4F2FA

Crystal structure of the metal binding domain (mbd) of the streptococcus pneumoniae d39 cu(i) exporting p-type atpase copa with cu(i)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
GMTEIVKASLENGIQKIRIQAEKGYHPAHIQLQKGIPAEITFHRATPSNCYKEILFEEEGILEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural paradigm in copper resistance in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal binding protein
molecule keywords Cation-transporting ATPase, E1-E2 family protein
total genus 24
structure length 100
sequence length 100
ec nomenclature ec 3.6.3.4: Transferred entry: 7.2.2.9.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13473 Cupredoxin_1 Cupredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4f2fA00
1NIFA 1J9SA 3FPXA 1DZ0A 2EINB 1W6LA 2VW6A 2YQBA 2FT6A 1OOWA 3QPKA 4YSAA 1PZCA 2CUAA 1PY0A 1IUZA 2EILB 1AS7A 3UACA 3D12B 1NWOA 4BDVA 2UXFA 2YAFA 2XV0A 1M9WA 2XUWA 6PAZA 1J9RA 4E9RA 4YSCA 2Q5BA 4W9ZA 3NJJA 3OMIB 2IAAC 4F2FA 2MRYA 5FC9A 2XLLA 5B7MA 1NZRA 5I28A 2X88A 1ZV2A 4K9JA 5I6PA 2FQFA 3ASOB 1BQKA 1GYCA 2R7EA 3TBBA 4BXSV 1CYWA 4E9QA 1X9RA 1I53A 4E9YA 4QLWA 5TK2A 3ABGA 1PCSA 1M57B 2H5UA 1JVLA 5ANHA 5I6LA 2I85A 2XX1A 4BWTA 3T6ZA 2FNWA 1A3ZA 1AAJA 1AIZA 4HCFA 1ILSA 2YAEA 1NPNA 2J57A 2B08A 3IE9A 1QLEB 4G71B 1RZQA 3DKHA 1SHWA 4DP9X 3OMNB 5LDUA 1OE3A 1A8ZA 2P80A 1JZHA 1N70A 3AG4B 1EZLA 1SDDB 1GSKA 4HIPA 4AI7A 1PMYA 2YAMA 1XB6A 3EH3B 1A65A 2OV0A 2P80D 3FYEB 1JVOA 3ZDWA 2J56A 1CC3A 1OV8A 5IY5B 2HRGA 2QT6A 2PPFA 4YVUA 2N0MA 2XV2A 3FQ1A 1AZBA 1CUOA 3DTUB 3JT2A 4KO6A 5F7BA 1E65A 3PPSA 2PP8A 3MX0B 1PLBA 2X87A 2BHFA 2XU9A 3AW5A 4YSRA 4AZUA 2XXGA 2GC7C 1X9UA 2IDQA 1AG0A 1XB8A 1ZIBA 4DPCX 2I7OA 4F2EA 3FU7B 2HLEB 1PLCA 3GYRA 4JKNA 1TKWA 3WKPA 2DYRB 2YXWA 1JZIA 4TXVB 4ENZA 1MG3C 2JFCA 3AG3B 4E9SA 1BXUA 3GDCA 3NJIA 4G70B 2IWEA 2A3TA 1HAWA 2TSAA 3PLYA 2XXFA 1OCZB 2HX9A 2JXMA 1ETJA 3BVDB 3NJMA 1SF5A 1AG6A 1ET8A 4HHWA 1JXFA 4KNTA 1AS8A 1JZFA 2HX7A 1ASQA 2IWFA 2BP8B 1HFUA 2VW4A 2UXGA 4PCYA 4UAHA 4E9XA 1AZUA 2TSBA 2GC4C 3PXLA 2FQGA 2HXAA 3WNJA 3CZUB 3WNIA 1GS7A 1DYZA 3FSWA 3T6WA 4A2FA 3CVCA 4AX3A 2VW7A 4GP5B 2OJ1A 4KO7A 4Q89A 2FQDA 3UABA 4PAZA 4ZK8A 1IKOP 3CVDA 3JTBA 1L9OA 4YSEA 4KOBA 5D4IA 4Q8BA 4A66A 1A4BA 3AG2B 1V54B 2QPEB 4F7KA 3CVBA 3S3BB 2PCFA 2FT8A 2CBPA 4YSQA 2IDTA 2H47C 2XX0A 4BWUA 5I5MA 1HAUA 2AANA 4YL4A 4A68A 3ZBMA 1ZDQA 3WKQA 1WA1X 3PCYA 2FTAA 1R1CA 2UXTA 1ZIAA 1ZDSA 1SNRA 2DY2A 3NJFA 4DP5X 3ASNB 3X1GA 5I6MA 2PPAA 1SFHA 3ZIYA 1GW0A 1JZGA 1MG2C 4DP4X 2VSMB 5I5IA 1BEXA 1GY2A 4G7QB 1MZZA 1TEFA 5B1KA 2ZONA 1SF3A 2PLTA 1CURA 2HRHA 4MFHA 5D4JA 2DWTA 6PCYA 2BP0A 2BWIA 4YSPA 2IDUA 3SQRA 1AQ8A 1UATA 1FA4A 1J9TA 1KYAA 4BK5C 4FA7B 4P5SA 3WG7B 1V10A 3S8FB 4KO5A 3IBOA 1NIBA 3MBWB 1PNDA 2XVBA 2BO0A 4E9WA 3EH4B 3FS9A 3SBRA 2YARA 4DP6X 3WI9A 3TASA 3TBCA 3DIVA 3H4FA 4A2GA 1OCOB 2DYSB 3H4HA 4HALA 3HB3B 2RACA 1BQRA 3FT0A 1OCRB 1FFTB 2PCYA 4EF3A 2UX6A 2PPEA 2VMJA 3CDZA 3OM3B 1MZYA 3NJKA 2EIJB 1T5KA 3ABKB 3NSCA 4G72B 5AFAA 2YAQA 4G7RB 2Y1AA 5B1BB 4UANA 3TA4D 5F7AA 2Y69B 1AZNA 4HHGA 5I6NA 4E9VA 1M56B 3NJLA 5B1JC 2UXVA 2WO2B 3NJNA 3S3CB 3C75A 2AZAA 2BW5A 2W8CA 1TEGA 2GBAA 4N8UA 3L45A 3NYKA 1W6WA 4NERA 2QDWA 2FQEA 3EF4A 3T71A 3T6XA 1L9PA 1AACA 3FYIB 1BXVA 3N55A 1SDDA 4DP1X 4HCIA 3ERXA 4GP8B 3S3DB 3PAVA 3SBPA 4YSSA 1QHQA 4DP8X 4KO9A 3AY2A 1NPJA 1RZPA 3T6VA 3T9WA 1JERA 2OCCB 1EHKB 1PZBA 1L9TA 2HX8A 3NJHA 4HAKA 1J5DA 1ILUA 1FWXA 1OE1A 2UX7A 3SBQA 5AKRA 2BZCA 4WTQA 1WA2X 3ZX1A 4KOCA 4YSUA 1N68A 2GI0A 4RH4A 1IBYA 3PAZA 2IDFA 1BYOA 3EHBB 3QJUB 4DP7X 5B3SB 5B7FA 2IDSA 2R7EB 4KNSA 1ET5A 2PPCA 4JHUA 2BWDA 1WA0X 3FQ2A 4KNUA 1OCCB 4FAAB 2EIKB 1OE2A 4X4KA 4AKOA 3UGEA 1WAEA 2IWKA 3OD3A 4DP0X 4QKTA 1KCWA 2XWZA 4AKPA 1AR1B 1GS6X 3CG8A 4YVNA 4GYBA 5D4HA 5PCYA 1QNIA 3RYMA 2DV6A 5B1AB 1YLBB 2CJ3A 1J9QA 1A4CA 3GXUB 2XV3A 1SFDA 2LLNA 2CALA 4M3HA 3AG1B 3HEIB 3WIAA 1IBZA 3OQRA 3UAEA 4CSZA 3NSYA 2MTAA 2GB2A 5EHFA 1E5ZA 1ADWA 7PCYA 1KV7A 1KBWA 1SHXA 4GY4A 1B3IA 3G5WA 4JHVA 4A2DA 2NRDA 1GS8A 4DPAX 4CSPA 4BDVB 3FU9A 1J5CA 3NP3A 3X2QB 1F56A 4NAJA 2PP9A 4L0PB 4DPBX 3UADA 2ZXWB 1NDTA 2XYBA 2VN3A 1AZCA 4HCGA 1TU2A 2FJSA 2VM4A 3FU7A 4WKXA 3TU6A 1L9QA 1BAWA 1AS6A 2GIMA 2VM3A 1JXGA 1KGYE 1NICA 2BP8A 5TK4A 1JXDA 3X1BA 2AZUA 1RCYA 1E5YA 1NWPA 2B3IA 1E67A 2I7SA 5B7EA 2BZ7A 2ZWNA 3KW7A 4G7SB 3QJSB 1XB3A 2BW4A 9PCYA 1V55B 2PP7A 1PF3A 4AKQA 3ABMB 2YAHA 3UAAA 3X1NA 1RKRA 2GSMB 2QPDB 3QJVB 2WO3B 3S8GB 4YSDA 5I6KA 3AZUA 3BQVA 1ASOA 4UF7C 2E86A 2FT7A 3OMAB 4BXVA 3FU8A 2DWSA 3U25A 4BWWA 2AVFA 2EIMB 1JZEA 3V9EA 1AANA 4DP2X 1JOIA 3FSAA 1PLAA 5AZUA 3IN0A 3H56A 3X1EA 1ET7A 1NINA 1AZRA 1URIA 1KCBA 2J5WA 2YAPA 1MDAA 3FSVA 3QJQB 2WSDA 4A2EA 5A7EA 5E9NA 3PAUA 4W1TA 4YSTA 3ABLB 4M4RB 4P5RA 3X1FA 4N4YB 5I5JA 5I6OA 1A4AA 1E30A 1WS8A 1XMEB 1BXAA 3QQXA 3V9CA 4E9TA 1AOZA 3FPYA 2VSKB 1L9SA 2CCWA 2IH9A 3NJGA 2GHZA 4A2HA 1KDJA 1PAZA 3CDZB 3EH5B 1IC0A 2YXVA 1KBVA 4A67A 1KDIA 1NTDA 1GY1A 3IEAA 1BQ5A 2W88A 3KW8A 3NSDA 8PAZA 2AFNA 1GR7A 2YAOA 1ID2A 3QJRB 4NB7A 1NIEA 1CYXA 2FWLB 2CAKA 3QJTB 4GXFA 1JZJA 3N2JA 1L9RA 5B1JA 5PAZA 1NIDA 1OF0A 3NSFA 4YSOA 3IN2A 3NP4A 2QDVA 3NT0A 3FQYA 1WS7A 2HZHA 2H3XC 1PZAA 2PPDA 2Q9OA 1PNCA 1ASPA 1W8EA 2JKWA 5I26A 1NIAA 2BP0B 2IH8A 4HZ1A 7PAZA 1VLXA 1BYPA 2ZOOA 2J55A 4GP4B 1SJMA 3FSZA 1ZPUA
