4AXWA

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1- 2, form i 2.2a.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
b'MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 44
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA02
4ZMZA 3MVSA 2OMZB 1ZVNA 3LNEA 1O6SB 4ZMLA 2WCPA 1EDHA 3UBGA 2OMVB 4NUMA 4AXWB 1Q1PA 4NUQA 1OP4A 3LNHA 2WD0A 2QVIA 2A4EA 1WYJA 4AQAB 4AK1A 1NCIA 4XXWC 5JYMA 2OMWB 2OMTB 3K6IA 4ZI8A 4ZMVA 3LNIA 2QVFB 5JYLA 2X2UA 4AQ8C 2A4CA 3QRBA 1WUZA 4OY9A 3LNGA 1L3WA 4ZMYA 4ZMPA 1ZXKA 4AXWA 2OMYB 2WBXA 4QD2E 4AQEB 3LNDA 4NQQA 3K5RA 3FF7A 3Q2NA 2EE0A 3UBHA 2OMUB 5DZVA 4XXWA 1SUHA 4AQAA 3UBFA 4APXB 3FF8A 4AQ8A 3K5SA 2YSTA 2OMXB 3Q2LA 4ZMOA 2WHVA 5CZRA 2V37A 4ZTEA 1NCGA 3Q2WA 4AQEA 4NUPA 4ZMXA 5CO1A 2O72A 5KJ4A 3K6DA 1NCHA 2YQGA 4ZMTA 4ZMWA 4ZT1A 3LNFA 4APXA 1NCJA 3Q2VA 3PPEA 1FF5A 3K6FA 4ZMQA 4ZMNA
chains in the Genus database with same CATH superfamily
1PG7L 1KB5L 3FT4B 4P5KA 4PGBB 5C0FA 3AACA 2WZPD 2KLSA 4FNUA 3SKUD 2X2YA 4EDXA 5I6MA 2EYTA 3VFUA 4KVPA 5GS2H 1F3DJ 3HE7C 4MMZC 1E65A 3FTWA 5F8QC 3C5ZB 3MGTB 5E1AA 1D2OA 3KEHA 5MP6L 4NNYA 3NJGA 4XMLL 5FLUA 1KYDA 1UEMA 1EDYA 4LEXH 1USQA 3VWJA 1SM3H 2DKSA 3GMRA 3WMPA 3Q6FA 1JXDA 5IKCB 1TJXA 4XC1H 1JOIA 3KXFE 1PZSA 2W91A 4HJSA 1MLBB 2O6EA 2X4NB 3MRIA 2QZ5A 1MXDA 4I48A 4QWWC 3RY4A 1BBDL 1OOAA 1E27B 3D0LA 5K33A 2E27H 2QJDA 5ESAA 3BAEH 3TT3H 4Y4FB 2VLKB 1I9RH 3QULA 1P7BA 3CDZB 1TTFA 3H9ZA 1KJVA 2F19H 4XN8A 5FWQA 1GJWA 3RG1C 1ZGLM 1AYOA 4M03A 4PJHB 1IARB 1B90A 1OGAB 1SGKA 2P5WB 2NY3D 3HLAA 4PSPA 3KE0A 2A9BA 2BWQA 5I23A 3FQXB 2DWSA 2K6YA 2Z35A 2R0LL 1BZ7B 5TPWL 3VWJD 1BYOA 5BV7C 3VXPB 3FUFA 2UWEE 1BM7A 5LVEA 4NPYB 2APFA 5I75B 3U1PA 1RZQA 2AJYH 3MACL 2GVYA 1N8OE 2GB2A 4TQIA 1UM6L 4WJG3 5HXMA 5C2BL 2HXAA 4NXSA 4CMHC 5E7FA 3SKOA 2Q9OA 2ADIB 1MW2A 3FCTB 3H1ZA 4L0YA 1NPUA 4OVUA 1J8KA 2BOCA 4RAUB 2C26A 3MA7A 1P6FA 4BFKA 2CLVA 4F15B 3V4UH 1F4HA 3IDMA 3TWYA 1D5XB 1UFGA 2G75A 1BOGB 3K4AA 4BK5C 3DO4A 4PRIA 4DPAX 1NCGA 2IDFA 2JQMA 4LEEA 4M6ML 4MCZB 4UB0H 3EBHA 2DEYX 2QKSA 5CO1A 5GIRB 3KYMB 3IMWA 3SDCB 4ZMTA 4PPTA 1JJUA 5I1DB 3DJSA 3HUJA 4Z7UA 5T33L 1HESA 2ZX7A 2D7QA 4BH8A 4Q9QH 5JHLH 2BS9A 5CEZD 5DQJA 3X12A 4QJ3B 3KNBA 4PTTA 1KTCA 4WTWA 3RLSA 5A1AA 43C9B 4CU8A 5K39B 2QLYA 1CFVH 2YAPA 4X7DC 4XAKE 4G3YH 1XGRA 1YMHB 3BUQA 3G08A 4MQXC 4PGCB 1FIGH 4HCGA 4H5SB 5EU5B 1VFAA 1TKWB 5EBGA 2HH0H 1HYSC 1FNLA 5E2UL 3JV4A 1XCQA 3WTYA 3CXHK 2PW1A 3SPCA 4BFRA 2N7BA 1EHAA 2YD1A 3IDGA 1U8MB 1S2EA 2Y7SA 3NESA 4WHTA 5C9JA 4N86A 3U9UB 4YDIH 3EGXB 3Q8BA 4NBZB 5C08A 1A6AB 1R34A 4EUPB 4JZNB 1KYOJ 3C5SA 4TULH 3POHA 4W4OA 5JIPA 2NY5C 5GZOC 2D3NA 2Z92A 2OYMA 2JIXB 4HISA 2AW2A 1BV8A 2VMDA 3QGVA 4UT6L 3H4HA 1DBBL 2C9UA 32C2A 3ARGC 3H3PL 4GKOA 1Q38A 2R23A 2Z8RA 3E0GA 5JOPE 5GJTH 2WXRA 4R26H 2M26A 1QATA 4FADA 1K8IB 5J9PA 1MW0A 4Y4HC 5DWUL 1QACA 2OI9B 3NIDB 3OZLA 1T1XB 3BSZA 4UT9H 2BMKB 3UC2A 4Y5XC 3WKPA 5TDPA 3BP5A 1QUNA 2C9SA 3RA7L 5J6HA 1TTUA 1SUHA 1U95B 5B38G 4HU2A 1FNSH 1OGPA 2OCCB 3GD1C 1QYGL 2OBGA 5EO1A 1A6TB 1T4WA 3AG3B 3N2JA 4LP5A 1BIIB 4NJ9H 4RMBA 5I1JL 4KZDL 1DFXA 5A2CA 3BGFB 4WRLA 4A2GA 3I6LE 3MUUA 3OB8A 1MJ7L 3R4DA 4W81A 3OHMB 5AW4B 4P2QB 4QYAA 3RZCA 2WTPA 3IM1A 5IW6A 2AANA 5CP3A 4ZMOA 3MLWH 3L48A 2ZXQA 1NUFA 1PD1A 5CSZA 3VNZA 3HE6A 4M8QB 4AYID 5DK0A 4LEBA 4EKXA 1L7TH 3FXIC 1PFOA 3GLEA 2V2WA 4CKVX 1IO4C 2ZYRA 1YEWA 3NJVA 1K4DB 4B9PA 4OQ1A 3WEXB 3F7VB 4U6HA 1AGFA 1KG0A 4HMDA 4LOEA 4HUKB 2IGTA 4WU7B 3TBTB 3L17A 2DAVA 4C55A 2LFGA 2BP0A 5G5DA 1YPZA 1G7IB 2NW2B 3L1OH 3PCYA 4H25B 2BS71 2FYYB 1ROCA 5DJ6B 3IMBA 4RMUA 4Z7QE 4OD1H 3ETBJ 3H55A 5CN1A 4YDVA 1IKFH 5F9DC 1ZS8B 5IUSA 2DM3A 2WP3T 1U8LA 3OKNA 4O5LL 4V1DA 4WHYG 4L5FE 5DUPL 3RY5A 1ZVHA 3FDWA 3E2HB 3RZCD 1N70A 4YHOH 5DJCA 3INUH 4A38A 3BVTA 1NGPL 4O02A 1SEQH 3BVXA 3K0WA 4YIQB 2IXQA 3HBQA 3HE6D 2X4TB 4NHUB 3DNKA 2R2HB 3I50L 5BUAA 2MCG1 5JR1L 5FUOH 5TQ0L 3ARTA 2DWXA 4U1IA 1N59B 1A7QL 1O6VA 5TH2A 5C0BB 3CLEL 4L1HA 3SGDI 1J8HE 3O6FD 5FA4B 1G94A 4AGLA 4EIGB 1WT5A 4X7SH 1XR9A 3BAIA 1IUZA 3C08H 4GT0A 4PW3A 2YRPA 4QOKE 4YGAB 3VMNA 5TDOA 1R3JB 4H40A 4QGYA 4V1DD 5ERWA 3U4EB 3EH3B 1JF5A 5E8PB 2WQRA 3ABKB 3QUZA 3FU6A 3VJ6A 2VMEA 3CQFA 4P23B 5DZLA 3UZVB 1MDAA 5EA0H 4HCRA 1L9QA 4TN9A 3JT0A 3BQUA 1MEXH 3L1GA 2AF2A 4AMKH 5IFJA 4U3HA 3F7KA 2WXGA 4NWUL 5I66B 1BMZA 1W72A 5ITBH 3S5LB 1RJYA 3GSWA 2ZSWB 3FSWA 3R8BB 3OKYA 4MJIE 1KSRA 4DESA 5CEZL 1KEGH 3AMLA 4UDUA 1B4RA 2GIMA 2CBPA 1CI5A 1BXVA 1KYFA 3PWUB 4LLYB 1F3JB 3IJEB 5I16A 4NXKA 1OW0C 1TPXC 3MLXH 3RKPA 1P7QB 4DQOH 1F2XK 1NCNA 2BNQE 4NPJA 5L4IA 5J13C 3QUZD 1ZHKB 1YEGH 1B6DA 3MV9B 2GEEA 1T2QH 5HI3C 4QHUA 4YEEA 3BQUD 2AITA 4L3EB 1J9TA 4ISVA 4QT5B 2RHEA 2JJUA 2Z31C 2AEOA 3FO9A 3L9RA 1E3XA 2QQKL 3QUKB 3FTUA 2EYRB 3QEGH 1NUNB 3FU0A 4FLRA 4FULA 4MVBC 3SD5A 2F53D 4AQZA 5A16A 1WS7A 4S1QL 2Y2YA 5CJOL 3MN8A 4F8QA 3OD3A 3NJHA 5INCB 1AHMA 1O5DT 2VDKH 3A6BH 3PHOB 3VRLF 1MWAB 3CFDA 3REVB 4RESB 4ZO7A 3IF1B 2E7DA 3VSQA 3C09C 1IT9L 2GT9A 2EDNA 1BFVL 3ARQA 5EDXA 4PJ8A 1FO0H 5C0DA 5DFTA 3VE0B 4ALAH 