4F2FA

Crystal structure of the metal binding domain (mbd) of the streptococcus pneumoniae d39 cu(i) exporting p-type atpase copa with cu(i)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
GMTEIVKASLENGIQKIRIQAEKGYHPAHIQLQKGIPAEITFHRATPSNCYKEILFEEEGILEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation-transporting ATPase, E1-E2 family protein
publication title A new structural paradigm in copper resistance in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal binding protein
total genus 24
structure length 100
sequence length 100
ec nomenclature ec 3.6.3.4: Transferred entry: 7.2.2.9.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13473 Cupredoxin_1 Cupredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4f2fA00
4E9SA 1J9RA 1JZJA 1NICA 2YXVA 4PAZA 4GP8B 5LDUA 1FA4A 2RACA 3FSZA 1JXGA 2GC7C 5PAZA 1ET5A 4E9VA 2EIMB 1BQ5A 1KV7A 2WO3B 5PCYA 2FJSA 4DP6X 3T6WA 2HX7A 5TK2A 1GY2A 4G7SB 2BP0A 1EZLA 2LLNA 5I6KA 3AG3B 3WG7B 5I6NA 1KDIA 1OF0A 1PZCA 2QPDB 2OJ1A 2DWTA 3NJMA 4Q89A 3FS9A 2BHFA 2IDQA 1AS6A 5I5IA 3AY2A 1E5YA 3FSAA 3T71A 1J9SA 2J56A 4KOCA 3KW7A 3GYRA 1PF3A 2OCCB 3N2JA 4W1TA 2VSMB 3QJRB 1OE1A 1AAJA 2BP0B 2XLLA 1PAZA 5AKRA 4YVUA 1OOWA 1E30A 1J5DA 4FAAB 2CUAA 3NSCA 3SBQA 1KCBA 4AKQA 3WIAA 4DP2X 3PPSA 1BXVA 2HX9A 1CUOA 1SF3A 1WA2X 3IEAA 1T5KA 4KO7A 3V9CA 1XMEB 2XV0A 1W6WA 3AZUA 1AIZA 5I6MA 1JZEA 2CAKA 1R1CA 2WSDA 4YVNA 4E9XA 1PCSA 4W9ZA 3NJKA 4RH4A 3JTBA 3NP4A 2FTAA 3T9WA 4HHWA 1URIA 2XXFA 2YAOA 3PCYA 1E67A 1GY1A 2AZUA 1HFUA 5B1JA 3AW5A 4E9QA 1HAWA 1AS8A 1CYXA 1PLCA 2Q5BA 1GYCA 2UXVA 1WAEA 1X9RA 4YSOA 3ZDWA 3G5WA 3PAZA 1AANA 1MZYA 4YSSA 1AR1B 1HAUA 4GXFA 3V9EA 4DP8X 1JXFA 2P80A 2X88A 1ET7A 1SJMA 2DYRB 4YSAA 1ASQA 1PLBA 2JKWA 4A2DA 1KCWA 1L9RA 4YSRA 3CVDA 3PXLA 3CZUB 2VW4A 4Q8BA 3AG1B 2IH8A 9PCYA 2IDUA 4EF3A 4MFHA 3FU9A 2PLTA 3T6ZA 2PPDA 3SQRA 1OCRB 2YARA 4QLWA 1X9UA 5B1BB 1IC0A 1A8ZA 1JVOA 2PCFA 1QHQA 4G7RB 2QDWA 2XYBA 5B7MA 2FQFA 2J57A 2GSMB 5B1KA 3OMIB 3OQRA 1RKRA 1AS7A 4G70B 1ZIAA 3EH4B 1MG3C 4HCFA 3OM3B 1DZ0A 1TEGA 2TSAA 3FQ1A 4NB7A 1GR7A 3CVCA 4BXVA 1J9QA 3QQXA 1GS7A 4G71B 1GSKA 3X1NA 1WS8A 1IBZA 1ZIBA 1B3IA 2XV3A 4P5SA 2BO0A 3KW8A 3OMAB 3NSFA 2AVFA 1SHWA 5B1JC 2DY2A 3GDCA 1KGYE 2MRYA 4AI7A 3T6VA 4AX3A 1A4BA 1V55B 2ZWNA 2VM4A 2BWIA 1ZV2A 2P80D 4N4YB 2PP8A 1OE3A 1KBWA 3AG2B 2HRHA 3IE9A 4KO6A 3H4FA 1RZQA 2BZCA 4PCYA 4DPCX 4KNUA 2PP7A 4YSPA 2UXFA 1OCCB 2FT7A 1NINA 1V54B 3CG8A 4FA7B 2BWDA 2QDVA 1KBVA 1NZRA 2HXAA 3H4HA 1I53A 1BYOA 1NDTA 1GW0A 3L45A 1XB3A 2H47C 2HX8A 1WA1X 4P5RA 2PPFA 4DP5X 4AKOA 4A2EA 6PCYA 3TBBA 1V10A 2YAPA 3UAAA 1ASOA 5I26A 1AACA 1MDAA 3FT0A 5D4HA 4E9RA 2UXGA 4HCIA 2HLEB 1J5CA 3ASOB 3UAEA 3CDZA 2YAEA 2H3XC 2FT8A 1RZPA 3HEIB 3S3CB 2IWKA 5A7EA 1NWPA 2FNWA 4F7KA 3EH3B 3FSWA 1E5ZA 3S8FB 2CJ3A 3GXUB 4HAKA 1BQKA 4KO9A 4KO5A 1PMYA 1ET8A 2VN3A 1JZHA 3ERXA 2AANA 2YAQA 2TSBA 4F2FA 4M4RB 4ENZA 2YAFA 3MX0B 2W8CA 4GP5B 1AOZA 3QPKA 3CDZB 1JVLA 1IUZA 4N8UA 1AZRA 1JXDA 3FQYA 4A2HA 2CBPA 3AG4B 4HCGA 7PCYA 2BZ7A 2BP8A 1L9PA 2PPCA 4GY4A 5B3SB 3WNJA 4BWWA 3NP3A 1DYZA 1ADWA 1MZZA 3NT0A 1MG2C 2WO2B 1E65A 2HZHA 2W88A 1AZCA 4YL4A 4ZK8A 1L9SA 1NIFA 4X4KA 4M3HA 1CYWA 4CSZA 3N55A 1TU2A 3WKQA 8PAZA 3FQ2A 3FU7A 2B08A 3NSDA 2H5UA 3PAVA 1JOIA 2IDTA 2VW6A 3DIVA 3SBRA 2A3TA 4DP4X 1SHXA 2BP8B 1NPJA 4UAHA 4YSCA 3SBPA 1L9OA 3X1BA 1XB8A 2X87A 1ILSA 3ABMB 4WKXA 3TBCA 4DPAX 3ZX1A 5D4IA 5I5MA 3NJHA 2VMJA 4JKNA 3IN2A 1VLXA 3IBOA 1AG0A 1CC3A 3CVBA 1OCOB 1JERA 4AKPA 3FU7B 3DKHA 1FWXA 2DV6A 4TXVB 4YSQA 1AG6A 2XX1A 3EF4A 3NSYA 2FQDA 2QT6A 2YAHA 1ZDSA 2FWLB 5AZUA 3ASNB 1AQ8A 1NIEA 3FPYA 4BDVA 3IN0A 1PY0A 2J55A 2XWZA 4JHUA 4DP9X 4BWTA 1BQRA 1W8EA 3X1FA 4HALA 2AZAA 2UX7A 3UABA 5EHFA 4F2EA 3EH5B 1FFTB 3QJUB 1BYPA 3EHBB 4BXSV 5F7BA 2Y69B 4DP1X 4E9TA 3FSVA 3X1GA 4L0PB 5I6OA 3PLYA 1XB6A 5B7FA 1IBYA 2CCWA 3NJLA 4YSUA 5FC9A 2BW5A 2JXMA 4BDVB 3X2QB 2GIMA 3S3BB 5I28A 2GHZA 3UGEA 2VW7A 1NTDA 1GS8A 4GP4B 2AFNA 1KYAA 1SF5A 5IY5B 3QJQB 2DWSA 4KNSA 1AZNA 1SNRA 1GS6X 2EILB 5TK4A 4K9JA 3TU6A 6PAZA 1JZFA 2EINB 2IH9A 1A65A 1EHKB 3WKPA 4GYBA 1N68A 3JT2A 3ABLB 3NJIA 1WA0X 5E9NA 3TASA 3FYIB 4G7QB 4KNTA 2I85A 4QKTA 2N0MA 3QJSB 4A66A 4AZUA 1F56A 1RCYA 2EIJB 1ASPA 4YSTA 1QLEB 3ABKB 3S8GB 4E9WA 1ZPUA 2FQEA 4NAJA 4DP7X 2B3IA 1NIBA 2FQGA 3NJJA 1ID2A 2YXWA 3PAUA 4A2GA 3NJFA 4DPBX 4HIPA 2VM3A 3NYKA 2GB2A 1M9WA 3D12B 7PAZA 1BXUA 2MTAA 3OD3A 3T6XA 1BAWA 1NIDA 1L9TA 2CALA 1W6LA 2E86A 4KOBA 4NERA 5AFAA 1IKOP 4A67A 2XVBA 3ZBMA 2Q9OA 2ZONA 2FT6A 3WNIA 2YQBA 1QNIA 3NJNA 3U25A 1N70A 1NIAA 5B7EA 2I7OA 2ZOOA 1OV8A 1A4AA 3UACA 1BEXA 4UANA 2IDFA 2YAMA 2R7EA 4HHGA 2PCYA 3BVDB 1AZBA 2J5WA 1KDJA 1TEFA 4UF7C 2QPEB 3FYEB 3QJVB 1OCZB 2GBAA 4YSEA 1NPNA 5F7AA 3FU8A 4DP0X 2VSKB 3WI9A 1YLBB 1SDDA 4HZ1A 4A68A 2GI0A 2OV0A 3TA4D 2EIKB 3ZIYA 2IWEA 4WTQA 1UATA 3S3DB 1M57B 1NWOA 3QJTB 1ETJA 4CSPA 5I6PA 1L9QA 1ZDQA 1A4CA 2IWFA 2PPEA 2R7EB 2UXTA 1PZBA 2I7SA 3DTUB 2XU9A 3H56A 2GC4C 3BQVA 1WS7A 2IDSA 4BK5C 2PP9A 2HRGA 3X1EA 5B1AB 1ILUA 1SDDB 1A3ZA 3HB3B 3FPXA 3UADA 1TKWA 3MBWB 2XV2A 1JZGA 1PZAA 5D4JA 5ANHA 2XX0A 1BXAA 3ABGA 2DYSB 2JFCA 2UX6A 4A2FA 1OE2A 1SFDA 1CURA 3OMNB 1PNDA 1PLAA 2IAAC 1PNCA 4JHVA 4BWUA 2XXGA 1J9TA 2Y1AA 1M56B 5I6LA 1AZUA 1SFHA 2NRDA 3NJGA 2ZXWB 4G72B 2BW4A 2XUWA 3RYMA 2PPAA 1JZIA 4YSDA 3C75A 4E9YA 5I5JA