chains in the Genus database with same CATH superfamily
1XSKA 2Q10A 4OZIF 1U2YA 5LB1A 1NMAL 3PGFH 1BBDL 3ZE2F 1Q9LA 4EUPG 3VRJA 5C0CA 2JJUA 2KZBA 3FOLA 2OL3B 1RK0B 3T4YA 3OR7A 3O2VH 4F8LA 4DGYH 4KI5E 2PWFA 4CMHC 4JCMA 1VPOH 1WZMA 3Q3GB 1T6BX 3KS0H 1NEZA 4JZJC 4OM0H 4M93B 4KTYA 2O6CA 1OQXA 5KVGL 2D3VA 3W5MA 5JIHA 1E8YA 1K3IA 2CIIB 4YZFF 1BQKA 1FYTE 4BXSV 4I7ZC 5JZ7D 1BD2A 4MAUH 2P5WE 1WV7T 1EMTL 5GRYA 4ZX5A 3VX0A 4POZC 1PYWB 2OTUB 5J1TC 1WBXA 1Q4NX 1IO4C 3TO2A 2VXVL 1NCIA 5EUOE 1AAJA 4O2CA 3SDAA 1EO5A 1CK0L 3C5SB 5K9OB 5L4FA 2B08A 4XVUC 4L9LA 1QLEB 4M8RA 2PYED 1N12A 2EDBA 3F12A 5J9PB 4JFDA 3ULVH 2K6ZA 3AFLA 3DRQB 5JA9A 5KYYA 2HLFC 3H9HB 5BRZA 3K4DA 4G1EB 4DFIA 1A8ZA 2P80A 5CZXC 1N70A 4YWGL 3WTXA 1KSRA 4UBDC 4JMNA 1I7ZA 3DX9B 5TE4H 3WNOA 5GS1C 5L9DH 3D8MA 2WXPA 4P48A 5F7YC 4BK4A 2BVPA 3AMLA 1JWUB 5I1LA 2WBKA 3WO3B 4JFDD 1C9SA 5AVSB 1WC7B 2WXRA 4MWFB 4NO0B 1FGNH 4NX0A 4AC4A 5I1IL 3EYVA 3IGAA 2C1PA 4FP8L 2MCAA 2IXQA 4C57C 5I30H 1P5VA 2ED7A 4JCWA 1CZ8H 2AV1A 1YNLL 2ZCLL 2GG1A 4D8PA 3GSVB 3RVWD 3PQYE 4R7NA 5HD8C 3SBWA 4EI5C 4X8JA 3EW3B 4HC1H 4JFED 4XP9L 3DTDA 2XWXA 3PNWA 5C0DB 1AGCA 1ZHNA 4N5UA 3SKMA 3TCTA 4F8NA 2MHAB 1IGYB 1HH9A 1HESA 4NYLA 3BXNB 3DSFH 1FDLL 4PFEA 2VDPB 4H20H 4K7FA 2Q86A 1JTTA 3MRPA 3O6FD 3KDMB 2GUYA 2QELA 4Y2OA 2R83A 2XZCH 3FO2B 4IDJL 1T20B 1WEJH 2NR6A 1SN5A 3GMQA 3GSNA 1NKGA 2HX7A 4FQXC 2P42B 4U6XB 1U58B 4K4KA 1I1AC 1P7BA 4PCYA 4A04A 3UYRL 2R2HA 4UTAH 4WO4C 2NZ9C 2XXCB 3CFUA 2WKOF 5D1QB 3RNKA 4BFJA 1AHWC 3T2OA 5F1NA 1CGWA 5JW5A 2ZAIA 4KRLB 1KTBA 4J3OF 1UH3A 5DU7A 3CVCA 1J0YA 2AQPA 2CRMA 5L2JB 1KTDB 4BZ1A 5BUAA 3LN9A 1NGXA 4PJIF 4MLIA 4WTXA 1ZTXH 2IIJA 1JNJA 2BY3A 4P3DA 3WUWG 1A6TA 4DKFH 3DVNB 4PJDA 2VDKL 3PIQB 1AQKH 2OCJA 2YSTA 2D2OA 2VLRE 4F7KA 2ZOUA 1QEWA 3I6LD 1SJHB 2XX0A 1SJEA 5AAWC 5HHXH 2EC8A 1HAUA 4Y5XA 3Q8BA 1ZDQA 2L04A 3TH4T 2FTAA 4LRIA 2SEBB 4MDRA 4N2DA 3U9PL 4JN2B 4AH2B 5IJCC 3SJVA 3D9AL 2HLAA 4FYRA 4NO5A 1GZQA 1MQ8A 2H6PA 4LGSB 3E2HB 4GQQA 1LK2A 4XBEL 4X8CA 1CD8A 3U36A 4XHJD 4LASL 1RIHH 4DP4X 3KPNB 3M7OA 3UEZA 4X0NA 1NAKH 3S98A 4RX4A 5B8CA 1RK0A 4DKEH 5BV7C 1TEFA 5LWYL 1T80A 5JO5B 4XZ4A 3HNTH 1AKJD 2Y0SA 3O6MH 2OTPA 1UD6A 5IVXA 3GDBA 3BD4A 2YO3A 4M7LT 3TM6A 4Q4IA 4HW6A 4XPTH 4W6WB 5C9JA 5IMLA 5J3HC 1NEPA 4N8VG 1OZUA 3TZVD 2HG0A 5JXEC 4CGTA 5DD6B 3KD4A 4TL5A 4J1UB 2K78A 2IGFH 3B7SA 1ECYA 2DMHA 4AQEB 3E2HC 3QIUD 3FU0A 5E00B 2O5XH 2BIHA 2GAZA 5BVJB 3KGTA 1HJCA 2HPOA 1KXVC 4LLUA 5TDNA 3QFDA 4QXTB 5I8KH 2GUOA 3QNZA 1EV2E 6FABL 5LNDA 1I7TA 3V4PL 3BPLC 3L5IA 5DVMA 4X7SH 1G5GA 1MCPH 3GLZA 3P3UA 2NCMA 1KGWA 1ZEAL 2FJHB 5JXAH 3US0A 5CD3A 5AZEH 1GW6A 2R9HD 4OLWL 1RZKL 4JO2L 5IW3A 5DRZB 3S5ZA 1IBBA 3GINA 2G5RA 1UVQB 1L7TH 4X8XA 3Q48A 1E9PB 3Q8EA 5EZLA 4PGCA 1G7JA 2LAGB 1NFDE 3EO9L 3KJ6L 4YQXL 4JPQA 4EIUA 4G7RB 2A5UA 5B1BB 2Z8WC 4QY8A 4KFMA 3VGGA 2R1XB 4G6AD 2QMKA 4UINL 4CN6A 2AJXL 4AL8C 3ARYA 1OHZA 4PU2A 3ARED 1V7ML 3K72A 5I16B 3JWNE 3OZKA 4YDJA 2PMZA 4Y4FD 1OW0C 2XRAH 1BPLB 4LSVH 3S3JA 5HVFB 1OTSC 4PD4K 1DJZA 3CC5A 5TE7H 2QL1A 5AENA 1A47A 3GNML 1C5CL 3KPQA 3QPXL 1RZGA 3ARBD 1M7IA 5HGAA 4CU6A 3IDMB 2P49B 1N5AA 4JL1A 4RBPK 5D2LF 3ARDD 3NVQA 2HVKA 3FZUD 2JB5L 3KDMA 4K3JL 4JUSA 1PD0A 5DC9B 1E3ZA 3JWDL 5CJBA 5FFGA 1N6QL 4AYGA 3LRSA 4LU5H 3REWA 1CFVL 1OHQA 1GKOA 1JN6A 1UB5A 1KCKA 3GRWH 5IBUG 1I7UA 3TN0B 3HG3A 2WP3T 1T04A 2NSQA 2X2HA 3VNYA 4PVLA 1WWWX 1UGNA 5GIRA 1PKQA 2G60L 4CVXA 4Z7OB 3P30L 2DQDL 1CDIA 2F08A 3U1SL 1ET5A 3SDCB 1LYQA 2JE8A 4ZUTA 2QR0A 2NX5E 4G7VH 3TFKD 2C9XA 1ZA6B 1AD0A 4OIFA 5KVEL 4QXUL 1JMXA 2X70B 3ZT7A 1MCSA 4YR6B 1RUQL 1RPQA 4K15A 4B5EA 2IWKA 3DX6B 1X5AA 1ZMYA 2L8AA 3GIZH 3HBPA 4W9HC 1NJ9A 2HJLB 4W4NA 1CPUA 3JWOH 4LEEA 5AUMA 5PCYA 5C0EA 4U1JA 4GUCA 1EBPA 3K6SA 1U8NA 2L3BA 3GXUB 4I3GA 5FK9B 3MRDA 5CWSB 1RFDL 2BNQB 5KWYC 2D03H 3LZFH 1HOCA 3MOBL 3L4ZA 1EA9C 3CZFA 4YHZH 5F7DA 1KPRA 1MLBA 2EC9U 4H7VA 4PY8J 3VFOB 4HOZA 5BZDA 1H6FA 2IJ0C 2V7HB 1JZ3A 4L18A 1GC1H 3L16A 2Y1ZA 2QGDA 3FB8B 2ZG3A 1HILB 3FL7A 1B3IA 4JM2C 4UQAA 3HPLA 3SO3C 4NT6B 4NAMA 2G30A 2M83A 3QZOA 3VYOA 3ZW3A 2V2TB 1EGJA 2E75C 3LN5A 1T0NB 2PTTA 3Q0HA 4LVNC 5GSVB 3D48R 4HS6B 3FT1A 3VRIA 5EO1A 4OI9A 1FFNB 2F54B 4Y4KA 4LGPB 2P5PA 2DLFH 3P69A 4AXWB 4FDWA 5J6HA 4ALAL 4KAQL 1QBLH 2BNUA 4C4KT 4G8EA 1NGWA 2HFFA 3FB5A 3IRZA 4OF0A 3WE1A 4CILA 1JXDA 5C0JB 1I1FA 1WBZB 3DV4A 3T0DA 4HAGA 2EEBA 5E0QA 2J8OA 1QKZL 5LUMA 5SWQA 2BZ7A 4RMQA 3UG4A 2X05A 1P7KB 2JI1A 1XB3A 1YEGL 1F2QA 4U6YA 3TPUB 3QNFA 4IIQC 2VR9A 3MUUA 1ZLWH 2FO1A 3B2UD 3UAFA 2VLME 3QZMA 3VGAB 2Z65C 4NQSB 1MW3A 1S5HB 2W65A 4NZUH 2LGNA 4UF7C 5HYSG 5I1DB 2FLBT 1CK0H 2BFVL 5EH1A 3Q05A 1CDUA 1S7WB 1Z3RA 2V7NB 2ZUXA 2XKSA 4I0PB 4QWWC 4GG6B 3WNLA 1FNAA 3L13A 3CPLB 1R5VA 1XCTB 4KUZH 3MRLB 3X1EA 4RESB 3D33A 1WAAF 4RRPA 5I24A 4FQ1L 3Q5OA 4H8WL 2R4SH 2WQAA 4LPYA 3VM5A 3QEHA 5LGKA 4MVBC 4TRPL 2UZYA 3VWJC 5L4JA 3UPRA 2J4WL 2FO4B 4XNXL 2TRYA 