1BGXL

Taq polymerase in complex with tp7, an inhibitory fab
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAQ DNA POLYMERASE
publication title Crystal structure of Taq DNA polymerase in complex with an inhibitory Fab: the Fab is directed against an intermediate in the helix-coil dynamics of the enzyme.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Complex (polymerase/inhibitor)
total genus 30
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1998-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL01
2NY5C 5IEHB 4UDUB 3BW9A 1LDPH 1QRNB 1QFPA 4OUUA 1MCRA 4MNQB 3GMRA 3TFKC 3KNBB 3O3UN 3PIQA 1H9VA 4WFHE 2I25N 2YXFA 2QHRH 5SWSD 5J3HD 2YUXA 3QEHB 3MODH 1UXWA 1I9IL 2EEDA 4RAVB 1HILB 5GISH 2CXGA 1BQLL 3AB0C 3V5DA 2PTUA 2UVEA 4Y4FB 1SEQH 1JPGA 3SKJL 1A4KA 3M1BA 3KPTA 2H41A 3QUKB 1Q9KA 3QIBB 5H94A 3GNMH 1I8LC 3A6BL 1N64L 4U7KA 1BBDH 2XQBL 1LE9A 2X4SA 1UCBH 5DEFB 5INCA 4DQOL 4QF1A 4MGXA 1BFVH 2AJYH 3KDMA 3T2QA 4NKMA 3LQMA 4FQXC 3FN0H 3V7AG 4DKAA 5C09A 4HF5H 8FABB 2RFXA 4Y5XA 1MAMH 1UZ8B 5HYJD 5L7XH 4NO5A 2Z31A 4X8JB 1XF3A 3HFML 2LTQB 3CUPA 1FZKB 1P1ZA 3NPSC 4M4RA 2YN3A 4G42A 2P8MB 3CVHL 2O93L 5GGTH 3UTOA 1A0QH 4OB5H 3BFOA 3VWJC 2Q6WA 1RY7B 4PJIB 3TPKA 4KQ3L 4M1GH 2CRZA 1EX0A 2VXSH 4X4XA 1OCWL 4H0IA 4S1QL 5EBGA 2EO1A 1Q72L 4PGCB 4GAJH 3QPQC 4U1HB 5KSUA 4EQ2A 5GJTL 4DK3A 1MFDL 5SX5H 5DEGB 4OZHA 4NQCB 2P46B 3UPAA 4MWFA 4KZDL 4AIZB 4R7NB 3QIWB 4QO1A 5IESH 5HHOB 3TF7C 3OXRB 3NABH 4QRTB 4Z78B 5T33H 2D03L 3CFCH 5DSCB 1U8QA 5IHZB 5KSBF 3QWOA 4YHIA 4JFHD 1TZIA 4NC1E 1A4JA 4YBHA 4ODUB 5DFTA 1UM4H 5D70L 1BAFL 1D9KD 3VFGH 1EHLH 1J87A 1KCUH 4JHWH 4WCYH 4ZTPL 3BKCL 3QA3B 3BMWA 4P59H 5BS0A 2VR5A 5IQ7H 3ARDD 4G3YL 1U58A 4B53A 2BC4B 3BISA 2X70A 4PJFE 3SDCA 4AK1A 3FT2A 4ONFH 4BUGA 1VPOL 3THMH 3EYUL 2EDEA 3TA3D 3H9SE 4KRPB 3ULUF 1CDBA 3O81A 3V79C 4NZUH 1IGIH 3MRNB 4MA7H 4E41B 5I2IB 3DV4B 3NZ8A 5I8KH 3SKMB 3MO1A 4QHMB 5HD8C 3M17B 3PWVA 4TPRL 5TE7L 2BY2A 2IAMD 3IDJB 2VL5A 2P5WD 2C1OA 3VMPA 3TBWB 4K2UL 3INUL 3I75B 4HQQL 4MJ6A 5CIPH 3EGSB 4ODTL 4G6KH 1C5DA 1MRCL 3MV7A 4O4YL 1OGAA 5ABDE 1Q8MA 2BSRA 4W4OA 1G7LB 5DJ2A 1JZ3A 5EA0L 2DOCA 1AR2A 2H26A 2R8SH 4U6YA 3L3OB 5SX4H 1JTPA 5HHNB 3V8CA 3ZHKA 2P24A 1G6VK 5ERWA 5JLZA 2VDML 5J6HB 5F7EL 1MIEL 4KK6D 1HSAA 1XGPB 1IILE 5AG9A 3I3DA 2OBGA 4YIQB 3GGWB 3MBXH 4YK4C 4WY7H 1KPRB 5F7KC 5F9OH 5F1IB 2QBWA 4G8FA 4ZO8A 3O4OB 3SGEH 4F7TB 2HT2D 2NY5H 2DI7A 5FUCC 2EXWC 5DFVD 4KKLC 2AEPH 2A77H 3UTSE 2PO6B 4EKXA 2B0SH 3IF1A 5GGSB 1FL5B 3FFDA 2JCCA 1CFVL 4NDMB 2YA1A 1T5XB 3M8OL 1A7RL 4Z7UA 4CUCA 1VDGA 4ZFOB 1XIWB 4L8BA 3B8SA 3KLSA 5D5ME 4MXWH 1AR1C 2CPCA 1NEZG 2P49B 1IGJB 4P4KB 2X44D 1X44A 3WLWD 2YPVL 3I85A 1AO7E 5ICYA 4XP5H 3T0EC 3EYFB 3LQAL 3T09A 4QHLA 3OPZL 5IG7A 2HKFH 3REWA 2FGZA 4BA8A 3DTXA 4U1NB 3VW3L 1JPTL 1I8IB 5ANME 4PRBB 3PDDA 4GXUM 1X5IA 4M7LT 4P2QE 3LS4H 2APTA 3LZFL 2IMNA 1ZHKA 1V7NL 1J0IA 1IM9A 4WWKD 4YHZH 3EZ8A 3PL6C 2VDPH 4M7LH 4U6HA 5I1KH 1AIFA 1MWAB 1T1YA 2FX8H 1MREL 3BW9B 4OUUB 4ZNEA 5CILL 2VQ1A 4V1DA 3GMRB 3PIQB 4MD0A 1DQJA 3MMEA 3EHBC 5CP7A 3B9VA 3NGBC 3P73A 1FZJA 2X4RA 4ZG1A 5I75C 3QCUL 2ESVE 1H0DA 5IMKA 1UXWB 1XZ0A 1WIUA 3U7YL 4JY4A 3EIFA 3WSQL 1M6OA 3V5DB 1WEJL 1LDSA 4UT6H 1JPGB 2O5ZL 3X3GH 2PETA 1A4KB 2VH5L 3M1BB 2R2EA 4EI5D 2ITCA 3VXME 1Q9KB 4Y19D 5DHVA 5H94B 2GITA 3TLRA 3CH1A 1U2CA 3SE3A 4YH6A 4P23D 5TFSL 1LE9B 2X4SB 5INCB 4Q9RH 4WWID 5IW6A 1CE6A 4QF1B 1MWAH 3KDMB 4NKMB 3BQUD 1PFCA 1U8HA 5C09B 3MZGB 2F58L 4TQEL 1F58H 2RFXB 4Y5XB 1D9KA 4F33A 3V0VA 4NO5B 2Z31B 5MERA 2P47B 1XF3B 2V9QA 2EH8H 4CVZA 3ZT7A 2XKSA 3CUPB 4JRXA 1BGXL 4XCYA 4XCNA 5CCKH 1P1ZB 2ZCHL 4J3OC 1EAJA 3ARWA 3ARDA 3HE7D 4G42B 3HMWL 1MJ7L 5JW3L 2OTPA 1TJHH 4ODXA 2Q6WB 2ZCKH 1A6UH 3HI1A 5T3XL 3H3PL 4X4XB 1S7UA 3OZ9H 3NIDE 4ODHH 3SHSA 5KSUB 4YAQA 1T7XA 1XR8A 1L0YA 1ETZA 4NM8L 3T2NL 3RVVD 2LU4A 4OZHB 4MWFB 4HXAH 1I9EA 3GKWL 2VXUL 4HBCL 1BWWA 3GMMA 1U8QB 5CJXC 2IAMA 3QWOB 4JO3L 4YHIB 3VXQA 3OAUH 3O9WA 1TZIB 1QFWH 3JWOL 1A4JB 3UTTE 3E8UL 3V95A 2JB5L 3FJTA 1G9MC 4NC2B 4PG2C 3MACL 4Z7OE 4GLRH 2K7QA 5BS0B 4XP9H 2DD8H 5I16A 2FEEI 2MQ0A 5DD1L 4FQQA 1KXVC 1U58B 2ED7A 1ZT7A 2J7LA 5SWQA 1NCDH 1OW0C 2X70B 2VTFA 5KANG 4HLZH 3SDCB 3BJLA 3FT2B 1JNNL 3OMZA 5FV2A 2X4PA 2ITDA 2VISA 2GHWB 2DQHL 4PLKD 5IFHL 1JTTA 3RNQA 4KJPD 1RJLA 1R3KA 4WUKL 5CGYD 2XQYK 1B4RA 3NZ8B 3HUJE 2GJ6D 1QSFD 3MO1B 2V6HA 4PP1D 1AFVL 4KY1H 3BIBX 5LQBL 2YUZA 3PWVB 3K0WA 4OCXL 3QWRD 3DUHA 2CK0H 5GRUL 3RVUD 3PE9A 2VL5B 3VFNA 1F8TH 2C1OB 1BD2E 3ARDC 3GIZH 4Q2ZA 3RZCC 3ZL4L 2ZUQB 1NDGA 2OZ4A 2JJTA 4MJ6B 4UUJA 1O5DT 4Z5RA 4KDVA 4OGZA 1C5DB 2F5BL 4C4KO 3MV7B 1VCAA 1OGAB 3C2AH 5L2KD 1GHFH 4LKXA 2BSRB 2OR8A 4OLWL 5DJ2B 3KG5A 3MA9H 5EZOH 3TA3C 2H26B 4U6YB 5C0JA 1MNUH 5L8LB 2P24B 2HRPL 1Q94A 3GI8L 5ERWB 5JLZB 1EGJA 3EKCA 4JPKH 1HSAB 3NCCB 1ZVSA 2DQCH 4MCZA 4PJ8D 4JZJA 3RBGA 4IRJD 2VAJA 1YPZA 3CVIL 2BDNL 2HVJA 5CZVL 1L4IA 4WEBL 3WYRA 1T6WA 2XRAH 5F3BA 3ARXA 5D71L 4G8FB 5D2LA 3ZTNL 3BDBA 1DSFL 1I3VA 2X40A 1T0MA 2IGFL 1MQKH 1QVOA 5GRJH 5TE4L 3IF1B 1NAKH 5IHUL 3FFDB 2FEDC 1EFQA 5LAXA 2JCCB 