4AXWA

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1- 2, form i 2.2a.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4axwA02
4NQQA 2WCPA 3Q2WA 1WYJA 4NUMA 4ZMWA 4NUQA 4ZMZA 5CZRA 1SUHA 3Q2NA 4ZTEA 4ZI8A 4AXWA 5JYLA 4AQEB 3UBFA 3UBHA 3K6FA 2QVFB 2OMWB 1Q1PA 2OMYB 2WHVA 1L3WA 1OP4A 3Q2VA 3LNHA 3LNFA 4ZT1A 4APXA 4ZMPA 4AQAA 3MVSA 3K5RA 4ZMYA 3K5SA 3UBGA 1NCGA 3FF7A 3LNDA 2QVIA 4ZMVA 4AXWB 3LNGA 5DZVA 2OMXB 4ZMQA 2YSTA 1FF5A 2EE0A 3PPEA 4QD2E 4ZMXA 4ZMTA 4XXWC 2YQGA 1EDHA 3LNIA 4ZMLA 2A4EA 2OMZB 4APXB 2A4CA 2WD0A 4AQAB 3K6DA 4ZMNA 1WUZA 4XXWA 4AQ8C 2OMUB 2O72A 1NCIA 4AQEA 4OY9A 1NCJA 5CO1A 3K6IA 1ZXKA 4AK1A 2OMVB 3FF8A 2OMTB 5JYMA 3LNEA 4AQ8A 5KJ4A 1NCHA 2V37A 3Q2LA 2X2UA 2WBXA 4NUPA 3QRBA 1O6SB 1ZVNA 4ZMOA
chains in the Genus database with same CATH superfamily
3V95A 2E4TA 3TBYA 3VSTA 4ODXB 3EFOA 2AK4D 4X7SH 3VMOA 3V6FB 1G7JB 3IDJB 5GRVK 4JZJB 1RJCA 4BK5C 1FE8L 2DBJA 3PXHA 5T1DH 1A0QL 3BUQA 4N3TA 3P73B 1MCCA 1CQKA 4NKIL 1ZHBA 5IFHH 4A7SA 2J55A 3MGOB 1H0DA 3ZKNC 3CN0A 4NZTL 4M3HA 1I8LA 1I8MA 1CGTA 1Y0LB 3BCDA 4HEPG 3QJFB 3MRPA 4FMFA 5DS1A 4TV3A 5AW2B 5I2IB 1BQKA 4LDCA 2BNUB 1KULA 4PJCA 2OMWB 3WLWC 2VR3A 4OIBA 4PQXA 1U3NA 3AMKA 5KVGL 4X9IA 1SLUA 1DEEB 2VN3A 1KLUB 4RZCB 3WEMA 3C60C 2X89D 2IPUK 1VFAB 4C59B 1E6OH 1A1MB 2DQEL 1A4KA 1ZTXL 1UA3A 1ZT4A 4L3EB 4NENB 1MCIA 3TIDB 1JIBA 2PPCA 2PCFA 3H54A 4WW2B 4XB7A 4FXGB 4HKXA 4K0OA 3OKOB 1QLRA 4YE0A 2ERJB 3GLDA 4J3OD 1BXVA 1M7IA 1T22B 3T0EC 5KVMC 3L3OB 5FOBA 3SZ6A 3UBGA 5ABDE 2HKFH 5D6DA 5J1TC 3PNRB 1I85A 3ZT7A 2ZF9A 5KG9A 1NM4A 3SJVE 1U8QB 3LNGA 4DZBA 4UT7L 3SKNA 1GC1H 1R5WA 3L9YA 2WNKA 4KKQA 2EKSA 4PJHE 2PABA 4EAEA 1YVLA 3GSVB 4UUJB 1HZHH 1ZGLA 1E50A 3QIUA 2BP0A 3R8BB 3L3GA 3I9PA 1CDCA 3TU6A 4WAFA 2VSMB 2F19L 3D3VB 4IRSC 3V8CA 1YEIH 3RNQB 1C12B 1DDTA 3MJGX 3MA7B 2BZ7A 2H2SC 3TV3H 4RGMB 2PXYA 1G6RA 1D5ZA 2F74B 2A83B 4D2NA 2CUMA 3F7KA 4H26B 4NWUL 4N4YB 5DEGB 1JPTL 1NCOA 3AROA 1SM3H 5FKAB 5HI4C 4WV1B 3OKLB 1DJIA 1FN4A 3QEQA 4TLSA 3WO3B 3G6JF 1YUHA 3O3AB 4KI5F 2OV0A 1QR4A 1RZJC 1ET5A 2I26N 2OMTB 1JCKA 1MG2C 5F7HA 1ZLSH 2WSPA 5ITBL 5DJZB 4C54A 2NQDA 1INEL 5E2UH 5C07B 5AKSA 5HGHA 2CD0A 2WBXA 3PWJB 1HYRC 3RPBA 2HFGL 2G3XA 4MMYA 5EOCJ 3MO1B 1IGMH 3HNTH 4A2HA 3WS3B 2V33A 3LKRA 5DURD 3KH4A 1OEZW 4FFYA 5I30L 1EVTC 3GO1H 3KYOB 4KJPC 5IMKA 4DGVL 3RWGA 2ADFH 2NY6D 4JFWA 1DFXA 1WP6A 1R75A 2NLJA 3VFNB 4MLIA 3EDFA 2NCEA 3D1MC 2UYLA 3Q7JA 3GMPA 1K4DA 1W2KT 4OIIL 3L17A 4WKXA 4DP9X 5AD0A 1F90H 2WC7A 4JJOA 2L7JA 1BBJB 3HZMB 3T0XA 4GRMB 4M7LL 1G9MC 3R8QA 1HFUA 5LNEA 3GSRB 1GA2A 2HYMA 1DQVA 3VXRB 3P4MA 2HVJB 3JTTB 1VZIA 1OTTD 2FT7A 2IH3B 2NNRA 3CJJA 3G5VA 4NPKA 4EZLA 2F0CA 1CD1A 4MNGB 2OL3A 2VLJD 1G7LB 2O5YH 2Y36L 4OB5H 2B08A 2FEEI 2FHCA 3ZDYB 4AYFA 4M93C 3CFUA 1U91A 2DMBA 3WN5C 4HLZG 4JHAH 3RZCD 1J5OH 2I25N 2VABA 5DGRA 2R2BB 2XQYK 3L1OL 1KCSH 1TQCC 3E1F1 5DO2C 1J9RA 1XF5B 2J43A 3CXDH 5HYJD 1F2XK 3G04B 4BZ2A 3RA7H 1B0RA 4Y8AA 3JUZA 5FF6A 4KTEL 1A2YA 1DE4A 2Q7NA 4PRIE 3BXNB 1BD2B 1M7DA 2ICEC 1T1XB 2ZX5A 5AB0A 4YSCA 5KW9H 1SJHA 2VUOA 1GY1A 1XAKA 3L16A 1S7UB 1IQDA 4QXVA 4F7CA 1OE1A 4AEEA 4WFFE 3QJRB 4JFOA 1OD9A 5FOJA 1LEGB 1Q72L 3T1FB 2VLRB 3RWCB 4B9YA 3APDA 2I9TA 4WTWA 1OT2A 4YDIL 4YL4A 4PB9H 5CN2A 6FABL 4C56D 3DO7B 4AGMA 1FO0A 1N5AB 2F53E 2AJZB 5HYQA 2IOIA 4Z7WA 4NRZB 4MAYB 1NCBH 2DAVA 4PJ7E 4U6VH 3EF7A 2EDOA 3CFKB 4YX2H 3IBEA 1NCIA 2Y22A 3QZWG 4JFFD 1TOXA 4UTBH 4WTZA 1LWRA 1MW0A 3FRUA 1YMMD 1OQOA 1U8KB 2E4FA 1S2EA 2IALB 4OJFL 5EIIG 2XOTA 5E2WH 3CZGA 1IGFH 1F3JB 4GBXD 4NJ9L 1NFDB 1OGAE 3QUZD 5TE7L 2DQIL 4JE4B 5I74B 1AIFB 3RGVA 1CFVH 1AZBA 2H6PB 2P8LB 1DUYA 4M6AA 3MRBA 2G0KA 3DETD 1YPZE 4LMQI 2OLDA 2YKLL 4M8VA 2OI9C 3FDWA 2JQMA 3KGUA 4QHPA 3RX7A 1RZFL 2N0MA 3K2UL 3O3DB 4CDGC 1WA1X 3LHPL 2GG1A 3LH2H 4NUQA 4X0NA 4G72B 5FYJD 5F7BA 3PREA 3KBPA 4DJMA 3FUIA 3WNIA 1S78D 2CDGA 2V2WB 2PP7A 2Y6TE 1ZT1B 2VMCA 2WY3B 4FFVC 2OZ4L 3BDYL 4YSSA 2H9GB 1Q94A 2B59A 4M9OA 5CN1A 5DZAA 3SOBH 3V7MA 3WEXB 4OCRH 1CDHA 1DJHA 1FGNL 3LKNA 2KQNA 2PO6B 3CAFA 5FFLA 2XRAL 1YEKL 4FNSA 4U33A 5E6ZA 2EAEA 3W9EA 3UYPA 2VIRA 4J3WA 4G7VH 5KSAB 4HK0B 2WUBL 1IRAY 3QJOA 1E6JL 4ODWB 4R96B 3T8XA 1MHPL 3VGBA 3WTSA 1MFEL 2F6AA 1KNOB 2FLRT 1TZ8A 1QNZH 1WEJL 3I2CL 4XMWA 1CFNA 4JG1H 1WSST 2EACA 5LBSA 3DJRA 3UEZA 3KPRA 3LNDA 1XB3A 5F6HJ 1RFDL 3P11L 3MRCA 4AGQA 5KBNC 1I7RA 1EAQA 2QVIA 3AAZA 3QYCA 3E8UH 4JG9A 1NCAH 1PS3A 4KRMB 1AS7A 3L4VA 2FK9A 4PGDB 3DIDA 3IKCB 1H15A 1DVSA 3ELAT 4MJIB 5BNXD 2O6EA 3DHPA 3LXBA 4RDBA 5FB8B 4DK6A 4S2SA 3DIFB 2XXFA 5I76A 1FYTE 2Z0BA 4NQSB 2FL5A 4ONGH 1BJMA 2DD8L 3T6XA 3IE9A 1N5YL 3GMRB 5MHSD 2ZG2A 3WJJA 3ARGA 5DT1L 2YRZA 4AC2A 1PKQA 2Q20A 3GXDA 1AG6A 4CILA 5F1IB 3K72A 2PPEA 3QCUL 4QTHA 4KPHH 3V4PH 4HDIA 2NYYC 1A9BA 2Y1ZA 4NUJB 3NFPB 3GHEL 2VUYA 4OM1L 1QVOB 1LQSR 4N0RA 5AYQA 4BZ1H 1KJ3L 2BVTA 3B7YA 3W11D 3DHMA 5DZNA 1PZCA 1ED3B 4ZO9A 1XF4B 1GAFL 1OAJA 3T2NL 1MI5D 4U1IB 2WLLA 1KMGA 2A9AA 4HKZA 2Q5BA 4UM8A 1FH5L 4YHPA 3DUSB 5L2KD 1XGQA 5E5LA 4LLMA 1E40A 1D2PA 1JPSH 4KV5F 4LFHD 