1BGXL

Taq polymerase in complex with tp7, an inhibitory fab
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
210
structure length
210
Chain Sequence
b'DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAQ DNA POLYMERASE
publication title Crystal structure of Taq DNA polymerase in complex with an inhibitory Fab: the Fab is directed against an intermediate in the helix-coil dynamics of the enzyme.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Complex (polymerase/inhibitor)
total genus 30
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1998-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL01
3QXWA 4F7EB 5K9JH 1FFNA 1D5XB 3MLSH 1U8KA 3CDGB 1K8DB 3FTGB 1UH4A 5DRZB 4O4YL 1KIQA 4J3VA 1ETZA 1BGXH 1NDMB 3IDNB 2J12B 3EFFA 4NCC1 5JQ6L 1BBDL 3AREA 4JDVA 3W9EA 1JMXA 4X4YA 4PRDB 3I6GB 3W9DA 4KJPC 5DUMH 1S5IL 4NKOB 4IRSD 3ULSB 2X9YA 5EU5A 3WE6B 2FBOJ 4EUPA 5D1QC 4ZTOL 1A4KA 1DANT 5J6GA 2IALA 4POZC 3QUZD 4YBQD 5LGHL 2VDLL 2Y5EA 3VFOB 5I18H 3RKPA 3R1GL 5HY9A 5EH1A 5FUOH 4M7LH 1IGFH 3CFDA 4KI5D 5FYLL 3BGAA 3O41A 2Y1VA 3EYUH 3UJJH 4QWWC 4ZTPL 2HLAA 1NMAH 1WITA 2DM4A 2J8UA 2HFEB 3MJ9L 3SDYH 2EDHA 1EMTL 1YN6A 2NNAA 1JTTA 4TULL 5C9JA 3FKUS 4TQEH 3MRMA 4BFEA 1T6WA 4IIQA 5T3ZH 5IM7B 1RUKH 2ITCB 1FZOB 1AGDA 3G6JE 4XCEB 4R97B 2QSQA 1Z6JT 1OAUH 3FFDB 5BMFH 3DX6B 2I9LA 2P1YA 2HKHL 1NCDL 2P5WE 1IC5L 4CMHB 4XCCH 2D9CA 3EO9H 2EIBA 2Z93A 3HNSH 1JGUH 2GJ6B 5F88B 3Q5OA 5A16B 1OP3H 2BFVH 5DRWA 3OJDB 1WZ1H 3DYOA 4R2GD 2BZDA 3KGRA 3IFPA 3SEPA 3H9ZA 4PJ7F 5GGRA 1QR1A 1H0DA 1NANI 4G6AD 1TTGA 4NKIL 1OVZA 3WO4B 1ES0B 3I6LD 4P5KA 3KXFA 5GRJL 3SDXA 1R3LA 1J1PH 3CXHK 3U0PB 3B5GA 5E8NA 2DLGA 4LPVA 1YYML 3SHSA 1CGSL 3DMMC 1FNHA 5IB3A 3JWOH 2EH8L 3NMEA 4KUZL 5JPNB 1AP2A 4G7YH 2GT9A 3ARDB 4ZFGL 1ZT4B 3LN5A 4X98B 1FYTD 2X9WA 3PHQA 4QRUB 1CFNA 3H7BB 1I7RB 4NDMA 4O4YH 3MV7B 3REVB 2F5BL 3U0TA 4MCZA 2VYRE 2H3NB 4HXBL 5KSVA 3LOWA 4G43B 1Q94A 5JQ6H 1BBDH 1TVHB 2GYSA 4A6YH 4PJHA 5ILTL 1N2RA 3O2DL 4PJ8D 2FECI 3GJEB 1S5IH 5JXED 1AO7B 2ESVA 1SMAA 1U3JA 2APBA 4PBVC 5DK3A 3LSOB 4ZTOH 2I5YL 4JFXB 4PJXF 1WICA 1T5WB 5LGHH 2VDLH 1MI5D 4KK9C 2DBJA 4R0LB 3SE4A 4WWKA 1ZKAA 3HAEB 3QHFL 3F65A 3V5HA 2HRPL 1ZK9A 1AD9A 4UAOB 5FYLH 5K59E 4O2FB 3SDDD 4M00A 4ZTPH 2QBWA 5D4QA 4NM4L 3O6MH 4G7VL 2PF6A 3NCYS 1RUPL 3SE3A 4JKMA 3MJ9H 1I3RB 1XIWB 2XZAH 4ORGA 1EMTH 4GW1B 4TULH 4HUXA 1QFWL 2EDFA 3IDJB 3X11B 4JQVA 3UZEA 3PV7A 1MCWM 2O61A 1REIA 1ZSDB 3HRPA 2W0KA 5B8CA 5GS1A 2IADB 1QRNB 3MACL 1J18A 1S9WA 2JK5A 1AGBA 3L7FA 5ACZB 2NZ9D 5C09E 1YMMB 1NEZG 2HKHH 1NCDH 3DO7B 4P2RD 1XGPA 1IC5H 3ALXA 2VZTA 3EOBB 3WFZA 4WNQB 2ILLA 2EKSA 2XZCL 5DQ9B 3LD8B 2APTA 1PEZA 3VH8B 3R06B 3TFKC 4MA1C 4RRPA 4ZD3H 4C83B 2ZNWA 1I7TB 4OLYL 1BFSA 4NZTL 5GJTL 4HGWB 4NKIH 2BVPB 5F70A 4URTB 1BWWA 1D5BA 1HHGB 4JANA 3MGOA 4PBXA 4KMQA 4RGMC 3ZHDA 3HI1A 2R4SL 4NRYA 1ONQA 3D39B 3DURA 5GRJH 2D2OA 4YFLF 4HK3N 1FNGB 3OAZH 1YYMH 4F33A 1CGSH 1FNAA 3B4NA 3ARGA 5EIVA 3QJFB 2GK2A 5HHVH 4KRPB 3TN0C 3X12B 2EH8H 3IU4L 4KUZH 3PWUA 5E4EC 2G2RA 5AWNH 4ZFGH 4WFED 5ABDE 4WI9A 4A6YA 5D1ZB 1XT5A 2EEDA 1A3LL 3MODL 3IDGA 3TA3C 3JV4B 3TO4A 2JJTA 4HUNB 1CGVA 3T0EC 2F5BH 1NGPH 1TPXB 4HXBH 3UZQA 4HLZH 1PY9A 4FTVB 3KDMA 5INCA 2YA1A 3VXSA 4HDIA 3MV8A 5ILTH 2WBJC 1JGVL 3O2DH 3P9MA 4JFYA 4DZ8A 2QSVA 4PRPA 2HTLD 1GGCL 5I8EA 1FGNL 5I1LA 3JV5A 5E9DE 3MFFB 2FZ3B 4U1GC 3SPVB 2Q7NA 3KWWB 2RHEA 4NZUL 1DBJL 1IT9L 2ICES 4K9EC 5IHLB 3C60D 5I0ZA 3MBEB 4L4VA 3MJ9A 1EV2E 3KG5A 3QHFH 4CW1A 2EECA 2HRPH 3OB0K 3T65B 4AMKL 5CJ5A 3QDGD 4P48A 3RVUD 1OW0C 1L6XA 1CDYA 3RRQA 4NM4H 5HGBB 3D25A 4G7VH 5T3XL 3BJLA 3AVEA 2EE2A 4XTRC 2WWKT 3FN3A 1BOYA 3G6DL 4PGEB 4TSCH 3V6FB 4OI9A 4Z6AT 1UZ8A 1WFNA 3CFKA 1FO0L 2PO6C 5FCSH 1G7HA 5GGSA 4G9FE 5IR1B 3MACH 4WEUD 5CJBA 1GGIL 4PJCF 5FYKE 4L29A 2OSLB 1VA9A 3WNOA 3VI4F 3SCMA 3PGCB 3JTTA 3BQUA 1AC6A 4M4PA 4R7DA 2XQYG 4YWGL 3RPIB 1YN7A 2D7TL 3ARFC 3O4OB 3UP1A 1CXKA 1I1YA 1X5YA 4WTZG 3B2UC 3LKOB 3WSQL 4F7CA 1C1EL 2NR6C 2XZCH 4G8GE 5DD6A 1HEZA 5BRZB 4PGDB 4FQ2L 4M1DL 1U3HC 4M6AA 5DF0A 2WAHA 3ULVL 2EYSA 4OLYH 3ES6A 5C0IA 3FQTA 3CFJB 3HA0A 4NZTH 1WC7B 5GJTH 3T3PE 3W0WD 4OZIA 1GGUA 3QFDA 4BSVB 1SY6L 3O3AB 4Y2DB 2R4SH 2PN5A 5EOTA 3WFDL 4BKLB 3RU8H 5IFHH 2AP2A 1DR9A 1PFCA 4JFPA 4E41D 3MRQB 4YDKL 4JRYB 4MWFB 1AQDB 2BOCA 2UZXB 3W5MA 4L8DB 5SWZB 2Z31A 4IMLB 3P11L 4FFZL 1H3WM 2P49B 2VR4A 3NZHL 5KVDH 4DGIL 1CDJA 1X5AA 3S34L 3IDYB 3QP3A 4LLDA 3VWJD 1XF4B 1A3LH 1Q9WA 5IHZB 3MODH 5H37H 1MCLA 1T20B 1IL1A 4PJGE 3ZE1E 1F3RB 2YZ1A 3CSYB 5JNYB 2ZPKL 2YPLB 5E8EB 5I17A 3UTPE 4EN3A 4KHTL 4L5FL 1HCFX 4IRZH 3NIDF 3BYYA 1JGVH 1VGKB 3G5ZB 4Y7MA 1JI2A 3K8LA 1SBSH 2W0LA 3OV6A 5D72L 1FGNH 4I3GA 3NFSL 4PRHB 5IW6A 5EBWB 3W82A 1QQDB 4JO2L 2O5XL 4NZUH 4FQHA 1DBJH 1IT9H 5D5MA 3MNWB 4QTHB 3ZKSD 1PD6A 1F42A 3FB8A 1H5BB 2UZIL 5FK9B 3WKML 5LXGL 2XZZA 1J87A 2HP4A 1DFBL 3C5ZA 2B5IB 3HZYA 4AMKH 3RGVB 1UWXH 1GGTA 2YA0A 3ZE2F 1X3DA 1KJ2B 4LSRL 4Y5YC 1IBGH 1UWGL 3FQWB 2MHAB 1KN2L 5GS2H 4PGBA 3U82B 1XGQA 3ARED 3L5IA 4IOSD 1FO0H 3QWRD 2Y25A 4GAYB 1W8NA 1HYSD 3QIUB 1NBYB 1QYGL 1NGZB 1GGIH 5EC2A 