3IPBA 1IV8A 5FO2A 1QEWA 1AHWB 1RAMA 4S0TD 2AXHA 1Q9LB 2XN9E 5H35A 2V0AA 5L6YL 2NY0C 3M8OL 3K72B 4IBQA 3S3SA 3O3BA 1FFPB 4P3DB 1MJ8H 2GTWB 1HHHB 4AGPA 4I18C 1VZIA 1UZ6F 1K2DB 5EF2A 1FIEA 4UTCA 3ZTNL 2O5YL 1KJMB 4AY0A 1VRSA 3WU1A 2YAMA 4QRRB 1YEHL 4Y1TA 4LLMA 1P6AB 2K9FB 4KKZA 1SUJA 4KVNH 1H9DA 4ZFOL 4NQEE 2IBBA 3PLYA 1MCJA 4YJZL 2Z8WC 4UQIM 4ELKA 3FUDA 1TVDA 1CGWA 1AI1L 3D52A 4PJ8D 1DJHA 5D2LB 1I9IL 1M42A 4PHZA 1KXVA 3K0YA 1BECA 4H8WH 1A6WH 1GIGL 4OCSH 1E6JL 2APBA 3QAZC 2J6WA 3X14A 5I30H 4RQQB 1MY7A 4NZJA 3WY3A 3BSZL 5HGDA 3M1CA 4X8GA 3ZJAA 5JYMA 1J18A 2VZ3A 1BA9A 4GRWB 3ZU8A 2VGLM 3RWGB 2V2TB 2D03H 2VZTA 5KUKA 1O75A 3KPSB 4GKLA 4LHUD 3PDOA 4AQ1A 3QRBA 3VXTA 3GK8H 4KH2A 3GMPB 3HS8A 4RAVB 3B6SB 1E5CA 5IVXE 3KXFD 4MD0B 4U7KA 4NP9A 4DVRH 5TF1H 2FB4H 4DKEH 4IMKA 2ZKHH 1OGTB 3QVAA 3VW3L 4KXBA 4OLWH 3F83A 2FHFA 1XD0A 3FQTB 1E40A 4G8FB 2NUPA 3NQKA 3P3UA 3QIUA 4TVPH 4KRNA 3C9NB 5DO8A 5KAQG 1S9VB 2J5LC 1ACYL 4KX7A 2KQNA 4WF7A 1JZFA 3UJTL 5JQIB 3NMEA 2QKIA 2Z0BA 1TVBA 1J8SA 3GMLA 4ZUVB 2P8PA 5SWZA 4NCC1 5KSBF 1LWJA 1MHHB 2R0ZL 1OHZA 4KXAA 3KWXA 2V37A 5HHQA 4AW4A 1TF4A 2VXSL 2EE9A 2DQUL 4R7LA 3NIGF 4JFHE 1UXWB 3BWAB 4FMKA 3VQMA 4GLRI 3HIZA 3QIUD 1OK0A 5IB3B 1E5YA 3STLB 4K71B 3D4CA 2C3VA 1A6UL 1NOAA 2L7EA 3F12B 3LS4H 1CR9H 4LLVB 3ZZQA 3PGFL 4X0NA 4JQXA 3CCHA 1D6EA 2VDOH 4Z0XA 5SWZD 1MCSA 2XWRA 3IRPX 3N85L 3QEQB 2Q6WA 4AK2A 4N4YB 3DK0A 2IMNA 3GUTA 3T3MF 3ZDWA 1Y18A 4LCCB 4K7FA 1KCRH 2NY4D 5AYUH 4LVNC 1I8IA 3N91A 3QXWA 5AAWA 2Y2WA 4XN4A 4MX7A 3T2NL 3TVMC 2AERT 3CHQA 5F7LB 2W88A 2YXVA 3G04B 1CL7H 2EIBA 2RFXA 5FO9B 5DK2A 5IMMA 3RWDA 1CZ8H 3V52H 1IGFH 3M88A 4XAKD 2VLLA 4XBEL 3DMMB 1DJYA 3U7WL 1ORSA 1L9MA 4ZFFB 2X2JA 1I31A 3STZA 1KXHA 3WFBL 4Y5VC 5AW0B 1U3JA 3SZ6A 2AJUL 1W8EA 2ILLA 3NFSH 1Q8MA 2VQ4A 4RGMB 4BK8A 1F42A 2H0EA 4JFPB 4TNFA 3OKMA 4PB9H 3TH4T 2ITDA 1T1WA 3TBSA 1QBMH 3ETBF 2ZAHA 2OMWB 4O4YH 5IQ7L 2HJKA 3P0VH 1YN6B 2J73A 1OT4A 2JJTA 1R24B 2OTPA 4G5ZH 4K7PL 25C8H 5C0CE 5IGXH 4TQPA 4AL8L 2MCPH 4KJWD 5KBLA 3NRPA 4EVNB 3VMOA 4NDMB 4MJJA 4CA4A 2F8OA 4TSBH 1FPTL 4LP8A 3RFZB 5F7EL 1FZMB 2UVFA 4HDIA 4NB7A 5E4AA 1WGOA 4UANA 4P2YA 4LP4A 2P1YA 2VXVL 2XFXA 3TZVA 2AQ1A 1KUMA 4J3OC 5JOPD 1JUFA 2LT9A 5FYLE 1IZKA 1QRNE 2GK0A 4WZ9A 4Z0BH 3F6IA 5FW8A 3S2AA 3SD2A 3U9WA 3J07A 3LKPA 3UPRB 4LSDA 1B6UA 3A4EA 4XPBL 2VL5A 4Y19B 3WIIH 5H37H 2QZQA 4DGVL 5K1NA 1A2YA 5L8LB 4HGWB 4I2XE 2YUZA 1MJUL 1SYSA 5CBEB 1RZ7L 3M46A 1DCEA 1HAUA 1I85C 1U58A 4B41A 4GAGH 4W1TA 5D6CB 4WENB 3I6LD 1UWGH 3LPWA 5EBLB 5FEBA 3WAJA 1RUKL 3US1A 1QBBA 1M7DA 3CUPB 1TZGH 3OR7B 2V5YA 4HIHB 1J12A 3FB6B 3TZVD 5K9KA 4ZODA 3ABGA 4MD4B 3H9SB 3WGUB 3DIFB 3FU7B 1DVFA 1MVUA 1PD6A 4NM8H 3SDYH 2YPKA 4ATTA 5LXGL 2P48B 4HQQH 4X6DB 3FB8B 4F37K 1AKPA 1T83C 4KUCD 4XP5H 3CMOL 1QFUH 3CHOA 1KTKE 1CGSL 1PZ5B 1SLXA 4X7CC 5CBAB 1QWNA 1TG8A 3HNTL 1WD8A 3VDAA 3IU4H 5F0JB 5F3BB 1M57B 1F6AA 4GXUN 4IGBD 2XWJA 5DVNA 4X0KA 4OZHE 2VDQB 4ZYKB 4QOKA 2VR8A 3T4AA 1E5BA 5IFAH 4KQ4L 3L5JA 4U3SB 2CGRL 1DVFD 2CO7A 4R96B 1F11B 4GRLB 4N2LA 3FFCA 1NJ9A 4WGKA 2OTWB 4WWNA 1FE8H 2D9QB 3DX6B 1N7ML 5B7MA 3CXDL 4KJYB 2WIMA 5CD3B 2UY7A 4H8PA 4F58L 1I1AB 4JJHA 1BZDA 4OQTH 1PKQA 3MDJA 1SMDA 1T89C 1J8HD 1HSBB 4ZOEA 2RALA 1T5WA 4MRCA 4KROB 4NO3A 4MJIA 2VR5A 1BVZA 1YEIH 2HYMA 5E6YA 4Q4IA 4GINA 1GZQA 5DJ2A 5LDUA 1KLFB 3O41B 4QOKD 3QJUB 4D8PA 1QFWM 3P11H 3QR1A 1JHTA 2FNWA 1HQ4B 4HGMA 5E4EB 1THCA 2P28B 3WJMA 1QAWA 4IOSD 2WLNA 2BNQA 4R90H 3ZDYF 1PD0A 4QHNA 4JN2A 5HHOE 4MA7L 3VGDA 5J5EA 4ADIA 5JDJA 4E41E 3HNVL 4ONGH 4WNQB 5DUML 4N2NA 4A7SA 3H85A 1J5OL 1S9WB 1H0DA 4CNIA 3PJNA 3LKQA 3B43A 1ID5I 4QHMA 4IIQA 3ZYJA 4N8VB 3Q3GB 2G0KA 4MJID 5BO0D 2FVNA 3LZLA 4OCYH 3RHWF 4DETA 3U0PB 1NBZA 3LQZA 5DTFA 2QMKA 1QO3B 1WC7A 5ECGA 3OL2A 5IMLB 4YBLB 2JKJA 3N9GL 5E0FA 4GW4A 2BNQD 3HS0B 3CVBA 4ZD3H 2LU5A 3AWEA 5CFAA 3N40F 3TF7C 1FP5A 3T6WA 2PTTA 1HILB 5GJSL 3VXQA 1CYXA 5J6GB 5E8NB 2XN9A 3GBNL 5KN5B 4M1GH 2BERA 2J2ZA 1H3PL 5F89A 3R7RA 3L7EA 4FA6A 3CVIH 1BLNA 3QDJB 1NCWH 2C7UB 3LB6D 3K4ZA 4BCZA 1QR1B 4IRJB 1MFAH 4K3EH 1X5GA 4NSKA 3SYPA 4MA8L 2APWA 2HTLC 3K4DA 3KGSA 1VA9A 4YZFF 2PPCA 4NQEA 3KBPA 5ICUA 2NSQA 3UG5A 3VFVA 2FZ3B 3SN6N 2IDSA 4FI8A 5FGCE 1S7TA 1AXTL 3M6DA 4N0YL 1T7XA 4N0UB 4LCUB 4QHPA 1CF8H 5D8JH 3KLLA 5GSVA 4YC2B 1PJ9A 3ESVF 3BN9D 2ALWA 2VQUA 2XN9D 4RDQG 5I1CH 4BSWA 1S9YB 3KYOA 1UA6L 2I7OA 5B39G 4Y4KA 3ZT5A 1NLBH 2NTFB 1I3RA 3IDIA 2HMID 5BRZE 4RDBA 1ECZA 2V6HA 2X4RB 2E74C 1LM8V 4AT6B 3ABLB 5ESQB 4Z3HA 3PWPA 3Q06A 1UZ8B 1UGKA 4ICXA 1OCCB 3MRFA 3NQIA 1M6OB 1JZ3A 4LSVL 4M7JH 4NQED 5IVXA 4JQIL 2OP4H 2E76C 4G6KL 4ZTOL 4XT1C 1P1ZA 4PP1D 4DGWC 1BVNP 1AZRA 1PX3A 4KPHL 1VESA 5FUZL 3HE7A 4MMZA 4Q0XH 5DJAA 4CADB 2OXGA 1GTNA 1IC4H 5KS9F 2B15A 4UNVA 2EKJA 1IQDA 2ISDA 1MFEL 4UBDC 2WM0A 1E5AA 2VXUL 3N3EA 4OFKA 4R4ND 4Y4KD 5A6IA 5F7HA 4B9CA 1HSAB 5LAPA 1T22A 3B7UX 3KH4A 2DDQH 4UTAH 3FL7A 2NYKA 2P43B 5D7SL 1S8DB 4EXPX 3B8SA 3WIFA 1WIUA 3AGWA 3PWPD 3V6OC 4QO1B 2XIIA 1T20B 1M56B 4OZFA 4OLVH 4JPIA 3EO1B 3AY2A 4ZPTB 2NRDA 2F5AL 1UACH 3HE7D 3JYCA 