1BGXL

Taq polymerase in complex with tp7, an inhibitory fab
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (polymerase/inhibitor)
molecule keywords TAQ DNA POLYMERASE
publication title Crystal structure of Taq DNA polymerase in complex with an inhibitory Fab: the Fab is directed against an intermediate in the helix-coil dynamics of the enzyme.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 30
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1998-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxL01
4U1SB 4NKMB 1WZ1L 3GJFB 1ORQA 3WNOA 4OZFG 4Z76A 3AM8C 4FXGA 1U2CA 1RJYB 3W81A 5D8JH 5ACZB 2YXFA 4NM8L 3NCJH 1AP2A 2XQYG 2MQ3A 4QOKA 4F7TB 2NTFA 3QNXB 1XF3B 4NHUA 3DETC 4XRCB 4UQ3B 4D9RD 4MA3B 4LQFH 4OLUL 4JFXA 4MXQD 1TJIL 4C83B 5C7XL 4LAQL 5C3LD 3B9KC 1I3GH 4G9DB 4QNPF 4MZ2A 3WYRA 5A3ID 1E27B 3BKJL 2ED9A 1ZMYA 2DQTH 5D7JB 4Y19D 5HHOD 4JM2B 3B6SB 2W9LA 2FEDC 4M5ZL 1N2RB 2XTJD 4EN3A 1KEMH 5EORH 1EJOH 2VDNL 1HHHA 5DRWB 4P4KA 2ZUYA 2NY5L 4JLRB 3BKML 3TO4B 4NSKA 3ULVC 1J0IA 1SJXA 5FHAL 4TSBL 1ITBB 5JQ6H 1F4WH 1MEXH 1T04A 3CFEB 2RCSH 3SGJA 1I9RH 3IAPA 1SJEB 1VSCA 1MRDH 1CICA 1FO0L 3RFZC 3OL2A 4D0BB 4LHQB 1U3YA 3IFPB 4V2BA 1LP9A 4ZTPH 3EHBD 2F53B 1DBBL 1RK0B 5FYKH 3AM8A 2DLHA 3W0WA 3PF2A 1DR9A 4IRZL 2H32H 4GBXB 2VAJA 5C0JA 3CFBA 3V5HA 2VZOA 4Z95L 4WWKB 5K9QI 3T0AA 3MLTA 5HI4D 3V6FA 2JJVA 3RL1A 4ZFZA 2VZVA 5F7LB 3VRIA 1K5NA 1U58A 3B9KA 3NZ8A 3P11H 1I4FA 3KDMB 4M7ZC 5KVGH 1KT2B 4RGNE 2O61A 2QSVA 2R23A 4KK5D 5BRZE 3D1MC 3HLAA 4RMVA 4X98B 1J1XL 3ORJA 2I07A 2AVGA 2BVQB 4HUUB 1OARL 2KQNA 1CL7L 1E4WL 4I5BB 4F9PC 4RWYL 1A0QH 5ITFB 3RWDB 1P4BH 2B4CH 5INDA 2HVJB 3JV6A 4QCIB 2ZUWA 2XQBH 3BPNB 3OPZH 4OCRH 2A9NL 4P2RE 2FBJH 1EAPB 2PW1B 4R97C 4NBXB 3HPJB 5LAXA 3AUVA 4QY8A 1QSEB 1H3PH 4H5SB 4EUPA 2XRAL 5D7KD 5D7LA 4ODHH 1CGYA 2CRZA 1RIVL 4YE4L 3T0DA 4JDVA 4LVNB 4UOJA 3QFDA 4CN1A 3V4VL 4KY1L 3T2OA 5KG9B 4MAUH 1FP5A 4LLMB 3QEGL 4ALAL 3WXVH 4JPVL 1HQ4A 1YQVH 5D2LF 4LEXL 4ONFL 3PV7A 1KPVA 4PJAF 4HXBH 1KC5L 1CFQB 3MUGA 1OCWH 1AGDB 4FQXC 1A6UH 1JPTH 4KK6D 4MJID 4DVBB 2OMNA 2M26A 4MMXC 1FG9C 1V3JA 1MCWW 1MLBA 4F9PA 1I8MB 1F11A 4ELME 3VFRA 1WEJL 3WFHB 1KYOJ 5DT1L 4OZHE 3RU8H 2HFFB 5EB9A 2X4TB 4HS3A 1B0WA 2P8PA 4POYA 3SKJL 3WN5B 2FH8A 