1BGXL

Taq polymerase in complex with tp7, an inhibitory fab
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAQ DNA POLYMERASE
publication title Crystal structure of Taq DNA polymerase in complex with an inhibitory Fab: the Fab is directed against an intermediate in the helix-coil dynamics of the enzyme.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Complex (polymerase/inhibitor)
total genus 30
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1998-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL01
4KI5F 1VGEL 5D1XB 1MHEB 5ISZE 3H8NA 4OCLC 2EE2A 2JCCB 5IROC 3DVNA 4I3SH 3IFOA 4APQA 3LN5B 1VEOA 5FHBL 1BM3L 3HC0A 4M3JA 3UDWC 2NX5A 1YNKL 4CGTA 3UYRH 3MA7B 5K9KB 4BQ8A 1DBAL 4U2ZA 3D39D 2ENYA 3KYNB 3WLWD 3WJJC 2R15A 3BW9B 5A16A 35C8H 4JHWH 4XBGA 3V5DB 1B0WA 3CXDL 4RDQG 3SDAB 5HYJB 3MRQA 5E4IA 2ZCKL 4JVPA 4G42A 3RVXD 4XPTH 5I0ZA 1H8OA 4U4BA 5CJOH 4MZ2A 5HHOA 5I8CA 3D69B 4JQIL 1NBZA 1NAMH 5EBGA 1FNHA 5HI3C 5SWSD 1QSFE 1WZ1L 1K5NA 3KLDA 5ICZA 4TSAL 4A6YH 4JFPB 3ARBB 1CL7H 4K94C 1PBYA 1V3LA 4OAWA 1I7RB 4AT6A 4BZ1L 4JEGB 4LCWB 1BVKB 1I85A 4G6KH 1A9BB 3X11A 4GG6A 4N8CH 4IOIB 1P9MA 3VXME 2MKWA 1C5BH 4WTZA 4G8IB 3WN5B 1BQUA 3PV7A 4NUJA 4PS4L 4MA7L 4JFFA 1MF2L 3OR6A 3RWHA 2HYMA 25C8H 2C1PB 2XWTA 3L7EB 4PYHA 1ZS8A 1KG0B 1NC2B 1ZOXA 5C7XH 4NBZB 2EYSB 4WFFE 4ZDHA 3TJHC 4DTGH 2D7PA 5JPMB 3CSYA 1T7YA 3D0VA 5CCKH 1ZT1A 3BKYH 2AKRA 1MFBH 5ISZB 2YK1L 2CKBH 1FYTA 2DKUA 4HK0B 5TGBB 1T20A 4PGCB 3DBXA 1J1OH 1I9EA 1D3CA 1X9QA 4WTXA 3HR6A 4OCMC 3PHSA 4J3XA 2WBJC 4TPRL 4P57B 1ZT4B 4YC2C 4XI5C 2AJSL 1BFVH 3SY0A 1G0YR 1GVIA 2ICEA 2WWKT 4B41A 3IKCA 4M7LH 4U6VL 4FQHB 3IDXL 1NLDL 5CILL 4PB9L 2RFXA 4HMEA 1UXSB 4FTVD 4N8VG 4D0CB 6FABL 3NZHL 5C0FB 3QULA 2R69H 4NRXB 5F1NA 2NY1C 2F54D 5LWYH 2G60L 2VXTL 1A3LH 1JWUB 3QUMA 1QLFB 3PGFL 3KPQB 3P3YA 1MJUL 1UWGL 1NFKA 2Q8AL 2AJUL 4NQXB 4YNYB 5K59F 4U7SA 1YPZE 4O2CB 1YY8B 3WSQH 2H2PC 1KLFA 1WICA 2YPLA 5FOBA 3VFGL 4NRZB 5DZLA 5D71L 1XIWD 2BVPB 2CD0A 1AR2A 5KW9L 1DBKH 1A2YB 2K3TA 1K6QH 4ZO7A 3JV4A 1UM5L 1BBJA 3N0PB 3UJTH 1JZ2A 1UZ6E 4WV1A 2CDFA 3ZDXE 3V95A 3VXMB 5MERB 2OYPA 4ODWA 2RHEA 4ZQKA 5FO9B 1H3GA 1SJHB 4QRRE 3V7AG 3E6HB 4NM4H 1I85C 2X7LA 3MJ7A 3S34H 3PG2A 3EGSA 4JFXA 2BOCB 5E2TL 1P9MC 2P5EA 1CG9B 3TIEB 1L0XA 4LVOB 4P4KA 3EOBB 3LKOA 1EEZB 4YX2L 3T4AB 3CFKB 4NP4H 1IAKA 4KK8D 4ONGL 3CU1A 1KJ2A 3NPZB 5GJTH 1HHIA 2CIKB 2XV6B 4TTDC 5F9JA 5AUMA 1EGJA 5BVJB 5TPWH 1D6EB 1N6QL 3VWJB 4HIEB 2M26A 4WU7B 5EO0A 4DVRH 5GS1A 4LSRL 3ULVL 5GZOD 2R4SL 2ADJA 3TM6A 3U46A 3WIHA 2BRRL 5I1LB 5D4QA 4O2FB 4LLYA 4XPBH 3TT3H 1D9KB 2CGRL 4MDJB 2EECA 2R23B 1A5FH 1KCSL 4QRTA 1H3WM 3HKFA 2CDGA 3RWGA 2A2QT 1YQVH 3MACH 1EAPB 4OLXH 1YEDB 4LLQA 4DCQB 3B6SA 1EO8L 1NGXB 1JCKA 3H9SD 2DWEA 4LRNL 4NKQB 2DLHA 5E6YA 3RGVC 4NYLB 2R9HC 5AWNH 1ED3B 3UZVB 4ALAH 2DQUH 2GJ6E 4LSSL 1U93A 4KRPC 4RA0C 3SKUD 4HKXA 3JWDH 4Q58C 4DJMA 1U6AL 1G7PA 5TDOB 3HZMA 3P0VL 1YPZB 3MO1B 2IFFL 1S7VB 2X4TB 4KUZH 5TH2A 4YE4H 4YXKL 3MJ9A 4WFED 2OXHA 2MQ3A 4Z0XB 2OTPA 5J1AB 4ETQA 3DIFB 3ILPA 4YUEH 2OQJB 3BJ91 2HFEA 3WO4B 4DOHE 4JY4B 4Y2DD 4QOKA 1MFDL 4KJWD 5INCB 1ZEAH 3TFKD 1JYXA 4HGWA 4QRPE 3TA3B 1T21A 4UQ3B 4QRRB 1HSBA 5C2BH 5HGAB 1QA9A 2VDLL 1DBJL 3R0NA 1LD9B 3QZWA 1RUMH 5F88A 5E2VH 4WV1C 1ORQA 1QSEE 4UT7H 5CEZD 1EUTA 1HHKB 1DQDL 1XF5B 2DQGH 3QRFM 2XT1B 5K9QI 3C6SA 3VGBA 3MBXH 4JG1L 4WFGE 2NXYC 3G6JB 1QFUL 1VADB 1NGWA 2V17L 4NRYB 4X7SL 1IC4L 3MUHL 3ULVC 4Z0BH 2K9UA 1R3JB 4IIQB 1I9JH 5F8QC 2VITB 1MLBB 1MY7A 4P49A 5E2WH 3RWIB 5DEFA 1KEGL 4O58L 4LPVA 3LS5L 5GS1C 5DQDH 1JV5B 1LO0H 4FG6C 4F7PA 1I1AC 4I9WD 1RUKH 3GBLA 5CJBA 1LK3H 2CH8A 1RZFH 4ONFL 4DVBB 3QUZA 4JHAL 1AHWA 1CDUA 2FX8H 4JDTH 3QIBD 4XNUL 2QL1A 5ITBL 3LQZB 3HMXH 3QFDA 1T1YA 2EDLA 4Y4HD 1D5ZB 4V2CB 4KI5D 1IGJA 4NM8L 5JORB 1Z5LB 1ZA6B 2YUXA 3PWJB 4KV5E 2ZP0T 3QPXH 4CAGA 2I9LA 2XZZA 3RWEA 4RX4A 3SDDC 5K9JH 4PJDB 4AYFA 1YNLL 4G80B 3ESVF 4HT1H 3UTOA 2DTMH 2EIEA 3A6OA 1XGUB 3UYPA 5AZEH 4DOHB 1GZQA 2HVKA 4HC1H 3VXRE 1WAAE 4N9OB 2OI9C 3MRBA 3QCUH 3MRFA 5AAMA 1CYGA 5J6HB 4U1IA 4QRPB 1ZANH 1T2QL 1MCPL 4NKMA 5L0QC 1NCWL 1U8QB 3EOYG 5BOPA 4R96A 4GXUN 1LGVA 4UV7H 4FMKA 4OV5B 1QSEB 5EU3B 2WMPA 4Y5YA 5E5UB 1TCRA 1AGDB 2E6QA 1OARH 3DURB 3HI5L 2GFBA 3TPKA 2I27N 2HMID 4NQDA 3MLYL 5CZXC 2FHBA 3WS6C 4P5TA 1FO0B 1NUGA 3HFMH 4P23A 1KLGB 1JTPA 2HJLA 4NNXA 4URTB 4Y4KC 3WIIL 2DI8A 4HQQL 5D7IE 1OAKL 3U0PA 5JUEH 4G8GE 5HY9B 5ADPL 4I77L 5EZLA 3VCLB 3B9AA 2V7HA 1QQDB 1BFSA 2DM3A 4MA3B 4P2RD 5KVGL 1AY1H 4UT9L 5JIHA 1J1PH 4BK4A 3V9FA 1T6VN 4JZNB 3P77A 3HRPA 4BFIB 4JRYD 1S78D 4PUBH 4HFUL 4L3ED 4PJAF 5DD6A 1DN0B 2DDQL 4F7CA 2SEBB 1CU4H 2OX5A 4ZAKC 3QNXB 1QD0A 4LSUH 3TZVB 1IT9L 2FO1A 5IM7A 5GHWH 3TBWA 2ZUYA 1Z9SA 1JWMA 3MX0A 3VMOA 5L7XH 2CUIA 4Z76A 1ZK9A 4MS8D 5BS0A 1WZKA 5I17A 5EO9A 3OWEA 1A6VL 2E27H 4HJ0D 2GTWA 1AHWC 4MHHG 2X4OB 3TBVB 5DRZB 1F5WA 2EZ0C 3GIVA 4LCIH 2VDNL 4HIIA 3O3DA 5JDSB 1UJ3C 3D85D 5KVEL 1AD9A 2D03H 2X4NA 4C56D 2VDKL 1QHOA 4MQXD 2CKNA 3VD3A 2EIBA 2OXGA 4K9EC 1XF4B 3QDGD 4PRPD 3GM8A 2X9WA 3K1KC 5EPMB 3L3HB 3IAQA 3NAAH 3QHTC 