1FFOA 5D93B 4FS0A 4YWGH 1HXYA 1AGEA 1JZ6A 1EZVX 3MJ8A 4QF1B 3NGBB 1UM5H 3L3OA 3BGMB 3QNXB 3WSQH 5C2UB 1C1EH 2IPKA 1ZTXL 3LPGA 3QZWB 2JCCF 5HTSA 3CCHB 3AXLA 4FQ2H 4M1DH 1DBKL 1A6PA 2I07A 3ULVH 4OZHF 4IRSB 2WINA 4NO5B 4J6RL 2JELL 3T0XA 1KNOB 3C6LB 5BZWB 1SY6H 3IFOA 1H3GA 4NZDA 1F02I 1KLUA 2JKXA 3WFDH 2C3WA 2YK1L 2BMKB 3QUZB 3OR6A 2WLZA 4YDKH 4XC1L 1SMOA 3BZ4A 4KI5E 3V7AG 1I1FA 3VMOA 4DVBA 2DWEA 5I8OL 4QRTA 1Q38A 3SKNB 3NZHH 4DGIH 3B9KD 3Q6FB 1PEWA 3SN6N 2J8OA 1GZQA 3BESR 2AJYH 4XNMB 1J8KA 1H8OA 1JHTA 3I6KB 5DEFB 4GBXB 4HT1H 1QO3A 2A6DA 5CZKA 1BQLL 4HMDA 3U4EA 2ZPKH 4LEOB 3RDTA 2HAZA 2NY2D 5JUEL 1R3HB 4L5FH 4UDUA 3A67L 1J0JA 2HJFA 2XTJB 3ISWA 3O3BA 4JY6B 2DTML 4DW2L 3KXFD 4EIGB 5T5NF 5D72H 3QQ3A 4AY0A 5D7JC 3VJ6B 1UJ3A 2IJ0C 3EO1A 4WV1B 5CD5D 5F7HA 4JO2H 5DR5L 2O5XH 1ZV5A 1NC4B 4YFEA 4ZPVA 2A0LD 2UZIH 3WKMH 5LXGH 1J10A 4LF3B 1DFBH 4E5XB 2RJMA 4OFIA 1FO0A 3O9WC 1WWBX 4NQDE 3TO2A 5HI4D 3I6LE 1AXSA 2FYYB 4N1HB 4LSRH 3FT2B 3RBSA 1JPGA 1KPRB 1UWGH 5C0ND 4FFYH 1KN2H 4KZEH 5ACLA 4OKVB 5DJZB 2X4UA 4PJDB 1ZVSA 1BOGA 4KKBC 3IVKB 4WTXA 2F54E 5EZLA 1N0LA 2E8ZA 4MD0B 4E42B 2ESVD 2QL1A 1QYGH 1UM6L 4IJ3B 3WIFB 1C7TA 3BE1L 1T66C 2D7OA 4M61B 1LEKB 4NUJB 1OQXA 4J1UA 3QH3B 4NQEA 4WWKD 4PUBL 2WQ8A 1ZTXH 2FJHB 1BZ7A 1FIEA 5DJ0A 1SY6A 1U95A 3WNKA 1JK8B 4BK5A 4RGNB 4HC1L 1RJZB 5T3ZD 4F7MA 1DBKH 3VCLA 3FHQA 1F58H 1QUNA 3OBAA 4OZGE 4J6RH 2JELH 1KENL 1NKOA 4NN5C 3S97C 3C08L 2V5TA 3BPNB 1H3UA 4ZFFA 1QFWM 3D87B 2OTWA 4AT6B 2YK1H 1N0XH 2AVGA 4RMQA 5GHWL 4XC1H 3P2TA 3K81A 3GRWH 4DK6A 3G08A 1GHFL 5A2LH 4F9PA 2VDKH 4FQCL 5I8OH 1G6VK 5DMYA 1ZHKB 2HT3D 5D6DA 3S5LG 1P7KA 5H94A 4HWUA 3VXME 3TVMA 5ICZB 1E4KC 3UO1L 3CMOH 1FYHB 1AKJB 1BQLH 2AXJA 1Q72L 3DUHA 5FUCE 3GNML 5JUEH 4N9GB 4ONHB 3A67H 3PJSB 1CT8B 2DTMH 4DW2H 5B4MD 3QJHA 4PJEB 3HAEG 4LEXH 1M7XA 3UTSD 3FB5B 3H3BC 1UJTA 2FNBA 1HOCB 1EXUA 4J4PC 4ZPTB 3WIHL 5DR5H 4KQ4L 3ARGD 2NX5B 4LRNL 1Z0NA 4J3WA 5DURB 1ZANL 3ARUA 4IDLA 1FVDA 4HXAL 3G9VA 3EUUA 4ESKA 1Z5LB 1AD0B 5I75C 1P84K 4HIJA 4LSUL 3D3VE 1MCOL 1NBZB 5BJTB 5F7KC 4ONOA 1YEEL 3U30B 3TO4D 4KRLB 1EUUA 2ADFL 2Q76A 5IROA 1WF5A 1K4CB 4OCYL 1MFBL 5KVMC 4EVNA 4L8CA 3SKMA 1QP1A 3VXSD 3MV8D 4CMHC 1C12B 3TC9A 1U41A 2X4QA 2A83B 3Q48A 4PRPD 3CFCL 1U8JB 1YJDL 5DMKA 1UM6H 4WFEE 5CKGA 2FJGA 5FYLD 4Z7QF 2PNDA 2VXTL 3QDJB 2OR9L 1KIPA 1BPVA 4U6XB 4Q6YA 4WU5A 1J7VR 1BF2A 3ZDYF 3EYFA 2YZ8A 2DLHA 4V2BA 1BZ9B 1HXMB 4PUBH 1KPVB 4WU7B 5GZND 3K74B 3WO4C 5EN2A 2XY1A 4GMTL 3WJJA 3K4ZA 4ZO6A 1D9KA 4HC1H 3VGDA 2IANB 4P46B 2CIIB 3I75B 1ZGLA 1F13A 3HNTL 1KENH 3GRWA 2IGFH 1Y6NR 1DEEA 5IKCB 5IVXE 5FGRA 3QO1B 3ARDC 1AGCA 3BH9A 4XBGA 2WQRA 5J12B 5J57B 3MRCB 1BIHA 4GH7B 1IGMH 4KKLC 1IZJA 3SCMD 3ZYJA 3DWTA 2R15A 4Q9BA 2VXVL 5CWSA 5A3ID 4FQCH 3QDGE 4WO4C 4LCYA 3MV9A 1J12A 3ALPA 4JJ5B 5M94B 2J5LB 1AIFB 2OQJA 4WENB 5DJYA 4L8BA 1E4JA 4MNQA 1ZLVK 4YGVB 3UO1H 5CMAA 1JWUB 4X6FB 1RZKL 4OCWL 3RX5A 2W60B 1Q72H 3V6OA 3GNMH 3JV0A 1FLRH 2VQ1B 4D0DB 5IQ9A 2X7LB 1GOHA 1T2XA 43C9B 5ANMB 4R0LC 3AC0A 4NSKA 3TPKA 4BFIB 1KCSL 4UAOC 5T5NG 1CFQB 3MZGB 4ODWA 4KQ4H 3HS0A 4LLUA 4LRNH 1OAZL 2Z31D 3KPLB 1ZANH 1FNEB 4HXAH 1XIWC 3MOBH 4PJDF 4LSUH 2P43B 4P4KA 4UINL 4XGZB 5ITFB 3W0WE 4F3FA 3MXVL 4XPTH 1YEEH 2YA2A 1F4YL 2ADFH 4I2XB 3SO3B 4EQ3A 3BEVB 4OCYH 1MFBH 5I8KH 5AG9A 1Q9LA 4JKWA 4EN3D 1NAML 3INUL 3HUJB 2N1KA 4JQXA 2XTLA 3ZDZF 4NRZA 2RBLA 4HQQL 4P5TB 3WFEL 4O2EA 3CFCH 4GRMB 1X6NA 5TE4L 2CDGB 2VUOA 4HC1A 2VXTH 2OR9H 1U8OA 3NH7L 3ROLA 5HXMA 4JAMA 4IS6A 1S8DA 4DAGH 3MNZB 1M71A 2C3HA 5DRXB 3LH2L 2HT2D 3FO2A 2K1MA 4J2XA 2IPUK 1KJMA 3VD5A 5JMOC 5JORB 3AM8A 1SJXA 1ZT1A 2RR3A 3GGWA 5JO5B 1IKNA 3GSOA 4MNGE 1CXHA 1RUQL 4KHXL 5IBLC 4PRID 3WDIA 3KPSE 4YK4C 3RUGB 3HNTH 1TZHB 2H6PA 4KRPC 2E9JA 2H2SC 2Y7QB 4MJ6A 4PRNA 1UM4L 4WEMB 1JRHI 1R5VB 4GG6E 3IYLW 4GUPA 2VAJA 5CSZA 4EOWL 3FT3A 4H1LG 4KXZI 5D1ZC 2R2HA 1P53A 2CIKA 1U8KB 3VFNA 5HPOA 2VXVH 1HNGA 3BI9X 4JHWL 4KWUA 2EO1A 4TNVF 3EOYG 1TPXC 3OG6B 3UPRA 4Y4FB 1KIQB 4OF0A 1ETZB 3QIWA 1M05B 5HGHB 1C5BL 4PJEF 4QRPE 1E4XL 2EYTA 4X4YB 3PHOA 1RZKH 4Q7DA 4OCWH 3OKNA 4EI5B 2LU7A 2P5ED 2QR0A 5DQDL 2YMXL 1YPZB 1A6ZB 4Z7NF 4HKZA 3L7EA 4U6TA 3CFIC 2VC2L 2WANA 1KGCE 3MBEC 1KCSH 1U8IB 2EDWA 2JLLA 4PTTB 4I77L 1ZGLM 1OAZH 2YD1A 3EW3B 3O6FC 3U79A 3VGEA 1AY1L 3RIAF 1BFOB 3G04B 3U4AA 4LIQL 4UINH 3V7MA 4ELKA 3MXVH 1R5WB 3ULUE 5C9JB 4JY4A 5B38A 4NP4L 4YHPB 5E94B 4OFVA 4IIQB 1HDMA 1VEOA 1Q0XL 3HTLX 1RZIB 3OX8B 1AGDB 4KV5F 3RDTD 2P7TB 3INUH 5IWLA 4LBEA 1G1CA 2BVUA 2I9LB 5DVLA 2DLTA 3MYZA 3O4OC 4HQQH 3WFEH 4CDHA 5JXAL 1PY4A 4XNQB 3C6SA 1OM3L 4PLKC 3QZWG 4HUVA 5TE4H 1YNLL 4JVUA 4WI5A 4DEPB 2HJKA 3NH7H 4TUOA 3B2VL 4JPKL 3PQYE 3MA7B 3LH2H 5GS2D 4HG4J 5AZ2L 2R56L 5GGRB 5GJSH 1H0DB 2R1WB 2VN7A 3QEHA 1CLOL 4U4BA 2BY3A 5E2VL 4Y2DC 2YSSA 1AR1D 4X7EC 1MAML 3FQNA 1JPFA 4KHXH 3HZMB 5JIHA 2GW5A 1OTSD 5CKAA 1NBVL 5E8NB 3WD5L 2GAZA 4FQQA 3DXAB 2YR3A 3H0TA 1UM4H 2F19L 1UG9A 4QXTA 3TPUA 5IB3B 4KKNA 5E6IA 1V3KA 5E8OA 1AP2B 1V3JA 2ZCLL 2XY2A 3IDYC 4WUKL 3GI9L 4GAFB 3QO0B 2PTTB 4JHWH 4UQ2B 2VO5A 1QLFB 1R6VA 1NH6A 1B4JH 5DLML 1S5HA 4NQED 3ULVD 