4U31A 4FEMA 2DYPD 1R5IA 1FFTB 3E38A 1UWGL 3FONB 4QCIA 5JR1H 4GQZA 5FYKH 3QQXA 1SLXA 2XHNA 3UPAA 3UJIH 4B9FA 5F88A 3GRWA 4I3SL 3VXUE 5FCUL 4QRTA 1P5UC 1BMGA 1ADQL 1V7NL 3Q8CA 3MKGA 3BP5A 3AJ7A 3FUHA 3L3KB 5DQDH 5EU5B 5C09E 2A9MH 2QSQA 3BIKA 5HD8C 5FGCB 1SHMA 3T65A 4MVBD 1UOWA 2DQGL 1AHWA 3X1BA 1RIHH 4Q89A 4JG0H 5EPMA 4NQVA 4Y88A 5J13C 5TTRA 5IFJB 4F58L 3W2DL 3ZKXB 1GHFL 3IMRA 1UADC 2X09A 1OD7A 1VERA 2FATL 3PUUA 5C6TL 1UWEL 4HXAH 3JWNE 4K3EH 4I9XA 1QI3A 1NUFA 2YR3A 4Y5YB 5J1AB 2XWJA 5HHXH 3QQDA 4HH9B 4QRUA 4JHZA 4PJDB 4HIJB 2ZUSA 2YPKB 2NXYD 3A47A 5KTEH 4AUUA 2IV9A 4Y16A 1JPST 2GC4C 4OF3A 1HQRA 1WZMA 2FE0A 3GMNB 5FK9A 3S96B 1XZ0B 3EH1A 1MFDH 5K1JA 4KGLA 4XE5B 4LCIL 5FKPB 2JK5A 3U0PB 3UC0L 4QMEA 2UXGA 4GW5B 1AQDA 2HUEA 1WBYB 1E9PB 4CADA 5IOPB 1G7HA 3O8XB 4X7TA 4JRWA 4JPVL 2V3EA 3NTCH 1DVUA 1IKFL 2WYZA 4ZUTB 2D4FA 1A65A 4LIQL 1DVXA 4KH2A 3O6LL 1RZGB 2CG9X 4N8VA 3E8VA 3T3MF 4HULB 3H3BC 3Q01A 3FFOA 2CLZB 5ALBH 3BGAA 5MP6H 3RFRA 4UYPA 4U1HA 3H0TB 2ED7A 3GZQA 3ZTNH 3BOVA 5L9DH 2OMUB 4WCYL 2V2XA 1I7UB 3H1ZA 4TVPD 5AW9B 3ZR5A 5AVRB 4ZX5A 1G7IB 4K2UH 1XR9B 3UBXB 4WKZB 1F4WL 3MV8E 1B0GA 2EC8A 3C5ZC 4KRPD 1J87A 1EAPA 1FORL 2CM5A 4WHCA 4DPBX 1RL1A 5IBUG 5F9JB 2MOGA 5IQ7H 4QXGH 4P99A 4FQIL 3DX6A 4S1SH 5CJ8A 4ENZA 2DQJL 1CK0L 4L29A 5IEKA 5GRUL 2JE8A 2RHEA 3O9WA 1O7DC 2V8LA 3HUJE 3PCYA 5ICYB 1WA2X 1RURH 3OJDA 4RAUA 5KSUB 1SNRA 1LO4L 3N50A 4U6XB 3AABA 4E5XA 4KZEL 3L7FA 5E9DB 1GYAA 2J88L 2J8OA 3CZEA 1E2ZA 2B1AH 4IDJL 4ZPVB 4DN3H 5LCVH 1S5IL 2R29A 1GC1C 2EYRA 1NPUA 1PY4A 1W72H 3VXOA 5C0BE 1MWAB 2H0PA 4JRLA 4TRPH 1BZDA 1D9KC 5HDBE 3VFUB 4WNQB 4K7PL 2PTUA 3H3KA 4MJ5B 1CC3A 4YEEA 4P59L 5I8KH 5FECA 3VTMA 3MACL 3UZQA 2Y9RT 1X5FA 3B8SA 4HV8A 3DDGA 4NEHB 1R1CA 4TL5A 2WXOA 2AFNA 1OTUD 1BZ8A 2HRLA 4M5ZL 3KWUA 1GGYA 3JWDH 5FYKE 3RTLA 2HMID 2B20A 4MMZC 4PRBA 3SKUD 2PMZA 1M1XA 2DMHA 4N85A 3ARUA 4L18A 4Z0BH 3FUEA 3UBXI 4WHTB 2W5PA 3CZSA 3Q6GL 1QYGH 5DURB 3GSNA 2XACC 1GPOL 1MF2H 3HEIB 4RRPM 4UQ2A 4ICWA 2ZXDA 4KOBA 5HHPA 1KJVB 3ZL4H 5JOPD 2BSED 4PJFF 3TYFA 1E2VA 1WBZB 4FOMA 1XBDA 4WHYH 2QHRL 4EDXB 1LEKB 5E08H 4G6JL 1E5YA 1CIDA 1FZOB 2NX5B 3A67L 5F9DC 1DUZB 1F4HA 1XIWA 5I1HH 4J3XA 5EO1B 3MRJA 1SEBA 4NCC1 1RIVH 3B2XA 4FQ2L 2OK0L 4XX1E 2IGLA 2EDNA 5F7WC 4ZTOL 3RURA 1TYJA 3X13A 4Y9EA 5DK2B 3U46A 3MYJB 1VFMA 2VLJB 1RY7B 5HYSA 4U6HB 5MEOA 3ZHFA 1MHHB 2ITCA 1JG9A 2G5UA 3LZNA 4FQLH 4PHXA 4Y9CA 3ENEA 1QLFB 3QCVH 2D7OA 3QNZA 1UASA 3MRMA 4LCWA 5KVDH 1NBZB 4F57H 1U8IA 1MEXL 2UZIH 1A25A 5DZPA 1S7RB 1HHIB 3HS9A 4UANA 5HYJB 4IS6A 2LFEA 1LP9A 3KPPA 4RQQB 3VG9B 4MS8C 2RFXA 3EGXA 5I73C 1MW1A 3AQYA 4J3TA 4WSGA 4WTQA 3SE3C 2OR8A 4XVSH 2ADIA 3F84A 2Z64C 1LDSA 3LD8B 3NCFB 4Q14A 5K93A 1CO1A 4AOFA 4ZFZB 2NNAA 4G8AC 1N7MH 3M8OL 2OFQA 2K8MA 1F58L 1E5UI 1KGCE 4OCXH 4P9MH 2Z4TA 1KTDA 3OZ9L 2WYHA 1N12A 4X9YA 1J8HE 4NN5B 4C56B 1P7QB 3I6KA 3W0WD 4LP8A 3SJVA 5LVEA 3TT1L 3II2A 2KC0A 5FO8B 2Y2WA 3VI4F 4BDVA 4GS7C 4ICXA 3RDTA 1DVZA 3PP3K 4JFFB 4IEFA 5I8OL 2H3KA 5IV2A 4Q9BA 3S3PA 4K3DH 1YMMB 4XP9L 2VN5A 3FTGA 4H1LG 1ORQA 4TTDD 3STBA 4N0YH 3QJVB 4GBXB 1P2CB 5C0FB 3QUZB 5HVHB 1K72A 2VUKA 1E4XH 2WQWA 4K15A 5GRVL 5HGDB 3L1GA 5A2JH 5FYLH 2V7HB 5C0ND 4YLBA 3K91A 3O45B 1LEIA 4HG4J 4GYBA 4XZUB 2YD4A 3TWYA 4L5FH 4H40A 1PIGA 2IH1B 5DSCB 3K8KA 2B8OT 1KOAA 2MHAA 1MWAL 4UQ3B 1AS6A 3Q43A 1H5BA 1AGDB 2IBBA 3FHAA 4BFGA 1HTYA 4ZUSA 2GTQA 1NANH 1OGSA 3KGSA 2WUCL 5AKVA 4JQIL 4IBWA 5SX4I 5AVQB 3AADB 4AITA 4MLSA 2GAZB 2FTAA 5FFGA 4LCCB 2GJRA 2A4EA 1RUPL 5IROA 3ARED 2X4RB 2HVKB 2G30A 4RNRB 1P84K 4LHUG 1FVCB 3HMXH 4EZKA 5C9JB 1KB9J 2IOOA 5C6WH 2WQXA 1C5CL 4JRXA 4KI5D 3W9DB 3POHA 3FB8A 1IM3A 3VXTA 2DTMH 4XB8A 1DP0A 3SKJH 3GS0A 4P2OB 2D31A 2E6JA 4UOJA 4NCDA 5DHVB 1UHVA 3FN0H 5ID0A 3PWNA 3U82B 5I1IL 1I3VA 2HFFB 5MEQB 1GTNA 3VYPA 5DRXB 4Q2ZB 5TQ0H 4IIQB 3H9YA 1CICA 4RH4A 2HZHA 1LDPH 4QRRD 4O4YL 3VFRB 4HH8A 1G4RA 2PYFB 2QZ5A 5D1QC 5FW7A 1BOGA 1RPQA 3P9LA 4XNMA 4YHKH 4PGBA 3NRPA 1YEDA 1RK0B 5GSRB 2ORBH 2UX6A 2AJVL 5ICXA 5FW6A 5G5DA 4LLVB 1TU2A 3T04D 4TVUA 2QELA 3IWUA 5EBLB 5IMLA 1A7NH 2A6DB 1MRCL 3QEHA 3BZEA 5T1MB 5BMFL 1HNGA 3V0GA 3RKDC 4M5YH 5DJDB 1OM3L 5BO0D 1QSEB 4GKOA 4XT1C 2AXJA 5HHQA 4WO0A 5A40E 4J6IA 3VWKB 1NUGA 1RCYA 3QDMA 2P5WD 3I6LE 4G9FD 4PFEA 1ZEAH 3S37X 3BAEH 3BQUC 4AQZA 3BP4A 3RWDA 3IVKB 4H8WH 3QXDA 3WG7B 3N44B 5C0AA 4MD5B 1KCRH 2Y3NA 4QRBA 4OV5B 4L8CB 4RRPG 2FYYB 4Y4KC 1HKLL 1TTAA 1LTXA 1MREL 3VFPA 4O2EB 2PCPB 4N8PA 4F24A 3N1QC 3M45A 5A6MA 1HNYA 2K1MA 3LMJL 1MI5B 4I77H 1N2RB 1TFHA 2GT9B 4LPWA 1XF3B 4PRIA 5L7XL 3QPXH 3K81A 4A66A 5H35B 1YEJH 1XH0A 1KTCA 4X6DE 1E5CA 3IYLW 3A4DA 1IJ9A 1WA0X 3QPKA 5F3FA 5L2KB 5FV1L 2DWXA 3CVIL 3FUJA 4KZDH 2A3TA 1ZTMA 4IU3B 2DYPB 5CSZB 3EG9A 4JKLA 5EOTA 4A2DA 3T4YA 1KTLA 4J3SA 5DS8A 1YRKA 3UG3A 1FL5A 3KEHA 4UTAL 5E2TH 2NY3D 1DHKA 4I48A 2ATKA 2OR9L 1BEXA 1U58B 2F8IA 3QP3A 3NJFA 2F53A 1CWVA 3ZRFC 2J7LA 1JV2A 2VQUA 4C57C 1MNNA 4PJ7A 5BW7A 1Z9SB 1H19A 4M6MH 3SDXB 5I1AB 1JGUH 3D25B 4WI2A 5GQBA 5I28A 1UTDA 2GKIA 4Z7VE 1OGAA 2JELL 1QRNE 1FFQA 