3X3FL 4BFIA 1HHIA 1G9NH 4X6BB 4ZUTB 1I3VA 1YPZE 1YEFH 3MMEA 5E4IA 2RJMA 1Q9OB 3I50L 4P23D 5E7FA 5IW1A 2UZYB 3HHRB 4JFZL 1WWWX 4RX4A 5C0IA 4IOSD 1T1YA 4GXVL 2LTQB 3KPMB 1Q94B 2WANA 1EZVY 3QDHA 4PTTB 4TUJA 5E00B 2CKNA 5JLZA 3MLXH 5TDOB 3T3PF 3QDGA 3TT1H 2VZTA 3OGOE 4JZNB 4L4VE 3OAUL 3H7BA 1UVQB 3OKLA 4YNYA 4ZOAA 5D7IA 5JO5A 1HCFX 5EN2A 4FQXA 5E2WH 1V3LA 3BHBB 6FABL 5MENB 1S7QB 4NZUL 4FZ8H 5IWLC 2XG4A 4LVOB 3ZKNC 2BFVH 4K7PX 3EIFA 3L3JB 4QRRE 2CR3A 5ANME 4G6AD 3QDMD 1Q9LA 2H1PL 1PZUB 5HHMB 3E2HB 2B20A 3MACH 5H2BA 3FKUS 3PWPA 1OQOA 4LCCB 4PJCF 4XWOD 1G7LB 1N64H 3H0TB 5FYLL 1UWXH 4R3SA 4EJ1C 5IJKC 5FUZH 5GZOC 4X80H 4X83A 4Z7VB 2EZ0C 3G6AA 5E03A 4JANA 3BAEL 2DTMH 4JZJB 1R3KB 4KKAC 3QR2A 4QXUH 2OYPA 4ZAKD 3KYNB 3UX9B 4YHNB 3T2NL 3GMQB 3UBXA 1F6AA 1E4JA 3IXAB 3WDJA 1JZ7A 4J4PD 3U46B 3VXRD 1CG9B 4HJ0C 2OTWB 3C5JA 3JUYA 3O2VH 5T1KD 3TBTA 3TBWB 1B2WH 2M1KA 1GGYA 5AZ2H 1WBYA 4MNHB 5D1QB 1RVFH 4JRXA 2ZNXA 2YPLE 2NXZB 5I30H 2Y07L 2D7NA 4MA1C 5IWLA 4UIKL 4I0PC 2N1KA 2XTLA 2XICA 5DVOA 2FX9L 2BOBA 3CU7A 5J57B 2R0KL 2X09A 4LSVL 4QRTB 1FFNB 2EYTA 2ZUUA 5D9SA 4NNPH 1JPSL 1ZAGA 4G6KL 3WIFA 4JQXC 5KS9E 3ILPB 3MRCB 2I60H 4N0FA 2C4XA 2QSCL 2XY1A 1EFXB 3EFFA 1EEYB 3NABL 4HUKB 2BZDA 4XMKH 8FABA 5IJKA 3JWDC 3W82A 1ORQB 3TLRA 1U6AL 4JDZB 4Z76B 4DJMA 2I24N 3U36A 3P9MA 5BO1H 3HR5B 4UNVA 5DD5H 2FWOA 3S7GA 4PYGA 3RHWF 3GSNB 5I19L 1NMAH 1X5IA 1ZSDA 1AP2B 2PNDA 1XF5A 4NHUB 5TDPA 4NHCL 4B53A 3BXNB 5JNYB 4WUUA 4XMPL 1DDHA 4G5ZH 2OJEA 4HFUH 1E6OH 4RGND 4MVBD 1CT8B 1JGLH 2HVKB 5EOQH 4X7FC 5BRZD 5MEPA 1JNNH 1XIWC 1S5HB 2C3VA 3ZE1F 2R9HD 4HG4J 4DAGH 4YXHH 4GKSA 3MXVH 3K8LA 4JO4L 4WDIB 4NCDA 2PYEE 4I0PA 1MOEA 1FE8L 1OOAA 4OV5B 3QQ9C 3IJSA 3WIIL 2YUVA 2NXYC 1CLOL 4WW2B 3VW3L 2DM2A 2HJKA 4JQXA 5L0QB 3ULUL 4E42A 5J4MA 1YMHB 5KANG 3CH1B 4X6CE 5DD1H 1CICB 2CGRL 2W0LA 4ORZC 1H3GA 1T6VN 2BY3A 3WSQL 2DQCH 4RFEA 5T1DL 5DR5L 4Z78A 3JTSA 3I3DA 2YD7A 4OBRA 4PJFA 3BSZH 4PS4H 1YY9C 3D9AL 4QO1A 5C0JB 1MJJB 2A9MH 4M6MH 1YC8A 1FCGA 4DFIA 1IL1A 3MRRB 3TZVB 1K5NB 4KMLB 2VLJA 5DJ8A 3NZ8B 3PQYA 5LCVL 1G7HA 2O61B 2R23B 5C07E 3EGSA 2R8SL 3GIVB 3O3AA 3FN0L 3HLAB 5HGAA 1UC6A 3EOBA 1U3JA 2JB5H 3GI9H 1TZHA 2OSLA 5E8NA 3HI6L 4Q9CA 3UJTH 3ZTJG 1U91A 4LCYA 3JWNC 3VFGL 3P4OA 4PG2C 4BZ1H 