4AXWA

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1- 2, form i 2.2a.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords CADHERIN-23
total genus 44
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA02
1NCGA 5DZVA 2OMTB 4OY9A 2WD0A 4QD2E 2WCPA 3K6IA 2V37A 4AQAB 2OMYB 3LNDA 4XXWA 5JYLA 2WHVA 5CO1A 4ZMXA 4NUQA 5JYMA 5CZRA 1NCJA 2A4EA 3Q2VA 4AQ8C 1ZXKA 4ZI8A 2WBXA 2EE0A 3UBHA 2QVIA 1NCHA 3Q2WA 1O6SB 1SUHA 3K5SA 4AQ8A 4ZMOA 3LNHA 4ZMQA 4ZMWA 3QRBA 4ZMLA 2OMXB 1OP4A 4NUPA 4AQEA 1Q1PA 4ZT1A 3LNFA 3K6DA 4NUMA 2QVFB 3FF7A 4ZMVA 3LNIA 2X2UA 3FF8A 3MVSA 2A4CA 1EDHA 3Q2NA 1FF5A 2O72A 1ZVNA 2OMVB 3UBGA 4AQAA 4ZMNA 4APXA 3K6FA 2OMWB 4AK1A 4ZMZA 1WUZA 3Q2LA 1NCIA 4NQQA 2OMUB 3K5RA 2YSTA 2YQGA 4AXWA 4XXWC 4ZMYA 4AQEB 3LNEA 3UBFA 4ZTEA 4AXWB 5KJ4A 1WYJA 1L3WA 4ZMTA 4ZMPA 3PPEA 3LNGA 2OMZB 4APXB
chains in the Genus database with same CATH superfamily
1BP3B 5SWZA 1E4XI 2EO1A 3IT8D 5B38A 2WYHA 5TK2A 4F7TA 3OX8A 2VZ3A 1MCCA 2NY0D 2VZOA 1B0GA 4OIBA 4MMYB 1I3UA 3LKQB 4ORGA 1LM8V 1J1OL 3VD9A 4PLKC 3ECVA 1OALA 4EI0A 5CZRA 1I1CA 2AAAA 5DD1L 3BAJA 3DMMA 2HKFL 2AK4A 2DW5A 1CDIA 4V1DA 4WSGA 4PRPE 3WJMB 5JMRA 5GJTL 1I7UB 3OPUA 3QDGD 1MLCA 4RFNB 4HF5H 5HHQA 1HXKA 3ALPA 3AXLB 4Y5YC 2MOGA 3TZVD 2ZKYA 1Z3GH 2BCMA 4BFNA 1J5HA 4M7LT 1CQKA 5L0QB 1KULA 3CH1B 2OULB 1VF5C 3G6JE 3IM1A 3ET9F 1RZGB 3H56A 4KUZL 4XC3H 1N8ZA 5HDBB 5ICYA 1MH5A 3LS5H 3NJVA 1V27A 5BZDB 2YD1A 2X89D 3MRHB 4LDOB 4YQXL 3FAWA 3GMQA 1U36A 5T3XE 1HIMH 3ABKB 2ZWNA 2A6KA 2KHAA 4RGND 1P4BH 2BHZA 4H1LB 1RJYA 2XN9A 1A3LH 3MLWH 2H2PD 1JPSH 2GKIA 3FYEB 2R1WB 3RKPA 3H85A 2V9TA 2WLYA 2ZPKL 2E4FA 3D69A 5AZ2L 3M1CA 3VMOA 1KXQA 2NY6D 3AG3B 4WWKA 4H8WL 2FHCA 4FXKB 4GQZA 1A3RH 1N3NA 5I30L 2XVKA 5MEQB 4MAYD 2PYEE 1JZJA 2FBOJ 1DEDA 4IRJA 1XF5A 2JI2A 1LEGA 2L8AA 2LR4A 3NCBB 4MCNA 3UEQA 4WHYG 4AL8L 3BJ91 4IBZA 4F8TA 1EHNA 1HDMB 5E7FA 5HGAB 1WBXB 3BZEA 3L2MA 4OD1H 3VE0B 2ZF8A 3KR3L 3KJ4B 2LU7A 2DQUL 5BRZD 5B8CC 4OF6A 4XNAA 3UYPA 2H2SD 4J3OC 3TEUA 3FRUB 3ELAT 5BNXD 4XC3L 5CZXC 1LEKB 4X8XA 4PJEF 1ZPLA 1H8SA 1ZD6A 4YQXH 3K8LA 4OLVH 4IRSC 3MRPA 4HCGA 1VZGA 3UBFA 3U4BL 4KDTC 3ZDZB 3NA9H 3UAJA 4AYID 5IHLB 3FT9A 1KG0B 1QR1B 2DKUA 5D8JL 4YHZH 5EIVA 5EN2A 3MRDB 3LTVA 4WKXA 3TZVC 4B3VA 4UT6L 5KS9A 1LO0L 1SMAA 1DZ0A 4H20H 1IX2A 1LO2H 5FA4A 3PPEA 3ZPDA 1E40A 1FAIH 5JXEC 3U30B 3IFLH 4HCRH 4I0PD 3NIFB 4A66A 5F8RC 1XH0A 2BCKA 3NZSA 1H0DA 1G7LA 4YHYB 1CT8A 3II2A 1LP9B 3K46A 1F02I 2OFQA 1KCUL 4G6AC 4KO7A 4YC2C 2ZKHH 1RU9H 3BLPX 3HUJE 3UZEA 4BH7B 1EHXA 4K5OA 3MGOB 2VR9A 4ZS6D 3P02A 1J86A 2H1LM 3NK3A 1AVAA 1IBFA 3BUYA 3K2KA 4LCWE 3AQZA 1JHKH 5JDJA 1AG0A 1IM9A 4HDIA 4PRHD 4WI2A 3C60A 4PJ6A 4XPTL 4A2EA 3QJHB 5HYJD 5IHZA 3ZHFA 1KBVA 4I4WA 3AY2A 3EKCA 1CD8A 5DMGD 3E3QE 4YZFE 3GMLB 4DT2A 2EEAA 5AZEH 4K23L 4MFHA 2FRGP 3MGTB 2Y06L 3RY6C 5JXAH 1CI3M 3QCTH 3RWEA 4J12A 3KBFA 5FO8B 2HLAB 1UXWB 4YGVA 4L1SA 2OSLA 5DJ8A 4YX2L 5IV2A 5FYLH 1K2DA 1E0OB 1X7TA 1IGCL 3GHBL 5DRWA 4HS3A 5I8KL 1ZKAA 4MZRA 3FB8A 1BVKA 5BVPH 2QQNL 3GXMA 4OZIF 1CGTA 1NIEA 3O4LE 4KKLD 5FO8A 2AEIT 4RA0C 1KJ3L 1KZQA 1K5NB 3TT3L 1BQUA 1K2DB 4KK6C 2JQZA 5FF6A 1R46A 3OF6A 1BYOA 3BEVB 5IROA 4BUHA 4F33A 3LQZA 3KPRD 3LZPA 3OXRB 1PLAA 1T89C 3MLXH 4UDUB 5ADOH 2KT6A 1M7IA 4IMKC 4TTDC 4CILA 4WUKL 4QTIL 4U6HA 2YUZA 5EEVA 2X6AA 2O1AA 2J1XA 3HBGA 1KY6A 3IPEA 4NOFA 5B39G 3NSYA 1IE5A 1F6LL 1HH6B 2BSSB 3BDYH 3D39A 4EI5B 3DV4B 1Y07A 2EP6A 4MJIA 1CT8B 2O5XL 5T5FL 2QSVA 3GXPA 3CC5B 2YJQA 4CSTA 3B2VL 4JDTH 3K72B 4F7TB 2G3XA 1SF5A 4XRCA 2W0FB 5I66A 1NKOA 2BP5M 3ME0B 3L5HA 4ETYA 1TSRA 1I7RB 1SEQH 2YA0A 3ZE0E 4N0CC 2APWA 5D8JH 3TBVA 2K78A 2Q1EA 3BOVA 1A6WH 3LQZB 5AFAA 5HHOD 3ULUF 2FEJA 5CFAA 3ARDD 1W6LA 3MCLH 1DBAH 2W07B 3L1OL 5E6ZA 2NY3C 5A2BA 2K1MA 3QRGL 5IQNA 3RL2B 3AAZA 1FI8C 3PYCA 3VH8G 3QFJB 4AMKH 4MS8C 4KXBA 4Z8FL 1HCYA 2Z7UA 4EZMA 1A9VA 1E90A 4IIQA 4X6EB 1NGPH 2CSPA 3DTDA 4FF9A 1KB5H 4LLUB 1O5DT 2V5MA 1UZ6E 3S2AA 3LXBA 2N0KA 1U8KB 1N6VA 3ECBB 4XZUB 1AE6L 5HDWA 5J4MA 3I3DA 2IC2A 4GS7B 3POCA 3C9NB 4CNIB 4QKXB 5F7DA 3H4HA 2CA3A 3D3VE 1E6OH 3ZDYE 3HC3L 4ESKA 5ACZA 4B9JA 1NPUA 4HA1A 1G4MA 5GGQL 3KZ8A 1G1OA 3IFPA 3CVDA 5JW3L 4NHCH 2AJXL 2ZYRA 2VL4A 5I74B 1A14L 2X89A 4AV4A 1N59A 43C9B 4K9EC 3KYKL 4IBTA 2Q9OA 3RRQA 2IGTA 1A7QL 1OANA 4H0HB 3VB9A 1QLFB 4EAEA 1RY7B 1CGUA 5H35A 4MYPA 5AVTB 2R9HD 1MJJA 3DX9B 3SDAC 3VA2C 3CXDH 4BSVB 3ARGB 1WJ3A 4XN7A 4PI2A 3VWKC 2DOCA 2ERJB 3K2UL 3ULVE 5CCKH 3H9ZA 3L3GB 2F1AA 3V0WH 2YMTA 1BVNT 3LCYA 3LNFA 4UTAA 5D96C 2L04A 1MI5E 2VDRH 3TU6A 3WDHA 5DZOA 2BNQE 3Q6FA 4KTEL 4MQXC 1MLCB 3I9PA 4XC1H 3IXAA 2DAVA 3MLWL 5IF0A 2OMYA 4GI9A 3WL9B 3BVXA 4XX1G 5BZWA 2V3FA 4GW4B 3EYVA 2DQIL 5GZOC 1HDMA 4EN3C 4MDRA 1ZVNA 3DNKA 4QCIB 2BMKB 1A8JH 1AFVL 4OBRA 3F64A 1T20A 5KJ7E 2MNWA 3RI5F 1HHGA 2EDRA 3MBED 3U0PA 1KCRL 2RCSH 1IAIH 2FH6A 4PBWD 4ZFGL 5IW1A 2Y6TE 1YPZF 4Q7DA 3KYNB 1A7QH 1HSBA 2ILLA 2NX5D 3VFVB 3US1A 1SOKA 2OYMA 2F18A 5PAZA 1E8WA 2CUAA 4RLDA 3FB5A 1ROCA 2EACA 3TJHD 3W39B 4CU7A 4IKNA 2YD4A 2K45A 4NZRL 2A0LD 4Q0XL 4UV7H 4G6FD 