1X3DA 1P4BL 1MIEL 3VFRB 1VKXB 1F3DJ 5FYJD 1SBBA 5F1KC 5EZOL 4GAFB 3ZYZA 4XH2A 4BSVA 3FQWA 5C70A 3VJ6B 4U1NB 2Y4SA 2FYYA 5GS0H 3NFSL 4IDJH 4FN0A 3BP4B 3QEHA 4PTUB 4XT1C 3TV3H 4WHCA 4E41A 5IQ9B 4IMLB 2HG5A 4OLUH 4ORZC 3AB0B 2GK0A 1J8HE 2VL5A 4I48A 4G43B 3RL2B 4Y5YC 5HGGS 5D7IB 3RY6C 1IKFL 3M17B 4NNYB 3K8KA 4G8GB 3EFFB 5T33L 2B8OT 1PZ5A 3JXAA 5D7SH 4JPIA 2BXYA 8FABB 1TIUA 4LDEB 3SKOB 3ZDZF 5BOZG 2B4CH 1XGPB 1A4KA 2D7TL 3D1MC 3WDIA 3PQYE 1HSAB 1CLYH 5BRZE 1NGPH 4U7KA 4YHKH 3CDCA 4GAGL 1ZAGA 4EKXA 4OCYH 3GNMH 4WI5A 4Y89A 4I3RH 3IJSB 4LHUG 2R8SL 4KROC 4X9FA 3DRTA 5CAYB 2PUQT 3HZYA 4N0YH 2JCCF 1M71B 3WUZA 2PO6B 1JMXA 1U3HD 3HC4H 5J6GB 4OLZL 5DMIL 1JK8B 1OTTD 1QLEH 3NVQA 4GLRI 5BXFB 3PDOB 2WV3A 1JE6A 5E0QA 1HHHA 4OUUA 5F7UA 3DX6A 1EIBA 4LCUB 5DYOA 1NBVL 2V2WB 4N5ED 3GMLA 5F71A 2BFVH 3GMPA 4S1SL 1FNGB 4HV8A 4MJIE 3HR5B 2X4PA 1CVSC 3VU2A 4FMFA 2BMKB 3NPSB 4XHJD 5IKCA 2VERN 5F1SA 3TESA 3FFCA 4PJ9B 1GYAA 3IVKB 4KTEL 1A6UL 1Q9WB 3BO8A 2VQTA 3AVEA 2CK2A 2VIRA 5DFVD 4JPVH 3I3BA 1G7JB 2AV7B 2XRAL 5E4EC 2AABH 2Y36L 3CVHL 4NNPH 2BNRE 1QR1B 1D6VL 4D9RE 4R3SB 4FP8H 2P7TA 2VJXA 2CO7B 1GZPA 2C26A 1MI5D 4U1JB 4NSKA 4X80L 1J10A 1J8HB 3RKDD 3V0VB 2OZ4H 3I6KB 3LQAH 2IALA 5F6HJ 1DSFH 1S7TB 3GSRA 4HSQA 1JZ7A 2Q20A 2F5AL 5JOPE 3DMMD 1GIGL 4LARL 3QEGH 1IC7L 3KPSA 3TJEL 3HHRB 3S88H 2D3VA 4ZOEA 4MJ4A 2FDBP 1ZE3C 3PQYB 1EVTC 1QEWA 3SDYH 4AL8H 3TVMC 3KPRE 4U3HA 5BRZB 4JPKH 5IESL 5EA0L 3ZT5A 5I66A 5DK3A 4JFED 1CFBA 3OKMB 1A3RL 2BHUA 1BFOA 4CVZA 3HNSH 4PRDB 5HHXL 5DRXA 4L5FH 5F6IC 1JPGB 3FJTA 1RQ5A 2D31B 4MSWA 1INEL 4HD9A 3QUYA 4Q6YA 1QO3B 3MODL 4XNYH 4TULL 4L29A 4WCYH 4NGHL 5EZJA 2AXGB 4L9DA 3TN0D 4MJ5A 5CHNA 2VR9A 3HG1D 3QXVA 4XCYB 3AGVA 1I7ZB 4QCIB 3IDIA 1OLZA 5KJRL 2WIIA 1CFTB 5F96H 5EU6D 4MJIB 1JNNL 4LL9A 1I7UB 1EO7A 4V1DD 1SMAA 3U0WH 5D1ZA 4PGDB 1J05B 3EFDH 5C0CE 3MV8B 5L6YL 2ADGB 4NN7C 1IC1A 4OLVL 4WNQA 4BQ9A 1CFNB 3MV7D 4G7VL 4RFOH 4PJ5E 2BNUA 3K1DA 1EXUA 2J8UA 4P3DB 4YK4B 1G0XA 4DN4H 4D8PB 3FHAA 3C60B 4HHAA 3WNNA 4ZS7H 2W9DH 3ES6A 5EC1B 2BNRB 1S9XA 1JF1A 1KEMH 1PQZA 2BERA 1UENA 5HYSA 4DWHA 4OI8A 4DQOH 4KMLB 5IT2H 1ZVSB 1V7ML 4X98A 1NFDE 4HX1B 3GSXB 3AM8A 5E00B 3DYMA 2L4OA 3IETA 3FN9A 3S37L 4X6FB 3UTSD 3BN3B 2VLME 4XHQA 5I15H 5HPMB 1OGAD 1T5XB 5FUZL 2XQYG 1SEBB 3KPRB 2OLDA 1NCAH 2DLIA 3TF7C 3G6AA 4GRLD 4HPYH 1CF8L 2ARJB 3B9KB 4G6MH 4YR6B 4N0FB 3OF6D 4XMPL 2VAAB 4EIZC 4K23H 1ZVYA 4I3GA 3KDMA 3JSSA 4EOWL 1OLLA 3MPCA 1UEYA 3CFCL 3DVFA 1NGQL 5BJTB 1FG2B 2V2TB 3HI6H 5D2NA 3WFHB 4J3VA 3JV0A 5EBWB 4LNVA 3IU4L 3X17A 2HWZL 2XG4A 1N6VA 1AO7A 1V3KA 2X4QB 5E5MA 2MMXA 3CLFH 5CD5C 4OM1H 3ROLA 5B39B 3LH2H 1RIVH 4JN1H 4PGEB 3T0DA 3MXVL 2O5ZL 4QYOB 4UB0H 3BIKA 3VXQB 1MVUA 5DSCB 1MNUL 1WWAX 4YHZH 3OX8B 3ZHDA 3AS3A 4FFYL 4PJ5B 2E3VA 1G7MA 4YGVB 5T5FL 3GB7B 4Y7MA 1FRGH 3N1FC 2J12B 1FIGH 4PPTA 4S1RH 3HNVL 5D1ZC 1KJVA 2PW2A 4HS3A 5TF1H 2QQQA 5IBTH 3DTXA 4NC2B 1YPZF 3O4LD 3EYQC 3MRGA 5FKAA 2UY7A 1AXTL 2YD4A 3C6LA 5CINH 4AM0B 4CW1B 2A9MH 3L95A 5DT1H 4FA8A 5KS9E 3GIZL 4Q2ZB 1FV1B 1NDMA 1SJVA 4FQJL 1I75A 1NH6A 5IHUH 1NFDB 3SE9L 5I6XC 2P48B 1UZ6F 4KJQD 1LE5A 3ZE2E 3ZDXF 3FRPG 5E9DE 1YJDL 1RURL 4MA1C 1T22A 4HKBA 2CRMA 2BCKB 2BY3A 2GT9A 1T5WB 3AFLA 3I85A 3AM8C 2CPCA 1C5DA 3D5OF 4OV6F 1WBZB 3VGDA 4R7DB 4HXAH 5JW4Q 5DURD 4KPHL 1IAOB 1QLRB 1WUNT 1RHFA 2AJ3A 4F33B 5EUKA 2FWOA 3W9DB 4LU5H 3D9AH 3GJFA 4F58H 1U8NA 2VXQH 4MD0A 1M4KA 5GSRA 3HUJE 3WJLA 5IVZB 2ED7A 3BVNA 4ZS6C 1HHJB 1LP9E 2F53D 4JJHA 1VFUA 4JKLA 2FEEL 3R1GH 2EEBA 5C6WH 4JZJA 4R90L 5FYJU 1PEWA 4OJFL 5I71C 3S5LA 2JIXA 1FDLL 3CVIH 5K9OA 1TNMA 3VI4E 4OKVB 3S3PA 2H26B 3VH8A 5IBLD 1ERNA 5DHYB 5BVPH 4WUUA 1MFCH 4U0RC 1A7RH 4R4BB 4MMZC 1IGTA 3DX9A 4HWBA 3SOBL 1I1FB 4HUMB 5CGYC 2R1XB 1KNOB 1ADQL 3OB8A 3WFBH 4GG6E 1KJ3L 3D18B 4IMKA 5FV2A 1C5CL 3O3AB 1X44A 4S2SB 5MEQB 3LEVH 1NC4A 4M8QA 4XPFH 5ITFB 4HIXH 4V2BA 1RAMA 4KMQA 1XFPA 5C2UB 1S3KL 4JRWA 1A22B 3T04D 2DM4A 3UTQA 4XBPB 1XR8B 4K3GA 2I60L 1YJDC 4WHTA 5E9DB 3S4SB 1KLUB 5HHVL 5C0DA 2WBJB 1KN2H 4M61A 1N6UA 3N85H 3THMH 1RK1B 4HFWB 3WUWG 3B5TA 4YC2B 3EJZD 5MHSD 4XMKL 3FHQA 1E6JL 4GMTH 5FDYA 1DQTA 4OZHA 3OJDA 4MQSB 2DWDB 3TCXA 1K4DA 4FFWC 5HYJD 4PRIA 1Z2KA 1ZSDB 4R7NB 3FAXA 1YEEH 4RIRB 1YMME 3NIFE 5D1QA 1FO0H 2ORBL 5C08E 3RX8A 2NY1B 1P84J 3AXLB 1CE6A 4OB5L 4TUJA 2PTTA 5EOCJ 3WIFA 1VEPA 2W0KA 3GKWL 1RFDH 7CGTA 1LP9B 4R4FL 4XVJH 4M8VA 1TZGH 2BVUA 5TQ0H 1BQHB 4LCWD 2CUMA 3P4MB 2YZ8A 2AXFA 5C0BE 2EE3A 4XVUC 4ODTH 3T3PE 2NPLX 2E9WA 2NY2D 2C4FT 2PW1B 2E7HA 1UA6L 4OCXH 4JGJA 4JG0L 3V4UL 3MRQB 1BECA 1FH5H 4RISL 3UCRA 1GGCH 3CDYA 4KK5C 1T7ZA 1PJ9A 1NBZB 4POZD 3V2AR 5ID1B 1GGBL 4JCLA 1NAKL 4MB3A 1FPTL 5GGVL 2B7DT 1S7XB 4GG6B 2QQKH 4QNPE 5BV7L 4KV5F 3OG4B 2APVA 2LAGB 4M5YH 5AD0A 1ZTXH 5FK9A 4K07A 4N8VA 5F70A 3S35L 4G9FA 1A21A 3CMGA 4AH2A 3BIBX 4IMKC 2XWTB 1J1XH 1KCVL 1KC5H 5E70A 3ULVE 2NY6D 4HKZA 1OM3H 4UT6H 2UY6A 3CSYB 5KOVC 3O3BA 3G08A 1F97A 4GKSA 4K3EH 3O3EA 4GS7C 3NCFB 1UB5B 2YKLL 1FYTB 5I1JH 1T20B 2Q3ZA 5I1IL 5I75B 3MLXH 1G9EA 3ARDD 4M43L 3C8DA 1PY4A 2Z4QB 3FO9A 2E7LA 1W72A 1TTUA 5A3ID 4GSDL 