5CWSA 4QF1A 1Z0MA 2ADJA 3IU3A 1FFPB 3S3SA 4DW2H 4F37K 1UFUA 3EYOA 2IQ9L 5LAXB 1DQLH 1BQLH 4WFFE 3SKNA 2V2TB 2YD2A 1VERA 5E2TH 3O2DA 2VXUL 4EUPB 3UDWC 1TVHB 3H3PL 5D7LB 1MI5E 1ZA3A 4JM2F 5F8RC 3SO3C 5KTEL 1I7TA 4WCYL 5L6YL 4PJ5B 2XXMB 2YRZA 4JDVB 3SKOA 1AH1A 3NZHH 3WFDL 3QFDB 5IFHL 1NGPH 3WIHL 2HT2C 3MV7B 1C7TA 2CK2A 7FABL 3HCVB 5JOEA 1DBMH 2BNQE 4FXKA 3LY6A 2DMCA 2GEEA 5LWYH 3DVIA 2V2XB 1RHFA 1VHPA 4L4VD 4YEFA 3WJLA 3DRQB 1KTLA 5B8CB 3FB7B 3MUGB 3EO0A 3U7WL 4XGZA 3QNZB 4XC1H 1V7MH 4NN7B 1GZPB 4Q9RL 1U93B 3ECBA 4NZTL 3QWQB 3VFTA 2YSSB 4QRRD 5C0BB 3VFRB 1KCSH 4CW1A 1GXEA 1WIUA 3FRPG 3LV3B 4JKPH 4HS3B 2P8PB 5I18H 1QLEL 4QKXB 1EEUA 1NFKA 3WL9A 3OKKB 3KPRA 1LO2H 3KHOA 3CLFH 1HHIB 1CXLA 1FRGH 3C09B 3DMMA 3UDWA 1WK0A 2GSIB 3T2PA 1FNGA 2R2BB 1BP3B 2EDJA 5IW1B 3U1SL 1W72A 2PYFA 2NX5B 1CLYL 1T1YB 4LVHC 4FG6C 3DX6B 4S11A 2EKSA 5DZNA 2OTUB 1LWRA 1RULL 4M61A 2DBLL 1TTGA 4MLSA 4CADB 5DEFA 1FGNL 4JQIL 5JO5B 1B0GA 2A73A 4GAFB 4L3EB 5FKAB 4A2LA 2P5EE 4Z7OE 3C2SA 4W4NA 5IOPA 3FO9B 1IGJA 2A38A 1BLNA 1X6NA 1AXSA 3IU4H 4ZFOB 1HEZB 4ZS6D 4HJJL 4JGJA 1MWAH 2ZZUT 5D1ZC 3MRNB 1U8OB 1A9BB 1Q9LB 5IK3A 1ZT4B 3TPUA 1CDBA 3SGEI 3UTSA 4HK3N 3HNVH 3MOAH 1FNEB 1LK3L 4Q74A 2VC2H 2BC4A 1YEKH 1BBDL 2CDEB 2FECL 1X4ZA 1ZWIA 4GKNA 1LEIB 1NAMA 1CDJA 43C9B 3G6AB 3RA7L 3LKPA 4G8EA 4KK9C 3SKUD 4XP1L 1MFEH 1AJ7L 5TGBA 5I76A 1UACL 4YLQT 4ZOCA 1AGEB 2XWTA 3PWNA 3AS3A 1Q1JH 3B9EA 3R06A 1IQWH 3HC4H 5F7NC 2P48B 1F6AB 4FA8A 1YEJL 1IAIH 3PL6D 1HKFA 4OCYL 1DEEB 1RHHB 5D1XD 4X9IA 4ZYKB 3HZVA 2FDBP 4ZUSB 5E0QA 1WBYB 5I1HH 4DUXA 1H9VA 4M7JH 4NM8H 3D69B 1I7ZB 4R4ND 2V9TA 1MFBH 1IAIM 5D2NB 5GRVK 1KJ2A 3BN3B 1IC4L 3IFOA 1MHCB 2DYPD 4P2QA 5C7XH 4LAQH 1VGEL 1NFDA 4KPHL 5D1ZA 4R7NA 1J05B 2A1WH 3QG6B 4M8VA 3H2WA 3CH8A 3NA4A 5JIKA 3PIQA 1BHGA 2V7NA 4KUCD 1XGRB 2OQJB 3ARFD 3EFFB 1EJ6A 3OB0K 4UDTA 8FABB 2VDNH 3UP1A 2X4PA 4R7DA 1KB5H 4KJPD 2GTZA 1CFNB 1NCAL 3F7QA 5GS0C 3V6BR 4HKXA 4HS6A 5FYJL 4X8XA 1AC0A 5K9OA 4HF5H 5SV4A 5J6HB 1FSKC 3MPCA 3W5MA 1XF5B 5C0CA 2DQFA 3VXPA 1FO0H 3VI3E 3MV8B 1R5WA 4N8PA 1DDHB 3MJ9A 3IDJA 4PP2B 5C07D 4E9LA 1X3DA 5HYJB 4QXWA 4BZ2H 2MKWA 4IRZH 3FCTA 1ZGLB 1FGVL 4UINL 5JR1L 4PJ8B 3TYGH 3RZCD 1I3RA 4Z7VF 4OZFA 4U49A 3RNKA 4Z95H 4OF7A 3T3MF 5IEKB 4JFDB 5E6IA 