5KVEL 4OLVH 3ROOA 2N7AA 4Z7UB 2NXZD 4L8BB 1EO8L 4PB9H 5ITBL 2EYTA 4PJBA 2A38A 4M5YH 3RFZC 4EI5A 2CR6A 4KK6C 5ICYB 3JWNC 5IG7B 4QHLB 5FIEA 3REWB 4WO4C 3DTXB 1CLOL 1GIGH 2QEJA 2FRGP 2GSGA 4HIHA 1FQ9C 2ZUWA 5F9AC 1RIUH 4RAHA 2EDOA 4ESKA 2AABL 4GMSH 4HPYH 2NY6C 2HT2C 5ISZA 3RL1A 5E2WL 2NZIA 1ZHKB 5DFVC 4CAGA 1IM9B 3BQUA 1FAKT 4CL7A 5CMAA 3HNTL 2ERJC 5DMKA 2EDXA 4U2ZA 4U6HB 5GGUA 1AIFB 3JV6A 2EDWA 3MLRH 1T1YB 4H8WL 5D9SA 4WFGD 2XYCA 1MCLA 2VQ1B 4PJFF 4V1DB 2AJXH 4OM1L 5KOVC 3R0MA 4MD0B 4CMHB 1DQJB 3MMEB 3EAKA 4S1DD 5CP7B 3WLWC 3HE7A 5IROC 4HKBA 1R0AH 3P73B 1FZJB 2X4RB 4XPFL 5E4IA 1NGPH 5F7YC 1XR9A 1QQDA 2BCKA 4K23L 4OT1H 1H0DB 5I1CL 5IMKB 1MOEA 1XZ0B 3WE6A 3I9GH 4JY4B 4RMRA 1M6OB 4ODSL 3MLSL 4OCSL 1KCKA 2R2EB 3HG1E 2ITCB 5DHVB 2GITB 4WWKC 1ADQH 3CH1B 3VXNA 5JA8B 1H8NA 3W5NA 3EJJX 5D7IE 3TCXA 5IW6B 3NFNA 2CDEA 1CE6B 2VR9A 4NFBA 2A2QT 4JPVL 3RJDA 3V7MA 3ARBD 1TJIH 1EBPA 1U8HB 3BP5A 1PY9A 1N0LA 3V4UL 1JGEA 3Q1SH 5H8DA 1TJGL 1XCTA 1WSST 2LQRA 1XF5A 3V4VH 4OCYL 1RVFH 4G80A 1D9KB 2R29L 4F33B 3QCTH 3MOQA 2FDBP 2QQQA 3V0VB 5MERB 3HB3D 4ZUVA 4CVZB 1Y6KR 2XG5A 2LAAA 4JRXB 4XCYB 4XCNB 3IT8D 3V0WL 3T0DA 3ARDB 1U3HC 5FYJD 5BRZE 3E0GA 4POZD 1NCUA 4LGRB 2A6IA 3VA2C 5DHVH 4ODXB 5HHPA 4WI3A 3MV8D 4P23C 1JZ7A 3SGJA 3HI1B 2UUDK 4UIKL 1PGRB 4S1SL 4NJ9L 4PJCF 1N3NA 1S7UB 3HI5L 5D4QA 1SJEA 5EC2A 4LVNC 4P9ML 1TVDA 4EDXA 2WK2A 4H0GA 4YAQB 4MB4A 3LMJH 1XR8B 1ETZB 3MLVH 4HGWA 4L3EE 3UDWC 2ZKHH 3Q6GH 4RNRA 2OJZL 5D5MF 4F9PC 2JJSA 3RVWD 2GJ6A 2CRMA 1QSFA 4KMLB 3GMMB 4HC1L 3V0AC 3QWRA 2IAMB 1YQVH 1ZTXL 4J4PA 4DGYL 3VXQB 1IGFH 1ITCA 2OL3L 1N6VA 3O9WB 4KHXH 4UILL 5J11C 4LHUD 1C7SA 4LLUA 1SJHA 3MJ6A 3WJLA 2E7BA 1UM6L 2I60H 5L2KA 4XNXH 2NLJA 1HHGA 2XQYG 4OFVA 5DVOA 3SJVA 3WKML 4DZBA 5I16B 1ROWA 3SBWA 4FQQB 4KV5E 1UACH 1FBIL 2H1PH 4G5ZH 1ZT7B 3DLQR 4J3WA 5FV1L 5KVGL 3RVVC 4M7JH 3JTTA 5IB3A 5SWQB 2NCMA 3MOBH 2W9DH 3QIUD 3RIFK 5J89A 4NUJA 4JDTL 1NJ9A 4RMTA 4XP4L 1FGVH 4IRJA 5EC1A 4DKFL 2X4PB 2ITDB 2VISB 1EXUA 1GRWA 4LBEA 3HI6H 2YD6A 4HPOH 4BZ2L 3RNQB 1Z3GH 3O4LA 2V5RA 1RJLB 1B2WH 1R3KB 1CGYA 5LGHL 3MUY1 2FO1A 2KZ1B 1OT1A 4JG1L 4RSVA 1I8MA 4ENED 5F71A 4L3AA 1KTLA 1EVUA 5DZLA 2PR4L 4JFZL 3PWLA 3VFNB 1GPOL 1QHPA 1HXMA 4Q2ZB 3HE6C 4NGHL 3CSPA 1W72H 1NDGB 1S9KC 4UUJB 4Z5RB 1AD0A 4YDKH 3O2VL 4L5FH 1U8OA 4PJEE 3LKQA 4IRZH 4LKXB 3TBTA 2DMKA 1YECH 1KC5L 1ORQA 5DMIL 3VXRD 5EBWA 4RWYH 5C0JB 5DUMH 4YHMH 4KRMB 4KJPC 1Q94B 3IXTA 3S37L 1ZVSB 4MCZB 1OAXH 4JZJB 3WD5L 1WTLA 1YPZB 1A9BA 2HVJB 4JY6A 1B6UA 2UWEF 1PSKL 2KUTA 3RVUC 3U0PA 2HMID 5F3BB 5BVPH 2OXGA 3ZSTA 5D2LB 5DK3A 1T0MB 2C3GA 5E03A 5KG9A 4L9LA 3K8LA 3B9KD 4YHNA 2YA0A 1QVOB 2OZ4H 3NIDF 5DVNA 3BUYA 2QQNH 4WV1C 5C07D 5LAXB 3OG6B 3RWFA 4OD3H 2PF6A 3ROOB 3C60A 4PRPE 4NRXA 4C83A 2FNBA 2EYTB 2W9LA 4PJBB 4M7KL 2BVYA 3LHPH 4P99A 4EI5B 4AMKL 1AE6H 4Y19B 4PJ8C 5FHBH 3ZLQC 4V2BA 2GSGB 4HIHB 3O6FC 1O0VA 2XTJD 4UB0H 3RL1B 5ISZB 4Z7OF 5IBTL 3C08H 4M9OA 3BQUB 5CMAB 5DMKB 4P2RE 4MLSA 1G9EA 2BY0A 4XAKD 4C57C 5GGUB 3JV6B 3TJEH 3EYSH 5IIEA 3IB4A 3ROLA 5D9SB 2NXZC 4M6AA 1WAAE 2ZUYA 4QT5A 3BE1L 2VDLH 4U1LA 3HE7B 5LWYL 3TV3H 4HKBB 4DJMA 4J3TA 2IPTH 4HUWA 1MCIA 1XR9B 1QQDB 2BCKB 5MHSD 5FOJA 1VEOA 3MV8A 3WE6B 2VXQL 1JYWA 3IDXH 4FS0A 3HUJF 4XXCA 3CK0L 1H8SA 5E8DL 1JWMA 3D3VE 2CGRH 5KW9H 4U7MA 2VZUA 1EJOL 2GY7B 4W68A 3UO1L 1W8NA 3VXNB 5C0IA 3ARPA 4PRIE 5FOBA 5ALCL 1SQ2N 5BXFA 2AI0H 3MRKA 3NFNB 2CDEB 4JO4L 5C3LD 2XXCB 4Q6IC 2Q8BH 4CNIA 1L7TL 4PJ9D 1IKFL 4S1DC 5JMOC 4LHUA 3BP5B 4C58B 1JGEB 1XCTB 1XF5B 4G80B 2R39A 1BVKA 4ZUVB 3LN5A 3LS5H 1KBGH 4U3XA 3JWDL 1MH5A 1N6UA 4ETYA 5EWIH 2DKSA 5DURD 3WFEH 3EOBA 1T83A 3FCTA 5E9DD 2A6IB 2F53D 4NZTL 3DXAD 1NLDL 4XMLL 5HHPB 3QIUA 3MV9E 1U91A 4QRPE 1NCAH 2Y5TA 2CH8A 1TVHA 1N3NB 1KCVL 1F6LL 1SJEB 5EC2B 3G5YA 1F00I 3RA7H 4EDXB 1IGYA 4U3CA 3ARBC 3HHRB 4L4JA 3GHBL 2YWZA 1JHLL 4HGWB 4JRYD 4A6YA 5T3ZD 1PG7W 4RNRB 4RISH 4N90D 2GJ6B 2XZAH 1QSFB 2DLHA 4OV5A 4M5ZH 4NKIH 5AWNL 4F15C 2FB4H 1DFBL 4Y8AA 4LLUB 1SJHB 4POZC 3RJQB 1DUZA 2PYEE 1AGBA 1PJ9A 4KJQD 1WF5A 1TENA 5L2KB 3K2UL 1X5LA 1DQMH 2NLJB 1HHGB 3SJVB 4XXCC 4DZBB 1WBYA 3GJFA 5TGBA 1BWMA 3D39E 1U8NA 2APBA 2AXJA 2BVEA 2LE9A 3VXRA 1CDUA 1AH1A 1JE6A 1ERNA 1SBSH 2FCBA 5TDNA 1MAJA 4Q0XL 4KTDL 3BHBA 3JTTB 4X7EC 2AJUH 5IB3B 2DIAA 3T2PA 2OP4H 4PJ8B 4HMDA 4PJXE 4NUJB 1PYWA 1NJ9B 4NCC1 4RGMB 4IRJB 5EC1B 3VGBA 1X5XA 4HH8A 1EXUB 1DLFH 4LBEB 4MQTB 5D1QA 3O4LB 4G6AD 3WS6A 4FTVE 4X7CC 3K81A 4FXGA 2VWEC 4OGXH 3CFEA 2E7LC 1IC4L 1I8MB 5E2UL 1S3KL 4U49A 4IDJL 1KTLB 1RZJL 1R5VA 3L5IA 2PTTA 3PWLB 1HXMB 1XEDA 3ALPA 4J23A 1LEGA 2Q3ZA 2YD2A 4NO2A 3VXSD 5D7IF 1AD0B 4NM4H 1U8OB 4HAGA 3LKQB 2VLMD 3WFCH 2A6KA 3TBTB 3LRHA 5MI0B 3P2TA 4N0UA 1JBJA 3ZZ1A 1ORQB 4BFGA 5DDHA 3J7HA 4PFEA 5EBWB 3IXTB 1CD8A 1NSNL 5LCVH 3T77A 1QKZH 1OP5H 3IS0X 5I18L 4C56A 3OGOE 1A9BB 4JY6B 3BPLC 5B3JE 1J1PH 4M1DL 2D7TH 3OL2A 3U0PB 3BIAX 1N5YL 2R4SH 5KG9B 2R0KH 5D7LA 4L9LB 2A74A 2BXYA 4YHNB 3QUYD 3BUYB 5C0BA 3RWFB 3VMNA 3C60B 5GZOD 2ZP0T 1IAKA 3MV01 4OBSA 3RVTD 1ITBB 4JVUA 3AY4A 4LLWA 3PJSA 5HI3D 2HJFA 4NRXB 5IHLB 3TESA 4C83B 