1BGXL

Taq polymerase in complex with tp7, an inhibitory fab
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Taq DNA polymerase in complex with an inhibitory Fab: the Fab is directed against an intermediate in the helix-coil dynamics of the enzyme.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Complex (polymerase/inhibitor)
molecule keywords TAQ DNA POLYMERASE
total genus 30
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1998-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL01
2IPTL 4DN3L 4Z7WA 1IM9A 5D7JD 3B3IB 3QXAA 5IUSA 4YBQD 5AZ2H 3QDJD 3SDCC 4OZGA 4KTEL 4NM4H 3ARBD 4NQSB 4P23B 3OJDA 4PUBL 1OP3H 5E8EA 3GB7B 1AKJA 4IRJD 4PJXA 2FJFA 3IF1A 2D4FA 4ZO6A 3VCLB 5CD5D 1GGTA 1CFVL 4JO1L 3QNZB 5DUPH 4JRYB 4M9PA 3BGMA 4PRID 5ALCL 4R90L 1XGQB 3IDNA 5EWIL 4PJCE 2DQHH 5T1LA 2Z93A 4KI5D 4WHYH 3G5XB 5I8KL 5ID1A 2EE6A 3NFNA 4QF1B 3KPMB 3U4BH 4Q2ZB 4KTDH 1JPFB 1RULH 1XF3A 1LVEA 4GW5B 2HFGH 1DUYA 4L4VB 1EEUA 4OGZA 3CLFH 3QCUH 5E00A 1MF2L 2FX7H 2GHWB 1OPGH 4X4ZA 3L3GA 3TA3A 1I9JL 4KVCH 4X4MA 3WN5A 1FV1A 2BOBB 4LSQL 3QWOB 2NY2D 4RAHA 1F4HA 2GY7B 5DD6B 3IDNB 4OI9A 3HI1B 4FNLH 5GISL 4LVOB 2RGSA 3CSPA 4M6NL 4M7LL 2YN5A 5F89B 1CU4L 4CW1B 1UYWH 5KVDL 3DARA 3MNVA 3RWIB 1BP3B 4YHYB 3L5WA 2PTTB 2UZIL 4NYLA 2BRRH 4LKXA 3UROR 1DBJH 5C0JA 1F4YH 3NVQA 5F72S 3S6CA 5I2IA 5C7XH 4XNYH 1D5BA 3VDCA 2PYEA 3O3DB 3EGSB 2BHZA 2AK4B 2H8PA 4NZJA 4IHOA 5F7EH 4K2UL 4Y5XC 4OQTA 3UMTA 5D2LE 2NX5D 1TXKA 5DRXA 3MJ9H 2EDRA 2AV1B 1A4JA 5EFIB 2A1WL 2ZCLH 3T0EA 1GL4B 4J3OC 5HHVH 2WBJB 2Q87A 3I9GH 1P69B 3FN0H 5LKNA 2H32H 5L7XL 4JG1L 4W6YB 1CL7L 1JHTB 1MCIA 4YK4C 1PKQB 3LEYH 5ESAB 4N5EC 2RHEA 3SKOB 3GI8H 3VG0L 3LEVL 4WFED 5L6YH 2BY3A 2BVPA 5F1IB 4XHJD 2YK1L 5MEOA 4W81A 4PB9L 3UTTE 2ZP0T 5DQJA 3EO1B 2B20A 3KPRB 4X9HA 4I0PC 4ODXB 5BS0A 5D1XA 5SX4H 3MRIA 1I9RH 1HCFX 4PGDB 1U42A 2N7BA 5LGJB 2NY5C 5IB1A 5F6HJ 4PJ9A 2CO6B 1NJ9B 4BSWB 1NBZB 4WFHD 3ILQC 3L3HB 4X5WA 1YN7B 5F3BB 1KYOK 2R2BA 1HHGA 5D96B 2C3HA 1MAJA 2D7PA 1PYWB 1JBJA 1OARL 3T08A 4EEEA 1J9CT 3DECA 5HYIA 2Y4SA 4PJDA 5KOVC 4X8JB 5KSUB 2XTJB 4Z8FH 2LTQC 3CZJA 3LKQA 4DKEH 4UILH 3QPXL 1UG9A 4NHUA 5J13B 4NKQB 3SDYL 3MJ7B 3TH3T 3UPCA 2R56H 4HWBA 1A7NH 1T6WA 5EZJB 3ELAT 3MRCA 2P8MA 3QWOA 3MC0A 5IHUH 5HHMB 2HFTA 5AYUH 5EBLA 3L3GB 1AR1C 4PG2C 5IBUB 2D7MA 4J3VA 1YEJH 2NTFA 1RZIB 2OM5A 5HYSB 4G8GE 4XP6L 3QDJB 3QISA 3QFJD 1EHLH 2YZ8A 4WUUD 4IRZH 3BH9A 3CNKA 4N0RA 3FAWA 4GRWB 3WSQH 4YUEH 4MQXC 4HUXB 4L8BB 1R5VA 5GHWL 4E41D 1R5WB 1JNNL 1I1FA 1KN4L 4LVHC 3DOSA 4RGNB 2GAZA 1JN6B 7FABL 1QSEA 3BZEA 2DKUA 1IM9B 2GJ6A 1FRGL 5D2NE 4GLRI 4PJXF 4GSDL 3QXAB 1MJJB 3RTQB 3C6LB 1OF2A 1AQKH 5SWSE 1Q72H 1P9MA 4A6YB 3FOMA 1CK0H 3ARWA 2HH0L 1F11A 1J86A 1INDH 2B5IC 4UIMA 5HSFA 2I9TB 1GOFA 1JNHB 5SX5K 2HTLD 3A67H 1LO3H 3QUZC 3L9RA 4OSUL 2HG5B 2P5WD 4X7SH 1S5IH 4YFLF 3VFUB 3QUZD 3TVMB 1JPSL 3HNVL 4XP1L 4LVHB 2G60L 4P5TD 4RGNC 3JWOL 4OQTH 2NCMA 3QRFM 3BW9A 4JRXA 5DDHA 3U6RA 3TESA 3RIFK 3IKCB 5B3NA 5MEND 4X98B 4PRHD 4WW1A 2NTSP 2VDQH 4J23A 3EDKA 5HTSA 4PFEA 4HFUH 3RGVC 4FQHA 3GBMH 1RZFL 4PY7B 4WCYL 1YPZE 4JLRB 4KRPD 1NUNB 4PYHA 3DPBA 2VDRH 1EK3A 5FCUH 2UYLA 2WUCH 4NM8H 1MFBH 1ZV5A 2ZG3A 2IANE 3KS0H 1QBLL 1KCUH 1NBYA 1GC1C 2N4IA 2V7NB 2VO5A 3ARSA 2Z0BA 3RZWA 1YEIL 4L3EE 1G7QA 4ZQKB 4X7DC 3UJJH 1W0VB 2W92A 4JO2L 3UC0L 3IVKB 1XH3B 3X13B 1ZWIA 2I26N 4NC1E 4N8VA 3HAEA 2XY2A 1FZJA 1NANI 1J8HE 4UAOB 3MLPA 1HQRB 1YMHA 4YXKL 1EX0A 1T2QH 3EZJB 5D1QA 5EUOA 1CFVH 1N8ZA 2ILLA 4JO1H 4KFZC 2HAZA 1P7QB 3EYUL 1MFCL 3TN0A 4G7VH 2Z8RA 4HXAL 1HXMB 2NLJA 5D93B 5EWIH 3O2WH 3B83A 3O9WC 2AJXL 1X3DA 3LKOB 3C5JB 5GGSB 1BIIA 1JZ7A 4MJ5B 2ARWA 4H88L 2HFGL 4XBGA 3BMWA 3C60B 1MFAL 4NJAL 4L1DA 4LPTA 5I1HL 4QXUH 5C09A 1R5VB 5C0DB 2NY3D 2NY1D 1U3HC 1HIML 2E7MA 1I1FB 3WCYA 1WEJH 3O3AB 1BVLB 3AU1B 4WU7B 1KJ2H 5D2LA 3T1WA 2I60L 3KLAB 2GK2A 2O5XH 1XCTB 5DA0B 1F45A 4HPOL 1Q9KB 1UYWL 3HE7C 4MAYA 5KVDH 4CNIA 4D9LH 2WP3O 3N1MC 3X11A 3A0OA 3ILPA 3QO0B 3U9PH 3U30C 1QR1B 1F58H 4KI1A 3S36H 4PJFE 4X7TB 4X6DE 3W11C 4AM0A 1CICB 4OFDA 1K3IA 4XNYL 1D7FA 2IAMC 1SEQH 5C07D 4CBPA 3CK0L 3R8BB 3RHWF 5JLZA 4NCC1 3GMNA 4YHIA 4NHUB 2BNRD 2RCSL 4X5XA 4NQED 2X1PA 2BNRE 1K3ZA 4IRSA 5EUOE 3PE9A 4X9IA 3QUXB 5C07E 3QUYC 5HHVL 3GKZA 1I1AB 5CJQH 3MROB 2WUBH 5HGAA 3BXNA 4PGCB 4ZYKB 2V7NA 5JTWA 4MXVF 3C6LA 3NIGF 3DX6B 3P4OB 4Y2DA 3C9NA 1NBZA 5L6YL 4IOIA 4X99A 2F74B 4NC2B 5C6WH 3MREB 3S34L 1RQ5A 1OOAA 2H2PD 3F8UB 2AJZA 1ZA6A 4MJIA 3BE1L 2E3VA 1S3KH 2MNUA 5CWSB 4N8VB 4IMLA 3WE6A 4F9LC 4MD5B 4TNWK 1KB5H 1WFTA 3SO5A 2YPKB 2ZKHL 32C2A 5GSVB 4UV4L 1HSAA 4OFKA 3QDHA 1TZHA 5CIPA 3QPQC 2GTZB 3O41B 1U0QA 3SCMD 1CD9B 5IK3A 3H9ZA 4CVXB 2DYPB 5FO9B 2A83A 1QRNB 4QRRD 1ZGLA 1OARH 2W9LA 4QGTA 1RZKH 2IMNA 5HGDA 3U4AA 1E4XI 2VH5L 4RGNE 4H20H 4M5YH 2XN9E 4XH2B 4QHKJ 2C3GA 4HKBA 2XN9D 4DKEL 2ZOKB 4N9GA 2VLLA 3EJYC 3QPXH 4HJJH 1J10A 4OCNC 4I2XA 3DLQR 4J7RA 1U8OB 4FQ2H 3SDXE 1T1WB 1I85C 1U8LB 2V9RA 5EIVA 3HRZA 4RRPA 1KSRA 5ACMA 1GGBL 1DLFH 2OMBA 5E8OA 1OSZA 4I0CC 3DTXA 5AYUL 5JW4N 3WHXA 4YBQC 2J8UB 4W68A 4P2RE 2CKBL 3BP5A 