1VFAA 3PDOB 2DQUL 1JIBA 1UM5H 4AQOA 3CFKA 3B9AA 4Z0XA 3P0YL 1T6WA 1JK8B 4NKQB 4WFFD 1NC4A 3CNKA 1MRCL 1UM4H 1OARH 2EE3A 1CL7H 3RIFK 4RWYH 1CFBA 5K9KB 5JHDB 5EC2A 1MI5D 3RIAF 4IBLT 1INQA 3QPQD 1LEGB 1TQBB 5C0EB 4YHPB 1A22B 4IS6A 3REVA 3MRHA 5HHPA 3H3KA 1SJHA 2J3SA 4PJFB 5EUOA 1ZK9A 4UI2A 2BNQD 5IT2L 4LF3B 4ELKA 4Y1AB 2D7TH 5CUSL 1I1FA 1UXWA 4FZEH 3O4LE 3HNSL 2OR7A 4Y4KC 5KJRH 3G5ZA 2XRAH 4PJGA 5DJCA 1MVUB 3PQYB 1BD2B 2Q86B 2Q3AA 1XGUA 3IDGB 3RGVD 2HKFL 3MRJB 4S2SB 4QHMB 3O3AB 4N8VG 3EW3B 3GB7B 5HGAB 1A7NL 1G1YA 5I71C 3SY0A 2ENSA 4KROD 2YEZA 4WU7A 3QFJE 1T89C 5FHBL 3MRLB 4LEXH 2WUBL 2X7LB 4UT7H 5E8NB 2J4WH 3KNBB 1U91B 4LCYB 4X6DB 3X11A 1NGQH 3WE6B 4P2YA 3UEZA 5DGRA 1OP3K 1I7UA 1NGYB 3UZQA 4OV6F 5CINL 5CJ5A 5GXBB 1EIBA 4OFYA 1WEJH 3W2DL 1ZA3B 1JHKH 4JHAH 5DT1H 3D5OF 2YMXL 1EUTA 3TVMA 3WFCH 5FO7A 3CSGA 3SKJH 3O9WB 3O8XC 4P57B 5EU7C 2EDKA 3CX5J 2L7UA 4F3FB 4WW2F 4DKEH 4Y4KA 4S1SL 4HXAL 5CS7A 3T77B 5BMFL 1NPUA 2JIXD 5CBAA 4PFEA 5I1IL 3EDKA 5DD6A 3LPWA 4JFZH 3EO0B 3CVIL 2P5ED 1LO4L 5FGCB 4XNUL 4OF0A 1JPGA 4QGYA 2IPKA 3ECBB 2EECA 1OAYL 2WWMD 2YA1A 2OM5A 3QIBB 1R0AH 1EGJA 4AMKL 2N7BA 2R4RL 4PG9B 3TYFA 1ACYH 3PWUA 1A2YA 4X4ME 1QSFA 1RZKL 1UZ6E 2EDHA 3VCLA 3CK0H 1IAKB 1KELH 4LSPH 4H88L 1QEWB 3WL9B 3H7LA 3WHXB 1JI1A 4LRNL 2UWEB 3U2SA 3O3EB 2YWYA 3SCMC 4L3CA 3DMMB 4YHYB 4TNVF 2APBA 4J3VA 1S7UB 1TIUA 1H5BC 1W72B 4L8CB 2NY1B 5HI3C 3RVVD 5HHXL 1QLRA 1WC7A 1SEBA 3GHBL 4I0KA 4KQ3L 4QEGA 2C4FU 2ICEA 4U05A 4ONGH 5FYLH 4YXKL 4DCQA 1G9MH 4M1CD 3MGTA 4M61B 1NBYA 1T03H 4P3CH 1IVLA 3ZHDA 1JRHI 3F8UB 2A73B 2FIKA 4Z7UB 1ZHBB 1BLNB 4CMMA 4AIOA 2ZSVB 4P5KA 1EX0A 1KN2L 5KSBE 5DFWH 3QG7L 1MVFA 1INDL 3TPUB 3QIWC 4FQIL 3P2TA 3UTSB 1A02N 1LHZA 4YUEL 3VDCA 1MFDL 1NLDL 3TBYA 5BJTA 3CSYA 3CUPA 3PABB 2QJDA 4UIKH 1F3JA 3ZL4H 7CGTA 1ZT7A 3SCMA 4GKNB 3WFEH 1MFCH 3B9VA 2V5TA 4LSVH 3GMNA 4PRHD 1H5BA 3E3QC 5I16B 1JPSH 4KJWD 4Y88A 4HCRH 3WLWD 5TGBB 2GTWB 4ZNCD 4EDWL 3QHTC 1OPGL 2XWTB 4YX2L 2D31B 4YO0A 3EJZC 4OKDA 3IVKA 1LO5A 2DQEL 5C9JA 4PY8J 4PRDB 2LFGA 3BT2L 3UTTA 2IAMD 4Z6AT 5LGJB 3GNML 1TLKA 1URLA 1T7ZA 2O5ZH 2BDNL 1U6AH 4Y89A 5EG6C 3QUXB 1JBJA 4LASL 5DVMA 1L0QA 3SOBL 2XKUA 3CSBA 4WO4C 4HIJB 4YFLF 4S1RL 1RIHL 4XMPH 5GSRB 3VGAC 1KLFA 1RAMA 5IVXB 1NFDB 4R7NB 