4F2FA

Crystal structure of the metal binding domain (mbd) of the streptococcus pneumoniae d39 cu(i) exporting p-type atpase copa with cu(i)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
GMTEIVKASLENGIQKIRIQAEKGYHPAHIQLQKGIPAEITFHRATPSNCYKEILFEEEGILEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation-transporting ATPase, E1-E2 family protein
publication title A new structural paradigm in copper resistance in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal binding protein
total genus 24
structure length 100
sequence length 100
ec nomenclature ec 3.6.3.4: Transferred entry: 7.2.2.9.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13473 Cupredoxin_1 Cupredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4f2fA00
4NERA 4BDVB 3FSAA 1OV8A 2CUAA 1BQRA 3FU8A 3JT2A 1AANA 2WO2B 4YVNA 6PAZA 4BWUA 1FFTB 2UXVA 4DP2X 1AZBA 5TK2A 4CSPA 3WKQA 3FYEB 1I53A 2YAFA 1BYOA 4KNSA 3FYIB 1V10A 2BZCA 3GYRA 1GS7A 2PCYA 1GS6X 2HRHA 3NJFA 2UX6A 3HEIB 4GXFA 1ILUA 2VM4A 1IKOP 3X1FA 1NWPA 2XV2A 3CVDA 2IH8A 2R7EA 2HX9A 4FA7B 2WSDA 4E9SA 2AFNA 2EIMB 1GW0A 1IBZA 2PPEA 1MDAA 1MG2C 4KNTA 2I7OA 1ET5A 3T6ZA 5TK4A 4AKPA 4E9WA 4JHUA 1QLEB 5PCYA 4WKXA 3IEAA 3OMNB 3KW8A 3NJGA 1AZNA 2IDTA 1GY1A 3N2JA 1NIDA 2ZWNA 3FU7B 2XV0A 1KGYE 1KDJA 3OM3B 2HLEB 1PAZA 4F2FA 2YAHA 1WS8A 1V55B 2XUWA 1A8ZA 4L0PB 1BXVA 1M9WA 3GXUB 2HRGA 3T6WA 5F7BA 1PLCA 4E9RA 3V9CA 3UAEA 3ABGA 4YSOA 3ABMB 1J9SA 4WTQA 3WNIA 2IDSA 4GP8B 2CCWA 1BXUA 1E5YA 1J9QA 1HAUA 2YXWA 4A66A 5IY5B 3SQRA 9PCYA 4GP5B 3H4FA 3NJMA 5B3SB 1ADWA 2FQGA 4DP6X 1CUOA 2B08A 1OCRB 3X2QB 4G71B 4G7RB 2HXAA 3QPKA 2PP7A 4JKNA 4P5SA 1PY0A 5I6MA 3FS9A 3X1EA 1IBYA 5I6KA 2PLTA 4NB7A 3AG3B 5I26A 1ILSA 4Q8BA 1PCSA 1HFUA 3T6VA 2X87A 1X9UA 4AKQA 2FT6A 3FQ2A 5LDUA 3WNJA 2XU9A 3QJSB 5FC9A 2PP9A 1GS8A 1PNDA 1GR7A 1XMEB 1QHQA 2J5WA 3OMIB 1AG0A 4KO9A 4E9VA 1YLBB 1BAWA 1M57B 1PNCA 2IDUA 5I5MA 6PCYA 3EH3B 2AANA 3S3CB 2JKWA 4DP4X 1AZRA 4AI7A 2DYSB 1AG6A 1JXGA 2FWLB 2XX1A 1AS6A 2XYBA 2XXGA 1AZUA 1KYAA 3JTBA 1JZJA 1J9RA 3AY2A 3NSCA 3NJNA 4KOBA 3AZUA 1NIBA 2FQFA 2UX7A 5B1JA 1ASQA 3FQYA 3KW7A 3PCYA 1NIAA 5ANHA 1PMYA 1OCZB 1J9TA 3PPSA 3FT0A 2BP0B 3AG4B 5F7AA 4AZUA 1NTDA 4YSEA 1AQ8A 1RCYA 1SNRA 2YAMA 1OE2A 3ABLB 1PF3A 1J5CA 3DTUB 1JVLA 1AZCA 5B1KA 1SF3A 1L9OA 2DY2A 7PAZA 2J55A 1SJMA 1KDIA 2YXVA 2OV0A 2CALA 3MX0B 2CAKA 3OMAB 4P5RA 4HCFA 1KBVA 3T9WA 3EF4A 3EH5B 2VSKB 1JZFA 1UATA 1AACA 4YSDA 2IH9A 2B3IA 3CVBA 1N68A 4PCYA 4KO7A 3TBCA 1A65A 3GDCA 1SF5A 2YAEA 5I6LA 2QPDB 5D4IA 2PPAA 5A7EA 1L9QA 1F56A 2W88A 4UF7C 1E5ZA 3QJVB 3T6XA 1X9RA 1JERA 2MRYA 3EHBB 1JZGA 2VW4A 5AKRA 2IWFA 1ASOA 2WO3B 4YSPA 3WG7B 2R7EB 1MG3C 3PAZA 3T71A 2BWDA 2RACA 1BXAA 3QJRB 1NIFA 3U25A 1OCOB 1PZAA 2BW4A 1ZDSA 1W6WA 1M56B 2HZHA 2J57A 3NJJA 3OQRA 1PLAA 4YSQA 2P80D 4YSCA 5I6OA 4PAZA 5B7MA 1KCWA 2MTAA 3D12B 1IUZA 1DZ0A 2VW6A 1IC0A 5B1BB 2CBPA 3ZDWA 2FQDA 3UACA 2EINB 3OD3A 3FSWA 3CDZA 1ID2A 1ETJA 1L9SA 2BP8A 3NT0A 1R1CA 3S8FB 3FSVA 2I7SA 1E65A 4FAAB 1A4CA 3G5WA 2XWZA 4YL4A 3NYKA 4DP9X 2LLNA 2EIKB 4BXVA 4A68A 1V54B 2IDQA 1KV7A 4NAJA 3ASOB 2PCFA 4A2HA 5I28A 2BHFA 3IE9A 1NWOA 3DIVA 4F2EA 3N55A 1VLXA 1L9RA 2GC7C 1DYZA 4W9ZA 3UGEA 1PZCA 1OE1A 4GP4B 1AAJA 2IAAC 1CC3A 2YARA 5B1JC 4HCIA 4KO5A 3TBBA 4E9YA 1NPNA 2PPFA 1WA2X 1AS7A 3NJLA 3BQVA 1TU2A 2XX0A 3FU9A 4HZ1A 1SHXA 2GBAA 5I6NA 3WI9A 1N70A 1T5KA 2FT7A 4E9TA 2N0MA 4HCGA 1BEXA 2DWSA 3QJQB 3S3DB 5D4JA 2H47C 3L45A 1XB6A 1JZHA 1W8EA 4BK5C 1WA1X 3X1NA 5B1AB 4G72B 1PLBA 2A3TA 5I6PA 1AOZA 2Y1AA 4KOCA 3SBRA 4QLWA 1ZIAA 3NJIA 1TEGA 2OJ1A 1XB3A 4Q89A 3AW5A 3S3BB 5AFAA 1ET8A 2IDFA 2I85A 3EH4B 5D4HA 3TASA 2IWEA 4K9JA 1MZYA 4AKOA 2XV3A 1RKRA 1WA0X 2JXMA 4ZK8A 4YSTA 4AX3A 4EF3A 3RYMA 1L9TA 4GY4A 1NICA 4BDVA 1CYXA 2YAOA 4QKTA 4A2GA 2H3XC 4YSSA 2CJ3A 3TA4D 1TEFA 1GY2A 1L9PA 5EHFA 4DPAX 4TXVB 4YVUA 2X88A 8PAZA 1CURA 1OE3A 3ZX1A 1MZZA 1SFHA 2XLLA 2HX7A 2FTAA 1EZLA 2GI0A 2TSAA 3PLYA 1AS8A 1OF0A 4E9XA 1ASPA 3NP3A 1BQ5A 2BO0A 1JZEA 2QDVA 2YQBA 2VM3A 4A2DA 1SDDA 3X1BA 2BW5A 4BWWA 2FQEA 4E9QA 3WIAA 4DPCX 1J5DA 3NP4A 1NDTA 4RH4A 1QNIA 2ZONA 1NPJA 2GHZA 4UANA 2GB2A 3QJUB 2E86A 4KO6A 4A67A 4G7QB 3AG1B 2XXFA 3NJKA 3PAVA 1EHKB 1SHWA 1SDDB 2P80A 1URIA 4W1TA 3ZIYA 4DP7X 3CG8A 4HALA 2EILB 2JFCA 3V9EA 3NSDA 2DWTA 3TU6A 1A3ZA 3IN0A 3S8GB 1TKWA 2GSMB 2QDWA 2Y69B 4ENZA 1OOWA 2DV6A 2VMJA 2FT8A 1NINA 2ZXWB 4MFHA 4DP1X 1A4BA 7PCYA 1GSKA 4YSRA 1CYWA 1ZDQA 2BZ7A 3FU7A 1HAWA 4M3HA 5AZUA 3SBPA 2VSMB 4HAKA 4DP0X 1B3IA 2AZAA 3ABKB 1JVOA 4G70B 2QPEB 4G7SB 1E67A 2PP8A 5B7EA 2UXFA 4A2EA 4N4YB 1FA4A 2QT6A 1ZPUA 3BVDB 3DKHA 2PPCA 1BYPA 1KBWA 2AVFA 2YAQA 1RZPA 3CDZB 3AG2B 2BP8B 3MBWB 4N8UA 4HHGA 1AIZA 3WKPA 3C75A 1ET7A 1WS7A 1FWXA 5I5IA 1GYCA 3ERXA 2VW7A 2GC4C 1XB8A 2HX8A 3HB3B 3FPYA 3CZUB 2Q5BA 1KCBA 2TSBA 1JXFA 3CVCA 1BQKA 4A2FA 3UAAA 1JZIA 2YAPA 1ZIBA 1SFDA 3IN2A 1AR1B 1A4AA 1W6LA 2W8CA 2UXGA 3QQXA 4BWTA 1NIEA 4F7KA 1NZRA 2FNWA 1RZQA 2VN3A 3NSYA 5B7FA 3FPXA 4DPBX 3PAUA 3ZBMA 2Q9OA 2XVBA 2AZUA 2H5UA 4JHVA 4CSZA 5E9NA 2OCCB 4BXSV 3IBOA 3UABA 1JOIA 2IWKA 5PAZA 3PXLA 2GIMA 2FJSA 3SBQA 3UADA 2J56A 3H56A 2ZOOA 4M4RB 3QJTB 5I5JA 4HHWA 1E30A 4YSAA 4GYBA 4YSUA 4DP8X 4UAHA 3FSZA 2BWIA 1ZV2A 1WAEA 2UXTA 3FQ1A 4HIPA 1JXDA 4X4KA 4KNUA 1PZBA 2EIJB 1OCCB 2BP0A 4DP5X 2DYRB 3X1GA 2PPDA 3NJHA 3ASNB 2NRDA 3NSFA 3H4HA