4O4YL 4O5LL 1R6VA 3IU3A 5C08B 3KPMB 4XWOD 2ICEB 5HPOA 2B1AL 3RGVB 4LLUA 1TJHL 1QSFD 4NJ9H 5D7IF 4YIQA 1A4JA 1W72L 1WCQA 2OL3L 5JXAL 5B3NA 5C0BB 3QULB 2NW3B 5SWQB 5FA3A 3VFOA 1DQML 3BEVA 4PJHA 3RWJA 3VXMD 3WD5H 2K7QA 5C6PB 5HHQA 1NSNL 3D39A 4JY5H 1F4AA 4ZYKA 2V5SA 5I30H 2XY2A 4J3SA 1JZ8A 1XEDA 3CMOL 2HFGL 4J23A 2P4AB 2V7NA 4D3CL 2CQVA 5FOBB 1T03L 5DJYA 3GK8L 3H3PL 3VRJB 2XPGB 3DI3B 2HRLA 3O41A 1WJ3A 3FO1A 3MV11 4KAQH 2AGJL 3QHFH 5DJXA 1YYMH 5J12C 1DBBL 1BBJB 1PY9A 1JYVA 2PXYA 1XGTA 4WV1B 5DMJB 5BV7C 5I1GL 4RMRA 3S9DB 3T0BA 4HZAA 1N64H 3QIWD 2NXYB 4GXUM 4JFXB 3TBSA 2P5EB 3MRJA 3FQNB 3LKOB 1IAKB 5LCVH 1CT8A 2O5XH 5INDA 4E42A 2IBZY 1MREH 1P6AB 5H37H 1P53A 1U8HB 1W0WA 3H3KA 4M9OA 2EXYC 1DLFL 1FFRA 2CR6A 5DJZA 4JFDD 4QXUH 5EO0B 3T0WA 5GS1B 2G75B 2X41A 4BFEA 1WSST 2ZG1A 2ICWA 3L3KA 3BGMA 3RA7L 1I1AB 1AKJA 2NCMA 4YHML 4OGAC 4P9MH 1T1WB 3RWCA 3U46B 4A2MA 2J4WH 3FB6B 3TYFA 5ESAB 4K3JH 3U2SA 4DGVH 3MCLL 1MJJA 2CSPA 1VACA 4K3DL 1X7QA 1MQ8A 1GOGA 3TO4D 3OKYA 4HWNA 2E7LC 4LLQB 4ELME 3L5HA 3EZ8A 4PYGA 4Q9QL 1OAQL 3AROA 3VXTA 1N3NB 2LE9A 4ZG1A 4BYHA 3SDDB 1OTUD 3JUYA 3EKCA 4QTHA 4DGIH 1YUHB 4HS6A 2G2RB 3X3GH 4LEOA 4RZCA 2EDOA 4YBLC 2OI9B 1AFVL 1KIPA 4IRZL 5J1SC 4KU1A 3KR3L 2FR4A 2F54A 1A14H 5J4MA 2JF1A 2XICA 5EZIH 3CJJA 5L0QB 4U1GC 4JM2D 5DVNA 4YDJB 4H8WL 1UM6L 3WLWC 3ARGD 5KTEH 5JNYA 4QOKB 4N90D 4JREC 4PIRF 1FVEB 4ZTPH 1BHGA 1YY9D 3P30L 3V6FA 4ODSH 4OCSH 4Y5XA 5ID0B 1PKQA 1QA9B 1ROWA 3RVXC 4L8DB 2B0SH 4Y4KB 3TWCH 3LQMA 4M5ZL 1UH4A 3FO2A 4HZLA 5CEXA 4NZDA 4UINL 5FO8A 5CP3A 1VB9A 3OBAA 4FQ2L 1QKZL 1LO2L 2EE9A 4JO3H 5JR1H 2EYRA 2V9QA 2ZSVA 3RU8H 4QF1B 3RWFB 1HKLH 2GJ6D 1S7UA 5TQ2L 1RU9L 3G5YB 4LHJB 4ZAKB 1HEZB 1AXSB 1E27A 2W60A 2PYEE 5LXGL 4MWFB 1UKSA 1K3ZA 5EIIB 2DRUA 3T8XA 2UZIL 4ERSL 3L3OA 2Q8BL 1I4FB 1IBGL 4FZ8H 2AEWA 2AJXL 1F4XL 4QHNA 3LRSB 4MXVE 4RMVA 1YDPA 7FABH 4FNLL 1A6PA 2VOTA 1AGEA 4XCFH 1KB5L 3QFDB 1UJ3B 1P1ZA 2E8ZA 4X6DF 5I74C 1OT2A 3H0TA 3TYGH 2NY5C 5JW3H 4MNGE 1OGTA 2QSCL 2YPKB 1KULA 4AMKH 4PJFE 5IHZA 1QSED 1TZHA 4JKPH 3H9SA 2ICES 3L3DA 4HKJB 2YD3A 1NCUA 2FECL 4MAUH 3KYKL 2WBWB 3T0AA 3PP3H 4CU6A 4H8WC 4LSVH 4WFGD 3D2UD 4PJXA 4R97B 1GZQB 2DQIL 1CFVH 4S10A 4UBDD 4Z77A 1U8JA 2UVEA 4FZEL 2VC2L 1FP5A 2HLFD 4R96B 3MTRA 2ESVD 3RBSA 4MMXC 4L3CA 3I6GB 4OD2B 3ZSSA 4Y5YB 5DUBA 2GFBB 1B0GA 4E41E 1QBLL 1KTKE 1S7SB 2VUYA 3FN0H 3EO9H 3B5GA 5I1DB 1IEAA 5CBAB 1XIWC 1BIIB 5DS8A 4NNXB 2DLFL 4HUXA 1MCCA 3MXWL 1G7LB 4PBXA 1T0NA 3STZA 2HFTA 3IDJB 1F6FB 3U0PB 1CFSB 2N7AA 1MHCA 5ADOL 3OJVC 4W81A 4Z78B 4Z7WE 3BESR 2VLJA 1B2WH 2PYEB 4KROB 3W2DH 1NFDF 3ARZA 5CEZL 1CD8A 2FIKA 4NZRL 2VKXA 1X5AA 4KK8C 4EI6B 4F7CB 4HUVB 1WZLA 4WW2F 1JGVL 5IM7B 2FLRT 2RGSA 3VXRD 1NLBL 3WDHA 4YAQA 2DYPD 2IEPA 5JHDD 3EO1A 5EFIA 3T3ME 1UACL 3WNPA 5GZOC 4JO4L 5EO9B 4C57C 5BZDA 2DBLH 4MNGB 2GTWB 4WIQA 1ZHNA 1CR9H 2FSEA 4PJFB 3WFEL 2X4NB 1W0VA 2FX9L 3BKML 3QIBA 4TRPH 1EJ6A 3MRHA 5EOCL 4Y4HA 15C8H 1JPSH 1O7SA 3CLEH 4JCMA 2AEPL 4UOW0 5FYKL 3LZFL 4IEFB 5E4EB 4XGZB 2IJ0C 2RR3A 4G8GD 4KQ3L 3QH3B 3TNNA 4BFBD 2P8MA 4K94H 4RFEB 4GLRH 2NY0D 2VYRE 1T83A 3W39A 2WAHA 5E24E 3M07A 2VLLA 3VFTB 1FL6B 2P45B 4LF3B 5MP6H 4Y1AD 5ALCL 3HRZA 3TT1L 3HZVB 5JPNB 4E41B 1PVHA 4WVRA 5MEOA 2HP4A 4QLRA 4QT5B 5C0RL 2VL5B 1XF1A 2HT2D 3FAWA 3AREC 4Y2DC 3VXNA 3TVMB 3U9UA 4KJWC 1TJGH 4LLVA 3E3QE 1TJIH 3IFPB 4Z7WB 1F3JA 1R3HB 3SQOH 4OZFB 2FEEI 1ZLSL 1RUQL 1VGEH 5KS9F 2E8YA 4C4KO 3Q6FB 4OZIE 3N1GC 1NAMA 5F6IB 2HRPL 2IQAB 2V5RA 3O45A 2EC9T 4A6YA 3ZE2F 1BM3H 2G9HB 3GBNL 1UT9A 2NW2A 4DEPB 5C0GA 2R56L 3KHQA 1YNKH 4XNQA 5LBSL 1IEHA 3STLA 3VRIA 1UWEL 1PZUB 1VFOA 1DBAH 3BDYL 2DJ4A 4JN2A 1B88A 4JRYA 1AP2A 4L3EA 5C0EB 5E2JA 3NABL 3S7GA 3GO1H 3IFLL 4MLIA 2FL5A 4NN7B 4YHLL 2BHYA 4K8RL 1XZ0B 3DXAD 3CXDH 3HUJF 3U36B 1OSZA 3OZ9L 1WCBB 4M03A 5DYOB 5FYLH 5L8KB 2PCPB 2ZCKH 1LP9F 2W0LA 1GJIA 2IPKA 3QXAB 4GRMB 3S96A 3JV6A 2J8HA 4U6XB 4U6YA 5FOJA 5HJ3A 1G9ML 4JQIH 4LNRA 3CVHB 1HE7A 4DZ8B 3QIBC 1WZ1H 3MRPA 5CJ5A 4TSAH 3R4DA 3D85A 4FXGA 3L3JA 3VI4F 4Y4HC 1JGEB 1FGNL 4BZ1H 1C1EL 1BZ9B 4KI5C 1GHFL 1PLGL 1W2KT 4L4VA 2VIRB 4LRIA 2BNQE 3QDGA 3QI9B 4PRPA 1GGTA 4OD3L 2IAMD 1A9EB 2P7TB 2BVYA 1GZPB 2EIDA 3X13B 4PS4H 5CSZB 4MA7H 3LRHA 5IB2A 1E4KA 1MF2H 1FZMB 2Z8SA 1RPQA 3F7PC 4Q7DA 3UZEA 3LN4B 2A74A 1IM9B 2IALB 4UUJA 3GSRB 3R0MA 3TBTA 3T1FA 1AQDA 5FF6B 5IW6A 5ETUA 5IFHL 1MIMH 3K7UA 2OK0L 2F19L 5FYJL 1KIQB 1U91B 4NFCA 1KGCE 4DN3L 1ZHLB 2KH2B 4OZIB 2YK1H 3D25B 1M6OB 2DTSA 2J2ZA 3UEZA 1JNHA 3PJSB 3QJFB 1MFEL 4X0KA 1KPUA 4HK3J 4J7RA 2R1WB 2HMIC 4LCCA 4MJID 1MH5A 2D4FA 5T5NG 2DF3A 2WIMA 5DRXB 2AJSH 1QACA 4GBXC 3VXUE 4U6VH 4KK6C 4C83B 3IDXH 2R2BA 3UTTA 4BZ2L 1NLDH 5CILH 4PB9H 4MGXA 1CWVA 4XNMB 2EDWA 3QUXA 4W4OA 6FABH 5EZJB 3FQTB 1MHHA 2L7UA 3NZHH 3MLRL 4HLZH 3C60D 3NIFF 4MJ5B 4K8RC 1EJOL 3F5WB 2G60H 5ENWB 2BNRD 2VXTH 4PY7A 3PGFH 1S78C 1CD9B 4U1MA 4N0UA 1UWGH 5IR1A 2Q8AH 2AJUH 4HWUA 1A6AA 4LSPL 1N4XL 1BLNA 5F3HB 3T3PF 1IAIL 3SDXF 4GJTB 2BNUB 3IDUA 3P73A 3CZFA 32C2A 2R1YA 3VFGH 5CFHA 5JW4N 5JOPD 5TE7L 4MS8C 4S1QL 2CK0L 4WJ5A 2UYLA 5KW9H 1N59B 3ZT6A 1EVUA 