2KZKA 2X28A 3QQNA 4WJG3 2H1PL 4GLRI 3EJPA 3HAEA 2OTWB 3H42H 4NZTH 3KDMA 3CX2A 4XC1L 5DGQA 3EAKA 3QPXL 2EYRA 4I48B 2BHUA 4R2GC 4K5MA 2FX7L 5DR5L 3MUUA 4KVPA 5CM1A 2P80A 4G72B 3UJJL 1T66D 2LU4A 2WQUA 3QORA 4PJ5D 1XR9B 5IW1B 2UYLA 4NQXA 3GSNL 4MRCA 2PWDA 1Q72H 1C08A 1DFBH 3UBXI 3QUXD 3QDJA 3LQAH 4KRMB 4G8GE 1M42A 2AEWA 4ZFOB 5EN3A 2GTQA 1JI2A 5C3LD 3IJEB 2PWEA 1ZEAH 3FRPA 1UM4H 3DURB 4KJWC 4NN6B 1NBVL 3HKFA 3HPJA 2PW2B 3NCYS 4LBEA 5LWYL 3HAEB 1MFBH 3FO0H 2OA9A 3QIUC 5AW2B 1I7TA 4UTAL 3NCFB 1TCMA 4KDWA 3TP4A 1NEUA 5C6WH 5E1AB 4XN8A 1MAMH 4RQQA 5L2JB 2J55A 4N2CA 3FT2A 3PAUA 3U1SH 4OFIA 4YSTA 2DWDB 3M45A 2B9BA 4U7SA 2DWSA 1IKFL 1CDJA 1YUHB 3B9KC 3BMWA 2IIJA 3BAWA 2VDQB 3MLZL 3L3IA 3UMNA 3WO3B 2CAKA 3MCG1 4PRNB 1X5XA 5AAWC 3NPSC 1N5YL 2RBLA 3MROB 2ZUVA 1U8PB 2EC9T 4H26A 1P7QB 4LLDB 5HDOA 1GXEA 1N9PA 2WN2A 1GZHA 1FWXA 1IBBA 3F85A 4NQDE 3O4LA 4UNUA 3BGMB 4JZJA 5JW5A 1Z32X 3QUZA 5EO9A 4DTGL 4QRRE 2VZVA 1TQTA 1BZ7B 5IVOA 4GXUM 5I1EL 1O7DE 1OGTB 4H26B 3PFUA 2W9EL 4HKXB 4LLDA 1CL7I 1U33A 4QXWA 4MNQD 4E5XA 2BM3A 1TMQA 3PRZA 2F8OA 2VW6A 1IZJA 2ZSWB 4NC1E 3RWGB 4OT1L 5K39A 5DK3A 2E9JA 1R5IB 4JAMA 4YDVB 2XETA 1OIOA 5EO1A 5LB1A 1SHMA 5MEOA 5I1AB 3A21A 4Z5RA 3FO9A 4DPRA 2E7LA 1MFNA 5F1IA 4DIXA 3V8CA 4ONFH 1FP5A 3QJUB 3KEHA 2XX1A 3OAUH 3V4UL 4E42A 5C86A 1M6OB 1F4WL 1UGNA 3KE0A 4I1RA 4OCSL 1P9MC 1KTBA 4N6RB 3KPRA 2MPAL 2GW5A 3CFMA 2K70A 1QPXA 2NY2D 1EXUB 3HPJB 4L3EA 1R24B 3BMVA 5DEGA 3OKNB 1VGKB 1P2CA 5IHWA 1XCTB 3ARFA 1CGXA 4Y4HA 3FQXB 2X4QB 1ECZA 2ISDA 3OHXA 5EU6D 4JPSA 4B7IA 4X7TB 2Z93A 4XXCC 3KCPA 3U36B 2K4WA 2IPUK 4NO3B 1JV5B 3PQYE 1RERA 1EHKB 1S7TB 2WD0A 3TJPA 2E27H 2MCMA 4WENB 3CD4A 4EDXB 3GBNH 5DI8B 3TEXA 1RUPL 1R3LB 3V4VA 3BKCH 3SE3A 3GKWH 3MOBL 4GRWH 1QA9A 2HFGL 1N6QH 4N2OA 3SDYL 4GXVH 1F4YH 1MFAL 4PR5B 3ARDA 2OK0H 3FFCB 1BOYA 4WU7A 2R4RH 3RDTB 5IOPA 4MBRA 1NBCA 4PIRF 4FQ1H 4U6YB 4ALAC 1ZCRA 2MPAH 2CNZA 1JF1A 5GGQH 2NY5L 3FU7B 4TNEA 3TT1H 4F57H 3LN4B 4PVBA 5C0EA 4NQEA 4HFUL 3LN5A 1KIQA 3HZKB 1J7VR 3TWCL 2Q6WB 5D7LE 5C08A 2Y2TA 4TM9A 3TNMB 3ZYOA 5HJGA 3FO2B 2D4DA 1YEIH 4EZLA 1QI3A 4HK3J 1PIFA 1UFUA 1KT2A 3QRBA 3JSSA 1MJ8L 3BC9A 3ECWA 2VABB 4GUPA 5GSRA 2Z8RA 4FNTA 5DA4A 4R7NB 1L0QA 4LLQA 4TL5A 5IIEB 3K8KA 4YLQT 5BZWB 1FQ9C 3BUPA 3PABB 3SZKC 1V3LA 4CSZA 2VSCA 5J1SC 4DHLA 4JW3A 5JIHA 2UX7A 5KVDH 4JVUA 3FONA 2YEVB 4UTBH 2ADIA 1J1OH 3RUGB 1HU8A 3NYKA 2B16A 3OXSB 2F53A 3QR2A 5BW7A 3QXAB 1F8TH 1O7VA 1MFAH 1FF5A 2YKLH 1XIWA 2NTFB 4JFQA 3KDPB 1HHGB 1G7QB 1HHHB 3AADB 1HTYA 5C70A 1H6UA 4Y19E 1CBVL 4D9QE 4OCXL 2D03L 4NT6B 3ZSTA 5HHMB 4UDTB 2BP0A 4E0RA 1RZJC 4C55A 3R7RA 2AI0L 1A6AA 1D9KB 3GEWB 5F89A 5E4AA 4Z76B 4WV1B 5CWSB 1TTBA 3RHWK 2A1WH 1LE9A 2WGXA 1R3KB 2HRPH 4XN4A 2A6DA 3H55A 5KVGH 3MRDA 5KS9B 1WITA 5KVGE 3QDMD 2B8OT 2ZXWB 1XF2A 2F53E 1WAAE 1Z1WA 4HIJA 3ZE2E 4H2CA 5HYSG 2C7UA 3RAJH 1BF2A 4G9DA 4GW1A 4D8PB 4ZO6A 4PMEA 1OT2A 1GOGA 2E76C 4AW7A 1A1OA 1RUPH 4A38A 2JLPA 2X4NB 4N2EA 1Z5LA 2BVQA 4M7KL 4OZGB 4Z7UF 1JZEA 1TNNA 1I8LA 4G5AA 5KVEL 3QCUH 2B3IA 2I5YH 4QTHB 5DUBA 4MSWB 3ML9A 4WW2A 3CDYA 1BVNP 3OR6A 4F8PA 1D5MB 1GS6X 1ZV2A 2FZ3B 1HWHB 2IDFA 4PCTA 3VXOA 2Q86A 4B5EA 2GJ6D 1G6RB 4XP4H 2DQUH 3VD4A 2A74A 4QRQA 3KG5A 3NJGA 1FJ1A 4JM2A 4WHTA 1QEWA 4L29A 3RB5A 1BGXH 2KH2B 1JP5A 5AB2A 2DN7A 5EU7C 2HP4A 3HB3B 5CCGE 2E47A 3PGFL 4L4TE 1S9YB 2QSCH 1S3RA 4XOBA 1N70A 1KG0A 3QNZA 5GGSA 3COOA 3E9UA 4HGWA 2F7OA 2Z0BA 3A5VA 3QJXA 5F70A 2XYCA 3E8UH 4XRCB 3GO1H 3UYRL 1YYMH 3KWVA 5I73C 3VG0H 4H8WC 3RB7A 1E67A 2F5AL 2A74C 1ZANL 3LIZL 3D48R 4FFVD 5F9OL 3ZLQC 4AQOA 2YPLA 4P0DA 3WS6C 4OZFG 3TF7C 2GSMB 4P46A 4XNDA 4PJDE 5IMMA 4QAWA 4P2RA 4RWYL 3DOIA 3ARED 4YFLF 3DYPA 3TYFA 4GT7A 4X5LA 2E7BA 3NJIA 4MJ2A 1LEGB 4N2NA 2D2OA 5TPWL 3MRBB 5E99L 5DSCA 4HHGA 3ULVL 1B9KA 1OP9A 2CMRL 3HMXH 2G5RA 5E2UH 1HE7A 1W8NA 3S36L 1TVBB 3MBXH 3TBBA 3ZZSA 2VAAB 4M1CD 2FQDA 3V0GA 2Z6FA 2VO8A 4BINA 2A3TA 3BISA 2P7TA 2ZAGA 3IN0A 4JFDA 1SJHA 3IDGB 2HKHL 1YG9A 4U1SB 1FVEB 4HS3B 4S2SA 5FYKL 2GBUA 4RGNC 5DJ2A 4NT6A 3RBSA 3SCMC 4FNRA 4NQQA 4TV3A 3WO4C 2I69A 3F7LA 5C92A 5KBLA 1KT2B 3VCLB 4OFDA 5ICYB 4O51B 1IGML 4RMVA 1XV8A 4ONFL 5KSBF 2EDEA 3DA0A 4L18A 2D7OA 2BOBA 4PWJA 1CLYH 3UG3A 3CZFB 3H2WA 4ABQA 1CFQA 5DVLA 4KI5E 3BD3A 1S3KH 2HPOA 4HK3N 2AK4D 2UXVA 4Y16A 4F57L 1AZBA 3EDKA 4I2XE 4O02L 5DZLA 2XN9B 4LSQL 4NO2B 2Y7QA 2VSDA 1IGFL 1K5WA 1ZK9A 3EJRA 4PV8B 1B0RA 1XQ4A 4UIMA 3MUGB 2AK1L 3ILPB 3WFHB 2FBRA 5BW7C 2BXYA 2DL2A 2JQMA 4XP4L 2GI7A 1V8HA 5HDLA 1CDHA 4H0LC 3S2CA 5GZNC 2P44B 3ARUA 1XBRA 1X5MA 2LGNA 1VPOL 5SWQA 4XHJC 2AVGA 1PVHA 1CG9A 2WV3A 5JW4R 5T5FH 1RD6A 2PXYB 4MQTB 2OR9H 1HOEA 2XRAH 4N0YH 4YE4L 5HPOA 5KYNA 2LLLA 4XCCL 1MFCH 3D18B 5IHZB 3QZWB 1FPTL 5C0JA 2K8QA 3B34A 5HHQB 2V3DA 5LGYA 5D1QB 5FW7A 3GS7A 4QRSA 4WEEA 3L9EA 4HS8H 1JF5A 4G43B 5DJZB 3TF4A 3AG4B 4WWNA 5J6HB 1ID5I 3OXSA 4NCC2 1F4YL 1WC7B 3LPOA 4PV1C 1KWGA 1JNLL 3D4ZA 4W9CC 3WFCH 2ICWB 5T3ZL 3Q3GA 4PLOB 4TUOA 2E0PA 1CTMA 3OJDA 1JYXA 1EO8L 3SY0B 3KXFA 1B0GB 4M6AA 2EYTA 5JIPA 1QWUA 1ZT4B 3PWPA 5DUPH 1NLDH 