WL 3GSOB 1E7UA 3GKWH 5B3SB 2HPTA 1F4AA 2ICEA 1MJJA 4YHML 4X98B 3BP5B 1GGYA 2P5WB 3DK2A 2EDHA 3SKOA 3VFRA 5EZJA 3DTXA 1KJVB 2ZOLB 1T5XB 4X9GA 5SWQB 3EF7A 2X9YA 2Z4QA 3HG3A 4GLRI 2Y7MA 5LVEA 4UB0L 2J72A 2A6IA 2GJZA 4NFCA 1J18A 3FUHA 3NZHL 2XHNA 5I76A 1HCZA 3LEXB 4MXVF 3QR1A 4F5CE 3E80A 3VH8B 1PLAA 3SY6A 3T3PB 3WNMA 4AVJA 2ZUVA 2V2XB 4ONHB 4PSRA 1J1XH 3BUDA 1DVZA 5L9DH 1MPAL 3WE6B 5GGVY 1T6VN 5IJBC 3OKEA 3CCHB 5EF0A 3NCWA 1JWMB 4JVWA 4KK6C 1JRHI 2NR6C 2VO8A 4ZMVA 5C9JB 3WNPA 2IGFH 1S9VB 3LCYA 4H0LC 1KCUH 4JGNA 3KBHE 1RY7B 1MNUH 3QORA 3II3A 2YARA 4LCYA 3L13A 5IW6B 4DGVL 4Z1PA 2ZNXA 1HZHH 2FGWL 4B9KC 2HH0L 3L5WB 2FSEB 4GMSH 3WMQA 3US1A 3NZ8B 3UTSB 3P9MB 4MMXC 5AKVA 4OCXH 1MWAH 3PXHA 4FZ8L 4A2EA 1UTDA 4PJ8B 5T5FH 4LP5A 2ZF8A 3EDEA 4TQEH 3QEHA 4K3HA 5DZ9A 2FJGB 1P7KA 1JTOA 3ZT7A 3BVWA 4LKCA 4F15B 1IGJB 5EIVA 4P59H 2X4QA 4FNPA 3VWKD 3Q8EA 1J8HA 4KTEL 5D1XC 4MAZA 2DJMA 4NNYB 2F53A 3OX8A 5LUMA 4DSYA 5J8OA 4OFIA 3FT9A 1OT1A 4OSUL 2J8UE 4GIPD 4XNYH 2OFQA 3KLAB 5D96B 1IM9B 3EOTH 4PJCF 3CSFA 1WO2A 4HEPG 1FYTD 2OQJB 3ZKQD 5DJ8A 3MRKB 5TH2B 3BUYB 1SVZA 5HI3D 3EYUH 4RAUB 5D9SA 2E6JA 3SCMC 6FABH 2R69H 3MRNA 1RLBA 2VIRB 2BXYA 4NRXA 3ECBB 5CINL 3EFOB 2JKIS 3AITA 4WFGE 2JV6A 4LIQE 3QXDB 4UT6L 1X5KA 3WU1A 4DO6A 5INDA 1KEMH 1OTSC 4F27A 4OVUA 4HULB 4FL4B 3IDJB 4Y4HA 1ONQB 5KN5B 4FQQA 1J88A 2H0EA 4XVTL 4WI7A 1R5VB 1L3WA 4R2GD 3WSQH 5A2KH 5JOPE 5FYLD 3EO9H 1PX4A 4E2OA 3SODB 4MQTB 3TN0B 1NKOA 2B08A 3QQ4B 1OAQH 4D9QD 4QXUH 2IIJA 3FONB 4GEIA 4WO0A 5ITFB 1SDDB 2ZWLT 1ZK5A 1QFWI 4G6KH 5JA8B 3KE0A 3MDJA 2P7TA 1I1FB 4IRJC 4BDVB 1IBBA 1KXTB 2WBWB 4DZ8B 4M4PA 5TQ2H 35C8L 4NPYA 1HHKA 2LU5A 1CGSH 4ZNEE 1JZEA 3BISA 3CIAA 4KPHH 3ECQA 1NCCL 3IYLW 1RZ8A 2D3LA 4HA1A 1YUHA 4ZXBA 2C3HA 5DQ9B 1NWOA 4IJTA 