chains in the Genus database with same CATH superfamily
3SDYH 2QPUA 1BLIA 4GEIA 2PO6D 3T2PA 3QUKB 2ATKB 2WLYA 4QR7A 4MQTB 5L6YH 3FQWB 3ZT6A 1QO3B 1U3YA 2BFVL 2RTTA 2VDOL 1ZVYA 3KLLA 3MOAL 4Y19B 3CHXA 5FUOH 1W0VA 3HHMA 5IQMA 1FFTB 4Z7UE 2FX7L 5EN3A 1KLGA 1YZZA 4TMPA 5IMMB 5L88H 4FS0A 4XP1H 5D1ZA 5F44A 5LVEA 1UQSA 4AH2A 2VLMD 3SDAA 5AAMA 2IBZX 1T83A 3FCSA 3VG9B 5BJTA 1RFDH 3QUMH 2FHBA 2GY5A 1J48A 3G6AA 4FABL 2QQKH 3IAGC 1XL6A 3IDGA 5E2TH 5KYUA 4FA7B 4S2SA 5GGTH 2EIMB 4IIQC 3VDAA 4S11A 2BSEA 5FXCH 1JPTH 5EF0A 4QWWD 3BCFA 1JHKH 2VUYA 3K6DA 2GEQA 4NZDA 4HJEA 5FYLE 1OZTG 4LU5L 1QLEB 4NYLA 1INEL 4K5MA 2CBQA 3QAZC 4MXQD 1TG8A 3MNWA 1DVQA 1YY8A 4LBAA 2HFEA 2V2XA 1U8LA 3E6FB 5E6UB 3QEQD 2P46B 2V9UA 4QPEA 5HGBA 1IGIH 2ZUUA 4G8EA 3QJFA 4Q4IA 1WS8A 3SHSA 3QGVA 1V55B 1JGEB 1JPEA 3EXLA 1IAOB 1F90L 1WICA 4K3JL 1N8ZA 2OL3B 4CW1B 3K1DA 2D3JA 1PLCA 3BKYL 2R2EA 4MBRA 4MAYB 4PRHA 5MI0C 3GLZA 1YNTF 4X9BA 2CO6B 3GS4A 2H9GB 2QADC 3LY6A 3VM7A 1OALA 2A9AA 5ITBL 3GBLA 4AC4A 4HJIA 4JRXA 1UB6B 2CCWA 2XXCB 4B96A 1FGVL 2EDJA 4N8VB 5ICXA 3QHFH 4YAQB 1CICD 2BNRB 4GP5B 3S96B 4YC2B 2IFFH 1HH6B 4U1IA 2HLFD 1K2DB 1G43A 4J4PA 4MJ5B 4OCXH 5I8KH 5FO7B 4G7VL 2VDNB 4PJFF 2ZT9C 4KKCD 3IRPX 3V8CA 4D9QE 2P42B 3B2VL 4HK3J 3G9AB 1AGBA 3WFBH 1JGDB 4IKLA 3MV8B 1EBAA 4NUGH 5EUOA 5F1NA 5GRVL 3CFJA 3DUSB 2DS4A 4QXGL 5DMIL 3UGXA 5IVNA 4OQTA 4HUKB 4Q9QH 3LZNA 4JM4L 4QF1B 1B0GB 1E4KC 1RZJC 4KUCD 1YCSA 1ZS8B 1JCKA 5F8RC 4U1LA 1DUZB 3GLAA 4ODHH 3ZKXB 2YQ2A 1I4FA 3BW9B 5IBTL 1EHLH 1MAJA 3UZQA 4QRRD 3KYOB 3FT3A 1T0MA 2OYPA 2B8OT 3T5WA 1M57B 4PG9B 4BQ8A 3Q6FA 3FKUS 3T8MA 3CSFA 4AI7A 3L3HA 4HW6A 4JPIB 4ZFFB 4Z5RB 2E74C 2NXYD 2NUTB 1G7PB 3H3PL 3B7SA 1GOHA 3QFGA 5AEAA 8CGTA 3LZFH 1J9RA 4MCYA 1NBZB 3RNKA 4OZ4A 3UIZA 1RZJH 1TYJA 2FQFA 4RGMB 1HILA 4PB9H 3QWNA 1Q0YL 4MS8C 1KLUA 3HNVH 2C4FT 3B43A 1KBGL 5EG6C 1XH2A 2ZYIA 3FT0A 2EABA 3H9SA 3C8KB 2WLLA 2F8IA 3ARFA 3EYSL 4EI6B 1J0IA 3ZE2E 2BCMA 4PD4J 1KENH 1ZLWK 4BGDA 3I6SA 3HG0A 4MYPA 3PP4H 1MFDL 3N1MC 3ZTNH 1RURH 2WVTA 4RFOH 3FRUB 2DQGL 5AW7B 4ETYA 2IANA 1DQLH 1TVDA 3TCXA 3WIHH 2KH2B 1ECYA 1IE4A 3HVNA 3PWJA 4LVOC 2AF2A 4KRNA 2VDLH 3ML8A 4ODSL 1S5HA 4EIZC 5J6HA 1UATA 2A9ML 1RUAH 3CVBA 2QGBA 1DSWA 4ONFH 4PW3A 2Z6FA 3NJVA 3VXMA 1S7TA 5HI5C 2DEWX 2E7CA 1FFOA 3HFML 2XJLA 1K3IA 3PWVB 4F58L 1E5ZA 4A6YL 4L4VE 3D18B 3T6XA 4E5XB 4G1EB 2Z35B 1M53A 2ZG2A 5CWSB 1KB5H 1I3RB 3L3DB 3PAZA 3VXTB 1VENA 3FONB 1OLZA 1RUML 4PVNA 3T71A 4OV5B 4LLYA 3O2DL 5IEHB 4FQ2H 3OHXC 3IU4L 3CFBA 1S5IL 1DJZA 3OL2A 4JO1H 3WGUB 1XCQB 2HT4D 4MQXD 1RP8A 3OF6A 4LHUD 3SKNA 2NYYC 2YBGA 2X4UA 2LHAA 5B7MA 2C3VB 4WWKA 1U8OA 1IAIH 4JHWL 3MRLA 4M7ZC 1A6UH 3B9KD 2ZX5A 4UT6L 5ID0B 2HFFA 4UOW0 4Y2NA 1BSIA 5I73C 2WW8A 1Z5LA 3FTVA 1OSPL 1ETJA 4QYOB 4NOFA 3FSVA 3RPKA 4B9KC 2N59A 3RY6C 4UQ3A 1N5AB 1F4YH 2BHUA 1LO5A 3WJJC 4D8PA 3VXRE 3NPSB 1G7MB 12E8H 2G3MA 4BXVA 4OB5H 1X5GA 2DIJA 3CSPA 3MXWH 5H2BA 1BXXA 4FI7A 4Y5VB 1MCFA 3RU8H 1H3WM 3RKPA 2H0EA 1M3JA 4L9LC 3VGGA 4HOWA 5DHYB 4P3CL 5FV1L 5MEPB 4M9OA 3KPOB 3O2WL 1IGFL 3ZUCA 4Z7VA 2NDFA 2EYRB 3ZTJG 4MMXB 4HHAA 2X2YA 1LEGA 2WZ6A 5DJCA 4V1DD 1U4FA 2CCVA 2GTZB 4NJ9L 3KXFE 2Y5TB 3V6OC 4GSUA 1N12A 1OARL 2YA2A 1MAML 3D85A 5E2VL 2VDOB 3TWCL 4OI8A 3Q5TA 3SDDD 3LQZA 3DV4B 4YDMA 3D69B 2WIIB 3FQXA 1TQCB 4OGYL 4Y16C 4XPAH 1DBKH 4LKCA 2DWSA 5BS0B 3O6FC 5D7JA 2RQEA 2CDGA 2X9WA 2YZ8A 1JD9A 1D7DA 1E8YA 5FGSA 1IC4L 2JB6B 1LEKB 3UBXB 4BFIA 2X53A 1W8EA 1YYMH 1LE5A 1EEUA 4QRQA 1T04A 1KJ2H 3C60C 1EUUA 3K2KA 4KOCA 1DHKA 1BFSA 1MRDH 3OZKA 1G7HA 4DZBB 2MQ0A 3EHBC 3GIZL 2Z4TA 4XVTH 2F54B 1I1CA 3GD1C 5KSVB 1SJXA 4XP9L 25C8L 1S3RA 1WFTA 5ADOL 4XNBA 4BZYA 5AFAA 3ARTA 5CKGA 4LSUH 2PO6B 4PBXA 3IMSA 1EGJL 3HNSH 4XPHH 3PF2A 2ROXA 4ZUTA 3X11B 4RX4D 3SQOL 2DWEA 2H41A 1RSYA 2BY2A 2YPLA 5C0DB 5AD0A 1NBVL 4IRSD 3VNYA 4AGPA 3MC0A 4YHYC 2OMWA 4M7LL 4EO5A 1IO4C 4CVXB 1OO2A 1JN6B 5C0IA 1MFVA 1TENA 4ZZKA 4MA7H 2OXGA 4IOFD 3ZRFC 4NM8H 4Q2ZA 2D31B 3H6JA 1FGNL 1SFHA 3CPLB 5I74B 4H8QA 2AQTA 1MI5A 2W94A 3Q0HA 3IGAA 5DRNA 4UCFA 3H0TB 2D9CA 4JDZB 3NCWA 3MUUA 4HC1H 3QXTA 4X7FC 4P46D 4UBDC 1F6FB 3ATAA 1N0LA 4NPKA 3ESMA 1XIWA 4F9PA 2ZAIA 3RWDA 3V0WL 2GBTA 2V2TA 1J5DA 2JJTC 2P24B 4OUUA 4B60A 3DLQR 5E4IA 4FQIL 3U6XA 4XBEH 4PIRF 4ZTPH 4N2CA 2LAGB 3K71A 5DYOA 3Q8CA 1CLOH 1AFVL 2AI0H 3G04B 4LLMA 4C83A 5CF3A 3WAKA 6CGTA 1WAAF 3B1UA 3N1QC 3QEQB 3N44B 4M43H 3GSRB 3NRFA 1NBYB 3CN4A 3IB4A 1YJDL 3STZA 5D71H 5K9OB 5J57B 1QNZL 2HRPL 3EOTH 1Z32X 5T33H 2VDMB 3DGCR 5GIRA 1XF2B 5DZLA 4JJ5A 4KZCA 3FDWA 3ZTCC 1C7TA 2NR6A 4L4TE 3GSNA 3MUHL 3FU3A 1I7TB 3VRIB 3U4KA 4DGYL 1O7DC 1WVZA 1OAZH 5FHAH 1X3DA 4ZFZA 1CICB 2Y7SA 3VMOA 1UXSA 1N5YH 3HG1A 1EAPB 2EP6A 1DJWA 1TZ8A 4PJEA 3NK4A 4YHKL 3AG2B 2PW2B 3L81A 1NFDF 2X4TB 3BDBA 1W9XA 1U8QB 4WK4B 5DEGB 3W0WA 5JIPA 5I1CL 1EX0A 2G3ZA 1Q8MA 1BQHA 5CKAA 4NX0A 2QKIA 4PN6A 3EYOB 3UH8A 2DL9A 4P4RB 3QFJD 2YMOA 2O6DA 4KKAD 