4EN3B 2E9WA 1HEHC 4G7QB 1DVYA 2R0KH 3CDGB 4P4KB 3UIZA 4X6CA 5ILTH 1RIUH 5DJAB 4XP6L 3EGSA 3KYKH 3U4KA 1JUFB 1J5CA 3EYVA 1L9PA 4ZUWA 3HE6C 2VOTA 4RETB 1MPAH 3TBCA 5A6IA 1TETH 1YPZA 3WDJA 4DETA 2WMPB 5E8DH 5GGTA 2CBPA 1IC7H 3APCA 1S7TB 2E74C 5GGVY 1NLDH 1KELL 1G0DA 3U4EB 4BQBA 3T6VA 3ZRCC 4FGMA 3MJWA 4LP4A 3EDDA 3BAXA 3C5JB 3LRSA 1DLFL 1ZPLA 5FYJL 4KTGA 3UOAB 4DF9A 2WXLA 2EVGA 4G5ZL 1F4AA 3D0LA 4O02H 4OJCA 5EZIH 1X5IA 3NT0A 2C7UA 4GPVA 4YDVB 4AJVA 4QWWC 2NXYB 1U8HB 2K3HA 5DJ8B 3ZQXA 1MZYA 3ROLB 2BS9A 4P04A 3FT2A 3Q6FA 4FRWA 4MJ6B 1FAKT 4LVOB 4YDLC 4S1RH 3SDDA 4GAJL 3B3IB 3GB7A 1HHHB 2FD6L 4YPJA 3EAKA 3QUYD 2A73B 3N43B 5I6NA 3VRJA 43C9B 3VRLE 1FFOA 2WZ0A 4QO1B 5EO0A 2GJJA 3H53A 4P2RD 1W0VA 2VJ8A 1RPUA 2CZNA 3SPJA 3QFJD 3JTBA 1UENA 1OCWH 4AM0A 1U9KA 3X1EA 4ZXBD 3GMMB 4U1KA 5TE4H 5T1KD 1MW2A 3C8KA 4WDIB 5CP7A 5I71B 4RDQF 3IF1A 4L3AA 1QP1A 1ZIAA 3V0JA 4J5VA 4UT9H 1VGKA 1KT2B 2JLLA 4LOUD 4NO0D 2V9UA 5A7EA 1A1OA 4ZRGA 4HS6B 2MCPL 4XBMA 2WOBA 5D70H 1KXTA 4J12A 1A4JA 5B38G 1FYTA 1T1ZA 2X70B 4Q52A 3WXWH 4HLEA 4Y2OA 1HESA 3KXFE 2IGFH 1FL3A 3PXJA 2D03H 4X9BA 5IVOA 2CUHA 3GSQA 3RUGE 3U2IA 2R0ZH 3DX9B 2EIKB 1UWXK 5KVEH 2P5ED 3T3PF 2P26A 3SCMA 2G5BA 5JTWA 3W81A 4MDJB 1MJ8H 1VADB 2VXTL 3IDYC 5ERWB 4JDEA 3S8WA 4KKCC 5DZVA 1ZY9A 1CR9H 3PHOA 5J06A 4A68A 3SDAA 2Q2LA 3O6FB 1NL0L 1SHSA 4IK7A 5LLIC 5JIPA 2FB4H 1SJEA 5GGQL 5EG6C 1ZA6A 4HFWA 4TNVF 1N6QL 1DBBL 5T33L 1NCTA 1T1YB 4X6BA 3SYOA 3F7QA 3RJOA 3EYUH 2UX7A 1AHKA 4YE4H 2FEJA 3ARSA 3IFLH 3BI9X 1TJXA 2J6EL 1F4XL 3DGGB 3HI5H 3DX4A 2VDPL 2OA9A 2YOAA 1CVRA 3AUVA 3IPFA 3QI9B 4WUUD 4Z5RA 2YXFA 5D9SA 5ANHA 3D07A 3CHXA 1LO2L 3RIFF 1BM3H 1OGPA 3VXUA 3KL5A 4G71B 4RAVB 4HPYH 5HJDA 3V52H 2WANA 1IVLA 4F2FA 3IFNH 3MRNB 1A5FL 5DJYB 1UZGA 1XGRB 5D7HA 5C09A 5C0DB 5BVJA 1U3YA 4JFVA 1A14L 2GIXA 2AQSA 3EJCA 1M53A 4PJAF 4QJ3B 5GGUB 2RIKA 2OS7A 2PPDA 2JF1A 4I3GA 4M6NL 4JQXA 4PY7A 4LSPL 1UJ3C 3UP6A 3OX8A 1DVFD 2JMRA 2AV1B 2R27A 3H42L 3HTLX 3KWTA 4A6YB 2DLGA 2XWXA 4XOEA 5DD0L 3ULUH 4WU5B 1DQJB 1N18A 3JWDC 1BP3B 4OCSL 4TM9A 3NZHL 5CJOH 2VMDA 2AKRB 1DN0A 3HE7C 1YQVH 1VDGA 5IF0B 4HX1A 1DQDH 4M9PA 3GHBH 2KMWA 3UTSD 4L4TD 1A7QH 2IBZY 3G08A 5ACZA 4M1CC 4WJ5A 2QZQA 2J21A 4Y5VC 2FWSA 2GJ6D 2KQMA 4FXKA 2BIOA 5EC1B 1JHLL 2H8PB 1ASPA 2APBA 2D7TH 3VXPB 1DSFL 3HRPA 5IVXB 5LN8A 4BUGA 1UD8A 4FNLL 1R5VA 3ZTCC 4E0RA 1FL6A 5SX5K 3O0RH 4JK0D 4ZOAA 4PRDA 1NQBA 4BRJA 2VDMH 3V5HB 2R8SL 2VQ4A 1X7TA 1O6SA 3NABL 5E2VL 2F9BT 1VFBA 1JNHA 5INCA 3TBVB 4AZ8B 4ODXA 1BZ9B 5EIIB 4F80A 2Z34A 3IDJA 5ADOL 4JZJA 5K1NA 1MIMH 5DK0A 1N4XH 1P1VA 1PLGL 4I0PD 1YYLL 3MJ8B 5J7CC 1OAYH 1S9WA 2DWYA 2CCVA 2EDRA 5I9QC 2WAHA 2WGNB 4IBUA 1EUUA 5FIEA 1CFMA 2YSTA 1AQKH 4NP4H 4AY0A 3VGEA 4KK5C 1I85C 1HHGA 1BSIA 1NBVL 2FZ3B 3IMSA 4EI5D 4JCLA 4QHKI 3QS3A 2BNUA 4HD9A 3U9PH 3E6HA 3W0WB 3VX0A 4M29A 4XPBL 5JORA 4FCAA 5E94B 1G9NH 1UVQA 3DRTB 5JPMA 4HXBL 3ZGIA 4YDJB 4NC1C 1P1ZB 3QIUC 1RUQL 4JHWL 1RU9H 3NVQA 4E9XA 3HG5A 2MMXA 3FCTB 2NUTA 1QLEH 3CIAA 1NEZA 1V3MA 2E59A 4G6AC 4N6RA 4NENA 4NAMA 3WHE0 5CD5C 4HGWB 1DL7L 4ABVA 3UROR 3GJFH 1MLBB 3P0YH 3RGBA 2W0KA 4PBWD 5IW6A 1UM4H 4GMTL 4XXCA 5GIRA 5CINL 2OQJA 2R69L 2EIJB 2OTUB 4J2XA 2PP8A 3KYMB 3ZE1E 4DGIL 2FO1A 5L4FA 4JFQB 5JA8B 3MFFA 4P2QE 5C0BA 1XB8A 4ADIA 5CGYC 3NN8A 4ZSOB 2XNAB 4PP2B 1B90A 3GGWA 3OXRA 1NAMB 3EGDA 1TNMA 4IJTA 3OAYK 1I53A 4J3UA 2V3FA 5E0FA 4BWWA 2GBTA 2C34A 4N8CL 2OYMA 3CXHJ 3D3VA 2D9CA 4WQOA 2XYBA 4JM2F 3MA7A 2PCYA 3RILA 1UACH 1BCIA 2ZWYA 4H44C 3AREB 4L0ZA 5C0JB 1ZANH 4BFOA 5I5MA 1J5DA 5CBAB 5L6YL 3AZUA 1Z5YD 3OD3A 3CDZA 3G6JB 4KDTA 4WUKL 2Y1AA 4HUNB 5ESQB 5I75C 3GSWB 1PLBA 1PAMA 1CCZA 4WV1A 4GKZA 4JEGB 1WWAX 3MOBL 3PWUA 2M1KA 4YDZA 4K5PA 4PB0H 2CXGA 3QXAB 2MOVA 1TEFA 3PABB 1PY9A 1Z66A 3VGGA 3QUMA 1RMFH 2N01B 4J4PA 2JTDA 4P5RA 5H94A 4QRRB 3U48A 1A4AA 1MDAA 4JPIA 2BNRE 1QHPA 2Y25A 2ZTBA 5E03A 5C07A 1FSKC 4HJIA 1U8JB 4B0MB 1ZVYA 4JGJA 1AC6A 2AI0L 2YN3A 2GTZB 2RGSA 3NSFA 1OP5H 3V6ZB 2WGXA 2VZTA 2Q0ZX 1XDTT 4GO6B 1ZLWK 3TPUA 5DMKB 4XHJC 5DFTA 3V5DB 1EEYA 5DUMH 5AZ2L 1S7VB 3EDEA 2M8XA 1AGBB 4LBEB 2DQHH 2BSCA 3KWWA 4Z7IA 1U41A 2OM5A 1S7XA 4OLWL 4G9FB 3B4NA 3V8OA 4M48H 4AE1A 4DP1X 4ZMTA 1MCRA 2YD5A 2EO9A 2C4FT 3OKNB 1PKOA 3HN3A 4XHQA 5JNYA 1JHKL 1KC5L 1K9TA 1NIDA 4MNHB 2X9ZA 1KGUA 5IVZB 2JKIS 1ANUA 3GC3A 2FWUA 1AZVA 2OMZB 3PAYA 5FDWA 2QJDA 1Q0XH 3ETBF 5D1XE 1WDAA 3C75A 5DR5L 2ZX8A 4QOKB 2HX8A 1E4KC 1INDL 2DQDH 4BHUI 3DUUA 4Z3HA 3C12A 1HVXA 3T77B 5IVNA 3MFGB 4X8JA 2Y6SD 1ZJBA 1ADWA 4AW4A 4OLUL 4F7TA 5DC9B 3EJTA 3TS8A 1COBA 4U1LA 4H8WC 2OXGB 4LLQA 1PD1A 4KKBD 2NY3B 1ASOA 1E8XA 4JO4L 4JFPA 1ORSB 5HPOA 2JKJA 3EOBA 1J8HA 1OF2A 4TMPA 5HHMB 4TQPA 1FVDA 2CO1A 4OKVB 2QQLL 3NIGF 3NDYE 2IOMA 2ROXA 2WXKA 1QSVA 2F5BL 4G11A 4RISL 5DLLA 3T2PA 3PL6D 1HHKA 5D7LD 4HWBH 4ATTA 2IH9A 3HPJA 4A7GA 2AEWA 3O3BB 1IKOP 4WFHE 5T3ZH 4OLYL 2JKSA 3NPSC 4FHBD 3ULVH 1X4XA 2QADC 1YEHH 1FA4A 4YO0B 4E9TA 1IT9H 1N59A 4O58H 3TNMB 2K70A 2VLRA 2J5WA 2BY0A 4YNYB 3U7WH 1GOHA 1F3DJ 2MEJB 2B15A 2H3XC 1HOCA 1T5WA 1DJGA 