4HKXA 4X6DE 6CGTA 3EZJB 3U9UA 2OM5A 2R69L 4WUUA 3U0TB 1H3VA 2MKLC 2W0FA 4D9LL 5I1HL 1TJHL 1C5BH 5BW7C 5KSVB 1J05B 3B9VA 2J6EL 2X4NB 1E4XH 5KSAA 5SWSA 5GXBB 3QISA 3ZTJG 1ITBB 5GZOD 4FFVD 3V5KB 3QEGH 1BQSA 3F7QA 5DQDH 3L3DA 3VFUA 3PIQB 3GMLB 1RJYA 4M43L 3THML 3S35L 5FA4A 2X09A 2PCPA 2VC2H 4X5XB 3K2UH 3BT2L 1H5BC 3QHZL 1FV1A 1CGXA 1X5XA 5DVOA 1LNUA 1S7TA 5JHDA 4WWKB 4I77H 2B5IC 5EU7C 2HN7A 2GCYA 1QBBA 1V7NH 5I8CA 1VKXB 3RGVC 4XB8A 3L5WA 1LQSR 1INQA 4P2QE 1VDGA 1AY1H 1TETL 2Q8AL 4PJBA 4LIQH 4PREB 1RZ8B 3C09B 4U33A 4ORGB 3WFCL 4XCYB 3TVMD 5DC0A 4GXUN 3IFLL 3QIUC 1ZGLP 5B8CB 1Q0XH 1UEYA 3CFEB 1J0KA 5F6HI 1S9WB 4HIHA 5D93C 3TZVB 4AQOA 5B39G 2ICWA 3L7FB 4O51A 2D4DA 3ARBA 4M3KB 5KSUB 3NGBC 2IFFL 5JXAH 3LN4A 1V7ML 2QHRH 1OM3H 4M6NL 1DUYA 4QRSA 2YEZA 2WP3T 2WWMD 3MA9L 3K46A 3NCMA 2HLFD 5HYJB 3U7WL 4E0RB 4FXKA 5IG7A 4QCIA 4IRSC 3B2VH 4JPKH 4R90H 5FM8A 2D7NA 5AZ2H 4U1LA 1FL6A 3C6LC 5IMOA 1DEDA 3BKCL 1DE4A 1CLOH 4HJGA 1OP5K 5T1LA 5E2VH 4LSTL 3RWGA 3WL9A 2Z35B 3AB0C 5T1DH 3QUZC 3B9AA 1MAMH 3MGOB 4QHMB 4Z7VE 3RNKA 3HI1B 1G6RB 1WIPA 3W11C 3DURB 4PGZA 5FF6A 5I76A 4KDTA 2DQFA 1NBVH 2ZG1A 3UTSE 3GUTA 1H3TA 2OYPA 3WD5H 1BAFH 3BW9B 4F33B 1OGTB 3UDWC 4WFFE 1J11A 2A73A 3FO9B 5IFAL 4PV9B 2F19H 2AJ3A 2C9AA 5CEXA 4BELD 3RZCB 4WUKH 2H9GA 3GI9H 3VFRA 1IEAA 3UPAA 1C7SA 4A6YB 4GBXC 1YPZF 4MA3A 3K0WA 5DLMH 3TO4B 5GRUH 2XWBA 2R69H 4PJ9A 5I1HH 1TJHH 5I1KL 4UUJA 1FLTX 3T1FA 2J6EH 4BQBA 5DYOB 4ELMA 3AMLA 3BP5B 4RAVA 1E6OL 4X6CA 1KTKE 2EDQA 4YHOH 2F53A 4WV1C 4N8PA 4QOKA 5B21A 5FYLE 3FFCE 4M43H 4XNUH 3THMH 3S35H 2DL2A 1XMWA 1I85A 4K55A 4R2GC 3BT2H 2IAMB 4WI4A 4DCQB 4YE4L 3G6JB 4JLRB 1MLBB 4L4VB 3TNMB 3WBDA 3VFTB 2GJZB 2Q7YA 4G6AC 3SDAB 1CD1A 1WGOA 4FOMA 1BFVL 5F7WC 2KH2B 4RISL 1WJ3A 4M02A 1IRAY 1WUNT 3QQ4B 5F7FA 4QNPF 1IGCL 1TETH 3MV9D 2Q8AH 4OAWA 3S98A 3EJYC 1QPPA 3Q6GL 4BUHA 3WFCH 5AYQA 4MNQD 3IFLH 5FIEA 1UZ8B 1I1CA 5CEYA 4XVSL 5ECJE 2WSKA 3V0VA 5IW3A 4H0GA 1CFBA 5F3HA 3JTTB 3BQUB 3HE6A 2IFFH 5ICXB 3GB7A 1V7MH 2PW2B 2FLRT 2VZOA 4M6NH 2GY5A 5E0QA 3MA9H 2BVQA 3HPJA 3U7WH 1HEZB 4J8RA 5JW5A 4YHNA 2OCFD 3MCKB 3MLWL 2ARJQ 4FMFA 5E5MA 2EYSB 4EDXA 3UX9B 5DMIL 5TQ0H 3BKCH 4OM0L 3M45A 5J1AA 5ESAA 3L9RB 4N1EA 4OZIB 3BPNC 1I3GL 4LSTH 4PRAA 4MXQC 2DQUL 2PW1A 1P9MC 4IRJA 4PJ5D 4X9HA 2V9RA 3MUY1 1ORSA 1UQSA 4CADB 2H1PL 3GSXA 5EZJA 4D94A 4M7ZB 5IFAH 4U2ZA 2MCG1 1NC2A 3QA3B 4U1KB 2C4FU 3MLZL 1CK0L 5D7KD 1S7VB 4OCNC 1CICA 2J6EA 1CLYL 1HQ4A 4X0KA 5A2IH 5MP6L 1K5NB 4LLDB 4EBQL 4FXGB 3HE7A 5L6YL 4S11A 1BD2A 2R23B 1UZ6E 4Y1AB 4LHUB 4MB5A 2DQGL 5I1KH 3LZFL 4DOHB 4H26A 4LOUC 5DUBB 1HH6A 4ODUA 4OV6F 4ZFOB 1E6OH 3OKLA 5DMGD 4M9PA 1T89A 15C8L 3DTXA 5ADPL 1WFTA 5D9SA 2SEBA 5IW6B 5MEOB 5CLTA 3LRGA 5D5ME 4FQHB 2MFNA 1P7QB 4WHDA 1A7PL 3G5VB 3D48R 4S1DC 1B88A 2M26A 5F72S 3O6LL 3FB8B 3DUUA 4RNRA 3LRSA 3EYVB 1B0GB 1BFVH 5JDSB 4RISH 2Q3ZA 5AAWA 1LP9A 3C5ZB 3U30C 4NKMA 1G0XA 1BLNA 1MAJA 2AQ2A 1MJJB 1IGCH 2ZUQB 1MHHB 4PTUB 2DQHH 5DDHA 2ZUXA 3DX9B 4PRIE 1A4JB 4MQTB 4UNUA 1H3PL 2IBZY 4DTGL 5BVJB 3QIWD 2YN3A 4PGBB 1T1XB 4X6EA 1XGQB 4M6OL 4FFWC 5A2JH 1A1OA 1T04A 3F5WB 4JDTL 4CMMB 4XVSH 1K9TA 4PB9H 1NDGB 2BP3A 4NNPL 4V1DD 4P59L 1M7DA 5F6IB 5EUOE 2ICWJ 1KF9B 4MDJA 4HCRL 2VDQL 1JWSA 1HXYB 3T2PA 4DUWA 1AGEB 1S78D 1RI8A 1G7LA 4L4TE 2BC4A 3VMPA 1NFIA 1U58A 1JNHB 1ND0A 5BS0E 2QQNL 1KBGL 4K9EL 4N0UE 1MWAL 5F7LB 4MXVE 4RFEA 2AJUH 3BKJH 1YY9D 3MLWH 2P5EE 5I1DB 4OCMC 4NJ9H 4JVPA 1DBMH 4HUUA 4OM0H 1I3GH 2X4RA 3OKMA 4TUKL 4RAHA 3IFOB 3DVNB 4M5YL 2G75A 2DQUH 5J12C 1G7JA 1UYWH 4WHYG 2Y6SC 2H1PH 5ENWB 3DPBA 4X9BA 4ZFZB 1Q9OB 3HCVA 1B4RA 3BSZL 3RVUC 4OF8A 4HKJB 1Z0MA 2EIDA 5F7DA 3PWPD 3RL2B 1CK0H 2J5LC 2AEPL 3S88L 1ROWA 1CLYH 1YY8A 4JZNA 1J86A 3KLAA 4LCWB 3UTTE 4EBQH 2VZ1A 4HH8A 3F7VA 4H0HB 4ZUWA 2J4WH 2DQGH 2NY3B 4QRRA 3TBTA 3RDTB 3LZFH 4AH2B 1A1NA 3V5DA 3G6JF 5IV2A 4WRLA 5C08E 2P8LA 3FRUA 5ETUA 5D2NE 1S7RB 1BF8A 15C8H 1OP3K 3ZDXE 1NJ9A 3C2SA 3VFWA 4F37K 3EO1B 5JPMB 4WDIA 1A7PH 5TDNB 5EO1B 3QQNA 2CRIA 4XWOD 5T3XE 5E6ID 1G9MC 3O6LH 3CX2A 2W9EL 2V5RA 4L1HA 5BZDB 4KJYA 3E6HB 4NFCA 1WSST 3MPCA 1PBYA 3VFVA 3SO3C 3SKJL 3GBNL 1AXSB 1RQ5A 1JPGB 4WUUD 5FGCE 1H3PH 4DTGH 3IAGC 4APQB 4G8GB 2NY4B 2CDEA 2FJFB 4M6OH 1UFUA 2R9HC 4P5TC 1RY7B 3VDBA 4JDTH 2X4UB 1QSED 2CK2A 1ZVSB 1BOGB 4PRBA 5KSAD 5SWSD 4DN3L 3RVXC 1J0HA 2ATPA 4P4RA 5EZLB 4Q58C 4KK6D 4NNPH 4P59H 4XC3L 3X3FL 4KU1A 2DICA 5GRYA 5IEKB 3GDBA 4XT1C 4HCRH 2HJLA 1G7IB 2VDQH 5BXFA 1VSCA 4P99A 4J1UB 3ULVE 4O02L 5EWIL 5JHDD 4LK4A 1VENA 1OSZA 2WK2A 4HJ0C 4N8VG 4MA8L 2QQNH 1KBGH 1BZ7B 3MRBA 4K9EH 3OTTA 1MWAH 1NMBL 5B22A 2FEDC 4K7PY 3VCLB 3OR7B 3PWLB 4HIEA 1SJEB 4I9WE 4GRLB 1WBZB 4KROD 4QHKI 1NBQA 3OAYH 4TUKH 2VXSL 2AJZA 4M5YH 3E3QC 4PJGB 4AZ8A 2VQTA 1NANH 2W07A 4I48A 3BSZH 3G08B 1GGBL 4Y4FC 5K59F 2EDRA 1P4LA 1DBBL 2CDFA 4L3EA 5B3JE 1INEL 1VADA 4BSJA 3JZ7A 1ZLSL 2AEPH 1FE8L 1P7KB 5H94B 1HSBA 1OWWA 2H2PC 4ODXA 4EI5C 1JN6B 4XHQA 5IJVA 5E6ZA 3CSGA 4UDTA 4LU5L 5C71A 5KS9E 4CGTA 5EULV 2FSEB 5EBLB 5T1LD 1SQ2N 3QG6B 2B0SL 5CZVL 1BVKA 3WYRA 1PZ5A 5AAMA 4S0TD 3STZA 1EXUB 1LILA 3TN0A 3KNBB 2W0PA 4XCNB 