3L5WA 3EUDA 1A14L 1NCAL 3QQ4B 5CIPH 3QPXL 3ZVVA 4P57A 5EORH 4NPJA 3R1GL 3FUFA 4QRRB 5DLMH 3EGDA 1UUNA 4W6WB 5DMGC 3MRJA 4J23A 2PTVA 2WQVA 2AJZA 4P4KD 3KPSA 3MRMB 2ZKHH 1JHTB 3VRJB 5LGHL 1MCPL 1FH5H 1L0PA 2IBZY 3V0IA 4PJDE 4AMXA 2YGQA 3BWZA 2NXYB 3HPLA 2Q2LA 2W9LA 3OAZH 5ADPH 3U4BL 4FTVE 2N7AA 4F7TA 4NQDB 2JLPA 4XBGB 4OT1H 3KLDA 3ES6A 1JJUA 1PZSA 3I74A 3JVGA 4M93B 3P11L 4TLKA 3A0OA 4GQRA 4A6YB 2H2SD 4F15C 3DK2A 1JWUA 4LSSH 2VQ4A 1VEOA 3L3KB 1E30A 3WEMA 3MO1B 4S0HA 5DYFA 3RJOA 2JK5B 4H13C 4D9RD 1YPZF 1KWGA 1JCVA 4AIEA 3D25B 3M8OH 1D5ZB 1ZV2A 5F0LB 3TBSA 4YGVA 3Q8FA 2Z91A 1J0HA 5CCGE 2JJSA 5CZVL 3UC0L 1BZ9A 1ZANL 2NT0A 1NEZB 3LAFA 4TSCL 1Y0LA 4JREC 3ETBF 4PWFA 4YO0A 4PRBA 3UFIA 1CDBA 1U93B 4TOYH 5JTWA 4HISA 4OM1L 5FYKU 4AGOA 3CZKA 2Y25A 3BOVA 4MCZA 5ACLA 3CK0H 3RJQB 4Y9GA 3LPPA 1UACL 1PW3A 1KJMA 4X6DE 2MCPL 2IMMA 3WEXA 1M2OA 5EB9A 1V10A 4FJYA 5DWUL 2BS9A 3LN5B 3NA4A 2UZYA 1E8ZA 3GS7A 5J56B 3LNFA 5CCKH 5C09A 1IFHL 1G9MC 3IU3A 4O5LL 2DN7A 4WY7L 2XN2A 2F58L 3LCYA 4N85A 3SE6A 5FKAB 4A37A 3ALWA 2IH1A 3MROA 3HMXH 4M7JL 5DZJA 4LHUB 3EADA 1GTNA 2XWCA 1SBSH 3TYFB 3WENA 4WU7A 1QR4A 3QEHA 1SOKA 2LU7A 3QEUB 3B9KB 1S3KL 5D1XD 5DR5H 4MNGB 4RWYH 3H53A 4AW4A 1BFVL 1FZKA 1KACB 3PPEA 1S7WB 4DN4H 4LOUC 2LU4A 1VGEH 2AKRA 5CEXA 4N9GB 1NCWL 2DDQH 4FYQA 3WLWC 3IJSB 1WSST 7TAAA 4TQEH 3K72B 3FU7B 4WDIB 1I9IH 2AXJA 3VQ1C 1G9MH 3MNVA 2P5PA 4DQAA 3FUEA 1UH4A 2XTJC 1JF6A 2D3VA 2HJFA 1NUFA 4I13B 5EEUA 4XC3H 3SJVE 3FO1B 3QWOB 4J3OC 1CE1H 1RJYB 1JL8A 3SOBL 2VZTA 1J5OH 3T6WA 3V5KB 5F7BA 3SKJL 3QORD 4XNUL 5I8CB 4BINA 4BGLA 3EDJA 3KVDD 3BLPX 2XKNA 3BT2L 1KXTB 2D2CC 5T8IA 3WTSA 1AO7A 5E23A 1YNLL 3BPLB 4B9CA 2LFEA 5DFTA 1OTSC 2Y36H 2NCMA 3IDMA 1T3FB 1UCBL 1M7IA 2WUCH 4G80A 4NWTL 4V1DB 4N8PA 5MEND 1X5XA 1IGCL 1U0QA 4PJGF 4BELD 2C34A 2IG2H 1NFIA 4UBDD 5K39A 3RBGA 1KZQA 3SDDB 3QS3A 4N26A 4YUEL 5C0GA 3EO0A 5L7XL 4JKNA 3FUMA 3C9NA 2XTLA 4NNPL 1QSFE 3HZVB 5DU7A 4BFGA 4O9HL 5J89A 4J3OH 1NCGA 5E51A 4UTBL 5DC9B 4XPFL 3KNBA 3AG3B 4QHKJ 4ZOCA 4WI0B 3GSQB 4PJXF 2QHRL 5EBLA 4OZHA 2COQA 3FFDB 1X5AA 5B38G 3M1OA 4S1QL 1MPAL 3MJ8A 1A7PL 1XR8B 1SYVB 2C5DC 5AKTA 2P8PB 5FFGA 1P1ZA 2BRQA 3SDXE 1RLWA 1RSFA 4FJ6A 4Y0GA 4B7LA 5FM4A 2XRAL 2DQDL 1XXFC 5FC9A 2KHAA 5KSAC 4OD2A 3KWXA 1S9WB 5IW6A 2YK1L 2ZCHL 4OCSL 3BI9X 3MRCA 2P5ED 5CINH 5IW1A 3BH9B 3DGGA 4PD4K 3DX8B 1HHGA 4GRLC 4NN6B 1AZRA 1XGRA 2XZQL 1G4RA 4MBOA 4IRSB 1TCMA 3CMGA 5KAQF 1WZ1H 5EWIL 5JDSA 1J05A 2J1XA 3ULAB 3ETBJ 5HGAB 4O51B 5AWNL 1NIAA 1ULVA 5IUCA 4OJYA 3B56A 4P5TA 4PJ7B 1Y6MR 2NX5D 3VD0A 4YBLB 1A21A 4YFLF 2X1OA 2X6MA 4AIZB 1T21B 3P30L 2ZX8A 4C59B 2WBKA 4UWQB 4K7PH 1DVFD 4O2CB 5I5RA 4Q9RH 5LCVH 1UM6L 3O3UN 4X9IA 3GXDA 4LSRL 4P46B 1XHHA 1TZGH 3A67L 4G5AA 4IBZA 1YO4A 4GXUN 1L9OA 3VFUB 4I4WB 3K81A 4PJBB 1HQRA 1IM3A 1C5DB 1Y18A 2OMXA 3LZRA 5EF2A 3QBTB 5DJ2A 4WV1C 1YN7A 5LGKA 2NY4C 3CV5A 3MRGB 1GOGA 4CADA 2IAMC 4D8OA 4PGJA 4XP4L 3M7FB 4NLHA 5D93C 2AXWA 2Q7NA 4M6AA 1KELL 2W59A 3MODH 3MRQB 1FZMB 3D39E 3JUZA 1F3RB 3QJVB 1E3FA 2EO7A 3HBZA 4M5ZL 1I9EA 2R8SH 4KUZH 5KVFE 3U1PA 3R4RA 5SWSD 5DS8B 5LLIC 1F3DH 4LVNC 4XZUB 3UPRB 4X6CE 2A6DB 4XNQA 4KI5F 1OGTA 5FGCB 1AVAA 5K9KA 3VE0B 1I7UA 1I82A 2VZUA 1DBBH 3MLZL 3UMNA 5KJ4A 3PDDA 3CCHB 2VN7A 4ZOBA 1LYQA 4YHML 5H4ZA 2P80D 4YX2L 5I6OA 3ZW3A 2ICEC 1Z0MA 4U31A 3IPEA 1SYSA 1KB3A 2WBXA 1W2KT 3MA7B 5DUBA 4AVJA 8FABA 3HG5A 5MERB 3PWPA 3MSPA 4N3UA 2ADFH 2XCMC 3QIWA 1FCCA 5T1MA 4DO5A 5KVEL 5LXGL 4ODBD 3FU0A 4D0BA 2Y07L 1AI1L 3VB9A 5IBUB 1XTMA 4GQZA 3S8FB 2FEDD 1HS6A 2FIRT 3DV6B 3QFJB 4Q6IC 5DHMC 2WKGA 2COVD 2NT1A 5FUZL 4TNVF 5JPNB 4I48A 5BZDA 3T0EA 3EO9H 3DIFB 4LPWA 1P4LA 3M1CA 1NGZB 5E94A 3EFOA 2UYLB 5FUCC 1RK0B 1OAQH 1YEKH 2OSLA 3AT0A 2A9DA 2ZQKA 1N3NB 5IQOA 3IE9A 4P4KB 1UB5A 1JZ7A 4HUVA 5CGMA 3KL3A 2HTLC 3O9WD 2FYYB 3J7HA 2UUDH 4BV1A 3OZ9L 5DEFB 4N8VG 1JV2B 5B1JC 2VC2H 4PTUA 4XCYA 3VVVA 4E9YA 1HDMA 5I1AB 3SQBA 4AE0A 4BK4A 4F8QA 4F2ME 3LNEA 4K5NA 3QUZD 2YD9A 4BUHA 43CAA 3VUAA 1M71B 2EO1A 4FF9A 3OXRB 1YN6A 3WI9A 4MD5B 3QJQB 1QRND 2N3JA 4Z6AT 4YQXH 2V7HB 3KD4A 2BNQA 2PWGA 3EOBA 3HI6L 4U6HB 4IW4C 1AD0B 2B1AL 4FKHA 4TULL 1A1MB 5DUML 1JUFA 1J18A 4Y7MA 3RX7A 3L4ZA 2XWTA 1FFNA 2BSTA 4LGRB 2BSRA 3TJHC 4AM0Q 1MJJA 4JY6A 4UM8B 3FO0H 2FLBT 3L3IB 4CJ0A 1UJ3C 2MKLC 5HJGA 1WC7A 1WWWX 2I85A 4OD1H 1JE6A 5ISZA 1MZYA 1OP4A 1ZCRA 1TQTA 4AKOA 4CNIA 3S5LB 4YHZL 4N86A 1LMKA 3DX9A 3WNOA 2DIAA 2W60A 3GZOA 2FHFA 4H40A 4R7NB 2AABH 3VB8A 1XX9C 2KLTA 2BXYA 4LSVL 2B3RA 4G8AC 4PQXA 3KWVA 1A22B 3HAEH 1UZ8B 3DOIA 1G0XA 4X6EB 4Y16B 1GYUA 3RTLA 1ZK5A 2HA1A 4BRJA 2ZYRA 1OF0A 4Z7OB 2J88L 3GHEL 4GAJL 4OBRA 5FYLH 3L3GB 1JZEA 1PD1A 1ZV9A 5MP6L 3CD4A 3WJLA 4B7IA 5HVHB 4JBSA 1W72H 4WUKL 5AB9A 1DSFH 2IJ0C 3KLHC 1TTBA 4OLZH 2ICWJ 2QQNL 4RH4A 1NAMH 4J3TA 3VXSA 5D1XB 1M3IA 3LEYH 4IEFB 1LVEA 2HP4A 4DFIA 4PGEB 3L54A 4RGNE 3VXUE 2ZOLB 3D05A 3D3VD 4PGBB 5D7KE 3ZDYF 1I8MB 2JSFA 3FOLA 4JAMB 1XH3B 4PHXA 3HR5B 4CU7A 1KNOB 3BVWA 4HFWB 2WQ8A 3QIBA 1TKWA 2X4NA 4MQ7A 4NP9A 5TF0A 3K80A 3VX0A 2DBLL 3V4PA 3OPUA 3P9WB 4MJHA 2ENYA 3OG4B 1AR1C 4E5XG 4K9EC 4FFVC 4P9HL 5IB4B 1D5RA 1U3HA 1I9RH 