3UBFA 4MBRA 3NIDE 2BP8A 5MI0B 3F58H 1ICTA 4R90H 1P7KB 3WMQA 4PJCF 1ZV5A 1KBGL 2G75B 5AAMA 2FBRA 3ATAA 4TUJA 1N67A 1OTSC 3CHRA 4GQ9H 4PGCB 4F15C 5I0ZA 4DP7X 2IALA 5H37A 1JZIA 5BUPA 2C4XA 3RX5A 4BFNA 3KM1A 3U7AA 1EZVY 1IAII 1NFDA 1QFPA 4N2CA 4QRPE 1HCZA 1QUNA 1I1YA 5I5JA 1PX8A 3QORA 2XFXB 5E2JA 5C92A 3G5YA 3TXAA 1Z9NA 2P8LA 3UTZA 4L3CA 2IDCA 4TPRH 3ZSSA 4WEBL 2F58L 1A3LL 5AOMA 3NQIA 1XCQB 4JREC 3MBEC 3KHQA 3K5SA 1U4EA 4YSQA 3D4ZA 4J3VA 2ZXEB 4HJUA 3TX4A 4S0HA 1CUOA 1CTNA 2GIYA 2ZCLL 5IFAH 3K6NA 2BZCA 6CGTA 3WE6A 4OD1L 2J8UB 2A6IA 1IBDA 1TQUA 4GI8A 4NDMB 3U36A 1KDJA 1YDPB 3QCTH 2E27L 3K4DA 1S7QB 5T1KB 3S88H 1ACYH 5GGSA 1WZAA 4OGYH 2CHNA 3WTXA 4PCYA 5TGBA 4KMTH 4KVNH 3MJ9A 5CP3A 2NY0D 1X5GA 4AK2A 3US1A 2A6KA 4QRQB 2PO6A 1LE9B 3B9DA 1ZGLM 5GZNC 3QPQC 5F7EL 3P9MA 3QAQA 5AALA 4XMUA 2OSWA 5TDPA 1VFUA 2H26A 4JM4H 2HG5B 3ZIYA 1WBXA 2R59A 3TTSA 5HDQL 4NO2A 1X9QA 4B3EA 4KROC 4XXWA 4KVCH 3P2DA 4Z0XB 2XQ0A 3ARGC 4HIIA 1IGJB 2OCCB 5BV7B 5CIPB 4QHLB 2PWFA 5ITFB 1O9VA 3FUFA 2WVTA 4JPKL 4NUGH 3VVWA 5FDYA 4YHZH 1JGVH 2YXMA 4U0RC 4HSAC 1CFTB 2P5EB 4LVHB 3MRIB 1SGKA 2HLEB 3Q3GB 3FQUB 1UEYA 2QPUA 4P5MA 4WVRA 3DX8B 4EN2A 5FEBA 4NKQB 4JPQA 4LU5H 3TYGH 4TVPE 3IKCA 5SWQA 5CUSL 4NKOA 1IAIL 5KJ7E 1NWPA 3MROA 3SQOH 3TO4D 4HUXB 4BKLB 3Q2WA 4X6DA 4B6ZA 2VXQH 3P4NB 4BIKA 3EO0A 4MJ4A 3CSYB 1OF0A 3TWCH 1A6ZA 4U2ZA 2QGEA 4Y2DD 4XP5L 5F1IA 4KO5A 4A37A 3QQ9C 2C8NA 3RKPA 4WUUB 1W0YT 4EIGB 5IMMA 4IMLA 1D7DA 2A1WH 5DFAA 2FSEA 1JNNH 1EO8L 4FN0A 2X6MA 3DHJA 1U2YA 4HCRA 3U1QA 2ZAGA 2YA0A 3GDBA 2CGZA 3NH7L 5DHMC 3GXNA 2ZXQA 3P3RA 4AEIH 1JMXA 4P9HC 4PJEB 5AB1A 1SDDA 4NC0B 3AVEA 4TSBH 4RGNC 4Z7VA 1E28B 1QRNA 1M6UA 3R1GL 2MNUA 4HK3J 3SDCC 1SRDA 1OGTB 3WSQH 1EGJH 4F7MB 2E9BA 3UGUA 4Y9FA 5C71A 4OF0A 4PY8I 3OHXB 5TF1L 1U3JA 1IKNC 4HUCA 5EZOH 2BOBA 3ATBA 1F4YH 3RHWF 2WTRA 4KK8C 4QAMB 5H8DA 3VFTA 1NA8A 4Q6YA 3AY4A 4XN1A 3VE0A 3TPKA 3O6ML 1G7QA 2NY5C 4B9CA 5B4MC 2ZOTA 1QX1A 1FE8H 1EEQA 5EU6D 3SIKA 3UYRL 3ZK0A 1C5BL 3BPLB 3MV7B 4G7SB 2IBZX 4GG6E 5BRZD 4NKIH 1AJ7H 4J3BA 4UINL 4HHAB 3KLAA 2WV3A 3ULUC 1TVHB 4NZTH 3WHE1 2EXSA 3N9GH 3U7YL 4PBVC 3DVIA 2W91A 3LIZH 2FT8A 3BLPX 3ILDA 3ILPA 5IEHA 1XGZA 1G43A 3B9KD 4YLCA 3MV9E 1LE5B 1DQML 3VAEA 5KVGH 4LPVA 1SN0A 5JQIB 3B56A 3WAKA 3LRKA 5DD3L 2VDQB 5KN5B 2AK4A 2OJEA 2DQEH 2X6BA 3ASNB 3EJYC 2XXCB 4I0PB 4N2DA 4TNVK 3BT0A 5IT2L 4LRIA 4PJ8C 4CVWA 3SKMA 3D0VB 4XPAL 2Z92A 4HU2A 4LF3A 2FWOA 4WJG3 3ZUCA 1MXDA 2CO2A 4S0SD 3X17A 4LE8A 3CMOL 4QHUA 3T3MB 4PI0A 2EC9T 1TG8A 1NM9A 4EI5B 5D4IA 3U2SB 2DWDB 3KXFA 3RIFK 3ARZA 4X7CC 5BV7L 1L6ZA 3RTQD 2Z0UA 3CFCL 5GS2D 5HPMB 2ED8A 4S1QL 3O9WC 5EUKA 2VE6A 4FKHA 2AK1L 2AC0A 1WIPA 2WSKA 4L8BA 5B7EA 1ETB1 4FERA 3HG3A 4ODBD 4UU9B 1KCVL 2F19H 4I3RH 4PLNC 2OMXA 2YRLA 1ZLVH 4QF1A 5DZOA 2PWDA 1K2DB 3F04A 1ID2A 3E2HB 2IFFH 5E5MA 1XR9A 1E9OB 5LQBH 3L6FA 1J9CT 4NWUH 5EHFA 5K9JL 2ARJQ 4UBDC 5BZDB 3BT2L 1YNLL 1G9NC 5M94B 1S7SA 3P77A 3WJMA 4AUJA 4GQQA 3JTSA 1Z5HA 4MX7A 2CALA 2HAZA 4NT6B 1FV1B 1RZJL 2XLLA 4CW1A 2YSSB 3SO3C 2YUZA 2H0JA 3JV6B 2B5IB 3BUYB 4M8RA 4ZAKC 4PLKD 4X7DC 1ZWIA 1BMZA 1NGZB 3TL5A 5ITBH 3FH5A 4CVXB 2JQAA 2E6QA 4DPCX 3EUDA 3ABGA 2G2NA 5DUPL 4HOMA 2IAMD 3SY0A 3RVXC 1T2XA 2XSKA 4N2HA 3VD4A 1B4RA 1MNUL 1EO5A 2BWQA 2QTVA 5I30H 1X4ZA 5EU3B 1ZE3H 5SWSB 4HISA 4DGVH 5BRPA 2X2IA 1AGCA 2ZUTA 1U3HD 2BVYA 4R2GC 3IJSB 5F7UA 4MJ5A 1J9SA 2OTPA 3VW3H 1XGUA 4OIIH 1XIWC 2VR5A 4S10A 3HLAB 4OH2A 4PV8A 3QQ4B 4M7LH 3DI2B 4U4IA 3VYOA 4P4RB 1L7TL 1KCKA 5L4MA 3LKPA 1BQHA 4JJ5B 4KI5E 4FULA 2OMVB 4Y4FA 5A7BA 2BIQA 4NYLB 2JI2A 3HMWL 2C7FA 4KK9D 4HJJL 2DWSA 5EDXA 2MQ0A 5HDRA 3D33A 4TUOB 1CD9B 3MNDA 2YGVA 5I18L 1DN2A 2EDLA 4YHYB 3L1OH 4ZX6A 4N0UB 3K4ZA 3SE4A 3RIAF 4HGMA 5GS1A 3FUKA 5EO1A 5B39B 3O81A 4CU8A 4NPJA 3ZKSD 4KTEH 2JI3A 4BD4A 1AXTL 3KPOA 3LKOB 2PYED 3PAUA 3QAZB 1MFAL 1X5YA 3BZ4B 2XG4A 3HAEB 4PRHD 4U1SB 4Y5XC 3V5KB 4UDTB 5KVGE 3L5WA 4KAQH 4F33A 4I9WE 1WFOA 5E24E 1Q72H 2JKNA 3B37A 4HJGB 2Y23A 4O2CB 3UXFA 4XBEH 4X4XA 1ZTXE 1Q1JL 2ZSVB 4GEIA 4YDIH 1UB5A 3ZTJH 4QUOA 3IDUA 3MJ7B 4WEEA 4MRCA 6FABH 1KN2L 1QEWB 3RZCA 2CA4A 3QUKB 4DPAX 1XGPB 1OQXA 4LEEA 2EUWA 4PJ9C 4GI9A 5HI3D 3OR7A 3B2UD 3RDTC 1E0OB 4ZMPA 1EZLA 4EVNB 2ALAA 2XZQL 3MLTB 4XMXA 5MEPB 4L48A 4HSCX 1NFAA 4M7LT 4J39A 5IJVB 2MQCA 4D0CB 3PL6B 4OJFH 3S5LG 2WCSA 4NJ9H 3MTRA 3PJLA 1PQZA 5TE7H 2DQIH 4M7JH 1A64A 1E7UA 3IETB 4XCNA 4ZFZA 4ELME 3F6LA 3RFZA 4U3HA 3D50A 5EZPA 2X0WA 5CEZH 3SQRA 4V2BA 2X05A 2YKLH 3KLHD 3WD5L 3VI4B 1JK8B 3K0YA 2ZOOA 1RZFH 3VH8B 4NM8L 2A9NL 5T3XL 3LHPH 3PHSA 2EYSB 2KHAA 5GJTL 1VENA 3IRCA 5IZ7A 4P2QA 3OGCA 4FDWA 3VXQA 2F7RA 2W94A 3A6BL 1ND0B 3BKJH 2N3JA 4AEHH 3ULVC 3DJZA 4DW2H 1G5GA 3I9GL 1P2CA 5EN2A 4MD0A 2OZ4H 1EZVX 4RMRA 5FFOA 3DC0A 4UIMB 1XT5A 4NQDD 2APVA 1KB5B 4OFYA 5IROC 5T1LA 3SKOA 4UQCA 4HP5A 3S3JA 2JCCF 1ZD6A 2CRZA 2XRAH 4LL1A 2ADGB 1MQ8A 1J1OL 3T0WA 3SODB 4ISVA 3E6FA 2AMGA 2ZZUT 4LOFA 1WIOA 2WUBH 2A74C 2R9HD 2O6PA 4G8EA 1MHPH 1FC2D 1JN6B 1MFEH 5CJXA 3I2CH 1WEJH 4JZOA 4JM2D 3LJ3A 1CICC 1M56B 5CJ5A 4WWKA 1RFDH 