5DHVB 5I74B 4MNGA 3QUML 3U7AA 3AXLA 1DUYA 4LLDA 4NQTA 4YDVA 2JK5B 3QIWA 3G5YA 3SDYL 4OJFH 2PCPB 5F7FA 3DSFL 2H41A 4XBEL 2BVPB 3OMZA 5CZXD 4R7DB 3WIIH 2NY7L 4U7SA 2GTZB 5I75C 1CLOH 4OKVB 4ORGA 2XZAL 3MLYL 3VW3H 3AGVA 4PUBL 4HS6B 4KV5F 3ULUH 1RURL 1BFSA 1ZLUK 4K3JH 1EHLH 1RZJC 3O4LD 1KCRL 3VXPB 1MJ8L 3DLQR 2CGRH 3LN9A 4Y4FC 3TA3D 4RRPA 1QZ1A 5L2JB 1P4IL 3RWGA 1J18A 3S35X 3WSQH 5T1DH 1GZQB 3K80A 5DK0A 1RUAL 5FM8A 1R5IA 2VDKH 3NTCH 4WIQA 1KN4L 1OTSD 3IT8D 5CHNB 1YN6B 4PY7A 5TQ2L 2ZCLL 3BIKA 3D9AH 4WO4A 1JNLL 4XWGL 3RNKB 4NJAL 4KC3B 5IMOA 1G0DA 4E41E 1Z3GL 4XB8A 4P3DA 3QEHB 5E6IB 3LIZH 3UBXI 4PRNA 1NCCL 1NGWA 3MGOA 1FVEA 2X4UA 4S1DC 4U3HA 1G7QB 2ADGA 3HUJA 3QH3A 4DN4L 5MEOB 2EIEA 2GUOB 2R8SH 5TFSH 4XCNA 3STLA 4U2YA 3FN0H 4I4WA 3S34L 5EOCL 3P4MA 1UZ8A 3IB4A 2E6PA 1NLBH 2R39A 4H8WC 3GSWB 4R4BA 1UT9A 1MCLA 3OXRB 4YHKH 3OJ2C 5EC2B 1OLLA 1MCPL 1INQB 3HI6H 4WVRA 3S37X 5C0RL 1T1ZA 2Y6SD 1A14H 4JY4A 3REVB 3VFGH 2MQ0A 1SJHB 1QA9A 1YEIH 5HPMA 3O6FB 1KEGL 4I3RL 3L3IB 1FYHB 3CVHL 2FL5B 1CGVA 5T3ZL 1LNUB 4LU5H 5KTEH 4I0CC 4OLYL 3IDMB 4KH2A 2NY2C 5L6YH 5DWUL 4L8BB 5JPNA 4OB5L 3F62A 4HC1A 1NKRA 3MRDA 5LQBH 1XGUB 2NLJA 3J8F7 3N06B 4KRPD 3HZKB 3WIHH 4U6VL 1H3VA 4Y8DC 1TNMA 1WTLA 2AJSH 4WU7B 5F3BA 1QKZL 1TDQA 3L1OL 3BN9C 5C71A 3Q3GA 2CPCA 2FB4L 4DGVL 5CJQL 3RL2A 2CIIA 2IH1A 1LMKA 1AR1D 3VXUE 3B9DA 4K3DH 3QJFA 3X14B 1S9YB 2DL2A 1HH6B 4JDTL 4PGEA 4W4OC 1WZKA 4Y2DB 4P5TB 3K3QA 5GGVY 3TVMB 4UNTA 4JPWL 1F4HA 1IM9D 1QLEH 5FO7B 3QXDA 4LKCB 3DRTB 3D39E 1HWHB 2I5YH 5HVWA 2K7QA 1JWMA 4LPXA 3CXDL 4XXDA 1C1EL 4GFTB 1UH2A 4MDJB 2WINB 1OF2A 3K4ZA 5GJSH 3FT4A 1YN7A 2IEPA 3HA0A 3DXAB 5C08E 1CLYH 3M1BA 5F7MC 2IPKB 4Y8AA 2X1OA 5LVEA 3BVNA 3LEVL 2APXA 4Q7DA 1WWAX 3VGGA 3HE7D 3THMH 2B8OT 1RULH 4PJFF 1FVDA 2XV6B 3RBGA 1FGNH 4JQIH 5IQ7H 1E4KC 5I2IA 1CVRA 2CRMA 3PWUB 1AGCA 1A2YB 1DANU 1MNUL 2GY5A 1DVFC 1YMMA 4TTGA 5D4QA 4POZD 1JWUA 1KPRA 4A6YH 3S88L 5C09A 3QUKB 4PV9A 1KTRL 5JXEA 3HAEB 4ODUA 4W4OA 3CXHJ 1QLRB 1WC7B 3OKEB 2R1XB 5EOCJ 1DTUA 4BK5A 3KPLA 3ARWA 2DQGH 1KIQB 5DYOA 3UTQA 2CO7B 3FRPA 3SN6N 2AKRB 1CE1L 5HHQA 4DCQB 1IEAA 3LH2L 3RAJH 3FMGH 1NBYB 3IRZA 1Z5LA 5D5ME 4WTZG 2AK4E 2EDBA 2NZIA 3F12B 3CC5B 4FNLL 3U9PH 3NCYP 2APVA 5BS0E 3QRGH 1JGEB 1H15B 1UACH 3FHAA 