3WXVL 1ZKAA 2D4FA 4KH2A 4K94H 3VGAB 1M1SA 1BQUA 1UM5L 1WFNA 2PW1A 3UZEA 3U7WH 2W9EL 4FXKA 4JGUA 2G60H 5AZ2L 1ZMYA 3G04A 4FP8H 2HMIC 2VR4A 1QSEE 5F6IC 3ARTA 1AXTL 4PJ9A 3B9KC 2J88L 3MLZL 4OZIA 3F7RA 1H3VA 3DV6A 4PJ5E 3LEXA 4XC1H 3FO9A 5IIEB 4HV8B 3ROLB 1KB9J 4QT5B 2GSIA 3UTZA 4U1LB 3HRZA 2AJSL 5HSFA 4RZCA 3W0WE 2W0KA 2DQTH 3DVIA 4HUWB 3JSSA 4JFFA 1GGYA 3SOBL 3DXAA 4UV7H 1WZMA 2EE9A 3MV8B 4U6XA 3H3KA 4I3SL 2BZDA 2NYYD 2XTJC 2B1HL 2YEZA 4KKAD 4UV4L 3RWEA 5JO5A 3D69A 3QEQE 1JWMB 4EBQL 1R3IH 2X10A 1XAUA 2BVTA 2Y23A 2WUBH 2Y36H 2PCPA 4QLRA 4FQ2L 4APQD 2H45A 1NCCH 5C0IB 1KGCD 5FOBB 3QFDA 4Y16D 3NFSL 1ZANH 5BXFB 3IDUA 4HEME 3MRKB 4PJHE 3F58L 2E9WA 4PJEF 4Q9QL 1A8JH 4AEFA 4CNIB 1T1XA 1P7QD 4YX2H 4BQBA 4LHUB 1I85A 5CUSL 3OJ2C 4X6CA 2IG2L 1CD0A 3BKJL 3LV3A 3V8OA 1BF8A 4O58L 5FYJH 2VITA 3HC3L 4QWWD 4ZUSA 1BVKB 4K7PL 3LN5B 3RX8A 3LKRA 1P5UA 1MH5B 2E6PA 5EBLA 15C8H 3QBTB 1VFOA 2J12B 1MCWM 3T3MF 3EOBB 3VU2A 3FCTB 2NTFA 5CBEA 4XXDA 4GFTB 1MCJA 3QIUB 1I8KA 1U91B 5ALBH 2W07A 3B2VL 3BKMH 2Y5TB 3WNNA 1TVHB 1P84K 3G5YB 3PDGA 1AI1H 2E27L 2OCFD 3IAQA 1FNAA 5EZIH 4PJ9C 2EIDA 1IGYB 2FLBT 4O2EA 3IVKA 1YJDL 4A6YB 5I0DA 1DBJL 5IVNA 1C5CL 4OLXL 5E00A 4OV5B 2DQGL 3ARZA 3MJ7A 4PJ7E 2J1KA 4JY5L 5I0ZA 4Y4KC 3RVXC 4WJ5A 1CD9B 5J13C 1BFOA 1LHZA 1DUZB 1AGBB 3CLFL 4KVCH 2D0HA 3UMTA 4JO1L 5I1GH 3QHFL 4RGND 3WLBA 5I8OH 2VSCA 5CAYB 3VA6A 1WBYB 3GJFB 5TGBB 1RUPH 1CCZA 1U8NB 3WJJA 3VXRB 3MJ9A 5TDNB 1J1XH 4GW4A 3T04D 3BHBB 1WAAF 3NH7L 3P40A 4M8QA 4OJFH 4J8RA 1PYWB 4A6YH 3CFJA 3LIZH 5IVZA 5K9KA 1KIPA 1QA9A 3NZHH 1DBBL 4G8GA 4EXPX 4JFDD 4KPHH 1FYTD 5D1QB 1F3JA 1KCSH 2V5YA 2VZVA 2PKDA 4G8EA 4OF7A 4BH7A 4FXGB 4KJQC 3CFEB 4XCCH 3VD7A 3QUYA 4DKEL 2GKIA 1KFAL 4RMVA 1R5VB 2PTTB 1AC6A 4KK8D 2J6EA 4LEOA 3TH2T 4NP4H 1JYNA 4D0DA 1LEGB 5AD0A 4NO2B 1KENL 4X5WA 4RIRA 3IU4H 1KEMH 4YXLH 3BH9A 1VEPA 1A6WH 1CDJA 2Y4SA 1E6JH 5C7XH 2A6KB 1NCBL 2YPLE 4N0UB 4PD4K 3GSNA 4R97B 3SE9H 5DDHB 3VD9A 2VXVL 2XTJB 5C6TL 3RKDC 1ZHNA 1ZVYA 4U6VL 4I2XE 2XWJA 4G6AC 2YKLH 3T77B 4PBWD 4UTAH 4P3CL 3QXAA 3CXDH 4C56B 4ZO6A 1B88A 4IMKC 2FH8A 3BI9X 1GGCL 2Q76A 3BPNC 4U05A 4NN5C 1X5AA 4HHAA 5D7LB 2A74B 1O7SA 1N4XH 2ZUUA 3RU8L 2BY1A 1T7YA 1YYMH 5C0BB 2Y07L 4JQIH 2DWEA 4N9GA 4D8PA 2XA3A 1H5BA 1IAKB 4LLWB 3PJSB 2HJFB 4OTXH 4KDTA 4ZPVA 5DJ8A 4ACPA 4K3EL 4MDJA 3UJIL 1GL4B 4YJZL 4OSUH 3O3EA 2PW1B 3NTCH 3OF6D 1QBMH 1H3GA 1JNLH 2LU3A 4APQA 1OAUH 4FXKB 3G04B 4P3WA 3MLWL 4PRHD 4Y16A 5FM5O 4NC0B 1CICD 5E2VL 1VEMA 2F5AH 1FO0L 4PJ9B 4OZIB 12E8L 1U8KA 3QUYC 2WSKA 4FNLL 4HUXA 3IKKA 3KJ6H 4LU5H 3DV6B 5DVKA 3CMOH 3HS0A 3LEXB 3FO9B 2LU7A 2F54E 5HI3C 5DQDL 2GSIB 3UTZB 3KGRA 3NAAH 3HRZB 3L95A 5IV2A 4Z8FH 3GHEL 1LE5A 5DURB 4HK3N 4JFFB 3DXAB 5M94B 5KTEH 3KPLA 4U6XB 3GBLA 1HE7A 2X1XR 2YEZB 1E28A 3RWEB 1A7BA 2VKXA 3D69B 5JO5B 3IETA 3MRJA 3SDYH 2R1WA 2PCPB 5C9JA 4ZD3L 3GBNL 3QFDB 5I1IH 2IC2A 2IJ0C 1GVIA 2VZ3A 4M1CC 1ACZA 5I74B 1KJMA 3FFCD 3CSGA 4EVNA 1T1XB 3DECA 1UJTA 2CKBH 4X6CB 2WIIA 3LV3B 2XN9E 1I1AC 5E4EC 4FOMA 2VITB 4ZUSB 1F4XH 2NYYC 4XVTL 3KPOA 3LKRB 3F7VA 3RHWK 1QSVA 5BW7A 3MA7A 5EBLB 2JJUA 2E9BA 5F1KC 5B3JF 1IC7H 5D2NE 3ZKXC 5GXBB 4APQC 2NTFB 1N0XL 5DT1L 4XXDB 4LRNL 4Z7VA 5CBEB 3Q5YA 1I8KB 3OKNA 3A6OA 3ULUD 1AGEA 1PDKA 5T3ZH 3RUGE 4QHKI 4R90H 4OFDA 5A2LH 1V3LA 4O2EB 3IVKB 3N1PC 4DEPC 4AEIL 3DSFL 1FAIH 5E00B 1HYRC 4KUZH 4QWWC 2LV4A 3MJ7B 1ZVHA 3QDJE 4U1MA 3NCMA 2VDNH 4WJ5B 1PG7H 4KK9D 1BFOB 1C5BL 4LVOC 3WFHA 3V4PH 1AD9A 3WLBB 4G8IA 1NMBL 1Q0XL 4BYHA 5ADPL 5GGQH 1C1EH 3MGAA 3DGCR 5D93B 2GCYA 4UT7H 2J2ZA 4HJJL 4GW4B 2AJ3A 4M8QB 1RI8A 4J8RB 4H0HB 4H26A 3EDEA 4HWZA 3CFJB 5IVZB 5K9KB 3LH2H 1YY8A 1KIPB 1QA9B 4UZGA 1T89A 4G8GB 3LEYL 2DTMH 1F3JB 2AK4E 4KQ4H 3CLEL 3C8HA 2OR9L 4OF0A 1AJ7L 2AK1H 5HDBE 4BH7B 4PREA 2D4DA 1MI5D 3QUYB 3MNWA 3DX9A 3GSOA 1SY6L 4PS4L 2GFBA 3SPVA 1E4JA 1EHNA 1H8OA 5BW7C 4LEOB 5FHAL 4D0DB 4YBQD 5AD0B 3HAEG 4HWNA 1ZLVH 4X5WB 2ZCLH 4PJHF 4RIRB 1FFRA 2E7CA 4P5KA 4RFEA 1BJMA 3BH9B 2G75A 4JGJA 1RFDH 2GIYA 5CBAA 5K93A 4Z7QE 4PRHA 3GSNB 4FABH 3G5VA 2HKHL 1CICA 1UENA 3HC4L 1ZHNB 4G7YH 3IDNA 2XWJB 3A0OA 4FQCH 3ARFD 3V2AR 4ZSOA 2HT4D 3QXAB 1EHAA 4PJDE 2MPAL 5JXAH 2DMCA 4P2YA 3QUML 1VESA 2WLZA 2Q76B 1G84A 1S5IL 1UWEH 4KK8C 3FQTA 4HHAB 4HCRL 3KPMA 3V6OE 4PY8J 1X6NA 5KVMC 1AHWA 5CP3A 2RAMA 2J6EH 2DBLH 4KJWC 4DAGH 2DWEB 1ZEAL 4N9GB 4D8PB 1HSBA 5I30H 4RAUA 3KPSE 1H5BB 3S35H 1GXEA 3QFJE 4ZPVB 5DJ8B 5FGSA 4P46C 4M00A 3GSNH 4MDJB 5JIKA 4PJ7F 3O3EB 3AMLA 3E3QC 2MTPA 5IB1A 2R69H 4APQB 4XH2A 1J10A 4GG6A 1S8DA 2PUQT 3ZKMD 2L4OA 4Y16B 5KSBA 3CH8A 1OY3B 1S7QA 3I6LE 2KKQA 1HHKA 5EORL 3LDBB 5F9WB 4A2MA 3RPIA 3RIAK 3UYPA 2FZ3A 3K8MA 1NKOA 1JCKA 1U8KB 3DO7A 4HUXB 4UI2A 4F8TA 3G6DL 3S88H 3ARRA 3HS0B 5J57B 3K3QA 3D18A 5B39G 2VLKE 1VA9A 3EDKA 4M6NL 5DUBA 3L95B 2GI7A 4X7TA 5IV2B 3LRSA 4WW1A 1LE5B 1N6QH 4QOKE 1GAFH 5FGCE 2MCPL 1FGNH 3P3YA 4XPGH 1K8DA 4UT9H 4DOHB 2Q7NA 3KPLB 1IRAY 4RFNC 3TIDA 5KANI 4K3JL 1JGUL 4PRDA 4IEFB 4F9LA 1MY5A 1E28B 3IETB 3MRJB 4NIKB 1PKQA 4KK5D 1BPVA 4R8WL 2KH2B 1QYGH 5L6YL 1CLCA 2R1WB 4B50A 3BMVA 2EZ0C 5C9JB 3EDJA 5H35A 