4LLQB 1BZEA 4HT1L 2DPKA 3LXCA 1NGZA 1YNTA 4P5TB 3V0VB 4HGWB 4PQXA 4PGEA 3T2NL 5TPWH 1NC2A 4QT5A 3IXTA 5T33L 3SE3C 3JT2A 5C6TL 1UWGL 4H88H 1SBBA 4YNYA 5DLML 3DRTB 4YL9A 3MLUH 1MKFA 4FFZL 5CAYB 2Y22A 5TQ0L 5C0CA 4XP5H 1YEKL 2NNXA 4AVIA 4U6YA 1BQLH 3DBXA 4XXCA 1G0YR 3VXQA 5I1IL 1T7XA 5LAPA 4DPCX 3FFCA 2CO6A 5AVYB 1DDHA 3DO3A 4CMHC 2ROYA 4GRLC 2X41A 3DUUA 1KTRL 4ZZKA 5D1ZD 3U83A 4B60A 2DF3A 4LNRA 4XP1H 4ZUUB 4DOHE 4IOFD 1Q94B 1N2RA 3FQRA 1BMGA 1RXLA 1I4FB 4NN5B 2XTJC 3BT2L 4GFXA 4I3RL 5BMFH 5K9QI 4EI6A 3BYYA 3POHA 3UPRA 2GG1A 1I8UA 1QSED 2AEQH 1N18A 4Z7NB 4B53A 1B4RA 2OMTA 1P9MA 1C5DB 1Q9KA 5DCCA 3VG9B 4EXPX 5AUMA 2FE0A 3CIQA 3EHBD 4KJPD 4XAKD 4W9ZA 5I1KH 1IGJA 4ONOA 3WEXA 2IAMC 4PRID 5IK3A 2EUVA 2V2XA 3HS0C 1SMDA 1NFDB 4FG2A 1E3XA 2KERA 4Q58C 2VXQL 3CFQA 3KBEA 3QUZB 3SQBA 4G9FA 4IM8A 4N9GA 4CAGA 1KCWA 1W9XA 5IBUB 4KMTL 1FLTX 4LCYA 4QF1B 4NS0A 2OYPA 3CNKA 4XN9A 3R7QA 4Z0BH 5JHDA 4BYHA 2QQNH 2VIRA 4YXHH 1ZANH 3LIZH 5KAQF 3TO2B 2CBTA 4YSRA 1PZUB 2XJLA 5E4OA 4P5MB 4GSUA 4FYSA 4Z5RB 4O4YH 2VN3A 1NFKA 4AJYV 5HDRA 4R6UA 4AYSA 4PVNA 4NO5B 3KLHC 2QFPA 5SWSD 4V1DB 1G9HA 3MKGA 1VDGA 3HZMA 4OGXH 2EDMA 5D1XC 4F20A 5L2KE 4Q9QH 1OOAA 1CGYA 4F8OA 3X14B 5AAMC 4P9MH 3O2DH 4E9WA 1DJWA 4JN1L 2X9XA 1FL5A 4ODHH 4BD4A 1DDHB 1OTTD 3CFIC 4GRLD 1MHHB 2AW2A 5D1ZC 1A1MA 1G7PB 3GRWH 2VERA 2Y1AA 4FLOA 2VXQH 2WXLA 5KG9A 1A4BA 2QR0A 3QIUA 1RVFH 4Z9KB 4DCQA 1OAXH 2NW3B 3S34L 4Y89A 3R19A 3WKYA 5I8CA 3TPUB 4JR9L 2NNAB 4U1JB 3RVWC 3C2AH 4PV9B 4YOKA 4G5ZL 3P3TA 3UPCA 4F27A 1NC4D 1DVUA 2QR0B 3QIUB 5FCSH 3W2DL 1YCSA 3V0VA 4GG6F 2FX8H 3MOQA 4XMKH 1OAQL 2VRKA 3EOYG 1HFUA 4A2MA 1DQTA 2PTUA 3IJSB 5F7KC 4FXGB 3VXRE 5IVXB 3ZTEA 2J43A 3QORC 4QCIA 3D52A 5AL0A 1Q9WB 4XPBL 2IQ9L 1MHHA 1MLBB 1TQUA 1NUDA 3MO1B 4PGDB 3G5YA 3KWUA 2A4CA 4KX7A 3DO4A 4WRLA 3RTQD 4HW6A 1DEEA 5E0QA 3V55A 3UGXA 1COBA 1WCQA 5F7FA 3ZGIA 4BZ1L 4ZFOL 2VDMH 1I1FB 5E8OA 2H32B 4N0YL 5F88B 1UCBH 1RVFL 4ELKA 2V9UA 3EBHA 4P5MA 2MPVA 2WKGA 4XPHH 3TO4C 4RMBA 1HSAB 1SVZA 3S96B 5TH2A 4YXKH 4BZYA 1G4RA 1HQ4B 2A9CA 4F37K 3T4YA 2B15A 3KDMB 3OMNB 4OZHF 5FV2A 3BRFA 4LCYB 1BAFH 2YRBA 5LCVH 3GSWA 2HJKA 4YDIH 2V2XB 2EVHA 1LO3L 5EDXA 4TUJA 3QFJD 1FZKB 2NXZD 3OZ9H 1HWWA 5D5MF 4F58L 2ZXDA 1YEGH 2YAHA 1I7ZB 2PR4L 4Z95H 1NFAA 1WZAA 4HKJA 4GY4A 3BUBA 4A67A 1DQKA 3CXDL 4O2EB 5KEZA 4F92B 2XV3A 3MV8D 4P9HH 2DWEB 1T2XA 4LCCB 2EVJA 2WCPA 3C60D 4YVNA 4FMKA 4AKPA 4ZW6A 4NWTL 2EEFA 3VWKA 1OAZH 2P48B 2ZUYA 3ULUH 1MFMA 3DPBA 4AMWA 1AIFA 1M1XB 3BZ4B 1W72H 1EAOA 3G5VB 3RVUD 1RPQA 2WXMA 5FYLL 3LZRA 5LQBH 1XBDA 3FHEA 1P1ZA 5DEFB 4G5ZH 1QTSA 3LSOA 3Q0HA 4QAMB 3IKCB 1OSZA 3GSXA 1UT2A 3RNQB 4QT5B 4HXAH 1FDLH 1VKXB 1YUHA 1OAQH 1KIRB 2OL3H 5D5MB 4QNPF 1RIHH 2DJMA 4RAHA 5DK0A 4N0RA 4GSDL 3QEQD 3VXSD 1CMOA 3L5XH 4QO1B 4F2FA 2PR4H 4IBVA 2XWBA 3D25B 2VDNB 1EERB 1CFTA 2IGLA 3FHQA 2K7QA 3LH9A 3VQMA 2C5DC 1RSFA 5CFHA 1OWRM 2QQKL 1YAZA 2A73A 2Z35B 3LDBB 4UTCA 1E50A 4QRUB 2Y7SA 4HH9B 1TZIB 4GAYB 4QUOA 4JQIA 1YJDH 4BFBD 4K9EH 4DF9A 3S88L 3O6KL 4FFZH 4NQSA 5EEUA 3V0DA 1GCYA 2TSBA 3D85D 3MOBH 1YN6A 4FTVB 3EO0A 5DJZA 3QISA 3ZK0A 2J6EH 1X6LA 4M29A 2X0WA 3LHPL 4XPHL 5IMOA 3BEWB 3UG4A 3FBQA 2P52A 1FC1A 2FSEA 4PRHB 4ZPTA 3FHAA 2FYYB 2OW7A 3TT1L 2WPGA 3CDGB 3SPJA 4FLRA 1ACCA 2XZQL 3QT2A 2MKLC 4N2DA 3VFTA 1R47A 5LDUA 2EUWA 2DQFB 3IRZA 4DPAX 3ABGA 4X9YA 1JZIA 1U8QB 1MJUL 4KJYA 1MCRA 4XCEB 4X5QA 1JSYA 2C7FA 1BMZA 1BXAA 3LRLA 4CSSA 3FUEA 1DVQA 1K4CA 1FYHB 1T1ZA 4JGMA 4XR8C 1UZ8B 3TIDA 3MYJB 1ND0A 4AW4A 1UZ6F 4KKAD 1M7IB 2M83A 4TUUA 4QHKJ 1T5WA 4TL4A 1UOWA 5C07A 1L6ZA 3HG5A 1CE1H 2BVOA 3FPXA 1YC7A 2C1PA 3LKOA 3N43B 3ARQA 1M9SA 1GYCA 3QG6B 1ITBB 1ZVYA 1W16A 5IMLB 4IMKA 2C8NA 5IHUH 2OCCB 5C0BD 3IE9A 4OFQA 3RVTD 1FVDA 2WBJA 5EEWA 3MJ6A 4H4NA 3WY2A 2XWZA 5EWIH 1WQVT 4ONHA 3FT4B 1N12A 2FK9A 3SY6A 3UTTD 3ARBB 1T7WA 1T1XA 1UD5A 2HSIA 4GG8A 4I9WD 1ZLUK 1LK2A 3GLDA 3I6KA 5EIIG 4L1HA 4E2OA 2HUHA 3GMLA 5FCUH 3RVXD 1Z9SA 3AY4A 3O2DL 3MXVH 3RGVD 4JRLA 1A47A 2EE0A 4GQ9H 1KN2H 1KGCE 5EN2B 3C6EA 3U7WH 4ZUTA 2YPLD 1OARL 2AABH 4S11A 1DBBL 1NIFA 3RY6A 2ORBH 1SXAA 2VLLB 1SHSA 2GT9A 2OTUB 3NJNA 3SDCD 2RD0A 1R33A 3AGWA 3NTCH 4MA3A 3C60C 2NY0C 1JNHA 4XHJD 1PEWA 5GQBA 4JFHD 1SLWA 3PWPD 3VACA 4A2DA 1FFTB 5SWZE 3C09C 3ZYZA 3EJYC 4PJ8A 3KH4A 4IDLA 3VGDA 4TNVF 2PYEB 5FGRA 2VH5L 3VI4F 2DLEA 3EYSL 4E9SA 4V11A 1X44A 2QDWA 4M1GL 3MV9E 5EWIL 1YEDA 4FQXD 1QMUA 1S9XB 3BZFB 4CVXA 1FJ1B 3WY1A 3OLGA 5BUPA 4YDZA 3FCUB 2F54D 2X87A 3ORJA 2AQSA 1QBAA 2IBGA 2Y1VA 5JXEA 3KPNB 4HD5A 5D6DA 3ETBF 1UURA 2WSDA 3R1GL 4OH2A 2QLYA 4LHUG 1BBJB 4RRPA 4A6YL 2ERJC 2JI1A 4BH7A 3JQOB 2JKRM 3FB7A 1JI1A 2AXFB 4A7QA 7PAZA 3LIZA 3LN9A 3U30C 1BD2B 1ZJAA 4IRJB 1PZ3A 2XKSA 4P46D 4PWIA 1B2YA 1N3NB 5MEQA 3SOBH 1A4AA 1CE1L 4WFGE 2DLGA 2CCWA 5IWLC 1QUNB 3V2AR 4WDIA 2C7UB 3VWJD 4ELDA 3F6LA 3CFDB 2FO8A 4LPUA 1ZV9A 4MQ7B 3STZB 3VXUE 2XIDA 4UT9H 1GW0A 5ANMA 4FN0A 1KPVA 4PJAE 2D7QA 3TN0D 1I1YA 4Y4FB 1DFBL 5DZAA 4IOFC 4NQCB 4WFEE 3MRHA 5GGTH 3DRQA 4M8VA 4Z8FH 3K71B 2PO6D 5I16B 2VLLA 4UDTA 2WUBH 3T3PE 4FA7B 3IF1A 