4J6RL 3AREB 1DQQB 4N5ED 4L29B 2FIKB 3ARGC 3U4EA 1HI6B 4I9WE 2WBJB 3HFMH 4WNQA 1J1OL 3JV4A 4F57L 1O7SA 4JPKL 1XH3A 1U3HD 2VIRA 1E4KA 5D71L 2YBRA 1KCLA 1UH4A 5I8OL 1DVFA 5FIEA 4RMQA 1WFTA 1VACA 3BUTA 4NYLB 2XWBA 2VXQH 1CD8A 4N0UB 2QADB 1Q0YL 2W60A 2ESVA 3RWEB 5CEZL 1F3JB 3TO2A 1ZT7B 3FOMB 1IC4H 3ZE2F 4OLEA 1KIPB 3O11B 4Q9QL 1VGEH 2VB5A 4KPHH 3FT2A 1JUFA 3MROA 4NQVA 4P48A 3MNVA 1F90H 1H8OA 3JTTA 4HAFA 2JF1A 3GGWB 3RWHB 3T8XB 4ISVB 1YUHA 4X7TA 4HJGB 5GS1C 4DUVA 4WFEE 4QHNA 5DD0H 3A0OA 1NCAH 4X99A 2AEPH 2RFXB 5DF0A 1J9CT 4HUWA 2UWEF 5FYJH 1MQKH 4MAYC 4XPHH 4TRPL 5DRNB 1VPOH 4E41D 3ARGA 4IJ3C 4ZPTB 4G43A 5L7XL 4ZSOE 1KJMA 2C3GA 4OSUL 1WBXA 4DGIL 4EOWL 1J8HE 4NBZB 1ZLSL 4F7PA 2Y25A 3VRJB 4HMCA 3H9HB 2EDXA 3Q5YA 3TWCL 5I1DB 1DUYB 4LLDB 5F9JA 4X6FA 2EDQA 3RGHA 5JR1H 1MCRA 3OB0H 3U83A 2FZ3B 3UJIL 3DVGA 2IH3A 2B4CC 4PGBB 3RDTA 5EZJB 3C5ZA 1JGUL 3ARDC 3GMPB 4P99A 3WFZA 3T1FA 3LS4L 4Z7UF 5B38G 3HAEG 1NCTA 4L1DA 2QR0A 1IEBB 3GSOA 4MXVE 5CAYB 3STZA 1JF1A 5EBLA 2DLIA 5KZCD 3GI8L 3X13A 3OAYH 2GJ6B 2G60L 1MRCH 1UXSA 2J5LB 2ZP0T 1T22A 3AU1A 2E9WA 3UPRA 1A6TA 4HKJA 3BGFC 4QOKE 3TV3H 4CVWA 2OS7A 3RWGB 2J8UA 2ITDB 4OF8A 4MB3A 1A4KB 4PBVC 1FNFA 5EO9A 2Z8SA 3TJEL 4KQ4L 2H32A 4LIQL 1NEUA 4MAYA 5IT2H 3MLRH 5DMJB 5DUML 4F58L 2EYRA 5IMOB 3MLWL 2FD6L 2G75B 1TCRB 4K2UL 3QAZC 1NGWB 1FVEB 2AI0H 2O5YH 2ADGB 3HUJB 3QH3B 4XPTL 3D85B 4UV7H 2HKFH 2DN7A 1S8DB 2FGWL 3R8QA 5ESVB 1FZKB 1QBBA 3T0WA 3VXUD 4AIZA 1HILA 3M8OL 4Q9BA 3BI9X 4Y19A 4FXLA 5B3JE 3KJ4C 2VE6A 5FHBH 5TF1L 1P6AB 2WUBH 4RAUA 2Y23A 3W39B 4U33A 2VLLA 3L7FA 5IM7B 4Y4HB 4EXKA 5IBLD 1LP9E 4RMUA 5TDNA 3D39D 1HK6A 3W0WE 5IVXF 1NFDF 2ZCHL 1EO8L 4TUOA 5HVFB 3RP1A 2GCYA 15C8L 4L8SB 5DQJA 2LU4A 1S7XA 1WT5C 3W2DH 5DHXB 3K8MA 4WHTB 3A6CL 4YGVB 5C08D 5JW4Q 2YMXH 3MRDB 2NLJB 2XKSA 3U82B 5IHZA 1CDHA 1F4XL 3CDGB 4UT6H 2Y5EA 1L0XA 5GGRY 5EDXA 1BX2A 3LB6D 2H2SD 5BMFH 5F3BB 3OQ3B 5E08H 3NCFB 3RVWD 5D7SL 1FL6A 3CVIH 1LO4H 3Q3GB 2X4RB 1J1PL 3FB5A 3ULVE 3RL2B 4HH9A 3QWOA 5CD3B 5KVDL 4KK6C 1OAYH 2BHZA 3STBA 4R90L 3P73B 3SE4C 4WUKL 4N8VA 4AMKH 2R4RH 5CEYA 3H9SE 1DBJH 5KOMC 4HDIA 1B0RA 4LOUD 2D0FA 1BPVA 4CBPA 3QXDB 1E0OB 4OD2A 2R4SL 3D0VB 1JHTA 3PWJA 3CMOH 1AD0B 1JWMB 4HIEB 4QWWC 2AK4D 4XCFL 3ZT5A 3S4SB 1WT5A 4O00A 