4HJ0C 4HHAB 1UM5H 1F11B 5IHLB 3NMEA 4NWUL 2BNQB 3KWWB 3WFZA 4NO0A 2VLKE 5I6XB 5SX4I 4WWKA 4TOYL 5A2IH 4OI7A 1N7MH 1DFBL 4I18C 4MA1B 3GMMA 5HYSB 1WQVT 3CCHB 4LRIC 2F8XC 4MAYD 5E2TH 4ELKA 4QNPF 1KV3A 3MYJA 4YX2H 1YMHA 3FT3A 3MNVB 2APXA 2KZ1B 1RZ8A 4ONGH 1MPAL 3OKEB 1BOGA 4ODUA 3K0WA 1OWRM 1B0RA 5H37G 1N6QH 5I76B 1OD7A 1UH3A 4LSRH 3G6AB 3ULVH 3RPIA 2R4SH 3ULVF 2CMRL 2QV2A 2BRRH 4P0DA 3DMMA 1EGJH 1LQSR 2GTZA 5C0CD 4C55A 5BW7A 2CGRH 5I71B 3MYZA 3VXUB 1KCSH 5F9WC 3GMQA 4K7PY 4ZPTB 1ZLUH 2Z35A 3KAAA 4Y19E 1F00I 5D2LE 3WIHH 1ETZB 4HBCL 4YH6A 1AO7B 5FUCC 4RBPK 1EO8H 5E5MB 5L8JB 2NQCA 3BPNC 4LRNH 4Y8AA 5DMYA 4U0RB 3ROLB 3QBTB 5H35B 3FRPA 5T1KB 2X44D 4L8SA 4BH8B 2OSLA 4XNZC 4LLWA 4LSSH 4DZBB 3BH8A 1HXMA 3KS0H 1JPST 3RJDA 1U6AH 2A0LD 4LKCB 3P0VH 1VPOL 4QKXB 2IFFH 2QSVA 4NKIL 43CAB 3PWPD 2MPAH 1ZXQA 3TN0A 1HI6A 4MVBC 2JE8A 4X9IA 4YXKH 3BISA 5GJSH 3P4NB 4PRNA 4HS3B 1U3HC 1ZKAA 3LKSA 3PGDA 4MLSA 4ODBD 5IB4A 1OTTC 4PRAA 4CDHA 4V1DA 2C9AA 1R24B 2NNAA 1UYWL 3PWUB 3MV7A 3ZTNL 4QEGA 5M7QA 1NDMB 2VDLH 3F62A 1DBJH 3T0XA 2LV4A 1MJ7L 1BBDL 2GSIA 4XHJC 4R0LA 2ICWI 1P2CA 1DQDH 5IGXL 2Y23A 1RJLA 4OT1H 4HG4K 4IBLT 4JG1H 3DX8B 4UTAL 2IG2L 5DMGD 4XCEB 2GT9B 1T7VA 2V17H 1OP3K 4D9LL 1EDQA 3E1F1 4X7SH 2HVJB 2W65A 3SJVD 2XXCB 4O2EA 1C5DB 4MDIB 1IC4H 4MCYA 1HHGA 4L1DA 4JKKA 3L5XL 5DMKA 3U4EA 1HN1A 3DSNA 4LIQL 5FM8A 2AJ3B 5HYQB 4NPYA 4KUCF 2XKNA 1KEGH 3GJFB 4O58H 1ORSA 1OGAA 4WRLA 3LS5H 1K8IA 3P4LA 4Q74A 5DJCA 3U6RA 3W5MA 4CUCA 2C3VB 3IFNL 3TCLA 1UQSA 5EOQL 4PJGE 4G3YH 4OLYL 3CDGA 1U8OB 1M05A 5LG1A 4GRLA 4Y19B 1B4RA 5D2LB 1VGKA 3DMMC 3GMRB 1DE4A 2X1OA 1IEBA 3REVB 4ONFH 3MCG1 2VN4A 1TZIB 4JHAH 2V2XB 2JIXB 5C86A 2MNUA 4XNUH 4XP4L 3H7BB 3BWAA 3SGKA 1HK6A 4C4KT 5E7BA 3UTPE 4PY8J 4NM8H 3VH8B 4ELMF 3PGCA 4P46A 5GSVA 1LEKB 3MFFA 2CLRB 3MRKA 3DX9B 2XWBA 4QGTA 1YNLH 1M7DA 4PRBB 5C3LD 4K9EH 4MD5A 3IDNA 3BP7A 5FGCB 2A6KA 5J13B 4WFHD 3FQUA 5F9DC 1T2QH 3BSZL 4PJAA 1NC4B 3DROA 1MCPH 1CDYA 1NCWH 5B39G 4G9DA 1UCTA 4NOBA 3NN8B 1TVHB 4POUB 3VI3E 1WIPA 1CBVL 2BVQB 4GS7B 1U3ZA 1CDJA 4KH2A 3AS0A 3O4LA 2A6DA 4FQXD 3HI5H 1AC0A 5GS2H 4PTTB 2FHFA 2Q86A 3MLYH 4M61B 4YBQC 3WIIH 4OGZA 2OJEA 4OZHB 5KSBE 5EU7C 4HQQH 1OAKH 5ADPH 4I77H 1FVDA 4HULB 4KWUA 3W0WA 5KVGH 4KFZC 4UT9H 1MCQA 5F3BA 4TUJB 4LLDA 3BXNA 2AP2A 4PJGB 3VG0L 4HFUH 4OLEA 2CO6B 2FECI 2DDQH 4YHPB 4GXVL 3QQNA 1VFBB 3TP4A 3QA3A 3OV6A 5C09A 1IT9H 1X4XA 4F2MA 1QVOB 2Y06L 5I1EL 1JYNA 1K4CA 3GSQB 1NGYB 3MLUL 5IMKB 3UJJL 4GRLC 1A6VH 2F53A 5KN5A 2MQ0A 2YHGA 5J12B 3OB0K 3VFNA 3DUSA 3KJ4C 4K71C 1WIOA 3NZ8B 4K7FA 3GSWA 1QRNE 5F93C 5BV7B 1UB6A 5HYFA 5KVEH 2P5WD 5DWUL 3F8UB 2VDKH 4NC1E 1F58L 5ERWB 4XPGL 1SY6A 5E8NA 1WT5C 5I1CL 1A7PL 2NMSA 1YEJL 3WKML 3O6LL 5IWLA 2XFXB 1LDPH 2A83B 3EOAA 4PJFF 5AD0B 5SWSE 1KELL 2HJKB 3DUUB 1P4BH 2OR9L 1MIEH 3VDAA 1U8KB 4AH2B 4JLRA 1YMMD 4ZUUA 2ZOKA 1XGQA 5EZOH 1I3RA 1X5JA 2PYFB 2WLYA 2VH5L 4PB0L 2ZUXA 1FZKA 2NY3D 1MHEA 5GGQL 2Z93B 3NFSH 5FCUH 1EERB 2JCCA 1BIHA 1MELA 3LN5A 1CGUA 2NYYD 5KSBB 1DZBA 1IKFH 4NO2B 3SKMA 1RZKL 3S36L 5K9KA 1W72B 3KPPB 4TUKL 3O8XD 1YNTB 2OL3B 1IFHL 3KYNA 2D7TH 3ZE0E 3WL9B 4LMQI 4NBXB 3Q6GL 4KJQC 3V5DA 5DJ6A 4GAGH 4NJAL 3SDAA 4Z7WF 5HYJA 4PLKC 5FA3B 4OZFH 3S4SG 4YBLB 2R8SH 3K4ZA 4XXDB 1L0YA 2AJYL 4N0CD 2CIIB 4HK3N 4CN6A 3LRGA 4J3TA 4U1GB 4JFPA 4EI5C 4OLZH 5DMIH 3ARBA 4ZYKB 3ARVA 2PNDA 4Q6IC 5DXWA 4FTVE 1I7RA 5IF0B 4JREB 3L1OL 4LCWA 1BVKA 1HZHL 1QRNB 3ULVD 1A9BA 2OZ4A 4IOIA 5IB1A 1SM3L 1FFNB 3T3MF 1NBVH 2Y7QB 3WN5A 5DJXB 4G8IA 4XP5L 5JW5B 3ZE1E 1NMCC 4GKZB 1BQHG 4M7ZC 3ZSTA 2R0LL 5SWSB 3RRQA 2BJML 3IF1B 2C1PA 4KDWA 5DUPL 3QXUA 1S9WB 4XMLL 1KG0A 1NC2A 3B9DA 1JUFB 2EYSA 2XY1A 1A02N 1U92B 1WBYA 5GGRB 2N1KA 4OM0L 5IBLC 1A6UH 1RJYB 5JPMA 1Y0LB 5E2UL 1FNSL 2XRAH 3CVHH 2Y36H 3AU1B 1A7NL 1J0HA 5ISZA 1D6VH 5CBEB 5TGBA 3V0WL 1AGFB 4PGCA 4HPOH 4X80H 5EIVA 4BSWB 3BGMB 1TETL 4FQLH 1ZT4A 1MAJA 1RZKC 3EJYD 3SDDD 2F5AH 3WHE1 1NBYB 4LKXB 4MD4B 4FQHA 1GIGH 4LARH 4TVSa 3TYFB 2WZPD 1IC7H 4UDTB 1SVZA 3TJEH 1GGYA 1UXSA 3VA2C 2WSKA 5L2JB 3M45A 4NRXA 5I74B 5IESH 4RAHA 5EA0H 1RSFA 1JWUA 3V4VL 1QLFA 3KPQA 2AK1L 3FFDB 5IJKA 4NQXA 4NHCL 5HHXH 4YNYA 3K8LA 3K4AA 3EJZC 3MV9E 2MTPA 1E28B 4S0TD 3LMJL 1IRAY 1QSFA 2J6EL 5CZXD 3MODH 4NRZA 5I18L 3LN9A 4TULH 4X4XB 1MJ8L 2BVPA 4NGHH 3C5SB 3NH7L 4FTVB 4Y4KD 5F7NC 4LEOB 2YD8A 5DLMH 3U1SL 4FFZL 2DM7A 4HLZG 1UC6A 4CDGC 2EKSB 2F54B 5LJYH 4WI6A 3K2UL 3VXMA 5B3JE 3LY6A 5MERA 4KUCD 1RZGB 5FO9A 4IS6B 1SJHA 5C9KA 1JNNH 3E6HA 3RZCB 2VXUL 4X9BA 5L6YH 4J4PD 4IJ3C 4OLVH 2NY2C 3EHBC 4QGYA 4XAWH 2BOCA 1MLCB 4G7VH 3RTQD 3V6FB 1CG9A 3VFMB 3TIEA 3D6GA 3EOBA 1EEZA 2WUBH 4WFEE 3CFKA 4JANB 3T4AA 1XIWB 3UAJD 3VA6A 4U31A 2CIKA 1D6EA 1N8ZB 4A2LA 4HZLB 4POZC 4HIEA 4WU7A 1N5AB 5DJ0B 1KF9B 1HQRB 1OQXA 1A7QL 4EDWH 3MREB 1J9CT 2COQA 1MUJB 5I1LA 5T1MB 3QIWA 1V7MH 1P69B 2EZ0D 4O2FA 1QTYT 4F57H 3GSVB 1D9KA 4MDJA 3S37H 4RMSA 5CEZE 1RZJL 2R23A 1S7UB 3VMPA 1A0QL 4JO1L 5FUZH 4ZFOL 1YEDA 4NKOB 1KB5B 1NGXA 3T8XB 3SDCC 2AK4E 2NY6C 3L3OB 3B8SA 4NYLA 4LPUA 1CF8H 1ED3A 2H6PB 1JMZA 4XMPH 4LMQE 1WWCA 1YDPB 4LAQL 2AEIT 