5DJDA 5EZJA 3PQYD 3QORB 4W70A 4XC1H 5F3HA 1J1PH 3VI3A 2WXHA 3RUGA 1B3IA 1Q9OB 1CK0L 2OR8A 1SN2A 4YS4A 2I69A 1D9KC 3GSVA 1BBJB 4XRCB 2ZUSA 4URTB 1ZLSL 4L4JA 1MH5B 2VSCA 4I8DA 3G6JB 2CQVA 5BVJA 3IMBA 1AGDA 5E6SB 5MENB 4Z18A 3HE7D 3D0LA 5JO5A 1B9KA 1KBWA 3UP1A 3BZEB 3SCMA 5CLXA 4YOKA 3TNNA 5F7WC 5E4EC 4K9EH 3ARGA 1H3UA 3F6IA 4Y9BA 4FFWC 4XBMA 2DQMA 4I9XA 1BWWA 4G6JL 4PRHE 5KOVC 3V0VA 3UTZA 1H8NA 4WFFE 3QQ9D 2W81C 5A40E 1MHEA 1G7IB 2FX9H 4POZC 5LNDA 2TSBA 4JRXE 3CUPB 4EJ1C 3FQNA 3ZMRA 3QDAA 5E4OA 1ZIBA 2FGWL 4KK9C 4OJFL 3NFPA 1HL9A 4HFUL 4X50A 4F7KA 3RDTC 2G0KA 2JQAA 3UBGA 1P7QD 2P5EB 4JZJB 3BZFB 2IADB 2EDMA 5FEBA 1XGZA 5CP7B 3V0EA 1AGCB 4HMEA 2HT2C 2Y06H 3F65A 1Q38A 3L5JA 3HRZB 1U8HB 3HBGA 4JM2A 4NM4L 4LQFL 4Q56A 5E9NA 5EUOE 3SGJA 3TFKC 3TN0D 4M3KB 4XN9A 3IDNA 3D34A 3S37X 4MJIA 4IBUA 3B6SA 4LF3A 1TYEB 5C86A 3H2WA 1I7RA 4WW2C 4H26A 2DQIH 4XVSL 5FYJL 2DJSA 1HTYA 3VFRB 4PJHA 5D2NA 3MKKA 4HLJA 1CVSC 2NX5B 4LDLB 5L0QC 2AVGA 4FG6D 3I50H 4ZTEA 3WSQH 4BSWA 3UBXG 5KANI 2Y7LA 1DVFB 3LOWA 3O11A 2WM0A 4L1HA 2NY1D 1T1WA 2EVJA 3EFDH 3QUXD 3LN9A 1PX3A 1EDHA 1KIPB 4DGIL 5HGDB 1A1NB 5CBAB 3CSYB 2Z3FA 3G9VA 3FMGL 1OVZA 1P5VA 2A6IA 2NRDA 3ECVA 3M17A 1IBBA 3VFSB 1T1XA 1JZDC 2DWDB 3QO1B 1D5MA 3DJTA 1VDGA 4XN4A 5E56A 3RWEB 3GMNB 5K9JL 4AM0B 4DKFH 3MRIB 4GI6A 2YMXH 1PZ5A 3GSWA 3CFKA 4FFTA 5CJXA 3BD3A 1F4WL 3H9SE 3KCPA 2PMZA 3H1ZA 5DZOA 1KN4H 2WXOA 1JHLL 5EBWA 4ERSH 1KJ3H 2DEXX 5IVXB 5DJZB 1S7RB 5SWSB 4NENA 3FCBA 3WBDA 2I9TB 5CXPA 1VFBA 3GBDA 1GS7A 3TNMA 3VDCA 4YLCA 3PS6A 4R4ND 6TAAA 4YGAB 1D5XA 1QZ1A 4IYKA 1MREH 4I77L 3VQ2C 2WVVB 3P9LA 3SY6A 1I1FB 4DK6A 4E9SA 5C0AA 4XI5D 4ZS7H 5EOCJ 5D1QA 1INQA 3IDXL 4OAWB 5H37G 1RUPL 4PTTA 1NGYA 4AG4H 3VXME 4P8QA 1WF5A 1J1OL 3NIFF 2CIKB 4JHUA 4G6AD 1L0XA 3JWNC 5E6ZA 4E36A 3ECBB 3RP1A 2WGNB 5ALBL 3DMMC 2P28B 5MEOA 1DEEA 2IDTA 1T7YA 3T08A 1LD9A 5AOJA 5E2WH 3OM3B 3CFEB 2IWGA 3O6KH 2ADIB 2DQHL 4U3SA 5HHNA 3WUWA 2XUWA 1QFWH 4L5FE 3KPQB 1LK3L 3GXUB 2BFVH 1JGUL 3V9CA 2ENJA 4DNLA 1RQ5A 4G1MA 3ABMB 4AIXA 1JK9B 4OJEH 2FX7H 3O9WB 1WBXB 2DLIA 4NRYB 2CKBL 5FCUL 3JWNH 2K6ZA 4MVBC 1AHWC 5J13C 3L3OA 2BVOB 3G6DH 3LEVH 1DUYB 1UVQB 3SQRA 3ULUF 3OGCB 4FEIA 4UT7H 4XO4A 1S7VA 4LSQL 1SLUA 2YSTA 3QUZB 2AGJL 2VXQA 4F33B 3BQUA 4FABH 4G59C 4G7RB 4YXHH 4L8SB 4MJ6A 4PJ9C 1FVDA 4UT9H 5T1KB 4AGQA 1YEWA 5DFVD 1GGCH 1IBYA 2JIXA 4UMGA 3ZR6A 1M1SA 2H32B 1QRNB 1UWEH 5EU5A 1EZSA 3FTGB 2YPKA 3S48A 4F7CA 3BAXA 3Q43A 2QSQA 2CM6A 4QHKI 3V6BR 5HYSB 5F9WC 1IL1B 4ZUWA 4N90E 1KTJA 4FMVA 4OVUA 4Z7VE 4I5BB 1HYSC 3NRPA 4ZW3A 3O3BB 5I71B 4ELMF 4N28A 2A74C 3RRQA 3ME0B 4YDKH 4QXTA 4Y1AA 3U9PH 2R0KH 3RWJB 3NCBB 5F88B 4K71C 4P2QD 3EYFB 4HULB 2WXKA 1NCHA 1BREA 1CTMA 1F90H 4PGCA 5I5MA 4K3JH 3P3TA 3S3CB 1F45A 5C71A 4BZ1L 1MXDA 2YKKA 2B4CL 2ZUYA 2R2CA 3RWFA 2X89A 4XCCH 3NSCA 3MRNB 3EIFA 3MFFB 2AJYL 2OZ4H 3ARBC 1HL4A 4TYUA 3HS0C 5IT2L 2AK4D 4DTGH 3JV4A 1XSOA 4TVPE 5DSCA 3ISYA 4CKQA 4OCNC 4ZDHA 5A3IC 2GSIB 5A2BA 4G7VH 3QI9D 3RPIA 1YC8A 3QXWA 4ES8A 3P3RA 3FT2A 3F7VB 4KJQC 4XHJC 3RGVC 2X4QB 1BP3B 2YPLE 5AW2B 2MJWA 1MCBA 1K3ZA 1NEZG 5DMIH 1VCAA 3KS0J 2FRGP 3KDMA 4EVNB 1QD0A 3D3VB 3SKOB 1KBVA 1NUNB 2ZUVA 3EJYD 4JM4H 2HG5A 5HHXH 1VIWA 1KN2H 2WPGA 3H3BC 5DD6B 5C08D 2DM3A 1RZIB 1F2XK 2OMZA 3L9BA 2D9QB 2WKOA 4GRLB 2BM3A 2Q6WA 2QPDB 4KTGA 3GZQA 4UOJA 1DZBA 3BDYL 2G4GA 4OCRL 3ZU8A 2Y2YA 2MRYA 4JFWA 5E9DE 2V4LA 3QG7H 2XWBA 3PQYB 5DRZB 3U30C 2VW4A 3FN0L 1KCVL 3N04A 4W81A 3FCTA 4K07A 1XBRA 3TBTB 3HS8A 4FERA 3Q1EA 4K8RH 3BAIA 4J3SA 2J6EA 1E7UA 5F0PB 3VSUA 4OZIF 4Z3EA 4EQ3A 1RU9L 5A1AA 3DETD 1ZDSA 4LHUG 3W5NA 5EZLA 3BHBB 3HE7B 2MNJB 4L0YA 2PCPA 2PNDA 1FZJB 1KBGH 1WITA 4AQEA 4YHLL 3V4UL 4PRAA 3MBXL 1WZAA 1FC1A 3EDKA 1CQKA 3BP6A 3EYSH 4M1DL 4R84A 3L1EA 2ZWYA 1KY6A 1ACZA 1S7QA 4OZGF 1VADB 2AEIT 1D3CA 2ZICA 5C0ND 1MFDH 2HKHH 4WJKB 4JDEA 2G3XA 2L7UA 3V5HA 1R1CA 2CIIB 2NY0D 4APXB 4UI2A 5C2BL 2XBTA 1P4IL 3APNA 1CXFA 1T1ZB 5F1IA 2VZSA 2FWUA 4PJCA 3AM8A 3K74B 5SX4I 4I0PC 4ODSH 2A9MH 2RFXB 1AYOA 4MMZA 1AKJA 4PJEE 4B50A 1P7QB 2OJZL 5I28A 2IQAA 3HFMH 4GFXA 4PJ8C 4QJ4B 3V6FA 4XX1G 4F58H 3K2UH 2J1YA 5FECA 4PWGA 2IVFC 3DHUA 2Q7YB 1D5BA 1FFQA 1NPNA 3TN0B 3BVNA 1CU4L 1KPRB 2X1QA 4JL2A 4OLXH 3T2LA 2YPVL 3ARQA 3OKKB 3AQZA 3IU4H 3TT3L 5DT1L 3KXFD 1IGML 2APTA 5DHVA 1CFSA 3ENEA 4WFED 2CO3A 2O5XL 1WHOA 3QWRA 4N25A 3QIUD 1HZHL 1OWRM 2R1YB 4N2NA 3HE6C 2QSCL 5DJXB 2QPSA 2GFBA 2XPZA 1QTSA 4JHWH 1U92A 5J12C 4Y4HC 4M7KL 1ZVNA 1FG2B 2NY1B 2O6CA 3KPSE 1NOFA 3SBRA 1AC6A 4NQSB 3OR7B 3GB7B 1GOFA 2FNBA 4G8FA 1HXYA 3QT2A 3SEPA 4JN1L 5CD3B 2VLKD 3TO4A 2YOAA 3GZPA 3CJJA 5TDOB 4BCZA 4X0KB 2XWRA 1T22A 1T2QL 2YOCA 2HT3C 5GZNC 2MCAA 4YFLI 3WGVB 3QJHB 2HN7B 3MYJA 1MCCA 1AJ7H 4Y2DD 1ZHKA 3TCLA 3RYMA 4GY4A 3IFNL 3JTTB 2W65A 3DECA 4A2GA 3O2WH 5HSFA 1IGFH 4TUUA 4FFZA 1SVBA 3GINA 2CJ3A 1EIBA 3IDIB 5F6HJ 2H4EA 2JQZA 1FO0A 4R96A 3RWIB 1ORQA 1A6WH 1F00I 3GTNA 4NJ9H 4XN8A 2Y2WA 4NSKA 3STLA 4H1LB 1MAMH 2IPKB 3KGUA 4ZMQA 5E2VH 4R90L 5T5NG 4IBVA 1JV5B 3PLYA 3ESNA 3QJXA 1B9ZA 2BO0A 4N2GA 1PX4A 3RY4A 4KVNL 3MFGB 4K0OA 4HGWA 2E59A 3D0VB 1BVLB 2CKBB 4YDZA 5IIEB 1SMOA 3GJEA 