2VL4A 4JN2B 5D7JC 4L8BA 3LRSB 1J12A 1TNNA 2ICWA 2C3VB 2G5RA 3GMMB 4WTXA 1KF9B 3T8XA 1BIHA 3DNKA 3VXME 2Q7NA 1A6ZA 3HB3C 5FYJD 3W39B 5TGBA 3V6OA 3EW3B 3GZKA 3QG6A 1IFHL 4JREC 1WISA 5KG9A 2A9MH 4KRMB 4K9EC 1FN4A 1G0DA 3QDMB 5BS0B 2RFXA 2XG5A 1CFNB 3GRWA 5K9KB 4Y89A 4JKPL 4L4TB 1FGVH 2QHRH 2E7CA 1F11B 3MACL 1MCPH 2D9QB 3NPSC 4NRYB 4WEUD 5FUZH 5D7LD 4ZO8A 5DRWA 5F6IB 3JUZA 3MV9E 5F9WC 1HZHL 2HKHL 1INDL 1YYMH 5EBGA 2ED8A 2PTUA 1EERB 3ES6B 4PG2A 5ADPL 1QLEL 3W82A 3I6KA 1AKJD 1JFQL 5AWNL 4U1MB 4PY7A 4DVRL 1MI5B 4ONHB 3BT2L 1WFNA 3WBDA 5DJAA 5I66B 2W65B 5I1EH 4NKIL 4JFDD 5C09E 3D3VD 1NC2D 1XF5A 3LKSA 4R7DA 2IANB 1EO8H 1EZVX 5JOPD 4K94L 1D5XB 4ZD3L 1XF2B 1QYGL 3MCG1 3O4OB 4WVRA 1I7RB 2Y5TA 3FB7A 5D7SL 5EZIH 4HFUL 1JNLH 4F80A 1JUFB 4ESKA 2VXUH 3DUSB 5IV2B 3TBTA 2VR4A 4DW2L 1FNSH 4QRQA 3REVA 4ZFZB 3U83A 3KHOA 4R4FL 5CGTA 4NQVB 3E6HB 1L7IL 1I3VA 4DCQA 4MNHA 3RVVD 4Z5RA 4M7JL 3K4DA 1EIBA 3T0DA 2GSGB 4X9GA 2YD2A 2YA0A 5BZDB 5D1ZC 4WV1B 3OTTA 3IFLH 1F6AB 2F53D 3R1GH 1LO5A 3L3OA 3FT2A 3UTTD 3CVHH 3FT3B 4NO5A 1GZQA 3I2CL 1FFNA 1P1ZA 3WHXB 4F9PA 4XAKE 2HJKB 4NWTH 4N8CL 1GC1L 1PY9A 1RUKH 4UDTA 4KRNA 2IALA 1YDPA 1QLRA 3RY4A 3SE3A 5MP6L 1P84J 1ZT7A 4JZJB 1HH9A 3MFGB 1XGQA 3GSXA 1ZT1A 4KTYA 4IDJL 4NOBA 3T0WA 4IRSD 2VITB 4NKDB 5BXFB 3VI4E 4G6JL 2NTFB 4HCRA 3KYAA 4XRCA 4POZD 3QDAA 1CFQA 3HMWL 3WFDL 1JWMB 5IB4B 2VRAA 4YWGH 4H88H 1OSPL 4PRBB 1HOCA 4YHZL 1JRHL 1ACZA 4HPYH 3MOAL 4KJWC 5HYEA 3FTGA 5CSZB 4F58L 4PGEB 3VFTB 3JV5A 2F58L 2LAGB 3RVTD 5MERB 3SDCB 5ETUA 4MSWB 2EXWD 4FQLL 3RHWK 4Y7MA 5IHZB 2SEBB 1MELA 1ZLVH 4TQEH 4JPKL 2O5XL 2XI9A 3KPPB 3MFFA 1EHAA 5IR1B 3VMPA 4L9LB 4CJ1A 1DN0A 4LLMB 4UOW0 2IGFH 1VFMA 5E5MA 1P5VA 4YHOH 4QT5B 3B9EA 3EHBD 4OB5L 1NJ9A 4FQXD 1ZLVK 3ZZ1A 5CSGA 3EYQD 3VXUB 5EO0B 4ONHA 5J3HD 2DQCH 3KPQA 5IESL 5D93C 3HR5B 5J57B 2QBWA 4QHMA 2HLAA 3U7AA 4JFOB 5SWZB 2RCSH 3DMMB 4QYOB 2R0WL 4G3YH 3ZTNL 4DAGL 3HE7D 1UADC 3DUSA 1X5FA 3OJDB 5IV2A 3UAJD 4NKOB 5DTFA 3THMH 1MIMH 1KBGH 4WI2A 3U82B 3ZDZE 5C08A 1HHJB 2DWDA 4W70A 4JDVB 5DHVB 1I7TA 4PJHB 2RIKA 1HNGA 3L3IA 1A1NA 5FUCE 2C3VA 4BZ2L 3QWQB 1T0NA 2YUZA 4WRLA 5FKPA 3ZDYE 1U3JA 3T2NH 1T7VA 3WFCL 5CCKL 2P7TB 5DC9B 3RBSA 1ZANH 2A38A 4PJ8A 4QY8B 1SY6A 1AI1L 1M1SA 1A7PL 3OXSA 2IFFH 4AYFA 3OKNA 5E9DE 3PP3K 1H3GA 5KW9H 4YDIL 2X4NA 5C0IA 2Z35B 5JIPA 1NFKA 3AS3A 2VZ1A 2ZCKL 4HC1H 2EDXA 1ADQH 3ROOA 2VZUA 4XCFL 4M93C 4JFXB 3D2UD 2DIJA 5CGYC 4Y88A 1O7VA 1HILB 2BNQD 2EYSB 2H9GA 3MV7B 4NZTL 1MFEL 5I30H 3I75B 2CRYA 3MUJA 3BDYH 3JBG7 4M5YL 4CRPA 4OT1L 1UFUA 2VR5A 4FXGB 3KPSE 5IMMB 3DGCR 4LPVA 3IDYB 4RA0C 3G04A 4APQD 5IMOB 1BZ7B 5F8RC 4DCQB 1SMAA 1BQHG 3KYKL 4U6XB 1S7WB 2PYFA 3ARVA 1U8KA 4G8IA 5GJTL 3ARFB 1KUMA 5HD8D 2ICWB 2DIBA 2VLKB 3QUXA 1HQ4B 4HBCL 1FO0A 4Y2DC 2O5YL 4MA8H 3W0WE 5KSVA 5KG9B 3D0VA 2ZOLB 1X5ZA 5EU4A 1DQML 4H5SB 2BY2A 1SJEA 2BHUA 3WDJA 1KLUA 4DGVH 2ZUQB 1UJ3B 3EJYD 1A9BB 3B9KB 3H3PL 4PR5B 3GBLA 5K9OA 3D3VE 3V8CA 4UOJA 1IFHH 4S1SL 1IEAA 1ZVHA 1WBXB 3IU3A 1FNGB 2B4CC 1GPOL 1CLYL 1S9YA 1WWWX 5TDOB 4L4VE 3W9EB 1ACYL 4D2NA 3CDGA 1MCQA 3L3KB 4P4KD 4LSPH 5EU3A 3BP6B 1PDKA 2B4CH 5IMLB 2AXFB 3QEQE 2DTML 2DQDH 1O5DT 1OQXA 1ZVSB 4I3RL 4P2CG 5CJ8A 4NZUL 5E2VH 4HC1A 3NIFE 1QFOA 3LZFL 2VAAA 3F6LA 5C9JA 1T22A 3MNZA 5HY9A 1DQQB 4XXCA 4WTZA 3MRKB 3HZKB 2KL6A 3TVMA 5ADPH 4JVWA 3BUTA 5FDYA 2ITDA 3ULVE 1AE6H 1IAIH 3L3IB 3CAFA 3F12B 4UDUA 4NKIH 3T2OA 3GMQB 2FEEL 1P7QA 1T21B 1XAUA 1YEGH 3CJJA 4KK9C 4G6FD 2DMCA 2BRQA 4GKNB 1FGNH 3ZKXC 3BP5B 3MJ7A 3WLWC 2FX9H 1A0QL 1U8NA 3P11L 1W2KT 1KPUB 5IG7A 2GKIA 3HR5A 5B8CB 3ULUD 5C0FB 4BZ1H 3ESVF 3CXDL 2V5SA 3F7VA 4PGJA 4LK4A 4NNPL 4PRPB 1R3HB 2ITCB 3CFJA 3TV3H 2DKSA 3GSQA 3FT4B 1ZLSH 2VDKL 5C09B 3NPSB 5JMRA 1PSKL 1NLBH 4F7CA 2R1YA 1EAPB 3IFLL 3C5ZC 4HS3A 4MJ2A 4WI6A 3FB6B 3GSVA 3MA9L 3VFRB 4EI5D 1F00I 4WNQB 1BJ1J 4JANA 2VDPL 1I7UA 4W4OA 2XFXB 1INQB 3HAEH 1PQZB 5KVEL 2VUYA 4OIAA 5DD1H 1RUKL 1X7QB 2X1QA 5IVXE 4PJGA 4Y4FC 5DS8B 3BX7C 3OB0K 1P4LA 4N9OB 1CXEA 1OF2B 2J6EA 3VWKC 3WXVL 5CHNB 1U91B 5ESQA 5DTFB 2V2TB 4HH9B 3SY0B 5M7QA 5F1SA 1NAMB 5JZ7C 5TDOA 1K8DA 3P3YA 2R15A 4P3CH 2X4SA 4P9MH 1KJ2B 2Q3ZA 3WD5L 3BD3A 3C8KA 4OTXH 1A6TA 1U58B 4QRPD 1JRHH 3BISA 4I3SH 2KBGA 3MOAH 5DLML 5JXED 3WNOA 1RK0A 4ZFGH 3O2DH 4KDTC 5C0BB 2A77H 3U6RB 4K07A 4U0RB 4MNQB 1T03H 1DQJA 4NN7C 4YQXL 3ZT5A 5DYOA 1ES0B 1LE9B 5KS9A 5FIEA 4LF3A 3QUZA 3VXNB 2AJUL 1JPGA 5D7IF 1NGWB 1TJGL 4JHBA 1R3IH 2CMRL 3LV3A 1FVCA 3AXLB 5CEXB 1U2HA 3D85D 2B39A 5CUSH 4QOKE 3SN6N 2BDNL 5KS9E 4OB5H 2EEBA 3E2HB 1WBYB 5GZOC 3K2UH 4WEMB 3VI3E 1BHGA 1RUQH 2Y36H 3MV8D 3ARGB 2EE9A 5IESH 3PQYB 4X6DF 1ITCA 2BVUA 2VLME 1PD6A 3PIQB 1J0KA 3JTTB 5GGRA 3ZYIA 5HVHC 2OXHA 5D2LB 1W0VA 4DAGH 3L3DB 4BFBD 5T1KA 3V5KA 1DTUA 5E0QA 1T2XA 5DEZA 3OV6A 1QFWM 2D0GA 4BUHA 3FQUB 4BH7B 1YPZA 4GBXD 3D69B 1UXWA 5TDNA 1N5AA 1MJUH 1IAOA 3ARBA 3LKQB 1Q0XH 1S78C 1BZQK 3IFOA 4Z7VB 1GIGL 1IC5L 2PTTA 1MCDA 3CVHA 5C8JA 5HVHB 1YEDB 2NY7H 3QEQA 3FFDB 1JNHA 3FN3A 4JFPB 1W72H 3PHSA 4ZS7L 1V5JA 5IVOA 2EIZB 5KW9L 4NZRL 5TDPB 3RDTD 1JWSA 3TBYB 5FAAA 1U2CA 3I3BA 4C83A 