1CDIA 4JFEA 1F4XH 2Y1ZA 2GITA 3VNZA 1OP4A 1LQSR 3N1PC 2JLLA 2FD6H 4KV5E 4PVMA 3T3ME 4QKXB 4L23A 2A2QT 3GM8A 4H8WC 4ZBJA 3VB8A 4MNHB 4B0MB 4E9SA 1IEBA 3OJ2C 4NLAA 2Z93A 4X8XA 2DLTA 3LQAC 1HEZA 5I1AB 2OULB 1PQZB 3FQUB 5CLXA 1EO7A 4UTBA 3B8YA 3B7YA 3HZ3A 3T0BA 2PPDA 1E2WA 2Z3FA 4NZ8A 2IQ9H 3WS3A 5EOCH 1A1MA 1Z5LB 2XZQH 3VI3A 4BRJA 3IDNA 1KDJA 5D1ZB 3ARBB 1OLZA 1O75A 3TM6A 1A66A 2K1MA 4KRNA 1YYCA 2K6WA 5DTFA 3U6RA 2XC8A 3Q6FB 5HHME 5F7HA 1IBGH 4HCRL 4XXWC 2DDQL 1JZ3A 4YK4C 3TT1L 2BCMA 3PHQA 5ANMB 1HSAB 4DPAX 4ZK8A 5DHYB 1XZ0B 3W0WA 2KKQA 2WP3T 4NYLB 1HCYA 2JCCA 3QEQD 5TK4A 4W93A 1BW8A 4BSVA 4X9HA 5E8PA 1LLAA 1FV1B 3BAKA 5F0MB 4HISA 1CFVL 4ZPTA 4YXKL 4G9FA 5HYSG 5K9JL 2BSCA 5ESAB 4HVBA 3NABH 3KD4A 5D1QD 4NQDE 3UCQA 4X4YB 4OZHA 3OHMB 4EKJA 3L2LA 3FB8A 3Q6GL 2ZG1A 3OKNB 5JMRA 4KY1L 2CQVA 3IFOA 4Z7WF 2Y06L 4RAHA 4MAUH 4MD0A 3TIEA 4NIKB 1OSZA 4I89A 3V0VA 4U1NA 3CN3A 4NRYB 2F5BH 4NRZB 2DYPB 4GBXD 1TLKA 4XNBA 2QQLH 1XMEB 4S2SA 4YIQB 2YPLD 1KXHA 3B9EA 3HI6H 4X6DB 6PAZA 1L9PA 3LN4A 3IU4L 3J07A 3ECWA 4FA8A 1EZUA 1ND0A 3BPCA 3HE6A 3LPGA 4NN6C 5KEZA 1O6TA 4PVLA 4P57A 1E4KA 3BDYL 3EGSB 2ZUWA 4PRHB 3ZHLA 3IFLH 2BP3A 1CICD 4I0KA 2JQAA 3BEWB 4ABUA 5IIEA 1GY2A 5I1CH 1G6VK 4LGSB 1AIZA 1N5AB 3KPRA 3DRTA 5FWRA 4GQ9H 1AKJB 4Z3JA 4WFEE 4WSJA 2VC2B 3CBRA 3S7GA 4MA1C 3TBYA 4NKOB 3HNTH 1QLRA 2FT8A 3ARWA 1W6WA 2ESVE 4KMTL 4PB9H 1A25A 2OI9C 2J7LA 3QO0B 3OKKB 3KWTA 2H9GA 2D73A 1KIQA 2BVQB 1E6OH 3HB3B 4MFHA 1JCKA 1O9ZA 4APQC 1KY6A 2APXA 1YVLA 5DFAA 1I75A 1CLYL 3BHBB 3AGVA 3P9WB 3RRQA 3FU9A 4AC4A 3EOBB 1DN2A 1QWNA 3EJTA 2W65B 3GZKA 2J1ZA 1MUJB 1UKTA 2BNQD 2OL3A 5E8DH 4JPIA 3P73B 3IJSB 2CMRH 2F9BT 4MNGA 5E8NA 3QUGA 4B3VA 2YRZA 3KWUA 1FL6A 2BS8A 2JQZA 3PGCA 5LXGH 1TT6A 2GUOA 3BMWA 3PWNA 4H8WH 3VSTA 