5I73C

X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central and allosteric sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i73C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i73C01
4I5BB 4JVPA 4TVSa 2DKMA 4KKBC 1NMCB 4QHKI 4LQFH 4HEME 2H6PB 5FYKE 3V8CA 5E2TL 4OLWL 1QLEH 3F6LA 3AROA 4ELME 1I8IB 4HK0B 2VQ1B 4G42A 1UH3A 3H7BA 1QO3A 3T0XA 2BOCA 5B39G 4ONFL 1SY6L 1QKZL 2YD8A 2K1MA 4WI9A 5DDHB 2UWEE 4KWUA 1F3DH 3I50H 3O0RL 4ZTPL 5BXFA 4PP1D 5E5MB 3X3FH 1H3PH 3BP7A 5LBSH 1WWBX 3PJSB 2D4DA 5EIQA 3BAEH 3DBXB 2F54B 2XA8L 1U95B 4NN7C 1NGQH 1YDPB 3RAJL 2IADB 5D5MA 3QIUB 4WNQB 1GGCH 1ETZA 2FH6A 3TN0C 3ECBB 2VDQL 4JFEB 5E6ID 3SQOL 1V3MA 1EGJL 3EHBC 4DKEL 3GDBA 1IGFL 2ZPKH 1XH3A 1OM3L 1RIUH 2P5ED 1MJ7H 2P7TA 5F9OL 2Y6SC 5D70H 2PXYD 4APQA 3MLXL 4OCYL 3FT3A 3CDYA 1AKJD 4LPXA 2DL9A 3AREC 4FFZL 4YXKH 4WHYG 1SEBA 2GSGB 4R97B 3V79C 1EAPB 1NPUA 3RTQD 5FDYA 4IRSD 4QY8A 4XB7A 1A6WH 1NANI 5EU6E 3JWOL 1JYNA 3IFNL 2R0KH 3ARGB 5ID0B 4M00A 3VFOA 1ZE3C 5AD0B 4PY8I 5EO9A 5T3XD 4DGIH 4TTGA 1ADQH 5HYJE 3IS1X 1C5CH 2DI7A 5EZOH 3N85H 1NFIA 4BFBD 3WXVH 1FVCA 2PYEA 3GGWA 1JNJA 2OJEA 4G43B 2DF3A 5IVOA 1NJ9A 1RZFH 5ESAA 3TO4D 4KVNH 4L8DB 4OAWA 3LN5B 1EXUA 1U8MA 2CGRH 2YWZA 5CP7A 1X5FA 3RUGE 4M4RA 1FH5L 4BQ9A 5GS0C 5IQ7H 4BFGA 5DYOB 2NMSA 2YRPA 1ONQB 2Y4SA 4NUJA 1FNGA 4S2SB 1I7ZB 4PJ8D 4ODVL 4O02L 3ARTA 1XFPA 4BM7A 1T2JA 1EUTA 1KPVB 4DZ8A 5ALBH 2GTWB 3NZHL 1HQ4A 3MA7B 3S96A 5DUMH 5IWLA 1UJ3B 3VGDA 3NGBC 1D5ZB 4N68A 1A7BA 15C8H 2NY4B 4U1GC 3SE4A 3K80A 2KKQA 2R4RH 4WENB 1BIIB 3H9SB 5EUOB 3WKNA 1KB9K 3W0WE 2DQGH 3QJFB 3TVMB 5I19L 1YUHA 2W9LA 2XWJB 2Y36L 4WV1C 1UM4L 3F7VB 3UBXB 1KXVC 2VDKL 5C0IA 3GMPB 1B0RB 4Q7DA 1IQWH 2NXZC 4OD1H 3CFBA 1Z9OA 3JWNC 3TNNB 2RHEA 3MLSH 4CADB 3IFPB 4BZ1H 3PWUB 3E6HB 2HKHL 2BCKA 3S34H 3L3OB 1M7IA 1L7IH 3OGCA 1JZ3A 3AM8C 1FNSH 4YX2L 2LU7A 3KR3H 1A9BB 2IAMC 3BXNB 4MSWB 4NDMA 5IB2A 4LHJB 4XWGL 4L8BA 4LSDA 3CXHK 2NY2B 4R90H 3IDJB 3ARFD 5F7MC 3SCMD 3B43A 5EORH 4F57H 1NCNA 2CK0L 1IC5H 4U1HA 4XI5D 4RMWA 2HYMA 2FATL 2H2SD 5F1KC 5LAXB 1MOEA 1BWWA 5HHMB 4L5FH 2V5TA 1A9EA 2NLJA 2X1QA 1H3GA 1OTTC 4O5LL 32C2B 3DGCR 3HR5A 1Z3GL 5HHOB 3MLRH 4MJIA 2YPLB 5C2UB 3L9RA 3QUMA 4HCRH 4HIXL 4M9PA 4XP9H 4KJWD 1TPXC 1HILB 3QAZB 4D8PB 1YMMD 1HEZB 4WW1B 4KQ4H 4FQ2H 1YEEL 5F89B 4FZ8L 3U7YH 3NA9H 1C12A 2CDGA 5HDQH 3MLTB 1WEJL 1I8KB 4RFNC 1KNOA 5IBTH 2A1WH 3VCLB 1M6OA 2APFA 1UZ8B 3ARZA 3Q3GA 5KSUA 5A16B 4Y5XA 2B4CC 3HZYA 5FYLD 2DWDA 5GS0H 2X2YA 4NJAL 2IPTH 2AI0H 2DOCA 3KPMB 3VD9A 4X6CA 4JFFA 3MRMB 4N90E 1BZ7A 4YO0A 1P7KA 4XAKD 1ZT4B 1UG9A 5MP6H 4U6HA 3RGVB 3KWWA 3QDHA 4JGUA 2BP3A 3T3PF 1MF2L 5K93A 3HC3H 2R23A 4NWUH 4WHTB 1E6OH 1BQLH 1PZ5A 5CEZH 4HS3B 3C6SA 2ZOLA 2YHGA 1MAKA 1ZLUK 3EDJA 1EVUA 43C9A 1HINL 3NIFE 1JZ8A 5EC1A 1GOHA 4PRNB 1IC1A 2R4SL 2EE6A 3GMNA 1KIUA 2QL1A 5F93C 1Z5LB 3VFTB 1MCEA 2OMBA 1CL7I 3WS3A 2Z35B 2NTFA 3BVNB 4FQHA 1AY1H 4XNMA 4AIOA 4HUUB 4PLNC 4YFLI 1PKOA 5DK2B 2R8SH 4KMTH 3JWDC 4NFCA 2AP2A 5F1SA 3M8OH 1NL0H 1L7TH 2BY0A 4QTHB 1OAZH 2VXSL 4HUKB 3TZVA 2BFVH 3WFCH 1OAUL 3SGKC 3C9NB 5FUCC 4ONGL 1J0JA 2A9MH 4AY0A 4KZDH 1IAKB 4P9HL 3F62A 1D5MA 1N5YL 3AAZB 3OZ9H 1MEXH 4PJHF 4MXWH 5KAQG 4WEBH 5D2LB 3WFZA 4EN3C 4MNGA 3K4AA 2NY3B 2WINB 4U49A 3K2MC 3ARFA 3LMJL 3DUSA 4P4KD 1FZJA 5B21A 5L6YL 3IU3A 3PIQB 3AVEA 3GHBL 4TQEL 4A6YL 1NSNL 3HAEB 1A7PL 2X4QA 2X4PA 1WFNA 1REIA 1WV7T 5TGBB 3QEQB 2W0FB 3BIKB 2X40A 2P4AB 4LPCA 3H0TA 1ACYL 2XXCB 5A40E 2R0LH 1GZQB 3FQWB 3QUZD 4UAOB 3FB7A 1NBZB 3VXSD 1KCUL 4JFZL 1FO0B 4FTVA 3C8KB 1ROWA 3MLVH 2B4CH 3ARBB 5ILTL 1WFUA 4NOBA 4LSVL 1I1AA 5E24E 4NN5B 1FYTD 4P9MH 5E6ZA 3STZA 2XZZA 4GQ9L 4FNLL 4YGVB 4P2OD 4Y4FC 5A3ID 3HZKB 4ZUSB 2YRLA 1OOAA 1OLZA 4JN1H 2XN9D 3QIBD 3WFHA 2P44B 4FOMA 5DD5H 3RWFB 5EU3A 1JP5A 1NAML 4M6NH 4HK3J 1CR9H 4EBQH 3BW9B 2PO6D 4NQXB 5MERA 4PTTA 1C08B 4HHAA 5F3HA 4LQFL 1OGTB 1ZT7A 3SBWC 1P4IH 2EKSA 1PJ9A 1WZLA 1QLEL 5DFVD 5I66A 1DVFB 3B2UC 2AEWA 2KZWA 4XXCA 1HOCB 5CMAB 5SWQB 4LLMB 4LLAA 3OKMA 4W70A 4WW2C 1K6QH 4NBZB 4N8VB 3I50L 3ZHLA 3C87A 5D1XA 1T5XB 1MHEB 3X3FL 1H3PL 5LBSL 3LKRB 3P4MB 4BFEA 3MRHB 1N26A 3BAEL 3DX7A 5F6HI 3UTPD 1T04A 2LVEA 4U05A 3GKZA 3QG6B 4TTDD 3RWHA 4PREB 1NGQL 2NW3B 2Y9RT 4XCYA 2D9QB 5HPMB 2OXGA 1FNFA 5EG6C 1GGCL 5IMMB 1KENH 1I9JL 4IMKA 4JFDB 2ZPKL 1A6TB 1RIUL 4YHKL 1MJ7L 3MJ9A 5D70L 2YR3A 3ZLQC 3KAAA 4PJ7F 3D85B 4Y5VA 4Y4KB 5E1AA 3GMLA 4YXKL 4JPVH 5FM8A 2HT4C 3VG9B 5J1TC 2YSSA 1XCQB 3EYFA 4D0BA 2HFFA 4DK3A 1WQVT 1R3KB 4JEGB 5T3ZH 1A6WL 4JFFE 4Q6IB 3BDBA 3O41B 2X4NB 2R0KL 3E0GA 1F2XK 2Y7QB 1KJ2B 1FGNH 5HD8D 2J8UB 4JO2H 2DLTA 2NNAB 1DBJH 5K9KB 1HHHB 3IFLL 4DGIL 1C5CL 3C6LB 5KSBF 2I07A 5EZOL 3N85L 4W4NA 4XH2B 3RL1B 2E8YA 1U0QA 1QFHA 3WXVL 3WDJA 5JW3H 5GZOC 3PNWA 1RZFL 1XGQB 4NO5A 3H2WA 3W5NA 1EEQA 3MJ8B 4KVNL 5D7JA 4F7MA 1U8PB 1F02I 4DVBB 2CGRL 4L8SC 3KPRD 4OB5H 5F7HA 1U8HA 3ESUF 4YHIB 5IQ7L 3ULUC 4Y4HC 3UX9B 3HE6B 5DO2D 4P2OA 3VXTB 2DQHH 5DQDH 5MEPA 2YA0A 4MXQD 1MJUH 1KUMA 4WO4B 4ORGB 4C59B 3DV4B 5LKNA 1I8LA 5EO0A 3TA3B 4LLVA 5ALBL 3L3GA 