2BY2A 5TDOA 4EOWH 4E5XB 1P1ZB 1YPZA 3CFCH 3MO1A 1NGQH 1IAII 1S7VA 2X4TA 3H0TB 1H3VA 5GS2D 2BOBA 2FD6L 3ARDC 2X1PA 3RIAF 4Q9RL 1HH9A 3IU4H 1MCWM 5CJ8A 3QPQD 2HWZH 2QKIB 5J1AA 3GM0A 3Q2CA 3DIFA 5A3IC 1NMAH 2OQJA 5FYKE 4JY4A 4XWOC 1N2RB 1OP5H 3JVGA 5INCA 4HXBL 4QRSB 2O5ZH 5DD0L 3TA3A 3UPCA 3QWOB 4UQ3A 4QRRA 3T08A 1XGYL 5HGAA 4JKWA 1U8JB 3LPGA 5IMOB 5I8OL 1MNUH 1LD9A 5GGUB 2EEAA 1DP0A 3C9NB 1G7IA 2DIAA 5T5FH 1AR1D 1HHKA 3E0GA 3ULSB 1XF5A 4JHBA 3N06B 3HNVH 1IJ9A 1OQOA 2W0FA 1VADA 3AREB 4Y2DB 5DUBB 4NRYA 1JVKA 1B0GB 5B4MD 4PREB 4I13B 1AXTH 2DIBA 1NUNB 1IEAB 1R3JA 2CDEB 5DI8B 3GIZH 2VITA 4NFDA 1MCSA 1MLBA 3GBMH 3RWIA 3STZB 3C5ZC 3SE9H 1ZV5A 4M6AA 3CGTA 1I3GL 1QP1A 4X6CE 1JV5A 1RZJC 2NY7H 1YJDH 1RURH 3ZLQC 2I9TB 5ANME 3QIWC 5JO5B 4DVBA 1XT5A 4J1UA 2QSTA 5ICXA 4NO5B 2HH0L 5DZNA 3W5NA 3LOWA 3WNLA 1S5IL 1R5IA 4ONOA 4Y2OA 3RIAK 4KPHH 4NQEE 4DAGL 2GJ6A 1D5ZA 4P2RE 5JORA 1Z5LA 2Z8RA 4PGBB 4FQQA 4G6FD 1KPRA 3PWJA 1TPXC 1NEUA 4OFKA 2F58L 3Q1SL 5I1AB 4JZOA 4H88L 4G80A 1R3KB 1INDL 3GJFH 3BKCL 3LSOB 4R90H 4U1LB 4OJFH 1GXEA 1MAML 1XGUA 1FDLH 4Y8DC 1EHXA 2E7BA 4ZMAT 4WU5B 3TO4C 4OLWL 4MNHB 4QRPA 2CR3A 3IGAA 4PJIE 4GQPH 4PJEE 5FM5O 1U8QA 5D2LF 4UV4L 1RUPL 3TVMD 2R0WL 4FXLA 1U3YA 4H26A 1QSEA 3MJGX 5EU3A 5CGTA 2NTFA 4OI9A 4C56E 5JW4M 3NBNA 5E1HB 5JTWA 3DURA 3JBG7 1ADQH 5ALBL 3MGAA 1KJ3H 3QDGE 1FO0A 4LSTL 5IMLB 1KLGA 1C5CH 3TLRA 3B2VH 3HRZB 4HWBH 2HFFB 5D8JH 3RDTD 1TTGA 1CGVA 4GQ9L 4H20L 3VGGA 3T2OA 2OBGA 5FYJE 3VCLA 4JM2C 3LS4L 4JJ5B 1CQYA 1QQDA 2HAZA 1I1YB 1S3KH 3ARGC 3C2SA 4G6AC 5HI5C 3MJ6A 3GSUB 4R26L 5FGBC 4LLVB 1BGXL 4JZNA 1F45A 3SQBA 3OG6B 2I60H 1TENA 4EIGB 5C0AD 1BD2D 2WK2A 5HHVH 5ANMB 1DN0A 2H41A 2SEBA 3G9VA 5D7LE 1F3DH 5CKAA 4XMKH 3TZVA 1E6JH 4GBXB 2X4UA 5D93C 5DVOA 3RVTD 3A67H 4R2GD 4IOSD 4NQEB 2NW2B 1I3UA 5FUCE 4P2RB 3TH2T 4M7KL 3BZ4B 2ORBH 5GIRA 2X4OA 4OB5H 1UVQB 5DRZA 3TBVA 9CGTA 3GKWH 3OAZH 4I8DA 4R4FH 5JDSA 3HC3L 4LP5A 4RGMB 3UC0L 3MZTA 1KPVA 4FQCL 1XF4A 3QI9D 4PRHE 4QXGL 3VXRA 1UZ8B 5EPMA 1UA6H 4F80A 3V4UH 2R0KL 3CSGA 5JHDA 3L3HA 4HJGB 4PJGF 4YEFA 4RISH 1MWAL 4PJIB 4PJEB 2E9JA 4RRPG 1VKXA 5GISL 1DL7L 1CZ8L 4LNRB 4KHXL 1QHPA 1GGBH 4YQXL 3D85B 3VJ6A 4FXGB 1NAKH 4U1NA 4C56B 1FPTH 4PJCE 4I18B 2A1WL 4PJ7E 3BP4A 4PTUA 5IQ9A 4AEHL 1RIUL 3OAUH 1BF2A 4IMLA 4UMGA 3QDGB 1D5IH 1Y6NR 4FQIH 2YZ1A 1IGYA 3Q5YA 5BV7H 3CFBB 4G43A 3BMWA 3RL2A 5IQ7L 5D7IA 3M17A 4NNYA 1L9NA 5E8EB 4G8GA 3EFFA 5IB2B 2XZQL 5F7FA 4GUPB 1OF2B 1IVLA 3TBYB 3S35H 1WIUA 8FABA 1IC5L 4R8WH 3B3IB 1XGPA 4F7TB 2HLAA 1A6ZB 1KCVH 4NO3B 4O02L 1EUUA 1AQDB 4WEBL 1HSAA 2CJUL 4Y1AA 5I1HL 4KJYB 5DZOA 5JA9A 5HGHB 2HLFC 4XX1E 1MI5E 3VI3F 3O0RH 3G04B 2C3WA 3ALPA 3BJLA 4WO4C 5D7LB 4G7YL 2JB5L 5SX4H 2YKLH 2Q6WB 3IJSA 5I1IH 4X0KB 4M43H 2Q3AA 5F9WB 5CWSB 4LFHG 5SWZE 3KPNB 4OFVA 2BSSA 3JTSB 4GSDH 2RQ8A 4O4YH 4O5LH 3ZKNC 5IB3A 5J6GA 3BPNB 1IGFL 1JK8A 3OKNB 5E7FA 4L1HA 2B1AH 5BXFA 3PDOA 1TJHH 5KSBF 5IEKA 2VDOH 4J12A 4ZTOH 4XNZB 1IILE 3ARFD 1W72H 1OB1B 4JFEE 4LCUA 2YMXL 2OL3H 2Z9TA 3HR5A 4OZFG 1DQMH 3OSKA 4JVWA 4PRHB 2AI0L 2BMKA 2GKIA 3MUGA 5DVLA 4N0UB 5IV2B 1CFQA 1FC1A 3TNMA 3N9GL 1NSNH 2UV3A 1JPTL 4BFGA 4PJ9A 1U3HB 1BLNB 5A2LH 2OJZL 2VABB 3CMOH 2HFGH 4FQPA 4IDLA 3IVKA 4D3CH 3P73B 1Q9WA 4P59L 1ZLWH 5DF0A 3N1MC 3HG1E 4XP9L 2Z31D 4X6EB 1T03H 3GK8H 1EZVY 2AV7A 4RGOL 2I25N 4ODXB 4PJCB 1QR1A 1PSKL 1CICC 2UYLB 2AGJH 1LWRA 4LLAA 4YBHA 5EU6E 1DBBH 5JOFA 1T3FA 4JQXC 4V1DE 4RMUA 3EDEA 4OF8A 2EDTA 4KHTL 1J8HA 5I1GH 4WHYH 2VR5A 3V0VA 3GMNB 3I6KA 1OAUH 1RV6X 3GMMB 3UMTA 4QTIL 1Y18A 2J8OA 3MRMB 2WQRA 4BZYA 3HMWL 4BKLB 4HIJB 4ELKB 3MYJB 4EXKA 4HH9A 3S3JA 3IKKA 1YMHB 3PQYA 3QIUD 5HHNB 3MR9B 3W9EB 3KJ6L 4LIQE 5CJQL 5BRZA 2APWA 4QHKI 3HTLX 1REIA 5GRVL 4ODUB 2Y07L 1MI5B 1DLFH 2NY0C 3DNKA 2DMKA 3MGTB 3OKMA 4XC1L 2EEDA 1QFOA 3FB7B 4PRDA 5T1KD 4YHMH 2EIZB 1A6WL 2D31A 3UTSE 3DMMB 4XRCA 5SWZB 1QO3A 4XPTL 3SE3A 1RJCA 3MCLH 4GRWF 2AS5M 2HT2C 5EBMB 4BA8A 4K3DH 2AXGA 2GJZB 2BXZA 4NOFA 5GGSY 3T0EC 2Z35B 4XCYA 1I7ZA 1NCDH 4QCIA 4G5ZL 3IDGB 3PV6B 4JFEB 2VE6B 4Q9QH 2EICA 1OAQH 4MJIA 4XCCL 3UROR 3B9EA 3ZE0F 4JM4L 4PGDA 1J05A 1Z9MA 2VLKD 2Y6SD 3O2DA 2ADGA 1ZLWK 1II4E 5GGTL 1NCTA 1CFNA 1W8NA 1KCLA 4J8RA 4PFEA 4P3DA 2LTQC 2NY5H 4D8PA 2X4RB 5I8KH 1UXWB 4IRZH 1AFVH 3C60A 3NPSC 3O2DL 3KR3H 3HG1B 3MOAL 1JZ3A 4GAJL 4U1SB 5EC1A 1P4IL 2BNRA 2B1HL 5C7XL 2Q1EA 3C5JB 4H8WH 1UM6H 2WWMD 5E03A 5EU6B 3QDJE 2WWKO 4DTGL 1OW0A 5CD3B 5CCKL 4V1DB 3UTZB 1HKFA 1G7HA 3MV7B 2FGZA 4HX1A 4PJAE 3P30H 5E00A 4KQ4L 1J1OL 4CJ1A 4X6FA 3MCKA 2IH3B 4XVUD 1G84A 5HPMA 3ZE1F 4M5ZH 4ZFGL 5F89B 1NKOA 4TNWF 3H9HB 1E4JA 4X6DA 1RJLB 1SEBA 3KPRA 1N5YL 3OKDA 1IL1B 3GSNL 1JGUH 2ARJA 3B9KA 4YR6A 4FQ2H 2OMBA 3Q5TA 1I3VA 4N0FA 5KANI 2VAAA 3V52L 1QKZH 3S3SA 3FZUC 5LWYL 3C08L 2IAMC 3OHXB 5BJTA 1PYWA 1FG2A 2V2TA 3UTSB 2VZSA 5TQ2H 1RU9H 2H32A 2XKNB 3WFHA 5JDJA 1CGWA 1ORSB 1BX2A 5EBWA 5HYSG 2YXFA 5DJCB 3U6RB 5LXGH 4NQSB 3QCTL 3WSQL 4ZUSB 3CFIC 1CDCA 4ERSH 4GRLB 2Q8BH 3WFCH 1IBGH 2ID5A 5F9OL 2AJXH 3FQXB 1F4XH 2UVFA 5D7JC 2V9RA 1K6QL 2FZ3B 2HT4D 4K71B 3TIDB 2MCPL 4QYOA 4FNLH 4RNRB 3VXQA 