3MMEB 3HUJE 4NGHL 4M1GL 2PW2B 5GGSY 1A3RL 3I6GB 1M7DA 5D7KD 1FFPA 4G42B 1FJ1B 3O8XA 1CGTA 3VXQB 4Z7OF 4XNQB 3NCMA 4DN4H 5DHYA 4U6XA 1YYLH 5I30L 2FGWL 2BVOA 1IGTB 2IQ9L 5DK0B 5HBBA 3GSXB 4JHWL 4YPGA 3QJFB 3GMOB 1RJYA 2IBGA 3BH8A 4RSVA 4MS8D 5HI3C 3MXVH 1TETH 3IRZA 3DMMA 4Q9RH 1OT1A 1KTLA 2XTJC 1C1EL 1BM3H 3UXFA 2CGRL 2J8UA 2J12B 1A8JH 5DQJB 3KR3H 4UOW1 1U8QA 4PR5A 2DD8H 2YOCA 1PZUB 4CVWA 1R3KB 3WFEH 3F5WB 4JFEE 4OLYL 5E2TH 5F7KC 1IE5A 5JUEL 1YY8A 4I77L 4PV9B 3LKRA 1NL0H 4HIXH 1QP1A 1JP5A 1LNUA 3VJ6A 4MNGE 1EV2E 2BOCA 3T0AA 5DMIL 4GRLC 1N2RB 5FM8A 1BPVA 3M17B 2XT1B 2Y7QA 4ZXBC 2MQCA 4FFWC 2CLRB 3SKJL 1CLYH 4M8VA 1VFUA 3CFEB 4WHYG 1ACYH 5F8QC 4TNWF 1Q94A 4MXQC 5L2KB 4N5ED 4PRDB 3G5ZA 1ZS8A 3D6GA 2ZPKL 1D5ZA 3M45A 4CGTA 4YEFA 1HHHB 2AJVH 3TWCL 4UUJA 3MLZL 1KCKA 3QNZA 4PJAF 4B5EA 4ODBD 1MHPH 1SYSA 2X4TA 3S4SA 4ZFFB 4ODXA 3KPNB 3WLWD 2Z93B 4B7IA 1DQJB 4RMSA 4ZXBA 1UH2A 4RQQA 4PLNC 5MI0C 2NW2A 3T4AB 4LVNB 3TYGL 2GT9A 2ATPA 5DD6A 5E2WH 1SHMA 2APTA 3SE4A 5D71L 4MA1B 2OTUA 5DJXA 3LRHA 3BPLC 3ALWA 3H3KA 3TA3B 5JIIA 3DBXA 3P30H 1IBGL 5IFHL 2X42A 5FF6A 3MOBL 1OAXH 1KJ3H 2OTWA 1U3YA 4CW1A 3P11H 5IVNA 4CKVX 1EH9A 5BVPL 2J2ZA 5DUBA 2Y07L 1RIHH 3O11B 4BUGA 1MHHA 1BEYL 1EHNA 2X1WL 3RVXC 2GUOA 1NC4B 5I19L 1RI8A 1GH7A 3IS1X 2GYSA 3ROLB 1MEXH 3DV6B 3ULVH 3A6CH 3HB3D 2D7NA 1PSKH 2DI9A 3I6LD 3GIVA 5CKGA 4KTEH 3WFHB 2W59A 3EYQC 3BESR 3STZB 4ERSH 3N06B 3DX6A 2VZVA 2CXGA 4APQB 4OIIH 3NFPA 4PG9A 3KWWA 2BX5A 2DQHL 4I5BA 2A9NL 4M61A 3BKYL 4JPVH 1TENA 4RFEA 3VH8A 5D7IA 5IROA 3C2AL 1AXSA 5FHAH 5I15H 4LLUB 1I8IA 1FH5H 2UY6A 1MFDL 4PJXE 5GIRB 2BVPB 3O9WD 4LCCB 1R0AH 4AEIL 3MZTA 5A3ID 1MLCB 2FX7L 4GRWE 3VFMB 1LGVA 5B8CC 1FYTD 1KV3A 3NFNB 2PYEE 2OSLB 1F3DJ 5DC0A 4UT7H 4PRDA 5GRJH 3CZFB 2BSSA 4YO0B 1BVKB 4U1HB 4ZUSB 1DVFC 1FVCB 4M6NH 4X6DA 3EFDH 4JFFA 2X5PA 4DTGH 3T1FA 1DFBH 3O2DL 4XP4L 3OKEA 3HUJF 1VCAA 5CFHA 1C16B 4YQXH 5A2KH 4JVPA 2MWCA 2NX5E 2AJUH 3KPLA 5GGQH 1TJGH 1AXIB 3ZDYF 3FO1A 3FZUD 5I75B 1DEDA 1XGYH 1HHIA 2F5BL 4GBXA 4YGVA 1KCLA 1AY1H 1W8NA 3LN9A 1AR2A 5GRVK 3RAJH 3HE7B 3O4LE 4O58H 4AG4H 1CQYA 2OQJB 4LNRB 4HH8A 4QXWA 2PNDA 15C8L 1U41A 4K3DL 1V8HA 4NQCA 1VB9A 1F6AA 1RJYB 3F7QA 3OJ2C 2YPVH 2C3XA 5E6IC 1MCNA 2G75B 3VXUD 5L7XH 3RY5A 1CL7H 2B1AL 5JO5B 1AHWA 4M7KH 2PW1A 3BIKB 3PF2A 4O2FB 1Z2KA 2BVQA 5CLTA 2W60A 5D7JA 4UTAL 1IL1A 4Y1AA 2PXYA 1ZA3B 4KH2A 5AUMA 5FA3A 1MJUL 1HQ4A 1MREH 3L95A 1Q0XL 4C83B 2EDWA 3TO4C 2UWEA 3OG4B 4L8SA 4M4RA 3LRGA 3WDIA 3WL9A 3N9GL 2NY7L 4JPIA 4EN3C 4Y4FA 5C92A 2VXTH 4O4YL 4OLEA 3GDBA 3V0AC 4JN2A 1MHEB 2V2WB 5KS9B 3QUMB 4BYHA 3VXRD 1GJIA 2R29H 4IRSB 3NCYS 2H2SC 3AREA 3C5ZA 3BUYA 1EA9C 4FQXA 3OKOA 5CJOH 3RUGA 3D39E 3TYFB 4Z7WB 1CICC 5DJYB 2FGWH 2P44B 3QHFH 3KYMA 5C0EB 4E0RA 3HHRB 4XPGH 3OR6A 4F33A 1G7HA 5L2KD 1MRFL 3ZHKA 4HZAA 5D1QB 5HDOA 5E8NB 1S9WB 5E6ZA 1A7OL 4Z76A 4UV7L 5JW5B 3NIFF 4HAFA 3LS5L 4M1CD 4M3KB 1KJMB 3SDAD 1WTGT 1NFDF 4OZHE 5F7HA 3OKEB 4Y16D 3GIVB 1C1EH 3KPOB 5C0CD 4HUMB 3H9SA 1FNHA 2F53B 2PYED 5GGUB 2IPKB 3B2VH 2F54A 2JF1A 1MWAH 2YC1B 3EYVB 2LV4A 3GRWL 1TZHB 5CIPB 4UDUB 1ZOXA 5JW3L 3PWUA 4KKLC 1N4XH 4IRZL 4ZQKA 1N7ML 4RMWA 2XZQL 4FQCH 4JM2A 2ESVB 1JGUH 4HIXL 3TO4A 5GHWH 4NQEA 2F54E 1LE9A 2ICWJ 1JNNH 4JFHD 5IMKA 3X13A 3IDMA 2PXYC 1I8KB 2OQJA 1G6VK 1GOGA 2NY5H 2CKBA 2OK0L 3ORJA 3GSQB 1A5FL 3GM8A 1TCRA 1AQKL 1Q72L 5E95B 1PX3A 3OKNB 2HH0H 4L4TE 2AXHA 5ITBH 1JZ8A 5E6IA 4EOWH 5DRNB 3OAZK 4JFQB 1K9TA 4MDJA 2DDQH 2GJ6B 3MLZH 2C4FT 5MEPA 2EE2A 3G9AB 4HUWA 4I2XE 2JJSC 3SOBL 4KC3B 3SJVD 2BZDA 1MRDL 5HYFA 1CDJA 2PXYB 2D31A 5AUMB 4OQTL 1NMAL 4L1HA 4KQ4L 4OBSA 4F2MB 5I1GL 4OZIA 2CDFB 3OJVC 3LEXB 3RJQB 1X7QA 2DLFH 3IB4A 3KPLB 2I5YL 3RQ3A 3WFBL 1DUZB 5TQ2L 4G9FD 1U8IB 3GI9H 1HSBA 2Z31C 3K46A 5EU6E 2P5WE 2AEIT 4HIEA 3P30L 4GS7B 3HN3A 1RHHA 5FKAB 5FECA 2HJLB 4RNRB 5J56B 4G7YH 3P4OA 2Z9TA 2VAAB 3BN3B 4HX1B 4JKLA 2Q7YA 3OWEA 2FEDC 1YY8B 2Y07H 3CFJB 2G5BB 4G6ML 4OZHB 4XGZB 2B1HL 2ADFH 5FYJL 3TO2A 1BEYH 4LAJH 1KLUB 4J4PD 4TVPH 5H35A 3GSRB 1FZKA 3BKCL 5M95B 4OM1L 5ICYA 3UC0H 3QNYB 5J6GB 5BZWB 5HHOA 3PL6D 2VQTA 2Y06H 1CDBA 4CU6A 1PYWA 4MHHI 3S5LA 1HHHA 1T2QL 1GRWA 1ZHNB 4FQQA 4HKJA 4ZO7A 5IWLA 2W0LA 2ERJB 4GKSA 1CFTB 1S7TA 4M3JA 1FV1B 1EEZB 2BOBA 2Q8AL 5C0AB 4G7VL 1UM4L 3MFFB 4OZFG 4WU5B 3EOAA 3VXSA 4KWUA 5DT1H 2VUOA 1JCKA 4QXUL 4NOFA 1CDUA 3SCMB 1OVZA 2WM0A 4XZUB 4U1NA 3GSOB 1E28B 4QRPB 4PJEB 4NP4L 1A6UH 2CIIA 3T4YA 3EGSA 3ETBF 3FO2B 3SO3C 2EYSA 1KJ2L 3MV7A 2I60H 4PS4L 4XC1H 2X4RB 1LDPH 4Z78B 3EFDL 3QIUC 5BOZG 1A2YB 4LHUG 1N5AB 4BFGA 4G80A 3S96B 1UWXH 5FHBL 2AABH 1ZT7B 1QFUL 4N0UA 4PJFB 4GRMA 3S36L 1KPVA 4XHJC 1NLDL 3HI1A 4UDTB 1Y6KR 5E4EB 5E8DH 4D9RE 3CK0H 1XGYL 2HFEA 2XKSA 3KGRA 4P3WA 1H3XA 5A40E 2FD6H 3SKMB 3RX5A 3FKUS 1KTDB 1NGPL 1U36A 1MQKL 3I6GA 2FJGB 4OF3A 1CCZA 3TBVB 4HMEA 2UVFA 3U1SH 2DQEL 3HMXA 5HDQH 3U4EA 1BECA 3UZVB 4FOMA 3CFBB 3RZCA 1NDMB 2P48B 3JZ7A 2IPTH 5J8OA 2XTJE 5GZNC 1ZGLP 4LVOC 2A6DB 4WGWB 2DL9A 5GQBA 4FXLA 5DJDB 2EIEA 4NM4L 2PYEB 3HC0B 4M9OA 4Z7VE 4KJPC 1HILA 5C0CB 1ADQA 1AXSB 3SGEI 3T0EB 4KK6C 1H3TA 3SDAB 1MCEA 