5GISL 2EH7H 2KKQA 5FA4A 2R1WA 5BS0D 4UT9H 4HPYH 1LILA 3FT4B 1YN7B 2HKHL 2HN7A 5HHXH 4TOYL 1ZV5A 4G80A 3GHBH 4MNQD 3ZDYF 4X4YA 4U0QB 4I9WD 3S9DB 5GGQL 5TF0A 3SGEH 2BXZA 4HZLB 1TVBB 1XGYL 4X9FA 1R3HB 4YXKH 2PUQT 1YJDL 4HEPG 4RIRA 2HG5B 1NDMA 4OLWL 2AJVL 4AEIH 4F15C 4HUVB 1AGCB 4U1HA 3UZVB 3VWJD 2HTKC 4DZ8A 5MI0B 5C0ND 1JWUB 2RB8A 5IVZA 1KPRB 1EERB 4EEEA 1FPTH 3SE4A 3UYRL 2YD1A 4R2GD 4PV9B 4FP8H 1JPFA 1PEZA 3NACL 1T4KA 3TN0C 2WK2A 5AD0B 1MAKA 3BQUB 1INDH 5MEQA 3KPLB 1BZ9B 5DYOB 1FNAA 2FX8H 1I1AD 1GAFL 3VDBA 4WFED 3QCVH 5F72S 1TITA 3PNWB 1IEAB 1WAAA 1E4XI 5I1JL 1S78D 3QEQB 2CLVB 4O9HL 5EBWA 4D3CL 3QDGE 1CWVA 3INUL 1N0LA 4IMLA 3CLEL 5IESL 2Y36H 3F6IA 1JFQL 5D7IE 2F54B 2IANB 4YX2H 4PV8A 5ABDE 3U4EB 4XNYL 4RWHA 4F7CA 1KG0A 2VDLL 4LPTA 3JV4B 43CAA 3GNMH 2AEIT 2VDPL 3HG1A 5TE6H 2NQCA 5J11B 5J13C 5E4EB 4HSQA 1N0XL 4WI2A 1TMCB 5D93B 2X70B 2Y5TA 3BDYH 4GG8A 1P7QD 4P46D 4RMSA 4FQQA 4NZJA 4JFOB 2W60B 3PWPE 5BOZG 2ESVB 4S1RH 1RIHH 4GRLD 4PGZA 2Q8AL 5SWZB 1YECL 2CDFA 1S7RB 3TN0A 3JTTB 1F6LL 1WGOA 3VD7A 4LPWA 5LGKA 4RMWA 2Z31B 3S36X 1A47A 2QQKL 3FAXA 2KZWA 2FHBA 3SDYH 3QA3B 1A7OL 1L7TL 2R2EA 3DSFH 3A6BH 1YUHB 4X7TB 4XBEH 1ED3B 4E0RB 4XXCC 4NZRL 3S4SG 5ILTH 4KDTC 5E6YA 5FDYA 3UAJC 2R56H 2NR6D 1NQBA 4WJ5B 1X5GA 4G6FD 3MLYH 2YD3A 1JNHB 1RURH 4PRPA 1A4JA 4J3OC 1IAOA 4AH2A 1ADQL 3WEXB 4XVUD 3OX8B 5JIHA 5TE4L 4JRXE 3I3BA 1FH5L 4X6EB 4NQCE 2E27L 4EN3D 4O5LH 1RY7B 5HVGB 3TIEB 1RIUL 4OFKA 4P4KD 1FL3B 4F7PB 5I66A 3VXRA 4AT6A 2A6IA 5KAQF 1EXUB 4KHTL 5T1KA 1YEHL 1G7IA 1KN4H 3BO8A 5TQ2H 4TTDD 5F6HJ 1JNLH 4XWGH 4FABL 4L9LB 1EBPA 1AE6L 2MPAH 3WS3A 3RDTB 2C4FT 3IJYB 5CD5D 3C5ZB 1YZZA 3P4NB 5LXGH 1QFPA 1JP5A 2VDRL 3KVQA 2AJUL 4GRMA 5I1LB 4DN4H 3NIFE 1SEQL 3MYZA 3STZB 4UAOC 3LS5L 3WS6C 4XMLH 1GOFA 4G9FB 4M93B 1UEMA 3QQ4A 5HVHB 3MNZA 3RX5A 4K8RL 3BUYB 1A6TB 3DETD 4I18B 4KTYA 2MSPA 5C0RH 4WUUE 4KDTA 4W70A 1CF8L 3B9KD 3FQNB 5INCA 3BMWA 1QBML 1FVCB 5ICYA 4G42B 4NGHL 1QO3A 1IGFL 3BOVA 5JDJA 2CQVA 4PJXA 4K7PH 3ARVA 3LCYA 1KEGH 2FEDD 5EA0L 1MFAH 3WNMA 3DYPA 3AAZA 3CVHH 3NIGF 3VGDA 5F7HA 5FDWA 3BZ4A 4OB5H 1OHQA 5IQ9B 3TFKC 3GSRA 3ULVD 1HSBA 1QBLL 5LKNA 5GRYA 2Q7YA 1MHHA 4Y16B 2XQYK 5AZEH 4FFVC 4EI6B 3O41A 5LGHL 4NQED 5HHOB 3TCLA 4NPYB 4YDJB 3H9SD 1MUJA 2XTJB 3DV6A 