2OMXB 4HS3B 4L5FL 3TBWA 4AG4H 3NABH 5GISH 1MFVA 2JQZA 1B0RB 2BSBA 4KUZH 5MHSD 1QBLH 3CIQA 3L1FA 3VFWB 4TL4A 5DR5H 3LKSB 3DVIA 4FFWC 1CD1A 1BX2A 3HG2A 3ZDXB 3PUCA 3CVHH 3EBAA 5GGVH 1AANA 3SOBL 1HH6B 1JK9B 1WCBA 3VVWA 1EV2E 3OR6A 2D4FA 4WEBL 4QJ4B 4QWWD 1W6WA 1L9SA 2DQDH 2I32A 3H9HA 3L16A 3RE0A 3R06A 4M4PA 4PJCB 4LLWA 43CAB 1UM5H 3BSHA 1MREH 3TEYA 2YBGA 4GS7B 3BW9A 3F62A 5DJXA 4NUJB 4XMKH 4Y2LA 5AZ2L 3TO4C 2WOYA 1XTLA 3L08A 3QCTH 3QIBB 4ZW6A 4JFHD 3AQXA 4F33B 4BK5A 4JFDE 1MHEB 1PZCA 4JFQB 1TIUA 3GMQA 4R2GC 3UG3A 1D5BA 2L0DA 2OW7A 1Q1JH 4WTZA 5DJZA 4AYMC 4NO0A 4GMSL 2GSIA 2DQTL 4M3HA 1U9KA 1SPDA 4PWEA 1FCGA 2OFQA 3D2UD 5JQ6L 1Z0NA 4GO8A 1EFXA 5DO2C 1MW1A 3VXUE 3BKJH 4Q6KA 3WTWA 3EZ8A 1UCTA 1IBZA 3BKML 1H3WM 3O0RL 3PQYE 2WLJA 5FCUL 3SO3C 1S7QA 3CVDA 2OJZL 1KPVA 2EH8L 1NCCL 2P3YA 2VDNH 4XNQA 4QTIL 3CV5A 4LGRB 1IFGA 2OS7A 3B37A 4B3EA 4NRXA 4ZS7H 3RTQB 4EZJA 5DGRA 4MKMA 4A6YA 4JDVB 35C8H 2YOCA 3BIAX 1NC4A 1SNRA 1JP5A 4NO0D 4Z8FL 1RJCA 3LRKA 3X3GL 3ZL4H 5D1ZI 4TS6A 1ECYA 2UX7A 2GCYA 5FS5A 1VSCA 5F97E 3K8KA 5AD0A 3L9EA 1UXSA 5BZDB 5MENE 4X5PA 4Y2OB 1FBIL 1EFXD 1FAIL 3WEBA 3B9EA 3THML 1E5ZA 4IIZA 5JOEA 1JPEA 3QUYB 5FUCC 2BCMA 1DDHB 3D0VA 3VD3A 1Z5HA 1MH5B 5EOQL 2IANB 1NPNA 4AEHL 1UCBH 1F00I 1NKRA 1CICC 4GUCA 1NEPA 1JGVL 3I9PA 4GG6B 1JGLL 1RK1A 1ICTA 2UWEF 1E4HA 4LAJH 4PRPE 2R56H 2FH6A 2QPFA 2X53A 3SJVB 4IKNA 2PR4L 1YQ2A 4LSTL 1A65A 5C0CD 2GSGB 4G9FA 4I2XA 5GZOA 2EXSA 1NC4D 4JRYE 4PJHE 4EBQH 3RNQB 3FB7A 2FD6L 3ARGA 3MRMA 1HYSD 1R5IB 2MOQA 2AJ3A 3K2MC 3TCLA 3ZHNA 2PNDA 3Q43A 1PLBA 3NJMA 4UU9A 4Y4HA 2AV7A 3TASA 4Y5XA 5FDWB 3OWRA 3LHAA 2XKSA 2DEWX 2A3TA 2H6UA 1QRND 3PHQA 4JHZA 4LLQB 4TL5A 5FYLD 4A39A 1MAMH 5KSAC 1UEYA 1C7TA 2JCCF 5T5FH 2VMFA 4FXKC 4H1LB 3NP4A 3O6MH 1XHHA 4ORZC 4DP2X 5GZOD 1B0IA 3L54A 4APXA 3GSXA 2PLTA 1XZ0A 2PKDA 2VLMD 3TV3L 2J12B 1CK0L 3KPOB 1G9MH 3M1BA 3OXSB 2G30A 4XX1E 3RIFF 2X9YA 2JMRA 1A9EA 3EUUA 4GFTB 2GBAA 3LAFA 5JHAA 2FEEL 3GLAA 2BSRB 3OLIA 5IMOA 4MNHA 5D1QC 4YMPA 3F01A 2FL5A 4I1RA 4JG1H 4Z7WF 1A14L 1RU9L 5DQDL 1WWWX 2VQTA 5ICXB 4CKQA 3N1PC 3VFRB 4KK5C 5ILTH 4JG0L 3CQPA 1I4FB 2V5MA 5AAPA 2HRGA 4TUUA 1UH4A 1SHWA 3FQUB 3BZEB 1UXLA 1O6TA 2ARJQ 4G7VL 5BW7C 2BZ7A 4FYSA 5JIDA 4AI7A 1GCFA 3IFPA 5FKAB 3SO5A 2X41A 4FI6A 1RSFA 4PS7A 1KGXA 1BF2A 1UYWL 1G7JA 4JFFB 4UQ9A 2FQDA 2BRRH 1MKFA 3EADA 4KKCC 3IPFA 4HS6B 1NFIA 3ZO9A 1JNNL 1HNFA 4N2KA 3GDBA 1M2VB 2A0LC 5C8JB 1GR7A 2O5XH 3BKCH 4UDTB 4DUWA 3D85B 4Y9CA 2VABB 2OCFD 2J88H 3NFNA 5HHVH 3ZRSA 3DOHA 3H42L 1PG7W 2GBVA 2D7NA 1Q72H 3ALXA 3Q8CA 1AQDA 1WF5A 3EJTA 3HC3H 4JZJB 5DC9B 1U8OB 5AW2B 3VTMA 1DEEA 4U7SA 1T1YA 4S0SD 4GB9A 2R15A 2WQUA 3VI4A 4ZQKB 3CXHJ 5F21B 4WSGA 1EHLL 4DGIL 4U6VH 1U8HA 3G5VB 4C57C 2AEPL 3A4DA 3N6YA 1S9XA 4P2RB 4APQC 4WI9A 2XOTA 3MLTB 2ADFH 3UXFA 3ZUCA 4F7EA 2QDWA 3MRJB 1CS6A 3GB7A 3W9EB 3HBGA 4HLEA 2IQ9L 3KPMA 1EQWA 1BVOA 3ARBC 1NINA 5FYJU 1ZV2A 4H8WC 4QLWA 2B4CH 5AOMA 1MOEA 2BJMH 3KYAA 1XQ4A 3B1TA 1FLTX 3B7YA 2BVTA 4ONHB 3GI8L 2EKSA 4LIQL 3RRQA 2Y5TA 4JM2C 1OW0A 3I3BA 4C4KT 3K2IA 1A7NH 2G2RA 3K2UH 5LNEA 1JWSB 1GGIH 1FORL 4I0PB 1MQKH 3UZQA 1ZJAA 1FNAA 4XP6L 1CIUA 4GFXA 1MFNA 3K71B 2B8OT 2NMSA 4HC1H 5HPMB 1WJ3A 5MEOB 1LMIA 4I3GA 4E42A 4U3CA 2Z31A 3HN8A 4KRPC 4TXVB 5D7IA 5I18H 4FNLL 4OIAA 5LUMA 2RACA 3L3HA 1GYVA 3VG0H 2VN5A 2XT1B 4IJTA 4FZEL 2R4RL 1ZCRA 3C5JA 4P4KC 3UO1L 2CLRA 2E7HA 5FXCH 1A5FH 3TNMB 1T21A 2KDGA 1NLDL 2HX9A 2P80A 2YFOA 3FYIB 4KI5C 5F7DB 5BRZA 1XH1A 1QX1A 2CRMA 1S7RA 4GXVH 3EGDB 4MMXB 3NJKA 4KOBA 2O4EA 4WO4B 3QHFL 3S37H 3NSYA 4LCWE 4DK3A 7FABL 5JLZB 2G60H 3QI9C 2YBRB 3C6LB 1QQDB 5ADPH 1LEIB 2Z31D 2O26U 3BEWA 3A24A 1Z5LB 5JZ7C 3HPLB 5ENWB 1MCKA 2NY2B 1N67A 4JLRA 4I18A 4MVBD 2VKXA 1X5ZA 3C6SA 2YUXA 1C8PA 4S11A 4ZFGH 3NJFA 5IW1A 5CIPH 5C0BE 4GAFB 3AXHA 3RILA 4ADJA 1OE3A 1UD6A 3RVXC 2NZIA 4LVHB 2A9DA 3UEZA 4DEPB 1FZKA 1QFWL 1YG9A 3TCTA 5DDHA 2P80D 5BO1L 1KCUL 1E90A 1UD4A 2XVGA 5BRZD 1TQVA 2IPUG 3WFHB 1TLKA 1M05B 5HHXH 3NCYS 1UD8A 3CC1A 4ZMYA 2EVFA 1N64H 1CFNA 3DXAB 3IVKB 3OSVA 4DF9A 5DD6A 2LOEA 3QNXB 5EN2B 4AQEB 1MCNA 1P4LB 2JB6A 3NZHH 4NN6C 4LOFA 1FH5H 2NY0D 3W5MA 2F2HA 5IJVB 3PL6B 5ANME 2NT0A 2AMGA 5I28A 3NEEA 4PR5A 5IQLA 2HN7B 1KTJA 1R5VA 4FQ2H 4KDTC 4OJFH 4KI1A 1AQKH 2DJUA 2XG5A 4Y5YC 4MB5A 4MXWL 1OAYH 5IMKA 4OTXH 4M6NH 3EXJA 1N6QL 2WUCL 1HZKA 2F54E 4OGAC 1D9KC 5B38B 3AGVA 3BZDA 2VITA 5TE7L 3EJYC 5DVPA 2H1PH 1UQSA 4LGSB 4LB8A 1CBVL 1OTSC 2EIJB 5HGAA 1S7VA 1SJEB 3V5HB 5I5JA 3SQOH 1Q0EA 2EABA 4RLDA 2ZSVB 3WFEL 5MEPA 3LD8C 3E38A 4IMLA 1N0XL 1FH2A 3GGWA 4LKCA 2JKLA 1B4JL 3S3CB 1VJSA 4U49A 5I0XA 2ZT9C 3QPQC 4G43A 4L3EE 4I0KA 4ZOAA 5J1SC 5D70H 5D7JB 3HAEA 4YWGL 3PWJA 5IEHA 1YYMH 1P5VB 4H88H 3NH7L 4IS6A 1CDGA 4NT6A 3WKML 2VLRB 3RWIB 1AACA 1GTFA 5DRZB 1D5MA 2HP4A 3ZKNC 1DQQB 2H3KA 3WMSA 2VWEC 4YGVA 3VXUA 2SEBA 4BZYA 1FWXA 2I9LA 4M8RA 3PQYA 3VFMB 4LSSL 2HJLB 3Q5TA 4BGDA 3HG1A 1HT6A 1LD9A 3L3KA 4HF5H 4ZUWB 4RSVA 2EE2A 1EDHA 2J1KA 2DI8A 3CH1A 4NUMA 5EBWB 1K3ZA 4ANXA 3UJJL 3MBXL 1BAFL 1R3LA 2GTQA 4Q58C 2R2EA 1WD9A 4OU3A 3RWCA 