1P1ZB 3BYTA 3S34H 3KPPA 1MREL 1F5WA 3U0PB 4RWHA 5T3ZD 5H35B 4ETQA 2ARJA 4AMKL 2YUVA 2DQFA 1TTFA 3RDTA 4UV4H 2CDEB 1KIPB 5IEKB 1FDLL 1QUNA 3EO0B 1UEMA 1U92A 2YMXH 1RULL 5HJ3A 2VXTL 4K3EL 2X4SB 4MVBC 4WY7H 1NFDA 3TCLB 1C16A 4JVUA 3EO1A 1R5IB 4HK0A 1TZGL 2IH3B 4JZOA 3QIUA 3ULUF 5F1NB 1I9JH 4KVCL 2A73B 5E5RB 1OTTD 1N2RA 1T4KB 4HJJL 1CU4H 1CVSC 1NGXA 1OLLA 3H0TA 4PTTA 4KI5C 4R4NC 5GS2H 4FQ2L 1G9NC 1MCRA 1WT5A 1JGLH 3PABB 1YEDA 3QEQB 1NGWA 4TYUA 2GTWB 1DBJL 1Z9SA 3BPCA 4I0PB 1OGTB 2EKJA 4FQIL 5ALBH 4ODTL 4NO2B 1I7RA 1MI5E 3FB7B 1RJLA 4C59B 4YK4B 3L5WB 5CP7B 4LSUL 1IEBB 3RX8A 3B9KD 3RWHB 1FIEA 3KLDA 1MWAL 3BP7B 3GRWH 4HIJB 1FL6B 4AK1A 4BKLB 1KNOA 3BO8B 1V7ML 3QXDB 3PDGA 4OAWB 3UPRB 1N7MH 3L3DA 4U2YA 4HX1A 3DROB 1JHKH 3PGCA 5HPMB 3QA3A 4PD4K 3D69A 3WNKA 3NTCL 2ESVE 5AD0A 3U0WH 1DLHB 4JG1H 5EU6D 2OR8A 4Y5YC 4ZS6D 2V9TA 1QFWI 2BP3A 5DRZA 3TC9A 2H3NA 1T3FA 4Z95H 4QRTB 4YX2H 4XPTL 3QEGL 4GRWF 4U4BA 4QRSB 2VAJA 2OK0H 1YEKL 5EOTA 2FO1A 1N6VA 2A6KA 2FB4L 1PG7X 2Q8BL 5IQ7H 1XGUA 4EOWL 2Z4QB 3N1GC 3O3UN 4LHUA 4P5TB 2X4PB 4RFOH 1YEFL 2APFA 3MMEA 3FO9A 2V6HA 4Z78A 4PJ7F 5IB3A 2EIZA 5DJ2B 3ZKND 1MRDH 3BVNA 1Z9LA 5I1EL 2CIKA 2GJJA 3NZ8B 3D9AL 3K8KA 4Y19B 3OKLA 4IM8A 1BZ9B 2DLFL 3PWLB 3U0PA 2NZIA 1MI5A 4AENA 2LU4A 1BBJB 1RZKC 3IFPB 1UQSA 1S5HB 3QIBC 1KCSL 4UILL 1VGEH 3VXTA 3CGTA 3T3PF 4ELMF 4UT9H 4JZNB 2OZ4A 3B6SB 3RTQC 4EI5A 1N59A 5IW6A 2E6QA 2R56L 3WIFB 4DW2H 4U1GB 5L9DL 2BFVL 4G6AD 3V79C 3NZHL 4G9DA 3MROA 1E6JL 4TSBL 5FYJE 2H2SD 4DZ8B 2NY6B 1UACH 3MRJA 5DVNA 2R0KH 4QRQB 3REVB 4UTBL 5JW4R 1F02I 3HLAA 3BEVB 4NHCL 1G7PB 4QXGL 2JJSA 1HDMA 2DOCA 3QQNA 1Z3GL 1G84A 2BOCB 2GQHA 3FCTB 3MRGA 4X7FC 5DO2D 2QQNH 2IH1A 3CFKB 4LPUA 3TIDA 2R0ZH 2VQ1B 4G5ZL 1GZPA 1KEMH 4TTDC 2DICA 1HH6A 1ZHLA 2D7TL 4S1DD 3RKPA 5EZLA 2VR9A 1QKZH 1UWGH 1ZAGA 3HZVB 1U8MB 4NRXA 4UU9A 1IGYA 7FABH 5AG9A 1PJ9A 1N5YL 4UNTA 2XIDA 3HZYB 4K3GA 1ORQB 3OGCA 3HFMH 4MB5A 2P1YA 4UQ3B 3GJFH 2QEJA 5CBEA 3M1BB 1CK0L 3D85A 3LKPA 2GK0B 4YHZH 3IJHB 3S3PA 4HPYL 2VQ1A 2ADIA 4R26H 2HRLA 4EUPH 1JV5B 4YDJB 1J1XH 1MCOL 1S5IL 1YPZF 2HFFA 5I17A 3S3JA 3VI3F 1RHHB 3QUYA 1JRHI 5D2NB 1B2WH 3CSBA 4XC1L 4XWOD 1BBDH 5C6TL 1T2JA 1G7IA 1B0WA 1XGTB 3EJZC 5F3HA 3DSNA 1RFDL 2KUTA 5LXGL 1RZ7L 2FBOJ 5FHBH 1PQZA 5IMOA 2YEZB 2AEPH 2XY1A 4EI6A 1B6DA 4RISH 2XRAL 1E4WH 3STLB 4Z7VA 4ZNCD 1AGBB 5DD0L 2K3TA 3OF6D 4HCRH 4TTGA 1T1YB 3ZKQD 2RQ8A 3SDDB 4YFEA 2ZZUT 2ZNWA 3IXAA 1KCUL 5IQ9A 2EZ0C 4DEPC 1NGPH 2YD6A 2R2HB 3GJEA 4G3YL 3BP4B 4WFGD 3MLRL 4JLRA 4MXVE 4EN3A 4I18C 1JJUA 3UJJL 3WFZA 4FTVE 2WWMC 5FO8B 2NR6C 4PRNB 2LU7A 4KJQC 1ERNA 3K3QA 4HG4K 5I1LA 4MB3A 3H7LA 2FHCA 1C5DB 2DLHA 4GW1B 4HQQH 1FG2B 4KHTH 3GSWA 3CVIL 4PP1C 4TULH 5FA3B 4BQ8A 4HS8L 2Z4QA 1ETZB 1AGDA 1SEBA 3BMVA 5J11C 3IVKA 3QFDA 4P3DB 5ETUB 2OR9L 3GHBH 3WUWA 4S1DC 5D6DC 4QHLB 3TN0C 4HXAH 4AMKH 2MHAB 3ZE0F 1NC2B 5IF0B 2XA8H 2VQUA 3CPLB 4X80H 3WHE1 3B5HA 5E99L 2YMXL 3CSGA 4K3EH 4WY7L 4XCFH 1FG2A 2AJYL 4WFFD 4X6DB 5KSBB 4Y5VB 1SBBA 3C9NB 4Q6YA 1HIMH 4NZTH 4ONGL 3ROOB 1IGJB 3QUML 2P42B 2VDNL 3GMLB 4PRIB 1NKRA 3LCYA 1I75A 3TIEA 4UQ3A 4PJAA 3CC5B 4M5ZL 5E56A 4UBDC 4F8QA 2R2EB 4XTRD 4I48B 3QUYB 4NQCE 5A43C 4FQPA 4U7SA 3RNQA 5DJCA 4LEXL 4J4PC 1KGCE 4GBXB 4RAVA 3IAPA 3OBAA 5CD3B 1DQMH 1IRAY 4GUPA 5K59F 4LSUH 3RFZC 1Q9OA 4DGVL 1KG0A 3JV4B 4PP2B 8FABA 2YXMA 3DVGA 3FFCE 4HKZA 5DZNA 3EYFB 3G6JF 2J1KA 3RIAF 2VIRA 5D2LF 1CFQB 4HZLB 1YNLL 4HFWA 5BW7C 4OZ4B 3FRPG 1GPOH 3MV8B 3W0WA 3WO4B 3P9MA 1T7XA 3VA6A 1Q9LA 1PY4A 4LMQI 1WT5C 3X17A 1XR9B 3NPZB 4HLZH 5C9KA 5GS0H 1DBKH 3BPOB 5EH1A 3D85B 3LKPB 3LKSB 5E2VL 3UTSA 4KDVA 3T65A 1YEKH 3QIBD 3LZFH 4HG4J 4JRXB 3MYJB 5F6IC 1S3KL 3LPFA 5IQ7L 3LDBC 1AJ7H 2V2WA 3ZKSD 2J6EL 4AENB 4PV8A 3FO0L 4PLKD 5H94B 1VADB 3D39A 1E0OB 1ZHLB 2CR3A 1AE6L 1IAIL 1ZSDB 3MR9B 1FL5A 4YHNB 3VXPA 3RDTC 2MSPA 2R4RH 4KKAD 4ZFOL 3WIFA 1RZKL 1D9KB 3DI3B 1BGXH 3MBEB 4ORGB 2OX5A 3D25A 3LKNB 1A6WH 4YHLL 5ISZD 3F58L 4PRIE 5DJZA 4P2OB 1A0QH 1VEOA 1CTOA 2GJ6D 1NCCH 2HT2C 3T3ME 3C87A 5GRUH 1J11A 1Q8MA 4R0LC 4NNPH 2BSRA 1K2DB 5D5MF 4XP9H 4BKLA 3UJTL 1U92B 1H8OA 3TV3L 3VGDA 1NCUA 2PO6B 1CIDA 3L3HA 3K1DA 1G6RB 1ZLSL 5HI5C 1I1AD 4WTZG 1Y6NR 5E2JA 1S7RA 5IB5A 1DN0B 4PJEE 2O61A 4NKDA 4U7MA 2F15A 2BNRB 2ESVD 1HYRC 4GMTL 4MHHG 4N0FB 2MFNA 2Z35A 4QRSA 2H26B 5C09D 5KVEH 3A6BH 1M7IA 4KQ3H 1CICD 1WIOA 3KPTA 3MRBB 4Z5RB 4MD4A 2IEPA 4G5ZH 2PN5A 1MWAA 2LE9A 1U95A 3RIFF 5D7KE 2OLDA 5B38G 1FC2D 1FGVL 1DBBL 2CLRA 1LO5B 5DVOA 1N5YH 4P5KB 2FIKB 3MACH 4Q2ZA 5J9PA 4G6FB 1RUPH 5D1QD 3VFVA 1C5CL 3VXMD 2NXYC 5FUZL 1HNFA 3T04D 2IQAB 5DUBB 2DBLH 5TE7L 3O2VL 1PG7W 5ISZA 3UBXI 5IB2A 1T80A 3Q48A 5I1AB 5KVMC 1J1XL 1MCOH 3C60D 4R7NB 3MPCA 4J2XA 2A77L 2Z91B 4URTB 1MRCL 3DXAE 1NCBL 3RWGA 3VFWA 2ZCHH 3QHTC 2QQQA 1B2WL 1ZT4B 3DRTB 2KH2B 4LCCC 2HT3D 2CRIA 5C6TH 1MCHA 3RL2B 3FFCD 3OAUL 4RA3A 4X4ME 5IM7A 5TF1H 4FN0A 1D3CA 5JPNB 2DM2A 1YMMD 1RZ7H 2E8YA 5IWLC 4O2EA 3W2DH 3GKWH 5JOEA 1TNMA 1LO4L 2VXUL 1WC7A 1ZS8B 2NY3C 4TVSa 5J0BA 2AEPL 9CGTA 4RISL 3BRDA 2X89A 3REWB 1R3LB 1E4WL 1R5IA 1EJOH 2Y36L 3JVGA 2ZUWA 4HCRL 2Y1VA 