3UJTL 1KB5H 2BVOB 5C0CA 4F8QA 2ZSWB 3OX8A 4NIKB 4PJ5A 1D5BB 4RWYH 4M62L 4QRUB 4YGVA 3GB7A 4M1GL 4CL7A 1U42A 3WNMA 3MFFB 3MRKB 4I5BB 4ZSOE 2XWBB 2ICCA 3KYKH 1H0DA 3OTTA 4W4NA 1SMOA 3KPLA 4CW1A 4AM0A 1ACZA 3QDJB 5TPWL 2DQIH 4Q2ZA 1HIML 1FV1A 4M6NL 4TNWK 4YDVB 4EN3B 2HJFB 3U4BL 1NFDA 4FZEH 2VC2H 4PJAB 1WC7B 4LPYA 5KSVB 1WFUA 1WBXA 3G6DL 5E6IC 4G9DB 1MCNA 3NCYP 4WGVB 5IROA 5J1TC 3FRUB 5B3JF 1OW0C 4MQTB 2PTVA 4WW2A 5TDPB 3UDWA 4X7DC 2AJZB 1NEZB 3BT2L 4RCAA 3FMGL 3MRIB 3MGOA 4PJBE 1A5FL 2YPVL 1V8HA 1WBZA 5HVFB 4R7DA 4KC3B 1YQVL 3ZO0A 2DLFH 1IAOA 1QLRA 3MXWH 2XKSA 3MLVL 3WJJA 4F33A 3W9DA 4JAMB 5MI0C 2P46B 3BZFB 5JIKA 5ADOH 5IVZA 1FC2D 4ALAL 4YJZL 3UTPD 1HHJA 3NA9L 2NR6D 5ECJE 1MRDH 2B2XL 3ROOA 1BF8A 3O2WL 1DVFD 4YHIB 4MAYC 4DKFL 3BXNB 5MHSE 5I73C 3C8HA 3L7FB 1FVCB 3RWDA 5CEZH 4NZRH 5BMFH 4WGWB 4EI5B 1CD0A 5F9AC 1WISA 5IEHA 4Q6IB 3UPRB 2H26A 5DHYA 1NLBH 3QRGL 1K4CB 3GRWL 1CDHA 1UACH 4R4BA 1LNUB 4KRNA 4JO4H 4PG9B 4KMTL 3X12B 5KN5B 4NHUB 3ARQA 5HDQL 2R1XA 1NDGB 1NMCB 5HHPB 1OY3B 4K7FB 3WFEH 4ZSOB 2ATKA 4M7ZB 3D18A 4UT7L 3BKMH 4CN1A 2VLRE 4OGAD 3O3AA 4LLMB 4EUPB 2EDFA 2CXGA 2RBLA 5E8NB 5MEQA 3NGBC 2FEDD 3MBXL 5ITFA 3HI1B 4PLOB 5KS9A 2VDPL 4N0RA 5FYKH 2EDNA 1FZOB 4PBWD 5FIEA 4K55A 4KQ3H 1R3LB 3EYOB 1XR8A 1FL3A 1GH7A 1MRFL 1BFTA 1I9JL 3CFJB 4WUKL 5E9DA 4JLRB 4ZUUB 3S4SA 1KLUA 1I3RB 2YWYA 2NXZD 3S37X 2A0LC 5HI4D 3VH8G 2IC2A 4KXZI 1CK0H 1RK1A 2X9XA 4HFWA 1FZKB 1OPGH 2EDHA 3TT1H 2VISB 2DWDA 5HHMD 2P8LB 4EDXB 1P7QD 4XPHL 4WW2C 3WXVL 1U8IB 1ZSDA 5C0RH 5E8DL 1C08A 4R7NA 4RIRA 4YHNB 4M48L 3LKNB 1X5KA 3IB4A 3SKMB 4WI3A 3HUJA 3AXLA 3HMXL 4X7FC 1PW3A 1LP9A 2DQJH 4ODHL 3F7QA 1ZLSH 1RUQH 4LSDA 1BQHA 3P4MA 1YN6B 2EO9A 1QRND 4ZO6A 3VD5A 4HMCA 2PW1A 4X6CF 5DJ6B 3BD5A 4J3OC 4N5UA 4YZFE 5DMGC 1JHTB 1K8DB 2R56H 4X4YB 1BOYA 1VDGA 3K74B 5LBSH 5I19H 1I9IL 3A6BH 4HC1L 1UWEH 5ID1A 3BDYH 1ZANL 2FATL 1LMKA 1P84K 5I9QC 1DR9A 3NABH 3AAZB 2OP4L 4ZO8A 4QWWC 1U9KA 2Y25A 2N56A 4YHLH 3TPUB 5JMRA 4IJ3B 1JI2A 1S7XA 2PKDA 2NY2B 3QG6B 4UV7L 5IB1B 4K8RH 3OZ9H 1S7RB 3RQ3A 3STBA 1EEYB 1A1MA 2WUCL 2E7CA 3HCVB 4APQD 1MFAL 2O93L 1C1EH 1WBYB 2F15A 1GHFH 1PLGH 4PJEF 4PJIF 1AY1L 1K2DA 4CMHC 5L88H 4OD3H 2LABA 1UB5A 4OCRL 4AJ0A 3CIQA 1QNZL 3KYMB 3RKPA 5SV3A 4U7MA 2Z4QA 1DUYB 1OT1A 3A0OA 5FV1L 1YMMA 5C08A 3KPMA 3ZL4L 4U05A 3FTGB 3SDCB 2NY6B 3RGVA 2IFGA 1P7KA 1DANU 5IFHH 1S9VB 4CMMB 4NKDB 1MCLA 2OK0H 1ND0B 5FYJH 1WV7T 5HHOD 5IOPA 1BPVA 3DPBA 5EDXA 5C0BA 4DN3H 4JFDE 4LCIL 5SWQA 2NW3A 3SDXA 5IVNA 3BP6A 1YECH 1MFEH 3ARDB 4FQXC 4HS8L 3L5WB 1UFUA 1XR9A 3RZCD 3NA4A 5A40E 3X14B 4EEEA 1WF5A 4JY6B 3GHEL 1QSFB 4BZ2H 3LV3B 3VRJA 3OKLB 2XPGA 1J0ZA 3F6LA 4Y16C 2VSCA 1KTDA 3MLRH 4P4RB 1RD6A 2MFNA 1EJOH 3ILQD 3WLBB 4K7PL 3T4YB 5JHLL 3PXJA 4IDJL 3TV3L 1JJUA 4PG2C 3B83A 4LSPH 1N4XH 4XVTL 1JI1A 3A6CL 5DK0B 5BO1L 3TH4T 5DD1L 1QBMH 3O81A 1IAIH 3LCYA 3S8WA 2BSRB 3FQNA 4R9HA 4S1QH 2CK0H 3NACL 4B5EA 1TLKA 1U8HA 1P5VA 3C5ZB 1CDIA 4NWUH 4N90E 4Z7QE 2G75A 5FEBA 2JKXA 2G5BB 4WHYG 1I1AA 1DFBH 1T1WA 4PJCF 4PJ7F 3QIWB 4ZFOB 4OCYL 3FB6A 5ESAA 1QSVA 5KSUB 2W38A 3MV9D 4I4WB 2W9LA 1OAZL 2XTJD 3KXFD 5I75C 1MPAH 2AQ3A 4N0YL 4JKMA 4ACPA 3QEQE 3SO5A 1CLOL 4JFDB 5EULV 2YPLD 1E6OL 5GRUL 4YHYC 1TPXB 2NY3C 1N3NA 2GY7B 4HDIB 2CMRH 3NCMA 3SDDA 3C2AL 2XN9E 5DEZA 1IGMH 3IS0X 4Y0GA 1YEHL 1YUHA 1RMFH 2NYYC 2W91A 2G2RA 2ZUSA 2CLZB 3KLAB 2BSTA 2Q7YB 4XXCC 2D4DA 2BOBB 3FB5B 3I75B 3TO4B 2X70A 1HH9B 2DQHL 1UCBL 2VN7A 4HBCH 1OSPL 3O8XC 4YDJA 3QQ4B 5J11B 3ARED 1Q9LB 4P4KD 4MNQE 2EKJA 1FVEA 2WM0A 1M1SA 3RNKA 5IFJB 1CIDA 3WS6A 5ID0A 1VPOH 2YEZB 4NKIH 4L8DA 3QO0B 4Y4KA 4N0CC 3S35X 1G7IB 5IFAL 2D2OA 3V0AC 2GHWB 4JM2B 1T80A 1IGIL 3TO2B 2W0FB 1H15B 3ARGB 4BK5A 3S88L 1Q0XL 3WV0A 2KQNA 3SDYL 3CX2A 2ZNWA 2AK4D 3GFUA 1UYWH 3GHBL 3ZTNH 3RTQA 3MMEA 2Z92A 4QF1A 3RWFA 1I8KB 3G5YA 1MJ7H 3DOSA 2ESVE 4ZAKA 5EC2B 5EO1B 1HEZA 1AXSA 5FXCH 3RP1A 1JYWA 5D93B 3CH1A 2DOCA 2FGWL 4MWFA 5CEYA 5EIIA 4UTAH 4XNYL 2IG2H 5IG7B 1I4FA 3QEQB 4ELMA 4J1UB 5FYKD 3LRSA 5ICXB 4KTYA 3OL2A 2D0GA 5C8JA 3CC5B 4WY7L 3L5XH 3IXTB 1R5IB 1UJ3A 1U41A 4LIQH 4Q0XL 2GJ6B 2XN9B 4PV9A 2Y5EA 2I26N 5AAWA 3I2CH 4OTXH 4FQQB 1FORL 2YPKA 2MOVA 1KPRB 3IFNH 5DTFB 5EOQH 4OLYH 4W6WB 4HKJA 3EJYC 4JZOB 5ESQB 4LASL 2MQCA 5EB9A 2I5YL 4XP4H 4MNQB 4PR5A 5JHDE 2H2SD 5TDNB 2EH7L 5L2KD 5JOEA 3IGAB 1K9TA 3HPJA 1YEIL 2IPUK 5IUSA 3DUHA 1I7TB 1U8LB 4H26B 3I6GA 1HWHB 5DQJB 4OD2A 1DQJB 3VFWB 2NTFB 3RY6A 3CFDB 1S7SA 1RZ7L 3D2UB 2VWEE 5MEPB 3B43A 5I1DA 5CBAA 5J3HC 1BIIA 2YA2A 1HNGA 4PLNC 1G7LA 3I50L 3QDME 5EN2B 4GBXD 2DI7A 3IDJA 4KK6D 1LHZA 3BSZH 1CFSA 4XC3L 4NQED 1PDKA 3QUZD 5IK3A 2Y9RT 3FO0L 1KXQE 1FN4B 4Z78A 2QHRL 1CBVH 1KENH 4WO4B 3RHWF 1EO5A 2ESVB 3HZKA 4K8RD 3RAJL 4J4PC 2PYEA 4M7LT 4Y1AE 3RTQC 2R2HB 1HOCB 4RRPA 12E8H 2VNCA 3D48R 3JWNC 4FXKB 4EI6A 3UAJC 3CD4A 4X8JB 4HUVA 3RVUD 4CADB 1U2HA 2X4UB 4YO0B 4RX4D 4JN1L 3T0EE 2GY5A 2V5MA 3NTCL 1I8LC 1A7BA 5DD5L 3EDKA 4MNGA 1DDHB 5GIRB 3MOQA 1HINL 3PIQA 5AYUL 3DVIA 5MENE 1WEJL 4PJFA 3VG0H 5LGKA 3QQ3B 5FB8B 1MWAB 3ZHLA 1FRGL 3FN3A 1KPVB 5IMMB 4OCNC 1UH2A 3G5XB 4GG8A 2Y06H 3GI9L 