chains in the Genus database with same CATH superfamily
3UYRH 2IQAB 2YMOA 4LLVB 5TGBA 4KDVA 3F7VB 3PPEA 2E9WA 1LXMA 5E6IA 3WTSA 2X89D 4GP8B 2D0GA 4PUBH 3MRJB 1FNHA 1Q94A 1NCCH 4YDVA 1AMXA 5DQDL 5FB8A 2O6FA 5GRZA 3H55A 3NESA 4DNLA 2BH0A 2YD6A 1UA6L 4WHYG 2NXZD 3ZE0E 2XWTB 3O3DB 1C12B 3CMGA 4MNGA 4HULB 3D39D 2QLVB 4I3SH 4R4BB 3VDBA 4Y5YC 5B8CA 3WHXA 5I0YA 5IW3A 4PYHA 2VR6A 1R5VB 1HZKA 3UTOA 1HHHB 3W1ZA 3WMQA 5I6NA 1YQVL 3OR6B 2J4WL 5I76B 3BPLB 2WLYA 4OIBA 3K6FA 3FS9A 4ORGA 3NIFF 1YECL 3ZLQC 1U8KA 3VX1A 1DBBH 1WC7B 4GSDH 5I1HH 1JPFA 1DVYA 4QHNB 4G3YL 2FGZA 3FSAA 2GIYA 3MUUA 3VFNB 5E1AA 3ZL4L 4TNFA 4HP5A 4KFZC 1P7QA 2J56A 5I18L 5LG1A 3J8F7 1Y6MR 3CH8A 5GGVY 3L1EA 3D30A 1E42A 5A2FA 3BFOA 2HG5B 4QLRA 1VEPA 1SYVA 4Q58C 3SKNB 4Y4FD 5D1XD 1VEMA 3JZYA 5ACZB 1BAGA 3QIUB 4DVBA 5JPMC 4TNVK 4Y2OA 5J1AB 3V0HA 4MXVE 4XXCC 2A74A 1XMEB 4UQ2B 3ARUA 2OMXA 3TZVA 4FQ1L 3DHUA 1MFCL 3V4PH 5SX5H 2ADFH 2CJTA 3VQLA 1S7XA 1PTZA 2NNAA 5J7CC 4OCRL 5C0CA 1M2OA 1DLFH 2YK1H 3AM8C 3E8UH 3IDYB 1SMOA 1E67A 2CKBA 3R19A 3TIDA 5DJAA 4CC4C 1I1RA 1DQIA 1AGFB 1S7QA 5HP5A 4Y2NA 1HAWA 1RUKH 1SN5A 4TL4A 3EFOB 3C5SA 4M48L 3QJFA 4AEHL 5GJTL 3WO4B 4J3SA 3G5WA 5MEOB 2V2TB 5IMMA 3U48A 1E5UI 2LFGA 3N85L 1FC2D 3LS5L 3Q8BA 5LBVA 4DUWA 1ASQA 3KJ6L 3FKUS 2EXYC 2KT6A 2ZX8A 1A3RH 1I1AC 3QUZD 4JPIB 4KKCD 2JCCA 3IJSA 3NFNB 5DI8A 2UWEA 3JV4A 5AVQB 2FH6A 3KR3H 1ZVSB 4G42B 4OCNC 3L3DB 3ZKND 3QQ4A 1YYLH 3QK0A 1JVOA 1CFVH 3EJCA 3NA9H 4NKOB 1JIBA 5F7MC 1JZDC 2KDYA 4MNQA 3CSPA 4HIHA 4NJAH 4Y16B 4HG4K 3GT6A 5EEWA 4TN9A 3U30B 4I0CC 4PIBA 3OWEA 2QQNH 1KIPA 3ECBA 1AGBA 3OM3B 4MASA 5BXFA 5D70L 1DZ0A 3IJ9A 4OZFH 3UZEA 3HZMB 3ZE2F 3OPUA 4M5SA 1XMWA 3MO1A 3BDXA 5D5MA 5EBLB 1VPOL 2OMWB 4G71B 2VLLB 4O9HH 5KZCB 8FABB 3HJ0A 4JGUA 1BM7A 3T3MF 2N59A 5EUOF 3ZDXB 2VABB 1P4IH 2G2NA 4YHKL 3BWUF 3CFIC 3H0TA 5CINL 4PRHD 1G9ML 4OCMC 2PYFA 3RQ3A 1H3VA 1USZA 2HRHA 3V4PB 3DJTA 1F86A 2PYED 1QFWI 3P77B 3T2OA 2VYRE 5C0AA 4LSPL 3WAKA 5I9QC 2ARJB 4OBRA 2JMRA 1EJOL 4PJHE 3VSVA 1QBML 3SKJH 5E8PB 3QDJE 1OAYL 4HX1B 4Q9CA 1JD9A 1U58A 3CZEA 4U1JA 2ESVB 4WI8A 1G6RH 1K5NA 1UGKA 1KC5H 3L6FA 3QHFL 4OJFL 3LV3A 3TBBA 1MJ7H 3OJMB 1DBML 2A77H 2VMCA 1JTTA 1P4UA 1PIFA 2EXWC 4ZS6D 1CBVH 2W59A 1MDAA 3QYNA 4KK5D 3JTSB 4XO4A 5D4HA 4Z7QF 1HDMA 4MA7L 3CDZA 4X99A 3SEPA 2FLBT 4QF1A 3CFUA 5JW4M 2YQ3A 1IAOA 3MNVB 1RSYA 3S3CB 3HN3A 5EU5A 5IMOB 2FNWA 1EO8H 1ZLDA 2Q20A 2ZE0A 3DJ9A 2VDRL 1IC4L 3A23A 5IJVB 5E24E 1NAML 2WQVA 5DVLA 5J6HB 3ZGIA 4W9FC 1KEGL 1IAKA 5DXWA 3FUFA 4OLWL 1N8ZA 3HC3H 3L9EA 3I9GL 4M4RB 4QRRD 1KBGL 2J8UF 2ED9A 3WNOA 1WAAF 4FFTA 4AUYA 5IBTH 2EE2A 2VLKA 1DVTA 3RPIB 4AIOA 3FCTB 4OZFB 4X6CB 3JWNG 1IUZA 4KJPC 1FLTX 2CDFA 3DVNA 3PV6B 1CE6A 1P5VB 1QKZH 5IKCB 5FDWB 1R5WA 4HWBA 1RP9A 2YPVA 4MA8L 4BSVB 4DGYH 4CU6A 3TF4A 3WNJA 4G9FA 4G1MB 4RAVA 3SE3A 3UC2A 1KJ2A 1DYZA 1LO0H 4ZQTA 1L6ZA 2Y6SD 4XPGH 4PJBA 4OQTL 1VCAA 4E0RB 5DS1A 4U1SB 3GSNL 5EOTA 2DQIL 4PJ9A 2F53E 2JIXA 1QTPA 4PJFF 3MREB 3SBRA 3KPSD 4JZJC 1IEAB 1RFDH 2BP8B 4CL7A 4NENB 2XTJB 4XPTH 3KEDA 4HLJA 3LDBB 2R69A 4R0LB 4D0CB 1B6UA 5D9SB 1ACYH 4OFIA 5T1KD 4UDUA 3FT4B 2O4EA 2OMZA 3P1VA 1P2CA 4ZUUB 3RFZA 2LV4A 4F2MB 1JERA 1U8HB 4WUUD 3FFCA 3IKCA 5DZAA 4FLHA 3CFBA 2IMMA 1JYWA 1MH5B 4I13B 4B27A 1EXUA 1MRCL 4MB3A 4QMEA 4F58H 1BVLA 4PJXF 2ICCA 2J8OA 3C6LA 4LSTH 3VI4F 3VNZA 4CN4A 1PFCA 4PGEA 3P4MB 2WZ0A 3DXAE 4BWTA 1G7QA 4PLJD 2HJKA 3TBYB 1JNNH 4AIEA 2PKDA 3FAXA 5EOCH 3WIFB 2BINA 4YN3A 1A8JH 2AZAA 4JFOB 2ATPA 2VDMH 3GK8L 1FFTB 4KROB 2J1WA 4EKJA 1E27B 5DUBA 4DP1X 1NLDH 1VACB 5D1ZA 3RB5A 4A2LA 4L5FH 4XX5A 1X5IA 4J4PD 1O9WA 5ADOL 4XZUA 4NFCA 4UTAH 1I7ZB 5BQ7A 5DR5L 3QDMD 4K73A 5ID1A 5TJWK 2BHZA 4K7FA 1XIWA 1YUHA 3CUPA 3BFQG 3FUDA 1KLGA 4W9KC 3KGUA 4JHWH 4L8SC 4DAGL 2WZPD 4JKLA 1XGRB 3TTYA 3HA0A 1WP6A 4ODTH 5ECGA 3LEXB 2X7LA 3AABA 2PO6C 4JB9L 2ITCB 4PRBB 3RGVB 3II3A 5CJXA 2Z0BA 5IVXA 4PLKD 1RZKL 1MEXL 2PWEA 2X4SB 1RHHA 2H3NA 4Z7VF 1IM9B 3AMLA 4M7LT 5AW1B 4XNXH 3SZ6A 4CU7A 4ZUWA 3NJIA 1RZFH 1GC1H 3IGFA 5LJYH 3MRFA 2VDQL 4E42A 3MJ6A 4UB0H 3UBGA 2AJUH 5TGBB 5DGRA 1ZEAL 2ZXDA 1N6VA 2NTFA 3E3QE 1SJXA 4D7PA 1MFEH 2AC0A 2YMTA 5FB8B 5ESQA 12E8H 5ANMB 5IW6A 1XCTB 3MJ9A 3RKDD 2KZBA 2NY4D 3ECVA 4LCUA 1Q0YL 4B9IA 2YXWA 1INEH 5B8CB 1Q9OB 1IC5H 2QVIA 1TZOA 3Q8CA 3A3YB 4RSYA 4TRPL 4BJLA 3LNFA 1X7QA 4M8QB 4ZOAA 2OI9B 3GXTA 1JZ4A 3FTGA 1L9TA 3V7AG 4G7VL 4PG2A 3UBXI 4IK6A 4QRTB 2P8LA 1GCFA 3DSNB 4K94C 4OLYH 3UH8A 2XVBA 4EOWL 5A16A 4YQXL 1OT1A 2AW2A 1QNIA 1I9JH 2WLLB 4Q0XL 2A99A 2VDMB 4YGVA 4OF5A 4NSKA 3GGWA 1TEYA 3QPQD 1T20A 3PGCA 2XQYA 4JO3L 5HVHB 1GIGH 1T5WB 1ZE3C 3QFJA 4W9IC 1LYQA 1QX1A 3D2TA 4L2LA 2QV2A 5IIEA 4X5WB 1IJ9A 1I9EA 1M6OB 4OZIF 1NA8A 3VXPB 1NPNA 5LBSH 1RIVL 1YN6A 3O81A 1M7IA 4BFIA 4HMCA 2HPTA 1C16A 3RAJH 3VFUA 3MBWA 1O75A 5JXED 4OAWB 2BIMA 4H0GA 4U1IB 3TA3C 5I6PA 4N2MA 4PWEA 4PQXA 2R7EB 3V0VA 4EN3C 4ZNEA 2X4PB 4QDGA 5E03A 4JN1H 