5K93A 1OY3B 4K7PY 4DOHE 3IFNH 1K4CB 5I73C 3D25B 5T5NF 5KVFL 5MENA 3OKKB 1EXUB 5L0QB 1G7MA 4QOKD 4D9RD 3S5LB 1J18A 1RU9H 3ULSB 4R8WL 3WUWB 5SV4A 2P5WA 5FGRA 5CBAA 4HLJA 4OCRL 3MNWA 1X4XA 5SWZA 2FJFB 2V7HA 3FB5B 4I4WB 2FX8H 2VLKD 4FG6D 3BOVA 4GAJL 4W6XB 4WO4D 3QI9D 1DQLH 5MP6H 1KG0B 3DI2B 3OG6B 1D5IH 4PREB 3V6FB 2OR9H 2DQFB 3ZSTA 4HV8A 4IDJH 3VFPA 3JWNC 4HWBL 4ZS7H 1UZ8A 3GSOA 1DVFB 4JM2F 2EECA 2QKIA 4M1DL 4LLDB 5A1AA 3HS0B 4JB9H 2WZPD 5I8OH 3MV7D 5T5FL 3HMWH 1HI6B 3VGBA 2QADC 1SYSB 1JWUB 2W9DH 2E27L 4WO4A 5ACZB 3F7RA 5F89A 1MQ8A 5IW1A 4IOFD 4BSVA 4DN4L 1CFSB 1BX2B 2HWZL 3LIZL 1X6NA 5EC2A 1S9VB 1OAYH 3C6LD 3DX8B 3PWNB 4B53A 1FYTB 2L7JA 2X4QA 4NPYB 4RNRA 2DQIL 3O9WB 1OB1B 2ENYA 1ODAA 3L6FB 2VLMD 4RMRA 3D39B 4RAVB 2EDFA 4Q9RL 1P6AB 3EOTH 4Z77A 1VA9A 2P5ED 4HKZB 2CRZA 5E24E 4LSSH 1D6VH 3W5MA 3MUZ1 4HIIA 4PJGB 4LEXH 3QQ3B 4IHOB 3UBXG 1JZ4A 3B4NA 1UCBL 4ZNEE 2EC9T 1T04A 3VGAB 5B4MC 4M62H 1ZVSA 5JUEH 4Y16C 1NL0L 5B38A 3O4LD 4AY0A 2AKRB 2WWKO 1JTOA 4J4PA 4D0CA 3FQNB 4GXVH 3THML 4PJBB 4R96B 3QEHA 2NXZB 3R4DA 4EXPX 3K0WA 1YEEL 2YWYA 3IETB 1JTTA 4HUUB 1AQDA 1RIVL 1S7TB 2ICEA 4Q7DA 3GUTB 4ELMB 1MCKA 1A6PA 1CICA 4HK3J 4NT6B 4F9LA 5GS0L 1NH6A 4NBYB 4W4OC 1J8HB 3QXTA 1NFDE 1OT2A 4B7LA 5FECB 1OCWL 4HXBL 1LK3L 2VDOH 4KAQH 1XR8B 2HVJA 3WFCH 3V6OE 4G9FA 3DJ9A 3KPSB 2QR0A 4X5XB 3N50A 4GKNA 2EIBA 4IRSC 3BAEL 3MBEA 2K1MA 4YXLH 3MGTB 4RMUA 2EDLA 3WIIH 1SYVA 1IAMA 4PRAA 4LIQL 3LSOB 5HI4C 3MRPA 1G7LA 3MRFB 1CXFA 5TE4L 2R4RL 1DQTA 2A6JA 5C1MB 3KLHD 1MH5A 1N64L 1KT2A 3V0WH 1K8DB 3TVMC 4BZYA 3O3BB 1CE1H 1G6RA 1EAPA 4J3TA 4OT1H 5J1TC 2DKMA 3QSKB 4Z7UA 2WK2A 1T7WA 1KGCD 2PCPA 3W9DB 4DFIA 5JA9A 3KYKH 5DJYA 3H9YA 1SJVA 3GSNA 5GRUL 1KIQB 3ILQD 2JIXD 4MDIB 1B0RA 3DXAD 4C58B 1ZMYA 3BPOC 2ZG1A 4I18A 3SBWC 2Z92B 3TO4D 3A6CL 4XWGH 3UCRA 5TE6L 3K8LA 1CR9L 4CNIB 1ZWIB 5EU7E 1FIGL 3ROLA 2GCYB 1M71A 1Z0NA 2F54D 5F7DA 1Z0MA 3H3PH 1BD2E 2W0FA 5I74B 2BC4B 5JO5A 1ZHBB 4HKXA 5ICZA 3OKYA 1W8OA 1KCVL 3AY4A 1DE4B 1G9EA 1QHPA 3K7UA 5EIQA 4ZAKC 1KXQE 2VNCA 3BKYH 3FB6A 4I48A 4LCUA 3WKML 4XNZB 3U46B 2B4CL 2R1YB 3C2AH 5FHAL 5I15L 1DBBH 5M94B 3GBNH 1FH5L 4I3RH 3LKOA 4R2GB 5GS0D 1N3NB 3QXWA 2F5AH 4BM7A 1IC4L 3U9UA 3BN9C 3NN8B 2V2XA 4NQEE 3GGWB 3ARDB 3LAFA 5J12B 5C0DA 2F53A 3BP6A 3E3QC 3I75A 3IETA 4CN6A 4UQ2A 3FOLB 1A7QL 2I24N 4CJ0A 3QDJA 1MI5D 4PP1D 3CU1A 3AFLA 3G6AA 1ZEAL 2B0SL 2CK0L 4WW2F 4UBDD 1U91A 1MRCH 2JJTC 2QR0B 1BZ9A 4WENB 1J0JA 1GCFA 1DP0A 1NGYB 5F7MC 3VH8G 3MTRA 5D7LB 3HI6H 1UXSB 1ZLWH 5HYJD 4YAQB 5TF1L 1CDHA 3QFDB 2ITDB 3C5ZB 5EU4B 1CXLA 4EXKA 4EIGB 2B8OT 2EC8A 2FX9L 4V1DB 3SJVA 1TQCB 4UIKL 3M1BA 3GKWL 1JWMA 3E2HC 4F7MB 1K6QL 3G6AB 4AG4L 4OCSH 1UB6A 4MGXA 4YIQB 2DBJA 4MAUH 3CX5J 1GYAA 4LRNL 2V5RA 1S7UB 1H8SA 1KNOB 3BO8A 3VFNA 5HGBA 1L4IA 3AMLA 2F8OA 5GRVL 3X3GH 3QDME 4JG0L 1IVLA 2GW5A 3UEZA 3H9HA 4IDLA 5FO7B 3EYOA 5ADOL 1QR4A 4YGAB 4TUKH 2DM7A 1MAMH 5AAMA 1RU9L 1TQCC 2BNQE 4KMLB 4OGAD 4UI2A 4BA8A 2YWZA 4UTAH 3H6JA 4AL8H 4NNYB 1M05B 1BOYA 4O2CA 4BQCA 3AC0A 2NLJB 3BGFC 2ICES 3VG9B 1OHQA 4LCWE 3BKJL 3QPQD 5T1LD 5GPRA 3NAAL 2X9YA 5DZOA 4GKZA 3IYLW 1KELL 4OI8A 3VD4A 3P77B 3DV4A 1NUFA 1IZJA 2D7OA 3SDAC 1RZGA 5I71C 3VD7A 5AZEH 1QBMH 1JPFA 3MA7A 3LQZA 3CU7A 5HHOD 4PJ5A 1HKLL 1YEHH 4JDVA 4NT6A 4OTXL 1UVQB 4I3SL 3SJVE 4HUXA 5GJSL 3OPZH 4LCWD 4HIIB 3FFDA 4DVBB 4XPGL 1T03L 4X6CE 3UBXA 1VFAB 5C2BH 2J5LB 1KFAL 1IT9H 4OGYL 2DQIH 1CXKA 3BGAA 2YD3A 4QTIH 2FECI 4PRAB 4MWFA 2XNAA 1T0MB 4G6KL 5CUSL 5ITFB 2GT9B 2BDNH 3PDDA 3TNNA 2A6KB 2LABA 4M48L 5KTEH 4H8WL 5I1DB 2BK8A 3N85H 5FGBA 4NKMA 1FAKT 4S11A 1JVKA 2WWKT 3SE3C 4NN5B 3KYOB 7CGTA 1RUQL 1X5GA 2NW3B 4PJ9C 4HWUA 4P23C 5EIIB 1EFXA 4P59L 4YHPB 3SCMA 3WS3A 3LQAL 3FCTA 3MRGB 4F8TA 5DUMH 3ISWA 2VTFA 3MUGA 5D1XC 1NBVL 3HI5H 4R3SA 1F6FB 2A0LD 5DJZB 1WIPA 5IOPB 1CXIA 1OGAA 5KS9F 1GHFL 1Z5LA 4PJCB 4YZFE 4U6HA 5HGHB 1RIVH 2P43B 1L0YA 5ENWB 5EO0A 4OGXH 4HWZA 1FCCA 4OLZH 4DKFL 3BPNB 5FM4A 4PRPD 1R3KA 2DLEA 3C08H 3QWRA 2FZ3B 5EO1A 1MJ7H 4QYOA 1IGML 3MLUH 5CILL 1I3UA 1LK3H 2VDOL 4KAQL 3AS0A 4Z7UF 2W91A 3SOBH 1QA9B 4N0CD 2FCBA 3TJEH 4KKCD 4F3FB 1RVFH 5TDNB 3PDOB 1LK2A 1FPTH 3QAZB 2Q6WB 4YXLL 4Y4KD 1ZE3C 3WIIL 4NZRH 5I1GH 1J05B 2WANA 5CP7A 4YDLC 5DJAB 1CGYA 1ED3A 1HDMB 3UTOA 4KZEL 1F42A 5TE4H 4D0BA 5DXWA 3GI9L 4OFYA 2X4TB 4LNVA 3S4SB 5BO1H 4JDTH 3DVFA 3QH3A 3Q5TA 1DANU 3HC0A 4KJQD 1RZGB 1OWWA 1CE1L 2YPLB 1LD9A 5E8PA 3A6OA 5H8DA 1QSFB 3NGBC 2YUXA 3MRRB 3MYZA 5HYSG 5HHNA 2QQKH 4HIHB 1CBVH 1P7QD 3K74B 3GM0A 1DBAL 3TNMB 4E5XA 3HC3H 2H3NB 4NQVA 2EC9U 4PJDE 2MPAL 5EOCL 4Y4FD 1FC1A 1PFCA 3SGJA 3VWJB 3GMMA 2CGRH 1OM3L 4TVPL 4P4KB 4AIXA 4OLVL 1HK6A 2JJUA 4OM1H 4LPYA 3UZQA 1FBIL 2N56A 4MQTB 4M6OL 2O61B 2ENSA 4DVBA 1T66C 5B21A 3WFEL 3O2DA 4D9QD 1UXWB 1KB5A 2VDLH 1KC5H 4RGMB 4PRNA 2MQ3A 2BCKA 1F3JB 1T7YA 4YNYA 2P8LA 2HTKC 5J7CC 1UKSA 1F90H 5F7WC 1Q9LB 1KCVH 1UM4H 3SKJH 5BJTA 3IS0X 4OF0A 1HEZB 1AO7E 1UM5L 4IJ3B 1YN6B 4ELKB 3NMEA 4NQCD 4KRPB 3KVQA 5DRWB 1P7HL 2I25N 5DT1L 4TTDD 2D4DA 5I76A 4X6EA 3CDFA 1U6AH 5IVZB 3E6FB 5IF0A 4DUXA 3TWCH 2F5AL 3BPLB 1J0YA 5DC4B 1GGIL 