2FX9L 4LSVH 5E2TH 5ITFB 2W88A 1KJ2H 5K1JA 1D9KA 5HI3D 4U1HB 3FO9B 1FFPA 4KQ3L 1IAIM 1H15B 1MNUH 1EWHA 4K9EL 1UA7A 3HG1A 4KJPC 5GRUL 4DKEH 2R0ZL 4N85A 1UGKA 3MRRB 2V0AA 1OSZB 3GSXB 1AQKH 3GM8A 4U6HB 2ZOUA 5HDQH 3SD5A 4WW1A 2Y1YA 3SBPA 3W9EA 2EXWC 3LRSB 5JHLL 4S1RL 4I2XB 1JE6A 5EORH 1KXTB 3CPLA 2FD6H 4HIXH 3ROLA 3VJ6A 5HHVL 3QIBC 2G5BA 4AUJA 1QSFD 3N85H 3CFEB 4Y5YA 5G5DA 1LMIA 1QW8A 2X9YA 4JGNA 3CFKB 4A2GA 2WNWA 3SQOL 4XN5A 5B3NA 3ULAB 1PX8A 4GKZA 2JXMA 3CHPA 4LT7A 1R3IL 4UM8A 4G2AA 3V5KB 2HFEA 2G60L 4FABL 3WXWL 2CQVA 2QZQA 4ZTOL 1HHKB 2VRAA 2ZG2A 5E24E 1AZUA 1FE8L 1BM3H 3TCTA 3FS9A 1H3TA 5GS0C 3JZYA 4JLRB 4ISVB 3BGFB 3K2UH 3MODL 4MS6A 1IM9B 3FB6B 3FFDB 4TSBL 1E9OB 4WAFA 5AW4B 2H26A 2YRPA 4GMTL 4H25B 4NO0D 3WIFA 1R9FA 4JL1A 5C71A 1C1EH 3P73A 2RQ8A 5DD1H 3UTSA 3X13B 3KWWA 4X99B 2MEJB 2L3BA 2XV6B 2JB6A 4FFVC 2QADD 2AV7A 2OKMA 4S1DC 1S7TA 2I27N 1SYSA 1EAQA 2Z7YA 4Z3JA 1QPKA 1A1NA 2YC1A 4UM9B 3MCYA 5HD8D 4R84A 4PJXF 3SQOH 1Y0LA 1ROWA 3BQUA 4BK8A 2XI9A 2BRQA 2PCPB 2BNRD 4W68A 5IFJA 1BGXL 4DVRL 5IR1A 4APQC 4F7EA 2IANB 5DD0L 2EIZA 3X1GA 3WKQA 5JW4Q 2E59A 3VXTA 2IG2H 2G75A 3AS3A 1UD2A 2Z35A 1MFDH 4Y4HB 4E41D 2UVEA 2B20A 3CU7A 3ZKND 4DN4H 4OKVB 3HC0A 4Y2OB 3IJYB 3BP6B 3N50A 4N2LA 1VFBB 1CICC 2HWZH 4JPVH 1EBPA 4JDVB 2Z8VC 1EJFA 5DC9B 1M57B 1TLKA 4GUCA 5E6YA 3P54A 4PJDB 1NSNL 4UZGA 3SGKA 3UMTA 1VSCA 2I9TB 5K39B 2CJUL 3F58H 3FQYA 1HEZA 1W15A 4LAQL 1B6UA 4U05A 3C5JA 3TA3C 2CDFB 1GGBL 2Q7YB 3HNSL 4WY7L 1BQHB 2PTTA 1M7UA 2TRYA 2VXTL 4NRXB 5F6IB 5HGHA 2B1HL 3L8QA 5F71A 5F1OB 2ZKXA 3SDDC 3ZMNA 2V7HB 1INEL 4HCIA 1A1MB 5GRZA 5IVXE 3VXRB 2UWEB 2X1OA 4E5XB 5E2UL 4OCRL 5C6PB 4FP8H 2ADJA 3O0RL 3CCHB 4K55A 1OCWL 4ZK8A 1I85C 3NPZB 3KBPA 1XZ0B 4U1MB 3SDXA 1NTDA 3RZCB 3LEYL 2ALWA 2E6QA 3T6VA 1A66A 4OM0H 3L3IB 3MUJA 3F5WB 3VFRB 5A16A 2GSIB 2J1YA 2NX5B 4IU3A 3U6XS 3U46A 3AT9A 4J27A 5FECA 3DSNA 1BXVA 4ELKB 4JMXA 2ATAA 1EEYA 4XP6L 5EULV 4AEIL 1T83A 2HVJB 2DQGH 4XBMA 1RZFH 5IFJB 1BW8A 4UNIA 3JTTB 4L0ZA 2LU5A 1SVBA 3BUQA 3O2VH 4NXKA 5KYUA 1CDUA 1UXLA 1OZUA 3CIAA 3QEQA 4MTMA 1RZJH 5CJ8A 3BCDA 4LHJB 5D2LA 1AHWA 3WHE1 4AQ1B 1QRKA 3NCCB 3OAZH 2JSFA 2CR6A 2JB6B 3GSUB 3UTPD 1IL1A 1UWYA 1OAUH 4JN1H 5D2LB 1N0XL 4GNKB 5F88A 4QLRA 4D7PA 3RX5A 5DVNA 5T1DH 1OCWH 43CAB 3RG1C 2EE6A 2DM3A 2R9HC 3ZRFC 2Y07L 1UWEH 2YN3A 4O2FA 1LXMA 2PXYA 1WHOA 3IFNL 2VQUA 3L4CA 4PV9A 5TGBA 4BDVA 2ZAHA 1BQKA 2DYPB 2YQ3A 3M17A 1U41A 4KFMA 4URKA 2HTKD 4DGVL 2DWTA 3QEUB 4HJIA 5KVFH 3EH2A 5AW1B 2B5IB 2GI0A 3KHQA 5D55A 5JDSB 1J88A 3SGJA 3V4UH 2KDGA 3WDJA 1B0RB 3CLEL 5A2FA 3G08B 4IDJL 2LW3A 3WLBB 5ISZE 1EUUA 2J8UB 3DSFL 1UADC 3FQNA 5C0CB 5J1AA 1KMGA 4QRPA 1LGVA 4TVUA 1AD0B 5E56A 5CD3B 3MA7A 4MD0B 4OZIA 2EQDA 4NBYB 4S1DD 4LKCA 2OCJA 1LLAA 3ILEA 5ES4B 4ZMPA 3DGDA 2ZOLB 4OIIH 2BNUB 1X4YA 1WD9A 5JOPD 1QFUH 2NQCA 4NEHB 1MRFH 2NW2A 3A24A 3UZVA 3TFBA 4PD4K 3QS2A 3UPRB 1OK8A 4PJDA 4TNGA 4L4JA 4JO3H 1TCRB 2WMPB 4RFNC 3DO7B 3D9AH 3U7YL 3QZOA 1LEIB 4DKEL 1N68A 2YPVL 1WFOA 2BO0A 1IIKA 3PQYA 3KPSD 5FM5M 3ZKNC 4MA1C 1MF2H 3CFTA 5AOLA 3OKDA 4MNHA 5SWSA 1S5IH 5B22A 3GTVA 2VT0A 4ZSOE 4HH8A 2VJXA 5IHHA 5IG7B 3KNBA 1G9MC 5E8NB 1S9KC 1TU2A 3AFLA 4HMDA 4L4TA 2C3HA 3L1OH 1OHZA 2Y7NA 4NLHA 1HZHL 1FFQA 3TO2A 3QHTC 1FVCB 2OMUA 2NDFA 4J8QA 5FF6B 4KX8A 1EO7A 4KKBD 1ML0A 3QDMB 3TA3D 5I9QB 3U46B 5EPMA 2FATH 3IF1B 1YO4A 1ZS8A 3INOA 2W0LA 4Z7VB 2GK0B 2WIIA 4AOFA 4QY8A 3H42L 1OTTC 5BS0D 5LLIC 4H44C 3UTSB 1LHZA 3LVEA 1M2VA 1ACXA 3MHZA 4WCYL 1AQHA 2X4PA 1GIGL 4LF3B 2BPBA 1JGEB 4NHUA 4KY1L 3HE7C 4M6OH 3NCEB 3HG3A 2VC2H 3ARVA 3MLPA 3KJ4C 2BWDA 4N1HB 4WSJA 4CKVX 1GA2A 4BK5C 4MB4A 4XMUA 3QPQD 3WENA 4B7LA 1BD2A 5HVGB 3B9AA 2ZWYA 5A2CA 1XDTT 2AJ3B 4X7SH 5JORA 3QUGA 4LCWD 4MXQC 4KUCD 2J5LB 2HFFA 1ZY9A 3C5ZC 3FFCD 3GNMH 5CN1A 5GJSL 4YMPA 1HOCB 3MNZB 5F3HB 2Y6SD 2WNKA 3PLYA 4OCRH 2Y5EA 3HC0B 3QNYA 4FC3E 3WMPA 1PCXA 2C9UA 3TZVB 3REWA 2HJLB 3RUGE 3NGBB 5E8EA 4WO4B 3DJSA 1NEZA 3L3OB 4GW1B 5DDHB 5CCHE 5GRJH 2XFGB 3UDWC 3QBTB 3NSXA 1I7RA 2R0KH 4KXZI 4Q6KA 3S5LA 2IXQA 3TA4D 3RZWA 1B2WH 3CVIL 1GTFA 4KVNL 3FSWA 5DJCA 3IDMA 2AV7B 3EBGA 3RX8A 3ARBA 3QFDB 3IE4A 5I0VA 4L4VB 5LHDA 4R0LC 2GIMA 3BKYH 3V7AG 4BIKA 3VD5A 3BH9A 3QDHA 4AKOA 1R3HB 4MMZB 3I75B 3H9SA 5E51A 4HG4K 1UOLA 4CL7A 2XVLA 3AZUA 2UY7B 1IT9L 1ZSDB 2AMUA 3HS9A 4WWKB 3QWNA 1OM3L 3RNKA 4ZPVA 2P8PB 4OF3A 4OD2B 1JRHI 3W0WE 5T1KB 4J6RL 4POUB 1QW9A 5D70H 2VRQA 2JFCA 4PCSA 3OAYK 3QGVA 3UC0H 3V7AE 3WFHA 4WUUB 1JCVA 2YAQA 4IBLT 2WIIB 5I1CL 5K5YA 4KRPD 3WNOA 1F3JA 3IRCA 4MNGE 5DJXA 3U1QA 4V2CB 5B1CA 3WSQL 4AG4H 5D7IA 1ZIBA 3KYOA 1J0KA 2Q6WA 2CIKB 4XCYB 4EDWH 3DXAE 2EDHA 1SOXA 2VDLL 3BAEH 4HIJB 3BKYL 5DSCB 1IQDB 2W65B 3HR5B 1P5UA 5AWNH 5BMFL 4PPTA 4S0HA 3K2MC 2SEBB 1ACZA 1J05B 4P5TC 3O3UN 1MRFL 2H6PB 1SN0A 4TLKA 1G9NL 5EC2B 2Z8SA 4M7ZB 2VDNH 4PGCB 2IF7A 2PTVA 4OAWA 4M02A 5AKRA 3QQ9C 3ZTNH 1WA2X 1GVIA 5C07E 3K6FA 4LIQE 3UBXB 3DHPA 5D72L 3O6FB 5LGKA 5MENB 1HL9A 2WLLB 4MD5A 4F3FB 5LXGH 4P23B 3MJ9H 1J9RA 1UEMA 2IFGA 1L9RA 4UV4L 2XC8A 5LAXB 2B2XH 3BVDB 5ACMA 2IWKA 2YK1L 