3P11H 4XVJL 4IGBD 4BM7A 1NINA 3RE0A 4EXPX 1QSZA 2Z31A 2BNRA 4OFIA 3C5SB 1QA9A 2JJUA 3CWGA 3N2JA 5H2BB 3K8MA 1BYNA 4HSQA 2VXVH 3JSSA 4Z3EA 4KKLD 3D4YA 4APQC 2DM3A 3UAAA 3O4OC 2DD8H 2L0DA 4H25B 4R7DA 3QFDB 4GXUM 4Z9KB 3QFJE 5DT1H 3BWUC 3EF4A 2XV0A 5DHVA 4HUWA 4JDZA 1P7HL 3QWOB 4YR6B 3QCUH 3WGUB 1A9EB 2WHVA 2ZUWA 3BWAB 3F5WA 4IIQA 4L9DA 5HGBB 2GJZA 5HYIA 4JQVA 2OSYA 2AMUA 4H4NA 4FP8L 4OM1H 5JIKA 3SGEI 2PYFA 2EDDA 1KJ3H 2NDGA 2E7HA 2AQQA 3KYNB 4XMLL 4Z3TA 4HT1L 4AQAA 1GAFH 1KN4L 2IGTA 3BVXA 3T2NH 4CJ1A 1M2OA 1KJ2L 1UATA 3AS0A 3ZKMD 4AL8L 4D8PA 2QDVA 3TO4B 1FH5H 3AW5A 3RWIA 3TC9A 4A55A 2DB8A 3F12A 3L3HB 3HZKA 1O6TA 3Q8FA 3LRMA 1XD1A 5EDSA 4NN7C 1R3LA 3LN9A 3T0VA 3ZGHA 1UWGH 3H4FA 4Y2DB 4KXDA 3AG2B 2JJSC 1KG0A 4GI6A 4G59C 5DZ9A 4ZMQA 3ZOAA 5BPPA 4F9LC 1BIHA 2E7DA 2ZOWA 1EFXD 1MCHA 2LLGA 5CZKA 1G7PA 4LPCA 5EWIH 1KPVB 1KUMA 1FLTX 1QW8A 2HFEB 5FCUH 4IOIA 3OAZK 4U7SA 3NG5A 1ADQH 3W5MA 1V7NH 2XBZA 4MA8H 1OAZL 2CKNA 1U8CA 2BSTA 2CO7B 3K6DA 2V8MA 3BPOB 3EJZD 4FKEA 2V5TA 4K3HA 5F1KC 4KGJA 4NBYB 3QUXA 5D7IE 5CSZA 4DP8X 4F58H 3W2DH 2DKMA 1URZA 1GHFH 5CO1A 1T66C 4R0LA 2BFVL 1U30A 2XN9B 4LDEB 1L9NA 4GMSH 4R5VA 1WG3A 1ZHKA 2L04A 3MBWB 1UWEH 5C6TH 4JY5L 3QISA 2Z9TA 3VRIA 5KS9B 5AAWA 1EXUA 1FH2A 5J6GA 1YEEL 2CIIA 5HJGA 3KLSA 5F71A 2ZOKA 4ENEC 5EBWA 5ECJE 2NZIA 1AQHA 1HH9A 5ESVA 5IJKA 4QRPA 2QSCL 4XP1L 3BW9B 5IB5A 3HR6A 1OAKL 3CDGA 4FXLA 1PJWA 3D9AH 3QYNA 1KB5L 3LQZB 4IBQA 4NHUB 4X5XB 2WMPA 4AJ0A 3UABA 3TTYA 1FCGA 4WFGE 1VLXA 4EUPB 4ZI8A 1SLVA 3UC0H 4P48A 4DWHA 1MH5B 3TJPA 3UJTL 1NAKL 1YLBB 1U8LA 4CBPA 3VQLA 3CN1A 1VEOA 2Q76B 1IKFH 5T1JA 3B9KB 2WWKT 1VKXA 1WD9A 3IJYB 3ZE0B 2MTAA 2BCKA 3O6LH 3U30C 3VA2C 3PHQB 4PRNA 2WLZA 4LCUB 2VKXA 1VESA 4PJHF 2J1ZA 5D6CB 4G43B 3ZYOA 4XNZC 3FQ2A 4QYOA 4K3GA 2ZXWB 3UTSE 1U8HA 2UY7A 4L4TE 4N1CA 3WNPA 4MZIA 1A6PA 2BHZA 5DEJA 4E68A 5D2NE 4AENB 4WCYH 2GJ6E 1XMWA 1YYCA 2ZICA 4CN1A 5JZ7D 3T6WA 1HHHA 3K5RA 5KYWB 1DZ0A 1MSPA 3ARVA 4WJKB 1B88A 3DKHA 4Q56A 2QMKA 4FG6C 3HR5B 4M56A 1FORH 2WWNA 4GS7B 2QFPA 5EZJA 4QKXB 1S5HA 2VR4A 5JDSA 1EERB 5HI5C 4KY2A 2CBQA 4RSYA 5F8QC 1FDLH 4QT5B 1IGTA 1CK0H 2DQJH 4M4RB 2Z4QB 2HX9A 5DC2A 3OTTA 5GRUH 3SCMC 1RJLA 1CVSC 4FG4A 3EFDH 4LPXA 3TO2B 4HU8A 1PLCA 5CM1A 3M1BB 2ESVD 1KCUL 1NKOA 4BJLA 2PXYD 4BXSV 2W07A 5EF1A 3VFMA 4KZEH 3BAWA 1CF8L 1IARB 1N8ZA 2ZX7A 4PRPB 3VFGH 3SDAC 3IMWA 3RB7A 1GJUA 4KUCF 1DSYA 5D55A 1A9VA 1EMTH 3N40F 1XGYL 4YK4B 4IDJH 3TVMA 5I24A 5T5FH 5C97A 1S5IH 5F0LB 1X5JA 1ACZA 3GRGA 3VMNA 1NMBL 3T3PB 4JY6B 2Y7SA 3NSXA 1C16B 2CWRA 3RHWK 2YAEA 1DYZA 4DP0X 4X6FB 1R9FA 1H6FA 1T4KB 1QQDB 2ARJB 4K7PH 3B7RL 3BO8A 2JB6B 2CDFB 3FYIB 3J7HA 4MQXD 5DVPA 3NCYP 5AOJA 4P59H 1BWWA 2VERN 2APWA 3MACH 3TV3L 2XT1B 2QGDA 1D5BB 2X53A 4XCFL 1IBFA 4HQQL 1CFQA 2NY1C 3RVVC 5CR1A 4M5ZH 5FLVA 1HDMB 1VEMA 4IK6A 3NAAL 3VGAB 2WQSA 4BFFA 1A47A 3CC5A 3OV6A 4HS3A 2WYIA 5IM7A 4KQ0A 2O6CA 2WWMC 1Y7VA 1DJZA 2HUHA 2IAMB 5E6UB 5BOZG 3TFBA 1BJ1H 1A21A 2G4EA 2NY2C 4PTUA 1IVTA 1K8DA 4P5KA 5GZOC 1XCTA 5CZXD 1C8QA 4N86A 3QIWD 3Q6GH 1TIUA 3BKYL 1GPOH 5JW5A 1OSZA 3CFDB 2IPKA 2XIBA 4OQ1A 4X5RA 4NGHH 3TA3A 1U3HB 4ZW7A 4QPEA 4M7KL 2QHRH 4CGUB 4EI6A 1BVLA 1VSCA 5JXEA 3TZVD 3A67H 3L45A 3IM1A 4RAVA 2P49B 3BLBA 4PJAB 4IBTA 3MNWA 3MRNA 2E47A 1IGML 4NKMA 1M2VA 1CE6B 3D05A 3WY1A 3ABMB 4FQ2H 4GQPH 5J5EA 2OK0H 1R6VA 3REVB 2GUOB 5BQDA 1H8OA 3SSGA 4A7QA 4TLKA 4AE0A 4KITB 4ZTOH 2WM0A 1ZE3C 2BO0A 1NFIA 1J0HA 4Y0GA 4OZIB 4JY4A 4Q6KA 4BQCA 2GK0B 3Q05A 3OMZA 4GG6A 3WJLA 2HN7A 1HEZB 4A6YA 4W9HC 3MLWL 4WWPA 3MX0B 5DMGC 1EANA 4PS7A 2C9PA 3QK0A 3Q1EA 4ZBJA 4LLWB 1TCRB 5D4QA 5JPMB 1R24B 4ZNCD 5FAAA 2AXFA 1CL7I 4PJ7F 1DCEA 4F5CA 4MZRA 1D5IL 1LM8V 2IH8A 1AGFA 4FFZA 2HJKB 3KPTA 2C4FU 2YAPA 1DANT 1TVBA 3HB3D 4JZJC 3BSGA 1MJUL 1T3FA 2QPEB 2UZXB 5D8JL 5EORL 3ZO0A 1ONQB 4OB5L 4L2YA 4PJFE 3HIZA 4PRHB 5HVWA 4U1NB 4LIQE 4MB4A 3HLKA 1U92B 2XWEA 3OB0K 3M8OH 4KTYA 3EXLA 1F58H 3M7OA 4CKQA 3OZ9H 3O2DL 2WD0A 1MCWM 3FCSB 1BFOA 1SMAA 1YPZF 3T2LA 4POZD 1Q9OA 1W91A 2LU3A 3B2MA 1VFOA 4PMFA 5KW9L 2AEIT 2R1WA 5I8OH 3L1FA 2NY7H 3RGVD 1EWHA 4XP9H 1MCNA 3B6SB 5HY9B 3DNKA 3IXAA 5EC2B 4L8SA 2FX7L 4LLYA 4WW2C 4FXGC 3N06B 3VFWB 1THAA 2ERJC 5EEYA 3L3OC 1DDHA 3G9AB 1OPOA 1DO5A 3U4AA 3KMDA 4OKDA 2F7IA 4LEXL 2FIKA 1TTFA 3OR6B 4UOQA 4U6YA 3MLXL 4KJWD 2VC2B 4LCYB 1NCCL 4FI7A 3W0WA 1J1XH 1U2HA 4YFDB 1QKZL 3CFBA 5DJ6A 5E2WL 3MBXL 5DD1L 1MWAH 4P23A 1XEUA 4XNXH 4AVJA 3QO1A 4XBPB 1MVUA 2WUCH 3BEWB 2HPOA 1JWMA 4JQIH 4YXHL 3K6FA 1HOEA 4L4VE 5F7MC 3D51A 3L4TA 1RUPH 2PW1B 4RGMC 2UUDH 2TRYA 3V4VB 3GLZA 5CCKL 1CDUA 2VQ1B 3QNFA 4NZ8A 4KDTC 3ARBD 5TE6H 4WV1C 3U83A 1I8KA 3BFOA 2GSGA 4IRZL 4UZSA 5CNHA 2FO8A 3CN2A 3V2AR 2ATAA 3RIAK 5C3TA 2AEOA 3EBAA 3N41F 1FQ9C 3B9VA 3MYZA 5CMAB 3WUWA 1OWRM 1HI6A 1GR7A 1NAMA 5ALCL 5I1IH 4OCWL 3P30H 4ZZKA 4JM2B 3BGFB 4FG0A 5KVFL 1JL8A 1QBMH 3G7TA 2WCGA 3HS0A 4O4YH 4IGBB 3ULAB 5EZLA 3W39A 1BXAA 2YRPA 3UG4A 1KY6A 3BDBA 5TQ2L 4DKAA 2EXWC 5IHZA 3OXSB 3OHMB 3AITA 4FLHA 2ZKHH 2WLKA 2AJVH 3ZJAA 4FLQA 1IGIH 4XPGL 2ZP0T 3G6JA 