2ICCA 1MPAL 2X41A 5DZLA 1YQVL 2MJWA 4JFFE 2ZCKH 3TA3A 2DQEH 3HZVB 3ZL4L 5I15L 4IIQC 1CFSA 3T0EA 5DTFB 1KN4H 1AXTL 3GBNH 3OAZK 1IGTB 4PJ9D 2IH3A 3TESA 2FR4A 2WBJA 4HCRA 2QSCL 4KVCL 4DN3H 3IXTB 2X4QB 1F3DH 4U7MA 4PLNC 1XR9A 2F53D 4OZFB 3WFHA 4XC3H 3X3FH 5DMKB 3D0LA 4QOKD 4ZXBA 4DEPC 3OKEA 1MWAA 1XCQB 2ORBL 1V3MA 1EEZB 2PYEE 2A1WL 4KKCD 4WU5B 4O02H 5EWIH 5IK3B 3RZWA 1D6VL 2YN5A 2VLJE 1YC8A 3UTOA 3DUSB 5IB4A 2BNRA 1OW0A 1D9KB 3BH8A 5KZCB 1NFDA 1Y18B 4N0YH 4HGKC 4JR9L 3AAZA 5TH2A 3CD4A 1EVTC 2CXKA 4Q0XL 1EFXA 1HI6A 1N5YH 2PO6A 4OIIL 4YHIB 1I8IA 3V0WL 2A0LC 2PTUA 5HHXL 5D7IE 4NQCE 1DEEB 1HHHB 1TJIL 3ARFA 1CDHA 3HE6D 3KPNB 1GGBH 1PX4A 4NBZB 1DSFL 1DBBH 4LCYB 1VGEL 3QXTA 4ETQB 1INEH 4OCXH 1FE8H 5GGVY 3V2AR 4LQFL 1U3HA 4MNQE 5KSBE 5F1OB 4J3SA 2NXZD 2CPCA 5IMMB 4IEFB 5DT1L 4HUKB 5BVPL 4LU5H 4I1NB 2WIIA 5AEAA 3MRJA 1A9BB 2VUYA 2RGSA 4NQDB 5IQ9B 3DX8A 4Q97A 2B0SH 3S36L 1F00I 1TJGL 1VACB 5CZVH 9CGTA 1PJ9A 1PAMA 4IRJD 4WWKC 4NHUA 1GJIA 1IGIL 4LVEA 1VERA 3SJVA 4UTAL 2UVFA 4UQ3A 4Z7WA 3W81A 1CQYA 1WWCA 5LCVL 2NCMA 4PFEA 2F54B 2XN9D 1NC2D 2XT1B 1MPAH 1VFUA 2NLJA 3C09C 3ZTNL 5C2BH 1DQLL 4F8QA 1YQVH 4EKXA 5CZXC 5DRNB 4QHNB 1KCVL 1XGUA 1CICD 4P4KB 4F3FB 2WM0A 3ZL4H 1T3FA 2HYMA 5I15H 4WEBL 3L6FA 3T3PF 3HE7D 5B8CC 4GG8A 1BD2D 4RMSA 1AXTH 4PJ5E 3TZVC 1WAAE 1OARH 1YDPB 2QSCH 5E5UB 2D31B 3HN3A 4KVCH 1HILB 5IVOA 3JWNC 3OKKA 3ZKMC 4U0RB 1TNNA 1Z9SA 2HT3C 4O2EB 4EXKA 1F2QA 5D7KE 2V5MA 2ORBH 4JZOA 3DHJA 3FT4B 2A1WH 4HWBA 4TRPL 2EYRA 1RUAL 4JAMB 4XP6L 5EU6E 1D6VH 3OJMB 2BSRB 4PJGF 3ZE1F 3O4LA 3BISA 1MFCH 2A6KA 3JWOC 2YUXA 4WW1B 4Y5YA 5JW4M 4JR9H 2DL9A 3DGCR 2V2WB 3EDFA 5HJ3A 1IM3A 4Q0XH 5FO9B 3VXMB 1ACYL 3K3QA 3ARGC 4OIIH 3V0WH 4RMTA 4KJPD 2P4AB 3QFJA 5HHXH 4MJ6B 2ADJA 3TEUA 1RZJL 4GUPB 2N7BA 5CSZB 1TJIH 1AC0A 4K7PL 1LDPL 4OFDA 5D1QD 4Q2ZB 4MSWA 1D6EA 4XRCA 2R1YA 1UWXK 4POZD 3TO4C 3D9AL 2JJTC 4LHUG 2VISA 1AI1L 3O0RL 1VGEH 4WTZA 2RIKA 3UPRB 4JREB 1WTGT 3PL6B 5C0BA 5GRWA 3G9AB 1ZLUK 4LQFH 4RMRA 3L3IA 4QWWD 5DJAB 2EE6A 1KCLA 2EYTB 3PV6B 5JZ7D 4HH9A 3OKNB 5F9DC 3RWDA 2QR0B 4V1DE 4YXHL 3D3VB 5TF1L 4PJ7A 4GT7A 4EI6A 4X99A 4MCYA 4HKZB 3L7EB 5F1SA 2IAMC 2FEEL 4ZUTA 2VLRA 4G80A 1TJGH 4GFTB 1T80A 2XWJA 3SDAC 1CXLA 2JE8A 4UTAH 5GZNC 1EHNA 4GKNB 2RCSL 5FO7A 5HHOA 2DM3A 1L9MA 1KOAA 3VXRA 5LCVH 1S9VB 3Q1SL 3C5SB 5C8JB 2VAAA 1J0YA 3T8XA 1RK1B 2XA3A 2JF1A 3V0AC 1DQLH 1KCVH 4F9LA 4OD2B 3QXAA 5FGBC 3U0WL 1I7ZA 1WBYA 3U1SL 4WEBH 2CUMA 4LPCA 4LNRA 2Z4QA 5IF0A 5GRXG 1CQKA 1KB5B 2XA8L 2D4FA 2APVA 2H45A 2W1NA 4QRRD 5TDPB 3RTQB 4MD4B 1PW3A 2VLKA 3BQUC 5A3IC 5E2TL 1DUZA 1WEJH 5D2LA 5FOJA 1RU9L 1GGYA 3PWPE 4OD1L 5F8RC 1FSKB 3DMMD 2AXHA 2HFGL 1U0QA 1WWWX 3RIFK 3FOMB 2BERA 4PJXA 5IVXB 5HHQA 4TRPH 3TBSB 1RUAH 4TUOB 2KL6A 4XP6H 3IDXH 4LCIL 2YC1A 1Z9MA 1CVSC 4YQXL 1JNLH 2FL5B 3GMOA 4JM2B 5F9OL 1IMHC 5IIEA 5KTEL 4R9HA 2RFXB 1WFUA 3LEXB 3GO1L 4MAUH 4K8RC 1AJ7L 5F7YC 5ISZA 4J23A 5CCKL 4X7TB 4M7ZC 3ILPA 2Z31C 1I8MA 3VXTA 1KG0B 4LVNB 3EJZD 4O5LL 2A6JA 3H0TB 4QXTB 1O7VA 2FHFA 1RZJH 3VXQB 3D2UA 1QSZA 2GFBA 4K7PH 1LDPH 1N7ML 1WFOA 3S4SG 1NLDL 5JW4R 4Y16A 1U42A 1T6VN 3D9AH 5FKAB 2ICEB 1AI1H 3O0RH 1S5HB 3MGTA 1P6AB 2DJSA 3U9UB 4WUUB 4U1SA 1EO8L 1CD0A 2W0FB 4FXLA 5MHSD 4M9OA 3H9SD 1QSEE 4Q9RL 1IQDB 5TF1H 3EBAA 5INDA 1DANU 5HHME 1RJYB 2GTZA 1NAKL 5GGVL 5IMKA 2N4IA 4MQ7B 2COQA 4Y19A 1P4BL 3R8QA 1D5XA 3IDMA 3AFLA 3CDGA 1S7TB 2FCBA 3FTGA 1JV5B 1MREL 3C5ZC 4KC3B 5DRZA 2HN7B 1E27B 3J8F7 4PJFE 2ZUQC 3BX7C 1NDMA 4U1NB 3EIFA 1J1XL 3TIDB 4DFIA 4HG4K 1INQB 4PJBB 3I6GA 2I27N 1QLRB 5EBMB 1E4KA 2BSTA 4HD9A 3U0WH 1A7QH 1I9IL 3T2NL 3ULSA 3WLBB 3TFKD 4JFEE 4YH6A 1HCVA 1MQKL 3DHMA 1F3DJ 3T0DA 1FDLL 1UWEL 4Z7UE 4HIHB 5F6IC 1U2HA 2H26B 5AYUL 4LFHG 4O51B 5E2TH 4CU8A 3ARBB 5DA4A 1RU9H 1PG7X 4MQXD 2APWA 1UH3A 2QSTA 5KJRL 3LV3A 3TN0D 1JYNA 2HFEA 1TVBB 2ZZUT 4QCIB 3HAEH 2BVEA 3KHOA 4GKSA 5J3HC 4WGWB 3F6LA 3HG1D 2NW2B 2RB8A 4GMSL 4U1LB 1FL6B 3BZEA 5IM7A 5IMOB 3TA3D 2ITCA 4HJGB 5F9OH 1FZOA 5T1LB 3TWCL 3T0ED 3WL9B 1Z3GL 4XCEA 4UU9B 3GO1H 3FFDA 3RNKB 3DX6A 1AJ7H 4XP9L 1J1OL 2WBJD 3DV6B 1OAXL 4QRPB 4PD4J 2A73B 2B20A 2GJ6A 3SKOB 4ZNEA 5F88A 2VKXA 5A16A 1JIBA 5C0AD 3OJDA 4LAJH 4RBPH 5CEXB 5TGBB 2OJZL 1S7SB 1W8OA 1N7MH 4AIZB 4ZXBD 3VFRB 4PJCA 3RI5K 1I3UA 1NLDH 4CNIB 1WIUA 2DD8H 1T21A 4R7NA 3RDTC 4U1IB 1EO8H 3M1BA 4PJ9B 1G7MB 1O0VA 4M3JA 4UUJB 1A3QA 3QIBB 3S7GA 3U0PA 4Q9RH 3B8SA 4OQTL 1UXSA 4XTRD 2E7HA 1BBJB 4NZRL 4YDLB 2VLLB 1EFXD 2PO6D 4EQ2A 5HYFA 5JPNA 1NAKH 5GGVH 3ARDA 1ZT4A 1P4BH 4X98A 5GGTL 4LIQE 4NO3A 1VFOA 1CGYA 3C9NA 3LQMA 5E7FA 2ERJB 1UB6B 4QRUA 1MREH 1CD1B 2KDGA 3H7BA 1I7RA 4K3EL 2XICA 3ARFD 3BEWB 2H3NA 3UJIL 3WNLA 3CK0L 4R3SB 3FB7A 4G43A 1TVHA 3DJ9A 4ZQKA 4APQC 1MCHA 3BVNB 2NR6D 4Y5XB 2NY4C 3GJEA 3MZTA 3QWQB 3TYGL 5KG9A 1U3HD 3T2NH 1I9IH 1AO7A 4MD5B 3ALWA 4W4OC 5GSVB 4YBHA 4OZFG 3PQYB 1MQKH 3LSOA 3U48A 1FDLH 1UWEH 4JFXA 5IVXF 1A14L 1KIRB 1T5WA 2XXMB 5AYUH 3SDCA 1PSKL 2VSDA 4R0LA 5FA3A 3HAEA 2H32B 2Z8RA 1FL5A 2A9NL 2IQAB 4EDWL 4O2FA 3DYPA 3SJVD 5KJRH 5C1MB 1EO5A 3HPJB 5JW5B 5I1EL 4FFVC 3N1GC 1U8PB 3OGOE 4JRWA 1MAKA 3IDJA 2RAMA 