5BV7C 5DUML 1IEBB 2VR5A 2PO6A 2EXYD 5GGSB 4IHOA 5D93C 4CN1A 1SYSA 1NANH 4JKMA 4NRZA 1A0QH 2R4RL 1P69B 3ARUA 1UXSA 4NO0D 4DQOH 1LK2B 3D1MC 4P2CG 1I1YB 3G5VB 2DQGL 2VLME 3SDDB 3OR6B 1CF8H 3EO0A 2X9YA 3QO0B 4GG8B 4ZUWB 1I1FB 1AGDA 4F9PA 4L3ED 3RZCD 5SWZB 3ZTJH 1D6EA 1A6AA 2YA2A 1IQWL 4OD1L 5F7WC 4HWNA 3MLSL 3D0VA 4LOUC 4LF3B 4BZ1L 3LQMA 1W8OA 4HUMB 2SEBB 2J6EH 2X4TB 4KK5D 3S34L 1R3LB 1V3KA 1BBJB 1L7IL 2H2PD 3BGFB 4ZSOB 1FNSL 2H3NA 3ZZ1A 6CGTA 4JFYA 3VXRB 3G5YA 4PGEB 4FTVE 1NEZG 3D0LB 1LEKB 4P2QB 4M4PA 4R90L 2HN7B 5EORL 4F57L 5DGQA 1ZV5A 1IC5L 4JANA 2G2RB 4OZIF 1NGWA 2EECA 4X99B 1YZZA 4JZOB 4L5FL 4P46D 3P0VH 2DICA 1ZT1B 3MMEB 4GRLA 1MRDH 3MRJB 3I6KB 4XCEA 1NMBH 3O6FD 2IG2H 5DMKA 3MLRL 4XRCB 1G84A 5FYLE 4ZD3H 4HCRL 5FYJU 1U2CA 2GT9B 4XP9L 2XZAH 4D3CH 4JM4H 4YNYB 3R1GH 2VDPH 4FQ2L 4KQ4L 5JHDA 4RFEB 1QACA 4I0PB 3U7YL 3NA9L 5HDQL 3C60C 3EOAA 1AHWC 5T1MA 1IT9H 1FN4B 4XAKE 4CDGC 2A83A 1K5NA 3O3EB 5IBTL 3H9HA 1E0OB 2A1WL 3BHBA 3Q0HA 4LPTA 4D9RE 5HI3D 4PRPB 1ZLUH 5H37H 3IF1A 1P7QA 4KUCF 1XF3B 2D0GA 3I85A 3W9EB 2W65B 5GS0L 3WS6C 1T2QH 2FSEB 2IPTL 2AI0L 3ULUH 1QRNA 4LIQE 4PJIF 4JPWH 1BOGB 4OCXH 1UFUA 2IEPA 4X6EA 1YNTA 3U30C 4N9GB 3RVVD 4L29A 1T3FA 4MD5B 2FX7H 1S3KH 2X4UB 5T1LA 5EUKA 2HTLD 1A1OA 3SDYH 5MP6L 1DDHB 2W1NA 2IC2A 4WI3A 3QP3A 3L3DA 5GRXG 3T0AA 5BV7H 3HC3L 3T1WA 1E6OL 5JA9A 4MB3A 1BQLL 5CEZL 1I3RB 1FE8L 4QRPA 3FT4A 3NMEA 1FJ1B 3ABZA 3CSYB 4JVWA 3SDAD 1QLFA 3D48R 1MCHA 3CXDH 4KDTA 4HC1H 5HXMA 3SGJA 4MD4A 4AL8H 5DHXB 4UIKH 3PV6A 1PEZA 3N1PC 5MI0C 4U0QB 4X7CC 2ZNWA 1AGCB 1HYSC 2ESVB 2ZCHH 2FBJH 1G7IB 1Z0MA 2JF1A 4H5SB 1AY1L 3X12B 2CDEA 3DRTA 2R8SL 2HFEB 4L3EA 3UAJD 4KMTL 1F8TH 2F19H 5HDBF 1LO5B 4R3SB 3QDJD 3M8OL 2FR4A 1NL0L 1L7TL 2UY6A 2PCPA 1OAZL 5GRVK 3WFCL 2BFVL 4LRNH 4GBXB 4LGPB 2E3VA 2CD0A 2IBZX 3ARXA 1J8HB 4ZS7H 4FFWD 2A9ML 4P5MB 4YUEH 4KZDL 1NKRA 4PTUB 3IDIB 3W11C 1YPZE 1NQBA 4APQC 4QRQB 3OZ9L 1MEXL 1OTSC 2D7TH 2X89D 3G6JE 4MXWL 5EZJA 3F58H 4WEBL 4P23B 3VXSE 5IFHH 5IESH 1RZGA 2R1XB 4CVXB 3ALPA 1BX2A 4JB9L 4OKVB 3CJJA 2ZUQC 3ALWA 3OKNA 3CDCA 3STLA 2IJ0C 4HQQH 1U8IA 1FYTE 2NXYB 2YD5A 3G9VA 3MLPA 5B39B 5DVKA 5D7IA 2CPCA 4X5WA 2R0LL 4YBLC 3GMOB 2ITDB 1CL7H 5JORA 4X8JA 4RAVA 3MLVL 4D0DA 1JZ2A 2B4CL 2X7LB 4Q9CA 2OTUA 1KC5H 4XGZB 3ZT6A 4YHLH 2NZ9C 4CMMB 2AK4B 4P9ML 2CDFB 4POZC 4UU9B 4R4NC 5J6GA 1HHJA 3PQYD 4K94C 3V5DA 3G5XA 1NFDB 4XTRC 4DJMA 3D39B 1WWCA 2EDWA 1UACH 3L3JB 1T1WA 3U0PB 4FQLH 2CKBB 4JN1L 5GS1A 3FHQA 5DD5L 2IGFH 3QRGH 5L88H 4M6NL 5L0QC 1CR9L 3FN9A 3SKOA 4EBQL 3LKPB 4TNWK 1CD0A 4W81A 2G5RA 1RD6A 3ISWA 3KPNB 5IWLC 1P4IL 5I2IB 3MROA 1WICA 5A1AA 1IAIH 4ODXA 4NQCB 5MEND 5BVJA 2NY1D 3SE4C 3QPQC 5IMOB 4N5ED 1OSZA 1QHPA 4LGRB 4WI8A 5F7NC 4P49A 1ZGLP 3FCTB 3NPSB 1EFXA 1K6QL 5C0JA 2V7HA 1S7XA 4WGVB 3IDMA 1H15A 5B38B 4K8RC 1EHNA 1QEWA 4UQ3B 3HFMH 4XVSH 4NWTH 3ZDXE 5I8EB 3G08B 4CW1B 1RQ5A 4XNYH 1QFWM 4A2LA 2GK0B 1QTYT 3H3BC 1LP9B 3SO3B 1ZANH 3FT2A 3BIBX 3F7PC 4IRJA 4ZNEA 5JHDE 2FJGA 2E6PA 5JUEH 2EIZB 1GHFH 3MR9B 5DD3L 3TIDA 2DYPB 1XZ0A 4TSCH 3H9ZA 3RFZC 2W91A 4MMZC 1R3JB 4U1KA 4WI4A 2VQUA 3FQXB 3RWJA 5KN5B 4JPVL 3SDXE 5IJVB 4G9DA 4BYHA 3ILQD 3MA9H 4FQXB 4ZPVB 5C0ND 1QRNE 4XNZB 5T3ZL 4UTAL 3ULVF 5T1KD 4JG0H 1FVDA 2DRUA 3BPLB 4AH2A 4L4VB 1BVKA 3OKKB 1FGNL 4ZUUA 4JO2L 3KHOA 3FO9B 2PW1B 3MV11 1Q9WB 3KPRE 5E8PA 2NPLX 1JZ7A 1J87A 4BK5A 4NQVA 2F53A 2E9WA 5IHZB 1UVQB 5DI8B 3P9MA 4QRPE 1U8JB 4CUCA 4B53A 4Y5XC 5ICZA 3ZTJG 5JW3L 4K94H 1T0NB 4GRWB 1DL7H 1AO7A 2F5AH 4PJEF 2LAGB 1URLA 1YEKH 3P73B 2DQEH 2R39A 1CIUA 4OB5L 4OFDA 1FG9C 4X9FA 2DQHL 5DQDL 3U46A 2YS4A 1B3JA 1MJUL 1PDKA 3QEHB 4W4OA 5SX4I 4L3EE 5ICYB 1MAJA 2X9WA 1OQXA 4KHTH 5EU4A 1IAOA 3UXFA 4O2EA 5D96C 5ALCH 25C8H 1W0WB 1X4XA 5ISZA 5IROA 1I8MA 4MNQB 1KACB 3FTGA 4NNXB 4UIMB 5B8CB 3O8XB 5KJRH 1A0QL 2F54D 1YY9D 3U9UB 4DQOL 3MRCB 2VDRH 2YN5A 3MGTA 4OZHF 2D0HA 1Q9LB 4K8RH 4PG9B 3S36X 1CF8L 2PW2A 2EIEA 2VDNH 5I1AB 3BJ91 4JFED 4JN2A 5FGBA 3WLWC 4I2XE 1CDBA 1VHPA 3SDCB 3ARRA 1G7QB 3NIDF 5GJSH 2KZ1B 4FXKB 1RIHH 3TZVC 5C0GA 3P4NA 2J6EL 3VI4E 5H37G 3O2VH 1FRGH 4IM8A 5EOCH 5HI4D 5JDJA 5ETUB 5DMGC 4MQXC 4J4PD 1I7TB 3ARGD 4J1UB 4Z7OE 3MX0A 1L0YA 3ARFC 3KYOB 3ARWA 4Z7WF 1XT5A 3UZEA 3QUMH 4ZFFA 5B4MC 5HVGB 1AXSA 3P0VL 1IZJA 1MRDL 4TOYH 5SWSD 1JF5A 1NMBL 2IG2L 4A6YB 3UZQA 3K0WA 4ZD3L 3IKCA 2XZAL 4D3CL 4GXVH 1O7VA 3VFUB 2DJ4A 4JM4L 3R1GL 2VDPL 3G6AA 1CWVA 1OTUD 2GSIB 1F4XH 4P4RB 4U1SB 2AJ3A 4Y19B 1OY3B 3FJTA 2DI9A 3Q5OA 1I1AC 4ZTOH 5F9DC 3PF2A 3MRIA 3GSNA 4XZUB 4YHNB 3EZ8A 2YBRB 1T2QL 4X0KA 4JO4H 3ULUL 5TE6H 5HYQB 1T5WB 1S5HB 4PJ7B 4JPWL 4OCXL 3VD4A 1A7QH 1G7HA 4ENED 3GSXA 2CLZB 4K3GA 2H6PA 2NY4D 1S3KL 2IQAA 2ZUWA 3SDYL 1CFQB 3H9SD 1NAMB 4HK0A 2VQ1A 2HWZH 3F7RA 1B0GB 5BV7L 3TVMD 1WVZA 5DDHA 3MODH 5C8JA 1MFAH 1NCAH 4XXCC 1F90H 4WJ5A 5HGBB 3QDJE 3A6BH 3CXDL 4HC1L 4LGSB 5E5MA 2XXMB 2BSTA 4AL8L 4UIKL 2YXFA 3DVGB 4XP1H 4RX4A 5D1XC 2ZCHL 1J11A 2FBJL 1W0YT 5IKCB 4QGYA 4G6MH 2P49B 1CE1H 1IQDA 3HPLA 1I9RH 3BWAB 2NY2D 4ODBD 1RUMH 3QIUA 2XYCA 4KQ3H 4WNQA 3TYFB 3ECBA 1S9YB 