3B56A 3GJFB 1TQSA 3NCMA 4MMYB 3U9PH 4DGYL 1I3GH 3IU3B 1SXNA 4YHZL 5GGRA 2BY1A 3MHZA 5IK3A 3VX1A 3VXUD 1G6RH 1I8KB 3ZE2F 3GMMA 4BM7A 3CPUA 5E8OA 4PLNC 2VXTH 4NI3A 4LPCA 3PQYD 3TVMA 4YDNA 4EAEA 1XCWA 3HG1D 3BHBB 3V6FA 1MVYA 4PRPA 4FXGB 3T8XB 5IB2A 2C1OA 4HJGB 1EJOH 2A6IA 2AABL 4BKTC 5F7AA 4LCIH 3TBVB 2XXCB 1B9ZA 3P4MA 4Y5VA 4FOMA 1PX4A 1HWGB 4JHWH 1MCWM 3JTTB 3RPBA 1N9PA 3EBIA 4U1LB 5MEND 2P44B 5GGQL 4M7LH 2BFVH 5A3IC 2GHZA 3QS2A 3EXLA 2EYSB 5FA3B 2I5YL 2XVBA 2CIIB 4LHQB 4YSQA 5J1AB 5D5MB 1LP9A 3TVMD 4IBUA 1QFWI 5E95B 3MXWH 2V33A 1RFDH 1X5YA 4LZKA 3NSJA 1U2HA 4K9JA 4PRPD 4Y4FD 3QXTA 1W16A 4K5NA 6CGTA 2WWMC 1D5IL 3NRFA 1JNLL 1NUGA 4WI8A 1L4IA 4JRYD 2DD8L 3QUXC 1OPOA 5T1LB 4XOAA 5K9OB 5J0BA 1YEKL 4MLIA 3IDNA 4XN2A 4XCYA 1HHIB 1R5WB 5F1IA 4Z76B 4BHUI 1JMXA 3ZPDA 3F85A 4WNJA 2VAAB 2IGFL 4GUPB 3V5DB 2WUBL 4U1MB 4OVVA 4A7GF 1IEBA 2DM2A 3W39B 1G9NH 2CKBH 1AGCA 5KEZA 4OGYL 5LBVA 4L0ZA 1PNCA 5DI8A 2XU9A 4OT1L 2KHAA 4WJ5A 5HD8C 5I8EB 4TUOA 4N0FA 4CC0A 4WW2A 3Q0HA 4LOUC 4HETA 2F61A 1RVFH 3J7HA 1MFCL 3OHXC 4J3OD 4UMSA 2NY6C 1VKXA 1TLMA 1B2WH 1EXUA 2OJEA 4JFXA 5DZNA 2CLZB 4XC3H 4MAYC 3V4LA 1T83A 3S34H 4FQJH 1EMTH 2W59A 4JFOA 2QPUA 5KYXB 1HL9A 1QLEH 1T3FB 1EO5A 2CBTA 3FULA 5KYNA 4OUUB 5I71C 3MV7B 1YY8B 1TZHA 1YYLL 4X6BB 3HB3B 3MRGA 5JHMA 1KWGA 1T2JA 1SBBA 3E8UH 3GSUA 4Z7VE 3TIEA 2AK1L 3R19A 1WBYB 4JJ5A 1IAOA 4BZ1L 1MCBA 2ERJC 4DKAA 2H32B 5J6SA 4QDGA 3ERXA 1DSYA 2AXWA 1SXBA 3KD4A 1AO7A 3O3AA 3CHRA 1A1OB 5D72L 1OM3L 1NFDE 5KYWB 1JZEA 5DZVA 1BQLH 1PSKL 2BLFA 2X4SB 1N2RA 1T89A 3MA9H 5B7EA 2PYEB 4GAJH 3L4UA 3KPQB 4Y2DC 3DX9A 3TWCL 4UAOB 1ORQA 1A6VL 3IKCB 4U1KA 1WFTA 1ZT1A 4Z6AT 5ISZE 2N0MA 4JFSA 4LHUG 5EU3B 5CGYC 1RJLB 3QB7C 4HKBB 4UQEA 5KVGH 3S8GB 3U0TA 2VISA 3CK0H 4MCNA 2XV6B 5IQOA 3FMGH 2CE6A 4NCDA 1HCYA 4TSCH 4TUJB 3KWTA 1GHFL 3V55A 3NA9H 4XCEB 1NMBL 4K2UL 4NQTA 3TIDA 3D9AL 2NZ9D 5EUOE 3SDAC 1DLFH 4HZLA 4Y19E 3T0EB 2QR0B 1GGTA 1ZMYA 2E9IA 2LVCA 3ENEA 3FT2B 1CXEA 5KVDH 3MU3A 5AUMB 3AT9A 3KVDD 1TYRA 4YUEL 3EDKA 2I9TB 5CJQL 4HXAH 1EEZB 1IIKA 3P3SA 3VI3F 4RMSA 1DQLH 1G1YA 2A9ML 2VZVA 3H3BC 4RFEA 3U4KA 1L0QA 3QWOA 2KZKA 4KGLA 4Z18A 3S3JA 3P2DA 2FNBA 1J48A 4FYTA 4PJDF 4HK0B 4G7YL 3WLBB 5HI5C 3V0JA 4OZHF 4O00A 4LEOB 4L8CB 4LCWA 1DL7H 3DRTB 4X6CE 2X42A 5GS2D 5H4ZA 1AR2A 4L4VE 4X6DE 5D7KE 2FO8A 4QF1B 4CJ1A 1T03H 2ZKWA 4LLDA 3N06B 3LSOA 2I27N 4WI7A 3UTSE 4N5EC 1IGJA 4QR7A 3L3OC 2Z65C 5EORL 1T04A 3RU8L 1TOXA 3B2UC 4NRYA 1E6OL 4WFFE 2WKLA 4G83A 2AKRB 1IGCH 1E9QA 5T3ZE 1C08A 4PJIF 4H13C 4J3WA 5I8OH 2DLIA 4WW2C 4ANUA 3ZKMC 4IJ3C 4LQFH 2IDQA 2Z8SA 2FECI 1H3VA 2EXWC 2AGJL 1JGEB 2XXFA 4F7MA 4RZKA 4LCWD 4F2FA 4YQXL 1NBVL 2CZNA 1PYWB 1N8ZA 4XBPA 5BVPL 5EZIL 1AG6A 2WLLB 4DKFL 4FN0A 5ANMA 1MCHA 4ETQB 4ZMPA 2VW6A 4FP8L 5DCCA 2XWXA 1U8KA 2MHAA 3QUGA 4BRVA 4LDOB 2B2XH 3KEDA 3VFTB 4JVWA 3D08A 4FRWA 4PJAA 1EEYA 2HTLD 5C0GB 1ONQB 4KRLB 4Q56A 3WO4C 3EF4A 4QEGA 2OR8A 3VFNA 4HIEA 2ZYIA 4QRSA 5JHLA 5DD1H 4G1EA 5TDNB 1AGBA 2R0KH 3PP4H 2VW4A 4U0QB 2OL3B 2HJFA 3NOIA 3NPSB 1XGPA 4P23D 1ZVSA 3EYFB 3G3LA 3QISA 5AKRA 1NFAA 3W0WA 2OTUA 4G42A 1HCVA 4FKEA 1SMAA 2PWGA 2VIRA 4NKMB 2J8UB 3EYUL 4QRPB 2N56A 3RWJB 4M61B 3DI2B 5AW1B 2VSKB 1UD5A 1NM4A 3QJTB 3QNZB 2F54D 3TJEL 3ASWA 4YFLI 1BBJB 3V6OA 3P4OB 1EHNA 3D3VB 1T03L 4FCHA 2UZXA 1TITA 3D39A 5D71H 3HG3A 3MCKA 2AJZB 1U92B 4HP5A 4W9CC 2QQLH 2DQMA 3SKJH 1P7QD 4DCQB 4JPQA 5DEJA 3JUYA 3VQ2C 3ZTEA 1KTRL 5BXFA 4BZ2H 3OMIB 1F86A 3FN0H 1V8HA 3DX2A 4WQOA 3FUNA 4E9TA 5CS7A 4DQAA 2ZPKL 3BE1H 4UBDD 1IGTB 1XF5B 3OB0H 2Z4QB 1XGQA 1QOKA 1BCIA 3MAWA 1LJMA 1ZLWK 4FEIA 4XPTL 4ZDHA 4DP9X 2BRQA 4A66A 4XMUA 1EGJH 3SB3A 5E1HB 1QLFB 4Z3EA 2P24A 4MNQE 3BLPX 5E6ID 3D39D 4H8HA 4AEIH 1RLWA 3EJRA 3TO4A 1HXMA 3MREB 3QA3B 4UT9A 4FABL 4JW3A 2DB8A 1X4YA 4PJGF 4OZGB 2AFNA 4JZOB 3I6GA 3FT9A 5E6ZA 2V8MA 2CK0L 2BP5M 2HG5B 3AS3A 3ZTCC 3FFDB 4LARL 1PLGH 2IALA 3N1QC 3BWZA 2D31A 3CQQA 4G9DB 4ECNA 4R4BA 4G1MA 4M6OH 4XNZB 5AL8A 4HJJH 2VE6B 4EMZA 3C2AL 1Z9MA 3KGRA 1IC5H 3RP1A 3FOLB 2VWEE 3DETC 4XNXL 3BFQG 4NZRL 2FWSA 1NDGB 3T3PF 1G9MC 1MIMH 3FTGB 1S6NA 4N85A 5DHYA 2KERA 4WFHE 1E9OA 3KBHE 3TO4D 5HY9A 3MRBB 1JGDB 4TM9A 5KZCD 5BNXD 3H2QA 4J4PD 2ICWJ 3HZVA 5EEWA 2Q0ZX 3QSKB 4PLKD 1DYZA 2BXYA 3O6LL 5MI0C 1JZ5A 2WWNA 4ZUSB 4D9LH 1AOHA 2YRBA 4R2GD 2ZCLH 1AY1L 4TQEH 2H9GA 2EADA 3MODL 3HI1B 4CVXB 2F5BH 1QWUA 3B2XA 2GYSA 3O6KH 4FQ1H 4JANA 2W60A 4MCYA 3HHRB 2A99A 1C12A 4PRAA 3BDYH 4J8RA 4OGZA 5CMAA 3UACA 4LL9A 5A2FA 3MUZ1 1JPGB 4EOWH 1PZ2A 2VW7A 3RUGB 3ZN6A 4XVOA 1CICA 4LEXL 1JNJA 2FLRT 3HCVA 4WEMB 1UT2A 2OV0A 3IYLW 3QUMH 4XC1L 3K80A 2O93L 4NWTL 1MVFA 2DLEA 4YFLF 2XZQL 4HYTB 3QFGA 1U91A 3RL2B 2N0KA 2YD8A 5D93B 2W81C 3D34A 5EU4A 4GSUA 4ZMWA 2E27L 4HX1A 3BAEL 4ZT1A 1I9RL 3CPLB 5KYYA 2J20A 3DROA 3A6CL 4XMZA 4WW1A 3BZFB 1QSZA 2JKWA 3MFFA 3LQAH 4P46C 4RBPK 1JPSL 2VDQH 3I9GH 4X6FA 5DRNA 3ESMA 5CZVH 4YLCA 3IETB 1CICD 1HEZB 5KSAA 5F7FA 3T0WA 2UZPA 2CIKB 4R8WH 5EUKA 3BGMB 5SX4H 4KWUA 1G9HA 1ZVNA 4N2OA 4OFVA 4FXKA 3ARPA 5DRXB 3KPNB 2G3XA 1JDCA 4HKXB 3GZPA 3LYRA 