2MFNA 1JGVH 1U8PA 3BP7A 3OKEA 1KJMB 3D9AL 1X4YA 3ALXA 4EVNB 2FX7H 4YEEA 3MLYL 3AFLA 1WZ1H 2QADD 2VIRA 1FC2D 2DICA 5ESQA 3QAZC 3BPOB 4MA8L 4HXBH 2WIIB 4OZFG 4IHOA 4HJ0D 4RGNB 4NPYA 3ARGC 1JN6A 1BJ8A 2ZSWA 3O8XD 2EE3A 3KPOB 3KHQA 3F7VB 1G7JA 1KJ2L 3GBML 5DWUL 3MA7B 3QNYA 1CYGA 3OB0K 5K9QG 4P9HH 3AXLA 4LSSH 2ADJA 3U0WL 4Z7VB 5E8OA 1C16A 1YEHL 2NR6C 4X4ZA 3OKNB 4WDIA 1JPSL 1NEZA 2W38A 1AGEB 5DJXA 3KLAA 1J5OH 2EKSA 4AZ8A 3VDAA 1X5GA 2W60A 1XGYH 4NKQB 3I50L 1S7SA 3VG0H 4YFDB 3WNMA 2ARWA 4BSVA 3QP3A 2YRLA 5DC0A 1A6PA 3B83A 5DZNA 1U3YA 5JOFA 3OKLA 5KSAD 5IBLD 1V7ML 1MI5A 4GSDH 1OARH 2AJVH 2FJGA 2RHEA 1CR9H 1JUFA 4U1MB 2DL9A 3BRDA 5EU6D 1T2QL 2GUOA 3PG2A 1CTNA 1BM3L 2XXMB 3WFHB 1JI2A 3E2HC 4XBEH 1AD9B 3GZKA 4G8IB 4LLQA 5D1ZC 3MOAH 1CZ8H 2GCYB 2ILLA 4F2MA 4OGYH 4P0DA 2EDJA 4NZRH 2AJ3B 5E08H 3ARFA 2C1PA 1IKNC 1J0KA 2X42A 3DYPA 1T03L 4H26B 4HWZB 4LCUA 1EV2E 1YY8B 4BSJA 4FQLH 5CKGA 5DZOA 4QTIH 1GSMA 3DRQA 1OOAA 4ELME 4I9WE 4KK9C 1BQLH 4ZUUA 4S1RH 3SKJH 4MHHG 3IDYC 4PREB 4LPVA 5HHME 1YEDA 3MNWB 5I1EL 5JXED 1QSZA 4TVPE 3DX9B 3GSOB 5DGRA 3A6BH 2GFBB 4FFYH 1N64H 3SPVB 2CJUH 3SE8H 3K7UA 1FIEA 2XQBH 3FMGL 2AW2A 5C86A 5FUOL 1WFUA 1PLGH 1CE1L 4DGIL 1DQDL 3CSYA 1U6AL 4LKCA 4XAWH 3VFPA 5BQ7A 3P11L 1IGTA 4P5KB 4RFEB 3S7GA 2G75B 2PN5A 3P9LA 5E5UB 5CBAB 3QCVL 5A40E 5D6DC 1PBYA 1J11A 1OQXA 2VDRH 2YOCA 1WGOA 1A7OH 4PRHB 5C71A 1R5IA 3GMOA 3MNVA 4K7PX 2HT3C 3G5VB 1CICB 2EH7L 4JR9L 3UBXG 2NNAA 4HIJA 1B4JL 1LNUA 4GRWB 1P9MA 2IPKA 3IDNB 1FFQA 4LVHC 3SCMC 4TNWK 2ICWI 1RZFL 3FT4A 4LQFL 1DJSA 4FQHA 4ZSOB 1G0XA 1UWGL 5F44A 5CJ8A 4RBPK 3ZKND 3B9DA 5LJYH 2GY5A 3ISWA 2WINA 4MVBD 3RGHA 4IRSD 4GUPA 1NL0L 4Q97A 3MZTA 3FQTB 4TUJA 3KPMB 5GSRA 1AHWB 2D31B 1Q72H 3K2MC 3RUGF 1CXFA 2R0ZL 3R1GH 1NQBA 5CZKA 1OAYH 5GJTH 2XY2A 5JQ6H 2JKXA 3WFBH 4UINL 1NC4A 3HNSH 3PQYE 1LO2H 1HSBB 1WWWX 4RAUB 2NY7L 3JVGA 1KB5L 1EH9A 1UA6L 1T7VA 2QL1A 1Y18A 1DZBA 1JFQL 4EDWL 1CF8L 2I26N 1HYSD 1YEIH 4X9BA 2FBOJ 5IB1B 4JKMA 4XH2B 2XKNA 2FATH 2MKLC 4GG6B 3V5HA 1S8DB 3ZYOA 5KSBB 1YPZF 1XMWA 1S7QB 4WHYG 1HHKB 5DJAA 1DQLL 5DD5H 4O5LH 1DR9A 4ZAKD 3RPIB 3VFTA 4RFOL 2XWBA 2FZ3B 4M7ZC 2WWMD 3DO7B 3NACH 5CP3H 2JJWA 3L3IA 3D18B 4HT1L 3C2SA 5JNYA 3SKNA 3O8XA 5D7JC 5T5FL 4XVUD 2WUCH 5DUBB 2YUWA 3ULSA 5B4MD 4X7TB 3LRSB 1L7IH 4WW1B 1RU9H 1CVSC 1ZT1A 4NKOA 4PJBF 2A9NL 4E9LA 4JKLA 3GMLA 3TZVC 1H3PL 1BLNA 3UTSD 1K8DB 2DMBA 3TIDB 5HDBF 1K85A 3WDJA 4DVRL 3B2UD 1YNKL 4PRDB 4EUPA 2OX5A 4TPRH 1PKQB 4K8RD 2YRZA 3AREC 2KDGA 4Y5VC 3INUH 3SGKC 5H35B 1AO7D 4K3GA 4TTDC 1INDH 3SGDI 1B6DA 3TT1L 1U8PB 2BK8A 3U82B 3VH8G 1QOKA 3BP7B 3OKEB 1LO4L 4GXVH 1F45A 5EU6A 1T2JA 4MJIE 1RJYA 4O2CA 5EULV 3ARQA 4Z7QF 2VIRB 5ESQB 2Q8AL 3U1SH 4N1CA 1PZ5A 4IHOB 4GG8A 5C0ND 4NPYB 1U8JA 1JN6B 5DD3H 2ZSWB 5FXCH 1FIGH 3BXNA 1G7JB 4PJDF 3QNYB 3CXHJ 3ULUH 1W0WA 3IAPA 3AXLB 3S34H 3UYRL 3BP6A 3C6LD 2ADJB 3DO3A 5E8OB 3H2WA 1C16B 3C8KA 4YXHL 4WDIB 1NEZB 2DDQH 5DJXB 3KLAB 1HKFA 2EKSB 4W6YB 2ESVD 1OWRM 1AGFA 1RQ5A 2W60B 1S7SB 1A7RH 1OAQL 3ETBF 1YUHA 2QADC 2Q1EA 5CLTA 3EO1A 4BSVB 5E2TL 3UPCA 4OCLC 5JOFB 5J12B 3OKLB 3DPBA 5IT2H 1MI5B 5JXEA 4QGYA 3RQ3A 3BRFA 4X7DC 3LQAH 2FJGB 3B8YA 5E6ID 1JUFB 4TUKL 4DN3H 3VW3H 1JPTH 3BZDA 2GUOB 1QBLL 3MXWL 1QTYT 1CGSL 4OD1H 1DBMH 2AQ1A 3JBG7 3ZT6A 1V7NH 2AV7A 3FQNA 4LLQB 1AQDA 2NX5D 2BP3A 1RUKL 2APFA 3U48A 3SY0A 4Q9CA 1RZIA 1MREH 5IF0A 1T5WA 4F2MB 1ZOXA 4NBYB 3ARFB 2C1PB 1K3IA 4TNWF 2WP3T 5IBLC 5KSAC 3X17A 2JELL 1KB9K 4LCUB 4G7VL 2UZIL 5F9JA 1T0NA 4PJFA 2RJMA 3DRQB 4IRSA 1I9JL 4LLYA 5F7MC 3U7YH 3FO2A 3ABZA 1JZ4A 3WSQH 1N7ML 4ZUUB 5KZCD 2CO6B 4HWBL 3H9SA 5EU5A 4AH2A 4EN3A 5I73C 3SO5A 1V3JA 1YEDB 5HHVL 4H20L 4NN7B 2DI8A 2ICWA 4YHLH 3T3PE 4P5MA 1BREA 4QRRE 4LSVH 4RRPG 3S36L 1A7NL 1VB9A 3WIHL 1MFEH 3CSYB 3ZSSA 4LKCB 3VFPB 5BQ7B 3VDBA 1IGTB 1KTDA 3LD8B 1CIDA 2QV2A 3P9LB 2F58H 3T4YA 4J2XA 1R5IB 3GMOB 3MNVB 5C1MB 4F37K 4F80A 2VUYA 2NNAB 1G6RL 4HIJB 1LNUB 4F7MA 5IMLA 3AU1A 1I9RH 2IPKB 4HH9A 4N9OB 4YFLF 5I76A 3FT4B 4QXWA 4FQHB 4GXUN 5JW3H 3C09B 2WINB 4U7SA 3QHZL 1K2DA 4OFIA 4GUPB 3NCJH 1INEH 1A7QL 3CX2A 3KYKH 4XNZC 5D1XC 4TUJB 2V7HA 5GSRB 4MB3A 2B2XL 4NNPL 4X5LA 4OFYA 4LP4A 2CQVA 3QWQB 3O3BA 4U0RB 5IMMA 1NC4B 5F88A 3SQOL 2VXTL 3UTSA 3KLHC 1YY9D 4YE4H 1Y18B 1AGCA 3GJFK 1KIQA 2JIXD 2K9UA 1KUMA 1OPGH 2E5EA 4I8DA 2V2XA 4FQIH 4MX7A 1MRFH 1BD2D 5D5MA 1T0PB 1RZ7L 1SJVA 2R9HC 4J12A 3E8UH 2XKNB 4I13B 3V5HB 1AO7A 2VZSA 4Z7NE 3QSKB 1JHKL 1TQBC 3MACH 4HUUA 4IRSC 3CIQA 5DJAB 2CDFA 3VFTB 2P8PA 1FORH 3BD3A 5ANMA 2XWBB 2BHUA 2QADB 1FSKC 4MD4A 4P2QA 4Z0BH 5HVGB 3REVA 3BRGC 3GI9L 4I0PC 4Q7DA 3QI9C 1MCNA 3L3IB 1U3JA 5MP6H 5JNYB 3SKNB 3EDFA 3X3FL 1JNNH 3O8XB 3EJZD 1A5FL 1A1NA 3ULSB 1RURH 1HYSC 2DQHH 3CJJA 1ZT1B 4NKOB 1HIMH 4DUWA 4HUMB 3GMLB 4PLJC 3C6LA 4OLUL 4ELMF 1TCRA 3WIIL 1BLNB 2FIRT 4R4ND 3G6AA 1EDQA 2J8OA 2ZPKH 4EUPB 1FFNA 2ESVA 5LQBH 4ZAKC 5CS7A 4U1JA 1QLFA 1IZKA 3QQ4A 5IEKA 3UJJH 2WWMC 25C8L 2VLJE 3ELAT 4YZFE 3VXMA 3PWNA 1ZA3A 1NGQH 2EDFA 3FHQA 3BGFC 1EAPA 3BH8A 3QT2A 4M3JA 1G0YR 4XVUC 1BECA 1G0DA 1H15A 5EU6B 2WIMA 4U1GC 1RJYB 2I9LA 4O2CB 4B41A 