1F8TL 2F19L 3A6CH 4M7ZB 4LL9A 3E6FB 3F6IA 1D9KB 4X9GA 4Z7UE 3BPCA 4Z76A 4LRNL 2VL5B 5JLZB 1G1CA 4KU1A 4IMKC 4G8GD 4P2YA 1UCTA 4ZS7L 4YUEL 3QB7C 4YBQD 4XP5L 5HHOD 3GI9H 4X5XB 1U41A 2HT3C 2D7TL 1TJGL 4XPTH 4LVNB 4Y5VC 4GKZB 3F58L 5IFHL 5IESL 4XXDA 2AJUH 1YN6B 2NY6B 1WWWX 7CGTA 3E1F1 5AD0A 1HQRB 3B83A 3H9YA 3KPPA 1L0QA 4HQQL 1RUKL 4H88H 2MFNA 4JRWA 3PQYE 4K3JH 3T4AB 3BH8A 2KDGA 4OGAC 5BW7A 3JV6B 1R5IB 1JTTA 1YY8A 5M94B 3UTZB 3MRRB 1CL7L 1WK0A 3LHPH 1IVLA 3PDGA 4H25B 1EO8H 1U3JA 1CU4H 3LN5A 2W60B 1B90A 1HSAA 3O4LB 4LCWB 3RL2B 4I3RH 1ZSDB 2WLZA 5D1QB 5DRWA 1KC5L 3SJVA 4H0IA 4PGZA 1OHQA 3RGVD 5D72L 4YHLL 2HJKB 5D7JC 5DYOA 5ISZE 1ONQA 4S2SA 1JI1A 1I7ZA 4AYFA 2BOBB 5IOPA 1PY4A 2ZUXA 1A3QA 1UACL 4P2OC 5GRZA 4FQLL 5F7DA 5I1GH 4X4ZA 1KPVA 2IGFL 3QRGL 3MA7A 3WIHA 5L88L 2CIKB 1UJ3A 3ES6B 1D5ZA 1KXTB 1U93B 2V5SA 1I8LC 1MWAB 1JGUH 3QO1A 2AXFB 1BIIA 3L7EB 1FL5B 3IYLW 2PO6C 1CFSB 1JPSH 1DQJB 1IAIL 1F3RB 3QJFA 1MLBB 4Z0XA 2XWJA 3VG0H 2UVFA 3PWPB 3F7VA 2IH3B 4OLUH 4M7JH 1I75A 3HG1A 4OM0H 3V6FB 1B0RA 2FD6H 1NBYB 3MXWH 5IMLB 4V1DB 1YYMH 4F9PC 1UQSB 3TNNA 4H1LB 1XR8B 4PJAE 4ETYA 3PWUA 4HDIB 4QHUB 1R5WB 5ITFB 1K4CB 3E6HA 2B1HH 1MCPH 4JY6A 3RX7A 3L3OA 1SJHB 5HTSA 4QO1A 3HFML 1LD9A 4PJIB 1KXQE 1A9BA 5TH2A 3BXNA 4XVSL 3BRFA 4NWTL 1D3CA 3RIAK 4NN7B 3WNNA 3DVNB 5FXCH 4XNYL 1HYRC 5A2KH 4LARH 2BERA 1ZANL 1ZWIB 2DM4A 3SPVB 2GHWB 4J3UA 3MJ9H 1V8HA 2B0SH 2HVKB 5DJYB 4G8FA 5JUEL 2PR4H 2YPKA 3BP5A 4U1JB 2Q3ZA 4TSCL 1YJDL 32C2A 3TGXA 4ZQKB 3AREB 4ZO8A 3JUYA 5IB3B 1OAKH 4M1DH 2YPLA 1WJ3A 4AQ1B 3VU2A 3L3KB 2YD7A 4GRLC 4D8PA 1HEZA 4WW1A 4MDIB 4KTDH 3MA9L 5F89A 4PY7A 4HWBA 4GAFB 4JG0L 2B5IC 3MLTA 1I8KA 3Q2CA 3VCLA 5CGYC 2VE6A 3EDFA 1UZ8A 5CSBA 4YJZL 3CDGB 2D7QA 2D0FA 1CDIA 1BFOA 3HNSH 3J8F7 3VMOA 3KPMA 1T22B 4ZFOB 4K94L 3BKCH 4PJBF 1P1ZB 2ZJSH 2X6MA 2FLBT 2YUXA 1DL7L 2F5AL 5CBAB 1ZT4A 3O6KH 3MJ7B 2Q86A 3RGVA 2R2EA 1YEKL 4XB8A 2DQEL 5FUZH 4WHTA 3T0DA 2QR0A 1I1CA 4ERSH 3CZFB 4HS3A 2F54E 5FO9B 3BT2H 3FONB 3PHQB 5GSRA 5EWIH 2A74A 4PR5A 4HFWB 4LPVA 4JFEE 1XF5B 5CD5D 1UKQA 2XG5A 4KHTL 4N0UB 4P5KA 4NFBA 1A6UH 5ALCL 4DW2H 25C8L 4KDTC 3SE3A 4ZXBB 4LU5H 4KRPD 3SGJC 3HUJB 1KJMB 3ZDYF 5KJRL 4HUUA 5DK2A 4YHMH 2IANB 4J3TA 2AJZB 2P24B 4PBVC 2VDRL 1EX0A 1GJIA 4K8RL 1LO2H 3DX8B 4MX7B 2QSQA 3B9KD 2VDNL 1XGPB 2DLFH 4GSDH 3CDFA 4JFDD 5ACMA 2X4OA 4MS8D 3DARA 1N2RA 3KJ6H 3C9NA 1FFPB 4WTZA 2J8HA 5GJSL 1IAKA 1TTFA 3OG4B 4F37F 1RIHL 2E6JA 3AAZA 3EO1A 3QNXB 1L9NA 1FRGL 5D2LA 4KJPC 4Q9QH 3HZMB 2F8VA 5LVEA 2HJLB 1S7QA 2F9BT 1U3YA 2Q87A 3ARSA 4LCUA 3HAEA 1MIMH 3TJEL 5TGBA 1U36A 3QEQA 3BIKA 3C6LD 3QUML 4UTBH 2BHYA 1GZQA 1TENA 3FQWA 1NBZA 2WP3T 4TOYL 4TN9A 2DAVA 2QQLH 5GGRA 4LVEA 1TPXB 3C8KA 4LPYA 1U3HA 4CMHC 12E8H 1W72B 3ARBA 4N1CA 4GXVL 3WKMH 1DZBA 3AFLA 1DUYB 5I16B 2F8OA 4QLRA 3C8HA 3CSGA 2P47B 4N0FB 1F4XL 2GQHA 1VENA 3HZVB 1DQLH 4PJGB 5EUOE 3H9SE 3HE6D 5IVXF 4OF3A 4ZUSA 4ZTOL 4XBGA 4WO4D 5KVGH 3F12B 2ARWA 4XCCH 3FN0H 3TA3D 5TE6L 5GS1C 3GMQA 4JFOB 2VLKA 4NQXA 1A7QL 1DN2A 2B7DT 5DTFB 1C08A 4YC2C 2A0LC 4MA8H 2BY2A 1MIEH 1DVFA 4OFYD 1G7PA 2HWZL 4PJ9A 3UPCA 1FIGH 3GBNH 5JPNB 5C08D 3QEUB 4HUVA 1BJMA 3MODL 4XMPH 1MFAL 1NCAL 1F90L 2W0LA 4PGCA 2ED9A 3FQNB 4C4KO 3GRWA 1F3JA 3V6OA 4OZGF 3A6BL 1T20B 3NFSH 5GGRY 3V9FA 5GRVL 1MHEA 3DI3B 1MJJA 4NKDB 3QUYD 5FM5O 3LKRA 5HHME 2R1WB 3H6JA 1RUQH 1KPUB 3P4MA 3U4BH 3QRFM 3M1BA 1D5XB 2AEIT 2XFXA 3MRHA 3FAXA 3W9DA 4XP1L 3CAFA 5HHOE 4QYOB 2YPLE 4J8RB 3QG6A 1X4ZA 4G6ML 1HZHH 4PREA 1CE1L 1QPPA 3VXRD 2NW3A 4F3FA 3HCVB 1I9RL 1YNKH 4PJDB 4G7YH 5HPMA 1RUML 4KQ3L 3ZKSD 4MZ2A 5IMMA 4JFDA 3A6CL 1EERB 4AJ0A 3S36H 4S10A 4KK8D 4IRJC 4HIEB 4D9QD 4WWKB 2LTQB 2X4RA 5ACZB 4B7IA 3D85A 4FG6D 4Y4KA 5BQ7B 4R0LB 3GI9L 2PYFA 1TNNA 1T0PB 3WJJA 4TVPD 3ZE1F 5DLMH 4LCYB 1U58A 4RMQA 1LILA 4XPTL 1ZLSH 3GSQA 3FZUC 1ZXQA 4Q6IA 2AJUL 2X4NA 4I0PD 2Y7QA 2J8UA 1TNMA 2NR6D 2NNAA 1OP5K 5K9KA 1HHHA 4OZHB 2AV1A 1CGXA 1N4XH 4H88L 5A2JH 3WIFA 3U4EB 3C5SA 4FQPA 3PWJB 4K3JL 3RL1A 3TESA 1JTOA 1X5IA 3GSOB 5HPOA 3LHPL 1EO8L 3HC0A 4NNPH 3MUGB 4PJCF 4I3RL 1VACA 3AB0C 1P5VA 3KNBA 4LHUA 4YHIA 1WFTA 1QFWH 1NCBH 2DN7A 3VXTA 5J3HD 4FQCH 4MCYB 3S88H 1IL1A 3MFGB 1DBAH 5GRYA 4HIJA 1F4HA 1BQSA 2FWOB 5A2FA 4ORGA 2BZDA 3CUPB 4P48A 3X17A 3DV4A 5DJCB 4K71B 1A7OL 1IEBA 4UOJA 1J86A 4W4OC 4M03A 4JY4B 5GGSA 5ENWA 2ICCA 2C1OA 1JGUL 1FL3B 2EDQA 4RA3A 1UADC 3DURA 4QXWA 3JTSB 4TNVK 2C5DC 4PJFF 2HFGH 1LK2A 1G7MB 3K4DA 4LVHC 3REVA 5GRJH 2XI9A 5IROC 1JPSL 1ACZA 5DVLA 3G5VA 3SDDA 1ZS8B 1AGFB 5D2LE 4ZUWA 1A3RH 1I1FA 4HS8H 3VG0L 5HVHC 4MAYB 3ZO0A 3MRNB 1UEYA 5SWZA 1LHZA 2UYLB 4OLUL 5F88B 3QXDB 4WW2B 4M7JL 4OM0L 3MXWL 2FD6L 4KHXH 4GBXD 1YYML 2X05A 5F7LB 2DTSA 2KH2B 1HE7A 5FGBC 2NX5B 2SEBA 3QEQE 4HULB 5JQ6H 1BLNB 2B1HL 2X4TA 4C83A 1MCPL 1R3LA 3EYUH 1BBJA 4Y1AA 4ZSOA 2EDBA 1UB5B 1ZEAH 5K9OA 3VXMB 4P23D 4PGEA 4KKLD 1DJSA 3D0LA 1LEKA 4P2QA 3UTTB 4LARL 5IIEB 2HN7A 3MCLH 35C8H 4MD0B 2D7MA 4EI5A 1TIUA 2B0SL 3GSUB 1MCBA 1VPOH 3LEYH 2PR4L 2NXYD 4JQIH 4JZOA 5I6XC 3VXOB 1IGJB 4X6BA 5EDXA 4BZYA 1ZT1A 3HRZB 3MQIA 