4YAQA 5IHZB 2B4CC 1MELA 5FHBH 1A3ZA 2O6FA 2BWIA 3M86A 2JCWA 1AH1A 4L8SB 3WY4A 3BP6A 4XWGH 4Z7VA 3V4UL 4UOZA 3LKRA 3OJDB 4WIQA 2BSTB 3UAJC 3ZKQD 3AS2A 5B39B 5BVJB 1BLIA 1Z9SA 1TZIA 3PIQA 2GG1A 5D1QA 5KJRH 2GUOA 4NP4H 1BDYA 1DQKA 3L95A 3QIWC 1GAFH 4FQLH 3NEOA 4MYPA 3F7LA 1R75A 1COBA 4R7NB 5HGGS 3ZE1E 2B39A 3UTZB 4MNGA 4AQ8C 3CFEA 3MLYH 3OKOB 2D7TH 3I6KB 4XP1H 1CGTA 3OMZA 2HX7A 1SDDB 3LN5A 1HAWA 2H41A 4XO9A 2VRAA 1QASA 5JHLL 1QI5A 1IAIH 5BW7A 1XGUB 3V4PH 2G2NA 2CO4A 4NN7C 5IZ7A 4ETYA 3GDCA 1J1PH 2VQ1B 4UV4H 3C5ZC 3ZO0A 3MRCA 3SKMA 4G3YL 2CHWA 3UBHA 2YUWA 4ORGA 2H26A 3MUHL 1GZPA 3S98A 4W9FC 4H20L 3GJFK 1E8ZA 4PJHF 1NL0L 1FO0A 5HHME 4UM8A 5F8RC 3UG4A 2HFFA 3VH8A 1XSJA 4KK5D 4OJDH 3EYOB 1IZJA 4UTBH 2P8LA 4GG6E 5E5MA 4BSVA 1TXKA 4XPHL 1RJZA 1MWAL 4F37F 5T1DH 1CLOH 2XQYK 5GGSA 4L3FA 3QPKA 2AAAA 2R1WB 1D6VL 1N5AB 3Q01A 1S7WB 1NMAH 4N8CL 4BFIA 1XO8A 1O7SA 1D5ZB 4PTUB 3ZXAC 1DUZB 3L7FA 1LE5A 5CFHA 1UWXH 1GH7A 2SODB 5IF0B 3JWOH 2LHAA 4HWEH 4P06A 5ISZD 2XICA 4KKCD 4TULL 4YPGB 3OGCA 2I7SA 1KN2H 3BVWA 3TNNB 4J2QA 3G6JA 2IVFC 4WV1B 1CPUA 4CN1A 1OF2A 1E50A 2YO3A 1KB5B 1H8NA 3Q2VA 1G7PB 3BH8B 3ARBA 3Q1EA 5GJTL 3WDJA 4JO3H 4IBLT 3ZYZA 4X6CA 3SE3C 4MHHG 2XI9A 3BPCB 3VWKB 3QZLA 4L4VA 4FKHA 4UT9L 3SE6A 2FSEB 1TYJA 5DZPA 3EOYG 4NNPH 1YQVH 3UTSA 1FAKT 3C60C 2MPAL 1FNSL 4F9LC 3OX8B 1DVZA 3GSQB 4DTGH 2IBZY 2P49B 5D7LB 2HT3C 4FZ8L 4D3CH 4GIAA 2YD7A 4UNIA 5JXAH 4AYFB 3FRUB 4APQD 1TJHH 2AQSA 1E8WA 4J6IA 4OZFG 1J8RA 4D0DB 4FFYH 3UOAB 1PY0A 2E3VA 3ARBD 2R29L 3GZKA 1JYXA 3UROR 1LEKA 4L4VD 3NCBB 5D7KD 2X4OA 2XWCA 4PJXB 3US0A 4P4KA 1FZOA 2Q2LA 2WQXA 5ETUA 4JM2D 3VMPA 2L7JA 3B2VH 5ABZA 2EDDA 1I7ZB 3UTSD 3RYMA 1EFQA 3SBPA 3BLKA 1EA9C 4WFFD 2BDNH 4URTB 3REWA 1RL1A 1SQMA 1CXHA 5SWQA 3L1OL 3FUHA 5C0RH 4BEIA 4OCWL 4U1HA 3SE8L 2Y07H 4PI0A 4OD1L 3QI9A 4KJQC 1IKFL 5HJ3A 2IH8A 4K8RH 4KRPD 1RUQH 3DI3B 3MRPB 3WFDL 2Y06L 2WKGA 4YHOL 3SPVA 1A64A 1ZANH 1GMEA 4P05A 3NBNA 4LCYB 3VTTA 1YNLL 1R3KB 4PY8I 2AK4B 1E7UA 4TVPD 4XZUB 3HR6A 3VSTA 1KB9K 1J0JA 3LPPA 1ZHLA 5EZLA 4WCYH 4AQAA 1A1NA 4OLZL 4P4KD 5L2JB 2BM3A 1K6QH 3FU8A 3JVGC 1JFHA 4R9HA 3S7GA 5FUOL 5HDBE 1NGQH 1N0LA 4ODXB 3GPSA 2BNRE 4KI5D 3NIDF 5DS2A 1V7NH 1I1AD 1EAPB 3L2NA 3LZOA 1BZ9A 5I6LA 4U1JB 4K5MA 4NAQA 4Z9KB 4PMEA 5CF3A 4JRXE 5I19H 3GHBH 2MJWA 2GJJA 3W9DA 3QI9D 2KLRA 1LQBC 3HRZB 1JGUH 5ACLA 5ALBH 4AGOA 3L8QA 3D18A 5JZ7D 1F41A 4GRMB 3V2AR 4GI6A 3ULUH 4KDTA 4JBSA 3KPLA 5CP7B 4Y5YA 3CFTA 5I5IA 4KY1H 1LO0L 3RVXD 1D9KA 5LN8A 2PR9A 4H4NA 4OH2A 4UILH 2JTYA 4F7TA 4YXLL 4HW6A 2AQQA 3VNYA 1CFSB 1E28A 3VD7A 1DJIA 3AWGA 5ICZB 1A4KB 1PZAA 3PAYA 3I6SA 4MNQA 4UT7H 1MFBH 5JIIA 1QVOA 5HYQA 1KEGL 4NNXB 1R17A 2MQ3A 4Q52A 2ITCB 1SRDA 2XJKA 3EOAA 2IQAB 4HJIA 2QVTA 2L3BA 4FQIL 4DQOL 3IDJA 3VXMA 3SE9H 5IHBA 1YEGL 2JJWA 2YIHA 3IJ8A 4HUMB 4B9IA 1AD9B 1FFNA 1XB6A 1XH2A 4OGAD 3X3FL 1I1YA 1D9KD 4QXUH 4HOZA 2VMJA 3QFDA 3DDGA 3Q48A 3N41B 3EJYD 3MNZA 5DHVB 4JPVH 5A2BA 2QVIA 1OTSD 5FFOA 4ZX3A 2A4EA 4DNLA 1ETZA 1E4KC 1XT5A 3TV8A 3QJXA 3IT8D 4MNQD 1DJGA 2AXFB 5KSBB 4Y9BA 1INQA 4IRJD 4YBQC 1XXDC 4J1UB 4YDJB 2YK1L 3GXIA 3A6BL 1VF5C 1Y0LB 2J1ZA 5LBSL 4X4YA 4KNQA 3QPQD 1J9CT 2I24N 2YLKA 1VHPA 1G9NC 5H37A 1KYAA 2ZWSA 1TMCB 4MB1A 4U1NB 2YMOA 1LLAA 3OXRA 5C0NC 1OAZH 5CGMA 4XB3A 3WS6C 4OCRH 2LLLA 4IEFB 1M7IA 1AIFA 5E99L 1HXKA 1RV6X 4OW6A 1OARH 3JTBA 3ZKND 1M3IA 2ZUQC 3PJSB 1ZV9A 1RI8A 1D2PA 1MJ8L 2WVVB 3TN0C 4DW2L 1NGXA 1B0GB 4DERA 4HKJA 4KTGA 4HCFA 3T65B 2X1XR 2ZQKA 3AAZB 2QL1A 4P3WA 1NAKH 3FF8A 2H7WA 4WFHD 3FAXA 1X7QA 4OF3A 3ZZ1A 4AIZA 4DK5A 1ZE3H 5CHNA 4XN9A 1UASA 4BGLA 4KVNL 5C7XL 4FLQA 3RX9A 3F3HA 5FECB 1DEDA 4HMCA 1KPRA 1B4TA 3GJEB 1DBKL 3BN3B 3EJCA 1RIHH 4PWJA 2ENPA 4X83A 1T4KA 2XX1A 3Q2LA 3N04A 3WFCH 3HC2A 4NRZA 3Q1SH 1R0AL 3S3PA 1VFUA 4P5KB 1EZVY 3ZT7A 4DEWA 5C0FB 2D8KA 1EEQA 4H8WL 1A6WL 4LSQL 4OCSL 2J4WL 1WK0A 4ERSL 2B1AH 4JGMA 4U4IA 5I30L 4NJAH 2EYTB 3VFUB 2WLKA 3ECUA 1HKFA 3BVNA 1KDIA 4NQUA 2CDEA 4U6XA 1JDAA 3BESR 1OWRM 1G0DA 2NY3B 2D03L 1F2QA 3UC0H 4YHIB 1DZBA 4NNYB 4XRCA 1WA2X 1WS8A 1LDPH 3VWJB 5HYEA 3MV8A 2GITA 2WCSA 1WITA 2YPLE 1HHJA 3GMRB 1GW0A 3KCPA 3Q6FB 4KV5E 4QYOB 5T3ZL 1O7DC 3E9UA 4ZFZA 2OSXA 4TKWA 4DVRL 3P9MA 4M4RA 2CR6A 2FB4L 2XJLA 4A2LA 5FO8A 5JXEC 3KLHC 3OJ2C 2ZKHL 4OQTA 3MJ9H 3MRIB 4I48B 3CDCA 4OLWL 3WTTA 3QUXA 2MMXA 3WBDA 3D0LB 2XCMC 2XYCA 5ESAB 1UXMA 4Y7OC 3QULB 1URLA 3BAXA 1CDJA 5EC1A 1KJVB 4HSQA 1A3QA 4M3JA 4YSTA 2C1PA 2N1TE 1DJZA 1RULH 2FIKB 3CBRA 3HLAB 4QTFA 3OVUB 2HRPH 1W0WA 1ZDQA 4X80L 2X7LA 4I3RL 1L9PA 2Z35B 5G2NA 4KY2A 2XXGA 3NCJH 1YC7A 3V0FA 5T1KD 1WYJA 2VTFA 2WWMD 1HJBC 3HMXL 2OJ1A 5AALA 2RTTA 3CN2A 3QUXD 5AKVA 4S2SA 3OHXA 4PREA 3DO7A 2BOCB 1VFBA 3MA7B 4PQXA 4QXTB 5C0AE 3OZ9H 2A9NH 2CLVB 3Q6GH 3LS4L 1CR9L 3IDMB 4Z5RA 4MAYA 2FQGA 2G75B 1CT8A 1KJ2H 4PRIB 4Y8AA 1BWMA 4GRWF 3CNKA 5D96B 1RZ8A 5FB8A 1MSPA 3FAWA 3HC4L 3N1FC 1BXXA 4BIKA 1INEL 1R6VA 2H2SD 2XNAA 3DKHA 4IU3A 5FYKH 1KULA 1KCRL 4ESKA 2F8VA 5F7YC 3APDA 5E2WH 5HD8D 5JW3L 2XWTA 4Z7UB 1XGZA 2BVUA 4BH8B 5I8CA 4LOUD 3RTQD 2V3DA 1IC7L 5DQJB 