1M7UA 1MRCH 5BMFH 3C60D 4U05A 3FRPG 3MRKB 3GDCA 5GHWH 4K3JL 3FPYA 5IBTH 3DYPA 1OM3H 1JRHI 4KJQC 2SEBA 4DPRA 3QXAA 1CS6A 2XWBB 1ZS8A 2O5ZL 1XHHA 4L9LA 1SUJA 3HFMH 4RA3A 4LNRB 5CSGA 2GFBB 2IJ0C 4N2FA 2MQ3A 3IDYB 5BRQA 1SF3A 1EDYA 3RQ3A 1FLRL 2AJ3B 4G8GB 1MCFA 4QAWA 2F7OA 2WXHA 2NQ3A 1SVCP 1HKLH 1MREH 4ONGL 4JFZL 4R7NB 2OYLA 5IIEA 3LMJH 5L7XH 3WS6A 5SX4H 2DEYX 3S3DB 5TD4A 3UTQB 3WDHA 3MN8A 3WOVA 1BPLB 1U8PB 3IGLA 3IFPA 2HPTA 3DURA 5F3BA 3IT8D 1H9VA 4RX4A 1HC1A 5DQJA 4XCEB 2IDSA 5DMJB 5AZUA 1QEXA 5I17A 1QWUA 4N90E 1CLYL 4JFSA 2UVFA 4UTAH 5K9OA 2P5WA 1Z32X 1WV7T 2OR9H 4NFCA 2E75C 3DV6B 4BWTA 2X0UA 1EFXB 4PW4A 5J3HD 4F7EA 4Q6IA 3ALPA 5DHEA 1I1AB 5EU4A 1BVKB 3RWFA 1HXYA 1U8MA 3MRFB 4PJXB 4X4ME 5HJ3A 4HCFA 1ZKAA 1C08A 2GY5A 2GQHA 3FAXA 4Q0XL 1T1WA 3TCLB 1R46A 3QRFM 2JELH 4JNXA 3MUY1 4NO5A 3L5HA 3VQ2C 4F27A 5CBEB 4AYMC 3MLVH 1D5XB 3GXTA 4IHOA 4B5ZA 4X0KA 2CJ3A 3QUHA 3LS4L 4Q9CA 5IHUL 2ZG3A 2H3NA 1IFRA 3NIGB 3WELA 4LXFA 4MAYC 2VC2L 4MJ2A 1LO5A 5G4OA 2YD9A 1JRHL 3MDJA 1KELH 2CXKA 1DVQA 4APXA 4ZOBA 1X6NA 3EFOB 3A6OA 2AVGA 1F13A 5FYJH 1DLFH 1EXHA 3CHPA 5C0EB 2IC2A 4Y16D 4G5ZH 1T0NA 4H8QA 5I74C 2CUIA 1XR8A 1ZHBB 3QORC 1BDYA 4BWUA 3CNKA 4B5EA 1H0DB 4Z78A 2J2ZA 4YSDA 5DJ2A 3MRPB 4GAJH 5AW1B 4HXAL 5FC9A 2FD6H 1ZHNA 4PJCB 2X6AA 4K3EL 4X4YA 4GKSA 4MA3A 1LWJA 5F7FA 2PNDA 1MLCA 3QARA 2ADYA 3KBHE 4E2OA 1AXSA 2AJUL 2Y4SA 3CN3A 1BMWA 4PGCA 2CJUL 5CGTA 1IBYA 1IC5L 1ZT4B 2R7EA 3WDIA 2PCFB 3FCGA 4LLUA 3F62A 4HKXB 3UAEA 4ZO6A 1DQQA 1MN4A 2EE3A 2WBKA 3HUJF 5EU6E 1QBBA 1M7IB 1DBKL 1MFDL 1SF5A 5FOBB 3RAJH 1WWWX 3D12B 3ETTA 4XN9A 5BRZE 1UYWL 1X4YA 2PO6C 1J0KA 3NSDA 2MNJB 5KG9B 1SLWA 3OWRA 2MCPH 4DUXA 4DZBB 3QUYA 1W16A 3SKNB 3L7EA 5HDOA 5CFHA 3GUFA 1R5WB 5KSAC 3AFLA 3AT9A 4MDIA 1GW0A 4WWID 1VPOH 2EKSB 4P2RA 3P4LA 3QFJA 1ZGLB 1JTTA 5DHXB 1YDPA 3L3GB 4ZXBA 3NYKA 1RZIA 5T1KA 1FC1A 3ZTNL 4R4BA 2EC9U 2JXMA 3VQ1C 4BUQA 4RSVA 5HDBF 1A8ZA 4HALA 3S8FB 3P4OA 4YFEA 3BFQG 1O9ZA 4XB3A 3ZE2E 2VXTH 5F7NC 2Q9OA 4FI8A 3WNMA 2PXYB 1G6RB 1D5ZB 2VDOL 4NOBA 4D94A 3QEUA 4NO0A 1TVDA 4JX0A 4I5BA 4ZD3L 4C4KO 4QXGL 4XNYL 1FN4B 1AGEA 1YAZA 5GGQH 5FW8A 3U1PA 1N6QH 1CGSL 1DBBH 2DLIA 2A9DA 4OCLC 1BF2A 3VDBA 2FWLB 2Y7OA 2BVPA 3TBSA 5ITFA 3PGCA 1BZOA 4H8PA 1J11A 3EO1A 1M57B 5E7FA 5AW3B 3WXVL 2J6EH 1F4XH 3O4LE 3RPKA 2VDPH 3QG6A 1P4IL 1QZNA 4Z23A 3FQUA 3E80A 3EHBD 1QOKA 3ZDZB 4XO5A 5HGHB 3VB8A 3S37H 5MENE 1LO2H 3MTXA 4F9PA 4PG2A 2ZKYA 2HB0A 2C3GA 4MMYB 4FQHA 2I69A 1A5FH 2IIJA 4M7ZB 5I75B 3HA0A 4XC1L 3LKRB 1PEWA 4BKLA 4ZMYA 3L5JA 1A14H 1YJDL 4X7EC 2HXAA 5IREA 4LSVL 3KDMA 5IMKB 4TRPL 1CI3M 3WEAA 4PPTA 1MOEA 4Z3FA 12E8L 3CSYA 3RWGB 1DBAL 2WLIA 2NLJB 3O6KL 1CIUA 4YH6A 5M7QA 4M6NH 4UDUA 5D7IA 1H8SA 4LSPH 1JFHA 2UYLB 3EJUA 4BCZA 3QQ3A 4ZUVA 3N6YA 1CDIA 3GMPB 4HG4K 2X3CA 3ILQD 1K4DB 5AD0B 1RZ8A 4PWFA 1RHFA 1MFNA 3H42H 2EE0A 1EZUA 5E70A 5DD0H 2D3LA 1MCPL 1UUSA 1IL1A 4WI7A 2C3XA 5KBMA 5IGXL 2E9IA 3S35L 1E3XA 1UA7A 4OCSH 3NZHH 4NIYE 3VM5A 2K3TA 3P4MB 3EDKA 3G5VB 2A4CA 2X1WL 5I6LA 1CD1B 1MF2L 1Q9LA 1WT5A 2OL3B 4GAYB 4IBZA 4NWTL 3ZL4L 4BRVA 1KBBA 4AYFB 2CRYA 3BVWA 4OBRA 2VDRB 1U91B 5AKTA 5CLXA 1TZGL 3VMPA 3ZDWA 3ZKXC 5BCAA 2VABB 2I9LA 5D5ME 4DGYL 1JHLH 1DVFA 4AT6A 1NKGA 3CZKA 2CKBA 3GSOA 2EIZA 5I1HL 3MNVA 1DSFH 2QPSA 3ARTA 4Z95L 2XKNB 3CD4A 3O3EA 4FNLH 1B0RB 2BWDA 1QSFE 2I7OA 1A2YB 4PVNA 1DE4B 3VYNA 3ZT5A 1M7DB 4Y5YC 2DIAA 2IXQA 4ZDHA 4BCXA 4UT6A 2R8SH 1OB1B 4YBQD 1ROWA 1AYRA 2PWGA 1SJHB 2HSIA 3FQNA 1IQDB 5AYUL 4F7CB 1G84A 4GO8A 1F3RB 2K0RA 3NZSA 2X4UA 4JFOB 5ADOH 3J2PA 1BVNP 3HB3B 3K8LA 5E4IA 2V6HA 4A7GF 3U0WH 1PLGH 3UTSA 4L4TA 1YYLH 2R0LH 4X80L 3OKYA 5D2NA 5ANME 5A2CA 4PVMA 2GJ6A 4ZX4A 3QCVL 1FZKB 3GMOB 1FO0B 4NPYA 5KVDL 3FT4A 3SJVD 5AVUB 3CVHA 5HYQB 1T7XA 1NDGB 1UEMA 4G8FB 4Z7WB 4DAGH 3IU4L 3O8XC 1NBVH 4HAKA 4UF7C 2IAAC 4MCZA 3X2QB 1UOVA 3FRUB 1E8WA 1TXKA 2ED6A 4OGZA 2CIKB 2OMBA 3U25A 3ISRA 4FE9A 4HXBH 5DMIL 3PWPE 2C9AA 2R0WL 1JZFA 1RUQH 2PYEE 4JHWH 1PCSA 3RGVB 2Z8RA 5DXWA 4FS0A 2KZWA 1UCBL 1DUYB 1RZ7L 4G7YH 4I0PA 3MRBB 1Y1DA 3H2PA 1FYHB 4ONHA 3KJ4C 1G6RL 3BEVB 3C6LA 4YZFF 3GBEA 2IQAA 4GMTH 2H32A 3MODL 5CINH 4YDKL 1A3RL 4BSWA 2R69H 5J56B 1M9SA 1KCBA 2ETWA 2DEWX 5EOCL 2G2RA 4K5NA 4QLWA 2J5LB 3CLWA 2ZAHA 1H3PL 5HD8D 3S3SA 1XXFC 4KJYA 4K3DL 3MLYL 4UI2A 4DFHA 2CDGB 4OM0L 4HYTB 1NIFA 3M46A 4Z3GA 1SDAB 1GZHA 2AANA 2CHWA 3EYSL 4GB9A 2V4LA 4WEUD 1Q94B 2B59B 3LN4A 3BRDA 2R1XA 1OCOB 5FYLL 4KUCD 3FTVA 4HOXA 1CXLA 4N8CH 3LKNB 4ONOA 3ZTJG 3L3JA 3T4AA 1YEWA 5FM5M 1K2DA 1IM3D 1CF1A 4L3FA 4A2EA 3W9EB 3UYPB 4OV6F 2VIRB 4ZMLA 1TKWA 4Q58C 5E8PA 4EEEA 3VGDA 3T8XB 3EUUA 3FK3A 5FO2A 4N2MA 1HK6A 3OZLA 5FUOL 1CFNB 1TTGA 1E90A 4NT6A 3KPRB 1FV1A 4LO9A 3L13A 3VGFA 3LIUA 4FFTA 5LWYH 3MRCB 1Y6MR 1NBYB 2YSSA 1I7RB 2ZKMX 3AAZB 3BKCL 1PG7L 2QLYA 1NEPA 3K74B 4FJYA 2Z1PA 1JWSA 4V2CB 1H15B 1YAIA 4NQDE 4NRXA 4IKKA 2OKMA 2IDUA 3INUL 4S2SB 3FMGL 1GZPA 5DUJA 4J8RA 1D6VL 5I76B 1GJIA 2FL5B 4DUWA 2AI0H 1HIML 5EIQA 1WLHA 5E1HB 5KANI 1ACXA 5GPRA 3ARGB 2HP4A 2DKUA 4P57A 3GD1C 2OL3L 3LKQA 4NBXB 1PKQB 