4LDCA 5TPWL 4ENEC 3MLXL 2DQCH 5T33H 1F4YL 3HE7C 4PRPD 1AHWA 3HZKB 4R3SB 2BCKA 4KVPA 3RVVD 4KI5C 4M93B 4Y88A 4KMLB 5MHSD 4DZBB 2E6QA 4MHHI 4R2GB 4RZCA 5L7XH 1A4KB 2NY1C 5DEJA 1DSWA 1FFPA 4R8WL 3EF7A 3QZWG 2GY5A 2JCCB 4NP4H 5F0LB 3CZFA 3PNRB 5F1NA 5JHDE 2IAAC 4WK2B 2VM9A 1Q9LA 3WOVA 2XXGA 5K69A 4L1BA 1CE1H 1JF1A 3U36A 1M56B 3LS4H 1ZS8B 1M71A 1JDCA 4FL4B 3QP3A 4HSCX 1Y18A 4ZTPH 2HKHH 1R3JA 4MDJA 3RIAF 1WD9A 3LRSB 4HSAC 1JGVH 4LLQB 2V9UA 3NTCL 4DTGL 1IRAY 3FQNA 3QC5X 5GS1C 2WAHA 1T5XA 4HIIA 4X9IA 3LNGA 1D7BA 4I87A 2EEBA 2B0SH 3FBKA 2DQUH 2YXVA 1BJ1J 1XCWA 4EUPG 1FVDA 1S7UA 2V33A 5BUPA 2HSIA 4UYQA 5HGBB 1ES0A 2EIMB 5B38G 2BSSA 1KV7A 3QWQB 4WV1A 1RZIB 1X5KA 2WWKO 4ZO8A 2R4RL 1N0LB 5F7KC 5FR3A 1OKEA 4OW6A 1T2JA 1GY2A 2BP0A 1S7SA 2A6DA 5FLUA 3SYAA 1NQBA 4KXCA 4UIMA 1JK8B 2XG5B 1KDIA 1PZCA 1TIUA 3DOSB 5EUOA 4MD4A 4NO5B 5J56B 2IGFH 3VWJB 4RWYH 5JIHA 2XYCA 5K9OA 2E6JA 5FCUH 4XNUL 4GO6B 3Q5YA 3CIAA 3GHEL 3BPCA 3O45B 1E5YA 1Q1JL 1ZOXA 1HXKA 2H41A 1OLLA 2HJFB 1WTGT 2EE0A 3BLBA 5D1QC 2GEEA 3H7BB 4FNUA 5FLVA 5HGAA 4XP6H 3QQDB 3MN8A 1EZSA 2IBZY 3DTDA 1QFWL 4FFWD 4GO9A 4PJAE 2P46B 5K39B 5CCKL 4YVUA 3LOWA 4L4TB 4RNRB 5IFJB 1IFHL 4PH8A 3BN9D 3OZ9H 2YLHA 4U1JB 4OGXL 3GO1L 5BVPL 4GAGL 4HOXA 2EVFA 3HG4A 3EGXA 5TDOA 1HYSC 1XGYH 1W0VB 2B39A 2WSKA 4KO7A 4RAUA 3IFPA 1BG1A 2B1AL 1AIZA 1K8DA 4J1UB 4HSQA 1CT8A 1IAII 2HTLC 3AS0A 2F74A 4UMGA 2BK8A 4FYQA 2PXYA 3WFHA 1D7CA 4M43H 5ERWB 3KYAA 1G7JA 2WYIA 4PG9A 2XXFA 4HXAH 4DF9A 4NQDB 4U2YA 4CN6A 5F3HA 4AWJC 3QNXA 2FIRT 4QRUA 1QFUH 1BF8A 2AK4E 1WT5C 1MFAH 4N1EA 4F7MA 3CGTA 1AR1B 1OQXA 2HN7B 2O5XH 3ZKMD 4H0LC 3IVKA 2NNXA 2OMNA 2WOYA 1I1AD 4L3EE 5F1IB 3U82B 1HXYB 1WAAA 2HJLA 4C83B 3CVDA 1NOAA 3F5WB 3PXLA 4XCEA 1Z9SB 9PCYA 5HJDA 2IH8A 2IFFH 3BD5A 3BCDA 4P5MA 4ZSOE 3RIAK 2EO7A 4QXTB 5SWSD 1BFTA 4KGJA 3BAEL 3OG4B 3QIWC 3PWUA 3VXUB 4UTBH 1HCVA 3RWHA 2CO6A 2F8VA 1XF1A 3R06A 2F1BA 4JLRB 1KIRB 4XWGL 3BLKA 4L1LA 3L1FA 5GS0H 1QTSA 2A83B 5I1EH 3CX2A 4GRLA 3IF1A 2XY1A 4P5TB 2OM5A 1BVNT 1X5GA 3O2VL 3FRPG 1FI8C 1SGKA 3B5TA 4FQHB 4Y2DC 4ALAH 3BUYB 3KPOA 4JW3A 3HHMA 4DJMA 4PJFA 1NEPA 2VR4A 1B0RB 3NCFB 3CVCA 3G6DL 2P5WE 4PVLA 3RUGB 1OSZA 2K4AA 1QPKA 3STLB 4P2RD 4NZRL 3KW8A 5FYLD 3U4BL 2Y7MA 3GMNA 4QUOA 1A1OA 5EU6B 4E5XA 3QXTA 4Y9CA 2C1PA 2DMGA 5E70A 1NGQH 2CR6A 2FUTA 4XZ4A 5IHUL 1SQ2N 2EDDA 3ARZA 5LUMA 2AXWA 3W37A 2VDPL 4XO8A 2FD6H 2DM4A 1CBJA 2Z35B 3BRGC 1H3XA 3IE9A 2YA1A 4XBGA 3H4FA 5CWSA 3UG3A 4H8WH 4LSQH 2VXVL 5T3ZH 2YMXL 2BZCA 3RWFB 2W9LA 5KYWB 4FQJH 3ARBD 4LOUC 4PI2A 4BA8A 4GSXA 3VI4A 2VLJE 2AKRA 2PWFA 4B9PA 2BWDA 2PTUA 4AG4L 2HXAA 3WFCL 3HN8A 5E2VH 2CHZA 3D08A 3ESMA 3CLFH 4FX5A 4N0CC 3SJVB 1BFOB 2GJZB 5I19H 4MVBC 4H5SA 1DE4B 5E6RB 3OKOB 4AEEA 1AO7E 3FO9B 2Q7YB 3U6XS 1PDKA 3IFLH 1I3GH 4F5CE 1X4XA 1AP2A 2ZAHA 1TITA 1BD2D 4MJIE 2ZOLA 2BVPA 3N1PC 3MRQB 2AJXH 3ETSA 2EC8A 3MGOA 3MRMA 5IFAH 3I9PA 4JQIL 4LOVA 2ADIB 5E23A 5C07E 1NC2A 1HT6A 3NCCB 2YAEA 3DUSA 1SEQH 4WK4B 2H3XC 1OSPL 4MRCA 4U1HA 3WDHA 2AERT 2VZ1A 3SPCA 4KMTH 1EQWA 1U4FA 2J43A 4PTTA 4DEUA 3MC0A 2NY0B 1U8IB 5MI0C 1FG9C 2COVD 4H40A 1N64H 1IILE 3AT9A 3FOLA 3VGHA 4C54A 1SVCP 4R83A 4RVBA 5FGBC 4BM7A 2R2HA 3M1BA 3AQZA 4IHOA 2E6PA 1GAFL 1Q90A 5E6ID 2J72A 1DQKA 4P9MH 2YAFA 1X5YA 2G0KA 2H3NB 5C2BL 3HFMH 3DTXB 3SGDH 1NEZB 1KPRB 2BY3A 3HG1A 1XFPA 1HHJB 1JVLA 3OPZL 3ZGHA 5JOEA 3RGHA 5G4MA 1INDL 3POHA 4O51A 5DC9B 2I69A 3F00A 4GMTH 4I0PC 3M8OH 4GY4A 1IVTA 1B0IA 1A7PH 1IBGL 2Y7OA 4GEIA 2E47A 3JWOC 3Q0HA 4NPYB 3VWKB 1CICB 2FNBA 3QR0A 4F7CA 2AQRA 1CG9B 3EG9A 4FKEA 3QJZA 4I18B 1LO3L 3IPBA 5CU9A 3OB0H 3SDCC 1COBA 2EUXA 5KTEH 3RL1A 1LEGB 3FQ2A 3GJEB 4NRYA 2R59A 3SO3B 4KY1L 4PJEE 5J13B 2C9XA 2E74C 1TJHH 1NPJA 1CVSC 4HFUH 4XAWL 1ETA1 2OR8A 1EFXB 5EA0L 1JTPA 1AI1H 3D4CA 3A24A 1Q72H 1J8HA 5F9AC 1JN6A 5C09B 5I5MA 1JG9A 3AT0A 3W9EB 1AD0B 2BHYA 2GHWB 1ZAGA 2X4UA 5BZZA 3HHRB 1QEXA 4HIXL 4KRLB 4JO4L 2DLIA 3TZVD 2AQSA 3SHSA 4AT6A 3JV6B 2WXHA 3BDYL 1KLUA 3IWVA 3QFJB 4HGKC 5L8KB 5AW3B 3NSYA 3QZMA 1E40A 1HOCB 4K3EL 4OZIA 1F02I 4PB0L 4A04A 2APTA 3O4LB 4DKFH 1YYMH 3UYOD 3WEXB 5A40E 5C0CD 43CAA 2YRZA 1B2WL 2B5IB 2X3BA 3B83A 3LMJH 4QO1A 2BNQE 5FA4B 3POCA 5I5RA 4TTDC 1D9KA 1A6VH 1RIHL 2WVVA 4BCZA 4BFIB 5AENA 3BSZA 1KB5A 5ELIA 5ADPH 1RPQA 4G59C 1OO2A 1I8LC 3OB8A 2DYPB 3ISRA 3L95B 3ULSB 3V4VH 1DJHA 2BERA 3DBXA 4M8VA 4OZHB 5T3XL 3ULUH 2AGJL 3SDXF 3VGBA 4NQCB 1QI4A 4XC3L 4J7RA 1KCSH 5MP6L 1WK0A 1ZHKB 3TBTA 3Q06A 4OJYA 2ZXAA 3AREA 1F1DA 1VESA 3A67L 5CKGA 2J1ZA 2FZ3A 5K59F 4G80A 3B2DC 4JK0D 1OALA 2AEQH 2YPLB 3KYMA 3T0BA 4XC1H 2WXIA 5IB1B 1ZXKA 4YO0A 4FJYA 3LPPA 4ZFZB 3L2MA 3DBSA 4Z1PA 5IZ7A 3SCMB 3Q6GH 2PO6D 1MQKH 2DIAA 3K72B 5K9KB 1WWBX 5LWYH 4MNQD 1Q9LB 1XZ0B 2YGNA 1D6VH 5KYYB 3HI5L 4JY5H 2FECI 4K71C 5E2JA 2DZEA 3RWDA 2JH2A 1IT9H 1L7IL 5SWZB 3TASA 1FG2B 3OSVA 4I7ZC 1FL6A 4L2YA 4X7SL 1R75A 1IM3B 4GKLA 5DTFA 4OV5A 2SODB 1T1YB 1T89C 1LDPH 1OW0A 2YBGA 4Q2ZB 2QHRH 4JUSA 3L5WA 4I88A 3N40P 3VM7A 2D7TL 2BSSB 4N26A 1M3IA 3GM0A 1PD6A 3MFGB 4I4WB 3IXTB 1ZPUA 4P4KC 5IVNA 1CMOA 1EGJL 1ZMYA 2BVOB 4CILA 1CF8L 2AEIT 1RQ5A 4C8XA 2A6DB 3NCYS 2XZQH 5HY9A 