3M1BA 3CVHL 3IMWA 3S4SG 1IC4H 1JS4A 3WLBB 1QNIA 2ZXEB 3QFDA 4P2OD 4AUUA 4TV3A 1VGKB 3I6KA 2E86A 2FLRT 2ICWI 4ISVA 4XNXL 2VLRA 1UJ3B 1EHKB 4UIKH 3MKGA 4ODXB 1XCTA 1AD9B 1B4JL 1Y1UA 3CZJA 4Q6YA 4TNVK 3VGFA 1FLTX 3ZTEA 4XP9H 4KJWC 25C8H 1KLFB 5C09E 5ADOH 3CE1A 4G5ZL 5DK2B 4EZJA 1EGJH 1WZLA 4HUCA 4NUJA 1M7UA 3EOAB 4UV7L 4XTRC 1KBBA 3MUZ1 1AZVA 2JTDA 2YD6A 3ARBD 5EPMB 1NBVH 4JCWA 5EBGA 3UYOD 2F0CA 4JE4B 4DO4A 4W9HC 1E5CA 2YEZB 4HKBA 1BD2D 4L4TD 2EDEA 1QX1A 3BUBA 1XGPA 2B2XL 1E6OL 3FH7A 4KY1L 2PKDA 3REWA 2F8VA 2BH0A 1OK0A 4Y4KD 4N2AA 1FL3B 4HUNB 3NZ8A 1PU0A 4QD2E 3RVWC 4Z76B 3LKQA 5TE6H 1ODUA 3LMJL 4LEXL 5GQBA 4IK7A 3BFWA 2DM7A 4LPCA 2C9VA 5EOQH 4G9FA 4K8RD 3IFPA 3NPZB 4HWNA 4R4BA 3WHE0 2IIJA 1ZLWH 4CDHA 2GC4C 3V0WH 3US0A 2VR5A 5IBUG 4LXFA 3KYNA 4KPHH 4FQIH 2EEBA 2NMSA 3OBAA 1SZNA 5KYYA 1M2VA 3CXFA 3U0WL 1AFVH 4IU2B 2WD0A 3CQPA 4IJ3B 2JI3A 2R0ZH 1AR1B 4XMZA 1N6QH 2UXGA 4BFKA 6FABL 3SPCA 1E8WA 1P4UA 1UASA 1WAAE 1QFHA 3MRKB 3RGHA 1QNZH 2FDBP 3L7EB 3P73B 4UQEA 4DPBX 3DA0A 4X8XA 4M1GL 4IDLA 3F2LA 3SDCD 5AOIA 2X70A 4HT1H 4NQQA 5D7EA 2FJGB 3QH3A 2VJXA 3VA2C 4DPRA 1ZWIB 1RHHA 3T2NH 4O02B 2R0LL 4BXSV 1JNLL 4G8GD 5GHWH 2VL4A 1OAYL 3VGAC 3PXLA 4FTVD 5LGJB 5D7LA 4NQXB 5E4EB 5IEKB 1AQKL 2A73A 3R19A 3UADA 2AK4B 2ADJB 3NZUA 3DVGA 4YHKH 1QMUA 2G30A 1WBZB 3QI9B 4KI5D 3CXHJ 3HIZA 1ZA3B 3IDYC 4LCCA 5BQ7A 1PYWB 2CK0H 2P52A 3WV0A 4ZFOA 2VCOA 3IDUA 1QSEA 3N50A 4YDJB 3EF7A 3D4YA 3ZE2B 2WIMA 1AC0A 3O6LL 3FF8A 1OCWH 1QWUA 4AK1A 1FAKT 2ADGA 2ROYA 1NFDB 4N0UA 3CDGA 2K8QA 3NN8A 5TH2A 5JZ7D 3RDTB 4XCFL 3CBKB 3VNZA 3KHOA 1BQRA 1EJOL 1A14H 5A7BA 1NCAH 5C08B 5DJ0B 3S5LG 1V5JA 2OSXA 2VQ1A 1V7ML 1FDLH 3BZ5A 3ECWA 3AT8A 2AP2A 1OP3H 3IWVA 1BZ8A 4FCAA 2X4SA 1MCPH 3VYPA 1BFOA 4BFBD 4HUXA 1MLBB 1OQXA 3T1WA 2FVNA 4PRPE 3DVNA 4PGDA 2Q87A 4NKOA 4XVUD 3EG9A 4NQVA 3ZDZB 5F70A 1T5XA 3BSGA 3CVDA 2CBMA 4TVSa 3VD9A 5J9PB 2R7EA 1MCSA 4F5CA 3EDEA 1M7DA 4TSBL 1MDAA 1MG2C 1NC2A 4S10A 5DC0A 4KNQA 1EDQA 3KPPB 3AMLA 2P9RA 1JRHI 4BRVA 1MQKL 4NN5B 4HOMA 4AKPA 4L3FA 4LNVA 2K6YA 3NJGA 4WEBL 1KMGA 4Z8FH 2VDPB 1ADQH 1JZ6A 3C5ZD 4QTHA 2JWYA 2NY0B 1N4XL 1ZANH 1HHHB 2HT3D 3N41F 1HL5A 4TSCH 4F2FA 1UKSA 1X7TA 3HCVB 1LDSA 2E4FA 1PFOA 4L05A 3QUYD 3T4YA 2EH7L 4OM1H 4QHMB 1IEBA 1B90A 1M9WA 2BVQB 3VXRB 3VCLB 2VXSL 1UKQA 3UYPA 2FIKB 4AENB 5BUGA 3AQYA 1UACH 3I02B 2N4IA 3PWPE 1OTUC 1Z7JA 3HBQA 3NFSL 4W93A 3QCTL 4N20A 5FFOA 1DVTA 2CGRL 2AQ2A 3ATBA 4FA6A 4TUOA 4HIHA 3H4FA 5EEWA 4ZXBA 1L4IA 2BSSB 3IJ7A 3MVSA 1IFHH 3L4CA 3H85A 3D8MA 4JB9L 4UZUA 5I1HH 1KYOK 3KXFB 4NO5B 1A9EB 1GIGL 2Q7AA 2VQTA 2VDRB 4KAQL 4M7JH 3X1EA 2PXYA 4LZKA 3BDXA 3O0RH 3QIUB 5F7NC 4FNRA 4KXBA 3EXJA 4Y4FD 3FOMB 3LQAC 1EFQA 3C2AH 3WTTA 3MRDB 4HPYL 4BSJA 1HFUA 1S3KH 5D7IA 1BM7A 4KJWD 1BFVH 4LLWA 5IFHH 2VLJA 4N2IA 1OQOA 3O45A 1NCWH 2VERN 2O4EA 5LDUA 3CVIH 2VLKB 2WTRA 4KHTH 4YHIB 4CC4C 2CJUH 4JEGB 1BQSA 2ZE0A 3VXOB 3WKML 4X7EC 3KLKA 4G9DA 1WLHA 4RGNC 3ZT5A 4OQ1A 3ECQA 4Y2DB 2OBGA 5E8EB 2WBJC 1AG6A 1G7JA 2XYBA 3LQAH 4XNUH 1UKTA 1JGLH 2XXGA 4F7MA 1BBDL 3FO2B 3CFMA 1T83C 2VIRA 3BT2H 1P0SE 2ICES 2VE6A 2AV1B 4MTMA 4UIMA 4X99B 1FYTE 1C1EH 1EFXD 1NMBL 1UCBH 3R06B 4NWTH 4PJ9B 4BZ2A 2UX7A 3GIVA 4S1DD 4TRPH 4NCDA 1AMXA 1FVEB 3IKCA 1PMYA 1CFNA 1KPUB 1ZE3C 1OCZB 1UD2A 4PP1C 4HDIA 1AQDB 4OCWH 35C8H 3AT9A 4YUEH 1KWKA 3GMLA 2D3NA 4BCYA 1S7SA 5F9WB 4A7GF 4O9HH 1A6AA 4EI5A 2J7LA 1WQVT 1EXHA 3UTPD 5C97A 4EBQL 2HJLA 2QHRH 5IROD 2LLLA 3O3AA 4P2OB 3WNMA 2CALA 2NW3A 3B2MA 5GS3A 4J6IA 4PJXE 4WO4C 2B20A 3ZYZA 2E3VA 5JXEC 2BWQA 1SMDA 4XAWL 5E8NA 3TOPA 1S7XB 3WMQA 3KPMB 2WWOA 1ZE3H 1FP5A 5TQ2L 3ETSA 3Q2NA 2LVEA 4PCYA 4W9FC 5TDPA 1ACXA 1R34A 2EJ1A 4KZ0A 4XPTL 1SF5A 1FAIH 3QR1A 3CLFH 1JRHL 1KPVB 3NSXA 4HKJB 4XN7A 4BKSC 2ZCHH 3MYZA 4OCSH 5EOCL 4JN2A 4X6FA 4XAKD 4NQED 2YO3A 2HSIA 4A7VA 3TVMA 4YPGB 3GMMB 5ITFB 2VQUA 3PHSA 4XMLL 5GGSB 5KJ7E 3ARBB 1IKNA 3D39D 1XAKA 3UTTA 2FL5B 4HQQL 1K85A 2BWDA 5EWIH 4AL8L 1IT9L 2NXZC 1BD2B 4L4TB 3PDOA 3MLRH 4ELKA 2BW4A 5B39B 1R3HA 3H42L 4KMTL 4RZKA 4Y4KB 1RL1A 4QY8B 4K3DL 4PBVC 3UO1H 2FO1A 4FXKC 4YSQA 3OLEA 4FQ1L 4JFYA 2BIMA 2F7PA 4I18B 2MTAA 1HOCA 4LVHC 3VWKA 5AW4B 1MCOL 1IC0A 3C87A 3QB7C 3A21A 1KJVB 3ZDWA 1WD8A 3A67H 4WU5A 1BG1A 2NCEA 1OPGL 5KBDA 2HPOA 3RUGE 5KVDE 2X40A 3DJSA 1ID2A 1GPOH 4N0CC 5CGYC 1IAKB 2A1WL 4JQVC 2R1XA 2I7SA 1E65A 3QRBA 3OKDA 1WUZA 2G9HB 4MRCA 1KGWA 2GW5A 32C2A 3MTRA 5FO9B 1UYWH 4NKDB 4XP4H 2RCSL 4JVUA 3FT4A 2IDQA 4YR6B 3B2UC 4YWGL 3B3IA 4JFTA 5CUSH 1R46A 1E9QB 1OAXL 3INOA 1KELH 1XF5A 3DX1A 3FHAA 1GXEA 2ENSA 3NACL 5KJRH 1VCBC 3SDCB 1VLXA 5C0EB 1RUQL 4M5ZH 5I16B 3MBEA 4LHQB 4RFEB 3QXAA 1J5IA 4OVVA 2ENQA 2I9LB 2WAHA 3BLKA 1P84J 2IH3B 4J8RA 3GBNH 4X4ME 2APVA 4P3DB 2PPFA 4P2AA 3NJLA 5K59F 4G8GB 4H0HB 4KXAA 3Q9QA 4XN5A 4GG8A 2OMUA 1SHXA 2GBAA 4WAFA 4WUUA 4FTVB 3T3ME 5L2KD 1QBAA 2FT7A 5M94B 4JFEA 3ATDA 3V5DB 1XD1A 4MNHB 4YHMH 4I3RH 4N2KA 1A6TA 1J10A 3U46B 5HYSG 4PS3A 4E0RB 2IFGA 1SJHA 4XR8C 1O7VA 3V8OA 4TF4A 4BYHA 4CA4A 1OLLA 1TTRA 3WY2A 2Z4QA 5TPWL 3U6RB 4LRNH 4UTCA 4GG6A 2Y07H 4JFFD 1AI1H 3UCQA 3VFTA 4LLQA 2QVKA 1H3GA 2CDFB 5BZWB 3MLTA 4GAGL 2MWCA 1CMOA 