2JELH 5CJBA 2YD2A 3X12B 3C8HA 1CL7L 4PTTB 2NY6D 4YNYA 1MI5E 3SZKC 4E0RB 3CVCA 1XGRB 4MAYD 1L3NA 3G08B 2B08A 4ANVA 1R3IH 2A9AA 3J2PA 4Q89A 1YO4A 4IBWA 3GZQA 4GIPD 4KKQA 4MD5A 3RWHA 5HHMD 3VDCA 5IREA 3NFSL 4MJ2A 3HI6H 3L3IA 4PB9L 1JF1A 3V79C 1RUMH 1QBML 1MAKA 1XCQB 3V6ZA 3B5TA 3BEVA 4PJ5A 4Y2DA 4HAKA 2PW1B 3O3DA 5DEFA 1Y7VA 3OLGA 3WO3B 4XXDA 5LDSA 3IDGB 4OJEH 5C9JB 1BFTA 2UZIH 4G5ZL 1UD3A 4GEIA 2MCPL 2EUWA 3DECA 3BP4A 4X4ZA 3VXNA 2H47C 3IJHA 3UPCA 4PP2A 3K7UA 4FDWA 2VRQA 5JPNC 4TRPH 4TSBL 4FQHA 4LLUA 3IDYB 3C5SB 1URZA 4ZFOB 1KC5H 2ZD0A 3OF6D 3U7AA 2Z92B 3ZDYB 4PCKA 5ID1A 3MTXA 32C2B 4WWKC 3RNKA 1A7PL 2R8SL 4FJ6A 2R23B 4PB0L 2DBLH 4Z0BL 3VM7A 3P40A 4LOVA 4NZUH 3SDXA 5A7BA 5J9PB 1BG1A 2YJQA 3OQRA 4FFZH 1HNGA 2R9HC 2YD9A 1FC2D 5HJDA 4CILA 5D2NE 4PJBE 3HFFA 4YDZA 5TDPB 3BP5B 3LCYA 1QUNB 2G9KA 4UTAA 5CGYD 5J6HB 5EOCJ 2CNYA 1IC0A 3K6SA 3RJOA 3PU7A 4BXVA 4F8LA 2K7PA 2WGNB 4FL4C 2WCGA 2EP6A 2NNCA 4N2IA 3STBA 2BSCA 3IE9A 4OLUL 1VFMA 3OKEA 4N3UA 5SX4I 3ZW3A 1PY4A 2H1XA 1KTDA 3DJ9A 1A6PA 4JY5H 3Q8AA 3BP7A 4K23H 2DTML 3P0GB 2BW4A 3SDAD 5IOPA 5KUMA 3E7JA 3RZCB 5IW6B 2XQ0A 2YD5A 5IW3A 4NYLA 2V9TA 3L3OA 3CZUB 4NM8L 5CSZB 1N18A 2VDLH 1FFOA 2HVBA 3HE6B 5DK0B 4HQQL 3AZUA 4BQ9A 1KPUA 5F6IB 1LO5A 1BMWA 3HAEG 4MA1B 3FZUC 3MV7E 4XP5L 1KGWA 3QEUA 4KFZC 2V2WB 3K5RA 5LWYH 3CVHA 2FR4A 1NFDF 2BNRA 3BWUC 1TCRA 3HRPA 4PRNB 4PRDA 4RMRA 4U6HB 1AGFB 1ILSA 1AYRA 1JK8A 1KG0B 3DLQR 1VPOH 5C09A 4ACPA 5HP5A 3O6FB 2PMZA 5HI5D 3GEWB 2BP0B 1YPZB 4JRXA 2QPDB 3IJYA 3ES6A 1ZAGA 4RGMC 3K5SA 4M48H 5HVHC 4YDVB 5IHUH 4PVBA 1U8LB 1D5RA 3OKNB 4V1DB 2LABA 5T5NG 3T71A 2E75C 2FATH 5D1XC 6FABH 4Q2ZA 5DJCB 4N5ED 1XGYH 2PP7A 3V10A 5BCAA 4KZ0A 1RZJL 2RJMA 2IXQB 3B2UD 4PJEA 2C4XA 1TTCA 2RD0A 2PYEE 1M1XB 1OP3H 5EU7C 2R0WL 4BFEA 2IWFA 2JB5H 2BNRD 3JV6A 4KHXH 3RVUC 4Q97A 5EUOF 3PF2A 5TH2B 5C09D 5IHUL 3LXAA 2DQGH 4HCIA 1ZT4A 1OTUC 1GZHC 1JZGA 4JRXD 4K55A 3E6HA 1AE6H 1XR9B 1KV7A 1WDAA 5TDOB 2O5ZH 5ERWB 3GBDA 3BKYH 4XNUH 2ZJSL 1XAUA 1QBAA 2OA9A 4D2NA 3QUZB 6PAZA 3VJ6B 4AH2A 3O4OB 2KI6A 4G70B 5CAYB 1U8PA 2CGYA 4WWPA 1CDBA 3BQUB 1XMEB 4MJ4A 3F6LA 5IFJB 2J72A 2EUXA 4X6DF 3LKOA 2DWEA 5AAMC 2EDRA 3FBQA 1J0ZA 1W72B 3CHSA 3LMJH 4J6RH 5FK9A 4U1SA 2XVKA 4JM2F 3ZHLA 5HDQH 2QBWA 4OCYL 1E9PA 2F53B 1Q1PA 4UDUB 2PCPA 3PYCA 2ZP9A 2WC7A 4WNSA 3U46A 4AM0A 2OK0H 1Q9OA 5DA4A 1KCWA 1T0NB 4P59H 4OFQA 5I16B 1IFHL 3AG2B 1HL5A 5PCYA 2XTSA 3RWEA 2UY6A 5DYOA 1ZGLB 2ZG3A 2B14A 1OOWA 3NT0A 5I1KH 1UKQA 3WNJA 2X6VA 1KYUA 3GHEL 3FKUS 3L2LA 4QHUB 4ZMVA 3DUUA 4N6QA 1TUPA 4Z95H 2HLFC 1C5CH 2LQRA 4ISVB 3X17A 2OZ4H 4F27A 4M1GL 3FO9B 1JZJA 5A6MA 2V5TA 3L9RB 5EEXA 1LYQA 3LQAC 4BD4A 4J3OG 3CVIL 4XX1G 2EDHA 5A16B 4TTGA 3LH2L 4M5YH 5E9NA 5FC9A 1RIVH 4AWJC 4EPSA 1FGVH 2G3NA 3CSYA 5T5FA 1F4YL 3CFDB 1HC1A 1JG9A 2WQVA 3QQ3A 2FQEA 5I1HH 3P0YH 1HFUA 4FA7B 4Z7OB 1SN2A 2Z34A 2GT9B 4FHKA 1PLCA 3KM1A 1KTLA 2BVPA 2H0FA 4JHAH 1KEML 4XGZB 4PJ8B 5C7ZA 1PG7X 5C0DB 1AR1C 1DQTA 1L7IL 2X1WL 3L6FA 1GOFA 5D8JL 5BQ7A 1JHKH 2DQEH 1A21A 5I1CL 3DDFA 5H35B 4OM0H 3MOBL 2ICES 3JWNH 5K9QG 1BJMA 5AYTA 5LGKA 2K1MA 3D1MC 1MRFL 4G8GE 1IB5A 4MYWB 3WIHH 1AQMA 3I74A 3TXAA 1Z3RA 4LLMB 5B3SB 5I1GH 2Y24A 4UQCA 2YPLA 1NC2D 1KCSL 5K9JL 1F58H 2OP4L 2K9UA 3KXFB 4F8OA 4ELKB 2J8UE 3DETD 3KBEA 4QRPE 4Q0XL 1QRKA 1MCOH 2FO1A 1M7UA 4GYBA 4ZMAT 4XMPH 3X14B 5IBLC 4RRPM 3HZMA 5HGDB 3QQ4A 2WXHA 1KBVA 2ORBL 2DDQL 5C3IA 3DJTA 1KOAA 3PDOB 4AQ1B 1YJDH 3VXTB 4FHBD 3GSNH 2YPLD 5B8CC 4OLVL 4W68A 3CN1A 4WK4B 1BJ1H 3E6FA 4X5LA 2V5RA 2X12A 4F8NA 3LY6A 3DGCR 4OV5A 1MJJA 4P46A 4NCC2 2ED9A 4JCLA 2WV3A 2NUPB 4M1DH 3BPOB 3BPNB 3QIUB 3N42B 3PP3K 5C0AA 3JWOC 5DR5L 1OL0A 5AWNH 2Q2EB 4XWOC 5AOJA 4OI9A 4G8IA 4B9GA 3QDGA 1O7DE 2GJ6A 4E9RA 2QKIB 4BUHA 1TVBB 2D7MA 5FHAH 4BUQA 3IXAA 3ARUA 3GMLB 2P8PB 5SWZB 3SDDC 4OZGE 2XQYA 4GEJA 1FFRA 1MCPH 1WFIA 5HHQB 5TQ2H 5BS0A 2OMYB 2NY4B 1NCOA 5IIEA 5EV7A 4P46D 1EZLA 2YD6A 4N2GA 1DQJA 2O5NA 2DI9A 3UAJA 4NENA 2Q1EA 3FQWA 3MLZH 5FYJE 1MI5A 5C0AD 1LK2A 3W57A 3IWUA 4WU5A 3QIWA 2C3VB 1HI6A 1IBHA 4L2LA 4HC1A 1SBSL 1UADC 2GJ6D 5B22A 1NZRA 4AQ8A 1I7TA 4Z7NE 2COVD 4NERA 3FT4A 3CCHB 1D6EB 2JK5A 3BKJL 2V9RA 3MI6A 4Z0XB 1I7RA 4OBRA 3GLDA 4QXGL 2Q6WB 1F4XL 3GUTB 1Y18B 3ASNB 5KVDE 4B0MB 4BWWA 5BS0D 4LK4A 1CD9B 2VXQL 3C5ZA 4OIFA 3VM5A 1I8IB 1CTNA 4GSXA 3VAEA 3JSSA 2ZXDA 4MX7B 3UAJD 7PAZA 2O1AA 5JUEH 2MOVA 1BQHA 4GO9A 2RFXB 4WY7H 4AV4A 1UWXK 1MI5D 3RWDB 4LLAA 5E4OA 2EQDA 2VLLB 3QIWD 3ZL4L 2IPTH 1TQBC 4M7LT 1ORSB 3OBAA 3EFOA 3STZB 1JV5A 4MBRA 4G71B 4K8RC 4F5CE 3JTSA 4ODTL 3ZDXF 1IX2A 1JXJA 3DX8B 1BVKA 1RUPH 1UWFA 3OKMB 2QGEA 1UCBL 3QJZA 1T1WB 5CIPA 3TBSB 2QADC 4PJCF 2X2IA 2HJKB 4NQVA 2WNKA 1GKOA 3H9YA 4X5WA 4GW5A 1MCQA 5ANHA 4GAAA 4PJBA 1GCYA 4OCLC 1U8NA 1A7OH 4RFNB 4YK4B 5KVFH 1BIHA 2WVUA 3CFBA 4DPCX 4EE2A 4EBQL 3ZMNA 1KBWA 5I8KH 4RMTA 3KVPA 3D4YA 1ADWA 1OPGH 4MDIA 3QZOA 5AVSB 4NC2B 2Z9TA 3FOMA 4HDIB 4DZBA 4J3XA 3B7RL 2XZAH 3SE3A 4TYUA 4XPAH 4PEEA 4P5MA 2FJGA 1E0OB 2XFXB 4AC2A 2C8NA 3TZVB 4RAUA 3ULUC 5FO7A 1JUFB 3QIBC 2GK0B 3C60A 4A2FA 2WXLA 1HOCA 