5DFWH 5DRNA 5BXFA 4OZFA 1PW3A 4X6DF 2CJSA 4PN6A 2X9YA 3K72B 2X4OA 3UDWA 4QTHB 2VDRL 4HDIB 5AZ2H 1A9BB 4U0RB 1QFWI 1FBIL 1I3UA 2NY6C 2VO5A 4J27A 1O7SA 4ODVL 4D7PA 2VN7A 3C8HA 3B9AA 3MUGB 4M1GL 4OLWH 5GS1C 2HG0A 1X9LA 4ZOCA 1XSOA 1U21A 3JV5A 3BIAX 4PRID 5A2AA 4G83A 1QUPA 2WLLB 1MY7A 3QQ4A 3CC1A 3COOA 4B7LA 4HKZB 1J0IA 3LYRA 4UM8B 4YHPB 1XGQB 2W92A 3GMQA 4LLMB 4WFFD 4M5YL 5DR5H 2WK2A 1R5IB 3UAJC 1E4WH 1OTTC 1INDH 3CIQA 2E7CA 3TBTA 4NYLA 4PJFA 4HC1H 2X88A 4I2XE 1LD9A 5GGRY 5EU7E 4QCIB 4Z7VF 5E99H 3LNFA 4KDWA 4PS3A 1BV8A 1XH3A 3MCKA 2Z35A 3OG4B 4OLUH 3UACA 1FO0L 2NY4D 4NM4H 5F88B 5IB2B 5KUMA 3N5AA 4JO4H 4QRTB 5GJSL 2L4OA 1MELA 2XZCL 1JYXA 3S9DB 4GFTB 3ESPA 5B39A 3BIKB 3QPXL 5AFAA 2QQLH 4UMSA 4RISH 1OGAD 2F5BH 5DZJA 2AQTA 4LSSL 1AHWB 1ML0A 5TPWH 1HXKA 4QTIH 1HYSD 1UZ6E 2E9JA 3BZFB 4NQVB 3LD8C 3HCVA 2V9RA 1B4LA 3D18A 1BVNT 1A22B 3FBKA 1U93A 1PZ3A 2LQRA 2MCG1 4IKNA 2JSFA 3S36L 3CSTA 2ZSVA 1ZOXA 2KYIA 2XTLA 4F7PA 4NN5C 3BP6A 2D9QB 4PREA 3MRRA 5TJWK 2D0FA 4XVOA 2XWJB 1A1NA 1QFWL 4QRUB 3VRLF 3FO2A 1OARL 4QLRA 3I6GA 2B16A 4PTTA 1KBGH 3G5WA 4ZUUA 4XCYB 1Q0EA 1CYXA 3PL6A 5D7LA 4XOCA 2G2PA 2CPUA 5C08D 5TH2A 1T6VN 4Y16B 4GBXC 5HVHC 3QUZC 3CZUB 5E0QA 1HQRB 5FK9B 3DMMA 1XB6A 3SDDD 4BFIA 4IRJD 1TETL 4AM0Q 3QDHA 3MLZL 4L4VA 4P5TD 3NJGA 3LQAC 1H6TA 2JK5B 3PNWA 4FHJA 4WEBH 1AQDB 2F58H 3DETC 3FSWA 4QRFA 1A3LH 4CADB 1G7HB 3PAZA 2BP3A 4X7TB 1A02N 3QJQB 2R4SL 2JNZA 5DK3A 2OTWA 1J9QA 5TF0A 2ZCLH 4BK8A 2LGNA 1AI1L 4N8VB 2EE2A 4O02L 3UC2A 5CJXC 5LBSL 2MSPA 4DTGL 3TV8A 3MZTA 2E27H 4U1HB 2IANE 1ND0A 5DD5H 1S78C 1UD2A 4J28A 3PP3H 4R8WL 3RUGF 3GLAA 3H8NA 3DBSA 4KXCA 4OTXL 2V2XB 2FQEA 1P5VA 4UIMA 4ANUA 3CQPA 4LCCC 5DDHA 3CZFA 3H85A 3VG0L 3KS0H 4PBXA 4AV0A 1D5RA 1FYTD 2OR7A 1IBZA 2CGRL 3DX3A 4PCKA 1B0GB 3OWEA 4ZODA 5C0GB 1EAPB 5AW6B 2F2HA 5KYYA 1RVFH 3P3TA 2Z91B 3VSQA 3NPZB 3IMBA 4XAWL 5FM4A 3DX6B 5JW3L 1NTDA 5HDQH 1PZUB 4MS8D 3UP1A 1KXVC 4P2OC 4L29B 2W0FA 3NCCB 4KKPA 5I6KA 5IEKB 1Z3GL 4JFXA 3O9WB 1HSAB 4PEEA 4JPKH 4PJBF 1UD6A 3OJDB 4RAUB 1OK0A 1SJXA 5F3HA 4IIQC 4NN6B 4U1JA 4UMGA 4E5XB 2UY6A 3L7FB 1EA9C 5D7JD 5KSBE 1XCWA 1IU1A 4MXQD 2W38A 4D0DA 1UFGA 3GEWB 5CUSH 2HH0L 1IAIH 2XC8A 3F7VA 1E7VA 3C5XA 2EYRB 3G9VA 2IGFL 3TCTA 3B7UX 3VXOB 1VJSA 1J48A 1I7ZA 2R0ZL 2J1XA 1MCBA 2H2PC 5B1BB 3LNIA 3VWKC 2C9RA 5TK4A 3QZBA 4XP5H 1CT8A 3UZQB 2BP5M 4HV8B 2PPFA 3VXUD 3GRWL 2ENPA 3PS6A 2ESVE 3FQWA 3W11C 5J8OA 1SMDA 4ZW8A 5LHDA 3FZUD 1EO8H 4PRBB 4YHLL 3ZZQA 2VLKE 2IMNA 1M1XB 4PR5A 3NH7H 4BELD 4P9HL 4X4MA 3TO4A 3V6OE 3GSNB 1U4FA 3LKSB 4YLQT 3BKML 3L3HA 5HHPB 4GXVL 3HI5L 1EBAA 4XMZA 3R1GH 3TYFB 2Y5TB 3VB9A 3P3YA 3VACA 3H7BB 1HCVA 1JPEA 4EI0A 2LU5A 5BS0E 1XGTA 2KKQA 2D4DA 3P9WB 1S8DA 5E9AA 1RPKA 4QXUH 1KEMH 3MRJB 2FJFA 1SEBB 4GW4A 3IDNA 1TJGL 4HW6A 3W37A 2NY5L 4MSWA 2EO1A 2N1KA 5FO7B 4HBQA 1F1DA 3RBGA 2G60L 3EH2A 5EUOE 3PFQA 3X13B 2ZIDA 4MVBC 1TF4A 3U46B 5IJBC 5B1KA 4EN3C 5HYSB 4Q4EA 1DLHA 5MEOB 4WSJA 1C5BH 1U33A 2D7PA 2ITCB 4XN8A 2CLRA 4MA1B 5I0WA 2VMFA 3QNZB 4N5EC 1NJ9B 4UINH 3FQ4A 3APFA 3MRMB 4LCWB 4Y1TA 1U8IB 3U7YH 1PF3A 4TN9A 1Y1UA 1GRWA 4NXSA 4IS6B 4LAQL 1LP9B 4AQ1A 2RFXB 3EGXB 5JPNA 2YJQA 4TNGA 1JHTA 1DQMH 2VXUL 1RJYA 3ZL1A 2W95A 2ADIB 3N42B 2VDNB 3IXTA 3RKDD 4EIBA 3DRQA 5DD3H 1Z9LA 2NXYC 5DC4B 3GSXA 1CN4A 2NNAB 3IDIA 4Y1AE 2F7QA 5EU6A 1HX0A 1KTDB 3BQUD 5IT2H 3LEXA 2I85A 4LVOC 5EMYA 1V5JA 5BRZA 3MV8D 1DANU 4XPAH 5B1JC 4E41E 3I6KB 4WEMB 3SJVB 1YY8A 1RAMA 2WLMA 4AG4L 2VDML 2LOEA 3CMOH 1MH5A 4N9GB 4BDVB 1YNTA 3RDTB 1BG9A 1KBWA 2HT4C 4IHBA 4IEFB 4YVNA 5IV2B 4PJHB 3SGKA 2MIZA 3ZE1F 1VACA 5BV7H 2B14A 2XV3A 3FTGB 5CIPH 3CFCH 1ORQB 3PHQA 4P2AA 3OGOE 3MCG1 3A23A 4LP5A 4S1QH 4LCUA 1OAYL 2AK1H 2Y7MA 4PD4J 2ENSA 1NBQA 1F6LL 4G6FD 1M3IA 2F54E 1KB3A 4L1SA 1A6AA 2B4CC 1NUNB 3ZRSA 3CFMA 1KCVH 2BWIA 3ABZA 3T5WA 3BN9D 1OB0A 5DD6A 5PAZA 2COVD 4Z7UE 3AWGA 4LBAA 5F0JB 2R29L 4OY9A 5LGYA 4IMKC 5C0BD 5K9JH 2MHAB 3BT2H 1YNLH 4P46A 1PIFA 1H5BB 1LWHA 2VSKB 5F97E 2C9UA 2N4IA 4M4RA 4ZUSB 5EOQL 3RTQA 2BC4A 1M3JA 1P6WA 4LKCB 3MNZB 3TO2A 3O4LA 2V5MA 2X2UA 4XXDA 2X7LA 3AB0B 1BZ7A 4DEPB 3FQRA 3SE6A 5FYKD 3M1BA 3A4AA 1UOLA 3TH2T 2O1AA 1J0YA 1TZAA 1X5ZA 1YN6A 3LXAA 5MENA 2WVUA 1JPGA 2DZEA 2QQKH 2V2TA 3UBXG 1UWYA 3KGRA 1C7SA 3FQTA 1QFOA 3FB8B 1IM3B 3VQMA 1JVKA 3VXTB 4C58B 3DLQR 3JYBA 1R33A 5HHME 1KYDA 3UJJL 3LZRA 2D31B 4R7LA 3EDJA 5BQ7A 3LN5A 1AO7E 5ID0B 3PWNB 1MNUH 1C16A 4RIRA 1BFTA 4XOBA 2B1HL 3OKMA 2VDKB 4FC3E 4NIKB 1ZLUH 3QI9C 2LU7A 5I1DA 3RPIB 1NEUA 3RBSA 3R06A 4O51A 1PZ5A 3NJNA 1BOGB 3P9LB 4XNMB 3HBGA 1KFGA 2YMXH 2YUVA 3GXFA 1YEDB 4PGBB 3UTPE 1J5IA 1OTUC 5ICXB 4PWIA 5G5DB 1TU2B 1IBGL 1UKSA 2Z65C 2AVFA 5AOKA 2HMIC 5IMLB 3APNA 3MLRH 3ESNA 3QEHB 1U3ZA 4UAOB 4B60A 3BZEB 4YUEL 4MA7H 1L7TH 2BXZA 3NSCA 4QIRA 1YC7A 1HWWA 4PJ5D 1KIRA 1N64L 2MQGA 1OCZB 2DDQL 3LRHA 5GSVA 2GSIA 1JK9A 2BXYA 2FGZA 3VNZA 3ZUNC 3HMWH 3WEBA 1IAOA 1RHHA 1UD4A 5D2LF 1XF2B 4ZMVA 3BP4B 1XCXA 3RWDB 1LVEA 4HF5L 5D5MA 2IPUG 5L4IA 1U3HA 3QBTB 3GKWL 2ZNWA 2FGWL 5HXMA 4WI0A 4A2LA 1G7MA 3NRQA 3VFPB 