2HT4D 4GRLC 3X11A 4GMSH 5E5MB 4EDXB 5E99H 2IADA 1QRNA 1KJ2L 3TWCH 3IFNL 1IJ9A 2ZKHL 5ACZA 5F8QC 4OKDA 1YMMA 1RULL 2PW1B 4JFDA 4XP9H 4JO4L 2Q6WA 3EOBA 4R96B 4LARL 3CUPA 1J1OH 4C58B 1OAXH 4M7JL 4WNQA 4KI1A 5EZJB 1S9KC 4F9PC 5EOQH 3FQRB 1DLHA 2XN9E 3UEZA 5D6DC 1HK6A 3RVVC 1ZAGA 4CN6A 4UIKH 1MCBA 4UNTA 4XHJD 1CICB 3CH8A 4C83A 1JRHL 2GKIA 5TJWK 4UIMB 4HGWA 3GM0A 3V79C 3U7AA 3D39A 2JCCA 1QHPA 4H26B 3H8NA 3VGGA 3KPMA 4GRWB 4OQTH 4ODUB 3D18B 1AFVL 4P2QB 1FNGA 5L7XL 3OKLB 5I73B 1LO4L 3VD3A 1DBAL 2K7QA 3VGBA 4NZRH 1I8KB 3QJFA 5F89A 1BP3B 1XGTB 3X12A 2SEBB 5F71A 1QTYT 4K23L 3QFJD 5DEGB 4QLRA 1S7UA 4IOIB 4UT6L 5GGTH 5D1ZA 3QWOA 3LRSB 1N6QL 3JV4A 4F7PB 1J8HE 4K3EH 3ZT5A 3UJIH 4FTVA 1RZGB 5IROC 4FQXB 5DDHB 4LVHB 5C0BD 3TYGH 3REWA 2CJUL 4D9RD 1A1OB 5DHVB 3MFFA 2X4OA 3KWWA 5LAXB 1A14H 4GG6F 1PSKH 3MBEA 2VLRD 4YBLB 1EZVY 4FHBD 5L8LB 2HFTA 2A9NH 4AJ0A 2P24B 4EDWH 3T65A 1CFTA 2BC4B 4X6BB 1YUHB 3QPQC 1NFIB 4CVXA 1U58B 3WJJC 4KVNH 5HHOD 5HGBA 1D9KC 3VXRD 1RJCA 5F96L 5I1EH 1CL7I 5J11C 4ODSL 4ONFL 4O58H 3GSNB 3WCYA 4NOBA 3CU7A 1OOAA 5IR1A 1KJ2H 3DX7A 1L9NA 3IFNH 4ZSOA 5DK2A 5FKPB 5AZEL 2ZKHH 1G7QA 1CXIA 1T1WB 3PGCA 4JO4H 2O5YL 3RPIA 5IW1A 3ESVF 4LARH 4M7JH 1T0NB 5FYJU 5C0DB 5F7DB 4DKEL 1EA9C 3JTSB 5BRZA 4ZDHB 5I1CL 4U6VH 5I9QB 4GO6B 3CDCA 2AEWA 1YY8B 2XOTA 1JRHH 1I1AB 2YD8A 1TCMA 3ULUF 3W39B 4KXZH 4BSVA 4C4KO 4ZUWB 4YHML 1NMCB 2CO6B 3O3AA 4QRRB 4Y2DA 4NO2B 5FM4A 4BKLA 1Z9LA 3V5DB 3T0WA 3MRQA 2P8LB 5ETUB 1AFVH 3NA4A 5DJ6B 4JRYA 5L7XH 1DBAH 4L8DA 4XAKE 4IMLA 3VFMA 4C54A 4PG9A 5ALCH 5IMKB 4E9LA 4UT6H 1QFUL 4H1LA 4PJIE 1FZMB 1XF4A 4X8XA 5CP7B 1N6QH 5IHZA 4P4KC 2LTQB 3UCRA 2VXQL 3BP4B 1T20A 3O2VL 5JNYA 4Y16D 5FUZL 2CLZB 4BYHA 2YPLA 5E8EA 1U8QA 5D1XA 3VFVB 5I1GL 3B5HA 4JO3H 2C4XA 4QHLB 2F74A 3BP7A 2XFXA 1VGKA 4G3YL 5CGYC 4JKKA 1CXFA 4U0RC 2FO4B 4PRBB 4PRHA 5EBWA 1VFBB 4KGJA 1QQDA 4ODHL 2ATKB 4P4RB 4BQ8A 1I4FA 5TFSL 1H5BA 3DVGB 3ZTJH 3JWDC 4W70A 2HJLB 4Y19D 5BXFB 2AK4B 5HYQA 1VFMA 4X9FA 3TCLA 3RGVA 3H9SE 1BECA 4X6DF 2RQ8A 4BZ1H 2CGRL 1KJ2A 2MQCA 5F96H 3BDYL 2MHAA 1ACZA 3BJ91 1IKNC 5DMGC 4ODSH 4ONFH 4M8QB 1PX3A 1P6FA 2MNUA 2X4SA 3VD4A 4GAYA 2UY7A 3T2QA 1NBYA 5DJDA 3NCEB 4G8IA 5AZEH 2E9BA 2HFFA 4HWZB 1MCWW 1QA9B 2DAVA 3ZMRA 2O5YH 2IMMA 1IM9B 3QNXA 2FD6L 5GGRY 5CIPH 4KUCF 5EIQA 3UYRL 3QZWA 1XH3B 4AIXA 1P4LB 4JREC 2CDFB 4J4PD 2EC8A 5I1CH 3QIWC 4L3EB 1NLBL 1VADB 1IEBA 1KYOJ 4Q74A 4L9LA 3CLEL 3D6GA 4NO5A 2AEQL 1KNOA 3C6LA 2DQIL 4YHMH 3QXUA 3QNZA 3U83A 3RY6A 3N1MC 2E9IA 4TPRL 1WT5C 4PJAE 5DJ8A 4DFHA 1T7VA 3QEQE 5DSCB 4DN4L 2AAVA 3UDWA 4PPTA 4RMVA 3STZB 1OGAE 5C7XH 2GJ6D 3Q6FA 1SEQL 1QFUH 3VG0L 1O5DT 5E00B 4KK5C 3V52L 3HG1E 4LHQB 3I6KA 4I5BA 4Z5RB 3BXNB 5EA0L 3O2VH 5FUZH 1HKLL 3T0EE 4LEOA 1CFSB 1MVFA 3EYQC 2X9XA 4L4TB 5I1GH 4MB4A 2ZSVB 1NCCL 3UXFA 4Z7VF 3RTQC 5LGJA 5BS0B 4TTDC 5IWLC 1ADQL 3MROB 3MRNB 4F8TA 4G3YH 1JP5A 2VB5A 2GSGB 5LWYL 3VJ6A 1QACA 4ODHH 2X4PB 4J7RA 5C0AE 1NC4A 2XWTA 5KBNC 1FSKC 3BN3B 1XR9B 5TFSH 2YD4A 3D0LB 5IFJB 3S96A 3R0MA 3OKEB 3S6CA 4N90E 1JUFA 3ARDD 2EC9T 4HFWA 4LF3A 2NY1B 2C3VB 4E5XA 5E8DH 4YAQB 1IAKB 3U9PL 1BIIB 1UKTA 2QJDA 5FFLA 4KKLD 1RZFL 4JM2C 2CGRH 1PKQE 1RURH 1VEPA 1U8NB 2FYYA 3EDDA 3FT2A 3QHTC 2BNRB 3BDYH 3N1FC 4M93B 1N8ZB 1G9ML 3BH8B 5FAAA 1DQTA 1NFDB 4OKVA 1P69B 4PJDA 1DP0A 3LPWA 1XF2B 3UTTB 4MD0A 1P4IL 5CIPA 1I8IB 1AO7D 3Q0HA 4NNXB 1ED3B 3DIFB 4K2UL 3ZLQC 4EUPG 2Q1EA 5B39A 2NXYB 3SDCD 1NEZB 3QH3A 5C08B 2FD6H 2VR5A 3ZYOA 2P45B 3UYRH 2FJHA 4J3TA 1BQHB 3B8YA 3FQXB 1NLBH 1II4E 4JPVL 4XXDB 2JTDA 3CLEH 3PWNB 1EH9A 3UTZB 2AEQH 5I2IB 3DO3A 2DQIH 4KK6C 5AD0A 3SY0A 2D0FA 3MRJB 3EDKA 1QRND 4TPRH 4F57H 1P9MA 3DX8B 2BHZA 3PP4L 1LVEA 5F7MC 1YMMD 4ISVB 1RMFL 4JFDD 4S1QL 1JMZA 5FO8A 3SJVB 2BHYA 2QQQA 3OKYA 3HI5L 3L3HB 3DRQB 1ZHKA 1SEQH 3VG0H 4RZCA 3UYPA 4JFHE 1WK0A 3V52H 4UZGA 5L0QB 5ICZA 2P44B 1IEHA 3GKWL 4JQIL 5EA0H 3BPOC 1AGFB 4LQ1A 1AKJA 2H41A 4R4FL 3L6FB 4N9GA 3PJSA 1NCCH 3S37X 2QV2A 4YHLH 3D39D 3ARBC 4PJEA 5D70L 5LWYH 3FB5A 4NYLB 2PYFB 4I3RL 5C6TL 1HOCA 3OKKB 4L8SB 1K85A 3WHE0 1TZGL 1CGUA 4KRPD 1MCFA 4R4NC 1IC7H 3PHSA 1OAQH 1AXIB 2QADB 1ZA6A 4JZOB 1R24B 2ARWA 1LMKA 4M1CD 3BFOA 5BJTA 3K1KC 3U9PH 5D1ZD 2GJJA 1RZFH 1UZ6F 3O4LB 2L0DA 4JDZA 5C6WH 4F15B 2A6KB 2HVKB 3P4OA 1G9MH 2EKJA 5HI5C 4FTVD 3QPXL 3EYOB 1OB1B 3UJTL 4LKXB 2A83A 3L3JB 4TVSa 1P4IH 3CIQA 1U8JA 1G0YR 3QFJB 4LPWA 1A7NL 3LAFA 12E8L 3ZSTA 2ADJB 3QB7C 4N8CL 2BRRL 5D5MF 3BAEH 5KS9B 4ZS7L 2VITA 3QDJA 1M4KA 3QG7L 4U6XA 2M2DA 4H20H 1D6EB 5L2JB 1FVEA 2NW3B 2YUWA 3MBED 1HXMA 4HHAA 4WU7A 1H8NA 3H9HB 3Q5TA 1FZKB 1DL7L 4PJ9C 1A47A 5EIIA 5C0BE 1OD7A 2IANA 1U8HA 4JPVH 3QIBC 5MENB 4P46A 2CIIA 3L3IB 3I75A 4D9RE 2ZG2A 3NTCL 4MJIE 4AEFA 4HH9B 4YDLC 5DI8A 1NUNB 1UKQA 3RWDB 3L3GB 3PG2A 4JFFB 2DLIA 4PJ7B 3QO1A 1I85C 4P5MB 4GQPH 3PP4H 2B4CH 1WWAX 1QBAA 5EUOF 3VXUB 2R29L 4N1CA 1RMFH 2ERJC 5IB1B 4S1QH 3FAXA 3OB8A 2ZUUA 3CVHH 1JPST 1IAII 3HI5H 5HHOB 1U91B 1WZKA 4WHYH 4AENB 1AIFA 3T8XB 5BRZD 4MXVF 3GKWH 4JQIH 2ADGA 4YGVA 2BVYA 1JWUA 3HZKB 4KMLB 3V6ZA 2W60A 2O26U 2PYEB 1I7ZB 4R4FH 4WIQA 2DQCL 2MQ0A 4LNRB 2Z4QB 2VQ1A 