3VXRB 4LVNC 5CJXC 3MLZL 1DLHB 2DYPB 3P4OB 5JHDB 3MLUH 4XGZA 4NQDD 2PTUA 3LD8C 2GAZB 4P5TD 1CICB 5F72S 3QH3A 4JPWL 4KKBD 5DT1L 2Q76B 3DETC 4RFEA 3OQ3B 4R97C 4HUWB 2VZUA 4HW6A 5IHUL 4OIIH 4GKNB 3VFTA 1FL6A 4LF3A 1OTSD 3DXAE 2DL9A 1F58H 1ZGLP 4WI7A 2OTUB 3HZVA 3IJYA 5JPNA 3IYLW 4XPGH 4P2CG 5I1CH 1JGLL 1A7PH 1YEJH 3RHWK 3WKMH 3O6LH 3QPQC 1IZJA 2QTEA 5D7LD 1G7QA 3GI8H 4QT5A 1IGYB 1JNJA 3QDMB 4NWTL 1QPPA 3TVMA 1KELH 4JQVC 2OR9H 4EUPH 1DQLL 1SVCP 4NQVA 4HXAL 1SY6H 2C3HA 3IFPA 1KXTB 4Z7WA 2F8OA 2NY0B 3SGJC 1R3HA 2HLAB 1XH3B 3D9AL 4OZFA 5TFSL 2EC8A 2VH5H 1ZMYA 4PB0H 5F7EL 3Q6FA 4Y1AB 2R2EB 5GGQH 1VFAA 2R2CA 2IQAA 1AR1C 1J5OL 2G9HA 5D5ME 2W59A 4WHDA 5F21B 3JTTB 4PRHD 1KN4H 3JUZA 4MVBD 3T0EB 1RZKH 3S36H 5B4MC 4PJBF 2QLVB 1NL0L 4TUKH 3VE0B 5J9PA 2BSSB 5IB3B 1IFHH 5C0EA 5GRXG 2EH8L 5FGSA 5BZWB 5IEKB 5MENB 1T89C 4X9GA 3O4OB 3RVVD 3Q6GH 1XZ0A 2ZUVA 3U36A 1WCBA 2LTQB 4NDMB 4NJAH 1VERA 4R4ND 5FHAH 2PCPA 1P5UA 1G9NL 1KSRA 3QXAA 4GRMA 2GCYB 2H3NB 4M6MH 4U6XA 1R3IL 1A1NA 3MUGB 1FNFA 3ARWA 1CFQB 2AJVL 4OFIA 3CVHA 3TNMB 4DZ8A 1SYVB 2R4RL 4HIXL 4PP1C 2NZ9C 1JGEA 1BZ9A 1JF6A 3L1OH 1HZHH 4U6HA 5EG6C 5E8PB 3QI9A 1F13A 3DXAB 1SM3H 3JZ7A 1B4JL 3QUKB 2B5IC 1A9EA 4XP5H 1L0QA 3X13A 5JOFB 1T3FB 5CSZA 1FZMA 2XQBH 3BPOC 1V3JA 1KYOJ 3LN4A 1IM9A 2R0LH 2BJMH 1KBGL 5DUPH 3DV4B 2ED9A 1Y18B 2N4IA 2XZCL 5FF6A 5SWZD 5IB5B 3RL1B 5T3XL 2DS4A 4BSJA 1BREA 4OM0H 4AG4L 5J56B 1KIQA 5E2UH 4HH9B 1U91A 1FNSH 2PR4L 5HSFA 4X6DE 2VXSL 1ZHLA 1A7NH 3WEXB 4OZIA 3D25A 5JXED 2IAMB 1M6OA 3V0WH 2F74B 3PJSA 3QJFA 5IVXE 5DQ9B 1D5XB 5D5MB 5TQ0L 2R1WA 4HAFA 2ITDB 4RA3A 1TETH 3BP5A 2DL2A 5CMAB 2XA3A 5HVWA 3OXRB 3UJIL 4XRCB 4C83A 3RDTC 1FH5L 3PABA 5D7JB 3K46A 4XNMA 4DEPC 4HWEL 1F90L 3FQTA 1TFHA 2YRLA 3RUGE 2RAMA 5J06A 3F5WA 2H8PB 1FNLA 3QEUB 5ENWA 4U0QB 3V4VH 5M95B 1G9NC 2AK1H 2W9EL 1P7HL 4FABL 4NHCH 5F3HA 1CLZH 4WENB 4JRXE 1W0YT 3WE6A 3F7YB 4KTDL 3LMJH 3RVTC 4J8RB 4M5YL 4R2GC 2J6EH 4ZNEE 1VENA 1MJ8H 1DEDA 3QJHA 3NH7H 4YBQD 1N59A 3QXWA 4YZFF 3U1SH 1HILA 4FFZH 1F11A 2BNQA 1KC5L 3KWWA 3K2UH 5IW1B 2R29L 5E6IB 4M4PA 3KPSD 2A73A 1Q72L 5HXMA 1FBIH 1X6NA 2M2DA 3CCHA 1G7HB 3QI9C 3PWPE 1OAXL 5I1JL 4JDVB 2ADIB 4WI9A 5FYKU 3GSNB 2FH8A 2DJUA 3MNVA 1LO3L 3MCKB 2ZZUT 3OKEA 4LVEA 43C9B 4Z8FL 4ZFFB 5MI0B 2CLVB 5TJWK 2VZTA 4X6DB 5I76A 3OKDB 1A7QH 3KYOB 4NJ9L 3E3QC 5KSAC 4YHOL 1OAYL 1RUAL 2ZNXA 3SEPA 1NKRA 4MAYB 4EVNB 2C7UB 5I73B 2ZCLL 5C07E 3PE9A 3UYOD 1PYWB 1RZJH 4U2YA 3VXUA 3QIUA 1E4WL 1NCCL 1A0QH 2H32B 4GW1B 4MB5A 4ZPTA 4JO1H 1BX2B 1WWBX 5HYEA 4JY5L 1BVLA 1ETZA 3LKRB 3PWLB 3WHXA 3I6LE 3V5HB 3SJVE 3G5VB 5DFWH 3FONA 3VFPA 4O51B 5H35A 5T1KA 2X5PA 4GO6B 4I2XE 4OCWL 4BH8A 3QDJD 4KAQL 4DZBA 4LAQH 4LGRB 4JGUA 1HQ4B 2OTWB 5C0CB 4LKCA 4EN3D 1OL0A 4JRXB 43CAA 5E1AB 2FD6H 1INQB 4M9PA 1N26A 3KGRA 4Q9RH 3NGBB 1L7TL 3CPLB 2YWZA 3P4NA 2DQDL 3VFSB 1MFNA 4YFLI 1H3PL 4HBQA 2P49B 2ITCB 3QNYB 1VEMA 1H0DB 2VLKA 4HXBH 1R24A 1FQ9C 3KPLB 3PWUA 5DD0H 2RIKA 3ARFC 2JELL 4NQCD 1L9MA 4ZPVA 5JW4R 1XGYH 3IRPX 4CVXB 3PWPB 1WBXB 3O6ML 1D5MB 1NMBH 1BZ7B 4OQ1A 3OKKB 4PLKD 4WW2B 3DX8A 1IGCL 5IIEB 4XCEA 4XP6L 2IPUG 4GW5B 5EH1A 3Q5OA 3MGOB 2HVJA 3REWA 4MDIA 4TQEL 4WFHE 2Z31C 2PETA 4KVCH 4QO1A 2JJTC 1Q8MA 4EI5D 5HYQA 4JM2F 5FA4B 1HNFA 1I3GH 4Z7QF 4HAGA 4ZUWB 5HD8D 5C07B 3HA0A 2C3VA 4X5XA 4EBQL 1CE1L 2IADB 1U8OA 3GUTA 1KUMA 3ROOB 4KXZH 4Y19A 3ELAT 5D2LA 3GMRA 1QBBA 2OR7A 3REVA 4GT7A 1TZIA 2D0FA 3X3GL 4M6OL 3SJVB 1B6DA 2V2XA 4FQ1L 2HH0H 3RWDB 1CXEA 3QIUC 2DQTL 3H7BA 4I2XB 4OZGE 1GC1L 5I9QB 3TC9A 5IEHB 1SYSA 1ADQA 2QEJA 1CQKA 1IQDB 3BZEA 1F8TL 4WI4A 3WFDL 2DN7A 1LEKA 2ZG2A 2CLRA 2VQ1B 5FECB 1MCOH 1NQBA 4OCSL 3PDGA 2AV1A 2F58H 2QSQA 1FLRL 4GH7B 5IW3A 4OZ4B 1INDH 4PRBA 3V5KB 2ATKB 1MAMH 4JFYA 3RI5F 3SO3C 2XYCA 1T04B 5D96C 4HF5H 5FO7B 2VZ3A 4QHLA 1U95B 3HB3D 4OLWH 4Y88A 2FB4L 5KS9B 3NN8A 1TVHA 3BN9D 1S7QB 2ZJSL 1RUPH 4CMHB 4KJPD 2BVQA 2R0WH 2YOCA 4HUKB 3L3IA 2Y6SC 1FL3B 2P5WE 2VTFA 5E8OB 4LEXH 1EHNA 2A6JB 5ALBH 1ZLVH 4PTTA 4P2YA 2YUZA 5LQBL 5DK2B 2XACC 4X7TB 4LSTH 1FGVL 4YFEA 3E6FB 4ZNCD 1DJSA 1X5GA 1TQCC 2JJUA 4ZXBD 3BDXA 2P8PB 4QY8A 3KPTA 5ACZA 4H20H 4GQ9H 1UM4L 4KKAD 3H6JA 3MUY1 1C08B 3DWTA 2WWMC 3P9LA 7FABL 3M1BB 4R26H 3CXHJ 1BGXH 3HUJB 4KZEL 2VDML 4FQXB 4PJGA 1PX3A 1MCJA 4JFQB 3TYGL 5JW3L 1B9ZA 3LEXB 4YHPA 2YS4A 4WUUD 1VFBA 3NCYS 3DGCR 3SDXE 4ZD3L 3EHBD 3CSPA 1QVOA 2XIDA 4HCRA 2VLRD 2JJWA 4MAUL 1FZJA 1NEZG 3VWKC 4DGYL 1GC1C 3GSQA 1NGYA 4OZGB 3ECBA 5IMKA 1BMGA 4Y16B 4AEIL 2GITB 2QQNL 2QBWA 3RI5K 4P48A 2Z91B 5E5RB 1DVFA 3NZ8A 1B90A 3EDFA 4HCRL 3ABZA 3HC3H 3VGAB 4XZUA 1RJZB 5C6TL 4L4JA 2FO4B 2XOTA 2BVEA 5ERWA 4HGMA 3UC0H 1FE8L 3T0VA 4QHUB 1GPOL 4FQCH 4IRJC 5IVOA 3OJMB 1U0QA 2XFXA 2A83A 4YDLB 2DBJA 1N0XL 2QHLA 4UU9A 2VO5A 2HJKA 3DUUA 1ZLVK 1U8KA 5GISH 1A1MB 1CZ8H 2EXWC 1EFXB 3BUYA 1FSKC 2HT4C 4KHXH 1A8JH 2PYFA 4YQXH 5BCAA 3SDCD 5J13C 2P5WB 4PRID 5DEGB 1F4WL 1SJEB 2A1WH 2Z93A 5D1QD 5BQ7B 4AEHH 1RIUH 1K2DB 2QR0A 2YA0A 3SCMC 3H3BC 3W2DL 5KSBA 1ACYL 5IQ7H 1PG7L 4NO2A 2JB6B 1Q9KB 3EUUA 2XZQH 1XMWA 5A43C 3KPPA 4EUPG 2FLBT 3MBEC 2HTLD 1YMMB 2OL3A 1IC5H 