1RZIB 3ET9F 1GCFA 5GGSY 1AQKH 3CX2A 3I6KA 4XRCA 1OAKL 4M1DL 4KZEH 4HIHB 3WUZA 1MNUH 1YQVH 1B2WH 4UUJB 4TSBH 1QR1A 5EU7C 3QQ9D 4KTDL 5EIIB 2FEDD 5CP3A 3S8WA 4O9HH 4RDQG 1J05B 3RJDA 1FN4A 4MJ6A 5GPRA 1CQKA 3O3EA 5FCUH 3EYOB 1TCRB 3D39D 4PRPA 4Y7MA 1AXTH 2VDMH 3GNMH 3NIGE 4QTIH 3L6FB 4UNVA 4HLJA 2W65A 1CFVH 4QHLA 3HNSL 4JLRA 1JN6B 4OZ4B 3BKCL 4EI6B 4R8WH 3MO1B 4HJ0C 2ZJSL 3V6OE 1RK1B 4MD5A 5LGKA 4JQXA 1X5XA 4QNPF 1E6JH 4X5LA 1T1ZA 1UM6H 4YH6A 3O6KL 4L8SB 4HH9B 2LABA 1CD8A 1NMCC 4Z7VE 2EYRA 5FUZL 2AV7B 2JIXB 1AJ7H 4LKCB 4DK6A 4ERSL 2VUYA 4JM2F 3T1FA 3VXUA 5KS9B 1D5IH 1RUAH 5EWIL 1FJ1A 3UTSA 3CSYA 3VGBA 4JFDE 3LQZA 5AYQA 5BV7B 2JE8A 2VNCA 1DUZB 3HN3A 5D93B 1A6UL 4DW2L 1GOGA 4KXZI 1AGCA 4ZNCD 2ESVA 4LU5L 2FNBA 1G7IA 4H5SA 3SN6N 1ZAGA 1S9VA 2APWA 4B41A 4BUHA 4OCLC 4OCMC 3QWRD 4YHML 2HLFD 2D31B 1FFOA 1F4WH 1M7DB 5GZNC 1CLZH 1LO2L 1NCDH 4G8EB 5F9JB 1C8PA 4R3SA 2UUDK 3HE7A 1OF2B 2FL5A 5L2KB 1CXFA 4I9WD 2DLFL 2C7UA 4GSDL 3QIUC 3IT8D 5IBUG 2J8UE 2EIBA 5D1ZD 5JOFB 1J8HA 3KJ6L 2HP4A 4P5MA 1GC1L 3LV3B 4PTUA 1JV5B 2XKNA 4QRQA 3PXHA 3P4LA 4R97C 4FQXD 4UZGA 4Q9QL 3GSWB 2R1XA 2A6DB 4OUUB 2PTTB 4C4KT 1MHPH 4OKVA 5FYKU 3I2CL 1LGVA 4ZOAA 2CUMA 1MIML 4DZBB 4S1DC 2WWKO 4R7NB 4NJ9H 3HNTH 4KGLA 4LKXB 5B39A 1KF9B 3HPJA 4UTBL 4NCDA 1LNUB 3I6LE 3GMOA 2ITDA 5DJ2B 3NCYS 4AZ8A 2QQLL 4YHYC 3CU7A 12E8L 2XICA 5I30H 5IF0B 4KK6D 5BW7C 2X7LA 4X80H 4XGZA 3WKML 4FABH 3C60B 1MCNA 2AK4A 5F96H 1TCMA 2D7PA 2R9HD 2CDFA 3GSNH 3BI9X 5EPMB 1DQLL 1NFDA 2BVQB 1OTUC 4F7TB 1EK3A 3CFKB 3VGGA 5C0AA 4F7EB 1ZVHA 2BVOA 2CKBA 3KPQB 5F9WC 4QOKB 4PRIB 5KVGL 1WAAF 4J2XA 3FN0L 5SWZE 1RMFL 3LRSB 3P30H 1SBBA 3O2DA 2CO6B 4ZFGH 3KPNA 3QDMA 4UBDC 4G8IA 4KTYA 2G75B 1SHMA 2P8PA 4MNQD 1UJ3C 4MA8L 5I2IA 3EFDH 3O8XD 5AYUH 1MIEL 3M07A 4NQCA 4MXVE 4ZSOE 1FIGL 3VFVB 3BQUB 3GBNL 1L4IA 3VXRE 5HYSA 1IGMH 4G42B 4P2QE 1QO3B 4MNHA 1BD2B 3GIZL 3FRPA 3HMXA 3NFSL 4GG6F 5B38A 4LSRH 3BUYA 1UZ6F 5MI0B 3IJYB 5BXFB 3OPZL 2V2WB 1RUQL 2VTFA 3QHZH 5E8EB 2EC9U 1MCOH 4JE4B 3NBNA 3QHTC 5I8EA 2A77H 4U6VH 2GK0A 1LP9A 1HZHL 2IF7A 1VKXB 2ARJB 4G7YL 1KN2H 3C2AH 4NKQB 2EIZA 3FRUA 3MUHL 5D5MB 3P2TA 3MR9A 1OP5H 5D9SA 4CBPA 3S36L 2DYPA 1AQDB 4PJXF 1EBAA 4MVBC 4FMKA 2XKUA 2ZG3A 1T66C 1QQDA 3FB5B 4OT1H 2P7TB 4PRPE 5KN5A 4APQB 1WISA 5IJVA 3FT3B 1FSKC 5DLML 5DK0A 1ZLSL 1SEBB 4MDJA 1R3IH 2BXZA 4YEEA 2J88H 3QAZC 1RJLB 1CGYA 3OKKA 4L4VA 1B6DA 1FG2A 2ZUQB 4QY8B 4F33A 4KJQD 5IVZB 3FO9A 2PW1A 1Q9WA 4Y19D 1VFMA 4MJ4A 1U91B 1N4XL 1FC2D 2LQRA 1UVQA 2VITB 3TLRA 5DI8A 4PBXA 3KS0J 1XGYH 2XOTA 1T0MA 2QEJA 2PYEB 3GGWB 1NJ9B 3IS0X 3U9PH 3VMNA 3P73A 5AG9A 4NM4H 1GGBH 4OAWB 4YZFE 1EXUB 1U8MB 2E7CA 2QADC 3QPXH 2ESVE 5C3TA 5KBNC 1QFWL 1NCBL 3T3MF 3IXAB 3RGVC 4FQCL 3S88L 3WIHH 4RGOH 2HMIC 5MEOB 1EEYA 3H7LA 4NUJB 5ICYA 1FNGB 2XTLA 1E4KA 2JLLA 5CZKA 2DI8A 4PLKD 2H8PA 2MKLC 3RWEB 4FFVD 4NZDA 4RGNB 1HQ4B 2ZUUA 3S96B 1H9VA 3QHFH 1BVLA 4K9EC 5B8CA 5HJ3A 2HFGL 1DR9A 3SE3C 5GRJL 1Q9LA 4PG9A 3FN3A 1KTLA 1A3RL 4HS8L 4RRPA 1BJ1H 4U3CA 3MJGX 3VXPA 5E2UL 1YUHB 3SDCA 2M8XA 4KHXL 1Q72H 5JQ6L 3OJ2C 3H3PH 1HNGA 2BC4A 1ZEAL 2WV3A 4LSQH 1TTGA 1VCAA 5ETUA 2B2XH 2VJXA 1JUFB 1I7TA 2NY6D 2VZTA 4GT7A 4J1UA 2BHUA 4NDMB 2NY3C 35C8L 3MYZA 2DBLH 4GKSA 3KYOA 3JBG7 3UC0H 2AK4E 1VPOL 3LEYL 4JQIL 2VERN 2EDDA 3I3DA 3OX8B 3PP4H 4GJTB 4X7DC 4U1HB 1NFDE 1KULA 3CD4A 1JE6A 3D39E 5JHLH 5J9PB 1AQKL 2BNRA 2EDFA 2HA1A 1Z2KA 3ZDZF 3O45B 1NGZA 2D9CA 4HWBH 4KZEL 1CTNA 4HG4J 1MNUL 3O3AA 3RI5F 4UAOC 1B2WL 4MJIB 4ETQB 5LCVH 3VFUA 4TSBL 3QUMB 3O4LD 2VMFA 5D1QD 3OJDA 4O9HL 4P4RA 1U3HC 2P42B 3ARBC 1KLFA 3DJ9A 5FCUL 4ODSH 3QFJB 1KNOB 1XIWA 5F7UA 4GQPH 4XZUA 3WFBH 1Z9LA 1PQZA 1AXTL 2VDML 3GNML 4QTIL 2YBRA 1BZ9B 1M6OB 4WWID 1CFVL 4Y5XB 5TDNA 1T5WA 2EC9T 1MVUB 4PIRF 4ZG1A 5E95B 4PJ7A 2J1KA 4KKBD 4R8WL 1MFNA 2WWKT 4KKCC 1E6JL 1UM6L 4X6CB 1CFQA 2C26A 4YO0B 1P7KB 2ID5A 5DJAB 1CCZA 1B0GA 4U6HB 5JMRA 1WCQA 2JJWA 3L7FB 3PWPD 3P0YH 1DVFC 1LP9E 4J23A 4PJ9C 1D5IL 1RUAL 4K9EH 1PZ5B 3L5WB 2UUDH 2ZOLB 4I3SH 3P40A 1P7HL 5CJ8A 5HGBA 1FZKA 3MLUL 5K9QI 5KSBA 1MCWM 5BO1H 4L9LB 4QWWC 1IFHH 1ED3A 4X6DF 4FS0A 2VUOA 3V6OC 1A4KA 5GGQH 1KCKA 3MRFA 5E8OA 5HVFB 4AENB 4OLVH 1DN0B 3BWAA 5CLTA 4HZLB 4FQHB 1DLFH 3TYFA 4F80A 1F4WL 1S9YA 5DUPH 4XNMB 3TN0D 1CLZL 3EW3B 3VFSB 1NCDL 3EHBD 3CVIH 4KI5F 3VFMB 4YPJA 3E6FA 1D9KA 1JVKA 2H45A 1FFNB 2VL5A 4LEXL 4C56D 2Y6SD 1U8KA 3NTCH 4G9FA 3ARED 5EC2B 3V52H 4X5XA 1OT1A 3U7WH 4K3EH 4Y4KC 4GKZA 3MBEA 5J06A 2BNQB 3HAEH 3VG9C 1EJOH 1YN6A 3WJJC 4GRWE 1MHPL 1IBGH 1HQRA 4MNGB 2NQCA 4LLQB 3WHXA 4Z8FH 3DUSB 4Q6IC 2PKDA 2IPUK 1DANT 1FZJB 2GITA 4ELMF 4NJ9L 4LAJH 5DURB 3HNTL 2VLJD 2GAZB 2XKSA 2X4QB 3T4AA 5FO8A 4PS4H 3JV6A 1R5IA 3MRRA 5E2WH 2UWEF 3LDBB 4H25A 2K3TA 4KXZH 3HI1B 3JSSA 3NABH 3O4LA 2DMCA 4LCWA 5F70A 3VD3A 5I30L 5K59E 1ZSDA 2I9TA 2P5WD 5IEKA 5I9QB 4X80L 1RK0B 1S7SB 4FABL 2XG4A 5GS0D 3CFJA 5F96L 4O4YH 4OGXH 4RNRB 3GSNL 4MNQE 1I1AB 2C9AA 3K46A 3MNVB 2CK2A 2BOBA 1VFBB 5FA3A 2VWEC 2GUOA 1INDH 3IAQA 4OZIA 2XWBB 5IB4B 5CGMA 3BO8A 3TJHD 3DTXB 1XR9A 2CIKA 3DWTA 