4F9LA 5DMYA 1KGJA 2WXNA 1OF0A 5GS3A 4AJ0A 3MNMA 2VL5B 2NSMA 5B4MC 2E7MA 3O6ML 3V9FA 2XZCH 3ATDA 4FG0A 3WHE0 4L1DA 4W9ZA 1SYSB 2VKWA 2L4OA 1I3UA 2DW5A 2IPKB 4CMMA 2L7UA 4KXZH 1L5GA 3LXCA 4Z7QB 5GGSY 1M7DB 1TJIH 2ITEA 1MNUL 5K9KB 2DRUA 3VQLA 2HKHL 5K39A 3V7MA 3MQIA 1XSOA 4HT1L 1WZMA 1DVFB 3C60D 4NBXB 1MVUB 1KV3A 2COQA 2YPKB 2WAQA 5EWIH 3GS4A 1CLYL 3MV7D 2HT3D 1Y6KR 4GG6F 1IKNC 4KRMB 2X0WA 1TKWA 3NVQA 1FL6B 1TQCC 4IDJH 2NYZA 2Y5EA 2DLFL 4LSRH 2YGQA 3QDME 1J8HB 1NCBL 4N9GA 1AZCA 4BXSV 3I02A 2QSCH 2Z91B 2XWJB 4X0KB 4R83A 3EHBB 4QOKB 1KIQA 4ZXBC 4PYHA 1F4WL 3OKLA 4MGXA 4OZIA 1IGYB 1E67A 1EXGA 3ARSA 3JVGA 3DTXA 5HGHB 4TMPA 3F05A 2YAFA 4Q7DA 1S78C 2CO7B 2Z1PA 4PJ9C 2O5XL 2W92A 1NJ9B 1YDPA 2NYYD 4I85A 3OKDA 1Q72L 1AG0A 4W93A 3CZFA 3K6FA 4X5RA 1G6RA 4P4RB 4KJQD 4ODUA 2AEWA 4PS4L 5E70A 2FLBT 1PKQB 3KPRE 2J8OA 1UT9A 1T5WB 4NO3B 5TE4H 4MJIB 5D1XE 3B4NA 1LWRA 3IJSA 4G6AC 4KZEH 2OXHA 4XO4A 3TCXA 4I77L 3B9KC 5JIKA 1T1XA 3S5ZA 3KR3H 1ZE3C 4D8PB 4HUNB 1OD9A 2DQJL 4U6VL 3O81A 1HXYA 4KTYA 3KDMA 3RJDA 1JHTB 2HWZH 4FNRA 3WJMB 4LVOC 5KVEH 5EU7E 3VFPA 2BNQB 3VCLA 3CZKA 2P45B 4QHNB 4JN2B 5J56B 2FCBA 2XBTA 1A6TA 3QG6A 3C8KA 3WUZA 3UCRA 1HQRA 1H0DB 1MRDH 1NCDH 4CNIB 3LKQB 1A9VA 3WEAA 3H4FA 4QHMB 1FCCA 2YAOA 3FSVA 3HHMA 3WDHA 1M9WA 5I2IA 2ICWA 1CLZL 3GI9L 2BSSA 3AW5A 4HMEA 4P9ML 1W8NA 1IAKA 5B1KA 3FO1B 3K2UL 4XOBA 3BXNA 1JHLH 1EANA 4M8QA 4NM4H 2G4EA 1XIWD 1GGIL 5IT2H 1WC7B 4JPWL 3DOSA 4JCMA 2AXJA 2A4CA 5CWSB 2K0RA 3WEXA 2ZXCA 4GW4B 2ED7A 1USZA 1S3KH 2X2HA 3HG5A 2NT1A 5C07E 5ITFA 2A6KA 2GSMB 2WQWA 2YWZA 5I18L 3MYZA 2ICEB 2Z8VC 4OIIL 4OLXH 3UTTE 2PTTB 1OALA 2DKUA 3GBLA 1E4KA 4MJ6B 1UUNA 2XN9B 1P84K 3T4YB 3S35H 3Q7JA 4POYA 1A5FL 4JO4H 1AC0A 2IBGA 3CC5A 4WFEE 3GC3A 5DEGA 2BPBA 5F89B 3L7EB 4L0PB 1BLNB 3GMNA 2CKBA 4GY4A 4PJFE 2XSKA 2X4QA 4W9GC 2VMCA 4GSRA 4RMWA 5AL0A 3C12A 3WS6A 3S37L 5DVOA 4I4WB 4DAGH 5FV2A 4HIJA 4NQEB 2G60L 2AK4E 3IEAA 1FV1B 1XF2B 3BAWA 3VFVB 4R4FL 2VDMH 3QAQA 4KK9C 4ODHH 1S7TB 3L9BA 1LE9A 5IHLB 4PCYA 5F88B 4PRHE 3UH8A 2MQ0A 1VGEL 3HG0A 2HLAA 5GSVB 3MJ7A 3MLUH 4E9XA 1S7XB 1F97A 1MCWW 1TETH 1F90H 3KYOB 3TA3C 2A2QT 4BSWB 2BY0A 3F00A 4Y4KB 3ZT6A 4QI3A 2K78A 1G0XA 1I3RB 3ET9F 3IDIB 2W0KA 5KYUA 2WXJA 4G8GD 3RKDC 1Z1WA 5LNGA 3DBSA 1IEHA 4I7ZC 3DOIA 1KB9J 4R0LC 5C0ND 1XF1A 3O2DL 3D51A 3PWPB 4ANKA 3MRFB 1AZNA 3HZ3A 3B9VA 1HL8A 3NZHL 1CBJA 5IVXB 3TA4D 1CXFA 4ZMQA 3FQYA 3H8NA 3QDHA 1P1ZB 3GIVA 2GTZA 5DD3H 3HE7B 4MMZB 3TN0D 2WWKT 4ZNCD 4JPKL 8FABA 5DJAB 5F7WC 2OXGB 4TQHA 3FW6A 1AQKL 5GRUL 3IJEA 5C6PB 3MRRA 1L0XA 1IQDB 4M6NL 4JG9A 1P6WA 2B1HH 3QBTB 5HVFB 1F8TH 3HBPA 3MGOB 1UVQA 1T22B 1BGXH 2PP9A 4GP5B 2X88A 5DMIH 5CCKL 3SQOL 2FX9H 5E8DH 5ABDE 1CD0A 2DWDA 3GNMH 4J7RA 4ILDA 3VH8G 2C9AA 2WXFA 2XXMB 5E08L 4OZFB 2AV1A 4JPIB 1MQ8A 4JB9H 2EYRA 4FMFA 4M93C 3SQBA 3TBWB 2OQJA 3EOTH 3VB9A 3QYCA 5L9DH 1RMFL 4Y1SA 2C9RA 3LXUX 1ITCA 2ZUSA 3EG9A 1C7SA 2YMXL 3IF1A 3G9VA 4F7CA 1QHPA 5EIIA 1NAMH 1ZTMA 2ZYHA 3DV4A 3IMTA 1CD1B 1BX2B 5HVGB 2DJSA 4LU5H 3D2UB 3V4VH 5JXED 1RZKL 3KLHD 4KAQH 2BVQA 2PW2A 4LHJB 2BFGA 1WCBB 2L7QA 4CMHB 1IBGH 4RWHA 5MERB 5JORA 4N90E 3H9HB 4XAWH 2VCOA 2VDPH 4XBGB 4LLWB 1XCTA 4WUUE 1P4IL 4XBMA 1FFPA 1WEJH 5DJXB 4HD5A 4MDRA 1ZPUA 3P3RA 4AEEA 3T8VA 4HWBL 1DN2A 3QHZH 2XQBH 5A6LA 4QRRA 4YXKL 4Y7MA 3GMQB 1D5BB 4LXFA 5I1EH 5DJZB 3ZHKA 3BCFA 3QRGL 1NANI 4NO0B 3TO2B 2GSIB 5KSUA 1I3GL 3VGFA 5D2LA 1G6RL 3GXDA 1EFXB 4F5CA 1GJIA 1KB5H 1VIWA 2EEXA 2VXTL 1GSKA 3VXOA 2WANA 1N26A 2PXYC 4UV7L 5ECJE 2A7BA 2FJFA 3D6GA 1S7QB 1KPVB 5DZ9A 3ISRA 4DP8X 2DYRB 3RVVD 1JBJA 3CAFA 1I7UA 3RWGA 2X6UA 4X9FA 3HC0A 5MP6H 2WP3O 4NRXB 4XMLH 3U0WL 1EJOL 5C0CB 4TNWK 3A3YB 4LCIL 4A6YB 1F3DH 4RAVA 4RISH 4DP7X 2QGBA 1NC4B 1PF3A 3QFJE 4JN1L 1XBRA 2AVFA 1SF3A 1SLUA 3GSVA 3VFSA 4M7LL 2H3NA 1UXSB 2JV6A 4F7KA 1W0VB 1BBDH 3MJGX 3ROOA 1FJ1A 5BMFH 2OMVB 3SGEI 3H2WA 2EEAA 3SY0A 2LU7A 4M62L 4O2EA 1S9VA 1QRNB 4E9WA 1JWMA 2AQRA 4HD9A 1RK1B 1MFDL 1UOWA 5JPNA 1RHHA 1PS3A 1WFUA 5DC0A 5CINL 2I07A 2R0LH 4G9FB 1J9RA 4I2XB 4NC1C 1AZBA 2UZYA 3MACH 3S3BB 1UM6H 3FB7B 4WWKA 3MRMB 3ARGB 4UQAA 4C56A 1K5NA 3RY6C 1GW6A 1SOXA 5HHNA 1TQUA 3TCLB 4HUXA 3BWAA 3LDBC 4HVBA 3ARRA 3D05A 4QHLA 1H19A 3FQ4A 4Y5XB 4G72B 5CLWA 2CKBL 4R3SA 4UOJA 1UOKA 1OB1A 3PHQB 1I9JL 4CSTA 3F12A 1JZ4A 1FSKB 4XO3A 1SOQA 3NZUA 3QEQA 4M6MH 1WFJA 1T6BX 5IOKA 5AAWC 2F8IA 2R59A 3QDMA 4TNVK 3GSXB 4APXB 5C6TL 5FOJA 1A22B 4BZ2A 4C56D 3ULUE 2HRLA 5LXVA 3M1BB 4PRIE 3SGDH 2QQQA 4K94L 5KBPA 5T33H 5E1IA 5DSCA 3T2LA 4XC3L 1A9EB 2R9HD 3S34L 4FQJL 5FO9A 4HSCX 2VSMB 2YAHA 1EMTL 5E6RB 4MNHB 1A8JH 2IG2H 1SVCP 4WTXA 1QLEL 3HUJE 4JL2A 1EGJA 5D5MF 2EEBA 1OP3K 4ZFFA 4XN7A 2F6AA 4XNYL 2GEQA 1X9QA 1T7YA 1M53A 4R5VA 4WI3A 5ID0A 2YQGA 4HEPA 4WDIA 2WIIB 3UTOA 3KPRA 3QJHB 3QDMD 3BMWA 2QV4A 3X11A 3ME0A 1EHKB 5D1XA 2OMWA 3IFPB 4HHAB 3II3A 3O9WC 2NY1C 4CVZA 1G7JB 5EZOH 2DJMA 1FYTE 2VUOA 1ZOXA 4HU8A 4M7KH 1YHPA 4JFYA 1NFIB 2OM5A 5CEXA 1AKJD 3C6EA 4B5ZA 4P9HL 1BQLL 1L9TA 2JI2A 3MA9L 3LOWA 2AZAA 2GY7B 5DHVH 3U4BH 4BYHA 1XH3A 3AITA 3DVNA 3NFNB 3WJLC 