1L9NA 3D0LB 3MJ8A 2EILB 1H6FA 2ZP0T 3QK0A 3MA7B 4MD0A 1MVUA 5CZKA 4YXLH 3RNQA 5HPMB 1IJNA 1JTTA 3LMJH 2ZZUT 1Q90A 5KYYB 1DUZB 3Q8BA 1AZVA 4HZAA 3KPRB 3EADA 4ONHB 1JZGA 1GPOH 1RLWA 1DQJB 4UF7C 2BIMA 2PW1B 2NSQA 1CFBA 4OGAD 3QQDB 2D3NA 3GFUA 1JHLH 3KJ6L 5DZJA 4ODUB 3M17B 4B9GA 4UTBL 3GIZH 3VMNA 4JPWH 2YD6A 3CK0L 4OCLC 1GY1A 4TS6A 4WCYH 1A1OB 1XR8A 3QNXA 2Q3ZA 1F4AA 4FHKA 3WJLC 3WTXA 1ORSB 2VDOH 4LP4A 1ICTA 1IAKA 4XCCH 3ERXA 2JWYA 3SYOA 3ZO9A 4K15A 3KLSA 1UA6L 4OCSH 1BAGA 3RY5A 1NDGB 3T0VA 1G9EA 3F84A 4RWHA 1MPAL 3FTXA 4QTHA 1BXUA 2LE9A 1R5WA 3VFWB 4LSPL 3G6DH 3B56A 5I18L 5BZDA 1BV8A 4X6FB 2FEDD 2Y3NA 3FC8A 4YBQD 5FO7A 3QQ9D 1T1WB 4JPQA 5DC4B 3SGEI 4J3OF 3QEQB 1U30A 1SLVA 2HA1A 5ACLA 3QW9A 3M7OA 3ZR5A 4JE4B 1ZDQA 4I3SL 3ZZQA 2BZ7A 2F58H 2WLNA 3NIDF 5TH2B 3KM2A 1CE6B 1AQDB 4JHZA 1MJ7H 2KLSA 4X5XA 1HZLA 3E2HB 3NK4A 3UGEA 1KXQE 3RGVC 2C3WA 5CEZD 4LSTH 2VLMD 5C1MB 2ZP9A 4AEEA 4EN3B 1OAKL 1O7DC 1P2CB 4MNHB 4QYOA 2GHZA 4NKMB 3I75A 5DD5L 3D85B 4G6KL 5DGRA 3TJEL 5IG7A 2E7DA 3LHAA 2I5YL 4FJ6A 3GHEL 2BY2A 4DAGH 2GFBB 5HHPA 2XIBA 4M6MH 3WE6A 1EJOH 12E8H 4TSCL 4XAWL 2KUTA 4G8GD 1KYUA 3N43F 4L2LA 4UAHA 4ANWA 4Q89A 5A40E 1OCOB 1D2OA 5ERWA 3ZE0B 4AL8H 1J0JA 4C56B 5D6CB 2NT0A 1X7SA 3C5JB 4PP1C 3NZ8B 1OGPA 4AGMA 3QXAA 3A67L 4MJID 5LNDA 4XGZB 3V10A 4LRNL 2XNAB 3TASA 3MUY1 1PY4A 3ASNB 3HS8A 2KKQA 3FDWA 4QRPB 4N24A 2QMJA 3KHOA 4NGHL 5BZZA 2Q10A 4GQ9L 3PJLA 4YSAA 3A22A 4LKCB 1HQRA 4Z3GA 4R2GB 1I8IA 3GO1L 2KMWA 2L7QA 2Q3AA 3NMEA 4LCVA 2O26U 1S7VA 4UOZA 1QFOA 2P42B 1AJ7L 4HBCH 2F5AH 1WZ1H 1ORQB 4AXWB 3ZXAC 4AT6B 2VM3A 4R7VA 2DQFA 4XXDA 1JK8A 5I17A 1CLOH 1IKFH 4G6AD 4ENZA 1QI5A 4HPYL 4DVBB 3ROOA 3MLZH 4N0CD 3B2XA 3X14A 4LCWA 3IMRA 3TH2T 3TYGH 3ZGHA 4H2AA 5I1DB 1IMHC 4L9LC 4MJ6B 4X0KA 5DZVA 3KGUA 3BDBA 5TGBB 3U2SA 4YL4A 3KW7A 3ILDA 4LVHC 2ZOKA 2ATKB 2VDLH 4P2AA 3UEZA 4CC4C 1T7YA 3TEWA 4M9PA 2WW8A 5IFHL 2DTSA 3EZJB 5TDPB 4D0DB 3GRWA 4UCFA 1LK3L 1SOSA 4NQSB 4QDGA 1VFOA 1W8OA 1U8OA 2ATPA 5CBEB 2CRZA 2YS4A 1WIUA 5E2VL 1PMYA 4N8CH 1K3IA 2YKKA 3O3DA 2BSCA 5B1JC 1NCHA 2SODB 1I3RB 3OD3A 4ZD3H 1RUML 3R0NA 4TNWK 3DI3B 1KBGL 6PCYA 4JFFD 5D7JD 4X9HA 3O8XD 4GOSA 3RFZC 2IGFL 1H5BA 3V0EA 1X5JA 2KC0A 3RHWF 3K5SA 5BOJA 1WEJH 2BSED 2OR7A 1GRWA 2ZCHL 1Y1UA 3DUSB 2G5UA 1WAEA 2VXSH 1VACA 2CLVB 2DMCA 1J8RA 3GUTA 3HW7A 3QZLA 2J6EL 4OF0A 4FG0A 5KYWB 4G7SB 1BFOB 2Z7WA 2HVKB 5EU6E 1TJGL 2WB7A 1E43A 3VG9C 2R8SH 5FYJD 1AIFB 5IBLC 5FA3B 3WEBA 1JPFA 1KTCA 5DEZA 1LILA 1QHPA 2EDXA 3US9A 4I2XA 3BIBX 1IAIL 3D5OF 4ZFGH 1AI1L 4GO9A 4N9OB 1NCUA 4CU8A 1KJ2L 4K8RC 4HULB 4EE2A 5BRZA 4HZ1A 4PP2A 3S7GA 2NW2B 2NUTB 4EZKA 2UY6B 4M93B 1M3IA 4G6JL 1RSYA 4FNQA 1V3KA 4K07A 3G6JB 1D9KD 1AGCA 4KXAA 3ZL4H 3QH3A 2JJUA 1BD2D 5CD5D 3GSVA 5EU3A 4OFYD 3KMDA 1QLRB 2Y25A 4N25A 1CYWA 32C2A 3ASWA 3BQUD 3FAXA 4NZTL 5KANG 5GS2H 1LO5B 1HNGA 2JCCF 1MHCB 1GAFH 3ESVF 1I53A 2L7EA 4HKZA 4TVPL 2F7QA 4KOBA 1HSAA 5G2NA 3QFGA 3HNVH 1OSPH 3U6XA 2QKSA 4B97A 3LMJL 1H5BB 2NY1B 5E9DB 1CF1A 1AC0A 2ZOKB 2V2WB 4PGEB 4NBXB 2PABA 1G6RH 5MI0B 3QA3B 5MENA 3A6BH 2AJVL 2HX7A 3FU9A 2YC1B 5IW6B 2P8LA 5I8OL 1JGLH 5CJQH 1CCZA 3LD8C 1U8OB 2ATPB 1BOGA 3IFNH 4PJ5A 4XXWA 3HRPA 5K59F 1Q4NX 4Y8AA 5FX3A 2QEJA 5E2JA 4ZI8A 2K3HA 3MQIA 2Q8BL 4XAWH 1C08B 3TBCA 4CADA 3VXMB 1YMMB 4X6DB 1UA6H 2X2IA 4C58B 5C0AD 3QJSB 4GI6A 5MHSE 1MPAH 1JK9B 2W92A 2KBGA 5MERB 2YAPA 5AUMB 3II3A 1OE2A 4LLMA 5D5ME 4WF7A 1ADQH 1IGFH 3UAEA 4ODUA 3L3JB 3V4VH 4FQLH 1T5KA 5DFVC 2AP2A 2HG5A 5EBLB 5KG9B 3MLRH 3SBWC 2D7NA 3H7LA 3KCWA 4N4YB 3VUAA 3I9GH 3SGEH 4K5PA 3FT3B 3VAEA 1QQDB 2WJ5A 1QKZH 3T4AC 2K7PA 3AAZB 1HAUA 3L3KA 3W9EB 4OJYA 4I13B 3IK2A 2NTSP 4ZPVB 4R26L 3C6LD 3CXHK 4CC0A 3OGCB 1VZIA 1U9KA 1OAYH 5T3XD 2HKFH 2QDVA 3C60B 5A6IA 2IBZY 2AANA 4XO4A 3K1KC 4XNQA 3CSYB 2ADGA 1S6NA 2WLLA 1GGIH 2VLKA 4NM8L 12E8L 5AVUB 4LHUA 3Q6GH 1ZGLB 1FUNA 2JKTM 3GJEA 1INEH 1IB5A 1EFXA 1U95A 1L0XA 1IILE 1DHKA 4J4PA 2Y69B 4M7JL 4WTZG 5CSZA 3SZ6A 1TVBA 2BX5A 2PUQT 4D9RE 1KTJA 4F5CE 3IJHB 3O3EA 4LCCC 5JHDD 5J89A 1GCFA 4MJ5B 5ICUA 5AD0A 3LRHA 1IBHA 2HUEA 4EI5C 2WUBL 4LU5H 4HGMA 4KRPB 3MLUL 1TJHH 3WOVA 1O0VA 2MHAA 4O9HH 4Y9GA 1YNTF 2GBTA 3T1WA 4MD4B 2PCPA 1EMTL 4TQHA 4NZ8A 1D2PA 1DQIA 1JXGA 5L8JB 3NCWA 2ITFA 2RMNA 3CFJA 1Y18A 3EGXB 3EJJX 1MCOH 3NGBC 1JPGA 3Q05A 5DUML 2AQQA 2YAFA 5CD5C 4MA7H 4KJWD 2RA1A 2UWEF 2OLDA 2AXFA 2HFFB 1PFOA 3HB3C 4FTVD 4OGQC 15C8H 1WFIA 2ZYSA 3LRKA 3HFFA 2BSRA 2FLMA 4JFUA 4XBGB 1EO5A 3X1FA 3DI2B 1MFVA 2ZUQC 5D1QD 1QNZL 2AQ2A 4Z7WB 5F7UA 3D2UA 1TETH 4P8QA 1RCYA 2WZ0A 3Q43A 3B83A 2YA1A 5MP6H 5ESVA 4YS4A 3OPZH 1TJMA 2Y72A 4P5KB 1QR4A 4Z7UB 5IQ9B 4JL2A 5GGVL 3F7RA 4RAVB 3T3ME 5I73B 1HHJB 4NDMB 1NGYA 3U0WL 4N8CL 1NC2B 5F2FA 1JNNL 3OKLB 1NCAH 5FYKH 5KYXB 1RMFL 3HFML 1EEZB 1H8OA 1OARH 2AABL 4WGWB 2V6HA 2IH1B 3QQ3A 3MJGX 2DQHL 3ZL2A 3GYRA 3X3GL 4NC0B 5DJCB 3EOBA 3NIGF 4TSBH 2G9KA 3SE4A 4W9HC 4UILH 4WV1A 5CWSA 4BK4A 1KEGH 3C6SA 4LEOB 4YVUA 2APXA 3CBKB 1PZSA 4RZKA 1S3KL 4HZLA 1CU4L 3U9UA 4W70A 4ZX3A 1OLZA 4XB3A 3MV11 5HDBF 5D2NE 2XQBL 4IHBA 3V6ZA 1FLRH 