5IF0B 3U7YL 4YHYB 2X7LA 2YBRA 3C8HA 4Y2DD 4N5UA 43C9A 5I1JH 1FH5L 4BFIA 4UMGA 2VLKB 3A6CH 5DQJA 5D70H 3WEXB 2QKIB 5D2LE 1GXEA 2JB6A 5C6TH 4I3RH 2I24N 3DOSA 4JRYD 1TVDA 1TZGH 3RHWK 5T1MB 4NNYB 5TPWL 3KPLA 3PUCA 3WXWL 1TFHA 4MXWL 1QFPA 4PJXB 4XGZA 5MEPB 1T2JA 4TQEL 3IKCB 1A6VL 1WVZA 1YEJL 3TGXA 3CH1A 4I2XA 3GMOB 3BEVA 2YPLD 5JIIA 2BNUB 3QPXH 4JM4H 1GZPA 5ISZB 1CLZL 1EBAA 4P5TA 1QSVA 3ZDXF 4GRMA 5HYEA 1A7NH 1BHGA 12E8H 1JGUL 4PRHD 4N8CH 2BRRH 2CDGA 5FGSA 3D2UB 1XFPA 4ZS7H 1CICC 3IRZA 2AGJL 4AEHL 5DRXA 4Y88A 4Y16B 5HGGS 1BQUA 4JB9H 1GPOL 2W9LA 5L2KB 3MGTB 1DL7H 5F9WB 3RGVD 5C07E 5M95B 4R26L 3SGEH 1D3CA 3NTCH 5D7LE 5I73C 1QSFE 5J56B 4MJ4A 5LJYH 4Y4HA 3CVHA 2IH1A 1R5VA 4GS7B 5INDB 1IQWL 1YC7A 3JWOL 1HHKB 2GTZB 4JRXE 1G6RL 4NFBA 3MMEB 3WS6C 4Y19B 1CDGA 1PQZB 2R29H 3IDMB 4HX1B 4OIAA 4YJZL 2WIMA 1BJ8A 1N5AB 1OTTC 3I9GL 2JJSA 4Y4FA 3VGAB 3OZ9L 1M05A 5HGHA 4FQXC 1TQCB 3KYKL 4PGCB 4LVHC 1QFWI 4A6YL 3OAYK 1W0WB 4EI5A 2D7MA 3NBNA 2BSTB 3FOLA 1YPZA 1A6ZA 2DQCH 4HW6A 4HFUH 3C6LD 3U7YH 3DROA 5GS3A 1FH5H 3BUYA 3LEVL 4YBLC 1U8IA 4LDEB 3TBWB 3I3BA 3W11D 5EDXA 3RGHA 4PTTA 2E27L 1BVLA 1CDIA 4PYGA 5TPWH 4LKCB 2X40A 3MRHB 4M7KL 3LV3B 3WXWH 2ZWLT 5B3JF 3KPRA 1ERNA 3O6ML 1BFOA 3G04A 1H3XA 2AKRB 4MXWH 3RY4A 5JZ7C 3P9LB 2XZAL 1R5WA 4GKSB 4KY1L 4BH7B 2AK1H 1GVIA 3V95A 3X17A 1A6VH 4GBXD 4TVPE 1YEJH 4YHPA 5E94A 1LEIA 2NY0B 4AIOA 5ID1B 3BZEB 4C4KT 5KS9F 1RZIA 3OX8A 3MRKB 4U0QB 3TIEB 4G6ML 2P7TA 4RQQB 4ENED 4G6JL 2XTJD 3LEYL 3VGHA 4GJTB 1CLZH 5DC9B 4P9ML 4OQ1A 4XNQA 2B7DT 1T2QL 3SQOL 1S3KH 3P77B 3TBVB 1B0WA 1KCUL 1NFKA 3HMXA 5I9QC 1NC4D 2OBGA 5JW4Q 2XPGA 2AGJH 4HGMA 4PJCB 4AEHH 4JCLA 5I66A 1I1AC 3MA7A 3NAAL 4ZD3L 1T21B 1QNZL 1EGJA 1GPOH 2R1WA 4O2CA 4R7NB 4N8VA 1K4DA 5EO9B 3UBXI 3M1BB 4ZOEA 2DJ4A 3SE9L 4R26H 1D5MB 3HZMA 3OF6A 4XX1E 3EJYD 4PV8B 1UXSB 3PWJB 4ZOAA 1YECL 2Y72A 3DXAA 4JFOA 5HHVL 2E8YA 4RMWA 1IQWH 4CVZB 3LCYA 1G6RH 1A5FL 1UKSA 5AWNL 1BJMA 4EIZC 4K8RL 4WFHD 4HBQA 4XZUB 1LK2B 3QO0A 2LTQC 4U1MB 2P8PA 2PTTA 3BIKB 4NO3B 2XXCB 3C9NB 3EYSL 4UQ2A 1QLFA 1YZZA 3I9GH 1ZXQA 4S2SA 3MV7E 3OZ9H 2OR8A 2KKQA 1P1ZB 1NGPL 4MYWB 3FB7B 1J05A 3KYKH 3S5LB 2X4NA 4ZQKB 4RGND 2MCPL 4YZFE 2XIDA 3TJEH 3V5KA 4ZUVB 5KG9B 3EJZC 3PIQA 1GOGA 2MQ3A 5EU3B 1TNMA 3GMLA 1XGRA 3FO0L 3TBYB 4X9GA 4ZO9A 5D7IF 3BP6B 4X5XA 1ZS8A 2ZNXA 4IMKA 4MXQD 4PD4K 3SGJA 5ICYB 3FZUC 4ZFOL 4YPJA 3SDCB 3LEVH 5FA3B 4OFYA 4X4MA 1FIGL 2JB5H 3EO0A 1M6OB 2E27H 1A2YB 4U49A 1FL5B 1VKXA 3LN9A 3LHPL 2XQYK 1ODAA 4M7KH 1T4KB 2AI0L 3SE8L 3WUZA 1TITA 1NCUA 4PREA 1RZ8A 1S7WA 1CVRA 2YD5A 5FOBA 1C5CH 4KY1H 2B2XL 4XCYA 5C0CB 5KSBF 3BRDA 1MLCB 4MS8C 4TSCL 4P2CG 2J88L 3UBXG 4O9HL 4ZG1A 2NQCA 1AKJD 5EOCL 3SKUD 1QRNE 5I0DA 3QULB 3CFEA 4G6MH 4JHZA 3T09A 5C0RH 3TZVA 4G6JH 3LEYH 5KSUA 4JFDB 3X13B 4LOUD 5IB5B 1MUJB 2Q6WB 2WBWB 4OLVL 4P9MH 1HE7A 3CUPB 3GKZA 3SQOH 1T2QH 1KTLB 1DLHB 1KCUH 4AEEA 1BQHG 2BDNL 1B0RB 1R5IA 2NX5D 5HYJA 5BQ7A 4E0RA 5HVFB 5HHMB 5HVHB 1ITCA 4RFNB 5DURD 1T7ZA 1XAUA 4S1DD 3VA6A 3NAAH 3NCCB 2GTWA 1QNZH 2V2XB 5HDQL 1X7QB 5GGQL 2YUZA 3VRJB 2Z35A 1YNTA 5JQHC 4LL9A 4QHMA 2YPKB 1K8IB 3SE9H 1FP5A 5DFTA 1G6RA 1TMCB 2JCCB 1WAAF 3RU8L 5IFHL 2R2BB 3KPMB 4MQXC 2A6IB 1F6AA 3BW9A 8FABA 1OGTA 4HUMB 3FO9A 1YECH 4OZHB 4FFWD 4PV9A 5F89B 3GM8A 2FIKB 5FDWB 1M7IB 2PXYB 1HHIB 1A5FH 4JFEB 3RZCA 5KVDL 4K8RH 1F4HA 1S7UB 3GJFB 5CSGA 3ZE0E 4Z7UB 3QWOB 4MHHI 3QDJD 3EYSH 3I02A 5J4MA 2YWZA 1ZEAL 1R3JB 3EOAB 4IRZL 2MCPH 5DYOA 1IVLA 1X5JA 3BP5A 4LLYB 3OGCB 2IAND 3LMJL 4FN0A 4P46D 3REWB 5IGXL 1SBSL 1I9JL 3T3ME 2OMNA 2X4OB 3FO0H 4UOW0 3O3EB 4ZXBC 4FQPA 5T1KB 2IAMA 1KEGL 3HR5B 1GL4B 1UCBH 3N85L 4DCQA 4X7SL 2X70B 3G6JA 4JLRA 4X7DC 1MLBA 3MOQA 3TNMA 2NY1C 2CR6A 2GJZA 3IB4A 3E8UL 5SX4I 3SDAA 3VFTA 1FIGH 2Y6SD 4LSVL 4M48L 4YNYA 4RCAA 4GKZB 2P5WA 5FM5O 1CFTB 5JTWA 3LHPH 1YMHA 3P3YA 3QQ4A 4YXKH 4CVXB 1JPTL 2AI0H 3SE8H 4M93C 3MR9B 3VA2C 1IBGL 4XWGL 2B2XH 5JA8B 2J88H 5FGBA 3H9YA 2AV1A 4O9HH 2DRUA 3CZFA 1X5LA 5E2UL 5EOCH 3DX7B 1K3IA 1YYLL 4BA8A 4ZSOB 5DK2B 1MCPL 1G7QB 2NXYC 3L95A 4M1GL 5IW1B 3SQBA 4OLVH 4WFGD 5ICXA 2PW2A 2BK8A 1UM5L 1IGYA 2CKBB 2BDNH 4MHHG 4S0SD 3MCKA 5I30L 3ME0A 5HDQH 3ZZ1A 5EB9A 1MJ8L 3L9RA 5KN5A 5E6YA 5GGQH 1RK0A 1WBXB 2BY1A 2YUVA 3KPQA 2EE3A 1HWHB 2VABB 2VE6B 3RJDA 4O00A 4CADA 3F12A 4NO0B 5C6PB 5F21B 5SWZE 2R9HD 4U1JB 4P5TD 3VFMB 4RWYH 3QA3A 2VL4A 4U1KA 4HSQA 3RVXD 4PG9B 2DB8A 1S7VA 5L0QC 2HT4C 4H1LB 1K5NA 2AJYL 1M1SA 2R8SL 4FXGA 3UTQB 2R23A 4HT1L 4UOJA 1F5WA 4LHUA 4Y1AA 1JL8A 2VDPL 3KYAA 3L1OL 3LPFA 5DVKA 1ZEAH 1U8QB 5ESVB 5D1XB 4HJ0D 4C56E 5DUBA 1ZWIB 4PY7B 3F8UB 3LMJH 4ZFOA 3S3JA 2F74B 1U93B 2XFXB 3BP7B 5IGXH 2FEDD 4NC1C 1L7TL 2V2TB 4L8SC 1I9JH 4HJJL 5MEOA 4HPOL 1NL0L 4NGHH 4Y4HD 2GQHA 2G5BA 5F9JB 4YFLI 1P7QA 1I4FB 4XHJC 3G5VA 2QADC 3RWEA 1KEGH 1L7IL 3HHRB 3N85H 4ACPA 3EAKA 4X7SH 3EYVA 3E8UH 4M48H 4LSVH 1B0GA 1UACL 5C09A 3IJSA 1UXWA 1WZMA 5JDSA 3QAZB 5EU7E 5HYQB 3CVIL 3OKDA 3TCLB 2HKFH 1MJJA 1CR9L 1JPTH 1MHHA 3CGTA 4Y4FD 4PTUA 3DX9A 3HPLA 1A4JA 1OF2A 4XWGH 5BVJA 4FFYL 5H2BB 4KZEL 1T1XA 2UWEE 1DQQB 5IB2A 3F5WA 1W72B 4Z9KB 3TJHC 4CMMA 2X4SB 