4MJIE 1CT8A 5FUZH 3ILDA 2F53D 3LSOA 1PDKA 3C6SA 1BJMA 2J2ZA 5DWPA 4MD0B 4PJHE 5D2NE 2WCGA 4P2RA 1RPKA 4JQXC 1E5UI 3GWJA 3CFQA 1NPUA 4WHTA 5B8CC 4W68A 2NY3C 2ZPKH 4PWHA 1FNEB 4ANWA 3QHZH 4F7PA 1IC5L 5BRZE 5I8EB 1CDCA 4FQCH 4UU9A 5CLWA 3RQ3A 3K91A 1E40A 2EDNA 1PLGL 4PRDA 3RNQA 4CVUA 3O4OB 4FYRA 4LT7A 5JIMA 3KM1A 3CFDA 5IZ7A 4G43B 4X6DB 1ZEAL 1A2YB 5F6HI 1R5WA 2IDCA 4YHNA 3ZX1A 2YZ1A 3P4OA 4QMEA 4WWKC 1QEWA 2TSAA 1XF3B 1HXMA 5D6CB 5TF1L 4ANXA 4APQC 1CDIA 4DUXA 5EC1B 4KZDL 3F58L 3GNML 1TVHA 2B5IC 5I18H 5J12B 2BS8A 3B37A 4A2DA 3G5ZB 4HS6B 1HHKB 4E9QA 3RL1B 3RZCC 2R0WH 4XPGL 1WCQA 4MA3A 1M6OB 1NPJA 4GT0A 4JFDA 1FVCA 4KO6A 3V4VB 2B1AH 4UTAA 2K7QA 4TULH 4N8CH 1UA6L 2ZOUA 4G6FD 1BVOA 3BEVB 1B6DA 1RXLA 1A9BB 3T3PB 1F3JB 3IJHA 5D1ZD 3PGDA 3LRHA 4K7PX 5DVPA 1Q9KB 4RMTA 2VOTA 5K1NA 1OOWA 4UUJB 3QUYB 3ZO9A 3SDAD 3SGDI 2DMKA 3PNWA 7PCYA 2V9RA 2QHLA 2YC1B 5C0AE 4P5MB 2VABB 3FAWA 5D1QE 3MUY1 3ZSSA 2Z64C 4FL4C 3ZYIA 1SOXA 4X80L 2GIYA 1OAUL 4XWGH 4LSVH 2JH2A 2BSED 2K0RA 1KB5A 1T1YA 1C5BL 5B7EA 4HG4K 3WCYA 5J11C 3BRDA 4QOKA 3ZDXF 2DPKA 3DKHA 2GT9A 3C6LD 5AL8A 5T1JA 5IOKA 4R7DB 2ZOKB 4CUCA 2P48B 3GHEH 2OW6A 3PL6C 4GAJH 4XNZC 2H26B 5MP6H 3T2QA 3UJIL 4ODUB 5J3HD 1ZLDA 4WUKH 4CBPA 3LRLA 4YH6A 2E8ZA 1YYCA 4RBPK 3DYOA 2X4RB 2EIBA 4X8CA 4HWZB 1CLYH 5HDBF 2J8UA 4MA8L 2NZ9C 4NRZA 4NC2B 4QGTA 4ORGB 4GXUM 4QHNB 1JXFA 4PRHD 3BWUF 4NEHB 3R4DA 1MN4A 4WFFD 5D5MF 3C08L 1KFAH 3EJCA 4WGWB 2XKUA 2W8CA 3OHXA 4QRTA 3BUYB 3ZDYE 4JFQB 3V0HA 1ES0B 1QVOB 1NZRA 3EYUH 2GTWA 4NAMA 2DBLH 5BRQA 4PI2A 3AXIA 5TE7L 4XCEB 3D6GA 3CXHK 3VGHA 4X5WB 4J4PD 5I0WA 1T03L 4C4KT 5A2FA 1H6FA 5ETUB 4CSZA 1N19A 1CK0H 3PHOB 1G6VK 3TP4A 4JFOB 2GJ6D 3OKLB 2L7QA 2W95A 5CJ8A 3WTVA 4X6BB 4TVPH 4BE6A 2KZ1B 1EFXB 2B9AA 4JY5L 4Q9BA 2BP3A 4KH2A 3RY6A 5IVOA 2FJSA 4D0DA 1XIWC 4ABWA 2J56A 3K2MC 2WINB 3VWJD 4EEEA 3DX6A 3UG3A 5JW3L 2I07B 2NY5L 5HVFB 4DP8X 4M5TA 4CBZA 1DQDH 4EQ2A 4TTDC 4IRZA 4L9LA 3TO2A 1ZTXL 1G9NL 3IMRA 5EO1A 1CF8H 1IGYA 1HNGA 2BP0A 5LBSL 5FAAA 3D52A 3NJHA 5JQIB 4FCHA 1L5GA 1SJVA 4KTDL 4UB0L 4YDIL 5EIIA 5FDWA 1IQDB 4DKDC 3V6OA 1BW8A 4UM9B 2CGZA 4S1SH 1TMQA 2E7DA 5DFWH 4UQIM 3RWHA 3D50A 5DA4A 2ATPA 2FGWH 4OJFH 3BPNC 2VSDA 5C9KA 1ZSHA 2NR6C 2FR4B 2HFTA 1G6RB 4RDQG 1HC1A 1XAUA 2EDWA 4NQEB 3VJ6A 4BSVA 5MEQB 4ZSOE 1E3ZA 1H9VA 3ZGIA 3O6FA 4DN3L 4TTGA 3PJSB 3VGAB 3IETB 2HH0L 1I53A 4LCWE 3B34A 1X7QB 1QATA 4KRLB 3ARFD 3D39B 3KH4A 4JKPL 1YEHH 3MV01 3T0BA 3HS9A 1PG7H 4H1LG 4LQFH 5FKPB 3X3GL 1CG9A 5C1MB 3PGCB 2VLLB 3MOQA 1VFAA 4M1CD 3VRLF 1UOKA 1UC6A 5T3XE 2VO8A 4XVSH 2IAND 3U2IA 4X6CB 3A4AA 4GKSB 4GUPA 4EAEA 1OTTD 4J8QA 1E9PA 4WCYL 3VSVA 2XWJA 5DRWB 3VXQB 2QV2A 3G08B 1E43A 1YUHA 4HC1A 1FNHA 2QKIC 2UZXB 5TE4H 3CDCA 3DHJA 3VX1A 3VI4F 4IRJC 5LUMA 3RA7H 2O72A 4JFHD 5IOPA 5EF3A 1KGCE 3VXMD 4DGIH 1ZGLA 3CBJB 4ODWB 5E8DH 3D48R 5A6MA 1XO8A 1SUHA 2R29H 3HI1A 3FB8B 3ZE1E 1JPGB 1MDTA 2P4AB 3DOSA 4JZNB 5GZOA 2XXMB 1AHKA 1A8ZA 2O6FA 1BXVA 4N2OA 3CTTA 3I6LE 4DZ8A 1F4WH 2KQMA 3L3JA 3F7YA 3OF6D 3AGWA 3NIDE 2D03L 4HEPA 4PJIB 5ESQB 1QUNA 3LRGA 5KANG 1MW2A 4BD4A 1ZOXA 2DYPA 4DH2A 1CFMA 4M6MH 3UTSA 3WDHA 3WE6A 1LP9B 1DBML 4AYDC 1CUOA 5C0RH 3PWLB 3TLRA 3LHPL 4NZFA 4MJ4A 4P5SA 1HHIB 5L2KB 3Q8EA 4Z7QF 4ABUA 1H6TA 4FNLL 5ICYB 2OQJA 3PV6A 4IKIA 2EVHA 4Z78B 3HB3D 1J1OH 3FT1A 5D96C 3KAAA 1ORSA 3SGKC 4JFFB 1LJMA 3BZ4A 4N2FA 1VPOL 2VR3A 4M03A 3KPLA 3TJEL 4C4BA 5E6IC 3QJSB 4QTFA 3E1ZA 4Z7NF 2BXZA 3NG5A 3ARED 1PNDA 2F53B 4O2EB 1QHQA 5CIPA 3U36A 4HX1A 2HMID 1QQDB 4KO9A 3PIQB 5SV4A 4E9VA 2VAJA 3D85D 3U9UB 2Y1ZA 3QRGH 1DL7H 3L9YA 1JD7A 5EU6A 4ONHB 1JGUH 1QBLH 4H8VA 4HH9A 4U0QB 2AJSL 1BLNB 2WLIA 1W0WB 4M5SA 2BVTA 5CEYB 2AEPH 3JTBA 4FQQA 3DVFA 5AVWB 1DFBL 1MJ7L 3ML9A 4RIRB 5FCUH 5D7JD 4L37B 2V2WA 2YWZA 2A99A 4L23A 2WMPA 2P8MA 1Z9OA 4LSQH 3VFPA 3PU7A 1PTZA 1Q94B 2VL5A 3ULUE 1SM3H 4MCMA 1PZ2A 4Z9KB 2H6UA 3AG4B 1A7OL 3EJSA 1ZHNA 3BAJA 3KPNB 4L2YA 4XB7A 2XQYA 2NZ9D 4MAZA 4TVPD 5CJOL 4JO4H 1KDIA 2E46A 4ODTL 4WVRA 4KRMB 1HN1A 3GJFK 5CN3A 4G6FB 1W0VB 4QDGA 2YPLD 4MX7A 1R0AH 5AKVA 2AAAA 4I0KA 1FBIL 4GW4A 4JPQA 3VA6A 1KLGB 1HKLL 1CD8A 1JZFA 3N1FC 5DO2D 5D1ZB 2EEAA 1B3JA 2X4PA 4KO7A 1CDUA 4U1GC 1BVNT 3TBCA 5I6LA 4KVCL 4N1HB 4X5QA 4Y88A 4PJ5E 3SDAB 2B15A 4Z7WF 1JXKA 3WTYA 1L9QA 3FCSB 5BJTB 2VXTH 3QULB 4N6RA 3FQTB 3G6AB 3EYQC 4LEOA 4NIKB 1OF2A 1MI5D 4FHBD 2Q8BL 3IDGB 5EO0A 1TMCB 5KYUB 2J5LB 4S2SB 2X2IA 2EDHA 3NABL 4L8CB 4I3SL 4X5XA 2ZX7A 2VLRE 3W9EA 3O4LA 4A7UA 4KGLA 1U33A 4M8UA 2AJYH 3Q9PA 4MMYA 3WFCL 1NKGA 3SO3C 4PYHA 2HVBA 2HZHA 2D0HA 1LHZA 4U3XA 1OANA 2PYED 3L48A 4YSCA 2P49B 2XPGA 3MNWB 1YY8B 4AQ1C 1R5IA 4PS4L 2HFEB 2V2XB 1U8LB 5F9AC 1IILE 15C8H 3IJ8A 4S0SD 5HGBB 3DUUA 5AW6B 4G8EB 3QJFB 4M6OL 3GRGA 1AOHA 2Y6SC 3BJLA 4QXUH 5DZNA 1CDHA 1VFUA 2PUQT 2X38A 1N8ZB 2CCLA 4CMHC 3B5GA 5I1DA 3LH2H 2R2EB 4PRHB 5ALCL 5F21B 4QHLA 5KUKA 3U4EA 2EAEA 3ZKND 5E4AA 5HHPA 2UVFA 4JRXB 4OIIL 2V0AA 5FS5A 1KCSL 2XETA 3M88A 4NAJA 2HWZL 4JM0A 5ICXB 1EJ6A 4A2HA 4PCSA 3FSOA 1ZD6A 3HG1D 4KK5D 4U1IB 4F2EA 3BDYH 5E00A 4UAOC 1PZCA 2P45B 1HE8A 1Q9WA 4HMCA 3DSNA 1CS6A 1IGTA 5CJQH 4PVBA 4IBQA 4JRWA 3HZKA 