1PYWA 2F19H 2OTUA 3QIWC 3HS0C 2IQ9H 2VABB 4KMTL 1TYEB 4DQOH 1S9YB 1XSOA 1OT1A 2C3GA 2G9KA 1TITA 4WK4B 4Y4HA 1TQVA 1M7IB 3WE6A 1Z3GL 4PJCF 2Z4QA 3M1BB 2VAAA 5E8PB 3QZBA 4R2GC 4QTHA 3ARRA 3IEAA 3T77A 1I1AB 3CX2A 2MPAH 4M7LL 1GR7A 2QSCL 5D1QC 1JG9A 1UZ8A 3LNHA 3PJLA 4G9FA 1IFHH 1LGVA 1PQZB 7CGTA 1SEQL 5BO1L 3FOMA 1FGVL 3AC0A 3KDPB 3FFCD 3BAWA 2DWEB 4JN1H 3W82A 4BQCA 2VQUA 1JI2A 3CVIH 2FYYB 2YK1H 2MOVA 2E74C 2AKRB 5C2BH 4HMEA 1PZAA 4ABVA 4X7TA 2JKWA 2WAHA 2H2PC 2KI6A 3MLWL 4JFUA 1JVKA 4L4VE 4XMKH 4U1KA 1K2DB 1GHFL 1BWMA 2G2PA 3GJEA 1CLOL 4R2GB 3PNWB 4LSRH 1W0YT 4TUJB 5K69A 3QUYD 4HCRA 2XKUA 3BUQA 4HXAL 4UIKH 2V2WB 5C3LD 1IUZA 3U4AA 3AGWA 2Q8BL 2A4CA 4J6IA 4RWYH 5E23A 3BD3A 4S0SD 3GI8H 2VLLA 3BAXA 4OCSH 4QRAA 5CN3A 2G2NA 4FFZH 2P1YA 4KI5D 3OMIB 4OCMC 4BZ2A 3A4DA 2YA0A 2G2RA 2UWEF 1JGLL 2CRZA 3RNKB 3FULA 1A02N 2EIBA 3QUXB 5IR1A 4LQ1A 1A7PL 5BRZE 5FLUA 4LNVA 3IPFA 4JFYA 5KBLA 1DJXA 4PMEA 2OA9A 2H5UA 2VMFA 4Q9BA 4W6XB 2OMWA 2P44B 3BKMH 1F42A 5KJRL 4PJ7A 1IAMA 1X7TA 4L4VA 4LLMB 3N41F 4BKTC 4Z7NF 3AU1B 3FQ4A 3IDGA 6CGTA 1P7QA 2CRYA 3IE9A 3QHTC 3RLSA 4APXA 5LWYH 1FN4A 4P2RE 1E6JL 2OMZA 3DKHA 1F13A 4OGYH 4JFVA 1HNFA 4EDWL 3ALWA 2FZ3A 3PHQA 5C3IA 3H55A 4PJAB 3AG4B 3UGXA 4ORGB 1J05B 3Q8FA 5CGMA 3GO1L 5DEGA 5DRXA 2ZT9C 5ACZB 4PRNB 3HBZA 3ZE1B 4N2OA 5EZOH 5HI5D 5JHDA 4R0LB 2FBOJ 1ZA3A 3I6KA 1BZEA 1CC3A 1T0MA 1WLHA 2YQGA 4LHUB 1ETZB 3BSGA 4GLRI 2IOOA 4UIMA 1QQDB 4QRQB 3T3PE 2CPCA 1F2XK 2ZOKA 3JT2A 3WXWL 3V4VA 5GGQH 3WHE0 2E47A 3V9FA 4RWHA 3VDAA 4PY8I 1VF5C 2DLIA 1FNHA 1UXLA 3HI6L 4KK9D 1M6OA 1Z9NA 1QFUL 2F53B 3BZDA 1ED3A 5HYFA 4YHPA 4F2EA 1JV5A 3BVTA 3IU3A 1IC1A 3CUPB 4M4RA 3ULVD 5I75B 4BE5A 4JO2H 5IQ9B 3EGXB 1NUDA 3BJ91 4P2RA 4QWWD 3UO1H 4FQPA 2DICA 2V37A 4J3TA 2NDFA 4UINH 4XCEA 4FQJH 2ITCB 3LZNA 2F54D 4KTEH 3UZVB 3D4GA 4UQ3A 1SJEB 5KOVC 4XPAL 3S0PA 4MYPA 4Y19A 3C6LB 4ZFFB 2EXSA 3CN1A 4L4TD 2FQGA 3DHJA 1N8ZA 3GMOA 2GW5A 5E2UL 1UWEL 3VE0A 4GG6F 3LEYL 2BSRB 4IRZH 3HE7A 3PRZA 5E6IB 5IKCA 1ORSB 4NKQB 2RD0A 5AW0B 1YEFH 3OXSB 3ZDYB 3D08A 4OB5L 4S1QH 2NSMA 2ZQKA 2O6PA 4Z95L 2R2BB 1KZQA 3PWPA 1DN2A 2IG2H 2FECL 4B96A 1RP9A 5GRVL 4DIXA 2JI2A 3L9RA 4OM1L 5JHDD 3JWDH 3NEOA 4F27A 2WY3B 2XFXA 4XP1H 1AKPA 1HH6B 2NY2C 4MQSB 4R97B 5HBBA 2WQ8A 3Q9PA 1NGQH 3B5HA 4HPYH 4LU5L 2BLFA 4ZNEE 3WTVA 3GMLA 1RZ8A 4L1BA 5B1CA 4K73A 4LCWE 3BUYA 5H8DA 4JFQA 2AJZA 2MKLC 4MKTA 2CMRH 1TTBA 4M43L 3R0NA 5DURB 3WHE1 4HETA 2CCVA 5EUKB 4BH8B 3SKMB 5T5FH 4O4YH 3NIDB 2WN3A 3OHMB 2JJTA 4QRRE 4JBSA 1YQVL 3QG6B 5TE6H 3UBXA 5BVJA 2C7FA 2XVGA 4XPBL 5CEZE 3C6SA 4AJYV 5L8JB 5LXGL 1TVHB 4NKDA 5IVXF 4LIQL 1SRDA 4QJ5B 1QO3B 4P2QA 5KAQG 2DYPA 4JHZA 1ZTMA 2AABH 2VNCA 3O4OB 3IM1A 1NLDH 4IKNA 2EXTA 1CO1A 3L2MA 1EXUA 1MCFA 2M1KA 5AVQB 3BIKA 3AQXA 1X5FA 3B7TA 1H6UA 3CFEB 1CDYA 4FNLL 4P2OB 1MI5A 2WINB 4HJJH 3FONB 1BZ9A 4HKZB 1QRNB 3DTXA 1V10A 3PL6C 4LVNB 5H37H 3MCLL 3MMEB 1A0QL 4LCWB 4N8VB 4UDUB 1L9NA 3U4BL 1RFDH 4L8SB 5CZVL 5I66B 3D25B 1CF1A 3M86A 4OZFA 2R1XA 4YDKL 1FGNL 4F9LA 5IOPB 2CO6B 4U49A 3NCJH 3VJ6A 3EH4B 3ZMNA 2E7LA 5KSBF 1KT2A 4A63A 1VZIA 1PZ3A 1F0LA 1T1ZB 1TZHB 3JUYA 3NCEB 1KJVB 1P7QB 1RU9L 3OZ9H 4X6FB 3DXAB 1CDCA 4GIAA 5IBTH 5GS3A 5L2KB 1HCZA 4F5CA 3S9DB 5E6ID 1ZLSH 3KM1A 3I50L 2XTJD 4FFVC 5CP3A 1O7SA 1T5XA 3JVGA 1BF8A 1E2ZA 1U33A 3QW9A 3VFTB 4ANKA 3K71A 1MFCL 1MCRA 4NCC1 1Q9OB 4W9CC 3SDDD 2W9DH 3CTTA 3KYMB 3HLAB 3UCQA 4ZMNA 1H5BA 3ME0B 4EN2A 3K5SA 2WUCL 3NJLA 4GRMA 4WO0A 2A4ZA 3WFDH 5KS9F 1XGRB 2WWOA 3BSHA 1EHAA 5F88A 3BGMA 1BQUA 1F3JB 5C3TA 3A23A 1ZHKA 2QDWA 2YMXH 1ZT1A 4XN5A 4CJ0A 1LO4L 2FD6L 1BVLA 3VFNB 3MODL 4P9HH 2IFFL 3N55A 4AEFA 2BFVH 1MLCA 4DP1X 5CGBA 2O93L 2GY7B 5F0JB 4NP4L 2B5IB 1IKNA 2CO4A 1Y07A 2Y7SA 1HJBC 5F7EH 2WUBH 3CN2A 3J2PA 1RZPA 3QIBC 3DO7B 1E42A 3FCGA 2AQTA 4ODBD 3T0VA 2F1EA 4AZ8B 4O9HH 5EN3A 5I5RA 4MXQD 2JF1A 2XWBB 4Y9GA 4MGXA 4HK0B 4HAKA 1BBJA 3MBED 1ILUA 3U83A 4JFEE 3D30A 4RFEA 5ABAA 3B3BA 4L1DA 1A6WL 1CLCA 4NBYB 2AQ2A 5E08L 3QORB 4MS6A 1OF2A 4PJXF 3U1PA 4DQOL 3ETBF 3V10A 3ZE1E 1B4JL 4QI3A 5CWSA 1MAJA 3O11A 4PI2A 3RVXD 4Y19D 5TF1H 3BUIA 3ULUH 2CLZB 1COBA 3EKCA 4PP1C 5ICUA 1TNMA 5EIQA 4XPHH 2IDSA 3BAYA 2ENPA 3BW9B 4AIEA 4WO4D 5E8EB 1RPKA 1F6FB 4UM9B 1EEUA 1Z9SB 2Y7QB 1FFOA 2V3EA 2QSCH 3ZKXB 3CZJA 3BCFA 5IVZB 4BGLA 4CMHB 3K2MC 4QPEA 2EO9A 4KQ4L 4OZFH 5BNXD 2I69A 2OMXB 4GRLA 1KCWA 4APQD 3ARFC 1GGBL 2NW2B 2YK1L 3HPJB 1HSBA 5ETUB 4P2QD 4GXUN 3APMA 5CBEA 1HT6A 1J86A 2WCSA 2OMYA 3ARDA 2GSIA 2YPVH 3QORC 4JO8A 3NACH 3HEIB 5E51A 5EO9B 4F57L 5LAXA 2Z4QB 1RSFA 2MTAA 2XTLA 4XHJC 3TNNB 3C8DA 3B37A 2Y25A 1GHFH 1KV7A 5C0RL 2C4FT 3T0AA 2ZIDA 1N4XL 3DV6A 5J6GA 3TO4D 1WWCA 2JKXA 3IDXL 3PGFL 3KYAA 3FQTB 5F9JB 3NP3A 4P2QB 2OYKA 2X41A 5EF0A 4ABWA 4RIRB 3RE0A 1ZEAH 3B83A 4V11A 1SQMA 4WGVB 3TL5A 5I1DA 3BDYH 4XN9A 5BUGA 2DDQH 4DGYL 4W4OA 5CUSL 4MNGB 4RWYL 3D4ZA 1A3RH 2GIMA 4IKLA 4ZI8A 1CGSL 5DD5L 5DJ2A 3T3ME 5MEOB 1LTXA 1E67A 1BG9A 1YAZA 2AJXH 4JDEA 5HHPA 4QF1A 4URKA 3KW7A 1SJXA 1TQTA 4YGAB 3WMQA 2OW6A 2DN7A 1W8NA 4N0YL 2WZPA 1ZLDA 1DE4B 1DVQA 3FUJA 1CG9B 3LXBA 1VSCA 1TQBB 4OIIH 5A2BA 3B5GA 3VXMA 2ZXGA 5FDWA 5AB0A 