3WFHB 3P30L 5CEZD 4RMVA 4HWUA 3LY6A 2Q6WB 4ZFGL 5E03A 1MWAA 2AXFA 3L7EA 1HHGA 5GRUH 2MKWA 2IH1B 3LH2H 3EFDL 4YK4B 4YEFA 4OLYH 5AYUL 1MLBA 4PTTB 2IAND 2WW8A 4NQDD 5F3HB 1FBIH 1UGNA 1ZT7B 3MNZB 2EKSB 2NW2B 4J7RA 3PWPA 4Y2DB 2ZZUT 2VZ1A 3GRWH 5I66B 1IGML 5EBWA 4NKOA 3SDDC 3V6FA 5FK9B 4F7CB 1QVOB 4V1DA 2NXZD 4H1LA 4WI2A 4ELKB 5BJTB 3QT2A 1R5WA 1QFPA 1K4CA 4LSRL 1CGVA 3H42H 2DD8H 4DEPC 1SJHA 2ATPB 4AEIH 4BUGA 3QNYB 3E8UH 3QHZL 5D1XB 4GW4A 1MCOL 4PJIA 5DWUH 1WC7A 4G6JH 1NCTA 2RIKA 1ZGLB 2A77L 4U6VL 3BGFC 1MH5B 2PF6A 2PTVA 3SPVA 3DX7B 1KN2L 3C2AL 2HVKA 2ZSVA 3IDYC 5DJYA 2APBA 1MFDH 3RUGF 3MV9A 1UXWA 4U7KA 1ORSB 2KL6A 3DHJA 4ZODA 4Y19E 4EI5C 2C3WA 1OTTD 2OLDA 4ZQKA 2E9IA 2EDYA 1QSFB 1OGAA 4MLSA 4UDTB 1CGTA 2AXJA 3PL6B 4OT1L 1LE5A 3FQTA 5E1AB 1NBVH 3BN9C 3GMLB 4TSAH 1VGKB 3TT1H 4FHBD 1R3IL 1JF1A 3EYFB 3VD5A 3GMRB 2J88L 1IM9B 1MPAH 3GFUA 4JQVA 2DM7A 3O3DB 3T2PA 4KTEH 2GIYA 2R56H 4OFIA 3OMZA 2ADGB 1XGYL 1T22A 1G9NC 5IV2A 5I73C 4ZFOA 3QDGD 1P1ZA 2EE3A 1FVEB 1FFQA 1MAMH 2XPGA 3MJ7A 3U9PL 3AXLA 5KVFH 1KIRA 1I4FB 2VDLH 4JKKA 1GGBL 3PXJA 4NM4L 4F7MB 1Z9MA 4JQXC 3QPXL 2JB6B 5FO9A 5C09B 3CZFA 1TXKA 3DSFH 2Z4QB 5E9DB 1CK0H 4R4BA 3FONA 5ELIA 1U8HB 5IG7B 1MFEH 4PV8B 5J3HC 3BKYH 3WIHL 5CKAA 2F15A 4XHJD 1IGIH 4NYLB 4EIGB 3GJEB 1EFQA 3HA0A 4ZXBA 1BECA 3L3GB 3HUJA 1KJMA 3QHFL 1E28A 5F21B 2IANA 2AJZA 1T1YB 4QHMA 2P24A 4I1NB 3K8LA 3EYQC 1UXSB 4UINH 3MUZ1 5TF1H 2FGWH 1RZJC 3Q6GH 5D7LB 3MBXH 1QSVA 3LIZH 3HE7C 2OP4H 2C3GA 1I7RA 4GW5B 5L7XH 5JXEA 4Z95H 4NKMA 4OI8A 1Q72L 3B5GA 4BJLA 2W07A 2H41A 3QFDA 3U48A 3QNXA 3H3PL 3DOSA 4GAYB 4EN3D 4LSQL 2B2XL 3B3IA 3V6ZB 5B3JE 1N3NA 1UWEL 3OB8A 4P3WA 2V9TA 5T5NG 5LGJB 3O4LE 4U0RB 4JFYB 4KKLC 3G5YB 2VXUH 2DBLL 1JWMB 3RRQA 1IGCH 2E6QA 3VDCA 3UC0L 3OL2A 4FXGB 4QRRB 3MSPA 1G0YR 3PP4L 5C0CB 4KPHH 5T3ZD 1N6QH 4U3HA 2NXYC 1A22B 1NGWB 4GRMA 5JHLL 3NIFF 1BWMA 2JCCF 5CP3H 2DKSA 4HWBL 2WUCH 5C6TH 1A7RH 1W72A 1F5WA 4XCEB 1ZLVK 5DMKB 5LCVL 3HLAB 1PLGH 4RAUA 1P9MA 5I16A 1JGEB 4NC2B 4BH8B 1JYXA 3QXAB 4Y16B 2V5YA 4N0FA 2DMKA 1G9NH 2ZCKH 1CDCA 3HZVA 1QA9A 1OAYH 5C0BB 1J1PH 4ODSL 2A6IB 5EIVA 3EOAB 2GY7B 4PY8J 5T1MB 3WFBL 4OLEA 3H9HB 2B39A 3PWPE 3CFEB 4WTZG 3S5LB 3ZYJA 3UJTH 3UEZA 4JFOA 1P7QB 3QCTH 4V1DE 4YR6B 4H26B 2CRZA 5KANI 4X6EB 2OQJA 1Q8MA 5I8KL 5INDB 3B2UD 1XGTB 2D7NA 5EUKB 4O00A 1NGXB 5JPNA 3QEUA 4DFHA 3L3DB 4YE4H 2FLRT 4MAYD 3P0YL 2EDHA 4M61A 2AGJH 4K9EL 3FQNA 4I3SL 5IW1A 1RHHA 5BO1L 1T89A 4NKDA 1NC4B 2R1WA 1IFHL 4MQ7A 1KPUA 2YOCA 1D5XA 4YPGB 4M02A 4H0HB 5GGQL 4MD4B 1Y18A 1RZJH 4QYOA 3PV6B 3Q48A 4O2FB 3IETA 4PJEA 5E5UB 3VJ6B 3GO1H 4CJ1A 3HCVA 3PGDB 2Z0BA 4OLVL 4PJDA 3BGMB 3BKMH 3UTTD 1DLFL 2A2QT 3SKNA 3ELAT 5DUPL 4BELD 2N1KA 2CO7B 4E0RA 3SO3C 2HLFC 3GI8H 3CVIL 2CR3A 1CYGA 3TBWB 1P4BH 3DO7A 2ADIA 1DQQA 4LNRA 4WWKA 4RA0C 1JNHB 5ACZA 2FR4B 3NTCL 2PCPB 4R0LA 3V52L 3U7WL 2DQTH 4OGYH 2W59A 3DXAD 4K3EL 2P8MB 3BZFA 4S11A 1EJOL 2OS7A 1CT8B 1IBGL 2VO5A 4XNZC 3RWCA 1RZGB 3L3HB 4OZHA 4Z8FL 1BX2B 3ARDA 3VDBA 4BSWB 1PKQB 3CMOH 3U4EA 3STLB 3PWJA 4YFDB 3RJQB 4FZEH 3IRPX 2AAVA 2QQNH 4YHPB 1KPRA 2ZKHH 4PS4L 1K8DB 5GZOD 5D7IB 5E2WL 4X5WB 4CMHB 3NABL 3MUGA 4KROC 2Q20A 2FJHB 3VFGH 1FNHA 4N0UE 5CEZE 1U8NB 4HZAA 4X8JB 5EU6D 3OTTA 4Q97A 5EO1B 4RAVB 4D0DB 4PRBB 4O4YL 4OGXL 5KZCB 2CKBH 3ULUD 3HUJE 4BQBA 1ZVYA 4M43L 5I76B 4LMQE 2R9HC 2FWOA 2IANE 4NQDE 3CUPA 3TM6A 3V5DB 1INDL 3G5XB 3O2DH 2EICA 1GAFH 2O5XH 3GHEH 3HI5H 1DBMH 2QBWA 3DECA 1YEHH 2EH7H 4F2MA 1RAMA 2AXGB 1E4KC 3T09A 1FL3A 3WSQH 1BOYA 2V7NB 3JTSA 5KVDL 5GRUL 5K9JH 5J89A 4OD3H 3LH2L 2VDOH 1ZA6A 1HDMB 2VISB 1FBIL 1OP3K 5B8CC 3MROB 4MAYA 4JRYB 3MRNA 2D2OA 4JPIB 5DR5H 3GRWL 3HMXH 5BVJB 5I19H 5BRZB 3N0PB 1NDMB 5F88A 2MCG1 5J13B 5L2KD 3K8MA 3BP6A 1AH1A 1RZ8B 1PGRB 4PYGA 1IGYB 4NZTH 1K85A 1UA6H 4LOUD 2NX5A 3SDCC 1IRAY 1BLNA 4C54A 3H42L 2DD8L 1ND0B 4AEIL 1S7XB 1UB5A 3IDMB 3E8UL 2Y06H 1X5YA 5DWUL 4KJYB 3VXMA 3AMKA 1QEWB 4G6JL 4LHUG 3RBGA 1P5UA 3W0WD 5IIEA 4MD0A 3U4AA 5FGRA 1MCJA 1MFDL 3FT2B 4RCAA 2WIMA 4GFTB 2K9UA 2Z31B 4PJGE 4WGWB 2FJGB 1RZIA 1UWGL 3KDMA 3MGOA 4JREC 3VXQA 1VADB 1QBLH 4HUXA 1EIBA 4HIHA 4CU8A 3U0TB 2EE2A 3NAAH 5ACLA 5CBEB 1NBVL 1SJEA 4U1KB 4TSAL 4R2GB 1WGOA 3TT1L 3TF7C 5BOPA 3C60D 5FO7B 1RZKC 2N4IA 3P4OB 1QNZH 1WEJH 3O3BA 1MPAL 1FVDB 4QGTA 1EVTC 1TCRA 5CJOH 2OR9H 4ZUUB 1JFQH 4YBHA 4KTEL 1T03H 4GRWH 2R56L 2FYYB 4QOKD 5E8PB 5F8QC 1XIWC 3G6DH 2EEBA 2F53B 3INUH 1IEAA 2YD6A 3ME0A 4JHBA 1XAUA 1RK1A 2GYSA 4HAGA 5ICZB 2EZ0D 1MAML 3AB0B 5KVFL 4GMSH 3EOBB 2VDLL 1AO7B 2AQ2A 3OR7B 3EO9H 3QXVA 5BS0A 2AV7A 4K2UH 2JIXA 4LKCA 3DSFL 1CK0L 2BHZA 5KS9A 1DEEB 4PJDE 1KB5H 2DLGA 3BKYL 1RY7B 4HD9A 1V5JA 3MZTA 5KOMC 1MI5A 4P99A 1HKFA 2B20A 4YAQA 4KY1H 5FF6B 1IGIL 4YXLH 1HYSD 4U7MA 2R15A 4NPYA 5LGHH 1B88A 5ERWA 4J12A 2J12B 4W6WB 2AABH 2VR4A 4G8EA 5F9JA 5K33A 1JWUB 3E2HB 4UINL 4UDUB 3MGTB 5TF1L 2FGWL 2WBKA 3ROLB 3GZKA 5JOFA 2FO4A 1QFUH 3Q6GL 4NQEB 3MBXL 4M7ZC 4JN2B 4OZHE 3LIZL 1OLLA 3LV3A 1IZKA 1WSST 1D9KC 5L7XL 1LK3H 2Z8SA 3GBLA 4Z95L 3W11D 2FB4H 4APQD 1OTSD 2PNDA 5C0GB 5GXBB 