2AQNA 3O2VL 3PWLA 4QCIA 4Z3IA 1AQDB 5DVKA 5C08E 3JWNC 4UT6H 1UG9A 1DBBH 3KPRD 3H3PH 4ZNEE 1DEEB 3RFRA 1T1YB 3MCLH 2HVKA 5D1XD 5DUJA 4KOCA 5DWUH 5FYJL 3X13B 5DRWB 2XVLA 1U8HB 2ZG2A 5F7MC 4TSCL 5JO5A 5GGVY 5IVOA 5HGBA 2V17H 5C07A 4F7EB 5KBKA 4JR9L 3RVUD 1AMXA 1QYGH 5AAMA 5C0EA 3GB7B 3MRHA 5D4HA 4Y0GA 3UTTA 1DLFL 5D6CA 5I1JH 3KPMB 4C8XA 5DXWA 2WBWB 1OTUD 4HG4K 4F2MA 3OR7A 1LDSA 1J0KA 3FB6A 3WY1A 4DEUA 4HXAL 4MD4A 2EKSB 3QUMA 2Y5TB 2CBMA 4MJHA 1DQLL 3WUWG 1TPXB 3UEQA 2G2RB 4GMTL 2GIXA 2DMCA 5T1MB 3F8UB 1YJDC 4PJFA 2NLJB 3UZQB 3J8F7 3CSFA 3PABA 3I75A 1OVZA 4EQ3A 5I6XB 4R97C 2AEQH 3NZSA 1PZ5A 5INDA 2ZAGA 4KXCA 4BE5A 1C9SA 3E3QE 5C1MB 2YEQA 1BQKA 5C07D 3OJVC 5IP4A 1OP5H 4E42B 1OAUH 4YXHL 1UHVA 2Z31B 4JMXA 5D7IB 4KX9A 5FGCB 5GS1C 3T4AC 3UTTD 3V0WL 4NQSA 4DSYA 3L3GA 3O2WL 4K3DH 4ZYKA 3HB3C 3CD4A 4PRHA 4DWHA 3AU0A 4OLYL 3GBEA 3A22A 4O5LH 3VRIA 2V3FA 2FHCA 2CLRB 3QT2A 4WFED 3VD5A 1YPZE 1WHPA 3TBBA 3LRMA 1T21B 1NGPH 2VLJE 3FU9A 5BRZB 5I8OL 3C09B 3FB5A 4LQFL 3HTLX 1KLGA 3D8MA 4ABWA 5KAQF 1YCSA 1DSFL 2PUQT 1S7RB 1QSEE 3UGEA 1NCHA 3FN3A 3PHSA 3QJRB 4P5TC 1WFMA 2AK4D 3IJ9A 1NICA 1P53A 2HLFD 3A47A 1NUDA 4S0HA 2QSQA 3BEWB 3DYMA 2NY0B 1LMKA 3ZQ9A 3C8DA 4Z7IA 4BWUA 4JLRB 4PRHD 3O41A 3C6SB 2X9ZA 2NCMA 4K3JL 2B2XL 3IAQA 4YHKL 5EB9A 4FG6D 4G6FD 1FZKB 5DDHB 1RLBA 2XN0A 4ZUUA 2JKNA 3HNSH 1S9WA 5FGBC 1CFNB 1NBYA 2ADGA 2VN7A 5DD1L 5DD6B 3PP4L 5CLZA 5KBNC 1AR1D 3MRNA 3V4PA 1TEGA 4NWUH 4FQQA 2JB6B 4TVUA 3RB7A 2J5WA 5AG9A 5EEZA 3SPHA 3QAZB 2WQAA 5BQDA 2EC9U 4EZLA 3NRQA 1JCVA 4PR5B 4NO5A 4I88A 4Y2NA 1R5VB 3TONA 1AOZA 2ZOKA 2XG5B 3BAYA 5IMKB 4UQ3A 3O3EA 1ADQH 4U1GC 4E9QA 4PD4K 4GLRH 1WZKA 5DEZA 4LFHD 5B8CA 2VITB 3IJ7A 4QGTA 4MAUH 1OCRB 5IR1B 1UQSB 4UTBA 2VN3A 2YQ3A 3HZKA 2RAMA 1P4BL 1S7VB 1HILA 4G5AA 5CUSL 3S48A 5E56A 2XTJC 4ICWA 3MUY1 5JTWA 5MEPB 2ZUVA 3O11B 4IMLB 1G6VK 4WUUA 5AKTA 3B8YA 4FQXC 2GJZB 3ALPA 4L1BA 3GGWB 4LKCB 3I2CH 4H1LG 3MLSL 5IBLD 2N4IA 3QDJA 2RB8A 1CC3A 2EE0A 1YNTA 4G43B 4S1QH 4HWZA 3HAEB 3PWJB 3FCBA 5IEHB 2P26A 1FZJA 1OY3B 4IS6B 4NT6B 2YC1A 3SDDA 3FN9A 3UPAA 1WO2A 2FZ3A 1D5MB 1BFVH 4KX8A 4AEIL 3C2SA 4OF5A 1IL1B 2AC0A 1RUAL 2VO5A 4N0UA 4YGVB 3QCVL 1ZLSH 3VXUB 2SEBB 1WIOA 4X7TA 4NI6A 4N90D 4M7ZC 1W2KT 2EIMB 3PQYB 4L1TA 2XWEA 4Z3FA 4WUUD 4JREC 3M8OH 5L6YH 3GXMA 2EIZB 3HG1B 1XCXA 1LD9B 3L3KB 4KDWA 3TEXA 1TMQA 3CH1B 5CXPA 5D9SA 5E00A 5EU6A 3ZTNH 2O5YH 4H26A 4XWOD 3MMEA 1L9RA 1R3LB 4AT6A 5JW4M 5ACMA 4XVTL 1YEHH 4NLHA 1RK7A 1IC5L 2J8UF 4LO9A 1JZ7A 2D9CA 2R2EB 3RWCB 4FFYA 2HX8A 3QFJA 3SDDD 4B27A 1MIML 2JKSA 5MENB 1AI1H 1TQTA 2ZF8A 5IK3B 1I9IH 3F65A 3GMMB 4PCTA 5E8OB 1T5XA 4LVNB 1J7VR 1GIGH 1E6JH 1U3YA 3TVMB 1G0YR 4F2EA 4R7XA 3GS7A 1MIEL 4D9LL 3QARA 1U8IA 4A1RA 4U2YA 2ZCLL 3ELQA 1FVCA 1X5FA 3H7LA 5EU6D 3V6FB 4PRPB 5IB2B 3WTSA 5IJKC 2C1OB 2ZCKL 3O6KL 4FQ1L 4RA0C 4HUWA 4D9QE 2A6IB 3ZE0E 4CC1A 1T20A 1SVZA 4Y5VB 3LRLA 3BDYL 4JRYB 4BQ6A 3JQOB 3QFJD 3ETSA 4FJYA 3EO1A 4OBSA 1HZHL 3HN5A 3ZLQC 1XL6A 1HH9B 3L3DA 1DBAL 2Y72A 4F57L 1B0RA 1OCWH 3D0AA 3QUML 4PLJC 2YXMA 2NQCA 3ZKSD 3EGSA 1LP9B 3WNPA 6TAAA 2YGPA 4OZGF 1RP8A 1A3LL 1XEDA 4JVUA 3BUPA 3UJTH 1OT1A 2RIKA 4ONFL 3PNRB 3FRPA 2IJ0C 2G0LA 3UERA 4ENZA 1GYAA 1GS7A 3IRCA 4BV1A 2DS4A 1O9WA 4CW1A 3T6XA 2Y25A 3EW3B 5JNYA 4K8RD 1K9TA 3LQAL 4CDGC 3RAJL 1JXGA 3IK2A 2E5EA 2R0ZH 3NDYE 3WE1A 5CZVL 1EZUA 1NEZA 3IDNB 4LMQE 4XCYB 4AVJA 3QIBA 2EVJA 2CA4A 2VXSH 5SWZE 2QADD 2DQUH 5F1IB 1EO8L 4TOYL 4E5XA 1T6WA 3TL5A 2GI7A 3NGBC 1MHEA 4I87A 2HVJA 3V7AE 1IEBB 3K81A 3PNWA 4JFZH 1RURL 1MY5A 1AGCB 1F18A 2Q7AA 2WXPA 1ZDSA 5F1OB 1K85A 2DZEA 4P5SA 1A6UH 3IBOA 4NC1E 1I1FA 2N7AA 3V5KA 5DI8B 1ZSDB 5H94A 3OAZH 4WJ5B 3N85H 1IBFA 1IC1A 4TUOB 4N0FB 2JF1A 5E7BA 2O6PA 3P2TA 4IK7A 4HBCH 2IEPA 3ULUD 4PRID 1AJ7H 4ELME 1UB5A 1AGDA 4NP4L 2AI0L 3AS1A 4YHNA 1TU2A 1GAFL 1TO5A 1EXUB 4JFXB 1ROWA 2OJEB 1FYTA 1YEFL 4JO1L 3RUGF 3T2NH 1CF1A 2FYVA 3P77A 2BVOA 2ZKXA 5JHBA 1IKNA 2D7TL 4JMNA 4OUOA 1UT1A 4XP1L 5B4MD 3FUMA 4JFOB 1ND0A 4X9IA 2DQHL 1AVAA 1MCFA 3ASOB 3C75A 2YUVA 3U7WH 1C5DA 4BDVA 4Y2OA 2DQFA 2DL2A 3DHJA 2MQGA 3OKKA 3WFBH 3SBRA 1GVIA 3MRGB 1EZSA 4ZXBA 4TUKL 2IANA 4ZNEA 5LHDA 1KGIA 4O51A 2ZWLT 5GRXG 1FG9C 3CSPA 4JJ5B 5IQ7H 1ACZA 4IM8A 3TEWA 1IAOB 1JYNA 5CN2A 1JPTL 3SJVA 4PJ9A 3TYFA 1FYTD 1BZ8A 4K7PH 5LG6A 1AO7B 2GSGA 3UYRL 4KC3B 4AL8H 3T0XA 4JDTL 5AG8A 2I60H 2XY1A 5AW3B 3P9LA 4HFUL 3QWRA 4L9LC 3ZGHA 1MHCA 1MUJA 1CLOL 1XF3A 5I26A 5F7EH 2BHUA 3ARFC 4IRZL 3EJUA 3QXDB 3LRSA 4TLUA 1EXHA 4BFFA 3QXAA 2QFPA 3WTXA 1ZK9A 1T2XA 5DVLA 2DKMA 3W82A 3DX9B 4UOW1 2B0SL 3B9KA 5C08D 2VXVH 3NEXA 3VU1A 3BH9A 3U7YL 4UM9A 4U1KB 1LVEA 2YQ2A 4DZ8A 4RDQF 2J3SA 5FDYA 1WWAX 1NGZA 3U0TB 4XPBH 1S78D 2VISB 4AENA 1ZS2A 4PJ9D 3SYCA 4RH4A 3QEHA 4BWTA 2XG4A 4DGVH 2EXYC 4X8JA 2Y22A 4JO3L 1U6AH 5ADOL 4QMEA 4XOCA 3KLSA 4H44C 5F1NA 3QWRD 3TIDB 5KSVA 5FFGA 2Y1VA 4HZLB 4DN3L 4NNPL 5L88H 1RUKH 3FONA 5DK3A 1RD6A 3B9KD 1N4XL 5FCSH 4PJ7A 3APFA 3NCXA 1E3FA 4B0MM 4UM9D 3KJ6L 2WO3B 3QPXH 4OJCA 5E2JA 4BFBD 3ARWA 4D3CL 4HJUA 2VLJA 1TJHL 3QWOB 1WCQA 5ICXA 1KZQA 3MJ9A