1YNTA 1CXIA 3PWVB 3WL9A 4O02H 1H5BC 4WEBH 3WBDA 4YHYB 1F3RB 2CJUH 5DC9B 1P7KB 2NY3B 3U7WL 4NZUH 3CX5J 4P2OC 4G8EB 5IOPB 1FFPB 1T6WA 4G7YH 3HAEB 3SDXB 2JB5H 1MOEA 3K81A 3BP6B 5KVDH 3QWRD 4XXDA 2I07B 1J0JA 2CIIA 3X3FL 1XR9B 3O8XB 4H25B 1HWGB 1IGFH 1YEKL 5IF0A 3VW3L 1XGRB 1QRNA 1TMCB 3ARRA 5DVKA 4BQCA 1FFNA 1L4IA 3B8YA 4G9FD 2YMXH 1KTDB 2NR6C 2Y7QA 3MRCB 4BM7A 1VCAA 3C5ZD 5JW5A 4RQQA 1DVFC 2VXVL 1OOAA 3QG7L 4GKZA 2YR3A 1JRHL 3GGWB 3N9GH 5SWSA 1WTLA 3IF1A 1JPTH 3FKUS 1S9WA 4UQ2A 2OJZH 1JUFA 5IJVA 1U92A 5GGRA 1RJYA 4P59H 1Y0LA 2GJJA 2DLEA 4XP9H 4YWGL 3BD4A 2X09A 1TJGL 4RGOH 5DJDB 3AU1A 1PSKH 1JWSB 3PDDA 5CBEA 1AGFA 4F7MB 3FQRB 2P44B 2BHZA 1E0OB 4KHTH 5LVEA 3AS2A 4BSWA 1ZGLM 1A47A 4M00A 1AGCB 5JMOC 1CI5A 3ESUF 3VXOA 3LKQB 4QTIH 4XPAL 1NBYA 4F8TA 4LKXA 4MD4A 3HMWH 1CN4A 2FEDC 1HXYA 2XG5A 3OXSB 5CGMA 4UDTA 1Y6MR 2VMFA 2GUOA 5L2JA 3KJ6H 5CJQH 2A9NH 1G1CA 3HS0A 2Y07H 3V6OE 1FAKT 2NXZC 4XC1H 3GO1L 4UILL 3FFDA 5HI4C 3VFVB 5EU4B 4ZFZB 3BMVA 4KRMB 4KVNL 4PGJA 1A6WH 1E28A 5C0ND 5FYLL 5F7YC 5EOTA 2PXYD 4NUGL 2FJFB 4X4XA 1AGBB 3ISWA 5D5MF 3ZT7A 2BSTB 3C5SA 4FTVA 2FX7L 2GSGB 5T1LD 1CS6A 3HE6D 2EKSA 2X70B 4G5ZH 3BFOA 1AJ7L 5FDWB 1TVBA 4UIKL 1RZGA 4G6AD 4IS6A 4XCCH 5KANG 3SE8L 2FBJH 2YN3A 5HI5D 3RZCA 4JM4H 3ARUA 4L3AA 5GGTH 1T1ZB 1MLCA 4NC1C 1ZT7B 3RNKB 1Q94B 2XWJA 3VFMA 5F7DB 2YBRB 4JANA 1XIWA 2BK8A 3DYOA 1AKJD 3O2DH 1N8ZA 3MOAH 4ZUVB 4GAJH 4N9GB 1N5AA 1P4IH 2B1HH 1Z0NA 5DJ0A 2DLTA 1HQRA 1MIML 4FOMA 3WS3A 2ZUTA 1IKNC 1DBML 3QEQD 3MREA 5CP7B 1MUJA 5T1MA 3EZJB 2DQEL 1WFNA 1P4LB 4ODVL 4OFYD 2BDNL 3RTQB 3MMEB 4KQ4H 3GSVA 1Y6KR 2Z92B 5GRVK 4UDUB 1L6XA 2XN9D 4H0HB 5J0BA 3CNKA 4X7EC 3S36X 4ZFGH 3P2TA 4DUWA 3SE4A 3CH1B 4NKOA 1KB5A 3QO1A 5CEYB 3FCTB 1N5YH 3IDMB 4APQC 1XF2B 3GSNH 5T1DL 4XP1L 3CK0L 4U1HB 3VXPB 3BE1L 4TVPD 4ELMB 4JGMA 2H6PA 4F7EB 3LEYL 3V52H 1AD0B 5C8JB 3FT4B 3C08H 4LGSB 4MNQD 4E5XA 3MV9A 2D9QB 5TE4H 1A1OB 4BUGA 1RVFL 4PV9B 1HCVA 3KXFA 2H9GA 3F6IA 5IVXF 2ZUUA 1WTGT 2QKIA 1CD1A 4LVNB 3L6FB 3QCTH 3V6ZB 1Z9LA 1U3JA 4KKNA 3D0LB 5DDHA 1N2RA 3QUML 3LD8B 4QRSA 2H32H 1NCBL 5F9OH 1N0LA 4MJ6B 3QWOA 1T0PB 2MCPH 3BRFA 2HKFH 5DUML 1NANI 4F9LA 5IMOA 2EE6A 1R0AL 4PR5B 5A2FA 5GGUA 5C0JA 3RUGF 5B38B 5HYIA 1JIBA 3MRDB 1A6TA 3C9NA 1N7ML 4M62H 3HPJB 4AQ1B 3ULSA 5D72L 4M1GH 4WO4D 3RZCC 3MJ8B 3O6FB 5CUSL 1JGDB 2X1XR 3AREA 4Y2DA 1SJXA 2YRZA 2F5BL 3VGHA 1X5LA 3Q3GA 4HUNB 4PREA 2HT3C 1ITCA 1ZGLB 5DHXB 2CDEA 3ZKND 3G6JE 3SKNB 5JQHC 2OCFD 3F7RA 5DI8A 1HIMH 4WI2A 3DV6B 4M6NH 3M8OL 3U4BH 1T7WA 3CUPB 3P9MA 3ILQC 2OMNA 3G6DH 2IWGA 5IK3B 3R8QA 1KJ2L 3QR2A 5I2IB 3PNWA 1YZZA 2I9TA 1EGJL 3HZKB 4MQ7B 3BT2H 5JO5A 2VDRH 3FMGH 1SHMA 3QFJE 2R0ZL 3O2VL 4D0BB 3QCVL 4NO5A 5C1MB 2YPVH 4PV8B 4RAVB 4XAKD 3V4PL 2AK4A 2MCG1 1KT2B 4OD1L 3WIHL 2X1WL 4Z7VE 3MLVH 3QNZB 3SE4C 4KY1L 4PGBA 1YC8A 1FLTX 5EU5B 3SGDI 3DX7B 1D7FA 4TTGA 1LILA 3DO3A 3NCCB 1CICD 3NA9H 5C0AE 5LKNA 1BD2E 2B2XH 3O2WH 5I1AA 3P40A 1Q1JL 4HJJH 3PIQB 1R3KA 3BGAA 3EO0A 4DKFH 1I8MB 4U1LA 3LSOA 2MPAL 2XTJC 4PJDE 4WU5A 3QHZL 5GJSL 4MNHA 1IMHC 4M4RA 2VDQL 3OR7B 4U1KB 4GG8B 3SGEI 3V8OA 1C12B 3QT2A 3QRGH 3QDMD 4P3WA 3GRWH 1DN2A 4G6FB 5LGHL 4X4MA 3MJ9L 2B5IB 4KMTH 2IH1B 2XTLA 5CLWA 5HDQH 3ULUD 3QDAA 2XQYK 3O9WD 3BPOB 4N8PA 4F9LC 2MKLC 4HWZB 5IMLA 3ZKQD 3EW3B 3NCJL 4CKVX 3IJYB 2HFFA 5L2KA 4OT1L 5T3XE 3LB6C 3N1QC 3LVEA 3MROA 2E6JA 2VLJD 1G7QB 3JWOL 3LKPA 2VDPH 2FJGB 4JJ5A 2VB5A 1ZHBA 1CXLA 1I1YA 1RZIA 4JHZA 4P2QE 3T09A 4P4KC 1E4XL 3GSUA 2KZWA 3T0ED 4X6CA 1XCTB 2X42A 4NQVB 1MRFH 2VZVA 4WUKH 4Z7UE 4G6JH 1TDQA 1EEUA 3U4AA 5ANMA 2C4XA 4MX7A 3L9RB 5GRJL 4YXHL 5F1IB 3QFJB 5MEND 1VFAB 3K8MA 4GBXA 2EDBA 4JVUA 4G3YL 3RDTB 5FHBH 4XPHH 2X89D 3WXVH 4NQEA 2BSED 4Z7VB 4CU7A 5E8DH 5D6CB 5DJ2B 4M48H 4P2RA 3BZ4A 1R5WB 5DJAB 2OS7A 2DQCL 2LAAA 1LVEA 1Z0MA 1UVQA 4ORGA 4GMSL 5J9PB 3S97C 4YDIL 5C0AB 1BD2B 2IGFL 4ODHH 3BQUD 3P0YL 4KKLD 1UADC 1XCQA 1PFCA 3MQIA 4R2GB 1UZ8A 4HJGA 2DJSA 4LHUD 2QADC 4K9EL 4PJEA 4PJIA 3IJHB 4UOJA 4ISVB 1A1NB 1I9IH 1NPUA 5FCSH 1ZHKB 4GOSA 2FATH 3OPZL 3D3VE 1JHLL 5F97E 4XBEL 5D9SA 4C56A 5C9JA 4OZGF 4I18A 2OP4H 3FT2B 1G6RA 1WGOA 4U6HB 1K3IA 5KOMC 4IRSB 3FZUD 5GRWA 1MCWW 4S1DC 2RCSL 1AQKL 4J2XA 3CFBA 5CSBA 5E8EA 1V05A 4HIHB 3JWOC 3K2MC 4GUPA 1OF2A 2IANE 3C09B 1G6RL 3SKJL 3TBYA 3DGGB 5JQ6L 4P2QB 3K80A 4KRLB 2WUCH 2AVGA 3B3IA 4F7TA 1A6ZA 4X5WA 4NO3A 2H2SC 1MFAH 3AY4A 3U9PL 3QWQB 1XF3A 4Z7UB 4I0KA 5KSAB 3MZGB 2FCBA 1QZ1A 4KJYA 5D7JD 4RGNC 3MLSL 5HGHA 1NCNA 4L4TD 3G04A 5D7LA 1CGSL 4F3FB 2UWEE 4UIMA 2Q6WA 3DLQR 1XAUA 4LPXA 4OCRH 1R5VB 3HE7D 1QNZH 5CWSA 4TPRH 2IF7A 2C1OB 1T0MB 4R6UA 3KPNA 1VFMA 3BP5B 3JTSA 5JLZA 2VKWA 3MA9L 3ZL4H 2XA8L 5EUOE 3OKNA 1LEGB 2Z8VC 3PABB 3F65A 2YD2A 3QUZC 1OB1A 4NN6B 1RIHL 3MNZB 4PRHA 5E6ID 5CZKA 3QDHA 1TITA 1JNLL 4HS8H 5IV2A 1MJUH 1T1XB 4RGMC 2W1NA 1FNEB 1X4ZA 4L4VD 1U3HA 3MRRB 4RBPH 1G9MC 5IBUB 3HAEH 3RVUC 1LDPL 2VABA 3WE6B 2H1PL 3VFUB 3GHEH 4OKDA 3L5IA 3D3VB 2BC4B 2E9BA 4X6EA 1KCUL 2ERJC 5D71H 4WDIA 4LBEB 3ARFB 3QJHB 4ODXA 4D0DA 4PJCA 3DO7B 1YN7B 4PJ7A 4GAYB 3MOBL 3UZQA 5EORL 1IE5A 1HILB 4BQBA 2FJHB 5ESVB