2O61B 3ESOA 3BQUC 3LQAH 4ENEC 1GAFL 2ENQA 1KG0B 4V1DB 2VR5A 4Y5VA 1XWVA 3WNLA 3SBWC 3QXVA 1THAA 2DKSA 4E41A 1VESA 4LLDA 5D7IE 2OR7A 4QYAA 5KYWB 4W9GC 2KLSA 1Z3RA 4Y5YB 5J56B 2HMIC 2JELH 2NY0C 3MV8E 1LEKB 1HL8A 3C6EA 3QDJD 1OOWA 4JRYA 4N5ED 2H3NA 4UZUA 1IFGA 3BAEL 4K7PH 3M6DA 3QHZL 2UWEE 4N90D 5LWYL 3UAEA 4CDGC 1ZT7A 1L6PA 2NNAB 3L3KB 2IBGA 3AXHA 1OGAD 2R2EA 3AMLA 1UD8A 4KU1A 5ID0A 3VDBA 2D8KA 1C16A 3DSNB 4R9HA 4G71B 5HJ3A 4JCMA 1G4MA 3IBOA 5ID1A 3GXPA 5EFIB 5BQ7B 2EAEA 2D03H 1W91A 1ZTXL 1I9IL 4P5KA 4JY5H 4LASL 2Q0ZX 3F12A 3O45A 2MCPH 3VWKA 1BJ1H 3I3DA 2PYEA 3DETC 3IJHA 4Z7QB 5I6XB 5IB1B 2PLTA 4PTTB 2A1WL 4LCIH 1QQDA 2ITFA 4CGUB 1XL4A 3ECUA 3ARGD 4N85A 1L9QA 3CZSA 4G5ZH 4X83A 1PZ2A 3ZSTA 1YPZB 2EYTA 2CO2A 5J4MA 3K71B 1QSVA 4HS8H 1FYTA 1A1NB 1ZVSB 3UPRA 4OV6F 3ELAT 3JV5A 4N8VB 4PJ7F 4ATTA 2PP8A 2DQEH 1A64A 4KQ3H 5F71A 5IF0B 4PJXB 5DZPA 1T2JA 1NDGA 1S78C 4PJ7A 4AUJA 1T89C 3NSCA 4Z7VB 3T4YA 4L4TD 1YG9A 3KXFD 2Y6SD 4N2IA 3VE0A 3SJVB 4H40A 4KXDA 4I2XA 2VDLH 1U95A 5A2LH 3BFQG 3G6AB 1I8KA 4OIIL 1BZ7B 5I1EL 1WITA 3UC0H 2X4SA 5FO9B 1TQUA 2UVEA 3DX6B 2CBQA 3ZKMC 3AT9A 4JBSA 9CGTA 4F33A 4G2AA 1I9JH 2DIBA 2YWYA 5DVLA 4LSRH 3RL2B 2HTKD 3AJ7A 5B8CC 4GT7A 4AYDC 2DQIL 4PJAB 2CNZA 4Y19D 1OIOA 3WD5H 1CFNA 4JHAL 4WU5A 3U46B 3V4VH 1N2RA 3RWEA 4I18A 3ZE2E 1NC2B 4B5EA 3E9TA 4KUCD 4P46B 4BFJA 3GEFA 3BN9C 5HJBA 1SBBA 1FPTL 3K8MA 4HLJA 4XB7A 3FN0L 4UQ2B 4F2MA 3A67L 1QFUL 5B1AB 1KJ3L 2IPKA 3TOPA 1U2HA 2ZYRA 4GRWE 3IJEB 2H5UA 3RDTA 5KVMC 4RGNE 4N2DA 4EIUA 1AZCA 4YLBA 1IE5A 2D3NA 5KBMA 2KLRA 3GI9L 5DJZB 1RULL 2D2CC 5EPMB 5E8EB 3WEMA 2WAQA 3NJKA 2NW3B 5CJ8A 2CO7B 3AADB 2A6KA 1S5IH 1U3NA 1XH2A 3QDGD 4OCSH 4V2CB 5CBAA 3B34A 4HGMA 2AQPA 1JVKA 3FQ4A 1D7FA 3ME0B 5T3ZH 1QKZH 5KVDL 1IAIH 5JZ7C 