3MJ7A 4K7PL 3EBIA 1YNLL 1PY9A 1OE3A 3KNBB 1YJDC 4GO6B 5DEFA 1SXSA 5K1NA 2W0FA 3V6ZB 4M62L 1CTOA 1Z5YD 4N5UA 3L3HB 2J56A 4KK8D 1OW0C 4FQPA 3P4OA 1BF5A 2WC7A 1NEPA 3SDAB 2MKWA 1Q9OB 2OI9C 3SJVD 2VDKL 1BQHG 4ADGA 5AVZB 4WUUE 1RUQH 2FIKB 4NPJA 1KGUA 4Z7WE 1LO4H 5IESL 3HB3D 4P2OB 2DYPD 3QWOA 5DHEA 1M9WA 3BGFC 5DS8B 4RRPG 2YSTA 5HGBB 4R7XA 3NFNA 4X4ZA 5HHXL 3X3GH 1UUNA 3BZ5A 4B9ZA 1KWKA 2L0DA 1J11A 3CFDA 1NFIA 2X6BA 5IB1B 4ODBD 4PB9L 2W60B 1BJ1J 3O6FC 1AG6A 2LT9A 4X9IA 1N64L 2WVUA 1U92A 5IUSA 1JFHA 2R56H 3FNKA 4J3OD 3HUJB 1RJZB 4GUQA 3PXJA 1K4CB 1MREH 3FTGA 2CO3A 3MR9A 2Q86B 5CEZL 3BH9B 4JUSA 2H0FA 1V10A 3NJKA 3MUZ1 1HEHC 4XCEA 2W9DH 3VFTB 4QOKA 4JHWH 1JUFB 1CF8H 2MIZA 5AZEL 4AQAB 2PKDA 2E27L 4ZUSA 4JQVC 1MNUL 4KFZC 1MNNA 1BZDA 2WBJD 5EBGA 3VGFA 4DP0X 4H8WH 4LLWB 1GC1L 3MV01 1PG7H 4I1NB 3FCBA 3FZUC 2CGZA 1UWFA 3CSTA 4BH8A 2NR6A 1JTPA 4KK8C 4XCNB 1A9BA 4GQRA 1IVLA 3MOAH 4HIHB 4LK4A 1NPJA 1DVTA 1R3LA 3V4VB 3FU8A 3DO7A 1X7QA 3VO0A 4JHAL 3FUFA 1Z6JT 1ZWIB 2VMDA 5FA4B 3QA3A 1IEHA 1A6ZB 1KBKA 4PJFF 3OG4B 4X6CF 1ADQL 3QIUD 4YDMA 5JNYB 2DM4A 3SPGA 4E42B 4XNZB 4RDQG 3REVB 1I8MA 5DRXB 4E9XA 3WIHA 1L7TL 1BIIB 3PWNB 4JRYA 5AYUL 3EDJA 5E8EB 1KIRA 1OB0A 5D5MA 4ADJA 1X5GA 2P43B 2XTJB 4KK5D 3PAZA 4Q6IB 3C87A 1WUNT 2ZD0A 4B9YA 5HYFA 4PD4J 7FABH 3QZWG 4QRBA 3B2VH 1EDHA 3C6LB 4R5TA 2QT6A 3V7MA 5AW5B 1VZHA 4FEMA 4HCRA 1F8TL 3APDA 3JV6A 4L8DA 4QY8B 1U8LA 1XGRA 4LPTA 5F96H 1I9IH 3UOAB 4DKFH 1U6AH 1OVZA 1HCZA 4GSXA 4WI9A 4OLXL 3SO3B 1NGWB 1P7QA 2QFRA 2Q7YA 5GPRA 1DQDL 2IDQA 1SY6A 4KNUA 3AQYA 3PE9A 4XPGH 2A6IA 4RIRA 3S3PA 1WTLA 3DSFH 4AITA 1TQWA 1PSKH 4NCDA 3WNPA 3VM5A 1AZCA 4QMEA 4PJFE 5ADPL 5DU7A 2WK2A 4JRXD 2F58L 1YNKL 2VXVH 3CZSA 4LHQB 1GS8A 2VZTA 1VADA 2QPDB 1ITCA 3BVVA 3P2DA 1AGDB 3PJSB 3NTCL 2ZCLL 4JZNB 4Y2OA 5L2JA 1IGTB 1F1GA 2UZYA 3CXFA 3O45B 1FO0B 3FQ2A 1XF3A 2XJKA 4NKDA 5FK9A 1OTSD 1LWJA 1EZSA 3GHBH 4FTDA 5I8KH 4C4BA 1MI5A 3EYOB 4PRIA 1ESOA 1XF4B 3DBSA 3FQTB 1N0LA 1MG3C 2FR4A 1FZJB 3L1GA 1LO0H 4Y1AE 1BLNA 3C8KA 2EO7A 3LHPH 3FT1A 5CLTA 4MDJB 4YSEA 1QSEA 1AMYA 2XXGA 3VFNB 5B3JF 1U6AL 5FYJU 5DMKB 2CKBL 2YSSA 4LLAA 1OQOA 4KZDH 2FLRT 4WUKH 1RU9L 1E7VA 4KK5C 2X4QA 3X1NA 2EDFA 4IHOA 1UUSA 2N01B 3HNSH 4TN9A 1S46A 2R1YB 2AGJH 5J6GB 1PZ5B 3S4SA 4YBHA 2VXUH 4DO6A 1JWUB 3UCQA 4PMFA 1SY6L 3G5ZB 4L1LA 2CO6B 4XT1C 3TTSA 2WXRA 2IOIA 2VDPH 2BP8A 4KUZH 3RJDA 5C9KA 4HUVB 2PO6C 1E6JL 3IKKA 1E3ZA 5HI4D 3ULUC 2JIXB 4FZ8L 1W0WA 5ABAA 1BQHA 3VNYA 4R7DB 2D7TH 2BS71 2ZUSA 4GXFA 2C9VA 2NCMA 2OYLA 4FKEA 2FLBT 4XMLH 3TXAA 3QH3B 2A9MH 1HEZB 4TTDD 1KTDA 3G7TA 2IMNA 1HZKA 1DL7H 2B2XL 3LNHA 4JQXA 3T0EB 1A25A 3ZKXB 3VRJB 2AERT 4XPFH 2CDEA 2VL5A 2P5WD 2ENSA 1D5IH 4MA1B 4PUBH 3S9DB 3OKMB 4K2UL 5IJVA 1XHHA 5T8IA 2EXWD 2HT4D 4I0CC 1TFHA 2PPAA 4N0FB 1AO7A 3GMOA 2XN1A 4MA8H 1YSOA 2NY1D 5E9DD 4YHML 1AS6A 1GH7A 4DKFL 2R56L 1T2JA 3SKOB 3ZJAA 3JWDH 4GBXA 5I28A 1SXNA 4G8GA 3E1F1 2FJGA 3MLXL 4YBQC 4F2MB 4FL4B 4BZ2H 3Q1SL 4HUUB 4RAUB 3WHXB 3FF8A 3GK8H 1FORL 1YYLH 3QXDB 2UZIL 3IJ7A 1A6UL 4PJAA 2ICEA 5DJYA 5KTEH 3TBSB 2C1OB 2DD8L 4O2FB 2CUIA 3FQUB 4IOSA 3IPFA 4MBOA 2VN4A 5HJ3B 2VDQL 3HNTL 1SJEA 4HFWA 4KK9C 2DICA 3N41F 3EFOB 2EXYC 1H15A 3CHXA 3IMTA 1A5FL 1EGJL 3FCTB 4MAYA 5L88L 1QSEB 3DECA 4JE0A 5IESH 2APSA 4PTTB 4MNQE 2XZAL 1XXFC 4WSKA 2RAMA 1OPOA 1U58B 1XCTA 3ARFB 3QXTA 4RMTA 2P24A 4NKIH 3IMWA 4ODWA 4M93C 2YAEA 1J5CA 3EO1A 1R3IH 4GKNB 4LSPH 5SV4A 4YO0A 2OTPA 5F0JB 4HK0A 4TTGA 1TTUA 2ESVD 1K8DB 2ID5A 2G60H 1L4IA 1FNFA 3HLKA 4LO9A 2V8LA 1FIEA 3CU1A 4JZNA 5FO9A 4K8RH 3WEAA 2O5YL 1YY8A 2FB4H 2NY7H 2ZKHL 4WFHE 4GP5B 3QDJB 4PM1A 1HCVA 1JRHH 4HCFA 4L8SA 3WFDL 2W9EH 1SJEB 3I9IA 4EBQH 1LWRA 2NUTA 3WN5B 4JQIL 2CR0A 3EYQD 4UINL 1RUKH 3S8FB 3D7PA 3EFDH 3T5WA 2YAMA 2VDRL 2Q8AH 4ELMF 1AE6H 3IDJB 3FO0L 4UTAH 4S1QH 2WBKA 3MRLA 4ZMXA 4JPIA 4HVBA 4OCXH 4Q6IA 5CP3A 3DJ9A 3OAUL 3UZQB 3E0GA 5L0QC 3INUL 4LEXL 4HEPG 5FFGA 4GI8A 4JGUA 1BECA 5LBGA 1S5IL 3VRIB 4HJ0D 4AQ1C 3VWKD 3WXVH 2MQ0A 5DRXA 3MNWB 4IMLB 2UV3A 1W80A 1SQMA 1I1RA 3MTRA 1KCRH 3R4RA 2PLTA 3D3VB 4JG1H 4L5FH 2R4SL 4F5CA 2LTQB 4JKWA 5D1XD 4GRWF 2P46B 3QYNA 5J57B 2F1EA 4EPSA 4OFVA 1SM3L 1GKEA 3VU1A 4LLVB 5JOFB 4FKHA 4JPKL 1AO7E 3PHOB 1W72A 1YN7B 1T0NA 4F7MA 2ARJA 3NQIA 3EYVB 1F3DH 5JTWA 3T65B 4P4RB 1FHNA 2XWJA 2EYTB 4AQEA 3QSKB 3KLAA 4Y2DC 2QPEB 1FBIH 3PDDA 3GXTA 1L6XA 2VDOB 5GGRB 5J6GA 3UTZB 5INDA 4XCNA 2XQYK 5HI4C 1R5VB 2NR6D 3HZMB 1U21A 4C4KT 1C7SA 3JTSB 3HG1E 2D7MA 4ZXBA 1II4E 5INCB 4PWFA 2R4RL 5EORL 4UQ2B 4U33A 1K8IA 4HJSA 1A4KB 1QVOB 4HIPA 1RZKL 1JDDA 4I9WE 1I9IL 5TDOA 3MFFB 3D39D 4F9LA 2BRRL 2HXAA 4QYAA 2C3VB 1BAFL 4OJAA 5D7KD 5LCVL 1DQLH 4EOWL 1T80A 2PCXA 2Y36H 3QRGH 2R2HB 2OTWA 4Y9FA 5CCJA 2YQGA 2BIIA 5HYIA 1KJ2B 2P1YA 3U4AA 2OZ4H 3LEVL 3ILPA 4JFPA 1IGTA 4ZTOH 3B7TA 4R2GD 3VJ6B 2XIIA 5E1HB 5AVWB 1NGPL 2BIHA 5I76A 3NSFA 1NZRA 4FI8A 5JZ7D 2P5ED 2MMXA 2ZCLH 1KYAA 2NLJA 4HIIB 2DH2A 2I26N 3QUXC 5BQDA 3M7FB 4BE5A 4H40A 4LPCA 4G3YH 4F8QA 2I60H 3BDXA 3PV7A 4R9HA 1ZHLA 4RGNB 1VFUA 4DEWA 1XTMA 3GPSA 5D9SA 4TULH 4LHUD 