5B4MC 4H88H 3QDGE 3MCLL 4OZGE 3SE4A 2F74A 3RWJA 5GSVA 5FECA 1PZ5B 1W0YT 4GG8B 5F7HA 5D6CA 3QRGH 1U8JB 3IYLW 2MQCA 2ZJSL 3B2UC 4QGTA 3RY6A 1KNOA 3BXNB 3ZE1F 5CZVH 4Y4HC 3FQWA 4FMKA 4K8RC 5GS0D 1W0WB 1X5JA 2EIZA 1KF9B 1LILA 4XMKH 3BP6B 1DSFH 1WWCA 3C8KB 1B0RA 3KXFE 5TE4H 5BMFL 3HNVH 4X0KA 4LSPH 1WLHA 1KSRA 1N8ZA 5FUCE 1BIHA 1AGFB 4TVPL 5T1LD 3RX5A 1UKSA 4PUBH 1YUHB 1EO8H 3EO1B 1NAMA 1TMCB 3U4AA 5C92A 1YEGL 4XPTL 5C0NC 3A67L 2ICES 3ZT5A 1WV7T 5AYQA 2NZ9D 1D6VL 3UTPD 1CLOH 3RL2A 4DCQA 3IFLL 5DD6A 3EJYD 2J5LB 4F57L 5EUOE 3T0EE 5F7LB 4WHDA 1YYLH 5E2WH 1LDPL 3PUCA 2X09A 2HFGL 1MCOL 2AV7B 3UTTA 3FQNB 3O3DA 3HNTH 4XVSH 1AQDB 1MFBH 3BESR 1F4HA 3SY0B 4YDLC 4H8WH 1RZIB 2ICWJ 1BMGA 4AEHH 3LEVL 2EC8A 4F37F 3BT2H 1L0QA 5C0AE 5IF0B 1T5WB 4WI6A 3MODL 4HDIA 3V52H 4XNMA 1KACB 5GISL 4CN6A 5I71C 2WANA 4XPAH 4QY8A 1SEQL 2DM4A 5DRNA 5F9JB 3MXVL 1CDGA 5E6IC 2H2PD 1T0NB 4PJFB 4MJ4A 3GNML 5A2IH 1TQBB 4IRSB 1E4XL 4LLYB 3LAFA 1BBDL 3FO2B 4TRPL 4QYOA 3MLSH 3H9SB 5EU5B 4AH2B 3SE4C 3HMXA 4EN3B 4Y1AE 4NFCA 5JOPE 1BFVL 1FG9C 5IVXF 3GKZA 2AJYL 4KFZC 2ICWB 4N5ED 4P5MB 3RY6C 3FN0L 3HUJA 3BOVA 5FO9A 5TQ2H 4HF5L 5EU7C 2YSSA 5AAMA 2JIXA 3T08A 1MAML 3EW3B 1FVCA 1X3DA 5I1AA 5L7XL 1BEYH 4PTTA 3V5KA 1KTDB 1CLZH 2BNQE 4JPVH 1BD2A 1DN2A 1UG9A 5DLML 4TUOA 1RAMA 2YHGA 2D9CA 1JYXA 2DIBA 1ZLWK 2ZNXA 4JCMA 4YNYA 4CDHA 1GZPA 3T4YB 2X4TA 4OCYH 4NQXA 5GGTL 1A0QL 2JE8A 4F7MB 5SWSE 5IMLB 3AU1B 3UZVB 4HEPG 3O6MH 4GMTH 4HH9B 3GSRA 3WHE0 5I76B 3K8KA 4BK5A 1KV3A 2VERN 2VXSL 3GFUA 4NYLA 2VABA 4GAJL 5CJOH 5D7KD 4OF8A 3NOIA 1RZKC 1K2DB 4LCCC 1YC8A 5E7BA 2V7HB 5I1HH 2EC9T 3F5WA 4P9MH 5IESL 4JM2C 3NABL 5T33L 4YGVA 4U33A 3O3BB 5IMMB 5F88B 1NUFA 3BD5A 5GGVL 3ZHLA 3UTSB 2G5RA 1UWXK 2HWZH 4IIQA 4OUOA 3ILQD 4ISVA 3W82A 1AGCB 1KIQB 5BV7C 1YC7A 1UYWH 3VFGL 1EHLL 2V2XB 3ZDYF 1KCUL 4MX7B 2ZG1A 4JHWL 5HYJE 2F19H 4LIQE 5D5MB 2C3HA 5EPMA 5C6WH 4XWOD 5DHYA 4C54A 1AO7B 3G6JE 4HUUB 1QRND 5KS9E 1CS6A 4MNQD 1X5ZA 2CDFB 4NQEE 3C8DA 4H25A 4G6FB 4X80H 3TN0A 3N50A 2P8PB 3OAYH 5ANMB 4ONFL 5DF0A 3TJHD 3N9GL 3THML 4MD4B 4P2QB 5F96H 3REVB 3DYMA 4NZUL 1BOYA 1IGIL 3ZHDA 4EJ1C 4MA7L 3DGGA 3UP1A 1A1NB 5I8KL 2XPGA 4R0LA 1VFAA 3QIBD 4WFEE 1ODAA 5D7SH 3C6LB 32C2A 4K8RH 1TCRB 5F70A 2D7MA 4D3CH 4EOWH 3KVQA 3G6AB 3KPRE 4XMPH 3PGCA 3L5JA 4G6KL 5EN2A 1FFNB 2ESVB 4U1JB 4I3RH 3NCYP 1QLFB 3QQ4B 4JFZH 5IEKB 1QFUL 2W91A 4AM0A 3OKMA 1QR1A 2R8SL 3HG1A 4HUNB 5HJ3A 2GW5A 3QXTA 3VXMB 1AXSA 3PWNB 1ZA3B 3O2VH 4LCWE 4HFUL 3NIGE 1EAPB 3BH8B 5JZ7D 2WV3A 3EJZC 1H15B 1KC5H 5D7IA 2I9LB 2IFFH 4UTBH 3SGDH 5GGSY 3MBXL 3PWJA 4ALAH 1AP2A 1Q38A 2F74B 5GSVB 3RWJB 5FECB 5F9OL 1A2YA 3AS1A 5D6CB 4IJ3B 4R4NC 3S37H 2NY5L 4P2RD 4TULH 5BOZG 5GRVL 3WD5H 4ZO7A 1KNOB 2AEPL 2A77L 4EI6A 2BJMH 1BQSA 1PSKH 2B0SL 2WBJD 3PHSA 3FQWB 1ZE3C 4Z95H 2EIZB 2FX9L 1X5FA 3SDXF 3WN5A 4FZEL 2PXYA 2FH6A 3ULVF 3H9YA 2P5WE 1KJVA 3QIWD 1B0RB 4MXWL 3RAJH 4X0KB 1N8ZB 4LCYA 4XP5L 2HKFL 1NAMB 5GPRA 4CVWA 3OV6A 1CFQA 4M7KH 4PJGE 3KPNA 1IAII 4U0QB 3LS4L 4WHTA 3VGGA 4PRID 3OWEA 4DCQB 3RL2B 3VD5A 4PGBA 4YHZL 2V2TA 2EO9A 5DD6B 3AM8C 2VDPL 5GS0C 5JR1H 5FGBC 5I1KL 4Z7NF 3B5GA 3UTTB 4U3HA 3O3DB 1IL1A 4KRPD 2DKUA 3IFNH 3WEXA 4HDIB 3BE1H 4XNMB 2A6JA 1XF2A 2CUMA 3EOYG 1PY4A 1NAMH 4UT6L 4QY8B 1OSZA 3RZWA 3X3GL 1IVLA 5DRNB 5C0DA 4GS7B 5L0QB 3MV9D 1BJ1J 3RWDA 1V8HA 1WWBX 4QYOB 1RZKH 2EDRA 4YHYC 2GT9A 5HGBA 1CWVA 1QEWA 3MNZA 1BFSA 1TZGH 4JM4H 4Q6YA 2B20A 1IBGH 4X98A 5IWLC 4LSTL 1MWAL 3DBXA 3ZDXE 1MPAL 3N1QC 2W92A 5EZLA 2YD1A 5L88H 1NUNB 1UCTA 3CC5A 3HUJB 5FO9B 5ALCH 4AY0A 3OAZK 4FFWD 4KI5C 1IC5H 1NMAH 2YSSB 4YZFF 4X5XA 3MUGA 1F58L 2JIXB 3VE0A 1FVCB 5I1AB 2MOVA 4PTTB 3V5KB 2VJXA 1D5IL 1BD2B 2O5XL 4HZLA 1IKFH 2EH8L 2ATPA 4QTHA 4TUOB 1TIUA 4XHJD 3ES6A 1RJZA 5BV7H 5CCKL 3V6ZA 4YNYB 1GZPB 3DVGA 4KROD 2H2PC 4PBVC 4OZGF 4PJEA 2X4TB 1F11A 1QACA 1NC2A 4NQXB 3ORJA 5I19H 1CXKA 3VG9C 2HJKA 1TJHL 2IQ9L 4GAGH 4XNUH 3GSRB 3D39D 2ZCKL 2X05A 3V6FA 4NOBA 2PO6D 4JE4B 4J6RH 4NYLB 3FRPG 1G9NC 5LBSL 4D9RD 1LEIA 2VABB 3HMXH 3QQNA 3D25A 4N5EC 4ODHL 1GOHA 2JF1A 4NZTH 3F12A 1NLDH 2C3WA 3MUJA 4XMLH 5EOCH 4Y19E 1XIWD 1J0JA 4URTB 2VAAA 2F9BT 2UUDH 4UMGA 4HXAL 1KCVH 5DA0B 3F5WB 3J8F7 4ZFGH 4YHKH 4YGVB 4G6JH 4FTVD 5KVFH 2OI9B 3G9VA 3OAUL 1QFWL 2NY3D 4HS8H 4IIQB 3S3JA 1IC1A 1D3CA 4ISVB 3GSVA 2R1XA 4ZXBC 3U30C 4AT6A 3RDTC 3PF2A 5EPMB 4XP9L 2DD8L 1SM3H 3WO3B 5EUOF 4ZPTA 3WFZA 5DHYB 4RGOH 1UQSA 4NHCH 1D6EA 4H25B 3TN0B 4OLYH 4Y7MA 1T20A 1WBXA 1MCEA 2MSPA 4OLEA 2VZTA 1Z5LA 5IB2A 1Z9LA 1FFOA 2J8HA 5DGQA 4P2RA 1T3FA 4ODVH 3DGGB 4D9QD 3FO0H 5HGHA 3STLA 2XPGB 4G9FE 2WBJA 4R0LB 2NXYB 5HDLA 1VFAB 1WAAA 3FONA 32C2B 4XWOC 1F8TL 3PGCB 3TVMD 1PW3A 2R2BA 3F62A 3SKUD 5E2UH 5EN2B 3S36X 5JPMA 1S3KH 3IS1X 5FCUL 3FQUA 3C2AL 2BMKA 3P30H 4GLRI 4AM0B 1MY7A 3MA9L 3OKMB 5EZOL 1QR1B 3HG1B 5HJ3B 3D3VA 1FH5L 1AXSB 4Y2DD 1MNUL 1KG0A 3N1GC 1JZ5A 2Z8WC 3D85D 4PRIA 2DN7A 1AQKH 4YUEL 5D8JH 4M62H 2IBZX 1S9YA 1R6VA 2LAGB 5D7IB 2NY0D 4JKWA 3QIBC 1QSED 5ADOH 3PWJB 5HYQA 1AP2B 2N4IA 1A2YB 1KXQE 4R2GD 3B5TA 3PHOA 3QXUA 5GS0H 3JV5A 5I1JH 1SJXA 4UQ3A 2MJWA 4M43L 5I18H 