4PRBA 1K4CA 4NP4H 5GS1A 5MENB 3WNLA 3GMPA 4EJ1C 2VLJD 4H0GA 2XFXA 2BNQB 1A7QH 4DKDC 2X89D 3CFDB 4PS4H 3B9AA 2NYYD 3QUZB 1T5XB 3LKNA 4Y0GA 3QULA 5HJ3B 3LQMA 2CK0H 2Z31D 2X40A 3G08A 1YMMA 4DQOH 2KQMA 3ULUL 5EC1B 1P7KA 2MTPA 3FT4A 1QA9A 1NLDH 5I74C 3HG1D 3BKML 2VISA 3OZ9L 1S7UA 3MA7B 1UWEL 4XNXH 3IT8D 3MJ8B 5LAXB 5IKCA 4LKXB 5KSAD 1RURH 4LL9A 3OJMB 4UIKH 4PRHE 5LQBH 5BVJA 5F9AC 2HN7B 1YZZA 3O6FD 1IGYB 4XNMB 5EULV 4IBLT 5IB2B 1LP9E 2CUMA 5JIKA 4MAUL 2NNAB 4BJLA 2K7QA 5IK3B 3PL6C 4PBVC 1XGPA 5LCVH 4WUUB 3WLBA 4KROB 3ULVL 1PBYA 2FR4A 3MRQB 3CVHB 4M7ZB 3MV8A 3TEUA 1NBQA 4LLYB 2YZ1A 2IBBA 3B5TA 1BFOB 4IOSD 2RB8A 1IGCL 4HMCA 4V1DD 4L3CA 3P77A 5D2NA 1UC6A 1QSED 3C5ZD 1ZXQA 1KLGB 5BV7B 3KYOA 1FAIH 3X12B 1JMZA 2CDFA 1UA6L 2PW1B 4PJHE 4E41A 2A9NH 4FFVC 4PGBB 3NAAH 4TNVK 4XX1E 4YDVB 3UTPE 1T83C 2HJLA 4JPWH 2G9HB 1MFDH 1S7QA 4ZOEA 2VXQL 4ZO9A 4AEIH 4Z76B 3FQNA 1DDHB 1TZGH 1BIIB 5I73B 1BFVL 1T1YA 5T33H 4MAYC 1MUJB 4JFDE 3BH8B 4U0QB 2YD4A 3SDCD 1T20B 4KU1A 5GRJL 1HKLH 1YEHL 4JN1L 5CZVH 5CEXA 5JZ7D 4P0DA 3ULVF 4R2GD 3ECBA 4S10A 4Z6AT 1AFVH 1SM3L 3DWTA 5ESVA 4RX4D 3MBXH 2NY4B 3V4VH 5TFSL 1OAQL 2PR4L 3KPRD 5JHDD 4FFVD 2CLVA 4OF8A 4NUGL 1VHPA 5FA4A 4ODTH 1AIFB 5DR5H 5I1DA 5H37G 3M8OH 4JFFB 3MRDA 5F9JA 4GKSB 3RVWC 5CP3H 2MHAA 2F5BH 2ZSWA 2EE3A 3EJJX 32C2B 3FHQA 4K71C 1MSPA 1OTTC 5I1IL 3MGTA 4Z7QE 3UX9B 3RAJL 2BY0A 3RWDB 5A2IH 4O58L 2GK0A 2R69H 3D0LB 5GZND 5JXAL 3QRGL 4JQVA 3UDWC 1KT2B 1TQBB 4FG6C 4XP5L 3C60C 3DIFA 4NZDA 2NYYC 5CP3A 4ZAKD 1NBVH 2A6JB 2UUDH 4TVPE 3U0WL 5E4IA 1MH5B 1URLA 2H1PH 4YDKH 1YUHA 4MJ4A 1GHFH 1QBAA 2M26A 3ZYZA 3FHAA 4U6VH 4OUOA 4N68A 4Z95L 4YX2L 1A64A 1A7BA 4PB0L 5GGUA 5IMLA 4K23H 4QHUB 4JFFD 1T1ZA 4IIQA 4LCYB 1HWHB 4OLZL 2XXCB 4PJ8B 4FQXC 4DKFH 4BH8A 4J8RB 2FB4H 5CJ5A 5CMAA 5TPWH 5HVFB 2Q8BH 4D9QE 4XBPA 2YBRB 1Q9WA 3U30B 3PHOB 2B2XL 2DQGH 2ESVA 1GAFH 5BRZD 3CFDA 3DRQA 4ZUUB 2HJFA 2ZSVA 4XPHH 5GGVH 3SQOH 4QKXB 4IOFC 2DIAA 2VYRE 4Z18A 4QTHB 1N26A 1NKOA 4TOYL 5BOPA 3Q5YA 4PGEA 3QDGE 4P5MA 1FPTL 4A2LA 3D9AH 4KGJA 5CD5C 4QRRE 5INCA 4NQTA 4JE4B 5IW1B 2QHLA 3KPSD 2DQUL 3C2SA 1U3ZA 4XBPB 1Y0LB 2XYCA 5DHVH 4KK5C 1OGAD 1WICA 3ME0A 2PYFB 3IDGA 3RWFB 3HPJA 3S36X 5ILTL 4L5FH 2BXYA 2XZAL 2MMXA 4Z7OE 4GG6B 3NBNA 2IAMB 4OF6A 2G2RB 1X5LA 2V2XB 2QQKL 4Y19E 5JQ6H 3VXUA 4KKBC 4JRYD 4TSBH 5CEYB 1QSEB 4JZNA 1D9KC 2NXZD 4MXWH 3P4NA 1L6XA 3LS5H 4F7EA 1A6AB 2MPAH 4GKOA 2CXKA 5L2KE 4M1CC 4UTBH 4TRPH 3F7YA 3QNXA 2ZOLA 3FMGL 3WFHA 4GG8A 3VXOA 3QDMD 1I1AC 1WBZA 3B2VL 1NPUA 5JQHC 5J3HC 4P46A 2C5DC 5F7YC 1UCTA 4U1KB 4M6OH 2QQNL 3BZFB 1IAKB 5D7JB 1BOGB 3LMJL 1I3GL 1N6UA 5D7LA 3H42L 4UB0H 3VD5A 5DK3A 1WQVT 2VDLL 4FQCL 5EPMA 5DQ9B 5FA4B 1JGUL 3K4AA 1FHGA 4KRLB 4OFYD 1QO3B 5I76B 4YR6A 3RL1B 4OJFL 5KSAB 1RIUL 1OLZA 4LLUA 4DGIH 5DD3H 2MQ0A 1H3PH 3W0WD 1TMCB 3KLAA 3HG1B 1S7WA 2W07A 1A5FH 2IPUK 4AEHL 1N3NA 3EO9L 1YA5A 1T20A 2DDQL 5A16B 4ENEC 4BELD 3HCVA 4FTVD 4P57B 4N0YL 3TH2T 4KJYB 4Y5YA 2DI7A 3B8SA 2DM4A 2RBLA 1NMAH 2EYTA 4P2OC 5KSAC 2VABB 1PKQE 5HYJE 2W9EL 1ZHBA 1BJMA 3LSOA 1JGDA 3UTSE 2DYPD 1WCQA 4PG9B 4PGBA 2MKWA 3DX8A 3PWNA 3S37H 1WLHA 2I5YH 3TNMA 3WFBH 3DO7A 1T21A 4Y4KA 5JR1H 3ULSA 3UYRH 4N0CC 4PJEA 3DVNA 3KYNB 5BV7H 4XZUA 5LGHH 1Z6JT 1I8IB 2HN7A 4GG6E 1G7JB 4GAFB 5DMGD 3VFOA 1PZ5A 2WQRA 4G7YL 1UWEH 4XNXL 5F1NA 5DD0H 1KTKE 3K81A 3GJFB 1RURL 3WNMA 2AK4E 1TVHA 1XGPB 4CDHA 2R9HC 2JLLA 2BSSB 5SWZE 2BCKB 4P2QE 2ERJC 1A3LH 3ARDC 2H32B 2ADFL 5FYJH 5FYLD 4NJ9H 4DFHA 2ATKB 1TZIA 3NFPB 4KKLD 3BKCH 2AK4A 2HT4C 3O6LH 4GRMB 3ZDZF 4D0CB 3E0GA 5JORB 5JXEA 3PNWA 3DSFH 3BHBB 1NGQH 1YN6A 4QLRA 4ELKA 1G1YA 4YHKL 3ARGC 4YPJA 4POZC 5GGTH 3C6SB 3T0EC 3VWJD 4Y4FB 3I50L 2YD9A 5HHXH 4MYWB 3WL9B 3WS6C 4HIJA 1NUGA 4DGYL 4GT7A 5DUPL 4Q6IB 1B90A 4WW1B 3QXVA 2IALB 4R90H 4FTVA 5GRWA 5EU5A 4MA3B 3FFCB 1PKQA 3HAEG 3KJ6H 4RGOH 5T3ZL 4GOSA 4A6YH 5I16B 4HUVB 4ZTPH 4X80L 5AD0B 1Z9MA 3NABL 4G8EB 4KTDL 5HHQB 1B0GA 1QACA 5JDSB 1CGVA 1EZVY 2AJYH 1N0LA 1HXYB 1U93A 3CLFL 1AHWB 1MF2H 2Y7QB 4XWOC 3U2SA 1S9XA 1OPGL 4JJHA 2BNUA 4ZMAT 4D94A 1WAAE 3QBTB 1A6UL 1P4BH 2X70A 3QUMH 1HOCB 3OKKA 4ETQB 1Z5LB 4FNLL 4PJCA 3EYSH 4OCWL 2ADJA 2NY3B 4GQ9L 1XF5B 2H26A 3H8NA 5LGJA 1SM3H 4WHDA 2YR3A 4M5ZH 4HK0B 2E6PA 3UYPA 2DQJL 1KB9J 3MJGX 5GGVY 3WJLA 3QT2A 2AABL 1F4YL 4FS0A 4NUGH 1EEQA 4EKXA 4OZGB 1C7TA 4BFEA 1BLNB 4PREA 1CGSH 3L5IA 2IADB 4H1LA 2EEAA 4XXDA 4Y1AE 3B43A 3V6OC 5E8DL 3DO7B 1H3UA 5E5MB 5F7EL 3VFVB 1LWRA 2C4XA 5HGBB 3LQZB 4X4XB 5GS0C 5IVXB 3QQ9C 1JNJA 2BNQA 4WWKC 3X14A 3IDGB 2VZSA 4HEME 3RWFA 5E7BA 1KJVB 3MV9B 1WZLA 2P49B 2ZCLL 4FHBD 1YECH 4XP5H 5I1AA 1CLOL 5CSBA 4YBLB 3O81A 3DMMC 1FL3A 3KPMA 3M17A 3VGHA 5BZDA 4MD0B 3CPLA 5HHNB 1KOAA 3DHMA 2H1PL 1I85A 1G7MB 3V4PH 4HSQA 4ZPTA 4RIRB 2J4WL 1DBKL 3H9SE 1P4IL 3MRRA 3MXWL 4N0FA 2NPLX 4MWFB 3HC4L 4PB0H 2WBJA 3DROA 1CFNA 4ZUUA 3MODH 2QSCL 3OX8A 1HWGB 3KS0J 1IGFH 2JJVA 4PJDB 3MBED 3INUL 3TZVD 3UTSB 2J6EH 3PWVA 4D8PB 1KB5B 2R0LH 5EORH 3ZT7A 3PWJA 1B0RB 4G9FE 3Q5OA 4TSAL 3VDBA 1U8LA 3SGDI 1FNLA 1S8DB 3JV6A 5CS7A 2NW2B 3T4AA 3NOIA 3GJFK 4AIOA 5D1XB 4GXUN 2Z8VC 