2A38A 3MCKB 3MTRA 3S5LA 2E59A 5EU5B 4EUPB 3OVUB 4KQ3L 3OMAB 5AVTB 2O5YH 3DMMB 1I3RB 5EBWB 3VI4E 1XR9A 4Q9RL 3RB5A 3K6NA 3DETC 5BQDA 1KXQA 1WFJA 2K3TA 4H5SB 5DA0B 2FHFA 1NFDA 3IN0A 4GO8A 4JDTH 3ZDZE 1KCVH 4XNMA 1IM3D 3FSVA 3QJQB 4A2EA 4NPYB 4PGJA 1N26A 3O3AA 4CC4A 2YEZA 4A38A 1G6RL 3GS7A 2WLLA 3DMMD 3UERA 4LBEA 2V2TA 4I18B 4ZW7A 4FD0A 2N4IA 4XN7A 3V9CA 5JW4R 2AV7A 1HTYA 4RAHA 1U8QB 2BVQB 5DJ6A 4A2HA 4W93A 2GYSA 3PWNA 2CJTA 4EJ1C 1KLFA 3DGDA 5I30L 4MJID 4RRPG 3R06B 5DD1H 4PMFA 5SV3A 1WJ3A 4MRCA 4A67A 3RPKA 3U4KA 1EBAA 1W0WA 1GY1A 5D8JH 3V0EA 1VESA 5HY9B 3U0TA 3L8QA 5J89A 3JV4A 1W9XA 4F7PA 4ZOAA 1OAKL 4KKLD 2X38A 3GEFA 4NCC2 4UQDA 3VI4A 4QGYA 4R90H 4PJDF 5EG6C 4YDLB 3RX5A 2CZNA 3HZVA 4NRYA 4AC2A 4NC1E 1ETB1 1RIUH 5I1KH 2ZXCA 3VFRB 4ELMA 4JRXD 2JJSA 4AT6A 1W15A 4WDIA 2TAAA 3TV3L 3HZ3A 1HXYA 1OP5H 3DX8A 2EH8H 3Q2NA 3ZHDA 2IH8A 1J8HD 15C8H 3FRPG 3P02A 4LMQE 3CN3A 1BYPA 3FQXA 5CJOH 4PCKA 5ISZD 3L54A 5JXED 4HFUH 5TQ2H 1OP3H 1S7UB 2UZPA 4FI6A 2DQGH 4XNUL 1M3JA 2YQBA 4UU9B 2GVYA 3OKOB 4LPXA 3K6SB 1A4JA 4S1QL 4Z7UB 5D1XE 5K59F 1AS7A 2WP3O 4JFWA 5DO2D 3KPMA 1J8HE 1OP3K 4FQQA 1ZVNA 1Y6KR 3FQRB 4G9DB 5KS9A 3Q1SL 3VXSD 4Y2DD 3WIHH 1HC1A 2X1QA 3TURA 3FB8A 1HYRC 3QIWD 3OZLA 2C9RA 3CLWA 3GMPA 1KLUA 4K9JA 1H8LA 2BNQE 4X6DA 3SSGA 5F89A 1TJXA 3BEVA 3MRFB 1KF9B 2Y36L 1JGDA 2AJSL 4U4IA 5MEQB 3BN9C 4OLVL 5A6LA 1YMHB 4BWTA 2Q87A 1QHPA 5A43C 4F93B 1JF6A 1JZ8A 2WSPA 2WXQA 3WJMB 5E6YA 3ML8A 4X7DC 4PVNA 3KWXA 5KYUA 2IAMC 4ACTA 3QXDB 4Z7NE 1XBRA 1PPIA 2D3JA 4CSTA 1S7VA 2EXWC 2HH0L 1G7PB 1U3ZA 5E0FA 3KEDA 4NM4L 3HI5L 4BINA 4BIKA 3L3IA 4Y16B 3RJDA 2FHCA 4GKSA 4C83A 3CUPA 3P9LA 5IESL 3V2AR 3O8XC 3KPLB 1BCIA 2WBXA 4G9FD 5C07B 5HSFA 1TZIA 4AQ1A 4NHCL 4I1NB 5D96B 1BAFH 3ZDWA 1KACB 1O6TA 3ULSA 3U6XS 2QHRL 2Z31C 5AW8B 3HMWL 2Y22A 2H0FA 2B2XL 3MRNB 1R17A 4M02A 2Z7UA 3PPSA 3G3LA 3FT2A 3SCMC 3PJSA 3QDMA 3IXAB 5FO7B 3LZRA 2JQZA 2QQNH 4OGZA 1MJJB 5TFSH 3W2DL 4GBXC 4K7PL 2VLJD 3QPQD 3HFFA 1J87A 2Q76A 1ZIBA 4OCXH 4Z5RA 3RUGA 2VL5A 2MPVA 4WCYH 3GYRA 2GJZA 3DYPA 4MTMA 3GXPA 4Z7WA 2YXWA 5EU3A 1O6SB 3AITA 5ERWA 4ENZA 3X3FH 3GTTA 1SYVB 3OKKB 2NY6D 4PYGA 4Y16C 5DK0A 4AGOA 4RVBA 4NPKA 4JPKH 1ZXQA 2H6UA 3GDCA 3KJ6H 4YQXH 2WSKA 2IWEA 2D73A 2V0AA 3D25A 5HPMA 1TPXB 3RHWK 3SE4C 2W9DL 1DZBA 1SDAB 4J3VA 3WTWA 2G4GA 1GYUA 1J9CT 5EORH 3BZ5A 4FQXA 5ABZA 2OSWA 1F3RB 4QHPA 2OW7A 5HGBB 5D72H 3SKUD 5FB8B 1CBVL 5I0DA 2K1MA 4XCCH 2YMXL 5GGTH 5T1LD 2XRAL 3APNA 3GMQB 4IBYA 4NWTL 1BD2E 3FSWA 1DEEA 1TKWB 2IFFH 3RWJB 3HC4L 2VW7A 1RHHA 4HQQL 1FL3A 1R24B 4L3FA 4OD1L 4WJKB 5DHDA 2PW2A 4CVWA 1GTFA 2E7MA 3CDGA 4LRNH 4V1DA 3FU6A 4JPIA 2G5BA 5LGJB 5CZXD 2WXGA 1OGAD 5F7EL 3JTBA 4BFNA 3IKKA 4HS8L 2XPYA 2IOMA 5I8EB 2DIJA 2Y5TB 1I4FA 4YC2C 2QPEB 2GBUA 2EDRA 4IIZA 1F18A 1RJZA 1CFVH 1N2RB 3PCYA 1UACH 4JM2D 1YYMH 3IE4A 3LIZH 2GT9A 4JJ5A 5E08H 3NZHL 2P8MB 4AMXA 3MRCA 1XGYH 1JFQH 4XPGL 4UDUA 2OM5A 4U1LB 5TQ0L 2LABA 1AQMA 1MVFA 4E41E 3S34H 1G7IA 3O3BA 4L4TE 3GLAA 4X5RA 3MV7D 2EE2A 4PSPA 2CA3A 1A6TB 1TO4A 2DQTH 5D7JA 5KVFH 2VLKA 2ITCA 1MHEA 5HGDB 1MN4A 5EOTB 2IPKB 4FNTA 4PYHA 3RQ3A 4PLJD 3MJ8B 2FX9H 2O6FA 1UA3A 3SPCA 2GCYA 4MFHA 1QUNA 3BH9B 1FORH 5AYTA 3VXSA 1YYLL 3KPTA 4P5SA 3S8FB 2NXYB 1T2QL 4JN2A 1JUFB 4GXVH 4NO5B 1JXKA 4OSUH 3U48A 3ZYIA 2MEJB 2NUTA 1I7ZB 1U30A 3DX9A 3N91A 4F57H 4ZX3A 4DEPB 3A6CL 3WAKA 1FP5A 3LKPA 1FVCB 5E1AA 2GY5A 3WI9A 1U8CB 5DSCB 2YGQA 3DIVA 1DCLA 2AJVH 2NQDA 2CLVA 3ZHFA 3PWUA 4QRPA 1OPGH 2YRBA 4D94A 3QULB 1IC7L 2CBOA 1F6LL 3DPDA 5L7XL 2C1PB 1YUHB 5ID1B 1Q1JL 5DHMC 2MCMA 5EUOB 2X4PB 1HL9A 4KAQH 4QHKJ 1UEYA 2JJSC 3NSCA 2IPUG 1BD2B 4G6ML 1GGCL 4K3DL 3NQKA 5D1QE 2NXYC 4OIBA 1WAAE 1FYTB 4TUKL 3UBXB 2LE9A 3L95B 1KJ2L 4PJGB 1BFVL 3HB3D 3OAZK 3X11A 5D1QD 5BPPA 5J06A 3WDIA 1EZUA 1S9WA 3AVEA 4QXVA 1DUZB 4FYSA 3RWCA 1I3UA 3ALPA 2YMOA 1M4KA 1UWYA 4Y2OB 4AEIH 4BE6A 5EO0A 2YD3A 5DD3H 1RP8A 1BXVA 5C08D 3UIYA 3MRKA 5JYLA 1QR1B 2YFNA 2Z92B 3WNNA 1RK1A 4K3EH 1K5NB 5L6YH 3SCMD 5IBLC 4I18C 4AMKH 5F1NB 4JR9H 3PQYB 1SOKA 2VDKB 2UY6B 2KERA 1NOFA 2NNRA 2WGNB 1E9OB 2EIZA 2H8PA 2N0KA 4JDTL 2CO6A 2XN0A 4Q0XH 4PWEA 4H8WH 4PS4L 3EG9A 4FLHA 2OCCB 1WIOA 5E4EC 3QH3A 5IVXE 4W68A 2OBGA 4PJ7E 3VGAC 2ZSVB 2JV6A 4XNXH 5DJCA 1IE4A 2BMKB 1MAMH 4G43A 5AL8A 2OJEA 3SBQA 3VXRE 4QHMB 4LHJB 1QTSA 4DHLA 3RDTB 1RMFH 1PD1A 2LLGA 3QDGB 4LP5A 2VQ1A 1TDQA 3M07A 3NCWA 1DJSA 2CXKA 3SDYL 5B39B 2YRLA 1A6PA 1IE5A 1CS6A 2JWYA 3VFTA 3TJHD 1FIGL 4IBWA 5DJAA 5E99H 1T04B 2XA8H 4HSAC 3LB6C 5LCVH 4N2FA 3AWFA 5FHBH 2VH5L 1EO7A 3SGKC 3VGFA 5K5YA 4TVPL 5FM8A 2N56A 3AT8A 3R4DA 4XE0A 1MUJB 1XF2B 5IQMA 1WAEA 3B7UX 5BO1H 1RZJL 2AMUA 4JN1L 4YHMH 3V7AE 4D9LH 2VLJB 1XT5A 1WBYA 1HE7A 1P5UB 2Q8AH 1S4IA 1S7TB 1S7QB 5D7JD 3L7EA 4ZDHA 3G5XB 3ZTDC 4ZUWB 1ONQA 1P69B 1YLBB 2CJ3A 3WO4C 3WY4A 2YRPA 1P7HL 2CNZA 2XV3A 4JG1L 4HG4J 5E1IA 4B9ZA 1KGUA 2ICEC 3NOIA 1LWJA 3WN6A 1Q72H 2HT2D 3NCJL 2JMRA 3BZFA 5IMLB 5IHUL 5JHLA 5I9QC 5EHFA 4QRPE 5C09E 7PCYA 1U95B 2MCPH 1UHVA 1KB5L 4JFXB 1J48A 3G5WA 4HFUL 1GS8A 4YEEA 4WV1B 4CSPA 3BVNB 4KDTC 1TJHH 2SODB 4NAJA 5E94B 4LDOB 4N6RB 5F7KC 1B0GB 3BFQG 5D7LD 5E7FA 3A4EA 