4TPRH 3GSWA 2A6DA 2WBJB 4P5TB 4OUUA 1PG7X 1X44A 1ZLVH 4LVNC 5E5RB 2G9HB 3MBEC 3IXTA 2OI9B 2VXUL 4DZBA 3L5JA 1F00I 5DJ8A 1IGCL 5I6XB 4LKXA 1A7NH 4E41A 5IP4A 4KPHL 4RFOH 4QRTB 1N6QL 3TCLA 1LNUA 1JPTH 1KCVH 4ZFFB 1RZKH 5DJ2A 1C5DB 1AXSB 3EDKA 5CWSB 1ZKAA 2BRRH 4X9BA 2PYED 2WUCL 5C6TL 1T7VA 5IF0A 1A7RL 3B4NA 3MNWB 5C6WH 1PLGL 5FECA 3GIVB 2NZ9D 1G9NL 2ZCKL 4POZD 3RA7H 4R4ND 2BVQA 5GGVY 1OAYL 3BP4B 3I3BA 4F7TA 3TBVB 4XTRD 2UY7A 4F7EA 3KPQA 4QOKA 4PRIA 3LPGA 2BY3A 3VFNB 4Z0BH 3IVKA 2RQ8A 3MRIB 1A64A 3GSNB 3UJTL 3LRSA 1GGTA 4K3HA 3QCTL 2IPUG 2JB5H 3PGFH 2G75A 5FV1L 2GK2A 1RIVH 2N7BA 4XVUD 2OSLB 1G7HB 3GSXB 1YPZF 1GPOH 4PD4J 3OV6A 5T1DH 5HYFA 4GAJH 3VFVA 3G6JF 2IQAB 2LFGA 3BQUA 3QPQD 3WD5H 2X9XA 3VXME 3WHE1 4HK3N 4YE4L 3UTTE 5HYEA 2VB5A 1BD2A 2AGJL 2YMXH 2A6JB 3LKNB 5HGDB 4PRHA 4EQ2A 5C8JB 5TFSH 1BQHA 1E4WH 3ZSSA 3LSOA 4K8RD 3IJYA 5KSAA 2V2WA 1G9MC 1K2DA 4WJ5B 5K9QG 5EN2B 1JPGB 5E8EA 4KKAC 2BSTB 3RNQB 4PJBA 1RZJL 1KJVB 3MRKA 4HGMA 2VLRA 4B7LA 4U31A 3GO1L 2XTJC 2ARJA 3DXAE 3EZJB 1VKXA 5I8OH 3BKML 1S78C 3VRLE 1IQDB 2ZCLL 3HPLB 3CC5A 3GI8L 2YA1A 3BRDA 1P4BL 1AQDA 5IM7B 1RUPH 1I9JH 1E4XI 3BPOC 4L9DA 5H35B 1VEPA 3FB5A 4YHKH 3BPCB 4Z76B 4NKIH 2ORBH 2DQTL 4NSKB 4OGYL 1Z9SA 4MJID 4PG2A 3RP1A 3RDTA 3KYMA 5FHBH 3EGSA 1ULVA 1RJLA 4LDEB 1IAIM 5IVZA 1MJ8H 1J18A 1JYVA 4XXDB 1CLCA 5E6YA 4N8PA 4WUUA 5HYSG 3MLYH 1DBBH 4UV7H 1MCLA 1U91A 2FIKA 3ULUE 3CMOL 2VITA 3IFLH 4IOFC 3UMTA 3KPPB 4JQVC 3FRPG 4FZEL 3CVHL 2QQNL 1X5LA 5B38G 5KS9E 2ZKHL 3VFRA 4JKWA 4YHYB 2VAAB 3BH8B 5C07B 1YY8B 3VFGL 1Y6MR 5T5FH 1A6ZB 4JFFD 2DIBA 3CGTA 3REWB 1RURH 4ZS6C 1HSAB 5B22A 1FNLA 2HLAB 2CKBL 3IXAA 5DRWB 3SJVB 5E08H 3ZDXF 4FQQB 1OSPH 3UYPA 1OP3H 4PLJC 5F9WB 2QKIB 5MEOA 3O2DL 4QRSB 4X4MA 5IOPB 1GAFL 1MWAH 5I18H 5L2KE 2O5XL 3GHEL 3RWEA 3MREB 3HI5L 1DBML 5F7DB 3JV0A 1YEHL 2EH7L 3TJHC 5KTEH 4I0KA 2RBLA 5GGUA 4TYUA 2JCCB 1MSPA 3WSQL 5J56B 5K9JL 4MGXA 1YNLH 4OD3L 4ZXBC 3QO1B 3RHWF 2VDOL 3SDXF 4HV8B 3MPCA 1G9MH 2AK1H 4H1LH 5A43C 3IKKA 5DR5L 1YECH 3HMXL 4ZYKB 2XV6B 3WLWD 4Z0XB 3PABA 4XMKH 3EJYC 5IW6B 4LPUA 3BE1L 4NZTL 4KRMB 3HG1B 4R96A 1UA6L 1P53A 5ECJE 3TZVD 4BKLB 2APVA 1GSMA 1GGYA 3Q6FA 2Y06L 4N1EA 3WNLA 5JXEC 4JY6B 3KPOB 1JUFA 1LD9B 3NACH 4HAFA 5DMGD 3T0EB 4MQXD 1IEHA 2VLMD 5TH2B 1KLGA 1ITBB 1WBXB 5FDWB 5A2LH 3VWKA 3T2QA 2DQFA 3RWIB 1G0DA 3OX8A 5B4MD 5TJWK 5DURD 5EZIH 2HH0L 4G8FB 2YPKB 3BP5B 5C0FA 5J9PA 5BZWA 5ITBH 1D5BB 5D2NA 1N0LA 1QBLL 3O45A 3QIWB 2DS4A 4QOKE 4PRIE 3WYRA 1FSKB 1RHFA 4MJ2A 4L8CA 3NAAL 4ETQA 1J0KA 4MA7H 1UEMA 4FTVD 3BPNC 4PY7B 3I02B 4JRXB 1P9MC 4RRPG 1I1AD 1QNZL 3QFJA 2P46B 3RY5A 4ZPTB 5CJOL 5F1IB 5CS7A 2OR9L 1JFQL 2BVEA 3UPAA 2VE6B 1T03L 1BZ9A 3L95B 2C1PB 1JK8A 3RQ3A 1X7QA 1MVUA 3G6DL 3F7YA 3INUL 1BD2E 1BFOB 2VAJA 4YGAB 1H0DA 3QZWG 4HBQA 4TUJA 3MXVH 5J12C 2CLRB 4HWEH 4NHUB 4GMSL 5DJAA 2QADB 3VI4F 2WIIA 1TJHH 3EO9L 2Q86B 2VN4A 3SE8L 4K2UL 3RY4A 2R2EB 3L7FA 4FQ1H 4Y2DD 5C0DB 4ZO7A 4D9RD 3NZ8A 2QR0B 3L5WA 1KB5L 3FFCA 4HKZA 1FE8H 1LE9A 3DUHA 4IS6B 4Z7OF 2OL3A 5GSRB 4L9LA 4NN6C 5D5ME 2A74B 2YD9A 4LVOC 4NFDA 5IEHB 4PR5B 5EB9A 4KY1L 3RKDC 5IHUH 1CDJA 1L6ZA 1T89C 2LV4A 4YXLL 4G6AC 3ALXA 4P5KB 3ARPA 4XHJC 5D1XD 5E6IB 3S37X 4AENA 1DN0A 5LGHL 3TWCH 4O2CA 4HZLA 5JDSA 2P5EB 2AABL 3VFSA 3P11H 1LDSA 2YD2A 3VFMA 3VWJB 3LRGA 5I1KH 1FFRA 1FFNA 1AE6H 1QFUL 3W81A 2VZSA 3RTQB 2X4OB 5EC2A 3TBYA 1QSFD 1LK3L 1J9CT 2Y5TB 1N2RB 3TPKA 3WMSA 4WWKC 2FB4L 2HT3D 2LTQC 4ZDHB 4R0LC 3D87B 3U7AA 5HDLA 2BNQA 4TPRL 2IMNA 1WLHA 1J0YA 1JZ5A 3EO1B 2PYEE 3RIAF 5LQBH 4YDLB 4LLQA 1YYLH 4XPBH 5FV2A 4NT6B 1KBGH 3QSKB 4JB9H 1EHXA 1S7QB 5CHNA 2DJUA 1IAII 2DQJH 1AP2B 1FPTH 5GSVB 1A7NL 1NMAH 2GAZA 4GXUM 4LCUB 4V2BA 5HHVH 2DTML 4AG4H 3Q5TA 3ARDC 4RFOL 4K23H 1W72H 2XY2A 4KH2A 3RIFF 3RKPA 3TNMB 1EA9C 2PN5A 4OGAD 1TZGH 1JPTL 1KCVL 1RZKL 1J0HA 4YQXH 3HI1A 2BRRL 3D25B 4U4BA 1RK0A 1S7SA 1A6PA 5GGRB 5KOVC 3OAYK 1U3HB 4RGNE 4PJ8B 5T33H 4RNRA 5D7JD 3NCJH 1SQ2N 3RA7L 1NAKL 3MNVA 4LLWB 1VFBA 3MC0A 5C7XH 1DSFH 1NLDH 3OGOE 2XWBA 5IB4A 4Z0BL 3FB8B 3DTXA 2A73B 1U8LA 4XBGB 5DMJB 1NGPH 5L8LB 2XZCH 1NH6A 3KPSA 2Q6WA 4Z7UF 4K71C 5L2JB 4JZNA 2JB5L 1BEYH 1VFOA 5DJDA 2GCYA 3PGFL 4WI6A 3GMQB 1CE6A 1MVFA 1RIVL 2IH1A 1BBDH 2XQBH 4Z78B 3PWNA 2VLKB 1IJ9A 4RMUA 3B2VL 1GPOL 1KGCE 2NW2A 3MNZA 4M7LT 4OIBA 5KANG 5T1DL 4GAJL 4X7TB 4Y5YB 3WD5L 4Y2DA 2JJTA 1G7PB 5H94A 4PJ9B 4P3CH 5FK9A 4F7CA 3KYKH 5DD6A 1QVOA 2YMXL 4MAYC 4HUVB 1GH7A 4WFHE 1ORQA 4ELKA 5BJTA 4PFEA 5TFSL 3LEXA 5GIRB 1E4WL 1EO5A 4PGCB 2ATPA 3V0VA 1F3JB 3QNYA 2J5LB 4UT7H 3QUKB 4CGTA 3PDOA 5DC9B 1MJJB 5ICXA 4WUKH 1ZGLA 4M62H 3M1BB 1MH5A 1R3HB 2XFXB 3W9DB 2CXKA 4MJIE 5I8OL 1KLUB 4WDIB 5CSGA 3S3JA 1Q1JH 3MCKB 4ZOBA 4F3FB 4ZAKA 1XF2A 5MEQB 3V4UH 1ORSA 5FGSA 2IBBA 5J11B 1DCLA 4Z7NF 2H1PH 4QRRD 1RUPL 4JM2A 1GVIA 5DD3H 1QSFA 3H3KA 3QFJE 5GS3A 1YMMB 2DL2A 4KGJA 4UDTA 3TH3T 1HSBA 3PL6A 1OB1B 1TTUA 2GKIA 1CXKA 2UV3A 2X4RB 4NKIL 2ORBL 4GRLD 3N1GC 2KQMA 1VGKA 3ZKNC 2PYFB 4OF0A 5SV3A 3DNKA 1U58B 3GMRA 5FHBL 4U33A 2LAAA 4UTAH 1XF4A 1IM9A 3GSQB 1NGYB 1VFAA 