3QE5A 4PUBL 3D08A 3GZKA 3DIVA 3BWZA 3I9AA 5F1NA 2X4SA 1KYFA 3S5LG 3EYSH 4PG2A 3T0AA 3SKMB 5M95B 5MENE 2VERN 1FRGL 3BVNA 4ODVH 4OCWH 3RWHA 3VD7A 1E5ZA 2AJXH 2OMYB 3QULB 3OF6D 3KYMB 3VFUB 1E2VA 3MRQB 4S1SL 3AJ7A 4M5ZH 5C0BA 3QUYD 4JDZB 1VA9A 5DHVA 4AIXA 4KXDA 5DRNA 2FQFA 4FQIH 4PRPA 2WBWB 3SPHA 2P26A 1TVHB 4PJXA 4AZUA 4QRPE 5C0IA 1ILUA 4LOVA 2NT1A 4YHPA 4QIRA 1MCFA 1WDAA 4S0SD 4OLVL 3DIFA 1OAXL 4HWUA 1XT5A 2EDOA 4QXTB 3PHOA 3S34H 3ZDZF 4AIEA 4J3TA 4PRBA 4FQXA 5E1IA 4L4TD 5CJXC 3S3JA 4TMPA 4FJYA 4OI9A 5LBSL 3BXNB 5DJ6A 2ICWA 1NIDA 1MW2A 1OD9A 2P5WB 5D1ZI 4GAJH 4AG4L 4MCYA 2XG5A 3IAGC 1WT5C 4ZT1A 4XWGL 4M61A 4QJ5B 5BRZE 5FW8A 5C0BB 4XN1A 3EYUL 2CDGA 4OLZL 1MW0A 2MCPL 3M07A 4Z7UA 2XWCA 5IQ9A 3QRFM 4M43H 2ZXEB 1DQLL 5FYLD 5E4IA 3FN9A 3NRQA 4WO4C 1DVFC 1JGEA 1IFHH 3PGFH 4NHUB 4KO5A 3P3YA 1URLA 2CHXA 4WU5A 4Y5XB 3V6BR 4P3CL 4YK4B 1M2VB 4PS3A 3WFZA 2O6FA 1JGLL 5CJQL 3STLB 2CGRL 1JZ2A 4XHQA 1G84A 3ETSA 3BH8B 3EGSA 3S36X 3W9DA 1U4EA 3RTLA 3APFA 3L3DB 1KGWA 5IMOB 2CCVA 4IK6A 4Z7AA 4NPYB 1JVKA 5IBTH 3SDXF 1RZFL 2WXPA 3H3BC 4QHNB 5EU6A 2FNWA 1MVUB 4ZUTB 4OZFH 3TH3T 4Q56A 1MIML 2NDGA 5J1TC 4K7FB 5L9DL 4PG2C 1EJ8A 2EH7L 1TPXC 1CU4H 3ZBMA 5CR1A 3VDBA 2A7BA 2X1XR 4J39A 3T2NH 3KPLA 3HI5L 1T22B 2CO4A 1TZIA 1MRCH 4MD5B 3Q9PA 4Z76A 3P1VA 4RZCB 4FG4A 4JY6A 2AEPH 4UQ3A 4JKLA 4K3EH 3V0HA 5B38G 2BOCA 4OCWL 2FO4A 1ET7A 5HJDA 2J73A 5L4FA 1J12A 3QUXA 5IT2H 1GJIA 1SJXA 2QTVA 5EPMB 2B1AL 3U9PH 4UI2A 2VLKB 4OV6F 1YEKH 3GJEB 4UQIM 4BQ6A 2F0CA 1F42A 3MXVL 3A4AA 4LRIC 3EFOA 2OSWA 1F6AA 5I1IH 2BY3A 5FUOH 3S5LB 2O93L 4JAMB 3N40F 4C8XA 3WS3A 2ZQKA 1O9ZA 3L5JA 4DW2L 2JNZA 3ARBD 1BJ1H 1RUMH 4NWTH 3QUKA 3GZOA 1UOVA 3CSFA 2J5WA 1G0DA 4OTXL 5K9OA 3OGCA 5DDHA 1G7HB 5A2KH 3VXMD 5BQ7A 4B95C 5A1AA 4N1CA 2KZ1B 2A83B 4P46B 4J3BA 5JPMB 1SEQL 1MQKL 5GSRB 1LEIA 2HB0A 1QHQA 3VWKB 2FAUA 5DJXB 4E9RA 2HG5B 5EBLA 4OB5L 3PABA 4HWBH 4TLSA 2WP3O 2Y36L 2Z31C 5KSBA 1E5CA 5CGMA 4DO5A 2PWGA 1E4WH 1U8NA 5D1XB 1FN4B 1OTUD 3QDGA 5C07B 5CEZH 2XWTA 3FQWA 5C0EB 1DBJH 4N20A 3CMOL 3UTOA 5GS2D 3IS1X 3TPUA 5C9JB 4KROC 4U6XB 2IH9A 2YZ8A 2EAEA 3BN3B 1ZSHA 1BG1A 3VXSA 1QFWI 3TCLB 1UB6B 3PWVA 1A6TB 4JDEB 4PTUA 1R75A 4L37B 4F2ME 5DK2B 1L5GB 3O11B 2EYSA 4DZBB 2R2CA 3RFZB 4JY4B 2LU3A 3PXHA 3TJEH 4WTXA 1TZHA 5ISZB 3ULVC 4PJDF 2PXYD 2P5PA 1ZLEA 5TDOB 3X17A 4NQED 1AGFA 1I8AA 1E6OL 3HRZA 5DYOA 4AQ1A 3A4DA 1XGTA 1L6PA 2ZOOA 5HXMA 1KYDA 2XX0A 3HI1A 5EEZA 3VFGH 1JXFA 2Y7OA 4W9JC 2WO3B 1PKQA 3LIUA 2WVTA 1AKJA 1QFWL 1DR9A 4G9DB 4HWZB 4KKAC 3B3BA 5JXAL 2W95A 4JFOA 4CDHA 3DK0A 4JO5A 2BY1A 3HG2A 3KL5A 3CGTA 3QO1B 3WGVB 2A1WL 4GYBA 4JS7A 1F5WA 1ZTXL 1S7SB 3RIAK 3ULUE 2D0HA 1MWOA 4LSVL 1B0IA 3P9LA 5IB3B 1D5RA 4ZS6C 5B7EA 2BW5A 1IC4H 4LASL 4X0NA 1N26A 3FOMA 3LKQA 4ORGB 5DTFA 4YSQA 3TN0B 2WWOA 3OX8B 3B4NA 3TO4B 3PL6A 4WGVB 3H9HB 4F1ZA 4HFWB 3BVUA 2UY6A 1SJVA 4U7MA 2YHGA 3KLLA 4JZOA 3LSOB 1GHFL 1S8DA 4HKJB 3UXFA 4KAQH 4YR6A 5I2IB 4ZQKA 5D2NC 1MQKH 4NUQA 2I9TA 5T1LB 1FFNB 4BQCA 1EO8H 3L13A 2FJGB 5J7CC 4G8GB 4G1EA 5AKSA 1BAWA 2VDML 3ECUA 3DUUB 3E2HC 5DUPL 1P6FA 4ZO9A 3E8VA 4HEPA 5F9DC 4YO0B 4CKQA 3DX2A 4M5ZL 3O9WD 4HQQL 1M6UA 3ULVD 3MN8A 3OKYA 1YEIL 1FFNA 3WMQA 2E7HA 1U8CA 5MI0C 1MI5D 3MLRL 3MI6A 2XT1B 4O5LH 1B4TA 1S78C 3T0EA 1U3HB 4Q2ZB 1C9SA 2XQYA 2ICEC 3QARA 5GS1C 5KYWA 3DDGA 4E41B 5CR8A 2WVVA 1J18A 3FSZA 5TQ0H 5DMJB 3A6CH 4GKOA 1E4KA 4WI8A 3QUZD 1LO3H 3JWOH 3LB6C 4GBXC 1T4WA 4K7PY 4P57B 3FZUD 3OR7A 3FH5A 2W59A 7TAAA 1ZTXE 1HILB 4HX1A 1WE5A 2WXNA 4NN7C 4M5SA 1ID2A 2NYKA 2PP8A 3Q8FA 1PZ5A 5E2WL 3S4SB 2NX5E 2B4CC 2P3YA 2W38A 8FABA 3T0DA 2MRYA 3LEXB 4HJ0C 3MBEA 2MCPH 4UOQA 2PW2A 2LFEA 3ATEA 4G43A 5K9JL 2EINB 2NY2C 1L5GA 1I1AB 5IROD 4AEHH 2OR8A 3VXRD 1KIUB 4PVLA 4X0KB 3FB6A 3FFDA 2EH8L 2PO6A 1UASA 1KJMB 2B59B 3GRBA 2PNDA 3PWUB 4Z0XB 5FM4A 5EZOL 2LVEA 2AXHA 1ETZB 2OPCA 3NA4A 4PBVC 3TIEB 4UMSA 2HKHH 2YPVH 4PJGA 3FQXA 3QEGH 1KFGA 5BRQA 3UAFA 1MHPL 4OFPA 2HLEB 2UVFA 2DJUA 3K6NA 4HKZB 1VGKA 5FK9B 4FYTA 1KCBA 2AXGB 4UM8B 4RISH 3EGDA 1J48A 3F62A 1P7HL 3FUJA 4JFDE 4RVBA 1AO7B 1JK8B 2VLJE 3C5SA 5EF1A 1BLIA 1FAIL 5TF0A 2YGPA 3BP4A 5CGYD 3UABA 4ZSOB 4J3OG 5BUAA 2O61A 5EZIL 2CLZA 3QEUA 4XNXH 5JPMA 3GEFA 4LZKA 2DBLH 4UB0H 3ZE2B 4W9LC 1OP3H 1SFDA 4D9LL 1QG3A 1CD9B 4HKBA 3DKHA 5D7IF 3V4PL 1GGBH 2YSSB 5I1LA 2NPLX 3MTXA 5DHVH 5GGUA 1HHKA 4G7YH 4APQD 1N8OE 1U3HA 4Q2ZA 4JJOA 2B1HH 2XKNB 3H6JA 3L45A 1JG9A 3I6GB 5C6TH 4C83A 3W0WA 5C09B 1JHTA 1KOAA 4XE0A 4HHAA 4ENEC 2OMZA 4A7VA 4IKLA 3WBDA 5E5MB 3GM0A 3ECQA 2CHWA 5KUMA 3W56A 5IHBA 2H3NB 5FA3A 3VM7A 4L3CA 5IMKB 5BO0D 2YFNA 3MV8E 5I16A 1CN4A 4ZAKA 3V0FA 1AR1B 4HX1B 3MMEB 4WFFD 4Y2NA 3LXAA 1ZLSL 2EEXA 1KLUB 1NWOA 1QNIA 1RQ5A 2BP3A 3ZKQD 3GMRA 3FFCE 4NPKA 1HXYB 4A7SA 3T9WA 5EBWB 3REVA 2NY5H 1J9CT 1MRDL 2W9LA 5KANI 2LLGA 1N0LB 4MQSB 3QJOA 5C0CD 4HOZA 2ZUTA 1SDDA 2H4EA 3AB0B 2DYRB 3V4VL 1WZ1L 1KNOB 2EIMB 4K3JL 1MCIA 2BNRA 3QAZC 2ZXCA 3O3AB 1T1WA 4BA8A 3V0IA 2JJTC 1GL4B 2YWYA 4NUPA 1T2QH 3W5NA 4J6IA 1R6VA 1TLMA 5HI5C 5ANMB 4DZBA 4G1EB 2Z4QB 4K0OA 2VW4A 1URIA 4DQOH 3AXIA 