3NYKA 3WIHH 4CMMA 2DQEL 2VXUH 5F96H 3MHZA 1BXUA 4XPHH 5TDPA 2MTAA 3KXFE 4H0HB 1FH5L 5JW5A 2AABL 3PWJB 5C0AD 4QY8B 2E86A 3TWYA 3TP4A 1UWGL 2XFXB 3TO4A 3AADB 4D8OA 1O5PA 1DCEA 3LD8B 3S35L 3SDDA 1L7TH 4GG8A 2VH5H 2ZOOA 3V4VB 1EXHA 3U0PA 4XAKE 3I3BA 2GT9A 1NCBL 3KPMA 3BVVA 2R1YB 3MGTB 1FSKC 2V3FA 4CKQA 1DQDH 5ECJE 1AZBA 3CSFA 3N40F 2RB8A 4P57A 2DKSA 3BD3A 4LHUA 4UQCA 5F8RC 1D5IL 2Z7WA 3UZVA 2E7CA 4LF3A 2WOBA 2IANA 3FUNA 3IFPB 3CHSA 4FNQA 1OZTG 4P9HH 2QKIC 2FHFA 3Q44A 1XSOA 3O0LA 4GKNA 1E8YA 2F74B 4TSCH 4YEEA 5D6DA 4ZD3L 5JHDA 1Y0LA 5HBBA 5C7XL 4UT7H 4KOCA 2IWFA 3HZVB 4ETYA 3GMPB 3FB8A 5JOFB 4Z7UB 4PJ7E 3K4ZA 2LW3A 4NKMB 4O2CB 2ZUUA 1W72H 2JWYA 2VAAB 1XD0A 3BQVA 4IRSA 4DVRL 2VLKD 1TVHB 2H6PA 2GJ6A 3CJJA 3G5VB 4KI5D 3LH8A 2K4WA 2CMRL 1UH3A 3E6HB 3D25A 5EIIB 5HYJE 2J8UB 1PZAA 3ARGC 3P40A 2NX5D 3MRHB 4G9FD 3P30H 4GKSA 5EU7E 1ZA3B 2W0FB 1A66A 4PWFA 3VD7A 2NNCA 4WWKC 1OE2A 4K5MA 3W9DA 2A2QT 4N0FB 2E9GA 2AJYL 2Y07H 3RTQB 1QYGH 5ITFA 4POZC 3BSGA 2CK2A 4AZ8A 5KVEL 3S98A 3D0LB 1G94A 1OGTB 2R29H 2YD0A 5E2TL 3CVIH 4LLMB 4PJ9D 2XUWA 2JIXD 2Q2LA 5DD1H 1BOGB 2ADGB 1BM3H 2P8PB 3SDAB 4JJ5A 4HUWB 5IHZA 5DRZA 4X5PA 1CI3M 4LVNC 1WBZA 2P5EA 1UXLA 5H37A 3KPOB 1BZQK 2GC7C 4GUCA 3UTQA 1U3ZA 4AYFA 3DSFL 4CVZB 4PREB 1M05A 5TFSH 2BPBA 5CZXC 5I1AA 1F6AA 4U6VH 5ISZB 1HL9A 3ATFA 3VXOB 2H0EA 2JLPA 4X5QA 3FFCD 3UERA 2LLNA 1YDPB 1JNHB 4ODXA 2OR9H 1TZIB 4XPFH 1JGLL 1LO5A 1X44A 3DV6B 4HPYL 4X4MA 4WY7L 2C1PB 4ODSL 2OBGA 3BT2H 2VDKH 4HA1A 1C5CH 4DEPB 3C6LD 3HC0A 1SOXA 2QVMA 1CVRA 3ZE1F 4J6RH 1ZVHA 1PZ5A 4EI5B 5EEVA 1J9SA 1ED3A 4FLRA 2WQWA 5DD0H 3IT8D 1NJ9B 1RZ8A 2ZAIA 1KCKA 4PJXB 3VI4B 2XNAB 2YPKA 4P46C 1I7UB 3GJFK 1TETL 2VZSA 4GB9A 4OB5L 1GTNA 2AK4A 5D1ZD 4V1DB 1RUQH 1D5BA 2XN9E 1W72B 1FYHB 4M1GL 7CGTA 4AGLA 3OC8A 1FDLH 3Q8EA 3OKEB 3DRQB 3IK2A 3MYZA 4NN7B 5G5DA 3KPNA 5H8DA 5KBLA 4XP5L 4Y5XB 3E3QC 4H26A 4JFQA 3QNYB 4YHIB 1XIWD 2DQTL 5DLMH 5AUMA 5TH2B 1TF4A 3B7RL 1KIUB 2EE3A 2MOGA 3S36L 1N5AB 5DJYB 5E99H 5B21A 2CLRB 5CJOL 2ADJA 1MNUH 1UD2A 4NWTH 4BH7B 3AT8A 4FP8L 3T4AB 1FVEB 3OX8B 4ZMZA 4U3CA 2VMEA 5EB9A 4NUPA 3STZA 1CGYA 2DDQH 1UOKA 2Z8VC 3FTXA 2B4CH 5D7IF 1HAUA 4DP8X 2WCSA 4MDIA 2KDGA 4MMXC 4PRDB 4F9PA 1UM5L 4Z7VB 1HOEA 4JDZA 4JPQA 1I8AA 1PLBA 2CO2A 3BVUA 4JFEE 3TCTA 1A64A 3QUHA 1HCYA 1FGNL 2X1XR 4HEME 4JVPA 4LLDA 4FFYL 5J6GA 4O51B 1JFHA 1DBAH 2P52A 5AW0B 5J1TC 1QAWA 1FNSH 2WY3B 4HBQA 3UDWC 5I17A 3C60A 1PQZB 1ORSB 1FE8L 5B7MA 1J88A 5L9DL 3MLZL 3R0NA 1PU0A 4YIQA 4TPRH 2HT4C 2VDKB 1F11B 2MIZA 4JPKH 3FQXA 5AW2B 2OXHB 3L4ZA 1HEHC 2BOBB 4PJ5E 1OSYA 1S7WA 2BNRA 3U6RB 3UTPD 2K70A 4NRYB 2X5PA 3GXNA 1F3JB 3OKDA 4L4VE 4TULH 1OAXH 3T0XA 3LXAA 2ZUVA 5A3ID 1SYSB 3LCYA 3V6ZB 3FK3A 1UXWA 2Q6WB 4PJIF 1QMUA 2AQQA 1AO7A 4K5OA 4MQTB 1E7UA 2BSRB 3BLPX 3QWNA 3DV4B 2ODIA 4M7ZC 5EC2A 4MJIA 1OM9A 1TFPA 3WN5B 1MI5E 4B9GA 2QR0A 2X4UB 3NIGF 5EEXA 3T6VA 4ZODA 3UTTE 2AJVH 4AT6B 5C0NC 1NFAA 5C07A 1JWMB 5CKAA 4GS7C 3OG6B 4LOUD 1BMWA 2F19H 2PP7A 5EC1B 2WUCL 4HH9B 3MBEC 2GITA 1XBDA 2WXQA 4XI5C 4RGOL 3EDKA 1FNGB 1TT6A 1P7KA 3WV0A 1CR9H 5T3XE 3L45A 3UO1H 2DMCA 3O6FA 4DP5X 4XWOD 3BQUA 4ODHL 4XH2A 2H4EA 4AQZA 3P69A 3UCRA 3KYNA 4NAQA 2CGRH 3MFFA 4Z8FH 3IAQA 2KLRA 1LJMA 3EYUL 4Q6IB 5CBAB 4E9RA 3L7FB 4CVXA 3LQZA 1CDJA 3KYMB 4NM4L 3VFOA 1U92B 1MCSA 3QHZL 5DEGB 3BH8A 3WSQH 5C0IA 5I23A 3S34L 3S8WA 3F2LA 4NQSA 3T04D 2HB0A 1AGCB 3DMMC 2A0LD 4QHUA 5BZWA 4Z0BH 4X6EA 3GXUB 1GZQB 4KO5A 1NUNB 2Q86A 3IXAA 1G9MC 1S3KL 2CDGA 1ACXA 3I6GB 1G7HA 4U6HB 3RVUD 1E9OB 4LZKA 1QSZA 4TUOB 2MHAB 3L1OH 5A2CA 3H9SE 3EJZC 2IGTA 4B53A 4ORZC 4ONOA 4GLRH 3ASWA 4JRYA 2QSCL 5FOBB 1D7DA 1KGWA 4NOFA 4LP5A 1KCLA 3EW3B 5AOLA 4Q9RH 5LCVL 3SDCD 4F7PA 1HE8A 1QUNA 4CA4A 4CVWA 5IWLC 2QVTA 3AS3A 3HBQA 1HEZB 1RIUL 2UZXA 3WKQA 4YDLB 3I6KA 4ZUTB 4G6KL 2WVSA 5JHLA 3WXWH 4RISH 1JWUA 1JPSL 3RDTA 3ARXA 4OGZA 1CGTA 1XR8B 5EO1B 5KVFL 3VXMB 4DP4X 2EC9T 4XP1H 4AYGA 5M7QA 2OSXA 3DO7A 1RJZB 4NQEE 5I0DA 3VX0A 1B0GA 1K3ZA 4NKIL 4MQXC 1ZSDB 3H2QA 4TLTA 4LXFA 3RPKA 2BOCB 3H3PH 4H8UA 1MCKA 2E7MA 3ENEA 2IG2L 3DX7B 3AY4C 2B59B 3LPWA 4LHQB 5EU4A 3EYFA 5DD5L 2FQDA 1H8SA 3PQYB 2LU7A 2PXYD 3F01A 5HPMB 1NLBH 5I0VA 1ZDSA 1S7TB 3ETBJ 5LAXA 4HOMA 1GYWA 5CAYB 3OKNA 5JDSB 2YLKA 4FNTA 2NY2B 4JZOA 4HUNB 4NUJB 4ZBJA 3RWIB 5ABAA 1CXLA 1WAPA 4MJ5A 3UXFA 4C4KO 4HD5A 5DA4A 4YWGH 4ADIA 3HC2A 5F89A 3BKMH 3W0WA 4LLAA 4DETA 5DVKA 5DEZA 5DO8A 5HYIA 1LK2B 2YOCA 4N2KA 4GSRA 1A4JA 1UUNA 4PW4A 5I8KL 2CA3A 3EJQA 4L0PB 3N42F 4IJ3C 4TVPD 3CZKA 5AL0A 4F20A 2SEBA 1S7VA 3E8VA 4HOWA 1SVBA 3PXJA 4ONHA 4NO0A 5F7WC 3KYKH 3LXUX 5FYKL 3DURA 2JXMA 5DMIH 1FP5A 5KSBB 2DLHA 2Y24A 3CNKA 3IJHA 5BMFL 3P9MA 1BZ7B 2CJUL 4HKBA 4EVNA 1GS8A 3EDDA 4AGNA 1JGUH 1NFIA 2AFNA 2K6YA 1GVIA 4KZEL 4JFDE 1MUJB 4IRJA 3QO0B 5IBUG 3VH8A 3P9LB 4IKJA 1JPTH 2DRUA 4WU5A 1GS6X 1YEHL 3UG5A 4A7GF 5KVEE 1FZJB 3OKYA 3CK0L 2RGSA 4RMSA 5BRPA 2C3VA 4ZFOA 4GRLD 1Q4NX 3NCWA 5IT2L 2ZSVA 4ZFFB 1BJ1H 4R4FH 3ZZ1A 1A3LH 4XBPA 3HNTL 4R90L 3PDOA 3U9PH 4GIAA 2Q8AH 3ZYJA 3QDJD 3S5LB 2Y5EA 4JJ5B 5DJDA 5ICYA 2VLME 1DL7L 4BK8A 1OGAE 1THAA 2XCMC 3S9DB 5DUJA 5GHWL 5AZEH 4BKTC 3SDYH 