3WO4C 4EI6B 3QB7C 1WVZA 1MQKL 5GRJL 1NAKL 5CEXA 4POUB 3KYAA 5HDQH 3OHXA 5HYIA 4OLVL 3WN5B 2H8PA 2DRUA 2DJ4A 2PXYB 4RDQF 3VI3E 4PB9L 1KJVB 5AZEH 1GC1C 1PVHA 4M5YL 2ZSVA 2LTQC 4LCYB 1CFSA 3W5MA 4JDVA 4OQTH 5C9KA 3MV9A 4QRPA 5L2KE 3FO1A 3UROR 1GIGL 3WXVH 2P8LA 4ONOA 2EICA 3QEQD 3BEVA 1CFQB 1RIUL 3KPNB 4GMSL 1UM5H 4K9EC 2E9IA 2HJLA 4WHTB 4RDQG 2ZUTA 4PYHA 4PGBB 2V2TB 2XZQH 1LGVA 3MLRL 1U42A 5KS9F 1RZGA 1J12A 3MLZH 2AJXL 3QIWC 1JNHA 1IL1B 4PLOB 1ZLSH 1NGPL 4Q74A 1UFUA 4YO0A 4MA3A 4OT1L 4NUGL 3WEXB 2DQIH 2HA1A 3VRIA 3D39A 2A6JB 1QZ1A 2DBJA 3C87A 3I9GL 1XF2B 2AJSH 3GM8A 1HWGB 4NO0D 4X6FA 1OSZB 5C0DB 1VGEH 3O45A 4PJXA 1ADQL 4BQ9A 1P4IL 3RWDB 5TJWK 4ZTOH 2XG4A 2GT9B 5HGBB 3MNZB 1QEWB 4X98B 3MV7D 2AS5M 4LRIA 1R5WA 1OGAD 3HZVA 3DBXB 1IAIM 5EZLB 3HRPA 4FTVA 3CC5B 4OGAD 1TJIL 1GJIA 4KRPC 2X5PA 4X5XB 3Q1SL 3MUGB 5FUZH 3MRLA 3V4VL 3VE0B 3NIGF 1RVFL 3P4LA 1MJJA 3QCTL 4Z6AT 2GTWA 1G9ML 4HZLB 4QTHB 2ATPB 2YA2A 4WFGE 1KCRH 3ES6B 1RJZB 2RCSH 3V6ZB 1KYOK 2IG2H 3DVGB 4PJEB 4O58H 1F11B 1NC2B 1T7WA 3HC3H 1CBVL 4K7PH 2HJKB 4ZFZA 3UTQA 4HGMA 1OD7A 3V6FB 4ZOCA 2YRPA 1LEIB 2QR0A 3D25B 4LSRL 4JGMA 4Y5YA 4YWGH 4LNVA 7CGTA 3CXHK 1JMZA 3F12B 3LMJL 5FFLA 1S78D 4FFWC 3MLVL 2VAAB 3OSKA 3B2VH 3Q6GL 4PV8A 1RMFH 3DMMD 4H1LG 3D5OF 4JO2H 4KKNA 5K9QI 1CL7L 5DO2C 4XHJC 5KJRH 1Z0MA 1YQVL 2B5IB 3VFRA 1IGFL 1ZAGA 3RGVD 1S7VA 2FSEA 4PJGF 3TVMA 4OLXH 1RV6X 2DQGH 3GSVB 3WO4B 3O4OC 2R1XB 3S5LG 5I8EA 5DR5H 4AT6B 1NUGA 2I60L 3TBYA 4XNXL 4LEXH 1IM9D 4GRWF 1MCBA 2PO6C 3FN9A 1WZKA 4I3GA 4CJ0A 5TPWH 4ZPTB 1UACL 1WQVT 2H1PL 1EZVX 4LMQI 4Y2DA 1UQSB 2KQMA 3ARSA 1XIWC 5FYJE 2YUVA 4M7JL 4V1DD 1BP3B 1OAKL 1D6EB 2YPLD 3D85A 4OCRL 1F2XK 2W9DL 5F1NA 5DJYA 1T20B 4DFIA 4P4KC 3ZMRA 3ZYZA 4NQDE 1FGVL 1WBXB 3UYOD 1J1OL 1QSEA 2EE6A 1Z5LB 2ZG2A 4GOSA 3HI6L 5IB2B 3NH7H 1FFOB 4HPOL 1M05A 1Z3GL 5D96B 4P2RB 1B2WL 2R1YA 1T3FB 5IJKC 1MJ8L 3STLB 1UH4A 5HGHB 1DBBH 2WBJB 4NBZB 4NRZA 3FONB 3WCYA 3BP4A 3O3AA 1D5ZA 3IFPA 3W0WA 3HAEA 1W72L 3HCVB 3QUMA 5KAQF 3O41A 2R2BB 4GG6F 4YDKL 4L5FL 5JPMB 3WDHA 3VI4E 2VWEE 3FQUB 1KOAA 5GIRA 1GC1H 2YMXH 4MS8C 1A3RH 4IRZL 2BMKB 1JF1A 4U1KA 1MCSA 1YECL 5B8CA 3QEQA 2F8OA 3D3VB 4Z7WE 2OK0H 4MHHI 4B5EA 4RWYL 3AVEA 5DUML 1KG0B 2O26U 4PRIB 3DVNA 1QR4A 4JRXD 2V5SA 4K9EH 1OAXL 1S9YB 4PJHA 5KAQG 2IPUK 2EIEA 2VXVH 4PB0H 5HYQB 5F9DC 5HI4C 4U6VH 3EFDH 5GS2D 1U2HA 5BVPL 3PHOB 1ZS8A 4FQJL 4UQ3B 5LKNA 5D72L 5CEXB 2F54D 3FTGA 3OHXB 3UBXI 2H8PB 4KXZI 3ZDZE 3OJVC 5ID0A 2OM5A 3SDAD 1I7TA 3DOSA 4Y5XC 2BOBA 3HN3A 1GGBL 5C0RL 1OTTC 1QFWM 2VO5A 4NO0A 4Y2DC 1U9KA 2C26A 3RU8H 2Z31C 5AYUL 4I1NB 5SWZE 2Y07H 2NTSP 2ZSVB 1CFSB 1XGQA 4JDVB 1AE6L 2X9WA 3MV9B 5FHBL 4YDIH 4QRPB 4XTRC 3O9WD 4XP1H 2NY0C 3FO1B 2P8LB 2AP2A 3BEVB 4NNYA 3UJIH 3EZJB 3C5ZD 4UB0L 5MEOA 2HJLB 5DRWA 2IH3A 2MKWA 3C08L 2RB8A 5E2VH 1IAIH 4PJ7A 4MAYD 3EYSL 3W11C 5B39A 4MB5A 4QEGA 1RZGB 2R4RH 4YR6A 2BRRH 12E8H 4MNHA 4N1EA 2VDLL 3JUZA 4OKDA 1JNHB 2H2SD 1MAKA 3UJTH 1P5VA 2FD6H 4HUKB 4KROB 3TV3L 3SO3B 1XF4A 4OLZH 5A2JH 4RMUA 2BSTA 5C07E 2CLVA 4YO0B 1P84J 3TO2A 3ZE2E 3VRIB 3D39B 3IDXL 1EIBA 1CIUA 1F4AA 4X6FB 4BQCA 1PEWA 5KW9L 2CGRL 2DQDL 3VFUA 5GQBA 3O45B 4PJXB 4F3FA 1KJ2A 4JFPA 1Y6NR 2GAZA 1IE5A 1UXSA 3MLUH 4DUVA 2Z4QA 3DMMA 5LXGH 5CEYA 3UAJD 3GK8H 1R5WB 2VLLA 2XTJE 3HZVB 3SDCC 1R3JA 5E6YA 1NGYA 5EIIA 2Q8BL 4FTVB 2DQUH 1YMME 2W1NA 3RGVA 2NY3B 5HHXH 3LKNA 4JKPH 4OZFA 3MRLB 4UOW1 4AIOA 1MJJB 2GTWB 1DN0A 3BO8A 3SDDA 4TSCH 1GOFA 3K1KC 3LS5L 5LGJA 4G9DA 5EWIL 3EO9H 5F8QC 1WWAX 4NZJA 3B6SA 3WFEL 1OTUC 4GBXD 4ONGL 2YPLA 2VOTA 2ZUQC 4ZFZB 5MHSE 3UTQB 1NCAL 1A9EA 2QR0B 4I2XA 5DVLA 2WNGA 3RA7L 2FBJH 4Y5YB 4W4OC 2L7UA 1FV1A 1DANT 5GS3A 1LK3H 4PV8B 3CZFA 2ZUXA 1VFMA 3GRWA 2XZAL 3N1FC 5SV3A 3CFKA 1TITA 4JFQA 3RWHA 1QNZH 4M5ZL 3QDME 4NKIL 1TTFA 3VFRB 4AEIH 1F97A 3DSFH 1LP9E 1X6LA 1S7VB 2FSEB 3TVMB 1VGKA 1QLEL 2DLFH 1NLBL 5BZDA 4LOUD 2CD0A 5ISZD 3O6KH 5I8EB 4PD4J 3TBYB 1DQML 4N0YH 1JZ8A 5A3ID 2O5YH 5TQ0H 5J3HC 1JYVA 3L9RA 1FL6A 4Y2DB 1SBSL 1S78C 4CN4A 4G43A 1CXLA 5E9DE 3D85B 3BEWA 2F53E 5F1NB 4CJ1A 4K55A 2OP4L 2FEEL 3OX8A 5DJYB 4L8SA 2NY0B 5DVMA 2X4NA 1QSEB 2OQJA 1DLFL 3PGFH 2HH0H 2EECA 1JL8A 4R2GB 1DQQA 4PIRF 1M05B 3KJ4C 2XT1B 2R1YB 4WU7A 1T2XA 4JRYE 3DYOA 4JZOA 1KN4L 3GIVA 1J88A 2F54A 2ICEA 5I1DA 1MFCH 4NRZB 2DQJH 3BP4B 1Z2KA 4YDVA 4PR5A 3O3AB 1D5ZB 3SDAA 3IFPB 2IPUG 3T4AA 3W0WB 3HAEB 4W6XB 4LLAA 3QUMB 5K9JH 2DQEH 3O41B 2XKUA 4NM4L 4R96A 5GHWH 1TNNA 3KPSD 5GIRB 1G7MA 4CMHC 3QFJD 1JF1B 1OT2A 4U1KB 2I24N 4XC3H 3WFCL 1CFBA 1JP5A 5FHAH 2ADIA 1I1YA 1A47A 5B8CB 3GSXA 3QEQB 2MHAA 4D2NA 3UBXA 3FAXA 2BNUA 3C5ZA 3KYNA 4W6WB 1KB5A 5HYEA 3GJEA 5LCVL 3DVNB 1I7UA 1QKZL 1YZZA 1IEAA 3MTRA 4LSQH 4M6MH 5FDWA 4PJHB 3F7YA 4K3DL 1J1PL 1MCQA 4MAYA 2D7TL 4I77H 1X4XA 4JLRA 3SE3C 2R4SL 1ZS8B 1U93A 2NY4D 4JFEE 1NCWH 3UPRA 3N85L 4XVJH 4NN6C 2IF7A 1I75A 2R0KL 2XN9A 5F7DA 4LARH 2MPAH 3HAEH 4JG0L 4PGZA 2R15A 5DRZA 2HTLD 3FTGB 2VLKD 4F7CA 2CSPA 5EIVA 5ID0B 4M4PA 3CNKA 2Q87A 1I7TB 2BOBB 4NO0B 1D9KC 4ORZC 5DA4A 4K94L 3VXSE 5E94A 1CQYA 3OR7A 1XGQB 3NIFE 4J4PD 3HZYA 5LVEA 3CZJA 4L8SC 3RUGA 