2CKBB 1NFKA 1XGUA 4HCGA 4HOXA 1N7MH 2FWUA 2PW1B 2XWJA 3QORA 4F20A 5DVLA 4EMZA 2PCFB 3TU6A 5DQDH 1B2WH 3GS0A 3LDBB 3IJ9A 3Q1SH 4LSDA 4ODWA 1TJIH 5IK3A 1DQMH 3UJIH 3V5KB 1UCBH 5CEXB 3WEBA 3FSOA 4GMTL 4NUJA 2YMTA 3TA3A 4FQIL 2ZWNA 4WI8A 2NUTB 3MRMB 3HC0B 3IETA 4U7MA 3WFDL 5GZOD 3P2TA 4KZEL 4WUUB 4LKXA 1SJHA 2YAHA 3NDYE 1MFBL 5D7LB 4E5XG 5CM1A 2GSMB 1MHPH 1U21A 1BSIA 3O4LA 1UWGL 4MNGE 4UV4H 4DSYA 4XBPB 2C9UA 4JRYD 3QUZB 4TNEA 4YLCA 3V8OA 3II2A 4PJHB 4N0FB 2XHNA 2FT7A 3WFCH 3ESUF 3QIWA 4XNZB 4FKKA 5CJ5A 2WLJA 5EUOA 2NY1C 1D2PA 1F1AA 3PGDA 3UPAA 4ZXBA 4JFPA 4U6HA 5E2TL 3ARFD 5D5MA 1F90L 1BDYA 2KH2B 2X2UA 1WBZA 3I2CH 1AZRA 4GBXB 4I87A 3STZB 3B2DC 3MV9E 3SDDC 2OSLA 2WXNA 1OCWH 2X28A 3K6OA 4YSTA 1P7KA 1PD6A 3V4PA 1TTFA 3B8YA 3U9UA 2NOYA 3S37L 1NANH 4LLUB 5JDSB 2X9ZA 2XTSA 1HHGA 3B9VA 2W0PA 4C8XA 4MXWH 5TF0A 2XG4A 4ZFGH 5GGVH 1E30A 2DM4A 1I8IA 4Q52A 1H3PL 2IFGA 2J5LC 2DM3A 1WGOA 2UZYB 5FFLA 5FF6A 3UPRB 4ZO9A 3PWVB 1XBDA 1B4JH 3FPYA 1L9SA 1H3VA 4MNQE 5DD6A 5TF1L 3NN8A 4WW2F 1XTLA 4CMMB 2DIEA 4FXTA 3RKPA 1UB5B 1IC0A 2R0KH 5IFHL 5H2BA 4WCYL 3NIFE 1EZSA 2DL2A 1R5VB 1MCLA 1UM5H 1UKTA 2UZIH 3IFOA 1S7SA 4MMYB 1I1CA 3TLRA 3TZVB 4F37K 1JNHA 1U8HB 4G3YL 1SGKA 1B4RA 5KW9L 1TZIB 2CGYA 4AQ1B 2XA3A 2IPTH 3BVXA 2LU5A 3EYFB 1Q9WA 5BRZD 1M7DB 1PDKA 4I4WA 1V3KA 3IDIB 4S11A 2BMKA 4ZFOA 4PJ8B 3ZUCA 3RZCA 2BSTB 5EORL 5BOPA 2OJEB 4XVOA 4YPGB 1HE8A 2IEPA 3MUHL 3QO0B 2N7SA 5GS0L 4ALAC 3JXAA 5CP7B 1OTUC 2HSIA 5I26A 5K39B 3V5HA 3B2MA 2BHZA 1SLVA 1MEXH 3T3MB 3F7KA 1G7QB 2WN2A 5J12B 1SJMA 2OMVB 1O6SA 3LEYH 4JHAH 5LDSA 3HC4H 4Y5YA 2I07B 2Z7WA 1T21A 5IHZB 4PJFF 4RMVA 1H0DA 2DMCA 3HHSB 3FRUB 1GZHA 4NNPH 1S7VB 3C6LC 4P06A 2X6UA 1OD7A 4DK5A 1PIFA 2MHAA 4UNIA 4P2OC 4YSCA 4QXGH 3TT3L 4NYLB 3N85L 2VM9A 2ZWLT 3PY9A 4I0PC 2HVKB 2HTLC 1R75A 5E6IC 5FC9A 2WM0A 2C3XA 4LMQI 5HVWA 3QZWA 3PQYD 4KJYB 1VEOA 4Z3JA 3CZSA 3BPCB 2F2HA 3B3IB 2WKOA 1CLZL 2Q6WA 5AOZA 2CGRL 4ZSOE 2E3VA 4RISH 2CMRL 1M57B 2K9UA 2I85A 4M9PA 3FKUS 3T6ZA 3CFQA 2VWEE 2E9WA 3V0WH 4B27A 2Q2EB 3WMSA 3D4YA 1PS3A 4JRXA 5DJ2B 3DVNA 3O45A 4G8GE 3NA9H 4XPBH 1AFVH 5GJSH 3S48A 2O5YL 3TEYA 3BWAA 3KAAA 2X0UA 1G9NL 3WV0A 2DQTL 2B0SL 4G71B 1EEYB 4LGRB 4DEPC 1DVSA 4FZ8H 4OCRH 2OQJB 2ZTBA 4Q4EA 3N9GH 4Z7WB 1BP3B 4KXZH 4GSDL 4NCDA 4X6CF 1P4IL 4YK4B 2DH2A 4G5ZL 5ESAB 5FGSA 1FVDB 3MSPA 2AEWA 3II3A 1N2RA 3WCYA 1XR8A 3IDNB 1MWAH 5SWSE 4MZ3A 4AI7A 4NKIH 4AGQA 3MCKA 4PWGA 1JVOA 1FLRH 2P24B 1SOSA 3ZTNH 4O02B 5JPMC 3MV8E 1I9IH 5ICYA 2GJPA 4XAWL 1SBSL 4UOJA 4I5BA 2IADB 3ZJAA 4AH2A 3I9GH 4LHUA 4HU8A 4H5SA 2BHFA 1BFOB 1GZQB 5DS2A 4D9RE 2XXGA 3SGJA 2P7TA 1F4WL 2P5WA 2YN5A 5A2KH 1A3LL 1Q0XH 2YD7A 4G11A 3I6LE 1OTTD 2D0GA 4PV8A 3EJTA 5D8JL 1IC7H 4LCIL 3D39E 3VDCA 2RR3A 5IV2A 1IM3A 1FZMB 4ZW8A 1KTCA 1W0VA 4FXKA 5DJYA 1XH0A 1CTOA 4QTHB 1XL4A 3TPUA 4NC2B 5D9SA 2D31A 5JA8B 1T0MB 3GPEA 4M6OL 1YECL 2XXFA 3D0LA 1KJ2H 5SWZD 3BX7C 3V4VB 1JPST 3RVVC 3SY0B 5FYLD 1XFPA 3BWSA 5AVYB 1FZJA 2VDOH 5I15L 2KDYA 2KMWA 1KTJA 5HP5A 3L17A 3RBSA 4I9WD 3CD4A 4XCNA 2FD6H 2WTRB 4JQXC 1DYZA 1L0YA 3VFUB 3HNSH 4J7RA 1NBYB 3WNMA 1U93A 3H0TA 2HT4D 4CC1A 1WIPA 5JIKA 4PGCB 2YWZA 1A6ZA 5F6HJ 2JLLA 3DRQA 2ADIA 2ZUQB 5DJ0A 5SWZB 3WLBA 2IH1A 3CVDA 3A67H 1CXKA 2EDNA 3S96A 3QFGA 1MRFH 3G6JE 2WQUA 4HD9A 3V6FB 5I75C 1NC2D 2BIIA 3H53A 3P0VL 4OLUH 5INCA 1IJNA 3RKDD 4EZJA 3WIHL 5EOTA 4MLSA 4YSQA 2YUVA 4PRHE 3DUSB 3IXTA 1TTCA 5K9JH 2WVVA 4ZAKD 2FSEB 4X5XB 3C8HA 1KEMH 1JZ7A 2E4FA 5K39A 4HKBA 1RUPL 3FTWA 3M1BA 3BOVA 3VD9A 3K8KA 3OQ3B 4D0CB 2K8MA 3GUTB 1OAZL 1W72B 3QPQC 3LN4B 1XCQB 3VD5A 4HYTB 5T3XD 2RALA 4GW1A 3ECQA 1MVUB 3PP4L 5DRWB 1DQQB 1Y1DA 3NH7H 4IKKA 5DWPA 1PVHA 1E9OA 4ENEC 4WEBH 4FQHB 3SDDA 5D1XA 1WUNT 4ZBJA 3CWGA 4KXBA 4Y5XC 1NCUA 3UYPA 4Z7QB 1EH9A 3Q6FA 5JOFA 4N24A 2F53E 5JLZA 2XN1A 5FA3B 1U8KB 2X7LB 1QA9B 4KQ4H 3DIFA 2W95A 5JHAA 2LFGA 2WNGA 3Q13A 2BP0A 4D9LL 3OAUL 4G43B 1CXEA 2H26A 4I9XA 3UJJL 3Q44A 1IX2A 4NZJA 4OVVA 3ATBA 1WITA 2K7QA 2ZCKL 4ZYKB 3T3PB 3MV8B 3TN0D 1MREH 1MY5A 1PAMA 4LVHC 1NL0L 2PW2B 3H2WA 3H7LA 1NFIA 3OV6A 1JD7A 5E9AA 4IHOB 4NZRH 3U2SB 1Q72L 1X5ZA 2EDDA 5CN1A 5B22A 3WUZA 5D7IF 5SX4H 4ZMQA 1CFSB 2KKQA 4XCFH 1XIWC 1A64A 2VUKA 2HTLD 4NNYB 4K3HA 1LL1A 2EDFA 1ZCRA 2VDNB 3FFCB 3NRPA 3WTUA 3BWAB 4EBQL 5DFAA 1E27A 5J11C 3DMMC 4XO9A 2WNWA 3SDCA 5EEYA 2B77A 2O61B 1DVZA 4KTDH 3UL4A 1G7LB 3MUZ1 1KENH 4Z76A 1LD9A 2APFA 3NFSH 2FEDD 4EI6B 4HWZA 3RY5A 3WFHA 3MGOB 1MKFA 2IANA 4GIOA 2UY6A 1JGEA 3ARBB 1KN2L 1MJJA 1JYNA 5I66A 3FFOA 4I9WE 1KJ3H 2X4OB 2X6CA 4DF9A 3GK8H 2PO6A 1M56B 2OKMA 2UXVA 2D7MA 2FRGP 2ZCHH 4HIHB 3D51A 4XVJH 1GA2A 1U8IB 4LXFA 2ADJB 3UGUA 1FYHB 1UFGA 5LJYH 3EFFB 4OIIL 3N42F 5C6TL 1ZLVH 3LYRA 4IW4C 5I19H 1JYVA 4NN5B 3H6AA 4OD1H 4CBPA 2YJLA 1FG2B 1CXLA 5DJ8A 2YZ8A 3NZ8B 1YN7B 4Q9RH 3DOSA 3TO4C 3QYMA 3WELA 1IT9H 1CE6B 4KRPB 3GRBA 4DEWA 3VRIB 5SWSA 1CVSC 3W1ZA 4XRCB 4KX8A 4TM9A 2OXGA 3I2CL 3ZDXE 4HIIB 1BJ1J 4GT7A 2PR4H 1F8TL 4QRSB 3TBTB 3UO8B 4E41D 3S37H 2ZOLB 5D7IE 1PG7W 5EC2A 3H2PA 3QFJB 1FWXA 1OE1A 4PCSA 5CKGA 3G04A 2IC2A 5ALBH 4BQ6A 1G1KA 5KZCB 5I0VA 4WTQA 1JNLL 2C4FU 4JG5A 1TYJA 5CZRA 4WENB 3ZE0B 