3VXTB 1MCOH 3N9GL 1NGPL 3TV3H 3TH3T 2C9RA 3MLRH 3UYPB 4HC1A 1LE5A 4WI0A 3TN0C 3UTSB 1RURH 5JQ6H 3L3OB 4EBQL 4N8VA 4NXSA 3O41A 4LNVA 4UINH 5IQOA 5IESH 4Y8AA 1AD9B 2V2WA 3UJIL 3S2AA 4IKKA 3D05A 2GFBA 5GRXG 2HUEA 1QRNE 3X17A 3W56A 4XNYL 4DGIL 1DVXA 2WD0A 5DWUH 3W2DH 1RZKC 1A25A 5IFHH 2G3ZA 4AJYV 3KBPA 3L9RA 3UACA 1J8KA 3V6BR 2DMKA 3LB6C 4MZ3A 1N19A 4UANA 1MPAH 3RTLA 4BH8A 3GBNH 4PRPB 3IJYB 5JR1H 1E3FA 5I75C 5JOPE 3FB6A 2IPKA 3WKMH 1LMIA 1H6EA 4OD3L 4ZW5A 1KJVB 4I3RL 2FX8L 1NC2D 2X10A 3I02A 3RX8A 1N4XL 2GUOA 4H26B 4WO4A 4XX1G 4AYSA 2VR8A 3H3KA 5DYOA 5L2JA 2QADD 3BXNA 4YR6B 4A7TA 1JHTB 3ME0B 4OFDA 4X7EC 4TUKH 4JKMA 2GI0A 3CXDL 2JTDA 4JKPL 4PIRF 1ERNA 1ZVNA 4APQC 4NPJA 1GPOH 3B5HA 1ZXQA 1A4CA 4HJGA 3QYMA 3F7YB 1T1WA 1QVOA 2BX5A 1GGCL 2F53D 2DQGL 4PPTA 4XNMB 2K0RA 5TE4H 3ZT7A 4A1RA 4D0BB 1JUFA 2CR3A 2ZOKA 1UZ8A 3QI9A 4E41A 2IDSA 1BAFL 1QNZH 3CBKB 4G6JH 5HHOA 3UZQA 5A2KH 1TYJA 1FAIH 2OTWA 2XIIA 4LIQL 1YJDL 1SDDB 1A3ZA 5C0DA 4UNUA 3IFNH 3VGAC 1E90A 1J18A 5ANHA 5JO5B 1CQYA 3ESOA 4JRXB 1G1KA 3KS0H 4MAYC 4Y5YB 4ZG1A 3E1ZA 3ABGA 4Y1TA 4U1GC 2UX6A 5B3JE 3GUFA 4POZD 3EDEA 2X6BA 1AVAA 2V8LA 3WEOA 1BQSA 4Z78A 4YHOL 1T0NA 5KYXB 4XP9H 1VFBA 1OK8A 2YSTA 3FCGA 5KVGL 2FBRA 5SV4A 1H0DA 2VISB 5E94B 1M2VA 1A0QH 2BIQA 2M83A 4S1SH 1KELL 3QSKB 2XWBB 4TF4A 2BDNL 3OJ2C 5DT1H 1J9RA 2R56L 1F41A 4HAGA 4HMEA 4Y1AE 5I1CH 1NICA 4PAZA 5LDUA 1FA4A 5C0FA 2CPCA 2PW2A 5D2NA 4FXGA 5SX4I 5PAZA 5CZXD 1I7RA 3UPAA 3HZ3A 1T0PB 1OARH 3V5HB 4Q14A 4DP6X 3I9AA 2WKLA 3MNDA 3D0VB 1XGTB 4KY2A 5JPMB 1EIBA 1ZLSH 3FO1B 3HNVL 3ETBF 4TVUA 3ZHNA 1T04A 1OL0A 1ZHLA 5I1GL 4N85A 5F8QC 4PJDB 3EBHA 3N0AA 5EDSA 2WWMD 3HVDA 5CU5A 2X09A 1DSFH 2P43B 2P24B 3KG5A 5ICXA 1WFTA 2JKXA 2QR0B 4F3FB 2BFVH 3DROB 1ECZA 1D9KD 4HUXB 4P3CL 1Y6KR 1PY9A 4Z0XA 1ID5I 4NAMA 1E9QB 1OPOA 5EO0B 4GO8A 4P49A 3ARTA 3BKJL 5TF0A 2NYYC 3GYRA 3CVHH 4KJYB 4W1TA 4NGHL 3OLIA 1CLZL 2UVFA 3ARFA 3KLQA 4UV4L 3M7FB 3GBML 5E8DH 1O6SA 3ARED 1PX4A 3FH5A 3WFZA 3LEYL 1CUOA 3DYMA 3ORJA 5EMYA 3ALXA 2D3NA 4FC3E 5FX3A 3SDXB 1I1AB 1W0WB 3AVEA 3BQUB 3Q43A 1MLBB 4APXA 2V3DA 4KAQL 2WSPA 4JFEA 3I75A 4NZDA 4DUXA 4U1LA 1BEYH 3IDXH 4HUCA 4O02L 4FFZH 3LEVL 5HD8D 3KM2A 4FQXC 4KKPA 5SWSB 1JV5A 4OF6A 1SHMA 2KHAA 4W9ZA 1OT2A 3NJKA 2XKNA 3ILPB 3FQUB 3GJFH 2DWEB 4HDIA 2FEJA 5ILTL 3LN4A 4URKA 4AQEA 2O5NA 2A7BA 3LYRA 1A47A 3WEBA 4JFZH 5D7LE 5B1JA 1I8IB 3TJEL 1URZA 4NHUB 4GW5A 1PLCA 4L8BB 3G6JF 3QEQA 1ESOA 1H3GA 4D7BA 5JLZB 2IVFC 3EGDA 1R46A 2EH7L 1MVUA 4QNPF 2A73A 4IDJL 4KK9C 2A9NL 2FO1A 1JGEB 1YZZA 4L4VA 4AMWA 3MRPA 2MPAH 5C0RL 2V17L 4YSAA 2JKWA 2VERN 3MLWH 5IHLB 3ZU8A 3UBXA 4GW1A 4QI3A 2ZCHL 2YS4A 4HPOH 3QCVH 2F08A 3MUJA 3S96A 4MFHA 2G60H 3C87A 1F3DJ 3B7YA 2IH1A 1WUZA 4L29B 1XF4B 4MX7A 3CN3A 4HU8A 4JRYB 4ZMWA 1IC0A 4W4OA 3RWGB 5IW1A 2PCFA 4KHXL 2AQ2A 2L7UA 3QNZA 4HLZG 3UTTA 4HJJH 4NUQA 3GSQA 4QHLA 5ABZA 1AHMA 4GRWE 2OAAA 1MWAL 2DTML 4OJEH 5I9QB 2EYSA 1T80A 3KGTA 4LKXA 1UH4A 3N43B 3TO4D 3ZTNH 4ANXA 4MJHA 1TXKA 5KVFE 3SDDD 5J89A 2PW1B 2XI9A 1PLGH 3BJLA 4YDKH 3DX0A 4W9JC 3SGKC 3CVHB 2YGPA 1E28A 3P02A 5DJ2B 1GZPA 5DJXA 5H2BA 4G6FD 4M3KB 3FT3A 1B3IA 2XV3A 3D52A 1Z7JA 3D1MC 1V05A 3D0AA 5L6YL 1Z0NA 4K23L 3Q2VA 4JY6A 1N0XL 2Q8BL 2IAND 4KKAC 3WUWA 4AENA 4B9CA 3BH9A 3AQXA 2CIKA 1HWWA 3UJTH 2OLDA 5EU7C 2XG4B 4S10A 1DQMH 5AVXB 5JHDD 3KLDA 4KO6A 3CFCH 3O2WL 1T3FA 5FGRA 1B88A 3GJFB 3MBED 4XMLL 2WXKA 1W91A 1T4KB 2CO7A 3N04A 4WCYL 2XQYG 4R6UA 4JFXA 4HPHA 4QD2E 3H4HA 1CGSL 1C8QA 1BFSA 3NG5A 3NIDE 4IRSD 3RNQB 1X5AA 3RWJA 4Q9QL 3CLEL 2GJ6D 3W0WB 1RVFL 2A6KA 1YEFH 5E08H 4FS0A 3QJHA 7TAAA 4Q56A 1DO6A 3H9SA 3OZLA 3FT2A 4AXWA 4S11A 4YUEL 4BA0A 2E8YA 1UZ6F 3CCHB 3L3JA 3UAAA 2O61A 1ASOA 3QR1A 2W65A 3FT0A 5FYKE 3HHSA 5F9JB 3BAYA 1T21A 3M6DA 3QXUA 2V5RA 1FH2A 3AU1B 3ASOB 4I5BB 2Z1PA 3U1SH 4ZFQA 2VZTA 1OZUA 2HVKB 4KHTL 4XBEL 1KWKA 3TEWA 3V7MA 1KPUB 3NAAH 4HJ0C 1UWEL 3MOAL 5FGCB 2QQQA 4XCNB 5E9AA 1XAKA 5LKNA 4WU5B 4A7GA 3K71A 1VRSA 1PMYA 1ET8A 3CFKB 2FJHB 3QEUB 5LQBL 2BFGA 1X5FA 3P11H 1BGXH 2AMGA 2AAVA 2X4NB 3QFGA 5ESAB 4JZJB 5C0GB 4J2XA 2NY7H 3KM1A 1DJWA 2A4ZA 4FCAA 1OP5H 2P5ED 4QXUH 3T3PE 1AOZA 3FFDB 4J8RB 2YQGA 3NDYE 4LFHG 1F0LA 1AFVH 1LK3H 1QSFB 3JYBA 1AZRA 1QRKA 3FQYA 4UILL 4JQVC 5DJDB 5TE6H 4NZTL 4FTVB 4PGCB 3GSUA 1W8NA 2OJEB 4LEEA 3HRZC 1WISA 3FONA 1UKTA 4BZ1A 1LNUB 1WLHA 1IQDA 3MV8E 4NM8H 4MYPA 1A7NH 1MG2C 4EQ3A 1A7RL 3RY5A 5B39A 4ZMNA 2VN5A 3K0YA 4KKBC 1LE5B 4NO3B 4UI2A 1MNNA 2J71A 3NEOA 4K94H 5CEZL 3RZCC 1U8QA 4PSRA 1AR2A 5GGVL 2DF3A 4Y4KA 5I8EA 4QWWD 4LCCA 2QQKH 2VN4A 5E0FA 1I8KA 5GRJH 1UFUA 2X4OB 3EO9L 3MRLB 3T65B 3WJMB 3ZE1B 4ZOCA 1WBYA 4IGBC 1XB8A 3ABMB 2WXRA 2AK4D 3KLLA 5HDBF 2ICEA 4WSJA 1ZE3H 3GBDA 3NJHA 5J9PA 4LAQL 4KTGA 1HHIA 3RX5A 1EHXA 1E4XH 3CVBA 4LLYA 5HHME 3TPUB 1C5DB 3KVDD 4OLUH 2ZCLL 3FU7B 3Q1SL 5TE7L 1FWXA 3D7PA 4U1MB 3CHQA 3WFBL 3VI3B 4AQOA 5B4MC 5LNDA 4PB9L 2J88H 5DJ6A 4JO1H 1H8LA 1JYNA 2X6MA 5DC0A 3B9KC 4F7TB 4JZNA 5FA3A 4FQLH 1KYOK 1TDQA 2JNZA 3A0OA 4OQ1A 5IF0B 4JHUA 3ZPDA 3MNZB 5T1LD 1E6JL 4DERA 4ADJA 3QG7H 1T7ZA 3P54A 5C0BE 2JB5L 4QHKI 2DJSA 5E9DB 1TSRA 1PEZA 4EI6A 4HALA 4N86A 2V37A 