2VLME 2HLFD 4R4BA 1JGDA 4NNYB 1BIIA 4JHAH 4WU5A 3CCHA 5CSBA 4EUPG 5C0CE 5GRYA 2AXFA 2B8OT 5MEOB 1CDIA 3JXAA 2EDDA 2IH3B 5DRWB 4YFLI 3SJVD 1MF2H 2Y06H 2BVPA 3T0VA 4AJ0A 4PYGA 5HXMA 5F97E 4PJ7B 4XC1L 3QDJA 1LVEA 4TNVK 5B39B 4QHUA 4WW2F 4YR6B 1J0YA 2CUHA 4MNHB 2EEAA 2EKJA 1XF4B 2AGJL 4J3SA 2IAMC 3U4BH 2BSTB 2B4CH 1MSPA 2DQTL 2W0PA 4GBXA 4RMWA 3O9WC 1P4LA 3O4LD 2CLVB 2PNDA 4UV7L 3TO2B 1ZGLA 3VFVA 3C9NA 4M6NH 1ACYH 5IFAH 5T1DH 2SEBA 3VD4A 4WI8A 3VFUB 1LO3H 1R3IL 2MCPH 4F3FB 2WUBL 2Y36L 4R4FH 1KJ2B 2J8UE 4JFPB 2GAZB 1NCCL 5HPMA 1UXSB 3GSWA 2Z4QB 3DMMB 1ZANL 5CEYB 3VH8A 5DJDA 1TDQA 2AK4A 3VI4F 2VLLB 4WEMB 1R3JB 1JRHI 1NGYB 5EIIB 4MSWA 1CK0L 2H2SC 4NJAH 3RGVB 3KJ4B 3HR5A 1T04A 3LKNB 4Z7WF 4OZFB 2EE2A 1HH9A 3D9AH 5FYJL 2QJDA 1DN0B 3BO8B 3MLYH 4XPHL 3SDDB 4YBLB 4G9DB 2EDYA 15C8L 4NWUL 3R8QA 4KHTH 2QLVB 3B6SB 1QLRA 3B5HA 2YPLB 1SYVA 2JJTC 5FYJU 5ALBL 4ZMAT 3BKML 1A9EB 1JPST 5EO0A 1LMKA 4HS3A 4R7DA 4I2XB 5BO1L 5EZIL 3P0VL 3C60D 3ZDZF 1YEHH 2V17L 1OM3H 5DHXB 4PJDA 1FV1B 1JPSH 3CZFB 1KGCE 4JPWH 1X5HA 4I5BA 1PQZA 1EUUA 1FRGH 2FECI 3CFKB 4OZFH 4PJAE 3RWHB 4JFQB 4I9WD 4XNYH 1O7VA 4JZJC 3V6OA 4BZ1H 2APVA 1OHQA 5HHMD 2WWKT 4TVPD 4NN6B 1DE4A 1VGKB 2I9TA 5BZDB 4KVCL 2D7NA 3KPSA 2QSCL 3QUZA 5I8OL 4HWBA 1LWRA 2J4WL 1K9TA 2Z91A 3QFJA 2EDNA 4YHOH 4JQXA 5GRZA 1RUPL 3L9RB 2BSED 1FL6B 4J3VA 4OJFL 4G43B 3WIHA 3I84A 1UEMA 3BEWB 3OX8B 1RIHH 4EI5C 4A6YL 4L8SB 3LIZL 4LHQB 5CWSA 2X4NB 3PWPE 2OQJB 3NZHL 4KI1A 3GRWH 4GKZA 4KPHL 1DQQB 1UKTA 1KCSL 1E4XI 3ZE2F 5JIHA 1R3LA 3CU7A 4WU7B 4GRLD 1EFXD 1H3UA 4XCCL 4YPJA 4JZOB 1G6RA 3TP4A 3GIVB 3MPCA 2F54B 3WDIA 2VLKA 2NY1D 2Z9TA 2ICEB 5I1DB 3BQUC 3QO0A 3BDYH 4RRPA 2COQA 5GZND 5BVJA 4YDVB 4PR5B 3SDAB 3T4AB 4M93C 4NP4L 2IBBA 4U4BA 4LCIH 4PLNC 4PRAA 1QBBA 2B7DT 1MCPH 1ORSA 3IU4L 3PQYD 4R96B 1KEML 4O2FA 4YXLL 3QH3A 1H3WM 4JVWA 1A6WL 3L7FA 1G7MB 1X9QA 5JUEL 3FMGH 3HE7C 2D3VA 5CD5D 2ADIB 1I1YB 3GSXB 2MHAB 4DGIH 1Z9SA 3WS3A 2E6QA 3SE9L 3UBXB 5CINH 1BQHG 2BNUB 3C5ZB 1IFHH 3KYNB 1KB5B 5GS2H 3GJEB 1OP9A 1I7UB 1IEAB 4UTAL 2FWOA 5FDWB 4YXKH 1JGLH 3F7YB 1S7TA 4KJYA 4TNVF 4MAYB 5JDJA 1MELA 1B90A 3G9AB 4GH7B 1E4WL 2WBKA 4JLRB 4WTWA 5CEZE 1U93B 4JFDE 1FYTE 4LQFH 3UPRB 1U3ZA 2XN9B 5F7DB 2XZZA 2VZ1A 3LQZA 5DRZB 1N4XL 4PGDA 5I9QB 1K6QL 1YYML 2JJVA 4F7CB 4JQIL 1NL0H 3M45A 1QP1A 1NGWA 3CD4A 5K33A 3QXVA 1J8KA 2W0LA 4XGZA 5E94B 1CGUA 4UINH 3OR7B 4JB9H 1J8HE 4KXZH 4OSUL 3NTCL 3HZYB 2IANE 3LPWA 2HFEA 2NY7H 5E99H 1KB5H 1P7KA 1JNLL 4I18A 3RUGB 4I48A 1LP9F 3VXOA 4XB8A 1U41A 1JFQH 1MEXH 4R4BB 1JGDB 1BIIB 4WU5B 2EXYD 3CCHB 1HKLH 2F5AL 4HZAA 5HVWA 2AXFB 3SGJC 3VRLE 1F4YH 1DBAL 4U6TA 4PPTA 2BVPB 4PLKC 3KJ6L 4DW2H 3E3QE 1RULL 2HTLC 3CMOL 4FZ8H 3QDJB 2UZXB 1WJ3A 2P42B 5CGYC 3VXUD 2R56H 4P48A 4QHUB 1TTGA 2FHCA 2JJSC 3NAAL 1EMTH 1FLRH 3VMOA 4PP1C 4Z8FL 3QUXD 3FRUA 4J4PC 3N0PB 4GBXB 5D1QD 3TYFA 3OG4B 4HT1H 1P4LB 1S9XA 1NBYA 4KTEH 1ZGLB 5KTEL 3VFVB 3C9NB 3V7AE 5FK9A 3WJLC 5FYLD 4EIGB 2X1OA 3RX7A 2SEBB 4WHYH 3VGFA 2ENSA 3EFFA 1UB6A 2XA8H 3SBWC 4ERSL 2QQLL 2DB8A 5HPMB 3GSWB 4XZUA 1WBZA 1YNKH 3VH8B 1UGNA 2W65A 4PRHE 5DJDB 5JA9A 4ELMA 2AK4B 5C0EA 3OB8A 1E0OB 4RGMC 4IRJC 1EGJH 4MSWB 4UOW0 4OFKA 5HBBA 2BRQA 2R0LL 5TF0A 2CKBL 3HR5B 1T04B 4F7EA 3TT1H 1FFPA 1YEKH 1M4KA 1HH9B 5C2BH 1LO4H 2QSVA 4OD2A 5TE6H 1F4XL 3JZ7A 5CZXD 3MRMA 5DMGD 1P69B 4C56D 4TSAH 1XFPA 4M93B 1IC7L 1QLRB 1DLHA 4I18C 1R3HA 1SYVB 1DP0A 5D7LD 3K4ZA 3WXWH 4JHBA 4FG6D 3OB0H 1JVKA 4JZNA 5T3ZL 3TBSA 1A6TA 4LAQH 2JK5A 5EO0B 4AQ1B 4HS3B 1D5XA 2X1QA 4R7DB 4R90L 5GJSL 5C0BD 2OTWA 3NCEB 5MI0C 5B22A 3EOAA 1FDLH 4K94C 1DVFA 2CIKA 4PJDB 4YXHH 3TFKD 3H3BC 4GRLA 3EDDA 1EFXA 4I5BB 1PQZB 1FAIL 5JORA 2Y25A 4XWGL 3ZE0E 1OAQH 3O0RH 3FFCE 1BOGA 2G5BA 2VDNL 4JFXA 1PG7L 4WVRA 4LSUH 4B0MM 4UAOB 1FNEA 1PD6A 1DE4B 2I9TB 1WT5A 3PQYA 4QRRD 3V4PL 1PZUB 1RSFA 4TUKH 3KPSB 3QUZB 4MA1B 3S8WA 4L9LC 2CXKA 2YD3A 2Z91B 3QFJB 4FFZL 3TNNA 5DEZA 3Q5TA 1VKXA 4NCDA 5IEHA 3C60C 3C5JA 5TH2A 4UT7L 4XP6L 1LEKA 1RUKH 4YC2B 3VGAC 3EOTH 3LH2L 5CWSB 1G1YA 4GKZB 4JFFD 1MQ8A 1HZHL 2DTML 2NY4B 4KQ4L 5MENE 1R3LB 2AK1L 5TDOA 5GGTA 1KLGA 2R0WH 4MJ2A 2UZIH 1G6RB 1CDHA 4HS6A 2OLDA 2VLKB 3QO0B 1ZA6A 3ULVD 4JPIA 5C08E 3VWJD 1TCMA 5BVJB 3KPPA 2J8UF 2FJHA 4HWBH 3IDIA 4FFVD 4JVPA 4ZNCD 4Z76A 4PRAB 1DCLA 1HHHA 1ORSB 5EU4A 1NMCC 3HB3C 4O2FB 3MROA 4N8CL 3R8BB 3QH3B 1RFDL 3L7FB 1A7NH 1EO7A 1A02N 1IAOA 4CN1A 6FABL 5IVXA 3WS3B 4LPTA 5DQ9A 4G7YL 5TDPA 5FA4A 1KPVA 4FQCL 1OP3K 4FQPA 2FWOB 2OXHA 1MCFA 1I1CA 4JREB 5JXAL 4Z77A 4DZ8A 1S7TB 4KJYB 3G5XA 5GZNC 4MJIA 3VXUA 1UWEL 3GO1L 3DSNA 3RVWC 2DLEA 3MLXH 2BVOA 4RBPH 3QUXA 3LQZB 2DBLL 4D9LL 3H42H 4PGDB 4DAGL 3QHZH 1IGCH 2XWTA 5CD5C 1NGWB 2B2XH 4P2OD 4PP2A 3S35L 4XGZB 2JB6A 4LFHG 4PJAF 5F89A 2D7PA 1A6VL 2VXTH 5ID1A 5E5RB 3KAAA 2HFEB 4L4TE 1P7KB 1ZXQA 2R69L 4I18B 4I48B 3DARA 3VXOB 2CMRH 1T83C 1SMAA 4JFOA 2IWGA 5ILTH 3PGDA 3U9PH 3MBEA 3QIUC 1JK8A 1MHPH 5HD8D 1RZ7H 1YA5A 5CIPA 3W81A 2I5YH 4OM0L 1RZ8A 3L3KA 4K71B 1JHKH 3S88L 4W81A 2D0GA 4PBXA 3BZFA 4Y89A 1KULA 3MR9A 5J9PA 1SVCP 2CKNA 4ENEC 3GI9H 4QRQA 2UY7A 3FRUB 1C8PA 4G8GD 