3D85B 3BRFA 2RFXB 4RBPH 1UM4H 3KYNB 3SPVA 3GUFA 3LRGA 4A7GA 2Y7NA 1A5FL 2VSCA 4LIQE 2YA1A 4A2MA 3TWCL 5CD3B 4K5OA 4P2RB 4OFYD 1FO0L 1JHTA 1C16A 5FLVA 4MJIE 4PIRF 3VFPA 1D5ZA 1OE2A 1A7QH 4YDVA 4HLEA 3NGBC 3BWUC 5J12C 2XWEA 5KUKA 2DPKA 3VFSA 5FM4A 4HWBH 3IU3B 4GRWB 1AE6L 1R47A 1GZHC 2VXQH 2DYPD 4M1CC 3BFOA 4DGUA 5LN8A 1ITCA 2VN7A 3KBHE 35C8H 4Q9QL 3MRBA 1WFMA 3T8MA 2ZICA 4N2BA 3QDJD 1S78C 5JHDE 1RJLB 3OKDB 3AG1B 3SCMA 4LLWB 1OAYH 1IBDA 3SPHA 1ZT4A 2DS4A 5D6DC 4PM1A 5JW3H 3AAZB 2F7RA 4Z7VF 3DXAD 5FUZH 5DGQA 3O6FB 3POHA 4FRWA 4JANB 3BMWA 1EJOL 1SXNA 1NBCA 2IAMB 1ADQL 3T1FB 1IGCH 1OPGL 2ERJC 4TF4A 3NRFA 1OAXH 3CCHA 2FEEI 4ODSH 2XFXB 4PJHE 3HR5B 1FQ9C 4ODXA 4OQTA 2HPTA 3E80A 4BYHA 1KXHA 3D34A 1KJVA 1XZ0A 4FN0A 4DVBA 3ZKXC 4MA8H 1JPSL 3HCVA 3MA7B 4FQLH 3LRSB 4JFTA 1EK3A 1X5IA 1NSNL 2I7SA 1QSED 3HUJB 3C60B 4KKAC 5KBPA 4WHYG 2KYIA 1IKFH 1QI4A 5I1AA 2NPLX 4MD4A 1NGZA 4LLYB 4ZTPL 3QUGA 1D7FA 1IGYA 1KGIA 3X1NA 3MJGX 4H1LG 5DUMH 1PZ5A 1X7QB 3ILPA 3POCA 4GRLC 5F9AC 4NZDA 2A6JA 5HVHC 1ASOA 4HIEB 3V0WL 2KT6A 2L0DA 5F71A 5IMOB 1A6VH 2ERJB 1RUKH 1FC2D 5HHVH 4ISVB 5D71L 3VXOA 2A6DB 4X9GA 4TL4A 1EUUA 1CCZA 3PJNA 4OCRL 4P2RD 1VIWA 4MMYA 3TZVA 3ZZLA 3TESA 2D7TL 3SDXF 5DI8B 5K9QG 1II4E 1D9KC 2X53A 5E9NA 2J1XA 3ABLB 4D0DB 1DVFA 1ZLWK 1PDKB 1CYGA 4QJ4B 3EJUA 4B3VA 1XMEB 1BXAA 1PKQE 5CSZA 3DHPA 4P59L 5FDWB 2VLJE 5A2IH 1AR1C 1YDPB 4G8GA 4J6RH 4ELKA 3X12B 5BS0A 1AHMA 2J6EH 2H45A 3FT3B 2XA8L 1HQ4A 3VXSE 4TSCL 2F8XC 3KW8A 2XKNB 4U1MA 3FQNB 5A1AA 2K3HA 2IAMD 3GBML 1Z1WA 2CLZA 1WFOA 4PRNA 5FKAB 4XB3A 4JGUA 1XD1A 2ZAHA 4R0LA 4X6DF 4ZOEA 4OD2B 2XZQH 4GW5A 4MA7H 1RZJH 2F7QA 1DLFL 4J1UA 4DPRA 1RVFH 3GKZA 1BVOA 1NIDA 3IFNH 4ANUA 3L7FA 2VZVA 1WWAX 5I82A 2HN7B 1T83C 2E6QA 1MHHA 2NY5H 3CJJA 4N86A 1PNCA 5IVXB 1W8EA 4IOFC 4Y7MA 4ZD3L 4JDZB 4IGBB 1A22B 2EEAA 3ESNA 1DDHB 4IU3A 2ZOOA 3SGEI 5AD0A 2WBJD 1PY4A 4Q6IA 3GQFA 3LD8B 5GXBB 4G8FB 5C1MB 4OZHB 5DO8A 1J9SA 2IMMA 3HG1D 3FPXA 5DS8B 5GZNA 4HMCA 5HY9A 4M48H 1W6LA 2E9IA 3C2SA 4NRZB 3AB0C 3KWTA 2C7UA 4N20A 3ARVA 3GBNL 3O3UN 3D0VA 4TSBL 3HNVH 3MRLA 2A4EA 1BV8A 4FLQA 3QWOB 2R1WB 3PGCB 5ENWA 1JTOA 1ZVSA 1YEWA 2VDKH 4D9QD 1JK8B 5FXCH 1IFGA 1S8DA 1UCBL 2Q5BA 3VFRA 4ZUSA 4BUHA 4GMSL 2FJHA 5JHMA 1T03H 4RDQF 1RJLA 3LVEA 1BZDA 1YYML 3LIZL 1CYWA 3L81A 1X9RA 3AT9A 4KZEH 3P3TA 2X9WA 4GSRA 1DBJH 4H88H 4XPGH 5BQ7A 3GZPA 4WSKA 3LS5L 3ISWA 4NQEE 2Z31A 3F12B 5J9PA 5DUBB 2IH1B 1OB1A 1I8KA 4M7ZB 1RIVH 4XNDA 2OMUB 1EEZB 2IV8A 3OTTA 2VDOB 3UYOD 3DJTA 4XXDB 3RZCD 4Z78A 3RWIB 4WWKD 1XZ0B 4GKLA 2VXUL 4RFNB 4P9HC 4HGWA 1XIWB 3X3GL 3DBXA 1IGIL 2LAAA 3BZ4B 1OCWL 3BZEA 4V33A 2P80D 3RUGF 2NNCA 1J5OH 3RY4A 5EIVA 1D5XA 1UADC 4V2CB 1MVUA 3F3HA 2LVCA 3MHZA 3K2KA 4G5AA 5IW1B 2X3CA 1R9FA 3DK0A 4KROD 2I9LA 2ZUWA 3LQZB 4N87A 2Q86B 2DYPB 1HS6A 1X9UA 4AV5A 1J5HA 1TT6A 4MQTB 4S1DD 5FO9B 4MCZB 1LP9B 1OK0A 3T2LA 3E1ZA 3ZKQD 3GXIA 3CXHK 2AGJL 4NQEA 4MD5B 1F3DH 3NTCH 3ULUC 1VFBA 4I89A 1ODUA 4TLKA 4HH8A 3TFBA 4L8DB 4WU5B 4ATWA 1H3GA 3SB3A 5AVRB 5JUEH 3FQTA 3ESOA 3OHXB 5F9OL 3SE3A 1MCEA 1CVRA 2NQ3A 3AMKA 3I85A 4G6MH 2PWHA 1HAWA 1MLBB 4ONGL 2NLJA 2R23A 1UG9A 3SDXA 5GHWH 1T1YB 3ZDXF 4DAGL 3ZT6A 1NGXB 2HX9A 3TO4B 4PB0H 4HVBA 1KT2B 4JNXA 3GK8L 1V7NH 4KNTA 3UZQB 3TF4A 3HG1E 4FXKC 4EUPA 5DT1H 4GO9A 3T2PA 1S7XA 1JHKL 5ID0B 4M1CD 1FCGA 3WNIA 4A2FA 3RVTC 5ESAA 3WUWA 3PXHA 3FQNA 4LEXH 1P84J 1NMAH 4NI3A 1RUAH 4DKAA 3K81A 4KO7A 1SMAA 1KGJA 1IBHA 2B20A 4PAZA 1K85A 4GJTB 2EDTA 2JKTM 3UMNA 4WTZG 3RWJA 3SZKC 3QSKB 3C5ZD 3OHXC 1ZXKA 1DJYA 2WC7A 4BFIB 1VPOL 5C7XH 5C0ND 3M45A 4AIXA 4WHDA 5TDPB 1ZA3B 1MJ7H 3N85H 5DHVA 5KVGH 5GSVA 3KL3A 3M8OH 5F8QC 4Y4KB 5D7JC 5MI0B 3V55A 2JIXD 4UB0L 3EFFA 4K5PA 2FHBA 3MLVH 5EULV 4ZYKA 4Q58C 4J8RB 4AEHH 1BVKA 3VUAA 5IHZA 1RJZB 5IMMB 1MXDA 1M6UA 3V6ZB 1GW0A 4F8QA 2WQSA 1WP6A 2WYHA 4FZEL 4NRZA 3BSZA 1PX3A 2VMCA 1GY2A 1QYGL 5HHOA 3T0EB 4AL8L 5D2NC 3IDUA 4ZMXA 1FO0H 4U3XA 5FHBL 4PJBF 1F6AA 3FO0H 1G9NH 4CN4A 2A6KA 2CUMA 4NIYE 2G3NA 2H32H 2ZUYA 1U8LA 2KLRA 3B9AA 3QZNA 1RUQH 1FJ1B 4MKMA 4H8HA 3Q9QA 2AEOA 3QI9B 3SQRA 4HUVB 1WFIA 1IGJB 1IEHA 4RGMC 2BRRH 5A2CA 2Q7YB 3KXFD 2P8MA 1T4KB 4KDVA 4JW3A 5KOMC 4HG4K 2ALWA 3C6LA 1C1EH 1MHCB 4XAWH 2MNWA 5HYQA 1KJ2A 3QQ3A 2CHZA 5F1OB 4DN3H 2R56H 1QASA 3QI9D 4L1SA 2EVIA 1YNLH 2ZCLH 3LJ3A 5CLTA 4MZRA 4MCYA 3CMGA 4LCIH 4OGQC 3WO4B 3VSVA 4GQZA 3OAZH 2DLFL 3P3YA 5DJZA 5KANI 2EIJB 4J3UA 2AJUL 2YC1B 4F58L 3ABKB 2IADA 3APDA 1O7DC 2WQVA 1B2WL 4PWJA 2YD9A 4UU9A 2YAQA 4ZAKC 2JI3A 5EUOF 1RV6X 5K9QI 4H20L 3TA4D 3M6DA 3SYQA 2HFGH 3RZCC 2BSCA 2BVYA 2JJTC 1B3JA 1Z5YD 2F5AL 2WZ5A 5IJBC 1E2VA 2QQLL 2WMPA 5DGRA 4ZTPH 3L45A 1C5DA 1MFBH 3KPQB 5EC2B 2DKUA 5E1HB 4K8RL 4XPFH 1HWHB 1Y0LA 3TH3T 4OFKA 2H1PL 5GS1B 3B9EA 1THAA 2N59A 4U2YA 3VU2A 4BD4A 2B3RA 1P6WA 1JGDB 5D1QA 1XMWA 2Z0UA 1L5GA 3CMOH 3ERXA 1CU4L 1M2OA 5ITBL 5GS2H 1LNUB 1LO3H 3WTSA 2Y3AA 3KYNA 5DFVC 4WHTB 1CR9H 3GZQA 5B38G 2R29H 3VB8A 4FQ1H 4ZG1A 2UZXA 3BP7B 3HN8A 4TTGA 1HCVA 1EXGA 1ETA1 1FAKT 4XP6H 4MD4B 1PZBA 3VNZA 1MJ8L 2AXGB 3WSQH 3QCTH 3OB0K 2J2ZB 3OMZA 3SOBH 2PXYD 3LQAC 5IUCA 5IT2H 1OM3L 1HCYA 1CDHA 2W07A 5GGVL 