1MJ8L 1WCBA 1JRHI 1PG7H 4X6CE 5CGYD 5JHDD 5C0BD 3O3DA 4HWZB 4PJ5A 3MLYL 1EAJA 1DBBL 2IFFH 4UV7L 4LLYA 1X5GA 2Q8AH 3TIEB 1XMWA 4EXPX 1OPGH 2ADGA 2AV1B 3KXFB 4H1LG 1M71A 1ZGLM 3WIFB 3MRLB 3C5SB 5HVWA 2HT2C 1P7QD 1FVEA 3BD3A 4PJAF 1QRND 1T7XA 5T5FL 1I4FA 3HC0B 5TE4H 3EDDA 4MYWB 5DSCA 3TV3H 2WWMC 1RURL 2JB6A 5FAAA 5C09A 1VACB 3KNBB 4LHUB 2Z4QA 2JJVA 5E9DA 5T1LD 1CICA 4YHZH 4OV6F 5E08L 5IG7A 2EIDA 5DEZA 1OSPL 4PV8A 4F37K 3OHXB 3LN4A 1E4XH 1IL1B 4MQSB 3U1SH 4HIJB 4QRPD 1J0ZA 2D7OA 3M45A 2ADJB 4LHQB 1MWAL 5ANMB 5I18L 4U1MB 2AJSH 5FYJH 4NYLA 1FP5A 3GJEA 5KTEL 3ZTNH 5ENWB 2IBZY 1T1YA 1YNLL 2C1OB 2BNUB 2KQNA 4QXGH 3DURB 7FABH 3QI9A 1G9ML 1I1RA 2AK1L 3REVB 2VLLA 3IFOB 1N6UA 1YECL 4MCZB 5GHWH 2Y1VA 4MNGE 3MZGB 5D7LA 4XMKL 5IBLC 1HXMA 3LKQB 4GW5A 4C55A 4JDVB 4DEPB 2W9DH 1FLRH 4GAYA 4LEOB 4C83B 4KJPD 1QLRA 1PYWB 4Y1AB 3V6ZA 5CCKH 1OL0A 3TP4A 3NACL 5LGJA 5K9OB 2EDNA 3IDYB 1JWMA 3U82B 3PWLB 4HIIB 1EUUA 3BX7C 3G6JB 3QUZB 4FXGA 4QRRA 1GRWA 3BKJH 3HB3C 4EI5B 5C0CA 5EZIL 5CINH 4L3AA 3ZT7A 1GOFA 1BZQK 2ICES 5ITBL 3RVXC 2H32B 2PETA 4X6BB 2X5PA 4HW6A 5IQ9A 3SGDI 2CRYA 1TZHA 3UTQB 3HLAA 1RZ7H 3L5IA 5IB1A 1JGEA 4MA7L 1FHGA 4BH8A 1QSEA 3QXAA 5DFWH 4Y16A 1QR1B 2DLHA 2XN9B 5C0BA 5KZCD 3QIBB 1T1XA 2A6IA 5KVEH 3K4ZA 4MJ6B 3FMGH 4ZFOL 3CFEA 1H5BB 3S5LA 3A6OA 3ARVA 4PJXA 5MHSD 5EULV 4F8TA 5I73B 1INEH 3TBSB 4LP5A 4YR6A 1U6AL 3TO2A 1FDLH 4QHLB 1S8DA 4H26A 4JLRB 1C16B 3MXVL 4CVWA 2A0LD 5HSFA 5HI5C 4HWEL 1HWGB 5INDA 4OF8A 2EZ0C 4IDJH 1XGTA 3CMGA 1T1ZB 1TJHL 1NGXA 2B1AH 3V7MA 3TCXA 4FQ1L 2LU3A 4JHWL 5I15H 2EYRB 3KYAA 5BRZD 3BQUC 1U3ZA 1MHCA 3VXUB 3T1FB 1N59A 1EFXD 1NC4A 5CIPB 3UTSB 5JPMB 3MRQA 4YPGA 3LQZB 3MV8A 5IHUL 3BSZH 1QSFE 3CX5J 2BVTA 4O2FA 5KSAC 1F4YH 3VJ6A 3PGDA 2WQRA 3TWCL 3BGMA 1D6VH 4NZJA 5GGVH 1S9VB 1OD7A 2AQ3A 2YZ1A 3EJZC 3P11L 3TBWA 1FFOB 5I1KL 1HHIA 1AE6L 2R69H 4IRJD 3HE7B 1JNHA 2FL5B 2H26B 5EUOF 2FCBA 5EH1A 4NC0B 2C7UB 5IHBA 4BQ8A 1WIOA 3K3QA 2X1PA 4PV9B 4XP5H 2P8MA 3F65A 3TBTB 1U2HA 2XKNB 4QXTB 2HFTA 1TJGH 3B5TA 3FZUD 1ZHNB 5LQBL 4JZJB 1CT8A 4QF1A 5ESVA 4PG2C 3ZE0F 1SMOA 1YYLL 3L3HA 1YJDC 3OAYH 4XPBL 3RDTC 1KBGL 3RX8A 3BIAX 4IRZH 5DQJB 2E7LA 5IUSA 4BSWA 2DQJL 1PKQA 3SEPA 3DVFA 1FPTL 5DEFA 1NMAL 5HHVL 1RUKH 4AG4L 1CN4A 4YHPA 4K23L 1W72L 4ZO6A 3EYSH 1K8DA 1TZGL 1UKSA 3QUXA 4OZFB 3HPJB 2F53D 4YQXL 2IALA 3K7UA 3TPUB 5HHQA 2BSSB 4W6YB 2FJHA 4FXLA 3NCBB 3RBSA 5C3LD 1U8NA 3CVHB 5EO1A 1JGLH 3LPWA 4NO3B 1WBYA 4PRBA 5T33L 1AO7D 3NCJL 4UB0H 5FM5M 1EDQA 5D72H 5I76A 1RV6X 2Z93B 1WT5A 2V17H 6FABH 5C7XL 1WFOA 4QEGA 4AM0B 1DSFL 1NLDL 2XA3A 5C0AB 2BVOB 1NGPL 1W0VA 4JDZB 5AWNH 2XZCL 1UYWH 2F74A 3RPIB 2AXGA 5D7LE 4K7FB 4LSUH 2ATKB 4AMKH 1BEYL 1M1SA 4K7PY 3ULVL 3O6LL 4X4XA 2V7NA 3AS2A 2BX5A 3VMPA 5FIEA 4RGNC 1BBDL 2XQBL 5JIPA 2VISA 1HDMA 3QDMB 4G8IB 5ISZD 2P8PB 4XVUC 3NH7H 4M93B 1EPFA 4G80A 3QH3A 5I8CB 4JRYA 1X6LA 1KYOJ 2GJ6A 4JPIA 4J3SA 3ZKXC 5BRZA 1NDMA 3DX6B 2J7LA 1JZ4A 4P3CL 3CLFH 1KT2B 1RZ8A 3KYKL 5J7CC 3WDIA 2YD3A 5HYSB 1IGYA 4NQTA 1S5IH 4MNHB 1OD9A 1DEDA 4DN4H 4QRRE 1G6VK 5C0CE 1ND0A 4EKXA 1AD0A 2JKXA 4EQ3A 4UT7L 1DQDH 4KJYA 3BUYB 2YPVH 4WUKL 3D3VB 4P5TD 1Q0XL 4M62L 2VZ3A 4AEFA 1A2YA 5ID1B 3S37H 1NUDA 1WZKA 1Q1JL 4HUWB 4HJGA 3V4UL 3A67H 2Z31A 3VWKC 5E8NA 2H1PL 3BWUC 1LVEA 1FNEB 3FRUB 4NHCH 4XNXH 5C0BE 3O11A 4P2RA 3G9AB 1KIPA 1VADA 5D9SB 1WTGT 1CIDA 1YJDH 5CBEA 3U0TA 3L5HA 3O9WA 3C08H 1QQDB 2BDNH 4OM1H 5D2NC 3UP1A 2UVEA 1MCQA 5C9JB 2WNGA 1X5KA 5DK0B 5FO7A 4MDJB 3P4OA 2R2CA 1PG7L 1AC6A 2R1YB 4YIQB 1FG2B 2IFFL 4F33B 2Q8AL 3PUCA 3MRDB 2AJXH 3TH2T 1OPGL 2FYYA 3AUVA 4ZFZB 3PDDA 5D2LF 1OVZA 1GXEA 3MV7B 4KVCH 2XT1B 1SMAA 1J10A 4LDLB 5DC4B 5DHVA 4HJ0D 4KROB 1T0MB 4GO6B 3B5HA 5IK3B 3DHMA 3MUY1 4EUPB 5TDPA 3EOBA 5TE4L 3OR7A 3TV3L 1NUGA 1QOKA 3BN3B 4JJHA 4G3YH 3DMMA 4PJHB 3W2DH 4HG4K 4YHZL 1MRCH 1TVDA 1YEJH 1DEEA 2HTKD 3BZ4B 1E4XL 1VEOA 3S35X 3U1SL 4ELMA 3F7QA 1T83A 1N64H 2AJSL 3JVGA 4L1DA 3FQUB 4EZMA 1EEYB 5FF6A 5FYJL 2DQDH 2VKXA 3B6SB 1F42A 2V2TB 3ZTNL 4L9LC 4HMCA 2UWEA 2YD1A 1KB5B 2H8PB 2CJUH 2N7AA 2X4SB 4N0CD 1BVLB 4RX4D 1JRHH 5HGGS 1TZIA 4QXGL 5HJ3B 7FABL 2X42A 4X7SL 5CILH 5GZND 1JWUA 1CFNA 4UDUA 1KTDB 2V2XA 1UH4A 4CU6A 4BQCA 3ROLA 5GHWL 2HVJB 3QIUD 1KTLB 2VRAA 4HUNB 4XVTH 1NC2A 4NQEA 4K7PX 4WFEE 3VXPB 1G1YA 1YA5A 3OKDA 3DGGB 2VXTH 1PKQE 5IVNA 2W9DL 3NIGF 1FLRL 2BSRA 1AGBB 3QWOB 2WBJA 4P5TA 2DIJA 5D7IE 3QZWB 3WCYA 1A02N 4BFIB 5CCKL 2G9HA 2BC4B 4QT5B 4XVJH 3LN9A 2P8LB 4G6FB 4UI2A 2XWTA 4FMFA 4URTB 5FOJA 3MRPA 2EO1A 4S1DD 3EIFA 4Z7VF 1BIHA 3BKJL 4GKSB 4OCRH 4QRTA 3TJEH 4S1RH 4JREB 5CINL 1BF2A 1G6RA 1C5DA 1KG0A 5CWSA 4I13B 5MHSE 2BNRB 3T0WA 5C07D 3MNWA 1RZ7L 1NGZB 3LDBC 3GIVA 3O3AB 1J8KA 4F15B 4MA1B 5GISH 5I9QC 3BP4A 2Y25A 3OJDB 3SJVD 3TBVA 2L7UA 5KVEL 1AI1H 3OJVC 4NQUA 3MRBB 3FMGL 4IJ3C 3VFNA 5E1HB 3VI3E 3P77B 2BXYA 1YEIH 4JRYE 1XIWB 5BRZE 1PQZB 5GS2H 3GMMA 1INEL 4LASH 2J8UF 3OBAA 5MENB 1FDLL 2NY1B 4D0CA 4JFXB 3OKLA 4UBDD 5TDNB 1T21B 3OF6D 2OSLA 3BMVA 4LSPH 2W9EH 2CIIB 2ZSWB 3V0AC 4IDJL 3NFNA 2RAMA 2B1AL 1ZVSB 2OL3H 4GOSA 