1M7DB 1Q38A 1BGXL 1H8NA 2LU3A 4L9LC 5C0AE 3SDDA 4HWZB 4KJPD 4R97B 3G6DH 2JCCB 3HG1E 3TO2B 4PP2A 1NCCL 4CVUA 5DWUL 5JHLL 2DF3A 3KAAA 5ICZB 1S9XB 3S35L 1X44A 4LKCB 1JGLL 3PP4H 3UJTH 3RTQD 2AP2A 5EN2A 5F44A 1J5OH 5JQ6L 1MAKA 3DX9B 1LDSA 1BD2A 3RUGE 3BDBA 5TF0A 1NAKL 1ZHKA 3GMRA 1G7IB 5EIIA 4MZ2A 2R23B 4D0DA 4Z0BL 1A6VL 3ARFC 5EDXA 1YEJL 2AJZB 3UPAA 3VFSB 1YJDH 1BF8A 3J8F7 1LNUB 1JYXA 5J13C 12E8H 2NW3A 1EEZA 3ARDA 3AY4C 4U1IB 1J8KA 4FQQB 4HKJB 1ZHNA 1BLNA 1CDIA 4QHUA 2HT4D 1V7MH 3K1KC 1L9NA 3QWRD 1YC7A 3TPUB 4NQDA 3ULVD 1JF6A 4YUEL 4LSVH 2M8XA 1NBYB 1KULA 4WUKH 2EO9A 3DGGB 2A6IA 3NTCH 4X9FA 2R2HA 3GJEB 3O6KL 5F7LB 1SBSL 3IU3B 3W9EA 3HE7A 1DBML 4DGIL 3G5YA 4RFNC 4NQDE 1GXEA 4P5MB 2ZSWB 1TCMA 4Q9CA 5HYJB 1E28A 4QRPA 3WIHA 3P2TA 2IAMD 2R1XB 5D70H 4RBPK 4OLXH 3PXJA 5EUOB 4X0KB 2YRLA 3PGDB 4ZFZA 2EDDA 3RX7A 1FVDB 3H7BA 3P73B 1W0WB 3D18B 3R06A 1RAMA 5CZKA 5D72L 2GEEA 4BQBA 3B8YA 2ZCHL 5D96C 5KANI 3FRUB 4N0UB 1Q9OB 3ARDD 3EDFA 3H9HB 3OAUH 1KACB 5EC2B 3AAZB 2R2CA 1QHOA 4LGSB 1KCSH 3I6LE 4XCNB 5BRZB 4AEFA 1LO4H 4KI5E 1EMTL 4PJCF 4XMKL 4GG8B 3UTQA 1Q9WB 4KVNL 3U79A 2Y6SC 3O8XD 4KK8C 1EJOL 4NO3B 4X7CC 1CGWA 1QBLH 1VFBA 5T1MA 4WHCA 3VXSE 5KVFH 5DI8A 2EDKA 1YEIH 2ORBH 1XGRB 4OZIB 3HE6C 2YA2A 3V7MA 4NHCH 3SQBA 4P48A 4QXGH 4YR6B 5FFLA 2UY7A 3V0VA 4R8WH 4ZAKB 5FKAA 4JO2H 3VU2A 4CADA 1UENA 1OL0A 3STLA 3RKDC 5DGRA 5ESVB 2PETA 3PG2A 3GSVB 4GAJH 1MNUH 3DXAB 4YHNA 4ZSOE 3LPWA 1DQDH 2JIXB 5F96L 3IJYB 3MJ9A 1KEML 1VEMA 5T3XD 2I9TA 2R8SH 3K8MA 1KCRH 4C54A 2D7TH 2EXYD 2DL2A 4PBWD 3ZE1F 4PJEF 3AXLA 1QKZL 1ZTXL 4HUUA 3TJHD 2EYRA 4FXGA 5IMMA 3IXTA 3Q3GA 4JRWA 5J6GA 4XCYB 3GSWB 5JHDB 4LGPB 5D6CA 2CH8A 2NY4D 3CFCH 4WEBL 3QB7C 4H26B 1TDQA 4XHQA 4OLUH 5I1HH 1NMBH 4LLDA 1WC7B 1YUHB 3I02B 2P8PA 4JFZH 4JDZB 4LASL 4OD1H 2BY1A 5HDBF 1OP3K 4CL7A 3LIZH 1X4ZA 2MCPH 4HEPG 2ARJQ 4N0UE 5E6YA 1EVUA 1BBDL 2NY0B 3LQAC 3PWVB 4EI5C 1VENA 5HYSA 5I71B 4HKXB 5CEZL 2GI7A 2H45A 1CWVA 5BV7C 3CDCA 5DVKA 1J8HD 5LXGH 2DQJH 2E6JA 2HRPH 1ZLUH 1XH3A 1CLZH 4OD3H 1BVLA 3FO1B 4UUJB 4GBXC 3DRQB 3RVUD 2XRAH 1AGFA 5FV2A 1SEQL 4KK5D 4Z7UB 2QSTA 3O6ML 1LEKB 1ZLUK 1UZ6E 4KV5F 3UDWA 4ZOAA 1XMWA 2FIKA 4NUJB 1Q1JH 4HWEH 2VDML 3I3DA 4MDIA 3UTQB 2A6IB 4ZPVA 1JK8B 4H8WC 1ROWA 1T22B 1CD8A 5FV1L 2BVQB 2NY6D 3VFPB 1YEEH 4TSCL 4MA7L 3T77B 2QKIB 3L1OL 5EA0L 4HDIA 2ATPB 3V4PL 3MRNB 4HGWA 4PUBH 4KUCF 25C8H 4N8PA 2ZUSA 2Q86A 3FQTB 2E9WA 4TULL 2X4PA 4HXBH 4HS8H 3IJSB 3CUPB 4NSKB 3NCJL 3JVGC 4DUVA 5SWQB 1IGFL 3INUH 3ZL4H 1IQDA 2XA8L 4WTWA 5E99H 2BXZA 1UEYA 1WVZA 1QVOB 2BSRB 3MLTB 1C08B 4ODHL 1IMHC 4JFEB 4CMHB 4O00A 4F37K 4LLVA 4I0PA 4GW4A 4FABL 2AXGB 2VLJB 3OR6B 5D1XD 4XVJL 4WI5A 4H20L 2YSSB 2VDNH 5EOTB 5ID1B 2E7LC 4YNYB 1EFQA 2QL1A 5GISH 4E0RB 4Y5XB 5C08D 4RMTA 1BQLH 1CYGA 1IEBA 4X4YB 3BP7A 3V4UL 3VE0A 3MR9A 1JGEA 3ZKNC 3PP4L 4EDXA 2L7UA 1I8MA 4PJ5E 4AH2A 3FO9B 3LDBB 3VFWB 1EAJA 3AVEA 1AGCA 3CDGB 3TBSA 5GS2D 1T0NB 1ZT4A 3DRTA 3MNWB 1NFDB 1NAKH 5C08E 3TCLA 2EYTB 2FWOB 5C7XL 3BYYA 2VWEC 2UWEF 3OKLB 3H0TB 1TFHA 4XI5C 3OKDA 5DEFB 3PDOA 5LWYH 4ODUA 3MRCB 3BPNC 4W6WB 2A1WH 2FRGP 3RWCA 1AR1D 1A1OA 3QI9C 3E6HA 3PV7A 5I6XB 4GLRH 4Y1AD 2Z8WC 4ODSL 5FUCC 3G6JE 4I0PD 5IOPA 4X0KA 4R7NA 3WKMH 3CLEH 3FJTA 3D3VA 2C7UA 1J88A 3EOAB 2EDNA 3EYFA 1SBSH 4DZ8A 5TH2B 1FL6A 3VG0H 1S8DA 3RI5K 5C3LD 1G7QB 2YS4A 3G04B 1IC4H 5J1AB 3BRFA 3RZCB 4X5WB 3KXFB 1UGNA 2Y9RT 1ULVA 3BQUA 4R7DB 5D70L 4XBEH 1S7QB 4OLXL 3UTPD 4PRPE 2ID5A 1GGCH 1X5AA 1HZHH 2B5IB 1GGUA 4PGZA 1XCQB 5C0GB 1INEH 4KY1L 4LNRA 2CJUH 1ZEAH 1A4KB 1T6VN 4NRZA 3IJSA 2B0SH 1JFQH 5AWNH 4NYLB 1FE8H 4HV8B 4JCMA 4PRHA 1FCGA 1X6LA 1EO8L 3OSKA 1J1OL 4NFDA 1A6WL 3EBAA 1F8TL 3F58H 4LHUB 4P5TA 1UVQA 1JF5A 1I7ZA 5I8CA 1JNLL 5DHYB 3RGVB 1J87A 4P5TC 3VFUA 3BI9X 1C12B 2X2YA 1WCBB 4XTRC 5IHZA 4KK9D 5CBAB 3SDYH 4UMGA 4HUVA 4OCSL 4NUJA 2VLRA 1LEIA 5EFIA 3SDCA 5MERA 4YPGB 3QQ4B 4HIHA 4MX7A 2W0KA 2Y5TB 1XZ0A 1MLCA 5LG1A 5IHUL 5JPNA 4X6EB 1PEZA 2ZUXA 4F37F 3KDMB 1PEWA 3CFBA 1T0MA 2ORBL 2A74A 3O4OC 2ZUUA 3ARTA 2KKQA 1RD6A 2VE6A 2XA3A 1MAML 1XF4B 5HGGS 4P4RB 5H2BA 3IF1B 4XP6H 3I2CH 4NWUH 4KPHH 4LLWA 2VITA 5F1IA 5F7UA 4YHPA 1FFQA 3EYOB 1N0XH 1G0XA 5C0BA 3FOLA 3O0RH 4C57C 3MSPA 2Y25A 4M7LT 3BKJH 1RJLB 1WK0A 1X5IA 4OZFA 5F7NC 3RU8H 3BRGC 1ZK9A 3CFEA 2CKNA 4P2OD 2VE6B 1DEEA 1VFOA 1L0QA 1T5WA 4U33A 3ARUA 4N90E 4P57A 5FGSA 3V5DA 5IBLD 1Q0YH 4GAYB 1NQBA 3CFCL 1QBML 5JORA 3MRNA 4HGWB 1JUFA 1E27B 1FLRH 4OZFH 3ULVC 1CDCA 3E6FA 4B41A 5DGQA 4P9HL 2FL5A 3BZDA 1SY6H 1H5BA 3S37X 1LO3L 1AO7D 4F58H 4RRPG 2WINB 4X7SL 4YFLI 5GJSH 3OPZL 4AT6B 3I3EA 3QZWA 4TPRH 4G80B 4LQFH 1F4AA 1IAII 3T09A 5C0JB 4AEEA 1HHKA 1KFAH 1IT9L 3SE9L 4JPKH 1A14L 1FLTX 5T1DH 3VXSD 1G7JA 2I27N 4FTVB 3HUJB 5FUOH 5FYKL 1LEKA 1X5KA 2VDQL 3OAYH 4S0TD 5HYQB 1IM3B 2Z31A 2D0HA 4BFIA 4XCEA 2E7LA 2IGFL 4GUPB 2AI0L 4PY8J 5EBWA 35C8L 3EAKA 4XGZA 1A4KA 3IJHA 4M48H 4NRZB 5KTEL 4LEOA 2E7HA 2VDRL 4Y2DD 4O2CB 3W0WB 3R0NA 3VXOB 4PLJC 5CGYD 2R1WB 3O6MH 4HFWB 5DUML 4NQXA 4NNXB 1LP9F 1U8NB 2R0WH 3ZTNH 3UJIH 3O6FA 3H9SD 5TDPA 2KDGA 2A6DA 2D2OA 2N1KA 3GGWA 4Y4KC 4DWHA 