1QEWB 2IQ9L 5DJDA 2BRQA 2DF3A 1OTUD 4FHJA 3PHSA 4Y16D 4CU7A 4KI5C 3GIVB 1IBYA 1T0OA 4I3SH 3E9TA 1G94A 4MA3B 4JPVH 2R0KL 4I88A 5IFHH 3EHBB 2IANB 4KHXL 2IBBA 3AY4A 4X6EA 2FIRT 3HI1A 2CHNA 4I48B 2EO7A 2YKLL 4TSCH 5D7KD 1CT8B 2OR7A 4U3HA 3O6FA 4JANA 2WZPD 5EEZA 4XMPH 5FECA 1QFOA 3FC8A 1JAEA 1EHLL 3QIBA 4N0UB 4H8UA 3I6KB 2VZSA 3C09C 1IBFA 2NXYD 1QQDA 1IVTA 1UM6L 4DO6A 2P9RA 2QZQA 3CG8A 1B6UA 2VLKD 1V3JA 2GABA 1TUPA 4X6CE 3IJ8A 1KV3A 2HYMA 4R4NC 4YNYB 5EF2A 5KSBE 3MV01 2VLJA 1URZA 1FZKA 1NL0H 2NY5L 3LPGA 5KSVB 3A6BL 4G6KH 2GJ6E 2Z6FA 1KGCD 4ZUVA 1FVEA 2VCOA 4ELME 3H7BA 2Z91A 2XQ0A 4JPIB 1E4KA 5LGJA 2JKNA 1QA9A 4N0CC 4ZS7H 2WXHA 3GHBH 3BPOB 4P5KA 1GOGA 5I8KL 3RPBA 1K4DA 1BECA 1F11B 2MMXA 3ZK0A 5HTSA 3V4PH 1M53A 4A2DA 1HEZA 5KSAD 3X2QB 3RY6C 3V0AC 3QQ4B 2HRPL 4Z0BH 3VI4B 4WTWA 4UIKL 3GSVA 4TULH 4LL4A 2H4EA 3D2UA 4QXTA 2OX5B 5I2IB 1L7TL 5IB5B 2VM4A 2IF7A 2XVLA 1IIKA 4XO8A 1AS6A 2ITDA 3IDYB 3LCYA 1D7CA 1ZKAA 1T4KA 3ULUD 1T03L 2X4PA 2VT0A 2Y1VA 1DDTA 1HYSD 4ADGA 1OARL 2ORBL 3FHQA 2BSRA 3DJZA 3HUJE 5E6IA 3QJFA 5HI4D 1LO5B 3MXWL 4UQEA 1HDMB 2ICEB 2WQWA 3MRQB 4TLTA 2QPDB 3HAEG 3ZU8A 3CFIC 4X6DE 4AJWA 4DGWC 4AYEC 5JOPE 1OSPL 5TE7L 4C56E 5JORA 1YPZF 2DLTA 2XSKA 1A6AB 4BXVA 5BZZA 1EO8H 3VAEA 1MNNA 1YEKL 3QRGH 3RDTC 3BD5A 4XBPA 1XGQB 5CLYA 1MFAH 4L29A 1FAIH 3QCVH 3B2PA 3AT0A 3VXSB 4CGUB 3V9EA 4K94L 4LSQH 5AVXB 5DURD 3V5KA 5CEXA 1X5GA 5A2LH 1HQRA 2PR4L 1N59A 2B1AL 4UZSA 4JFQB 4DUXA 1JDCA 3MLZH 2CJSA 4K5LA 2XIIA 3QDGD 4H1LH 3ZTNL 4AQ8C 5F9WB 1J5OL 1UZ8B 5SWSD 5HGHA 1E28A 3GRWL 1KEGH 4KZ0A 5GGQL 3GSOB 5JDSA 1AOZA 2FBJL 3DPBA 1A3QA 5CILH 1EHNA 4NO0D 1DBAL 4FQCL 1J1OL 2AXFA 2NX5D 3N43F 1CFTA 3EH5B 4LSPL 3S3SA 4PR5B 2VJ0A 2W5PA 2CE6A 1NTDA 3JWNC 3FO9B 3TWCH 1EXUB 5FUCC 1KIQA 5C8JA 2YGOA 5HJBA 3QHZH 2A1WH 3QJHB 5HDBB 3WY1A 3P4NA 1R3LB 2WQXA 3N2JA 4MXVE 1S7SB 3CAFA 3QQNA 4BZ1H 4XN2A 5D1ZI 1QUPA 2APXA 2G5UA 4MB3A 3RA7H 2ZX8A 5DFWH 4DETA 1QBBA 4ENED 5E4EB 5GHWL 2AQ3A 1KOAA 5C0BE 2BDNL 4PG2A 35C8L 1C5BL 2LU4A 4NUQA 4DT2A 3ULSB 5AW3B 5GGUA 2D7OA 3WY3A 3GSQA 5AAPA 2PCPA 4X0KB 4JFFA 4C4BA 3IS0X 4GG8B 32C2B 2OTWB 1GC1L 1NAML 2J55A 1M71B 2CH8A 3X11B 1CDBA 4N3TA 2J1KA 1BD2D 5B3NA 3L5JA 4LEXL 5BQ7B 1QHOA 5EU6D 4JHBA 3EYOB 1YAIA 4B7IA 3EOAB 3V0FA 2DM7A 1QBML 5DK2B 4ODSL 1GL4B 2CUAA 3OKNB 4PJIA 5GSRB 1PY0A 1G1OA 4KK6D 4QTIH 5MENE 3ZY7A 4ALAH 5C7XL 3D3VB 2XV0A 2I27N 4ZPTA 5HYJE 4L8CA 2YFOA 5F88B 4FERA 1G4RA 1QKZH 2MRYA 4IJTA 3M8OL 1ZOXA 1NZRA 2Y7MA 1J8KA 2X88A 2R9HC 1XAKA 5I6PA 4HUWB 1GYCA 2R7EA 4L4JA 3EG9B 3LZLA 3S35L 3WL9B 3LKOA 4NAQA 2E4TA 4E9YA 3LIUA 1CQYA 3K2IA 4WJG3 4UQIM 1F11A 3HHRB 4G6AC 3FHEA 4FG6D 2NZ9D 4IK6A 3V5DA 1X6NA 2BJMH 2A9BA 3MA7A 2JKRM 3NIGB 4LOEA 5KBDA 1XGRA 4PS7A 3LRHA 1DL7L 2HN7A 3NJVA 2VYRE 3NABH 2HT4C 4WI5A 1TMCB 1H8NA 3CDGB 4V1DB 5IGXH 3QYCA 1N5AB 3ILDA 1VZHA 4RMSA 2D2CC 5TDNB 4YO0B 3TT1H 4ZAKA 4YHOL 4NS0A 2AVGA 3SKNB 5E5LA 4Z7WF 4PN6A 1LK3L 4TRPH 1CICC 4K7PY 3O11B 4AT6B 5ICXB 1U95A 3OF6D 2N0MA 1OVZA 3QFJE 2C1OB 5IJDC 2WO4A 4MJIA 2NUPB 3V0VA 3MLSL 4NQQA 3BQUB 4F1ZA 4JO4L 3UAJA 2CHWA 2XU9A 4OUOA 4R4FL 3QWOA 8CGTA 4LLAA 3BP4A 4UAOB 1MW2A 4AY0A 1SEBB 1J10A 1SXZA 1A6AA 1NA8A 2XNAA 2V2XB 3S4SG 1RU9H 4KKQA 3FU7B 3MC0A 2CBQA 5FUOH 4BQ9A 2XQBH 1DVFB 3DGCR 1JZIA 3R0MA 2OQJA 1TJGL 4OLYL 4IIQB 2AP2A 2NT1A 1Y6MR 4WWID 5JIQA 1BXUA 1BVZA 1FF5A 2A3TA 2MFNA 3CHSA 1D5IL 1HIMH 2CWRA 4ZW5A 3K1KC 3SYCA 3L4XA 2HFGL 1N64H 1U3JA 3AABA 3WOVA 3RFZB 4NN6B 1E0OB 3QGVA 2FYVA 2A9NH 2HKHL 1ET8A 1OGTA 4HHWA 4NGHL 1MFEH 4F37F 4A37A 5TDPA 2HG5B 4E0RA 4BJLA 1I1YB 2BNQA 1M2VB 3L4VA 4JDVA 4XVJL 4BFGA 4YXLL 4I77L 4L3ED 4LLQA 3L9RB 3T65B 1RUMH 2ICWA 3L3DB 3MU3A 3GSUB 4HEMA 2Y7OA 4NHUA 3RWGB 1RLWA 2O6DA 1GGYA 3B9KD 1WE5A 3ZOAA 1QWUA 1S3RA 4PRPE 1CB4A 3EH1A 1F00I 4F9LC 4GBXA 4L9DA 4M48L 5JR1H 1EFXB 1FPTL 4NQCB 2ZUUA 3BDXA 3M1OA 4GAGH 4PRPD 4HXAH 1QSEE 2FJGB 1IT9L 3IJSA 2R39A 3CH1B 1MWAB 3QB7C 2C9SA 3G9VA 4JAMB 4Q8BA 3OF6A 2ZUSA 1ID5I 2Q8BH 3AG2B 3CSFA 4JKLA 1MFVA 5HI5C 2YRZA 4ZFZA 1UZ6E 2XBTA 3RFZC 2R59A 1U8LB 4LEBA 2FEDC 2VDLL 4FS0A 1G5AA 4B7LA 1TQUA 2P45B 3MJ6A 4QYOB 3IGKA 1JGLH 1B0RA 1CGXA 2CUHA 1XO8A 3MO1A 1A6WH 3FT2B 2WLZA 3VXUB 4UTBA 4D9RD 4DP5X 5HI3D 1BEYH 5IIEA 1A1OA 3K91A 2P48B 3QR1A 2FR4A 2QPFA 1MI5B 2WINA 3PV6A 1HZHL 1AMYA 2PYEB 5DQ9A 3GWJA 4WHTA 1JWSB 2EYRB 2NNAA 3QQ3B 3MRDB 5EA0L 1ZWIB 5ISZE 1IQDA 1TZGH 4FA8A 5C0AD 3ARTA 4AQAA 4PP2A 3D39A 3O9WA 3VTAA 1WAAA 3BH8B 4QRRB 4L8SA 3EFOA 4FCAA 3B2VL 1WFNA 5H35B 4N5ED 3KPRB 1F4XH 2X7LA 3MV9A 4TLSA 3RDTD 3AQZA 3QH3B 1QFWI 3IPEA 4PRIA 3SKOB 2YPVL 4C47A 4N90D 1YCSA 2VITB 3WLWD 2LV4A 3IU4L 4ZNCD 2XN9A 2BSTA 2VTFA 1AHKA 4HGWB 5EDXA 5DRWA 2X3AA 4DGVH 5AALA 1ANUA 4MJ6B 3MDJA 4MVBD 3GHBL 3JV4B 4HJ0C 3O4LD 1K4CB 3MLXL 3HB3B 3KLAB 2XWTB 3QS2A 3MV9D 1KC5L 2H3NA 2VERA 3ET9F 3FT0A 5ABDE 1U3HB 1NCDL 3N1FC 5FW7A 4E41A 3BKYH 2Z7YA 1KG0B 1U8QA 3I74A 1A2YA 1FRGL 1HKLL 3N0AA 3N6YA 3OM3B 4M7JH 4X99A 4YDNA 3TYGH 3W9DA 4PRPB 4WEMB 1A3RL 3R06A 4PRHD 3GGWA 5T3ZE 3N5AA 3LKQB 4FQLL 1T21B 3F8UB 5FGRA 1DP0A 2H3KA 3HN5A 3PL6B 3BLPX 3U9WA 5BCAA 3LNGA 4BSWA 4ZDHB 3N50A 2WO2B 4MD5A 