5L8KB 4HZLB 2H2PD 4XP5L 4EI5D 3BD4A 5E2UH 3RWJA 1NPUA 5C92A 1NDGA 3R8BB 5HGAB 1YYLH 4HV8A 4HUWB 5DJDB 4G8IB 1MCPH 2HFFB 4QHKJ 4M1GH 5SWQB 4L1DA 2XACC 3MX0A 1DJSA 3ARPA 3TNNA 2IBBA 2E6JA 1UGNA 5FM5M 2WUCH 4BFGA 4HULB 1JNHA 4CBPA 4PJFF 1T83A 4TOYH 3D0VB 4G42A 3GMMB 1IEBB 3KPRD 3KLHC 1F58L 5I30H 1EJ6A 5I1DA 4L9LB 2D9QB 1MVUB 4H25B 1MJ8H 1TZIB 3LQZA 2HG5A 1GRWA 3DVNA 4XNZB 3QNZB 4X8JA 1N0XL 3AS0A 4Z7UF 1BEYL 4YR6B 4X4XA 5DJ8B 5ENWA 4ZFZA 1Q9OA 3KLDA 3GRWL 1MFAL 4HKJA 2VDKL 1HH9B 3P73B 3UC0L 5DJXA 5KVEL 4XXCC 3RL2A 2YD6A 4XMKH 5E9DA 2FGZA 3BGFB 3CFBB 1RFDH 4LCWA 3S4SA 2OL3B 4XPGL 1JZ2A 2R8SH 4F9LC 4I5BB 4K94C 4JKLA 2KQNA 1SYVB 3CMOL 2E7CA 3Q3GB 2VDPH 3L1OH 3OPZH 3MUGB 4NHCL 4OLWL 3MCLL 4YHYC 3B5TA 2BXZA 4PG2A 4AH2A 2CMRL 3MQIA 4HBCL 4PR5A 1S7RA 5LGJB 1EFQA 4IM8A 3FQUA 1L7TH 3OF6D 4LEXL 4HJJH 2NMSA 1I8LA 4RBPK 5JPMA 5IHUL 4HPOH 4WWID 1NL0H 2DOCA 4KAQL 2XWTB 3JVGC 3DXAD 3TM6A 4YO0A 5TDNA 5EO1A 1L7IH 4OFPA 3S96B 1JUFB 1UACH 4WHTA 1D5ZB 5BZDA 4HFWB 3E6HA 3QUKA 1NGWB 3CVIH 4TNWK 2WUBL 1KYOK 4LASL 4W81A 3GEWB 4NWTL 5DFWH 4YIQB 1CR9H 5F1IA 3P4MB 4APQA 4G8GA 2FJFA 4NC0B 4XP5H 2EXWD 5ID0A 4KRMB 4W4OA 2Y5TB 2ITDA 5CIPB 4QXWA 1UH2A 4WFHE 1SVZA 1CXEA 3NABL 5D6CA 5IEKA 3OXRA 1FYTE 1X44A 1G7IA 1JZ4A 2VWEE 5B39B 3WLWD 5DS8A 4Y16C 3QCVL 4OFYD 4OZFH 3BO8B 1R3KB 1C08B 3B6SB 2Q20A 4MZ3A 5F9WC 3MRGA 3HRZA 4P2OB 4D9QD 3MSPA 3JWDL 3O8XA 4YLQT 3OR7A 3PWLA 1KJVA 2N56A 1NUFA 1SJEA 3RJQB 4GRLA 1WBZA 4YEEA 5CZXD 5AD0B 5D71L 2IGFL 3SY0B 4GS7C 4UBDC 5B38G 4PJGA 1MI5E 3LDBB 1BEYH 2B39A 3FONB 1YEKL 2R0KL 3TZVD 1CDBA 1IGML 2HTKD 5FYJL 1CTOA 5FO8B 1MFAH 3UC0H 3VGAC 4G8EB 5KVEH 5IBUG 3ZKMD 3P4LA 3RY5A 1TQCC 2A38A 3EKCA 4OFKA 4RZCB 3UAJC 4MJ5B 5HYJD 4XPGH 5C0EB 1JN6A 3H3PL 1VHPA 4OLWH 4NHCH 4BQ9A 3CU1A 3MCLH 2X4TA 1HQRA 2FSEA 2CMRH 4X7FC 5EBLA 1FLRL 1FFPA 5HHNA 1MQ8A 4HBCH 4EEEA 1JI1A 3QG6A 4P2RE 3S8WA 5LG1A 3VD9A 2ADIA 5EFIB 5IHUH 4ZAKB 3VE0B 4KAQH 3ZYIA 1JWMB 2NX5E 3DSNA 1JNNL 3KNBA 2IFGA 4KRNA 3RNQA 4ZNCD 4Z7NE 4XCNA 2XKUA 2ZSWA 1ZA6B 4X7CC 3MOBL 3RZCD 5JHLH 4XPBL 1X4YA 3HZVA 2AXGA 4LLMA 4K3JL 4XPTL 2FLBT 2WUBH 2NY0C 4LASH 4NWTH 3KYNA 5DTFA 3TV3L 3QUXB 5EOCJ 4JDZB 3F62A 4R97C 1IGTA 1RZJC 3P4OB 5I8KL 1DQJB 3LKRB 1E28B 4BK4A 1FBIL 2BNQB 3IXTA 2IQ9H 4OZFA 1KB5L 3N06B 3LKNA 4QGYA 5JIPA 3NABH 1XCQA 1EEZA 4CKVX 2VITB 2IAMD 4DZBB 5HPMA 3MFGB 3QCVH 5CJOL 1FVEB 1QG3A 3PDDA 4PJAB 4L4VD 5IK3A 4DAGL 4HHAB 3SDAD 3PGDA 3QEQB 2EDDA 4MDIA 5CHNB 3TH4T 3TH2T 4DGYL 5K9OB 4PB0L 3DUSA 2P5WD 2V17L 3O81A 1E4XI 1OGAB 3IF1A 5EIIB 1Y18A 1U8HB 3JWDH 1DZBA 1PZUB 2HRLA 4CL7A 4JZJA 4YHIA 5DI8B 5D71H 1UEMA 5L8JB 1HHHA 2KBGA 1YEKH 2R0KH 4W6XB 5FYJH 3BQUD 3KPNA 4LLWA 1I1RA 1ZHLB 4ETQA 3VXOB 1LE9A 4WJ5A 4ZUUA 1MNUH 4D8PB 4U1GB 3ZKXB 1E0OB 3KPPB 2ADGB 1YNKL 1BWMA 4Z77B 2OX5A 3H3PH 5IMMA 3V6ZB 2V5SA 2R2EA 3QUYB 1O7SA 4UV4H 4AL8L 3WN5B 1A9BA 3RBGA 1LO2L 4JN1L 4NQDA 3LB6C 2DN7A 1VACA 2YBRB 3SDCC 5ANME 1KIUA 4WFGE 5HI3C 3VWKB 3NIGE 5DQJB 4K8RD 3GBLA 2JB6B 3BOVA 1K2DB 1JNNH 2CRZA 2F54A 3FB6A 4KK8C 2FIRT 2QQKH 2E6PA 2MMXA 2WMPA 2ZUYA 5DRNA 4QHNA 4XPBH 4K3JH 4YC2B 1JCKA 1OTUC 4XBEL 4GAGL 3V4PH 3TV3H 2X1QA 3CH1B 4Y1AD 4LHUD 4E41E 3VFSB 3CLFL 3F58L 3HUJE 5DK0B 1BMGA 1GZPB 1YDPA 2D31A 1HILA 2WWKO 1FBIH 3GMPB 5JXEA 1A7OH 3AS1A 1KB5H 2VDRL 3IU3B 3FJTA 2BOBA 4LVOB 3LD8C 1XR8A 1G9NC 3QDMB 3FT4A 5HVHC 4RFNC 1P7QD 1EEQA 4PJIF 4QTIL 5CJOH 2W91A 3VXNB 3RKDC 4Z76A 3IETB 4DGYH 5EG6C 2BSRA 5GJSL 5C09D 5E5RB 4PB0H 2J1KA 3C5ZD 2V17H 4WW1A 3PXHA 1U3YA 2H8PB 2V2WA 5GSRB 3RUGE 3VD7A 5FO9A 3VXMA 2L7JA 4IOFC 4Y4HB 2K7PA 3CVHB 4GW5B 1DVFB 3S3PA 2IH1B 3BWUC 5EC1A 3QXDA 4OT1L 2PXYC 3GMQA 2KQMA 3E3QE 4JY5L 4M1CC 4Z18A 32C2A 4Q2ZA 5ERWB 3MO1B 5DGRA 1AHWB 4H5SB 2ZG3A 1ZVHA 3G5YA 4HWEL 1B4JL 5IP4A 4HK3J 4MNHB 3PL6A 5CD3B 2XNAA 1ZOXA 1WCBB 3ELAT 1G84A 5DJAA 5I19L 4N0FA 4Y0GA 3PV6A 1YNKH 4P3WA 1PYWA 2OJEB 2EXYC 3QEGL 3FOLB 5BCAA 5J3HD 3D3VA 4AL8H 1LO2H 4JN1H 3W5NA 1QLEL 3DROB 5D8JL 3K2UL 1ORQB 3ARSA 1WT5A 2VLMD 1T22A 1TCRB 4PBWD 1I7UB 3BUYB 3RHWF 1F3JB 1RIHL 4GKNA 1ZMYA 1EEUA 3CPLA 1BVLB 3GIVB 1V7NL 3OKOB 1S9VA 3C5SA 4LCCA 5C8JA 1A3RL 2M8XA 5HGDA 1RK1A 3KPRB 3GK8L 2J8UE 4B7LA 4OD2A 4XAWH 1U2CA 4LCWD 4XBEH 4GAGH 5D7SH 3QYCA 3B43A 1LEIB 1SYSB 1KB5A 2XKNB 2Z8SA 2NY3D 3CLFH 5TDPA 3RTQA 3F58H 4MD4A 4P23B 4PJAF 1CG9B 4U1HB 3MYJB 4I0PA 4U7SA 2QHRL 2VDRH 1OT2A 1VEMA 4MJIB 2P42B 2ZOLB 3E6FB 3NA9H 4K3GA 3FOMA 4CN1A 4Q6IA 3C60A 5IVXA 4QTIH 1ZHNA 2Q86B 3TBSA 2XPGB 5I66B 4HF5L 4I0CC 4OCLC 4R90L 3JUZA 4MAYB 1CIDA 1MRCL 4IHOB 1EHLL 2EDOA 1KXTB 4O2CB 2FL5A 4JM2A 4N8VB 1K4DB 3QDGA 4P9HC 5T1DL 2RFXA 3LEXA 4HIXL 1J9CT 2DKSA 3KXFE 3SDXE 3NVQA 4TNVK 2ARJA 4X7TA 4APQD 1RVFL 4G8GD 3ARVA 2NY4D 4ORZC 1BAFL 5J0BA 1KG0A 4LMQE 4JFOB 4OT1H 2LAAA 3VXQA 3AY4A 4JY5H 4JHAL 4HIIB 5J6HB 3P4NA 3HMWL 5C0JB 5EUKB 2E5EA 3WV0A 3NFPA 3VFPB 2P8PB 5CBEA 1L0YA 4LFHD 4WTWA 4POUB 5FKAA 5H8DA 4HWEH 2ICEA 4MA7L 4M4RA 3MTRA 4U6HA 4S2SB 5I6XB 5GRUL 4YEFA 4WI7A 1YEFL 3MRLA 5D1XC 5D7JB 2PKDA 4R8WL 2DM2A 2VL5A 3JV6A 1F11B 1OHQA 2LQRA 5I19H 4PJHE 1JGDB 1IQDA 3GSRB 1C16B 2UYLB 2HVJB 3O8XD 4YHOL 2ESVE 