1PBYA 2ZP9A 4EJ1C 2VDKB 3IS1X 2W60A 5JNYB 1IJ9A 4ZW3A 3ZIYA 4JPKH 4WUUB 4NZRH 4H20H 1LO5A 4P4KD 3QIWC 5F6HI 5IQ9A 3JTTA 2GHZA 5HVHB 4U0QB 1R0AH 1JGVH 3ISWA 3QEQA 4CILA 5C0EA 1AD0A 1AAJA 3KYNA 4CVXA 3K8LA 1NAMH 1WG3A 4FQLH 4JB9L 5J11B 5C97A 1IQDA 3UYPB 5IV2A 1QW9A 5D1QA 3NJHA 2NTFA 3BVTA 3O6LL 1P53A 2H6PB 1JD9A 2IMMA 4L8BB 3W37A 3V4LA 1BF2A 2I07A 3RGVC 3QPXH 1MCSA 5EUKB 2W9EL 4MNQA 2V2WB 5CCGE 2NY3C 1I1YB 2OL3L 3WS6C 4CVZB 1MCKA 2R29H 4ANKA 4P5MA 4GBXA 2YPLA 1A14L 5LGKA 2P8MB 1H8LA 3HCVB 3ARDB 4XBMA 3D51A 1PJ9A 3CZJA 3KPPA 2PW2A 3BKCH 3PWVA 3HNSL 2V7NA 1FFTB 1S7RB 3MRFA 2YUZA 1MW1A 1LO4H 2D9QB 3QI9B 4P2RA 3UBHA 3HG5A 1B0IA 1D9KB 2HFFA 3B7SA 3NIFF 5C3IA 2DQMA 3L4YA 1FSKC 2X0WA 1UWYA 3CAFA 4FXGA 5IR1B 3BH4A 1NUFA 2YXWA 4CAGA 3DUUB 3CFBB 4X0KB 3GRBA 2GSGA 4OY9A 5J0BA 2Q10A 5F8QC 1I85A 4P8QA 3MLVL 3PHAA 4NHUA 4PCKA 3GSWB 3FTGB 3AWEA 1YYMH 3ZL2A 1EZVX 4XBPA 5GGQL 4X2UA 5DJ6B 3ZDXB 3HRZB 1DSFL 1YZZA 3D87B 1KBPA 1FE8L 2BCKB 1DDTA 1MEXH 1AH1A 2ORBL 3Q2CA 4O02H 4ZPVA 4WV1A 4X4MA 1MZZA 5IB3B 4OCRH 4XP9L 1JNNL 3FT2A 3W9DA 4GRLD 4L48A 4G7VL 1I7TB 3TBWA 4QRPE 4MHHG 2CO4A 4M6MH 3MOQA 3O6FC 3NEOA 1YAIA 3D9AH 5AD0B 3SGDI 2WKGA 3MSPA 5HXMA 1T22A 4QHKI 4PRBB 4MJ6B 4MRBA 3T2NH 2BNQA 1MJ7H 4R97C 1GMEA 3CHQA 1ASOA 2VXQA 4I3GA 4AGMA 5HHOB 2LT9A 3FOLA 3IDXH 4Z6AT 4NEHB 3B2UC 4QRRB 3S9DB 4JO2L 4X7FC 2AJUL 3QC5X 1V7NL 3O2VL 1ZD6A 5F72S 4YUEH 3RLSA 1FGNL 3TZVC 5SV4A 3QFJD 4OCNC 1E9PB 5FGCB 4DAGL 3RBSA 2Y5EA 2ZONA 1F2XK 2L7JA 2B9BA 1U8OA 3N1QC 3WUZA 3FB6B 4Z3GA 5CZXC 3QIBA 3TC9A 1FZMB 5BVJB 1BM7A 5EZIH 3MLZL 2J6EA 4PREA 1PL3A 3EJJX 4HIXH 4HSCX 3C5ZA 4Y16D 1HILB 3Q2WA 3K6IA 1E5ZA 4NOBA 2ZPKL 5FFLA 1XEDA 3V0FA 4LDCA 2W9LA 4XOCA 4DP7X 4YDVA 4FTVD 1YMME 3GS7A 3RY5A 3T2PA 2V7HB 3ZZLA 2YLKA 3PRZA 