4HEME 2W8CA 3QQDB 4N8UA 3D69A 2DTSA 3D18A 2NY3D 3NYKA 3QO1B 1NMBH 4LVHB 4XCEB 4N0YH 5IB4A 4JVUA 5IMKA 4MJ4A 3HN3A 4AZ8A 3L3OC 3T6XA 3CHRA 2FIKB 1TLKA 4KC3B 4CDGC 3QUKB 4F1SA 4UBDD 5AAWA 1SDDA 4C54A 3A21A 3MNVA 5JQHC 1B88A 3RWHA 1KBGL 3GMOB 3QRGL 4UM8A 5C97A 3SBPA 1QHQA 3SE8H 3TXAA 1MCWM 2CDEB 4L5FE 2OYPA 4JM2F 5F0LB 5T1MB 3PWPD 2ZKXA 1SUJA 3V79C 4R8WH 1W72L 4KH2A 4OM1H 4KHTH 3T3MF 3IPBA 1D5MB 3MGAA 5SX5K 4UTCA 4NJAH 2NQCA 5HHME 3NJHA 3A5VA 3PXJA 3EAKA 4BKSC 2WQRA 3OC8A 5EDSA 1AHWA 1YMMD 4JFOB 5DMKB 1R3KB 3US1A 4DQAA 1BXXA 1XGPA 4M1GL 3QUXA 5GZNC 3OSVA 4PG9A 4GUOA 1DBMH 3B34A 2DWEA 2FBJH 1UKQA 3O2WL 1DBAH 4FQCH 4DVRH 4RH4A 4BUGA 2J6EL 2WOYA 5TE6L 5EBMA 1INEH 1BYOA 2VC2B 3NZ8A 3JYCA 1UURA 4Y16A 1QYGH 5KSBA 4M62H 3F84A 3QUZA 3S88H 1YNKL 3P9LB 2E7CA 4KI1A 3TBWA 2X1XR 4M8QA 3TBVA 4A6YH 1S7RB 2WYTA 4LPTA 1QSFB 2G3XA 4TSAL 4C4KO 3TNNA 4APXB 2H32A 4FJZA 4UT6A 4MNHB 5FA4B 3PWLA 1L0XA 1NLDL 1VKXB 4XC3L 5KYUB 2W91A 3KCWA 5I1CH 1C08B 1FZJB 4AKPA 3EYSH 5F70A 1AR1B 3MRHB 4FMKA 4G2AA 4QYOA 4ZSOB 5G2NA 1U92B 1E28B 4HOMA 5I1HL 5I1KL 2BDNH 3MCLH 1BMWA 1M1SA 1IAOA 4J5VA 1DFBL 4KVPA 5D9SB 2QHLA 3OQRA 3UAJD 5I71C 4ZTEA 2YSSA 2VLLB 2JK5B 4NN7C 2OK0H 5ESVA 5FYJU 2NY3B 5A2FA 4ONFL 3LH9A 4EZKA 1NCWL 3L9EA 3OZ9L 1R3JA 5IBTL 3WIFA 3F2LA 4TSBH 2PP9A 4R2GD 2OR9H 4WJ5A 5DMGC 5IFAH 2G0LA 3WENA 1HN1A 4LARH 5INDA 3JTSA 4L1TA 1KGYE 1JWMA 1NICA 4YL9A 2VGLM 4XZUA 1W8OA 4JG0H 4OFIA 2ZSVA 5CCKH 2QVIA 3GD1C 3QRLA 4IRSD 2WLNA 3RIAF 1XCQA 4QUOA 5CIPA 3ARWA 5I0XA 4OJYA 2M26A 2I9TA 1JHLL 1MCIA 3S3PA 3SPJA 2QQLH 2PP7A 2Y36H 5D7IA 3CIQA 3GI9L 4ZJ9A 3RAJL 2ZXQA 2NY4C 5E6UB 3RIFK 3V4LA 3S37X 4YXHH 2FSEA 4X5XA 4XNYL 4XPFL 2A77H 2WO3B 1DVTA 4XXCC 5LHDA 3S8GB 5JOFB 3W9EB 4AJVA 5JMOC 3BQVA 4WZ9A 1RPUA 3MODH 1U8KA 1CIUA 2FH6A 4HJUA 4M61A 4WRLA 4CC0A 4IBVA 1B9KA 4PWIA 1G6RB 5I18L 4Y1AA 5JO5A 4L8SC 2COQA 5C92A 4LLVA 2X2JA 4O5LH 3BQUC 3DX1A 4WHYH 5D1ZD 4B3EA 43C9A 5FYJE 3KLQA 4JFHD 2W94A 1MLCB 1PLAA 1DEEB 4LB8A 2E27H 4ZUVB 5I76A 4YXKH 1ZHNB 4OGAC 5GJTH 1DBBL 3CZGA 4NDMA 5DR5L 3B3IA 2F5BL 4Z77B 1JJUA 4YDZA 5B3JE 1MJ8H 4N8CH 3WSQL 3H9SD 3L3GA 1QP1A 4JKPL 3UC0L 2HUEA 3UTOA 4KITB 4CU8A 2DMBA 4PY7B 5G5DA 4KJYA 4G6FB 3BPCA 2EUWA 4N2AA 4G7YL 5CF3A 4ZQTA 4YHIB 4GUPA 1F58H 3MV8A 3ZE1F 4A6YA 4ABUA 1SMOA 2ZSWA 4FL4B 3CDZB 4H8VA 3SQBB 3D0AA 5EUKA 2APBA 1QPKA 4LEOA 1KBVA 3WIIL 2BIQA 2IDCA 4K07A 4IOSA 5FUOL 5H94B 1BQ5A 1VA9A 2RH0A 4MZ2A 1S2EA 2IWGA 3VX1A 4EZLA 3JV0A 5T1MA 2JKLA 4LE8A 3GB7B 4OAWB 2ZWKA 1VEMA 3T1WA 1NIEA 4PREA 3ARZA 4GQ9L 1E40A 4Y89A 5IJVA 2F0CA 2DQHL 5IQLA 3VFMA 2FEJA 4QOKE 3QDJB 4L3AA 2G0KA 3IN2A 4FJ6A 3OLEA 4R6UA 4OCWL 3LQAH 1QRNA 3DTXB 3LNEA 3WFHB 1H15A 1CT8A 3L7FB 2RCSH 2WTOA 4FQQB 1RUML 3PDOB 4YFDB 5C0GA 3M46A 3GJFH 1CE6A 3FSZA 4ACPA 1A4JB 3FUDA 4PJFA 4I2XE 1CE1H 3OKDA 1W0VB 4FFZA 3B9DA 3FQWA 4MB1A 2F54E 5HYIA 4ECNA 4GAGL 2X09A 1Q0EA 4Q6IB 1OOWA 2XN2A 4MSWB 2QGCA 5F7NC 2IH3A 1KTKE 3UACA 4MMXC 5HYEA 4U6TA 3J07A 5CU9A 2H9GB 1QAWA 1NLBL 1JIBA 3QI9C 3QG6A 3DRTB 2Z91B 5D6CA 2VDLH 2VR8A 3NJJA 3REWB 3NFPB 2XLLA 5I28A 3QUMH 4M00A 4MNQD 3L3DA 4JJHA 1NC4A 4HGMA 5C0CB 5IHWA 3TCXA 4OZ4B 5IP4A 2KDGA 3QWNA 4UZGA 4LSSL 4XWGH 1VJSA 5I2IA 5EZJB 1IC4L 5DA4A 1JZDC 2VUOA 3OBAA 2JTDA 3DIDA 4HKZA 3L5WA 3B1UA 4X8GA 3UG3A 3IFOB 4HD5A 4AL8H 3QCUL 4JAMA 1YN6A 4KKLC 1ZA6A 4YHNB 3MRNA 2YPKB 4JQIL 1L3WA 3LEXB 4N2NA 5D2NA 1Q0YL 2DJSA 4N0CD 2KHAA 3NIDF 1Q9WB 4Z7OE 5BOZG 1KPVA 1G1YA 4RRPM 3IK2A 1AJ7H 3C12A 2PCPB 5KEZA 1CIDA 2Y07L 3OGCB 2F7IA 5ES4B 5KYWA 1PMYA 5EU4B 4MS8C 1GIGL 1F4XL 4ZO8A 4IRJA 3C60C 1BLIA 4IOFD 3TX4A 3VXRB 1I9RL 1MCJA 3OXRB 2A0LC 1FNSH 2E0PA 2EDYA 3JUZA 2QKIA 4PS3A 2PP8A 1D3CA 4NO2B 4Y1SA 1HCFX 3ECBA 3N3EA 3AW5A 1IV8A 4LKCA 5FWQA 4DGVL 4FA6A 5EU3B 1J1OH 4ODXB 5KTEL 5KUMA 2QQQA 5ERWB 5JLZB 1KN4L 4Y1AB 2WVUA 5FYLL 2ITFA 1MCNA 2JB6B 1AKJB 2Y9RT 4JKNA 4M7ZC 2N01B 5I0ZA 3DETD 5L7XH 2HJFB 2I60H 3CK0L 1Q1JH 3T09A 1OAKH 2FE0A 1UYWL 3H42L 2AJUH 3FQUB 4GSQA 3WJJA 3ES6A 5IB3A 1E4WL 3VFNA 2AJ3B 1KELL 1NMCB 1MWAA 3QXAA 1QLFB 4A7TA 5T8IA 5F7WC 2WXFA 4Z7AA 1HL5A 5FW8A 3HG0A 4LT7A 2W92A 1WISA 3QZLA 1ASQA 3HZVB 4QGTA 3EDJA 4WFFE 4JRYA 1LO2L 2K6WA 4G80A 1MRCL 1N5YL 1BOGB 4IRZA 1VACA 3JYBA 4JQVA 1I9EA 3T2NL 4L23A 2ICES 1S7QA 2HXAA 3SEPA 4ANWA 1B0GA 4ZUWA 4X6BB 5GISL 4ZAKB 2DJMA 4A7VA 4GRWF 3V6BR 1KIUB 3CBJB 4K7FB 1K9TA 2QLVB 2W81C 1CBJA 3PWJA 4Q89A 3CFJA 4GKZB 3QC6X 4WUUD 3WS3A 4YHYC 3IMSA 4LVEA 4ZK8A 3DJ9A 4NUJB 5DHYB 2QADD 3VFMB 4DCQA 1LO0L 2R2HB 3BO8A 3F00A 3L2NA 1W72H 4N1EA 3AREB 2Y2YA 4BSVB 2R2CA 3MGOA 2CO2A 2IDTA 5KJ4A 4MMZB 3ARBA 3GSXA 5C08A 2X4RA 5E8DL 4LVOB 2BS8A 3NZSA 2OZNA 1SNRA 5DF0A 1RMFL 1KIPA 4N28A 4QTFA 1DBML 3MBEB 4CW1B 5M7QA 1UENA 3IJYB 3U30B 1RULL 4ZUTB 1EAQA 1DSWA 3OG4B 4JPVL 4CVUA 3PREA 1SJVA 1AGBB 1GYVA 4X9BA 5EU5A 1UC6A 1VDGA 2IH3B 4IKJA 4YHYB 1BQHB 4G6FD 4GQPH 1OGTB 1TXKA 1EHLH 1KZYA 1YN7A 2X4NA 3ECVA 4WY7L 4L0ZA 4E41B 4YWGH 2XKNA 1XF3A 2DWTA 4U1MB 3IDYC 4YHOH 4BCZA 3DV6B 5J6GB 2HWZH 2OCFD 1SM3L 3APFA 3CE1A 3U4EA 1FA4A 3ALXA 4PJ9A 1SOQA 1INQB 3WBDA 3VWKA 3BGFB 2V9RA 3ARGC 4JKKA 4RGOH 2APWA 3NBNA 3QI9A 4GOSA