5IQOA 3C87A 1QSFA 1G0YR 3HNVL 1IAKA 2J56A 3GINA 4PRIB 2HWZL 4X98A 5DYOA 1BQHG 1ZVSB 4AGNA 5IWLC 4OJYA 3ZL2A 3L95A 4XI5C 1AXTH 4A04A 1MFAH 4GH7B 4OU3A 2J8UE 3EG9B 5EOTB 3T4YB 1KGCD 1KTLB 3HVDA 2BW4A 5DS8B 1FL5B 2OX5A 4I48B 2ATKB 5ANMA 5F21B 1RK1B 1J8HD 1IIKA 1T0PB 3RRQA 2E3VA 4XBGA 2F53B 1Q1JH 3UAFA 1JV2B 2AJSH 1KN2H 1QHOA 4PJ7B 4F2EA 3T0EE 3WTUA 4O9HH 3SE8L 3PPSA 3CTTA 3NIDF 2OMYA 1UURA 2XZQH 3LNEA 4LPUA 1UD3A 2W0LA 2DQDL 1OGAB 3PWPA 4ERSL 2PYEA 2F08A 1E4HA 3EGSB 3CK0H 4JAMA 2FX9L 4MDRA 4WO4A 4ZUWB 1MFVA 3QZNA 4WRLA 3GTTA 1A66A 3FHQA 3BX7C 1YPZB 3LQMA 1HZKA 1UM5L 3FB7A 3CSPA 1E67A 3NCXA 2UWEE 5F1OB 4NM8H 5T3XH 3LRSB 4HJ0D 4HWBL 4OAWA 2WLNA 5GJTH 4R83A 2AXGA 3D0LB 3K3QA 3EW3B 2EEDA 5L4JA 1UQSB 2C7UB 3FUMA 4TSCL 5HY9A 1IT9L 1XD0A 1ZK9A 3QJXA 4TTDC 3S4SA 3FT2B 3Q6FB 5LGHL 3I9GH 5DHYB 4JKPL 4NQUA 1KGIA 1W8NA 3SDDB 1BZQK 3GI9H 3GB7B 4IRJB 3EZJB 3U9WA 1J8RA 5C0NC 4ZT1A 3N40P 2GK2A 3VRJB 1FFOB 4ZO8A 2FUQA 2BSRA 5DVOA 3AM8C 5EO0B 5T5NG 1JTPA 1EO7A 1XTMA 1W0VB 4ZFFA 1R34A 2GITA 5FUCC 4AM0B 3HE7D 4GQ9L 4C4BA 5BOPA 1T83A 3C8KB 3ATDA 1JZ4A 1JZ6A 3X3GL 3CBJB 5SWZE 3QXVA 4M61A 5CP7B 2VDKL 3IF1B 3ARRA 3N3EA 4F8TA 3F65A 3D39D 3DX7A 3VJ6A 5EFIA 1VGKB 4XBPA 5A2KH 5C6PB 2IQ9L 4XVJH 3QC5X 1A1OB 4NQDA 5B3NA 2JCWA 1TLKA 3IN2A 1KXTB 3UTTD 3AREC 4F91B 1A4JB 4LKXB 1FYTB 3V4VA 3TFKD 1T1ZB 1BLNA 1S7WA 3H9HA 4HEPA 4UB0H 4Y2OB 3T6ZA 3VWJA 2XQYG 3B2VH 4KI5C 3N41B 1FL3B 4QGYA 3HZYA 3BMWA 2FSDA 2ZX9A 5IG7A 1EHKB 1MCEA 3GSQB 2P80D 1TEGA 1ACYL 2R1YA 3I6LD 4NLAA 4JKWA 5CMAA 3SCMB 2DV6A 2G5BB 3CUPA 4TQ8A 5JIQA 4KMTL 2ATPA 2DW5A 4AMXA 1OCCB 1RUML 4ORGB 4JDEB 3OG6B 1ZSDB 4XNDA 1GVIA 4I18A 4MRBA 1HILB 2JCCE 2YGQA 4CVUA 4IGBA 4FP8H 5D7JB 4ES9A 5AVSB 1ACCA 2E7BA 3C8DA 1KXQE 4XMLH 4RWYL 1Q8MA 1F02I 3QRLA 4JM4L 4HT1H 1EHNA 1WFUA 5FYJU 5HHOE 2X4PA 5B8CA 1KN4H 4DKDC 1SJEB 1ZA6B 4HFWB 4KVCL 4S1DD 4U1GB 1KJ2H 4AL8H 1P6AB 2WSDA 1NCUA 4N2BA 4X6BB 3S7GA 3HAEH 4NUGL 1O5DT 2XKUA 3FC8A 5DFVD 4YHZL 5B3SB 5I1GL 2EKJA 3HOGA 3V9EA 2ZXGA 2XETA 3BD4A 3GZPA 4X5QA 4ABWA 1HJCA 4Z5RB 1PVHA 5D9SB 2UVEA 3VXUB 3ULVF 3DUHA 3ECQA 4O2FA 3MSPA 2HRGA 4LQFL 1EHAA 5IW1A 5C09B 1M9WA 1PX4A 3GZOA 5GS0D 3MMEA 1TEYA 4UQAA 3TEUA 1OAZH 1QRND 4MYPA 5DEZA 1ETJA 1JXKA 4NI6A 1Q9WA 2EDQA 3H3PH 4PY7B 5K59E 1OP4A 2VRKA 2EE6A 1F45A 3OX8B 4FQJH 1TSHA 1ZLWH 2PTTA 2YO3A 3GBMH 3D69A 1TZHA 5GGTL 2HRPH 3K6SA 2H41A 2NY3C 4R3SA 5E6ID 4GG6F 5FGRA 2QKIA 5TDOA 4NB7A 2AGJL 1YEFH 2BFVH 2EEAA 3HHSA 2PWHA 4AYID 2KERA 3TN0A 3I85A 1DN0B 5AVXB 3WV0A 4HX1B 3GQFA 1YEEH 2IG2L 2ZCHL 4JFDE 1R3HA 2CDEA 1OPGL 3RB5A 4LFHG 3FQYA 3G08B 3QB7C 3SGEH 5ACZB 4WJ5B 1OT1A 3WSQL 2OSLA 4XP1H 2A5UA 2QSCH 3MRQA 4FMKA 4FXKB 1IC1A 1OAKH 1TYEB 1IE5A 1CXEA 2VMEA 2DLHA 1BF5A 1KB5H 4W9DC 2Y72A 3TLRA 2J1YA 3KW8A 4K5MA 2DI8A 2E8YA 3BPCA 4IBYA 3ZDXE 4E0RB 1H6EA 3TASA 4R4ND 1FL6B 3HRZA 4RA0C 2YPLD 4PRDB 3FU5A 5MI0C 3UJTH 5ESAA 3LZFL 1NAKH 3MU3A 1OLZA 2CCLA 1H6UA 1VFBB 1JNHB 5INCB 3VI3F 3NJLA 1CLVA 4ODSL 4YSPA 3KPQA 5E56A 1FP5A 2AV7A 1ESOA 5DK0B 5DHDA 2NMSA 5C0EA 3HBPA 1I9RL 2IANA 1ZXQA 4U1MA 2LW3A 3ORJA 1S9WB 2FQGA 1N19A 4AVKA 2D8KA 1AJ7L 4DO6A 2EEXA 4ODTL 3N9GL 1P4UA 1HHGB 2B9BA 4JDTL 1BZEA 1OAXL 4YHNA 3G6DL 3LIZL 2WLJA 4AQ8A 4CC1A 3QUYC 3E6HB 3KXFD 3DDFA 4BQ6A 4CN6A 4HVBA 2JKWA 4Z1PA 4N2OA 5JORB 5ADPL 1UVQB 3FCUB 5TFSL 4YC2B 4DSYA 4ZFOL 4FQXA 3BRFA 1QPKA 3EKCA 3TEYA 1WS8A 5EO9A 1QAWA 2NUTB 2BIPA 1TQVA 3HUJB 3M1OA 4I8DA 1NEZB 4N6RB 3REWA 3GPSA 4GRWE 4N68A 1QFHA 1JXFA 1EEUA 2LHAA 4PUBL 5A2FA 4ZYKA 5IW6B 4YHOL 3MNMA 5KSBA 1KCUH 5GIRB 1H9DA 4QHNA 2DQUH 2OQJB 4LOUC 1AR1D 4BYHA 1CF8H 1CTMA 3VCLA 3BPNB 1KBPA 5F7DA 4JFTA 5E8OA 3V0WL 4BBWA 1VCAA 1XGYH 4XE0A 3QDJD 1SFDA 3FU3A 3MFFB 4NKDA 5C0BB 3S3BB 3NN8B 1NCNA 2YC1A 3CHQA 5BV7C 5I1KL 1NMBH 2GCYA 4JFYA 1M4KA 4WK4B 1LK2A 2IADA 3OXRB 3GGWB 5HDBB 2R2HB 3EGDB 5JHDE 3QT2A 4CRPA 4BFJA 2XTJD 5E7BA 2VZSA 4LVHC 4I3RL 3D87B 4EIUA 4L0YA 2EXTA 2ESVA 5C7XH 2IFFL 4PG2C 4XCFH 4HQQH 5LQBL 5KOVC 4P5SA 4Z76A 3FAWA 2VLKA 1TYRA 4NFDA 2FEDD 3NAAH 3CDZB 4TNEA 1VRSA 2X2YA 2Q8AH 5GRZA 1F18A 2DMCA 4GKZB 3V6OA 1MCKA 1YECH 3ULSA 1FG2A 3PWUB 5JIHA 1ZDQA 3DOIA 3BKYH 4KXZI 3NDZE 3O3UN 3RU8L 4HGKC 4YJZL 3QUMB 1CDBA 1B0WA 1CLCA 2EDFA 5BS0A 5H94B 3RIKA 2BK8A 1RZPA 3OQ3B 4JPIB 4RMUA 2WYTA 4M7KH 4OFDA 3UADA 1I9IL 4N87A 2HJFA 2VITA 2NCMA 3BSZA 1QI5A 2FO4A 4Y4FD 1MJJA 1T7WA 1JF1A 1EIBA 3TPUB 3ZSTA 1YG9A 3EH5B 4UOW0 5EUOA 5AVTB 1EEYB 1FWXA 4XX5A 3JXAA 3OLGA 1D7CA 1AYOA 1W8EA 3QIWA 4B0MM 4WGKA 3KWWB 4JANA 1JZ5A 1S7XB 4ADGA 1T03L 3VW3L 4D3CL 3OHXC 1JJUA 2XTSA 3MLWH 5JNYB 4EUPH 3T8MA 5GZND 2ITDA 3TZVA 3MRLA 5FDWB 3A0OA 2J44A 3CV5A 4KROD 1K4CA 1D5IH 5LG6A 3DUUB 1U8OA 2PTVA 4M5TA 4GAYA 1CDYA 5EORH 3VD0A 4X8JB 3BH9A 1MJUH 5D8JH 4JN2A 3KDPB 4DH2A 2KZKA 2ZP8A 3BPLC 1EDQA 4OIFA 4F7TB 2WXGA 3IGKA 4NHCL 4CSTA 5EEXA 4U1LB 1FIGL 1L0PA 1UH2A 1IAIM 1JDAA 3NJHA 4LLQB 5D7SL 4ACPA 2QVFB 4ELMF 2WOYA 4JFPB 1UXSA 3EOBB 1J8HB 1OF2B 3QXWA 1FVDB 3O2DH 2R23A 2XKNA 4PBDA 2XFGB 1SVBA 1BAGA 3Q06A 4ZNEA 4LVNB 1AACA 1ILUA 3BCFA 3W82A 3OLEA