4UM9A 3DK2A 3BEVB 1JHLL 1BYPA 3QJUB 1MRFL 3K3QA 4X0KB 5FO7B 4ZX6A 1FZMA 2Y69B 1TPXC 3C9NA 2OTUA 2LLGA 3KDMB 5DK3A 1UM6L 1FFOB 3QWOA 1USQA 4P2QA 3GB7B 1GGIL 1JF6A 1PZ3A 2QBWA 1MHPH 4HS3B 4YSUA 5EOQH 1WITA 2HTKC 4ZXBC 3X11A 2OTWB 3NCBB 4NCC2 3HTLX 5D7IB 4TSAH 4LASL 4MZRA 4FKHA 3D85B 4PBVC 2R2BA 3C60D 1E2WA 2H2SD 2FEEI 3MCKA 4P3DB 2KLTA 2OX5B 2VQ4A 5D7HA 1JZFA 1FL5B 2EZ0D 4PY8I 2NY6D 5F7HA 5KVGE 3EKCA 2HRPH 4N8PA 1NH6A 5C9JA 4RGND 3JT2A 1GOGA 2OSYA 3JWNE 2BNRD 3QULB 4Z18A 4EI0A 4S0SD 4M6ML 4PWKA 4AOFA 2VLRE 1DN0A 2I85A 2ENYA 1QRNA 2CIIA 4PWIA 1KN2H 2H26A 4HGMA 5E1QA 3WS6A 1JWSA 2F5AL 2FL5A 4JRLA 3ISWA 1Z3GL 3ZDYB 4EN2A 3IMWA 3S8GB 1MJJA 4I3GA 1AO7D 3MNWB 4XP4H 4OFPA 1O7SA 3HPJB 3RP1A 1KTLA 1I4FA 3AQDA 1IMHC 4MJID 4U4IA 1FVCB 2EDKA 4V33A 1V7ML 2OL3H 4DPBX 1OTTC 4ODWB 3ATDA 4PJIB 4HW6A 5C07D 7PAZA 1P1VA 1NEUA 3B4NA 4GQZA 2COQA 2MSPA 1QLFA 1DBJH 2HPOA 1FYTE 4F27A 4P23A 2GJPA 4FG6C 4JO5A 4N2DA 1CXKA 1KTRL 3TA3B 4F9LC 4WHTA 1HSAB 2WM0A 5FM5M 3WTWA 4EN3B 4FFVC 2FT6A 4HCRL 4PM1A 4ETQB 5MENE 1KF9B 3KL3A 1N70A 2HYMA 1WWAX 4E5XG 3L3HB 1VKXB 1XO8A 3O6FD 2R1WA 2LVEA 5EUKB 3HE7B 2WGXA 3LRHA 2YAMA 1CN4A 2J1XA 1KG0A 2PCYA 4R7NA 4ONFL 5FW6A 3BP5A 3PABB 5K5YA 4N90E 1T2QH 3NCJL 5CILL 2QPEB 4X0NA 1U8MA 4RDQF 3SE6A 1YPZA 2NY1B 4CJ0A 3APNA 3TOPA 2NX5B 1LP9E 2VSKB 3HI6L 4U1LB 1CGWA 4APQD 2ZJSL 1FFQA 2UY6B 4LQFH 5AAMA 4DKTA 3AGVA 2H6OA 2J6EL 2CUMA 2OMYA 2WTRA 1UATA 1HQ4A 1FJ1A 2A9MH 3VFVB 4B97A 5DZPA 4B95C 1ZDQA 1CD0A 3IMSA 3O6LL 4OCWL 4LRIA 5GS1B 1G1CA 2XU9A 1VADA 4YDIH 1VB9A 4PJAF 1HINL 4LESA 4Z7WB 1M9SA 2MNUA 4GRMA 4Y2LA 2OMVB 3EGDB 5FFOA 3PNWB 2HRGA 2BM3A 1QZ1A 2R2EB 2WZAA 2EYRB 4MJ6A 2DBLH 2D2OA 1DUYA 2WTPA 4K8RL 4XXDA 1E4HA 4H7VA 1I75A 2VIRB 1AQDA 3F04A 2EH8H 4RFNC 2ICWB 4ZT1A 3HG3A 5AVTB 5JW4N 1EAJA 4UT6L 1IGYA 4Q9BA 1K6QL 3KGRA 3KPTA 2F9BT 3DX9A 2YUWA 2R0KH 1ZHBA 4JREC 4GIOA 1NCDL 4PS8A 4RESB 1TQSA 3RDTD 1QUPA 2IIJA 2YOAA 1C5BH 1YEJL 5D1QB 3UAJC 1G43A 4NQVB 4KXAA 4U3SB 2OMTA 1KTJA 3HS8A 5TTRA 3UG4A 4LBEB 1HNYA 1B4LA 3BVWA 1C08A 3DX8B 2HMIC 1RK1A 1UYWL 2B7DT 5K9QG 1ZRUA 4KDTC 4X4ZA 4B50A 4ZW8A 3SY0B 3VXRE 1GZPB 4MCYA 3GRWL 1LWRA 1N59B 2CRIA 3VYNA 1A6ZB 1LEKA 4XT1C 4L4JA 4WENB 4W9DC 3V7AE 1PZUB 2GCYA 4OJCA 5J5EA 4W70A 2P1YA 2P7TA 1DQJB 3ZL1A 4ERSL 1RMFL 5E00A 1OP3H 1K4DA 1IEBB 3KPRE 5I5IA 4BHUI 4NZUL 5BRZB 4HFWA 3ULVF 1QABA 4HETA 2FJGB 2X4TB 3C6SB 4I48A 4OIIL 5CP3H 1S7RA 4YHZL 5J8OA 4B60A 5BS0B 1Q0EA 4YH6A 4OZ4B 3DPDA 1OE1A 2WO4A 1H15B 5ALBH 1GL4B 2YC1A 4IEFA 4LVOC 2X12A 3UMNA 1M53A 2AQPA 3QARA 5GZNA 5GIRA 3L5XH 4AKQA 2F54B 4LOFA 2VTFA 4D0DA 1CDGA 4D8PB 2CK0H 4HHAB 1UD6A 1KYFA 3NABL 4AXWB 4FQXD 1F4WL 2VR3A 4IBLT 4YVNA 1UM4H 1FBIL 2GK0B 3L3KA 4IRJD 3QIWB 2KERA 4RH4A 4M6OH 5F70A 3WLBA 4D9RE 2VXQA 2Y5QA 2M2DA 2HKAA 2QQLH 2ARWA 3R8QA 2VB5A 3AW5A 2ZUWA 1FNEB 2P8MB 3Q5OA 4OCYH 3F65A 2NNRA 4K07A 3PWPB 1A7QL 4Y2DB 3F58H 2BRRH 1AJ7H 4KK9D 4WI4A 3T2LA 4XCYB 2OK0L 2C8NA 1Y1DA 3TNNA 2X53A 2AEPL 3LPOA 1KGCE 1N26A 1X5MA 3OHXA 4KVCL 1EAQA 1TNNA 4FHKA 4X80L 2BVQB 1OF2B 4ELMF 4OSUH 2D7PA 4U6YB 3C8KB 2DMHA 4XAKD 5H4YA 1MELA 2Y5TA 3RE0A 3VG9C 4WHDA 3X14A 2VW4A 3JWOH 4PRNB 5I1DA 4LK4A 4XVJL 1BQUA 3EO1A 4B9YA 2PLTA 3VA2C 5ETUA 2AJ3A 2DQHL 1FN4A 3H8NA 4Z5RB 2JKLA 3DK0A 4WJ5A 3HUJF 3SE9H 2FIKB 4S1QH 3ELAT 1E8ZA 1RY7B 3M07A 1R4XA 1DO5A 1IQDB 2E0PA 4N6RA 1PS3A 1FL3A 2ZX6A 5E5MB 5B39B 2XWDA 3GBLA 4YFDB 1KIQA 2OKMA 4A6YH 1W80A 5DJZB 5CEZE 3ZTJH 4FQIL 1MWOA 1SXZA 3CN0A 4HK0A 1S9WB 4PJ8A 4WFGD 3V0WH 4UZSA 1OAQH 5GGQH 2F58H 4IIQC 5FGSA 2YEQA 3HZYA 2OXGA 2TSAA 3BYYA 1ZK9A 2P3YA 4K2UL 2ZCKH 4LARL 4K3JH 5LGJB 4ACPA 4P04A 5JZ7D 1GSKA 1QBBA 3TC9A 5HVFB 2D9QB 2X2JA 3TEYA 5D2LE 25C8H 1WIUA 2C4XA 3WJJC 3DX3A 3NSFA 2WV3A 2ZKHH 2BNUA 2YXMA 4HYTB 1EEYA 1U8PA 5HYJD 2ZKWA 1HHIB 1R3KB 2EDEA 3F12B 1AQMA 3ZE0B 4WO4D 2AHIA 4S2SB 3QIBC 2VDLH 4EIUA 2ZWNA 1F4HA 1NCHA 43C9A 1KBWA 2JI1A 1Z5HA 4J3UA 3D39E 4N2NA 1FIGH 4YHML 5MI0B 4EE2A 3JWDL 4G6ML 4NBZB 3EYSL 3QHTC 1V54B 4HK3N 4YNYB 3M46A 2H0FA 4FQ2H 1E6OL 2H6UA 1VFMA 3QI9D 4BE5A 1NDTA 4E41D 4MB5A 4LHUG 1HU8A 1XB3A 1JNJA 3OBAA 2ZWZA 5HHOD 2X0VA 1I85A 3MV7E 4GUQA 5I1LB 1P6AB 2WB1A 4M02A 3Q2NA 1JFQH 1IBBA 2FGWH 3LKNA 1ONQA 2VSCA 4KBPA 1QOKA 4FXKC 4I0PB 5IQ7L 1AACA 4NDMB 5DRWA 5HHNA 3L4TA 5KSUB 2HLEB 2ZWYA 2BSDA 1I9IL 4NO2A 4EDWH 4AQ1A 2WP3O 5GSRB 2OZ4A 4JEGB 3IETB 3CSBA 3BEWB 4B5EA 4BZ2L 3KPPA 3DJRA 3N06B 1BW8A 3O2DA 4W68A 1M1XA 1TTBA 2BJMH 3HMXA 5E2UL 1LVEA 1EV2E 1E50A 3L7EB 1E5ZA 5JPNC 4FDWA 4WEBH 5F3BB 3V79C 1RZJL 2FEEL 2FX7H 4A6YB 1JZHA 3D8MA 3IJEA 4HMDA 4ZQKA 4NNXB 3BAKA 4MQ7B 3QUYA 4CGTA 3ARDC 4FG0A 1E5BA 4LU5L 5KS9F 5GGTA 4C56B 3QPKA 4NC1E 1NL0H 2XKUA 1D5ZA 1A9BA 2UYLB 4PGBA 1JXDA 2AXHA 2CBPA 3K4DA 2FATL 2BZ7A 3MBXL 4PJCF 4YDZA 3GNMH 4BQBA 5ID0A 2CDEA 3CMOL 2H1PH 3NH7H 3BRDA 1H6FA 1KV3A 2XPGA 2Z8SA 4TLUA 1ZANH 1ADWA 5T1MB 4EEEA 4JDEA 4XXWC 1P5UA 4LCIL 1CLYH 1AZCA 5KJRH 3DO4A 3LQMA 4I3SL 3FT1A 4QHMA 1NIFA 3QA3A 4OIAA 4XO9A 2EE6A 2VDLB 1XH3A 3RL2B 4RMUA 5IBLD 5H37G 3MRNA 2BMKA 3S35X 3PAVA 2ZUTA 2HFEA 2XWJA 1H5BA 4IGBD 2HH0L 5C0BA 3ZUNC 3ARFD 4IU2B 4MD0A 3THMH 5I1KH 2G0LA 