2WINA 5GRVL 1BLNB 4M8UA 1SYSA 3EDDA 4NT6A 2DQHL 5LG6A 1TKWA 4G6MH 4QHMA 1HJBC 2CSPA 2Z6FA 3A5VA 2ADYA 5B1JA 1AGBA 1OGAA 2ATPA 3KPLB 3L8QA 3GEWB 2P8LA 3RX5A 2VM3A 1WIOA 1XCTA 2H32H 2H8PA 2KPWA 4RSYA 1GIGH 5IT2L 2CIKA 2R4RL 4TUJA 5LGHL 2ICWA 5FYLL 1XXFC 4ZI8A 3GJFK 4NUGH 5MEPB 4ZFGH 1TMCB 4N1HB 1OARH 1P2CA 3KPSD 4HHWA 1XB6A 4IW4C 1ASPA 3EFFA 5DDHA 1KGCD 1DR9A 2PCFA 1ZJAA 4XMTA 2DWDA 4MCMA 4WVRA 3I50L 4K4KA 3CHRA 3EYQC 2FQGA 1U58A 5AW1B 1E4HA 3JWOC 4RFOL 5C09D 3G5YA 2FEDC 3AREB 1ZTMA 4IRZH 1DQJB 1FNEA 5L2JA 2Q7AA 4OM0H 4AV5A 3B5HA 4KKQA 1JN6B 1OCRB 4BQCA 1ODUA 1KJMA 2VR6A 3HS9A 4HIJB 4XP4H 4Y5XB 4X6FB 3GDBA 3MV11 3ZTDC 2FGZA 3IMVA 2ZP0T 4M7KH 3S2CA 3H7BA 1Z9LA 2GTZA 3JZ7A 4GG6B 5CEZL 4UT7L 2ARJB 4NZUL 3GIVA 3WFZA 3VXTA 3SQBA 4PV9A 4MAYD 3RZCC 2COQA 4AJYV 1YA5A 3G6DL 2ZCKL 1K2DA 1DFXA 3EYVB 1N5YH 3L1OH 4GSQA 4OI8A 4PGCB 2EEBA 3EHBC 4TSBL 1NFDE 2VB5A 3BVNB 3VFOB 1HKFA 2XXCB 1SNRA 4LLUB 3W1ZA 1GJIA 4BKTC 2DQUH 2DYRB 3E0GA 4XP6H 1F86A 2VZOA 5JOFB 4ABVA 1E4JA 3QQ3A 2EIEA 5C0AE 5JIDA 5GJTL 3MACL 2IADB 2QKIC 4DKEL 4Z3EA 1SM3H 4YR6B 1A6VH 1H8OA 3BVUA 5BVPH 5IESH 1TJGH 4EVNB 5E4AA 3EBAA 3KHQA 3KCWA 2HLAA 4MA3A 2QGEA 1Z1WA 1J8SA 2ADGB 3MRHA 5FA4A 5TE6L 5EOTB 4U6XA 1F00I 2P5EB 2WBJB 4Z5RB 4Y19A 5HY9A 1I53A 2GK0A 1BFOB 4PJDB 1FVCB 2IALA 1I9RL 1YEJL 3G6JB 2NZ1A 1SJXA 2DWEA 1ZJBA 3GBNH 4UOJA 4WW1A 3SDDD 3FYEB 4JFFE 4NC1E 1NBQA 4JGUA 5LKNA 1MQ8A 2L0DA 4AQ1C 1QA9A 4UDUA 4AEIL 2G5UA 1UXMA 4OT1H 2RHEA 3KPMA 3G5VB 1HCFX 2OAAA 4X6BA 1JGEB 4YPGA 5LAPA 1QPPA 1TDQA 5EEZA 2IXQB 2Z31B 1QRNB 4H2AA 5DZNA 5EN3A 3C60B 1JWUB 3I3EA 5BW7C 2R1WA 3M7OA 1FFNA 4PY7B 2BZDA 1WWBX 5IVZB 1NFAA 3QJZA 2PTUA 2GC7C 5GSVB 3HFMH 5F88B 4ZNCD 3I6GA 3AABA 1Z9NA 3IXAB 2WIMA 2AKRB 2EILB 2XWRA 3QHFH 2H7WA 2L7EA 1YSOA 