3WNKA 1DJZA 3T8MA 5EZLA 1EUTA 2CKNA 3C9NA 1RIVH 3GTNA 3NJLA 4J2QA 1YEJH 5ELIA 4CNIA 3DK2A 1KB9K 1QLEB 5KBPA 4JRWA 2O72A 3J7HA 4P2YA 3UG5A 3ZR6A 3AMKA 3MBWB 4D0BA 1O7SA 3RWCA 4AV5A 1XR8B 5E4EB 4DFHA 2M26A 4NSKA 4BFGA 1GYWA 3RTQA 1WBYB 1U8KA 2R4SH 2NY1C 3QIWA 4X5PA 1DBAL 5HHOA 1UENA 5CMAB 4AYDC 4BSJA 2MTPA 5AB9A 5CN3A 1P4IL 4W4OA 5I8EB 3HZVB 4N0UB 1JNHB 2N56A 4X6EA 4XNMA 2X4NA 1Y6NR 2ORBL 1DBKH 3Q9QA 1W91A 2M8XA 4LQFL 5JIIA 2DI8A 5H2BA 2VISA 4U6VL 4HUNB 4WTZA 2EUXA 2CDGB 1C16A 1A2YA 3LD8B 1XAKA 2X2HA 4LARL 3H6AA 4DK5A 3PWLB 5JQ6L 4P4KB 4DN4L 4EZJA 3MV9B 5DURB 3ZHKA 3RAJL 3MLTB 4PCKA 1M4KA 2DIAA 3IJHA 1F6AB 5F1SA 3DXAA 1JUFA 1TF4A 1YEJL 2OXGB 3U7YH 4LIQH 2NY4B 3CHSA 2BMKA 3QULA 1O75A 4ZUWA 1FG2A 3BI9X 4E9YA 3L08A 4IU2B 5ID1B 3MUGA 4PY7B 1GTNA 1T4KA 3MV8A 3VGAC 4Y4FA 4BZ2L 1VGEH 3QNZB 1MFEH 4YHLH 5JHLA 3HE6B 1S7QA 1R34A 1PIGA 1EEQA 1QNZH 2WANA 2P49B 4Y4KA 5ITBL 3LV3B 2R29L 4L5FE 5TF1H 1EHLH 1DJIA 3PWLA 1XTLA 4EIBA 2NLJB 4HIIA 1R0AL 1T1XB 3NRPA 4QWWD 4NENA 4EUPH 4FYQA 1S7WB 1E2WA 1UZ8A 2DRUA 1OW0A 4WVRA 2GTZB 4WKZA 5HGDB 3W5MA 3QNFA 5IEHA 3Q13A 3MYZA 2H6OA 2FJFA 1Q0XL 3ZO0A 1U8IB 3B7UX 1KGCD 3V4LA 2DTML 3OMIB 1DQMH 5G5DB 4Y19D 4AH2B 2BSBA 5GXBB 5CLZA 2Q2EB 2BVTA 3CH1A 1RIVL 5IEHB 4OD2A 2W60A 5L6YH 3O6LL 2J6EA 3E38A 1AXSA 3HHSA 4I7ZC 2FX8L 4KJQC 5H94A 2VZUA 2FYYA 1WZLA 1T5WB 3OJMB 5FGCE 2OMVA 1PL3A 3LKRA 3MRNB 4M5YL 4YFDB 2H45A 3II1A 1QACA 3MRRA 3UX9B 4CADB 4XH2B 2F19H 4TYUA 4DETA 1NM9A 5JQIB 1T7VA 4HIEB 4MAUH 4G7YL 4PRPD 3RWJB 4HDIB 1ZHBB 4PR5A 3IU4H 4U6TA 4HZLB 1FFPB 1PSKL 2FIKA 4DOHB 4PYHA 4DPBX 2F53D 4GP4B 3GB7B 3NJFA 1H0DB 2WO2B 4LOUD 4WWKD 3EOBB 2VDKH 3JV4B 1RFDH 4S1RH 3GSOB 4F7CB 5FKPA 4JDTL 1KY7A 1ILSA 2OTUA 3QFJA 4ZOEA 4A63A 5K9KA 4F7KA 3ARZA 1V7NL 4WWID 1I75A 1OE1A 4I77H 5D2LE 1G9MH 4QHUB 1NDMB 3C6LC 1YMME 1PDKB 5IVZB 4P4KA 4P2RB 3UYRH 4FQHB 4RGNE 3U4EB 5CBAB 1KGIA 4GAJL 2NYZA 4Q14A 3MRFB 5F9OH 3V9FA 1X4XA 5C0RL 4JKPL 3VGBA 1NCCL 4U1IA 3H7BA 4FI7A 3OZ9L 5E1GA 3I9GL 1O6VA 1RK1B 4LSDA 3BVNB 3ASOB 3UP6A 2X6MA 3NDYE 1MREL 2PYED 4XTRD 4LMQE 4OZGE 1HKLH 3QZPA 4WIQA 4Y5XA 4APQB 1SVCP 4I88A 3HVNA 3VXUD 5DFWH 2GJ6A 2V17L 2ODHA 4JBSA 3I6LE 3L95B 3D8MA 2ED7A 4B9PA 5MEOB 4P3CH 4JDZA 1Y18B 2JCCE 2BVOB 1OSYA 2MH4A 3X1EA 1UM6H 1RHHA 1V05A 3VD3A 3DGCR 5JW4N 1MAML 4J4PC 3T3MB 2JE8A 2D03H 4L1DA 5JPNC 2ZWZA 2LAAA 4KH2A 2G3NA 3KPQB 3X1BA 2UWEE 3RU8L 2IANE 1T1ZB 5D71L 3S37X 5FO9B 4MJIE 3MJ9A 3AW5A 4LDEB 5C0GB 1OB1A 1V55B 3P4LA 5D9SB 1U95B 3V5DA 1X5FA 5A3ID 1KCVH 4LRNH 1ZHLB 4JFEA 5KOMC 1KNOA 1N67A 2HLAA 4YGVB 1YQVH 4NO3A 2WXKA 3W1ZA 4JFFA 1U58A 3QWRD 5D7JA 3WNIA 1QSFE 2OI9B 2LLNA 1T0OA 1Q1JL 4QI3A 3VRLE 4NJ9L 3WD5H 5HVWA 3T4AA 4I8DA 2VITB 3D0VB 5AD0B 2C26A 1UTDA 1FAKT 3SDCC 2K8MA 2X0UA 2Q3XA 3NCYP 5TDNB 4YWGH 3RZCC 3SBWA 1K8DA 2HFTA 4OQTA 4OT1H 3MRQA 4XVSL 1IKOP 1LK2B 2C1OA 2DY2A 3I6KB 3O6KH 1A4JA 1EX0A 4LBEB 2OMWA 4TULL 4UOW1 3EF4A 4G42B 2D9QB 3WN6A 1QQDA 3HLAA 1X5AA 3BPCA 1W72B 2C9RA 3Q5TA 3VI4E 1FH5L 2FWOA 1WA0X 4NERA 4UV4H 5SWZB 2P47B 5IW3A 4NP4L 1CLZL 5IY5B 2NTFA 4JFQB 3KL3A 1ZA3A 2JKSA 2X6VA 2KDYA 5B38B 3H9SE 2XZQH 2A9NL 4JRYE 4Y1SA 3VRJA 3D6GA 3V6OA 1DEEB 4LEEA 4NUJB 3S4SG 3OMAB 4XXWC 4YDLB 1A2YB 4NJAL 3KLAB 4X6DA 2J2ZB 4ABWA 3FCSA 2GEEA 3M6DA 4RMUA 2BVUA 5K69A 3F7VA 3GGWA 4IRZH 5EA0H 1IGCH 3KPRE 4WU7B 4AC4A 2FTAA 1HINH 2APFA 1JZ7A 1U8CB 4EIUA 1T5XB 2BNRE 2F1BA 3HHRB 3BFOA 3EFDL 1L3WA 2DQTL 2G4GA 1DQML 1FL5B 1X5YA 1KLFB 3L1FA 5C0DB 1TQSA 4F9PA 3MBWA 4K94C 4TOYH 1JZ3A 4QTIH 4BCZA 4KVNH 1JF1B 5AZ2H 3IGAA 2FEEI 5D1ZB 4ECNA 5IOPB 4M62H 3L6FB 1YPZB 1QZNA 1I7ZA 3V52H 2JV6A 1FNSL 5DA0B 2WLKA 3E1ZA 1JPFB 3S35X 1FDLL 3T2PA 1AACA 3PV6B 3WE6B 2YXVA 4JN2A 5CIPB 3QUYB 4HALA 1IZKA 2VUYA 5B39B 1IGIH 1A4JB 3ARXA 5HI3C 4A7GA 3CQFA 4HUKB 3R18A 3NCJH 5D4JA 2X1QA 5F0MB 5C0AB 5ICZA 2G2RA 3FTWA 3T4YB 3CMGA 1BD2E 4GRWB 2PN5A 2MQ3A 1I3GL 4UNTA 3CSPA 5DJ0B 3VU2A 3EOTH 5C0FA 2Y7LA 1HINL 2ED9A 5CN2A 3MX0B 3GSNB 4JO8A 5FOBA 2AVFA 3U48A 3K0WA 2HVBA 3VFNA 2R7EA 2ESVB 1HI6B 2YBRB 3F05A 4JR9H 2GY7B 5E94A 5J12C 4NKOB 4CDGC 2V2TA 2CBOA 4U1NA 1WFTA 2DLIA 5SX4H 2ZP8A 1TZ8A 3VFSA 1QSEE 2ICEB 2YKLL 1H3PH 1MZZA 4U1KB 5DJYB 3G6AB 1D6VH 5BXFB 2ZKWA 1YZZA 4DP9X 4N6RA 4CN4A 3UP1A 4CJ1A 4JRFA 1U8LB 1XGRB 4X98A 1RZIA 2VZSA 4PJ9B 3T77A 1Q9LB 4PRIE 3LQAC 1PG7X 4AKQA 4YDNA 4UT6A 4MAYB 3A67H 3MROA 3ZT5A 2UWEA 2DQEH 3DETC 4PEEA 2WZAA 2A2QT 5C09A 4IIZA 4NKQB 4C83B 2NXYC 5I1DA 5BV7C 1BYNA 4LVEA 2XPGB 3GBML 3L95A 4V1DE 3KBHE 1NMBL 3F01A 4G59C 3QPQC 1Q94A 3FQRB 3FQWB 2AJSH 1GR7A 1NBZB 1ADWA 1EZVY 1OPGL 2WQVA 3LKNB 1CXIA 3O3DB 3IGKA 5DVPA 1QSZA 1DUZA 5G55A 2H9GA 4CC4A 1EGJA 4PLKD 2IBZX 4U1IB 5SWSE 4LEBA 5L2KD 4L9LA 2WJ7A 5CHNB 5HD8C 1QRNB 3O2WH 1IM3A 2Y5TA 3P77B 1BSIA 4HIHA 3P4MB 4P2QA 4F9PC 3VGHA 3K6SA 3BHBA 5AOKA 4RDQF 4X5WB 1ZMYA 2I9LB 3C5ZB 2P4AB 5FOBB 1AOZA 2E6PA 3L48A 3V0WL 1SYVB 2V9RA 3VFOB 1QO3A 1WIOA 1NAMH 2PO6B 4QHLB 2NNRA 1UYWL 5D2LF 5FHBH 2VZ1A 3HRZB 5IREA 4UQAA 1YUKB 3HTLX 4I85A 4U1LB 5I75B 2IH8A 3HI1B 3GSOA 3BP7B 4KMQA 2VIRB 4CN1A 4ANVA