2BVPB 4R7DB 4YK4C 3MLWH 5IB5A 9CGTA 3MUJA 5I15L 4NCC1 4Y2DC 1VESA 2A6JA 3LKNA 1HCVA 5HGDA 2JJTC 1CBVH 5DMYA 2EEAA 3OXRA 3ZKMC 3HG1D 1CDGA 5EN2A 1FZKB 1JPGA 5DEGB 3SGDH 5KSBB 1CXEA 4NZRH 3RNQA 3BSZL 3Q5YA 1B4RA 1ED3B 1KJVA 4Q0XH 4UT9H 2IPKB 5EOQH 1T7ZA 1X4YA 3ESVF 1F4YL 1I3GH 2ITCB 1A4KB 1DLHA 1D6VL 5GGVL 3MRFB 3F8UB 2X1OA 5E8OB 4WU7B 1QFWI 5IM7A 5SX5K 5JOPD 4ODHH 2R69L 4F7PB 4MVBD 5H35A 4ZAKC 1AHWA 3QULA 1T66D 3RVUC 5HHMD 2F5BH 4JM2C 1U8KB 1NUFA 4NSKA 1S9WB 4G9FB 5TF0A 5DHYA 3K1DA 5E0QA 2YN3A 1GIGH 1T80A 1CGSH 3CFCH 3PL6C 2YPLD 5IW3A 1CFTB 2F53E 2DLIA 4RMRA 1XGUB 3AY4A 3MBEB 1U42A 4TUKH 3RU8H 4IRZL 1AO7E 1HN1A 5JZ7C 3BDYH 3WHXB 2ARJQ 4MXVF 3LS4H 4ISVB 4RWHA 5KW9H 2AEPH 4Q6YA 2ZUSA 2Q8BH 1PSKL 4Q2ZB 2GITB 1BQHG 1MHHA 3EYSL 5D71H 1HXYB 4P59H 5CZXC 3C5ZA 2VAAA 5FO8B 5HGHB 5C07A 4OV5B 4GLRI 4UMGA 3M17A 2CQVA 2I27N 1O5DT 4CDHA 1A6ZA 4AEEA 4CN4A 4XPAH 3REWA 1JGLL 1QBMH 2I9TB 5CJBA 2QADD 5IEKB 1JPFB 2HLAA 3KS0H 4RSVA 1JNLH 3B8SA 4UB0L 3WE6B 3G04A 3HC4H 4FQQA 3CFJB 2V17L 3WHE0 6FABL 3BZDA 4KV5E 1CDHA 2QKIA 2W0KA 3KJ4B 2HMID 1CICC 2E8ZA 4NZUH 4QRSA 5F1NA 4S1QL 5HDOA 5FA3B 2GUOB 2CSPA 3MREA 3RY6A 1W2KT 2I25N 5AWNL 4OZIB 1UYWL 3BO8B 1A7OH 4NQEE 1I9EA 1G9EA 4LSUL 1XR9B 2JCCA 4AMKL 3T4YB 3OF6A 3O6MH 1EBPA 4XWOC 4GAGH 4WVRA 3K1KC 3MYJB 4HV8A 2QSVA 1HHGB 5F72S 3NH7L 1S7WA 1TETH 3QYCA 3HKFA 3RVWC 2GTZB 4JAMB 4ZYKA 5DRZB 3VWJD 4X6FA 5FA4B 3CLFL 1A21A 3QI9C 5IW6A 3RI5K 5EBWB 4NKOB 1S5IL 3WN5A 1MELA 3U36B 3F5WA 5SV4A 4DN4L 4BKLA 4RWYH 5E7FA 1DQDL 1UWXK 3HNVH 2YPVL 3KPOA 5DQ9A 2XTJB 5IGXH 3T0EA 4GW4B 5EU7E 1WC7B 1WBXA 5FDWA 3RVTC 4W6XB 2NY3D 3GJFB 4U6XB 3S37L 5DJ6B 1GC1C 3RWIA 4G5ZH 3I75B 5SWSB 4UV4H 4U0RC 4YZFF 1NKOA 3A67L 2ZSVB 3BPOB 4XNXL 4NHCL 3MV9B 1UXWB 3MLZH 3I3EA 1J5OH 1D5BA 2VIRA 5DJ0B 3QEQD 1TFHA 3QIWA 3VRIA 5FKPA 3TEUA 3DETC 2E9BA 3FO2B 3I9GH 5KVMC 1OGAB 3CCHB 4A2MA 3C08L 3RWDB 1WZ1H 2BDNL 4OM1L 1LE5B 1CD1B 3FQTB 4UT6H 1U3HD 5DJZB 3D18A 1KEGL 3ARBD 3I02A 4JRXA 5E56A 1JF1B 4Y16C 4ZPTA 5F1IA 3V7AG 2E27H 4GKOA 3L95A 2AJXL 2C1PA 3L1OH 4KVCL 4M8VA 3CSPA 4GS7B 1JI2A 5IV2B 1VFUA 1JGDA 1WIUA 4U1NB 4KKCD 2CLRA 2HJFB 3R06A 3NCEB 4NHUA 2C4XA 4ORZC 1JF6A 3QQ4B 1JHTA 2VLKD 3WUWA 2XPGB 4ZUVA 5DGRA 3W2DL 2FO1A 3AXLB 4G3YL 4LQ1A 1KIRB 5TPWH 5C0DA 1DVFD 1MRCL 1YEJL 4PJ9D 3FAWA 1WUNT 4IS6A 4R4BB 2UZXB 4PP2B 3IDNA 1N64L 3FFDA 5IEHA 4QWWD 3MOAH 3BUTA 2DQDL 1HIMH 1S9XB 1NFDF 5I1DB 2CJUL 5E6IA 3K74B 2DM3A 2MNUA 1DFBH 1AR1D 3QR2A 1CXHA 4MHHI 2P5EA 3GSVB 4PB9H 1JRHL 4CJ0A 4POYA 1E28B 2PXYA 5CILL 1MLCA 3TYGH 1AKJA 4QHMB 4G8GB 3VWJA 3BRGC 4C58B 1KTKE 2DM2A 4PUBH 3FKUS 4XVTL 5EBMB 4X4YB 5LXGH 3RTQA 2COQA 4NNYA 4IRSA 1RPQA 1ERNA 2Y5TA 2VXTL 4L4TB 4CVZB 2MOVA 4WHDA 4ZDHA 1GC1H 2EH8H 1I7RB 3D85D 4NKMB 4Y4KD 3KLAA 3LB6C 2EDLA 3QFDB 4M3JA 5C07E 4XP6H 4XVJL 2IBGA 4NT6A 1QZ1A 5FB8B 1U8QB 4MAUH 3QEGH 4BH7B 3B3IB 3FHAA 1N3NB 3I2CH 1AP2A 2YUZA 1AXIB 4Y8DC 5GSVA 2KBGA 3V5KA 1UC6A 4WEMB 3TO4A 5E70A 3SJVE 4OCRL 8FABB 3KXFD 2E7LC 3TNMA 4S1RL 1JHLH 2XZQH 1LP9F 5HY9A 3S4SB 3MFFB 3T08A 4YDKH 2CRIA 3OKYA 4GRMB 3D25A 1F11A 3QUXC 4O51B 4MJ5B 4PGJA 3BPNB 4PJ8A 5HGAB 5D7KD 2JCCE 4RAUB 5GISL 2VKWA 4LLWA 4LHUD 2CH8A 4MB5A 1HNFA 1AI1L 3BISA 1DE4B 1QA9B 4JR9H 5AAMA 1B9ZA 4JG1H 1HWHB 3FB8A 3VE0A 5J8OA 1YEIL 2D03H 2X1XR 1WT5C 1MCWW 2A73A 3I6LD 2Y72A 2DKUA 5E00B 3EYVB 1G0XA 3C5JA 5L2JA 1XCTB 4LASL 2WMPA 1FORH 5FGCB 4QHNB 1FZOA 1RMFH 1Q94A 5J12B 3HG1E 1TVBB 5I1JH 3H8NA 5DZNA 5CEYA 4Z78A 4LSPL 2W9EL 1RU9H 4X7TA 4Y5YA 2OQJB 2Z9TA 2OL3L 3RNKA 3MLWL 3LOWA 4GRWF 3T0EE 5EBLA 3SDDD 2BMKB 1FGVH 3X13A 4NN6B 5J13C 4LVOB 4GXUN 5SX5H 4M61B 5SWZD 1BMGA 4N9OB 5GIRA 1CBVL 1BJ8A 5JOPE 3GIZH 4FQJH 4DKFL 3S35H 1KJ3H 4OGZA 3QWQB 1RHHB 5IW1B 3OAZK 3QUKA 3LZFH 4TUOB 4NZRL 3SCMA 3VXNA 3OPZH 4Q0XL 4UT9L 4MQ7B 1LEIB 5EOQL 1R3HA 1I3GL 4Y1AD 1Y18B 4Y89A 3BH9A 3T77A 4NGHH 4LBEB 1KLUA 4WDIA 2V5RA 5K59F 3BD5A 4D94A 3IETB 4PJEB 3MCKA 4X7EC 4P2QD 5MEQA 1M05B 2GJZA 4RQQA 3VH8A 1FIEA 3SKNB 4LPWA 4JRXE 4EI5D 4E0RB 4ODHL 3HMWH 1G7LB 2R29H 1B4JH 1YMMA 4AIZA 3DO7B 2FRGP 5F7YC 2Z31C 3VFWB 4KMLB 2ADIB 1OB1A 2FHCA 3CNKA 3DROB 1DQQB 2F5BL 4K7PH 4LNRB 2FEEL 4EEEA 5EFIB 1A4JA 2YKLH 3BN9D 1GIGL 5J4MA 4UQ2B 1CGSL 3CFCL 3X14B 4O58H 3X3GH 5IMKB 3O9WC 1N0XH 2EXWC 3BZFB 1NGYA 4FQIH 4J3VA 4R2GC 4TUKL 1HHKA 2IQ9H 4HWZA 3RU8L 3AS3A 4IDLA 1ZMYA 5DK3A 3TIEA 3C8DA 3JTTA 3RWCB 3BDYL 1PAMA 3KPTA 3KXFA 3LS4L 5KW9L 3ARDB 2AEPL 2Q8BL 1ODAA 3MRLA 4PRPD 3UO1H 4J3XA 4KI5C 5D71L 4P59L 2HG5A 1KPRB 3QBTB 2MQ0A 4FA8A 2PUQT 1T4KB 4ACPA 1RJZA 4KUZH 4JCMA 4XPAL 1QBML 2MWCA 4PBWD 1BVZA 1JNLL 3HC4L 1J12A 3OHXA 4LAQH 1O0VA 2P5EE 3DMMC 1H8NA 3JWDH 2WZPD 4NZUL 1BFTA 5CUSH 5ANMA 2ADJA 4KRPB 4U1MA 4Z7VB 4JFHD 5FHAH 3VXUD 4OTXH 1L0XA 3N1QC 3UTSD 4CVUA 3T8XA 4Z7WB 1T83C 1ZOXA 3JVGC 5I0DA 5HHNB 3O4OB 3O6ML 4F2MB 2CR6A 2Y5EA 3B9KB 4ZOEA 3PV7A 2HRPH 4GAGL 2BNUA 4Z9KB 2P43B 1UWXH 2ESVD 1EHLH 2FJFA 3EYQD 1TETL 3ZYOA 5T3XE 1ZA6B 3IFOA 3P9WB 4MCZA 4G7VH 4JY5H 1PX3A 2YUVA 3E2HC 4XX1E 3HE7D 3FO0H 3LKQA 5E2UH 2VL4A 3ZT5A 3BP6B 3PHOB 4JDVA