4APQC 2CK2A 4NRYA 5C71A 2XZCL 3QQ4A 4MA7H 4PJ9D 3S97C 1QPXA 3LVEA 1SJEB 2JCCE 4OCRH 1AP2B 4PV8B 3NH7L 4PJIE 3QUYD 4U1JA 1H0DA 1MJ7L 4R9HA 1DQLL 1QVOA 4YXKH 1YJDC 4LF3B 3MOQA 5DEFA 1G7PA 1D5IL 1HCVA 1OGAE 2XQYK 4P9HC 3JV4A 5CIPH 1ZSDA 4X7EC 3VGAC 5A16A 2BC4A 3TCXA 3BWAA 2XTLA 1AI1H 1AGEB 5EOCJ 1A7PH 4ISVA 1CD1B 3MGAA 3IDJA 4RMVA 5EBMB 5ID0A 2ICEB 5I8OL 2FGZA 4HC1L 1I4FA 2FECL 1L6ZA 5DVMA 1AD9A 5E8EB 5L88H 1A2YA 4IOIB 1C5DA 2YUWA 3QDGA 3D0LA 2ICWI 4Y8DC 3IDMB 4NRXB 1UQSB 3LY6A 5J11B 4XPBL 5E1AB 4Z0XA 4OD2B 4LIQE 4FQHB 2X05A 1CD1A 1HSAB 3VFNB 2X44D 3OKOB 3MRPB 2VXSL 3RUGB 3TYFA 3HZMB 1P7KB 1EUUA 1KLGA 1ND0B 4H0HB 3HC3L 4D9LL 3RL1A 3X12A 1K4DB 3SKMA 1RK1B 5D6CB 1CZ8H 1DUYB 4L4VA 1ZHKB 3GMRB 1D6VL 3P40A 4JEGB 1JE6A 3V6BR 4QF1A 2DYPA 4Q0XH 3BEVA 1OB1A 1CLCA 1S7XA 4YAQA 4PRIA 4M62L 1OP9A 2WSKA 1FSKC 1NCTA 1G9NH 3CCHA 1HYSD 1IGJA 1YMHB 2YXFA 1MUJA 1NDGA 5D5MB 5LWYL 2V9QA 4U6YA 5DRZB 5C6PB 1T89C 4PRPA 4L3AA 3CIQA 2F19H 4JREB 1Y0LA 1DLHA 1KLFA 4S1SH 4UQ2B 3WEXA 3TO4B 5HY9B 3ZMRA 3S35X 3N0PB 1T5WB 2WUBL 5GGSA 5JLZB 3HZVA 3BIKA 2AKRA 5C0BE 2PF6A 5JOFB 2QLVB 1V3MA 5DJ8A 1IKNC 5DI8B 5HYJA 2CKBB 2JJTA 4MXQD 3F12A 1E6OH 2UWEB 4L8SB 4ONFL 5GRZA 1I9EA 4U3CA 1GGIH 4WWID 3BVNB 3BE1H 4XBEL 2WLYA 2YBRA 5T3XL 2Z8SA 1EJ6A 5BQ7B 2EH7H 3QG6B 3EDDA 5HVWA 5B22A 5I17B 4KY1H 1KXVC 2Q3AA 3AU1A 4CN1A 4K9EH 1V05A 3O9WA 4PJAE 3DV6A 1QFWH 4Q9QH 3IJYA 2FJHB 4S0SD 1XCTA 2IMMA 5C9JB 5F1OB 1ETZA 1SEBB 1FE8L 4PJFF 1H3WM 3ULUH 4G8GA 5H37H 1YEGL 4FFZL 2DQTH 2VH5H 4P2QA 3BKMH 1KENH 4OGAC 1F8TH 3ESUF 4IS6A 1LEIB 5DJ6A 2IG2L 1BD2B 2WBKA 1UM6L 4FZEH 3SGKC 5LQBL 1C7SA 4OZIE 3G6JB 4BZ1L 4PJBE 4F33B 1A9BA 3B9KA 4I5BB 4M61B 4GG6A 1VFBB 3V52H 5E1AA 5K9JL 4MQ7A 4YGVB 1S7VB 2R2BB 1DLFL 5LCVL 2VDKH 4O9HH 4OKVB 5CEZE 1PAMA 3HTLX 5DFVC 1YNKH 3GHEL 2AVGA 4EDWL 4L8CA 3L3KA 3R0MA 1GSMA 3ZKXB 4F3FA 5I8EB 2XWTA 2XN9A 4Z7VF 5IR1A 3DGGA 3O4LB 3SKNA 5ESQB 2YN3A 5EBWB 4NWUL 3TPUA 1LP9A 3FQRA 1JIBA 4KROD 2ZJSL 2JIXA 4C56E 1N0XL 5JNYA 3VG9C 4IMLB 3WE6B 4YO0A 3O0RL 1MCCA 2NY1C 5ICXB 1ZA6B 3EDJA 3VFRA 3ZE0E 5ACZA 3O6FB 5E9DD 3QH3B 4L3EA 3RU8L 2P5EB 3HZYA 1T83A 1HI6A 3PGDA 5FK9B 2AAVA 4MB4A 2QHRL 1G7HB 5IGXL 4O02L 1S9WA 3JWDC 1TCRB 1BFVH 4F15C 5T33L 2WINA 1QFHA 4EZMA 3BN9D 4Y19D 1D6EA 2ADIB 4OZHF 2J3SA 3NZ8A 4Q6IC 1BQHA 5D2NC 3V8OA 1YYML 3W11D 2IANA 2ZUYA 1IM3A 2Z31B 5DLMH 3PWPE 4K7FB 5A2LH 2YHGA 4XVTH 2BSED 3MCLH 1YDPB 4XMLL 4XNMA 5MHSD 3ZDXF 4ZFGL 4TPRL 1S78D 3P9LA 3KLSA 4GS7C 5DMYA 4DVRH 1CVRA 3VXTB 3BT2H 3REWA 1P2CA 5TFSH 5IBLC 2YEZA 1CGUA 2PTVA 1T04B 4GAGL 4XCCH 3U7YH 4P99A 3H3BC 3WJJC 2FEEI 5FUOL 5MEOB 5DR5L 4Q97A 2VSDA 3BZ4B 5HI5D 4ZD3H 6FABH 1XIWC 3SE4C 5C0ND 3TGXA 4RX4A 4OCLC 1BFOA 5DK0A 35C8H 2R23A 4D0DB 5CGMA 5H2BB 2NX5A 4YHYC 3AB0B 3HLAB 3RWGB 5HHQA 4NN7B 4TNVF 5A2JH 2MJWA 1L7IH 5MEQA 2HG5A 3P9WB 3G5VB 4YZFF 4QWWD 1VDGA 4KXZH 4JFFE 1MVUA 2OL3A 2CRMA 1TTGA 1BREA 4J3SA 3X3GL 3JV6B 4JG0H 4E5XB 4JY4B 2VERN 3WO3B 1G6RH 5F9OL 4LLMA 3F5WA 4NBZB 4K23L 3U36B 5JOPE 1K8IA 1UKQA 1U8QB 4JGMA 4JKMA 2FATH 3O45B 3NH7H 4NWTL 3IDXL 4D0BB 3CUPA 3CMOL 3QEQD 4NSKA 2DQGL 3VW3L 5FM5O 3IDJB 5EC1A 1TJIL 3Q1SH 3L3OB 3FQUA 1YMMB 5GGVL 3HE6D 3SQOL 4BH7A 5IB1B 1MHCB 3P0YL 5I9QC 2FEDD 3HG1A 3FTGB 1XT5A 2ED7A 5JW4Q 1TPXC 2HJKA 4I1NB 2Q7YB 4YDLB 4HBQA 3QR2A 5E2UH 5AZEL 3WXWH 4NGHH 4F9PC 4HT1L 2P5EA 2SEBA 4F7TA 5I18H 1OSPH 3X14B 3PNWB 1KIRB 1BFSA 1OQOA 4KKNA 2BNUB 2F58H 5ILTH 4MJIE 4L5FL 4XPBH 2X70B 2VN7A 4Y4KB 1MCJA 2OSLA 4QT5A 1EEYA 4QRTA 4JHWH 3L7EA 5F6HI 2B7DT 2VXSH 3QHZH 4RQQB 2XKUA 4PJFA 4OGYH 4FRWA 5F7FA 2K9UA 1T0PB 1OW0A 1TETL 5KZCD 3D2UA 5CWSA 1WAAA 2O5ZH 5DJCB 1ED3B 3O8XC 4KK8D 3BQUC 3LS4H 1H15A 4G6KH 2MOVA 5B39A 1RJZB 3KHQA 1KIUA 5CEYA 2OTUB 5DJXB 4WV1A 3QJFA 3KR3L 3PWJB 5DRNA 4H8WH 4F7EB 4OZIF 3N85L 4Q0XL 1NFIA 3LMJH 3MZGB 2DQCL 4U05A 5JA8B 3BZ4A 5F9DC 2NY2C 1DZBA 1UB5B 2YSSA 4X6BB 3D5OF 1HHKB 5EO9B 3QI9A 5DMIH 4HMDA 2J88H 4L3EB 4WFHE 2LTQB 4WI7A 3ARBC 4LPXA 2XG4A 1QZ1A 4JFHE 4PV9A 1KN2L 3K2MC 4KRPC 4N5UA 4EVNB 2CO7B 2ZPKH 3SPVB 3EO9H 5C0NC 4WHTA 4UNUA 4NIKB 3NFSH 4P4KC 5SWQA 4NKOA 4AZ8A 3I6KB 3T2NL 1WZMA 5EO9A 5E7FA 3P0GB 1CT8B 4NDMA 2X41A 5FGCB 4HAGA 5JXEC 1G9ML 3GK8H 4NO0D 3P9LB 3L5HA 5A2FA 3TJHC 2OL3H 5KBNC 2HFEB 4RGMC 3RDTB 2W9EH 4F7PA 3BWUC 3CH1B 4CU8A 3OHXB 5DMKA 3ALXA 4KZEH 3UYRL 4BK4A 5F1KC 3DURA 4Z7UE 5E2WL 1NCNA 2JB5H 5FOBA 5HHOB 4IJ3C 4JDTL 4FFZH 5LGHL 1WWBX 3MQIA 1MFEH 4GFTB 3BDYL 4P23A 1WWAX 1FFOA 2OP4L 4K8RC 2WIMA 2IG2H 3QIBB 5C0AD 3MRHA 1NGXB 2APXA 1EFXB 4FZEL 1K2DA 4NC0B 4XI5D 5IIEA 4PBXA 2AGJH 3BSZL 3U0TA 1MVUB 2OL3B 4OQ1A 5T1LB 1MY7A 3OXRB 5EOCH 2GTZA 4IRJC 3V52L 3GMQA 5K9JH 5KSAA 1LP9B 4U1SA 4XMPL 1KTDA 2AK1H 1H3VA 4Y5VA 4KROC 3SKNB 3JWOC 4H1LH 3AROA 1FBIH 3BDXA 3RWCB 1QLFA 5CMAB 3VXNA 4XVUD 4LDOB 2AEQL 2APBA 1C5BL 3MLVH 2A0LC 2WBWB 3P73A 4RFNB 2OCFD 1YN7A 4QCIA 5F3BA 1MY5A 5MENE 3ALPA 3WUWG 3BJ91 1ZT1B 4ERSL 1EPFA 2UV3A 3GMLA 4GRLB 1F90L 1T1WA 4G8FB 4ZXBB 3SEPA 2DRUA 5B39B 4M4PA 4LVEA 1IC1A 5EB9A 3SDAA 3RWJA 5BQ7A 2FO4A 2F74A 3EIFA 4MNQD 1X5YA 2DTMH 1YQVH 3ARZA 2PO6A 4XT1C 1IAIM