1KCVH 5DJ6A 1EWHA 4GI8A 4P5TC 4YXKL 3SPGA 3UEQA 3ARDC 4NKQB 3W0WD 2AV7A 3CFJB 1IQWL 4LASL 4RFNB 4MHHG 5EU4A 5ECJE 3GM8A 2D7NA 4E9TA 5M95B 1FV1A 1S4IA 1PD0A 1BEXA 3CH1A 3VWJB 2EC9U 4JRFA 5FGBC 5DEZA 3KPRE 5GGVH 2E6QA 4OZIB 3QCUH 1DDHA 3MBXH 2XOTA 4U1LB 1JPFA 2GJJA 5KW9H 3P4LA 3LB6C 4M1DH 2DH2A 5ICZA 3TV3L 3UZQB 2CRZA 2Y1AA 1A7NL 3FT3B 1T0MB 2WNGA 2APWA 2WP3O 4YHOL 4OSUL 5GS0L 2DB8A 4K7PY 4OZGE 2VGLM 3KPSD 5C2BH 1P4IH 4JX0A 1ZTMA 1D6EA 4P49A 2GK0A 3L3HB 4JO2L 5E7BA 4XMVA 5I0YA 3DJ9A 1TOXA 4I2XA 5D7LE 4K7FA 4HCRL 2XTSA 4MCYB 2X12A 3RNKB 4ZMLA 4YSTA 1DVUA 1ZVSA 4FKKA 4P99A 2OJZH 2YD2A 1HILB 2JKJA 3HMWL 1KLUB 4JHBA 2FJFA 1MFAH 4JKKA 4M9PA 3DXAA 1YYLL 2RAMA 4HK0B 2WLLB 1CXIA 1QSEE 3ARFB 4FMKA 3S36L 2WHVA 1CU4H 1OE3A 4NC1E 2Y2TA 3MN8A 4N0UE 1NDMA 1NM4A 1JYXA 1LO3L 4DEUA 1U58A 1IGMH 4RETB 2IANB 1GGTA 1O75A 2E47A 5KSAA 3QIWC 5ILTL 3X1BA 2O5XH 3KL0A 4GUOA 2JKLA 1YEJL 4BWWA 3PWJB 5L2JA 2QSCH 1NDTA 1S5HB 2OMTA 3FH8A 4KROC 3WFHA 4Z77A 4UANA 4FLHA 4WENB 4F9LC 2X9XA 3VXMB 1NLBH 1S7TB 3V95A 1FFOB 3CG8A 4LOEA 3UZVA 5G4NA 2CRYA 2EILB 1GZQA 2EDQA 2R51A 1XSIA 2BC4B 3MLPA 4NCC2 1A3ZA 3LX9A 2QDWA 2EC8A 3K3QA 4KQ4H 4DEWA 1KCUH 5ESAA 5DEJA 5I82A 1KBPA 2WWKT 3Q5YA 4BQ9A 4ENZA 1CBVL 4AJYV 2FT8A 1FIGH 1NINA 1T2QH 2VDQL 4K3EH 5GS1B 1OD7A 3EO1A 4F5CE 3ZHFA 3M45A 2CXGA 3CFBB 4ZQKA 5FOJA 4GRWE 2HAZA 1U2YA 3SKNB 2AZAA 5B22A 5EOTA 4P5KA 2ORBH 1GVIA 3E6HA 2ERJC 4PJAA 1U8OB 5FOBA 3BGMA 2NY6C 4N4YB 5B39G 3TM6A 3DX3A 3NGBC 3CU1A 2X5PA 4QRPA 2HFFB 4N2EA 1NUDA 4XN1A 1MHCA 4WV1A 2LTQB 4FNPA 1BYPA 2CWRA 2KDGA 1Z5LB 4MDIA 4NN7C 3C6EA 5FA4B 3T0WA 1FCGA 3I6GA 1WTLA 3PUCA 1AIZA 2C8NA 3TTSA 1G0YR 1LK2A 4AEIL 1LO5B 4D8PB 4HVBA 1RAMA 2EIDA 3D51A 1M05A 1S2EA 1XB8A 3HB3B 5CEZE 1ZGLM 2WTPA 3JWDL 5H2BB 1ZLEA 4WEEA 1U8IB 5FCSH 1YSOA 1E28A 5E8PB 4K5OA 3UAAA 4EIUA 4ACTA 1AY1L 1P69B 4AQ8C 1U8JA 1VEPA 1AO7D 2Z8RA 4Z7VB 4KKQA 4XNDA 4HHAB 3AREB 4XH2A 5E5UB 5DJCB 2BY1A 2VN3A 4O2FA 2NUPA 3MAWA 3D85B 4HWEL 3PAUA 2ICEA 4ABQA 3LQZB 2EYSB 3VFOA 5ELIA 2EDOA 4YJZL 2AXGB 1WG3A 2KZBA 3O2VH 4LKCB 3I9PA 2IPUG 2R4SL 4GS7C 5D7JB 5D7IE 2CDGB 4PRNA 4RNRA 4LP5A 2VLJE 4BFIB 5PAZA 4LCIH 4XNZB 3B9AA 3BLBA 1JGVH 4M8RA 5IVZB 5I75B 4QRQB 1LO2L 1T04B 4L3EA 3QHTC 5BMFL 3C09C 3ZL2A 1G7HB 3ZGHA 5HVWA 4BH8A 3NIGE 1VERA 3PWUA 4JFZL 1BJ8A 5GJSL 4GNKB 3HC3L 3Q6GH 4LDEB 4ZNEA 4XOCA 2W1NA 1XR9A 4ZUTB 3TT1H 2JI1A 4H0LC 1PPIA 3JYBA 1ID5I 5GISL 2Y4SA 1NCTA 2DWEB 2NYZA 3ASNB 5J4MA 3K6SB 2YGOA 1WZKA 2UY7A 2YPLB 1KEGL 1UT9A 3ZR5A 3U0WH 3DO7A 3L95A 2CUAA 1L3NA 3FU8A 5TFSL 2OMWB 2O30A 4JS7A 1U3HC 3F7RA 4MD4A 2K45A 4MKTA 4Z7UA 2WOYA 1A64A 5C0IB 1RIHH 1CR9L 3OKEA 2C9QA 2OXGB 4HZLA 3K0YA 5I17A 4Q2ZB 1HH9B 3N43B 5E6RB 1HSAB 5HJBA 4FULA 1G1KA 1MI5B 4JPWL 5DRNB 2ITDA 3UZEA 2P8LB 5JMOC 2YSSA 5BVPL 2VB5A 2HRHA 1OT4A 1N0LB 3QNXA 4CVWA 1XIWB 5I19L 4ZUUA 3RWDB 1JNLH 4CN6A 3MMEA 4EOWL 2V2TB 1YECH 3V4PH 3HAEA 4OUUB 1OAYH 1KYDA 4F7EA 3ZZ1A 3K71B 5DYOB 1AQKH 2PYEB 4DGWC 5E99L 3OZLA 5KVDH 4LLMB 4C83B 1ITCA 3BWAB 3PFUA 2VYRE 4OIAA 5FYJU 3BRGC 1W72A 3E0GA 2GEEA 1T66D 3LKSA 2OMNA 5SWZA 2NQ3A 3STZB 1I1YA 3LXUX 2C4XA 2CH8A 4KTEL 1TT6A 1CLCA 1HU8A 3MACL 1ZMYA 2K3HA 3MLSL 1LNUA 4FOMA 5IB5A 2ALAA 2PR9A 3O6LH 2FBJL 5GIRB 5LWYL 1IIIA 4JJ5B 2UWEA 3BPNB 1WIPA 4NJAH 5J6SA 3GSNB 2H9GA 1QZNA 3VACA 4TVUA 3MJGX 4WI3A 1J0YA 3ULVE 1EJOH 3C2SA 4X9FA 4ONGH 1KTDA 2ZP0T 3MDJA 2DLGA 4U6VL 1UOWA 2PABA 1S78D 3GLDA 4ZFZB 1UXSB 4YAQA 4JM2C 3SGJC 2MSPA 4MB3A 3HG1B 3L17A 4G82A 4HJ1A 5FDYA 1UA3A 1XGUB 1TEYA 3FB6A 2EZ0C 2RMNA 3FJTA 4PJEB 1TQWA 3KGTA 1BXUA 4J1UB 5CHNA 3OAYK 5EEXA 4XVJL 3S34L 4P23C 5E8OA 3PWPD 1SVZA 4TNFA 2ITFA 2X6AA 2ZZUT 3QIWD 3I84A 4A55A 1TETH 3LPGA 3W0WB 1TPXC 1WK0A 3RTQD 2XBDA 3QPKA 5I2IB 1YEIL 5BXFA 2WQUA 1BGXL 1G7QA 1XDTT 2IPTL 4M48L 2FWSA 4TSBH 1Q1JL 3L5WB 4Q8BA 1ZS8A 3T0ED 1M42A 4L29A 4P57B 4PEEA 1N8OE 2X10A 4U1NA 4F1ZA 4C56A 3SE4A 4Y2OA 5CZRA 3C5JA 4WEBH 4GKLA 2F5BL 3MRJB 2WLJA 3EAKA 5KSBE 4I89A 3MPCA 1D9KA 1MQ8A 3KPSB 1ESOA 1PJWA 5EN2A 3KWWA 2FO8A 4ZFFA 4MZ2A 2C7FA 1R3LA 3HPLB 4HK3N 2IALA 4WUUE 5BZXA 4F7TB 4ZYKA 2G5UA 1PNCA 3N44F 4MAUL 3ES6B 2VXSH 4HKXA 2FWLB 1AS6A 3OWEA 4P2YA 3TZVD 2AEQL 1CZ8L 3Q13A 3MGOB 1JWUB 4ZUVB 1KYAA 1DTUA 3QDGA 3BP7A 3NFSH 5JIDA 3BH8B 4JHAL 3P3UA 2CGRH 2BNQD 4PLOB 2R23A 3IXTA 4KQ3H 4OF6A 3TBSB 4ZMVA 5D1QC 4YGVB 3MCG1 2Z91B 4IBYA 2OMVA 1MCWM 4JB9H 3FRUA 2ETWA 1BZ9B 1V3LA 5I30H 1GIGH 3AWFA 1BAFL 1AQ8A 1Y0LB 3OTTA 4K94L 3DSFL 2YRPA 1G1CA 3F00A 1QSVA 4YO0B 4PRBB 4IM8A 3KWTA 5ISZD 5I1LA 4JDTL 5FO8A 5G55A 5A6IA 4KRPC 2ZCZA 3POHA 3ILQD 2F68X 3CFNA 1FJ1A 4B0MB 1KJMB 1SXNA 1VFOA 1X9LA 3EJJX 5DJ8B 3TWYA 2EDKA 2WOBA 4G6ML 3WEXB 4E5XA 4OI7A 5KVMC 4DO6A 4PI0A 1JNNH 4WW2A 4L4VA 2BRRH 3HPJA 2UZYB 4KUCF 2VR7A 4OUOA 3IU3B 1X9RA 1JERA 3Q2VA 3WXVL 1L7TL 4OZFA 3L3OC 2EO9A 5I1GH 5DVLA 5BV7H 2IH1B 3MROB 2KQNA 3DPBB 3PNRB 5JW4Q 2NLJA 4WU7B 1P1VA 1JP5A 2I5YL 4JFDE 4DOHB 2DEYX 3QEHB 3NDZE 3QXDA 1NMBH 3VXSD 3T77A 3JWOL 2WXIA 1EZVX 4AYBA 4FQHA 3T4AC 1FZKB 3F7PC 5DS2A 3I9GH 5CEXB 5DK3A 5IQ9A 2JMRA 3LKPB 2MOGA 1N64L 4ABVA 3L1OL 5L4MA 3QIBD 1JWMA 4LDCA 5DQJA 4JQIL 2HJFB 4EBQH 