3NZSA 1LD9A 4G9DA 2X42A 2XZAL 1PAZA 1ZA3A 2COVD 4P4KA 3KDMB 1X44A 3U2SB 3SDXF 1OTUD 4OLXL 2VLKB 3HFFA 3V7MA 1H3GA 5L4JA 3W11C 1RUMH 1ZA6B 2QADD 2YAHA 2NLJB 5LQBH 1IGIL 3RB5A 1J5DA 3SDXA 4LHUG 2VXUL 1AQDB 4FQXC 3BWZA 1YEGH 2PWDA 3REWB 3N9GL 3CSPA 3LAFA 2X0UA 1BXXA 3MOBL 4NXSA 4XCYA 2KYIA 1FQ9C 1ROWA 2JB6A 1N6QL 5GS1C 2WMPA 4EE2A 3BESR 4HU2A 3QZWG 5LCVA 4CMMA 5I18H 1DUZB 1CT8A 2EKSB 4NB7A 4FERA 3KG5A 3D18B 3WFEL 1JGLL 2VXQL 3FSZA 5C0BA 3UJJH 3KZ8A 1WP6A 4KC3B 1SXBA 1SEQL 4ZAKD 4FMVA 4XBGB 4NJAL 2OW6A 4KXAA 5GS0H 3WJMB 1U8LB 4Q58C 4TSAH 3ZQXA 4UCFA 3ROOA 1P84J 4C83A 7FABL 1SPDA 4OD1H 4L9LC 4NWUH 1MAML 2OA9A 1LP9B 1CFQB 5D72L 5KYXA 4RGNC 5K69A 1J0YA 1T03H 5DRZB 2J6EL 3RWDA 4M7ZB 5HYQB 3QG6B 1IQWL 5FEBA 2UZYB 3ZTNH 2E8ZA 2W0LA 3PIQB 4F7CB 4KKZA 1ZRUA 3KBPA 2A77L 5EZLB 1PVHA 2BX5A 1TZIA 3GGWB 3LZFH 3BP6A 4N86A 5FYJE 2R0WH 1KV3A 2GIXA 5SWSE 3S35X 1N67A 5EU6B 4XH2B 5HDBF 3NSFA 3EO0B 1AHWA 3TBVB 4L2LA 4I9XA 4PRDA 3C8KA 5FO7A 4RFNC 5LLIC 1IIKA 4KHXL 2RQEA 3VG0L 1VZGA 1AANA 2FATL 1MJJB 4TQIA 4AMXA 1R75A 3V4UH 2R8SH 4WQOA 3VFRB 4TVPH 4TOYH 5EZJB 3RBGA 1TJIH 3DTXB 3EH4B 4BH8A 2BHFA 3GF8A 4F37K 3P0YH 2Z4QB 1ITBB 2OR8A 5AW3B 5EOQH 5LAXA 4KFZC 1AGEA 4FKKA 4LLQA 3N44F 2A6IB 2GJZB 1A6AA 2CHZA 5DMGD 2Y69B 4R4ND 5I76B 1BCIA 1G6RH 1AGFB 1C5DB 4HJJL 3HAEH 1E4WH 4RZKA 5CS7A 5JPMA 2PXYD 1DL7L 1HN1A 1RMFL 3S34L 5DUPL 2B9AA 1D5RA 2DQFA 1MOEA 4IOIB 3OKEB 5I1GL 2JXMA 1I31A 3BT2L 4WWKD 1HS6A 3HC3H 4DW2H 2WCGA 3MV9D 3Q13A 3NACL 4Y16A 4YHOL 1XFPA 1KN2H 4LCYB 5F7LB 4O2FB 2MPVA 4FTVA 4ICWA 5AAWC 1S7UB 5KVEL 1YEKL 3MLXL 4JFXA 1YMHB 3DURA 4CW1A 2VO5A 1YRKA 3CVIH 3JVFC 3HG2A 1RPUA 2WYHA 2AJSL 2WD0A 4P23C 4QAMB 4F20A 2QVTA 1KBKA 2DYSB 2DW5A 4ZTPH 2NY2D 4W1TA 3QEHB 2O6DA 5ISZB 2YFOA 3LD8C 3TCLB 