4KUCF 2VUOA 1GAFL 3TYFB 2P48B 3LY6A 4CGTA 1S9XB 4K3HA 1NBYB 1BVLA 4UT9L 2JLLA 5FK9B 2F15A 2EXYC 3QG7H 1TLKA 1D5BA 4OLUH 1TXKA 3EFFB 1EO5A 3FT3A 3L3JA 1KEGL 1UB6B 3KXFD 5GRXG 1NFIA 5IB5A 1A3QA 2EXWD 4XZUB 4KKLD 1WBZB 1OSPH 5KVDH 1JGVL 4PG9A 1DBKL 2W65B 4ELMB 1RJCA 5C0EB 2X89A 2A1WH 1G7IA 1FL3A 1RIVH 5HHMB 4ZS7L 3WUWG 4F7EB 4HXBL 1AR1D 1FFPB 5D1QC 1EEYA 4QRRA 1JRHH 4OD2B 3WS6C 1I8LA 4JDZA 3T0ED 2ZZUT 3MRMB 3EBAA 5FO7A 1KTKE 2VDQL 4KV5F 1AKJA 4RWHA 4P9HL 1XGTA 4R26H 1XH3A 1DLHB 5FYKD 1NMCB 1R3HB 2XI9A 4HULB 4FQXA 4MZ2A 1U8LA 4J3UA 3CFBA 4JZNB 3TBSB 2VYRE 1J5OL 1A6TB 5C0AD 2JK5B 5HGAA 1D5XB 3ZTJG 1XGYL 4PY8I 2W59A 4FA8A 5HYSG 1MCDA 2OTWB 5F7FA 1PEZA 4XCFH 3VG0L 2EDBA 2MNUA 3EOAB 1UVQA 1DVFB 2CIKB 4R97C 4GRLB 1EFXB 3SDXA 5JORB 4DN4H 4GSDL 2NY1B 1OARL 3A6CH 2AJVL 3CGTA 3VWJA 3CX5J 4Y1AD 1BOGB 2G5BB 4JFXB 1RUML 2AQ3A 3A67H 1FNEB 1I1RA 3FOLA 2DWDA 3P0YL 3PQYB 4HFWA 4XBEL 3BSZL 5HVHB 5L9DH 3DI3B 3GEWB 1RK0A 1D6VH 3DUUA 3VRLF 3TNNB 3QPXH 2DTSA 4WNQA 1VKXB 1JF5A 2B1AH 5EOQL 4HG4J 2BNQD 4HLJA 3FQRA 3MOAL 1CZ8L 1NANI 5IGXH 3C5JB 5TH2B 2C4FT 2HYMA 2HFGH 3S3PA 4OGYL 1MCOH 3AY4C 2P5ED 1OD9A 3G08A 3I6GA 4NZRL 5CEZL 5E08L 2FGWH 1LEKB 5DI8A 3JV4A 3LEVH 1G7PA 4FQLL 4AEEA 5JW4N 1IEHA 2N1KA 4QTIL 1YEJL 1T7ZA 1Q0YH 4KMTL 3U2SA 4S1RL 3PABA 5TDOB 5I6XB 3TBVA 1KLGB 2BNRE 3MXVH 1SYSA 4HS6B 1ZA6B 4FFYL 1E4XH 4UIMA 2CJUL 3SE8L 4JPIB 1A1MA 1WISA 4TRPH 3KPPB 2FJHB 2DS4A 3IDIB 4P2OA 2XFXA 5EU6E 3W2DH 4Z76B 4CU7A 1PLGL 5J6GA 1HHHB 5EU4B 4XAWL 3MROB 1QD0A 3QEGH 4LDEB 1IAOB 5IBUG 2VDRL 3MRGA 2YZ1A 5IVXB 1A7OL 4YQXH 2F8VA 4YGAB 5DQ9B 1Y6MR 5DLMH 5TDPB 5DJZA 5FA4B 2V5TA 1KPVB 2VLJA 5ELIA 4IOSD 5CFHA 4IOFD 4EIZC 2VSDA 3FRPA 4TVSa 1MIMH 2OMBA 2BVQA 4NQED 2BHZA 4Z77B 3ULVC 4DZ8B 3G5XB 4LASH 4MJIB 3VXUB 4FFVC 3QDGA 4OZGA 2BVOB 5I74C 2QQKH 4KRLB 1FNSH 3QUXB 3VFOA 3R1GL 1YEFL 4GAFB 2C9AA 1OAYL 5JQ6L 2FHFA 3WFBL 1CL7I 3FKUS 3FB6A 2XWTB 3HNSL 3Q5OA 5JHDD 1LO2L 1I85C 5JHLH 5KOMC 4L1HA 1AY1H 3QHTC 4PP2B 4WI2A 4WFED 2DLTA 2JB6B 3Q6FA 1FPTL 1MFAL 3ZE0F 1YEIL 5F89B 4KVNL 4AG4H 5GGVH 3KPRD 5ID1B 4GQ9H 3KXFA 1QPXA 5CSZA 4X8XA 2FATL 2PTVA 4LGSB 4POYA 2AVGA 3GJFH 4JFOB 4ODBD 3QG6A 4BM7A 3PGDB 3MBEB 1JK8B 5DD5L 3AAZA 4O5LL 5CIPB 4XCEA 4LCWD 3RZCD 1E6OL 3NACL 1RZ8B 3L3KB 5LG1A 2XNAA 2LFGA 1IGML 3UC0H 3BZFB 4DTGH 3RWGA 4P2OC 3H9HA 3MR9B 5EUOA 3T0EA 5J9PB 4JN1H 3N9GH 4CDGC 2WUCL 1HINH 2WM0A 1RUAH 1L7IL 4QRQB 5FYLH 1RU9L 4MAUH 4MNGE 1M7IA 2E3VA 3IRPX 4OCWH 1BVLB 3WNPA 3S4SG 3DRTA 3PL6A 5C0AA 2BY3A 4NCC2 3H6JA 3PXHA 3Q48A 3RWCA 1D5BB 2VLRD 3FT3B 3L3JB 1XF1A 1C7TA 2GEEA 3MJ8A 5D93C 3WJJC 1NFIB 5IB5B 4NZDA 4DUXA 1INDL 4XBPA 4PG9B 3GMNA 1W0VA 2FEDD 4LL9A 1NBVH 5F72S 1QFUH 4GXVL 1ZT4A 3AUVA 1G7IB 2ORBH 1FL3B 3IDMA 3TWCH 4Y1AA 3AB0B 4HFUH 3U1SL 5EBMA 1EEYB 3CMGA 5ICXA 4QRRB 5K59E 4JDZB 5DD3L 5DYOA 1FIGL 4BFBD 4WO4D 4J1UA 5FO7B 2FR4A 1AKJB 2WW8A 1I3GH 3ULUL 2BNQA 1XGTB 1TETL 2ICCA 3CDCA 4HWUA 1QG3A 5GZOC 1XH3B 3S34L 3RVTC 3WMSA 3AROA 2NY6D 2P5EA 4FQXB 4PJXF 4PJCE 1U8LB 4R6UA 4RZCB 3CFBB 3T0WA 2DDQL 1F2QA 5HGAB 5SWSA 3UXFA 2FX9H 4FZEH 3WNKA 3PNWA 1UVQB 4LLMA 1F6FB 4L4VE 1Z9OA 3LKOA 4KTYA 3NPSB 4BUHA 4MCYA 5IT2L 3SDXB 3FAWA 1G1CA 2P4AB 4WTZG 4PV9A 1JWUA 4DN3L 2AEQL 3VWJB 4N5UA 3TCLA 4HGKC 5DUPL 2A9MH 1INQA 3FOLB 4OD1L 1ADQA 1DBML 2DWDB 2GK0A 4HW6A 4HFWB 2GJJA 1RK0B 3DUUB 2H9GA 5J06A 5EFIA 3L1OH 3OXSA 2CDGA 1ZK9A 4WNQB 4X4ME 1GH7A 2HAZA 4U2YA 1KCLA 5HYJA 3FQRB 3HPJA 2AXHA 1H5BC 4ZODA 3QISA 3G08B 5ETUA 3I6GB 4KDTC 5CJXA 4C59B 4X7SH 4XPBH 3O6LH 4TSBL 4KKAC 5DI8B 3G6JA 5KS9A 3JV4B 2FJFA 1X5KA 2XOTA 1G7PB 1KN2H 4NQEA 3OR6A 4ZQKA 1J0ZA 4PG2A 3ULVH 3U2SB 4Y16C 2D0FA 3PABB 3TBVB 1ZLUK 3LDBC 5F9WC 1A1OA 2RIKA 1SYSB 5HGDA 1U3HD 4YHLL 4UIMB 1A1MB 5JHDA 4LSVL 1OW0A 1SHMA 2X4OA 1MCHA 2ARJA 1N26A 2FIKA 1IQWL 1JJUA 2XFXB 4P2OB 1MFEL 2WQ8A 5J6GB 4LSTH 1DL7L 4NBXB 1MPAH 1RUQH 4S11A 1CLYH 3KPRA 4BELD 4JAMA 3MRGB 2NX5E 3WNLA 5EU7E 1D5IH 1NFDE 2O5XH 3PV6A 4TOYH 1I9RL 5DJZB 4BZYA 2VLJB 4P9HC 1ZLWH 3BDXA 4LCWA 2FL5A 3RZCA 4KKBD 2UWEE 4CW1A 1Q1JH 1P4BH 3EYVA 2BVQB 1QO3A 2IQ9H 3NCJL 1INEL 3KYKL 2AV1A 2DLIA 1JV5A 3QDGB 4OZGB 3QXWA 5LBSH 5I15H 3TA3A 4H1LA 3L5XH 3VFOB 3HR6A 4AL8L 2KL6A 3KR3L 3FB6B 5FM4A 4G9FD 3CVHA 3BPOC 3F7PC 3B9EA 4G8EB 5AUMA 4YE4L 4LPXA 4RGNC 3S5LA 1DDHA 3PV7A 3Q6FB 1KELH 4YK4B 4BFEA 5M7QA 1OPGL 2VLRA 1PG7X 4FQIL 5GRWA 1MRFL 3DHJA 4IOFC 2P5WA 2YK1H 2R23A 3KXFB 5CSZB 2VDOH 2CR3A 1UWXH 4HIXL 3BX7C 1I7ZA 3QG6B 1IT9H 1CU4H 4F8QA 3MJ9H 5KN5A 5JW4Q 3AAZB 7FABH 1W72A 3DVFA 3OAYK 1FORL 4PJGA 4XCEB 3DIFA 2XZCH 3HE6D 4Z0BL 2XNAB 4KAQH 4U31A 2WBWB 5MP6L 3RWGB 3H9HB 5EUOB 3T0EB 3PP4L 2QSTA 4WO4A 3I6KA 1C12A 1RURL 3FB8A 5F93C 4ZO9A 1OTSD 1HIML 1M7IB 1T21A 2LVEA 1WUNT 3TYGL 1YNLH 1HK6A 4NQSA 1OL0A 2N56A 2VNCA 3DRTB 3PL6B 5C0AB 2ZPKL 3QJHA 3LPFA 1CGXA 2L7JA 3RWCB 5T3XD 1GCFA 3GDBA 3UJJL 4HBQA 3MJ8B 3DUSA 3PP3K 1F4WH 2X9YA 1KXTB 4W4NA 4XBPB 2VB5A 1NGQL 5IROA 5FCUH 3GMNB 3NGBB 1W0VB 3TT3H 3L6FA 3WL9A 3BAEH 3K4AA 5I75B 1ZT4B 1EEUA 3IDMB 5CJQH 4Y1AB 1CFNA 4QXTA 4H88L 2ZOLA 1FH5H 3I2CH 1T89C 3BKYL 2M26A 4Y0GA 4FMFA