3BE1L 2VAAA 4LBEB 1PBYA 4HXBL 2XVKA 5FYKH 2G75A 4GQ9L 5T3ZE 1J1XL 1FL6A 2A4EA 3G5WA 2XKNB 3KPOA 3N85L 4XAWH 3MCYA 1AO7B 1OL0A 2GUOB 3FQUA 3MRHA 3IDMB 4G80B 4XPTH 1M7IB 2BHYA 4ATWA 3ASOB 5K93A 5EOCH 3MLVL 1WCBA 4EPSA 4FX5A 1JTTA 1L9RA 1NFIB 1NDGB 2D7TL 3D69A 3NZHH 3EO0B 2JJVA 3AU1A 3SCMD 5C0GB 2YARA 3C9NB 5I8OL 2G3NA 4YPJA 1IMHC 3MQIA 1GZPA 4KMQA 3ARGD 4J3BA 4AYSA 3KNBB 1MIEL 4HQQH 2J8UE 5I9QB 1UWGL 4GXVL 3DMMA 1IT9H 3CC1A 3KLSA 5EBLB 3H9ZA 2EDFA 4OZHB 1RIVL 1RY7B 4JRYE 1T5KA 3QDJE 5CP3H 3WTUA 2Z9TA 5I6XB 3MJ8B 1SXSA 4FQ1H 3S3DB 4DZBA 1OHQA 1P1ZB 3QPQD 1TLMA 5IMOA 3R7RA 2QGCA 1MCOH 2DD8H 4S1RL 2OYMA 3ATEA 4OD2B 3CZEA 5IW6B 5INDA 5CBEA 2ZUWA 3EUUA 3MRCB 5GGRA 5IW1B 1SDAB 3DGGB 2OPCA 1HHGB 1AHWA 1CTOA 2R69L 1ANUA 1XGRB 3TIEB 3U7WH 3ZE0F 2A1WH 2E56A 5C0DA 4XO8A 3GMQA 2J72A 1J05B 2V7NA 4MJID 4UAOB 4UDTA 2EZ0D 2Y3NA 5GGSY 3WO3B 1OAXH 1F6AA 3NCEB 3IPBA 3MHZA 2XZAL 4ANUA 4GBXD 2M8XA 3E8UH 3NACH 1ZJBA 2D7PA 1HXKA 3GKZA 4BFFA 2C3HA 3P02A 4NBXB 4PMEA 1RUQH 5T3XH 1R9FA 4J12A 2NY2C 4F8LA 2R39A 5JHAA 1B2WL 1L9PA 2XIDA 4W4OA 3D06A 1R6VA 2ZSVA 2L7JA 1MJUL 3GMPA 1CURA 4J2QA 1HQ4A 5EEVA 1S9YA 2XLLA 3TIDA 5H37A 2A74A 3BC9A 1HQRB 1RZFL 3BSZL 2Z31D 3ARXA 3V6OE 1IM3B 1Y18B 4R6UA 2OMXB 3FTXA 4RMWA 5DJ2B 2JKSA 5K59E 1YN7B 1MW1A 1O0VA 2AEOA 2EUWA 3RB7A 4CADB 3WIAA 4YDLC 5DHDA 2C9RA 2HLAA 2J6EH 2XN0A 3OSKA 4Z1PA 5HYJD 1OB0A 2DRUA 2EXWD 1OGAD 3AG1B 5L4JA 3L1GA 2E9BA 5AZEL 5TPWH 2J3SA 2BINA 1TTFA 3AM8C 4JMXA 43C9A 5DVOA 4YLBA 1W15A 1U8MA 1NL0H 2QQLH 2AW2A 4KTYA 1U3NA 3HS0A 1EV2E 1F1DA 1HWHB 4HYTB 3MREA 5A2KH 1NMCB 1MF2L 1OGTB 5AZUA 3HG4A 5K9KB 1I7UB 1DQTA 3FTUA 3SOTA 2J1KA 3AAZA 4FZEL 1IC5H 1KF9B 3ZOAA 2Y7OA 5C0AD 3WD5H 3RGVA 1XWVA 4BBWA 1PLGH 1T0NB 3KS0H 1SYSB 4ZG1A 2G9KA 5DUBB 4W9LC 8FABB 4M02A 1JI2A 3BSHA 3PWPB 1MFCL 3QIWB 1ZEAH 1U8QA 5T1MB 4LOVA 3DO3A 1C08A 3N91A 4D0BB 3UX9B 3RVXC 4K2UL 4HP5A 3PABA 4KKRA 4KZDH 4OIBA 4N8UA 3ZZSA 4CMMA 3KHQA 4TQIA 1JVKA 4PJ7F 1LO0L 4I48B 1GYCA 3KMDA 2JELL 5T5NF 3T0EB 2HX8A 4YXLL 5BZDB 5DQ9A 3WS3A 1NGWA 3TO4C 3ETTA 2D4DA 2MHAA 3D9AH 3EFOB 2E9JA 4QRRA 3ULUC 3T09A 4FQXD 2OSLB 2R9HC 2VWEE 3ZLQC 1E6JL 1UB5B 4HUVB 2NNAA 5DHVH 4PJBF 3BUTA 3UTSE 3IN2A 4HS8H 3K5SA 5LDSA 4U05A 4PTUB 2I26N 2I60H 4XCYB 1RZQA 1HDMB 1X6NA 3SQBB 4PJDA 4C58B 3ELAT 1ZSDA 1IEAA 4MB1A 2WWMD 3SPVA 3BQUD 3W82A 4JGUA 43CAB 2GJRA 2XVBA 1NEPA 1YN6B 2H5UA 2YD0A 3RL2A 2F9BT 2L0DA 1MWAL 5F8QC 4YN3A 3ROLA 3TZVB 5IB3A 2JIXD 1OAUH 3ULUH 5JHLL 3IBOA 3SZKC 1ND0A 2BIHA 4KFMA 4EIBA 3Q2LA 5DTFA 5FX3A 5A2AA 2BNQB 4FQJL 3EOBB 3AADB 4FEMA 1G9EA 1OP5K 1YY9C 4PLKC 3K6NA 1JUFB 3ZDXE 3KJ6H 3F64A 4IHBA 1FFNB 2BSTB 2BSRB 4I0PA 5I5JA 4YSUA 1MJJB 3BKML 4JY6B 4I9WD 4B53A 4Y1AD 2X9YA 1OPOA 1WC7B 1C8PA 4PJ8A 4LPYA 3BUPA 5DMKA 4Z0BH 3KBEA 1WH0A 3O6ML 3QZMA 1KC5L 4UT6A 5ISZB 1EAQA 3IGKA 3TX4A 4CNIB 1LWJA 4MA8H 1QEXA 5KS9E 3DX9B 3NVQA 2W60B 2QFPA 2VDKL 2FX8H 4LLAA 2FJHA 5HDBE 4ZS6C 3VH8B 1JWSA 3WY3A 4E42A 4GO9A 3JT2A 3JYCA 1ZLVK 2BOBA 3TFBA 3PRZA 4K4KA 2NW2A 5T5FL 6PAZA 5F3FA 4NT6A 5D5ME 1MRFL 3CN1A 3S3JA 5LHDA 5TE7H 1A0QL 4DP2X 2DQJL 4R2GD 5TD4A 4RMRA 1JNHA 1T03H 4CSPA 1G9NC 5FKAA 4FDWA 4Y4HA 3FYIB 4XGZA 4ZTOL 3HHRB 4KDWA 2WXLA 3C09B 4JGJA 5C7XH 4NGHL 3VXSB 3TEWA 3QWQB 4WWID 1ETA1 1PVHA 2FD6L 2ZF8A 2QEJA 5T3XD 4MB5A 4EKXA 3FOLB 4FG2A 5J7CC 4J7RA 5GZNA 5JW3H 3LIZL 3OR6A 5ANME 3IFLH 1TKWB 3QIBB 4HPOH 2X4NB 4MQ7B 4CJ1A 4UNVA 2ZSWA 3V4PB 1G9NH 1H3VA 5IQ7H 4IOSA 4XXDA 3ARPA 3FO1A 5LBSH 1TJIH 2Y3AA 5KS9A 1RJYA 1U3HB 5DJDB 5EZJB 1KGYE 2ZCKL 3N6YA 2XG5A 4HLZH 5F3HB 3SJVA 4KTDH 1UENA 4FZ8L 4YDIH 3RUGB 2YAHA 3VI3B 5BO1H 3O4LE 4LMQE 1KCLA 3FW6A 4H7VA 1QLRB 3N40F 3VFVA 3X13A 3ZHDA 5B3NA 3GSVB 4X8GA 1QP1A 1FNFA 2JCCF 4F3FA 3CSTA 5BVJB 1EGJA 1EANA 4PWKA 4YSOA 1K6QH 2EVGA 3TEUA 3D0LB 1J8HD 5JO5B 3WNIA 4IIZA 3HUJA 3QUGA 2O1AA 2VTFA 1LO4H 3I6LD 3SCMB 2HH0H 3TNNB 5CSGA 1G7LA 3HZVA 3WTXA 3ARGB 4JKPH 2JF1A 5B3SB 1YEGL 1QSFA 3UTZB 1OCRB 3V0VB 2HXAA 1CD9B 1PY0A 1MHEB 4LCCC 3FS9A 5EA0H 1CFTB 2UVEA 4X7CC 5E2JA 2J4WH 3I75A 2SEBA 3VRLE 3CC5A 5JQ6L 1U9KA 4H88L 3FQNB 5IF0A 3O8XC 1TZHB 1ILSA 3T3MB 2ZJSH 4Z7OF 5D2LF 4NC1C 1R75A 3NFPB 3VFNA 3SDXA 3S7GA 1WPCA 3UAJC 1AKJD 4JG1H 5HDOA 2A2QT 5IBLD 2KDYA 4P48A 1UWXH 3VI4E 1QOKA 2XU9A 2JKNA 4JCLA 3U0TA 1DSYA 1KTBA 4IRSA 5CJBA 5I0ZA 1ODAA 1QFWM 3QQ3B 1BAWA 2YBRA 2J44A 3IDNB 4JRLA 2H45A 4ODVL 4MJIB 1PY9A 2FGZA 2QMKA 3B6SB 4LF3B 2A6JA 1I7RB 5E0QA 2JE8A 2X1WL 4H26B 3N0AA 1TO4A 2OL3L 4JLRA 4GBXB 1DBJH 4F93B 4PJHB 5D2NB 2AJXH 3NAAH 3QWRD 1JZJA 1EZVY 4BSWB 4EUPH 3FFOA 4O2CA 5AUMA 5IFJA 4H8PA 3O11B 4UV4L 1E27A 3BJ91 1T1WB 5ESVA 4U6TA 1OSEA 1DBMH 4N0RA 5DI8A 4NQTA 5B4MC 2ZTBA 3G6JF 3S4SA 3GI9H 3LHPH 2O5YL 5F7AA 4AZUA 2YGPA 1T2JA 1P5VB 2A6IB 2YEQA 1E0OB 3M17B 4I2XE 3TO4D 1T1XB 2R2HB 3V0JA 1MLCA 1UZ6E 2E6JA 4YE0A 2VDNL 3FB5A 3RVVD 1D5MB 3MRGA 1I1AD 4YZFF 1SJMA 4Z7QE 3DX4A 4B41A 2OR7A 5HYJB 1HCFX 4U7KA 4NO0A 5BRPA 3CFKB 4NLAA 5CSZA 4HCFA 3KCPB 2EECA 1G0DA 3VSTA 1VPOH 5GSRA 1K8DA 1NCOA 1ZPLA 1AACA 3CGTA 2F7OA 3B2XA 4QTIL 1RERA 4WHYH 4NENB 2OULB 4HIXH 2DM2A 2B1HL 1VFBB 4GRWH 3DVIA 5D4IA 3TNMB 2MPVA 3U1SL 1D5XB 3KJ4C