3GSVA 2O30A 4O2EA 3DMMC 4EZMA 3VSUA 3D5OF 3BAYA 2VL4A 4XMPL 3EDJA 4XOAA 3T6XA 1V55B 3KPSA 4H0HB 3OX8B 4RMWA 2WYTA 4JL1A 4EQ2A 3E38A 4U1GB 3QCUH 1U8MA 4ZTOH 4IIQA 3RKDC 3BW9B 3KJ6H 1JBJA 1NCWL 1F4YL 1ZIAA 3U30B 1EERB 2NNCA 4J3UA 1EHNA 4IKNA 3MUY1 5C09A 2MTAA 1GZHA 5AW6B 1CZ8H 4LFHG 4LLMA 3J8F7 5AL0A 5DJ8B 1AQKH 5IM7B 1BGXL 4HAKA 4QO1A 4NZDA 2IO5A 4GRWH 3MRNB 4UOZA 2HG5A 3DYPA 4NRXB 4ISVA 1O7SA 3S35L 3JTSA 1DEEA 1P4LA 4L1HA 1GJWA 4G3YH 1TITA 1UOKA 3QPQD 4OM1H 4BEIA 4EI6A 4MAYA 1JTPA 5BQDA 5INDB 5KANG 5F8RC 1AACA 2P49B 4P5TC 2CE6A 2OSXA 2EO7A 2AHIA 4FQQB 4GRMA 4PQXA 1NFIB 2A9AA 3KVPA 2MTPA 3AW5A 5DZLA 1JI2A 4I85A 2X4OA 2ZKYA 5E2UH 3ZT6A 4LRNL 1U3JA 2C5DC 1VAHA 2Y3AA 4YXLL 5IBLD 4UNTA 3I6KA 4TL5A 4NNXB 2OYKA 2D31B 3E7JA 4ZO9A 4QTIH 2DMCA 1H3WM 3EADA 4QOKB 4O2CA 4X99A 4E68A 3IGAA 2P7TB 4N2OA 2OP4L 3L9RA 4J28A 3FL7A 1HHKB 2ZSWA 1QZNA 2CXKA 1QUNA 2GBVA 4LSSH 4P2OD 4UBDD 2XFXA 4POYA 1YEEL 2XX0A 1XB8A 3F83A 4FXKA 3UEQA 2IMNA 4ZXBB 4PY8J 1E5AA 1XIWC 4PWJA 4DZBB 2YKKA 3NJMA 4BQ6A 2MCG1 5TE4H 2Q6WB 5T3XL 3B9VA 5AUMA 4P0DA 5E4EB 3SDDA 1KCBA 3CHSA 2E59A 1IEBB 4HFUH 4HIHA 4JDVB 4C8XA 4D0BA 3BIKA 1HEZB 2WO3B 3QR0A 2J8UF 2X9ZA 3ZE0F 1T1XA 2Q3AA 4ZUWA 1AD9A 2JQMA 4G8GE 3WS3B 1A1MB 2HLEB 1JPFA 3MA9H 1IGTB 4OD2A 4TPRL 3IDNB 3VI3B 4A6YA 1NQBA 4NCC1 4NQED 2JJVA 4DEUA 4YHIB 1T2QH 2D4DA 3CX5K 4YXHL 3O6KH 5DTFB 3QBTB 1WD9A 5CBEB 2AEPH 2B1AL 4JFDD 4DKTA 4B9CA 4MJHA 3PHQB 5ESVA 4BFOA 1IGML 3HUJE 4GO8A 4JG9A 3MLRL 4HXBL 2LU7A 3TO4A 3W0WB 4ZOAA 2WANA 2JCCB 2BMKA 4BSVB 1MFMA 5FDWA 3V5KA 2MKWA 5KS9E 5E8PB 4HUVB 3RNQA 4ADGA 2A74C 3IXTA 3N91A 1SHWA 1OZUA 2QDVA 4G9FB 1MI5A 1TTUA 4A7VA 1ORQA 1OE2A 5J1TC 1MW0A 2OZ4L 4OZHB 4AIEA 1KGJA 5FO8A 1TVBA 1MLBB 3VGHA 1G5AA 1NM9A 1UD3A 1N64L 3TF4A 3IFOB 2WZ5A 