4Z3GA 1ILSA 3WE6B 5T5FL 4DPAX 1U8CA 3ZX1A 1U8JB 3T8XB 2EXSA 5CHNB 2ENPA 4YBHA 1YC8A 1HH6A 3CSYB 2E9JA 4A39A 2Q7AA 2HLAA 4JFED 1CFBA 4B3VA 3U7WH 2FK9A 4R7NB 2F1AA 4KTDH 5FO8A 2DQFB 5IQ9A 2BC4B 4L1HA 1IFRA 1NBVH 2VZ3A 3AUWB 1NCOA 3W11C 1K72A 4B41A 3SIKA 2GTWB 4DZ8A 2LE9A 5D8JH 2EUZA 4N3TA 3QRBA 3GINA 3LKQA 4HUMB 1JK9A 1XBRA 3EOAB 1UVQA 2W0LA 2WYHA 4I9XA 3IWUA 2JSFA 1H6TA 1ORQA 4M6NL 3K6DA 4R96B 3MUY1 2WTRB 4EQ2A 5DF0A 4K71B 3GZQA 5EBMA 1OD9A 4LEOA 1NDMA 4O4YL 5F7BA 1YEIH 3IYLW 1BZDA 4PJHB 5FYJU 4L4VD 2PYEE 5CCGE 3EYVA 3D69A 2LGNA 2HTKD 1RUKL 3G6JB 5HHPA 2YEZB 5BJTB 3MZTA 1Q0XL 3VFPA 5CMAA 5DFAA 2Y3NA 3IU3B 4P4KB 5E7BA 5F71A 5C0JA 4MJ6B 4F33A 4JANA 2IWGA 2W38A 2O6EA 5G4NA 4Z77B 1J1OH 2G75A 1MHCB 1MI5D 3FN0H 4NQXB 4WTZA 5EZIH 3QO1A 5K93A 3UTTD 2C7UA 1YN7A 4UU9B 4X6FB 4BEIA 1QSEA 4LGSB 3LXBA 3MRKA 3B2VL 4PJ7F 3L16A 3INOA 1DDHB 3ESNA 4GUPB 5DUPL 3GSRA 3VFSB 3A4FA 1MFUA 4UBDC 5I8CA 4KNTA 1G9EA 3NVQA 1NMAH 3BWZA 1QPXA 1S78D 3NN8B 4A66A 2OMTB 1TZGL 1WFJA 4LBAA 2XETA 4OFQA 5CR1A 4E9LA 1RERA 2ITDA 2F5BH 3MUZ1 4LCWA 3VMOA 1FSKB 3WL9A 4LLWB 4N8CL 3QT2A 3BWAA 4AW7A 2CO1A 4LNRB 4DP7X 4F15C 1I8UA 3ET9F 2EDLA 3NJJA 1UJ3A 4ZUVA 5GQBA 2CKNA 2BOLA 4TSBL 2VUKA 1LILA 1XGPA 3EJYC 4GAFB 4NLAA 2VM3A 1ADQL 5DD3H 3PP4H 2Y9RT 5IK3A 5FO9A 2QKIB 3RLSA 3V52H 2I07A 1FO0A 3AXHA 4MXQC 2ZYHA 3CZLA 4NERA 1G0DA 5D6CB 5BVJB 4JDTL 3CZJA 2YD2A 4W4NA 1A6TB 4E2OA 4I48B 1V3MA 4R4NC 4GOSA 2F53B 3MTRA 1NIAA 5DHVA 5JORA 1J05A 3HC4L 2P49B 2NZ1A 2XHNA 1KWGA 3PU7A 3H9SD 1N5YH 3UAFA 3VFWA 3SKJL 2QL1A 2CG9X 5DQDH 2YD1A 5D93C 4PGDB 3VXSA 4HWZB 3ARGB 3E6FA 2WIIA 3FYEB 3ZMNA 2FB4L 4AYID 1JS4A 4WWKB 3H6JA 4MMZC 3FU8A 2QSQA 2JK5A 2AXJA 3MV9A 4P2OC 4WJG3 2GVYA 1YQVH 4A68A 2J4WH 1O9VA 5FYLL 1EA9C 4Y4HC 3QUXC 4AUJA 4LPYA 1XH2A 1JYVA 3KYOA 2G5BA 4G9DB 2Y06H 5DMYA 1YECH 4WUUE 4PD4J 1KGUA 3SBWA 4KUCF 4G3YH 1J1PL 3DA0A 3GTNA 3VNYA 3ZL4H 1E8WA 1PZ2A 3T8VA 2WLIB 1NSNL 3L08A 5I18H 3DXAB 4TUJB 5GRVK 5CSGA 5KN5A 4LVNB 4UOW0 2B9AA 2NUPA 3DUHA 1RH8A 5IVOA 2O5ZL 1DLHB 3T4YB 2NY3C 4KV5E 3GD1C 5AVWB 2ZSWB 4O5LH 5K1VA 4PY8J 1XCQA 2DIBA 1RHFA 3KPQA 4IBUA 2AXGA 4G8GA 3VXRA 5AAWA 2OFQA 1BIIB 2LQRA 4FQ1H 5BV7L 2Y1AA 2G3NA 3NQIA 3D2UB 1MFCH 2QJDA 3KWUA 2ZXWB 3CU1A 3VGFA 3CPLA 5GZOA 3UAJD 4OCRH 3II1A 4PFEA 3QDME 1YMME 4XPGL 3KPRA 4M1CC 1GKOA 4JMXA 2WXJA 3FQRA 4G1EB 4P2AA 1F4XH 1S46A 5FW8A 2PCPA 5F6IC 4P3WA 2IOOA 1RUAH 4P46B 3VQ1C 3NFPB 5BZXA 5DJ8B 4KGLA 4M48H 4HWNA 4IW4C 4AEHH 5GJTH 2HFFA 1YNLH 4UUJA 1UQSA 5D7SL 5EZJB 3N85H 2Y36L 3G08B 3LS5H 4OGAC 3A47A 2Y4SA 3WELA 3KJ6H 1EZLA 3MJ8A 2YIHA 1HL5A 3L2LA 4M6AA 5DS8A 2XC8A 3G9VA 1NCWL 1YJDC 3CIQA 1KXTA 3N1MC 1D5MA 3OHMB 1AGEA 3NJMA 2BNUB 4RIRB 1GRWA 2TRHA 3PGDA 4HKZB 1E9PB 4JQXC 2EKSA 2D31A 2PR4L 1KT2A 4HV8A 1J0IA 4OGQC 3LHPL 5F6HI 5HTSA 1XH0A 1FUNA 4G8IB 3G3LA 4M61B 4UM9D 1ZT7B 1CQKA 2YUZA 3O3UN 3S3SA 1ZWIB 5E5RB 3CFJA 5KSAA 1K8IB 3HS0A 3JWNC 4ZTEA 2RAMA 4I77L 5D70H 4MMXB 3N44F 4M3JA 5KVMC 1BXVA 4P2QD 4WU7A 4WK0B 4Z9KB 2UZYB 3MJ7A 4L9LA 4IOFC 3RNKB 5I15L 3HE6A 1ZT1A 3FO2A 4NYLA 3H3BC 1MW2A 4NXKA 3QUKB 1W6WA 2ZWSA 3QVAA 1NLDL 1NANI 1X7SA 5T8IA 2CAKA 3J7HA 1ND0B 2K8QA 5CM1A 4F80A 3HI1A 4P06A 2HLFC 4O2EB 3OR7B 4AGOA 2P42B 3T0EA 5AVUB 1OAKL 4YHKH 3O9WA 2CJSA 5CINH 3LQAL 4EIBA 2Q0ZX 2D4DA 1G9MH 4Y9FA 3H2PA 5AW5B 1N8OE 3IM1A 4QTHA 1MAJA 4M7JL 4ODTL 2UXVA 3WIIH 2Q3AA 2IO5A 1EJOH 1I1YB 1NKGA 5EZLA 3U0TA 1QBMH 1I3RA 1QRND 2CKBL 2XWEA 2VQTA 3EBGA 3NA4A 3SGDI 1OAYH 2D2CC 2C1OB 4PCTA 2YO3A 4GXVL 4DHLA 5KS9A 3VH8G 2XBDA 3QHFH 4XOCA 3AG1B 5AVSB 1KTKE 1A9BB 1Z9LA 2IDUA 3EADA 2J1YA 5D2LA 4FNRA 5JOPD 3T6ZA 1DBMH 1KLFA 1X3DA 4PJCA 4J8QA 4M7ZB 1BSIA 4RWHA 1IKNA 3KDPB 2E8ZA 3T8MA 3EJUA 5C6PB 4Z76B 1R3HA 4MA7H 2XACC 4TKWA 1U8NB 5MHSE 3CFEB 4GS7B 1XV8A 2XXMB 1HILA 5IOPB 3TFKC 3D3VA 4G8EB 1VZHA 32C2A 4MTMA 3EO0A 2H32H 3P0YL 4BBWA 4FD0A 4YL9A 1E5CA 1MCWW 3RG1C 1T0MB 2OP4L 5I74C 3TVMC 4NRZA 2VDRH 4GBXC 1KEGH 4NRXB 3REWA 2KBGA 3C5ZC 4OLWH 1I1FA 4GFXA 4X8JA 1PCXA 1A3QA 3I9GH 3ZQ9A 5JXAH 3BVXA 4GG6A 1KBGH 3X1NA 4R7DB 2GBUA 1S9YB 4N8VG 3W57A 3D9AL 4DN3H 1WICA 1ACZA 2GTQA 4LPTA 3O6KL 3PXHA 1BMGA 2JI3A 4MA8H 4AI7A 4OJDH 3QORC 4XVUD 5IEHB 1A4BA 1V55B 5FO2A 4JM4L 1EWHA 3FU5A 2PP8A 4OQTH 1OB1A 4PCYA 3DMMB 1JI2A 4HT1L 4M8UA 1UB5B 3MA7A 1CDHA 2PTTA 1VDGA 1JK9B 3BGAA 3GSNH 4XMZA 2DQIH 2YA0A 3MRIA 1JL8A 1PKQA 2XZZA 4RMRA 1UXMA 3MXVL 4Y1AD 2H47C 1MCIA 1Z32X 2WXLA 5CGYD 1S4IA 1U8LB 3DRTA 1HC1A 3CQPA 4UOJA 4LP4A 4BQ6A 4PJAB 3LKOA 5FK9A 2ZKMX 2FBOJ 5EIQA 3GPEA 3MRRB 1R24B 2ZNWA 4LP8A 1CLOL 3SKOA 3L5IA 4KQ3H 15C8L 2AEOA 5CMAB 1YRKA 1NC4A 4DK6A 4L8DB 2X3AA 2WQUA 5KG9A 2I24N 1ZT4A 4WDIA 1U3HA 2R39A 1B4JL 1PYWB 4ZYKB 3WD5L 3Q3GB 3L3IB 1AXSB 1IIIA 1MRCH 2YBRA 1TQWA 5I30L 3EH3B 4NP4L 1IZJA 4HAKA 3T09A 4ELKB 2Z91B 4AK1A 5J12C 2TSBA 2NXYC 3O8XC 3TCLA 3LS4L 2NY5L 3BW9A 3REVB 4RQQA 1E4JA 3MODL 3V6OA 3GUTA 3GK8H 1SJVA 4DQAA 4AIZA 2VDRB 5D72L 3HOGA 2BCMA 4NS0A 1NDGB 3FULA 4IIZA 5T5NG 2B0SL 3DGGA 4N9GB 4KFMA 2E7DA 3IPEA 3TBWA 4IBVA 3UJJL 1WHPA 1EPFA 5DZNA 3FTWA 4U6XA 5BCAA 5D7JC 5ADOH 1SLUA 4L3EB 1CXEA 3MR9B 3EYQD 3QFDB 3OGCB 5FM4A 5HJ3A 