1J0IA 4GRLD 1DQML 3RIAK 2KUTA 2DIBA 1XGRB 4XNUL 2X10A 1QLEH 1XCTB 1VPOL 3O9WB 1ZS8B 4FZ8L 3LQAC 4MQ7A 5D8JH 4OIBA 3MLUL 1RIHH 3UTPD 2I9TA 4X4ME 2YXFA 3QAZC 1JV5A 4QT5A 3ULUH 3EO0B 1G9EA 1E27A 5EU4A 3OXSB 5CFHA 1A3RH 5T3ZE 4U1NA 2G60L 3TIDA 4D9QE 2JIXA 3GK8H 1N26A 1S7WB 3RVVD 3VWJA 5FOBB 1QLRA 5EBMA 2DYPA 3DARA 2WZPD 3WLBA 3KYMB 4BM7A 4R4BB 2AJXL 1TQBB 2BCKB 2EDBA 2YPVL 2H26A 2UUDH 5M7QA 4YDIH 3SO5A 5C07B 2OTPA 2DLFL 4OGYL 3KPSA 5D7LB 1QSFB 2EDTA 1R5IB 3TCXA 2FH8A 5HYJE 4Q9CA 1TVBA 5BQ7B 8CGTA 1LD9B 4NKDB 4WW2B 4GG6A 2H32H 2P8MA 4HF5H 4L9LC 4JRXB 3NACL 2OZ4H 2BRQA 2NW2A 2GTWB 1MRCH 4LLQB 5KVFL 1EHLH 2YRPA 5TQ0L 4YXLL 4FQ1L 4TUJA 4G6FD 3X14B 3GMNB 4XNZC 43CAB 1YNTB 4HIXH 4UU9A 3RY6C 4HEPG 2ZP0T 3GSNL 3VI3E 3MRPA 4U05A 1RVFH 2V7HB 1F6AB 3N9GH 8FABB 4QRPA 3DV6A 4RIRA 4UB0L 4EJ1C 3AMKA 3QWRA 5I16A 3SKOA 2WNGA 4JHAH 2ZUTA 2CD0A 5TGBA 1S7SA 3BGFC 4AIZA 3HMWH 2N7AA 1BVZA 3RWFA 4D3CL 2BX5A 3VG9B 3MLXL 4CNIA 4IDJL 1UA6H 4OZ4B 2A74B 1IGJA 3I02B 4CU7A 1ULVA 4P3CL 1H15B 5JMRA 4MA7H 3NN8A 1YEFH 4QY8B 4U1IA 3QCUL 4ENEC 2FX8L 4R8WH 1G7MA 3QPQD 2XTJC 4N0CC 3TT1L 1IAIL 3QIBA 3VXSE 1FORL 1D9KD 2UVEA 3MV8E 5KZCD 2ZJSL 3QSKB 3QEUB 1A9EB 4PRPE 1BBJA 4K7FB 2VLLA 5I75B 2DKMA 1DQMH 3BMVA 1N64L 2AS5M 1VPOH 4FZ8H 2LFGA 4GRWH 4Y5VA 5CJXA 2Z8WC 3MLUH 4L4VE 4X5LA 1UB6A 4OSUL 1CWVA 4YNYB 3G6AB 5C86A 2P5WB 4KKAC 3BEWA 2DQJL 2G60H 1QBLL 4R3SA 1YMHB 5I74B 4R6UA 2VN4A 1T7YA 3B9KA 3MJ7B 2DQHL 3BVNA 4Y5XA 3VXPB 4RAUA 5CBAB 1PG7L 4MD5A 1TDQA 4J3XA 5GSVA 2AV1B 3PQYA 2AJXH 4IBLT 3CZFB 4IJ3C 4PB9L 4BJLA 3QRFM 4MX7B 4OGXL 2YPVH 1KIRA 5L9DL 4NQDD 3L95B 2DLFH 5HDLA 2H32A 5DHVH 1CZ8L 4NRXB 5J89A 2IQAA 4OGYH 2OZ4A 3FN0L 3RX7A 1T1ZB 1U8LB 2LVCA 1IGYB 3B9EA 2F8OA 2CXGA 4RGNC 4DKFL 2DWDB 4P2OC 2F54D 4GW4B 2AJUL 4KDVA 2JJVA 1U8PA 3BKJL 3NACH 1QFHA 5J7CC 4F80A 1VFAB 3PWVB 4NJ9L 3HFML 5KVFH 3JBG7 4P4KD 1DBML 4OZIE 4YXLH 4FQ1H 5KN5B 4KPHL 1MCRA 1RK0B 3OAUL 1S7QA 3LDBC 4WO4B 3MC0A 4X6DA 3KPQB 3ZYZA 3NCYP 1UYWL 3GSNH 1F4WL 3FHAA 3F12B 1JVKA 4LLVA 4R96A 4Z0XA 2BVOB 3J7HA 4UB0H 5D2LF 2JJUA 2FWOA 3G5XB 3FQRA 5CGYD 1LO5A 4D3CH 3D85A 3MLRL 3MLXH 4IDJH 4NQXA 4TSAL 4QEGA 4AYFA 3QNYB 4P3CH 1HIML 4UIMA 4Y1AE 3R1GH 3H7LA 3QCUH 2J4WL 2FX8H 5HD8D 2EICA 4DOHE 4BQ6A 3TT1H 3UPCA 1IAIH 3RPKA 1FORH 2FX9L 2ZJSH 4P2QA 1HWGB 3D18A 5TF0A 1IAMA 2EZ0C 1I8KA 3WFBL 4ZAKC 2VDNL 3VXMD 3PP3H 1XGTA 2IPTL 5FYJD 1N64H 5DEGA 2G5BB 3ECBB 2Z92A 4IOIA 3PNWA 3RWEB 2E6QA 1JTOA 3WS6A 5DEZA 3T4AB 4OSUH 1Q9KB 3CC5A 5C09B 3IJSB 4F7PA 1UXWB 2DQJH 1QBLH 3OKDB 3QUXC 3GSUB 4F7TB 4RMUA 1RZGA 2YKLL 1RHHB 4FQXA 3HPLB 4W68A 3PL6D 1OF2B 1ZHBA 1XF1A 1BX2B 3ILQC 1PG7H 3JXAA 5IB2B 2CR3A 3TH3T 3KPOA 3L3KA 5DHVA 3RWJB 5LAXA 3D3VD 4OGXH 4HV8B 4WW2F 5L9DH 4XVJL 2LVEA 3RL1A 4Z7VA 1CZ8H 2P24A 3FN0H 3UTSA 4X6BA 3TNNB 1YUHA 2R0LL 4YK4B 4X80L 4Z7OE 4JPWL 1CE6B 4DKFH 4P46C 4G42B 1MRFL 3GSNA 3D69B 4KK5D 5HBBA 3HFMH 4KPHH 3LQZB 4WY7L 3OAUH 1G1YA 2HG5B 4PY8I 5FKPA 2VLME 3EYQD 2CUIA 1T1WA 4X8JB 2J3SA 5EBGA 1PDKA 1F4WH 4X4XB 3RTQD 3PE9A 1H8SA 4TTDD 2DBLL 2BY2A 2KZ1B 1T0NA 3VFGL 4AM0B 5C0DA 3EJJX 4I0PD 4ZOCA 5DJXB 3JTSA 1NCAL 4TTGA 4ZDHA 1OY3B 5E9DB 3SOBL 3FFCA 3ZKXC 3MLRH 2I5YH 4TSAH 4LCWE 4YHKL 3S4SB 1GAFL 1I1AA 1HIMH 3W39A 3QUYC 4OB5L 4LLAA 1PVHA 3GSVB 3WN5C 2MPAL 4NO2A 4AK1A 5DJ2A 1EIBA 4JM2D 2I26N 2FX9H 1C8PA 4KTEL 1L0QA 3O6FB 3VWKC 4PR5B 5DJ6A 4I3SL 1RUPH 1A0QL 1CGWA 3FQUB 3M07A 4BQCA 3WFBH 1QFWH 2VDNH 2W65B 2XQBL 3RVTC 2IPTH 3T04D 4B41A 4M62L 3BZFB 1RJLB 2FECL 4YO0B 1JYVA 2YRLA 4G9FB 1FZMA 3NCBB 3MV01 5IOPB 2M1KA 5CP7A 2GSIB 3BP4A 4WHTB 2ZCKL 4YC2C 3QUKB 5GGUB 2DQEL 2CLZA 4ZO7A 5F1IB 3ROOA 2YKLH 1KN4L 5F7EL 5IVZB 2GK0A 4QHLA 3QDAA 1UC6A 4H8WC 5FV1L 2F58L 2FO4A 1VFBA 5ID0B 4GQ9L 2ATKA 4UT7L 2ITDB 3O3UN 4LVOC 2KPNA 5F1NB 4NQSA 3HR6A 1A7BA 4XVJH 5CJQL 5D6CB 5DZNA 3OXRB 3DVGA 4PLJC 4OF5A 4PYHA 5H35A 2I25N 3BDBA 5DS8B 2AK4A 4NQEE 5E70A 3IJYB 3GIZL 2GEEA 2R0LH 4X80H 5KOMC 1CS6A 4JPWH 3FO1B 4ODBD 2MSPA 3MRGB 4TYUA 4I8DA 3IU4H 1QOKA 5HYSG 1MRFH 3HRZB 4M8QA 4HWBL 4N0YL 5FB8B 2JIXD 2B4CC 3O11A 3O8XB 4YZFF 4HAFA 1KJVB 3QUMB 4Y4HC 5E7BA 1FJ1B 1MHEA 2DYPD 1DVFC 3O2DA 4WY7H 1N5YL 1N4XL 4WHCA 3BN9D 2NY6D 4KJQC 4HWZA 1QA9A 4QRQA 2V6HA 2E7MA 5J9PB 4C56B 3PDOB 1AHWC 1IM9A 2DBLH 3VFGH 3ARBD 5T33L 4HS3B 2VERN 3WUWB 2JJSC 2EIZB 1GGCH 1XH3A 1NCAH 3KPSD 5CSBA 3SOBH 4OCXL 2EO9A 3RVWD 2NYYD 3U4BL 4R4ND 1T03L 4I18A 4YHKH 4LPUA 1GAFH 1LDSA 2IWGA 3V4UL 4OB5H 1YQ2A 1ZA3B 4B5EA 3B3IB 2MPAH 2X4TB 3F7YA 1HQRB 3TT3L 4JN2B 3NZ8A 1FFPB 5HHNB 4KTEH 1NGXA 5T3XH 4I3SH 5EZOL 1A0QH 5DSCA 4PRIA 3MNVA 1ZT7A 5HI5D 4J12A 2ADIB 3G6DH 2XQBH 2CLRB 3QXVA 2UWEB 4XMPL 1ZLUH 4QRPD 4M62H 2WBKA 3RNQB 3PGFL 5E00A 2EC9U 2ZSWB 3IJHB 4TNWF 5C2BL 4Z5RA 3BXNA 2Q87A 2QLVB 5EUOA 3OJ2C 4G6FB 3MRDB 2AXGB 1KGCD 4LLMB 4D2NA 4F2MA 2D7TH 2ZOKA 3T77A 3ZHKA 4L4TA 3KYNB 2X6MA 3STBA 2ZSVA 3T1WA 5F7EH 4JGJA 5BS0A 4P23C 4KJWC 3MROA 3MRNA 4N0UA 2F58H 1EO7A 2GSGA 4ETYA 3QIBD 4K94L 3L5JA 1OARL 5FCUL 2P5EA 4U3CA 1IAIM 2X4PA 4GQ9H 4YHZL 4UT7H 1F45A 3LKNB 2OI9B 3ULUD 5IFJA 3L5XL 5CJQH 2G9HB 1PKOA 2WV3A 2CLVA 3AB0B 2FHBA 3ZE0