3BGFC 3WOVA 3GSQB 1HC1A 2AZUA 3L7EA 4MD0B 4C56A 3TIEB 5ADOH 4NHCH 1OSZB 4EIGB 4U1NB 5D5ME 1KLGA 3VDAA 1P4UA 3JBG7 2NY6C 3AVEA 4M8RA 1QEWA 4XN8A 2QV4A 2PTTB 3LS5L 1M6OA 1HNFA 2JMRA 2PPFA 4Z7AA 1U8HB 2PMZA 4O51B 3U9WA 1TIUA 1Y07A 5A2JH 3RHWF 2KZ1B 3GWJA 3HAEG 4PHZA 3BPCB 3HE6B 3O9WB 1AQMA 1UD4A 3DJ9A 4PP2A 5JXEC 5CCKH 5MHSE 1DUYA 4JZOA 4P57B 1QMUA 5ICZA 5IMMB 3EH2A 4H44C 1MFEH 3OMAB 5CHNB 2X1XR 4LLAA 1CE1H 3H4HA 4ANUA 5I74C 3WMPA 5IIEB 3V52L 2PR9A 1H5BC 1QLEL 4MJIA 1WZMA 3KPRB 4NC1C 4ODBD 3DRTB 3MLWL 5F9WC 1EK3A 4G1MA 2XXFA 4QYOB 1QACA 4HW6A 3UO8B 1MQKL 2WXPA 1QLRB 4XO5A 4XMLH 5JW3H 3N40P 2WUCL 3LHPL 4QTHA 2DPKA 3QUYC 1WFNA 2H9GB 3T5WA 1FAIL 1KUMA 2CBMA 5FX3A 1IC0A 4QJ3B 1KMGA 4DOHB 5E1AA 1QBAA 3QHTC 3BVVA 3KW7A 5F7EL 2VLRD 5L4IA 3T0AA 3V0DA 3KYMB 3NGBC 4O00A 3FO9A 3V5DA 4DVBA 3LZQA 4DK3A 5ITBL 1RZKC 3HZKB 3PNWB 1P1ZA 5DYOA 5L7XL 2IH9A 4J3OD 4QHLA 1MAJA 3MLUH 3ULAB 4Y2DD 1GVIA 2GY5A 3WLWD 2KBGA 2OL3B 1K8IA 5GHWL 5D71L 3O6FA 4MNGB 1AE6H 1FNSL 5E8NB 1ESOA 1LDSA 2F7OA 2YAOA 1FL6B 5I26A 3VWJC 1P7QD 1TYJA 1XH1A 3PGCB 2UXGA 2GUOB 3PWNB 4X4ZA 5JHDE 4DP0X 3D0LA 2Z9TA 1RFDH 1M3IA 1BIHA 5FHAH 3QW9A 1GH7A 1KCVH 4CMHC 2XRAH 4Q6KA 5IW3A 4FG4A 3FT3A 5LN4A 1L9TA 2BDNH 3VGGA 3X2QB 5JHMA 2Z7YA 2N56A 2FO8A 4JG1L 4LLDB 4TV3A 2Y36H 5I6MA 2OCFD 3H2WA 3S88H 1A2YA 4HWBH 1SFHA 2R2BA 3ML9A 4NN5B 4WWKA 2IAMC 1GZQA 3X1FA 4JRYB 3LOWA 2CJ3A 2G3ZA 3O4LE 4PP1C 5AZUA 1WV7T 4U3SA 3EF4A 1V3JA 3DX7A 3AZUA 4KTYA 4PIRF 4FLOA 4IMKA 1TETH 4ZFQA 3ULSA 5EF3A 1OXYA 1VF5C 5DJYA 4ZFFA 3O3UN 1H8SA 5ID0B 1TQSA 1P6AB 1S7XA 3F58H 4KNUA 2KL6A 4ZS6C 2ZOOA 5KVGE 1C16B 1MFCH 1MLCA 3LIZA 1HK6A 4Q89A 1M53A 3S37H 4LAQH 3W57A 4F9LA 1UADC 3SE4A 1MCLA 1XSKA 2NY1C 2F5AH 2I25N 3OSVA 5B7EA 5ID1B 1BVKA 3ZX1A 4YEFA 5J9PA 2BVOB