4OI7A 3WS3A 1LD9A 5DR5H 4U0QB 1WIPA 4N0UB 4ZSOB 1YEEL 3OXSA 3ZDXF 4YL4A 3ES6B 4HWBL 2YPVL 2OYKA 1Z3RA 1WE5A 3U9WA 2V5MA 3V0IA 1XGPB 1ZPLA 2WKOA 3LZOA 4DAGH 4K9EH 1EO5A 3B9DA 1WZ1L 1DFBL 2CNYA 2EVHA 2WYTA 4JB9H 1JOIA 2VW6A 3DIDA 4MA3B 4RMQA 5T1LB 5D7LD 3RVWD 4HOZA 4KZCA 1RZKH 1MEXH 4LSUL 5F3FA 3GSNB 3LIUA 1RP8A 4BFFA 3PHSA 3MPCA 4FYTA 4PD4K 2VDQH 1UURA 3PIQB 4IJ3B 4XP6L 4F57L 1ZEAH 3IN2A 2GKIA 4PBWD 4EXKA 4ZNCD 4IKLA 2P5WB 2QFPA 4UQ3A 1YVLA 1U95A 4JBSA 1U2HA 5A2AA 4QRPE 2QSTA 3VJ6B 2XX1A 2MQCA 5CN2A 5EOCJ 2R69L 4JDVB 5GRUL 4BFGA 5M95B 4WFFD 4F1ZA 1A2YB 1KJ3L 2VCOA 1Q0YH 2W07B 2I32A 3FPYA 2DI7A 2J55A 3G5YA 4TRPH 1BQRA 2KMWA 4AQ8A 1HQRB 2NLJB 5HI5C 4WEUD 3QQ9D 1O7VA 4MS8C 4G7VH 3UX9B 2J20A 4JN2B 3CC1A 1P1ZA 4QOKB 4JFPB 4EOWH 1EHLL 2VLJB 4BELD 4YQXH 4Z7OF 5HDQL 1FGVL 2CLZA 4LLUA 4XVTL 1QFUL 2CCWA 4Q0XH 3EFFB 2NUPB 4HKJB 3V95A 5HGHB 5JMRA 2HT2C 4BDVB 4JUTA 4JO3H 3O3BA 4HZLA 3B5GA 3SE4A 4ELMB 3TN0B 3AAZA 2X38A 1GZHC 3S88L 2EYTA 2NPLX 4PJGA 4MKMA 3HRPA 3O11B 4K9JA 3GLEA 5L2KA 3ECUA 1BD2E 4EXPX 1HHGB 4KU1A 1PGRB 1RIVH 4IMKA 1CFNB 4FYRA 2NXZC 3ULAB 3HUJB 2PETA 4PJ8D 4UBDD 2DWDB 1RZGA 1TTAA 3UBXG 1D5XB 3ARQA 1A9EB 3FYIB 4GW4B 3P4OB 4MKTA 3ZZSA 3OKKB 4BFEA 3VXNA 2RD0A 1O6VA 3HR5B 5TPWH 4HIEB 4OD1L 4L37A 3L4WA 2CCVA 3MLXH 4M62L 4XB8A 4NN6B 1F4YH 4ZDHA 2WBJC 1IGML 2DW5A 4E9WA 1FHNA 5I75B 1FFNA 4U1KB 1OGPA 4NAJA 4GXUN 1QWNA 5FKPA 5B3JF 1CTOA 3SKMA 3PAUA 1Z1WA 5SX5K 4L3CB 4DQOL 3GMOA 4GT0A 1I7TB 4R8WH 4AEFA 1G7LB 1MXDA 3BUDA 4MNGE 2IAMA 4QTFA 4L9DA 3PRZA 1FPTL 2MH4A 4NWUL 3GBEA 4JM2A 4Y4FC 1BAWA 4APQB 1P6FA 2CUHA 1W6LA 5DRNA 3DDGA 4A67A 5CZKA 4JAMA 2E4TA 4JPWL 2FD6L 2D03L 2H8PB 2K1MA 1A6AA 3GSVB 5I2IB 2ROXA 3ZN6A 1ETZB 3LZNA 4DTGH 2XJLA 3NTCH 4F7EA 4PJEB 4FQJL 2WXFA 4OLXH 5DCCA 3WUWG 4ZUSA 3C5JB 4ZFGL 2L7EA 2Z31A 5EZPA 2IDFA 4FTDA 5CUSL 4ZOEA 2BSCA 5GS2D 5DQ9B 5J11C 3VGAB 5F88B 4MAYB 2R4RH 3SQBB 2DH3A 1JPGA 4MHHG 4TLKA 4U1GB 4FADA 3FCBA 1V3JA 4ZAKA 2AJZA 2X70A 1RL1A 2HT3D 1WHOA 3QUXD 3MV8D 2F15A 4HZ1A 3ZL2A 3TA4D 1YA5A 4UOW1 3HI1B 3LIZA 4OCSL 3QBTB 5IV2A 4XNUH 2EDHA 3DTUB 4PVBA 3GHEH 1Q1JH 3QUZC 2IF7A 4KKCC 2BNQB 3QUYD 1MHHA 3QS3A 5C0CE 4JKKA 5CJQL 4QTHB 4Z7IA 3TEXA 3ZKNC 1QFWH 3U0TB 3KBHE 5CCKH 1UCTA 3BHBA 1SRDA 4NKQB 2IQAA 2OTPA 3SGEH 1IFHH 3F7VA 3B1TA 2XV2A 5FKAB 1FNFA 4HWUA 3GO1H 5D4JA 4GAGH 5BVPH 2XX0A 3MRJA 5HHMD 2WNXA 1VGKB 4NI6A 5HYQB 2B20A 3OF6A 4X9FA 2P9RA 5KAQF 2EIZB 2B1AH 2CH8A 5FIEA 2AEWA 3VD4A 5L0QC 5GGRB 1IE5A 2XWTA 1C12A 5AG8A 4R4BA 2JCCE 4KVNL 2UWEE 1R5VA 3MJGX 5EPMB 2C9PA 2G4EA 1HHHA 3NOIA 3SGJA 2D7OA 3OR6A 4N2GA 5I76A 5CXPA 5CGTA 5C0BD 3WU1A 2AXFB 2GBVA 4H1LH 4JX0A 4Q74A 4H88L 1BZ9B 1WC7A 3L4UA 4QHNA 3FSZA 3CZNA 1G4RA 2Y3AA 2Z4QB 4M5YL 3VFNA 1DEEB 1UGNA 2IV9A 4K7PX 1BQ5A 1ACCA 4J3OD 3PL6C 5PCYA 4AL8L 4OGAD 3M7OA 5B39G 1I1FB 4X8JB 2ZAGA 4HFUL 5C08B 3IDIB 1JGIA 3EHBD 2HG5A 4NI3A 3AG3B 3SKNA 4P2YA 2MWCA 5ACZA 1YY9D 4FQXB 5D5ME 2IXQB 1XXDC 3QIUA 4Q89A 2CGZA 4UTCA 4WKZB 3BAEH 5J1AA 5LLIC 2DTSA 2I5YL 4K8RC 4UQ2A 2X0UA 2NYKA 4GRWF 1L0QA 3FB7A 3B2UD 3P73B 1R3LB 4XWGH 3SZKC 1S9KC 3IMTA 5ALCL 1SY6A 5F1SA 1GH7A 3QE5A 3KXFB 4ZS6C 2XZCL 4KK5C 1IKFL 4QYAA 5CZVH 3O2VH 3SBQA 2VLRD 5C0AE 3MTXA 2QEJA 2B15A 1AGFA 2EDQA 35C8L 4XX1E 2A6IB 3G6DH 2N7SA 1WA2X 3EFOA 3HR6A 1T5KA 4QRSB 4CUCA 4OFYA 5SWQB 2Y23A 5DHDA 4OF0A 5MEOA 2V2TA 4NZRH 4MAZA 5CIPH 3U4BH 1KGIA 3TGXA 2WQSA 1KSRA 3JTBA 4QRFA 4JPIA 5IHUH 1K4CB 3NFNA 2E3VA 2Z7UA 4LEBA 1FLRL 1OM3L 3HAEH 2FYVA 2VDPH 1QSED 1ULVA 5GISL 4OF7A 1ZVSA 4G42A 1AQHA 1W9XA 3M1OA 4BFRA 2VXVH 2YMXH 1FYTD 1MRDL 3QS2A 3LN5B 3VRLE 5EN2B 4JG5A 5CN3A 4NKOA 3B7SA 3KWWB 3T2NL 2PNDA 4GXFA 2WBWB 2Y6SC 2ITFA 4H1LB 3S6CA 4AG4H 1F2QA 4Y16A 2J2ZA 3K1KC 4PJ7B 5K1JA 3WFCH 4U3XA 2IPUK 4LCWD 2KPNA 3VD3A 1T03L 1MF2L 4GLRI 4QJ4B 3VFGL 2QMJA 1I82A 5DLLA 3VRIB 1FV1B 1J11A 4N90D 3V6FB 1YAZA 1L3NA 2VLKE 3IDGB 1OK0A 3GMQB 4TVPL 5EBLA 2OMWA 2MCAA 3SPGA 5HYJB 2VLLA 1NGYB 4GI8A 4S1DD 1IZKA 2AK1L 2QDWA 3AUVA 4JVUA 2XDHA 3TFKD 2AVGA 3SOBL 1OSPH 2ROYA 4KJQD 3TFBA 2APSA 4R5XA 4G9FE 1TUPA 1IVLA 2LT9A 2VABA 4M7KL 3WNLA 2ZF8A 1MFBL 3H9ZA 4JJHA 3ULVD 3TVMD 3TEZA 3EH4B 4PJBE 2VXUL 4GBXD 4HCFA 4YBLC 1G7MB 4FKKA 4FXTA 5CSBA 4CKVX 1EVUA 2HVJB 4J2QA 4RSVA 3BGMB 3EJTA 3V4PA 1GMEA 2XA8L 5EO9B 3ZDZE 3P77A 2L8AA 1GAFH 1J9QA 1JRHL 3QQXA 5F7DB 5C2BH 3LVTA 1XF2B 4KZDH 3BZFB 5E8PA 4G8FB 3TESA 2VQ1B 3VXSD 2YSSB 1KJMB 4W9CC 4HX1A 4QYOB 4BSWB 1SBSL 5F6HJ 1INDH 2ESVA 4PLJC 1KXVC 1XGQB 2QGCA 4JFYB 4WGWB 5DFTA 4NT6B 4WW2C 1RK0B 1U95B 4S0HA 1IBGH 2PTVA 5EU6E 5CIPB 2P28B 1OE3A 1YEDB 3AG2B 3N3EA 3JTSA 1LO3H 2ZX9A 3FFCE 3L4CA 4QT5B 4YEFA 1BQHB 3VSTA 4J4PC 3GRGA 1LDSA 2B2XL 3HAEB 2VZVA 2I9LB 2VDPB 3MGAA 5FYJD 4JCWA 2ZPKL 1KB3A 4O2FB 1MXGA 4KY1H 2AITA 3MNVA 5JIIA 4PMFA 3ZQXA 3FTZA 3CTTA 1BYOA 2OW6A 5IMOA 4PBXA 5F97E 1E8XA 1YY8B 3V0GA 4XAWH 3WJLC 5C3LD 4DO4A 5EA0H 5E6ZA 2DPKA 4DKEH 5IJVA 1JNLL 3WMPA 1AE6H 5J6HA 2HVBA 3AFLA 2YAPA 5DD6A 4DN4H 4M4RA 1SXSA 5JW3L 3FU3A 4G8GD 2XN9B 4Z95H 3VXRD 3HRZB 4PLKC 4X8GA 3F64A 3RPIA 3FCTA 4OZFA 4HIXH 4X6CA 3VYPA 3V0AC 1TLKA 3FMGL 3PV6A 2XKSA 3BDYH 1P5VA 4Y89A 5IKCA 1JBJA