4PB0H 1OVZA 1QFUL 2NY6C 5CMAB 5DXWA 5SWSE 4U1LB 4ETQA 4PREA 5C86A 1HIMH 4U2ZA 2BXYA 1CTNA 1G7PB 2FB4H 3WS6A 4DGVH 2GITB 3GKWH 4Y5XC 4WWID 2D7OA 1BM3H 1TQCC 5D6DC 5LBSL 3IGAA 5JUEL 1U8QB 3OWEA 1S7XB 2BVOB 4F7EA 4MD0A 4JDTH 4S0SD 2P8MB 2VLJE 1ZXQA 5SX5H 4JPWH 1DQJA 1A5FL 1M05A 1A1NA 3F5WA 1BGXH 2EDFA 2BSRB 4NUGH 1DQDL 3MODH 4XBPB 2JCCE 2BSTA 3CXDH 4RAVA 1C1EH 2Z8WC 3WJJC 1BVKA 4EDXA 1CBVH 2VOTA 4K94L 4N0CC 1T5WA 4R8WH 4RISL 1YEEL 5ADOL 5JORB 4IHOA 5E5UB 3ULVH 1KJVB 3MCG1 2ORBL 3QCTH 5H8DA 4CJ1A 3VWKC 3LDBB 3MJ8A 4HLZH 5F7YC 3RJQB 2PXYC 1QNZL 4JQVA 4PJHA 1DEDA 4AEEA 1MNUH 4OZHA 4XNZC 1JRHH 1JGVH 2HFGL 4RX4D 3KYKL 4PRIE 5BXFA 3RKPA 4JO2L 5EZLA 5CGYC 4Y5XA 5MP6L 1QR1B 1ZVSB 4OD2B 3HNTL 3HUJF 5D6DA 2AP2A 5I9QC 2AV1A 3S88H 4NO3B 4YHML 1ZLVK 2R1WB 4N1EA 1G7MA 4ZTOL 4Z7QF 2HN7B 1UA6H 3I3EA 3HMXL 3V4UL 1S9KC 2BNUB 5BV7L 1UEYA 5K59F 3LMJL 4JY5L 2HMIC 4OCLC 4EVNB 5HYIA 4U1KB 3MV01 1CE1H 1LGVA 3LH2H 1FFOB 4RIRB 1NDMB 4MD4A 3WJJA 1NCNA 2MWCA 3QXAB 5KANI 4FNLH 3W11C 4L4VA 1X5YA 2J6EH 2AGJH 4YBHA 1BFVL 2ARJQ 3PWPD 3S35L 5J56B 5TPWH 5DJ6B 1GIGL 5F70A 4H20L 4MJIB 3AMLA 2XA3A 2V9QA 3BPCB 3VWKA 1QFWL 3KPRE 1R24B 4F57H 3S8WA 1MCOL 4JPKH 1MWAA 1JPFB 2QQLL 1QUNA 5HD8D 4QRRA 2PXYA 5D71H 5ANMA 3DUHA 1IBGL 2HH0L 3QRFM 5MEQB 1ONQB 2JJWA 1H3XA 4NN5C 1BF2A 1YQ2A 5F7WC 1FV1B 5KW9L 3OJDA 3FQRB 1IC1A 4PRAA 4YHLL 2Z92B 4PJ7B 1ZVYA 2V2WB 2NY5C 1A6PA 4PLNC 2WNGA 4IMLB 1JTOA 1BIIB 4FQLL 4U1GB 5A2IH 4P23B 4JRXD 1UYWL 4Z7WE 4NQCD 3S37L 4XX1G 3NVQA 3V6ZA 3NGBB 3MSPA 4RGMB 3ZKND 5L88L 1UWGL 2EDTA 3C5SA 5GIRA 4ODWB 4Z5RA 3CFJA 5IGXL 4OT1L 2K3TA 1EHXA 2HJLB 1S7SA 3FQXB 5FYKU 1HKLL 4WTZA 1IMHC 4GG8B 3IFNH 4YH6A 3I9GL 4GS7B 4RDQF 5H94A 2F5BL 4OSUH 4DGIH 5GZOD 5EU5B 3MLSH 1MY5A 2YPKA 2EZ0D 2CDFB 2X4SB 3JZ7A 4FHBD 3TWCH 5JW4M 2OL3L 3ARRA 4H25B 4IRJC 2ADFH 1AKJD 1SJVA 5KS9A 4JHWH 2DQDH 3QDMB 4HW6A 4KKAD 1MCWM 1XT5A 5JXAL 3SGDH 2FJHA 4MXWL 3UJIH 2AV7A 4FQJL 2VXTH 1RUPH 4WUUD 1KB5A 4HJ0D 2A6DB 2ICWA 4CGTA 3UCRA 1IGYA 2YC1A 1J88A 2Q3ZA 4KJPC 5C9KA 1A4JB 1O5DT 3HC0A 5IBTL 4X9BA 4PJIA 1BMGA 4X7EC 2AXGA 3L9RB 5K93A 1X44A 3HRZB 5EIQA 1FO0A 2OZ4L 4YQXH 4ZAKB 4JREC 4I0PD 1A6AB 2HFEB 3LQAL 1T80A 4OTXL 1VADB 1GC1L 2A2QT 4WI3A 4P2QE 3PL6A 2JTDA 3TJEH 4LIQH 1N4XL 3BO8B 4NC2B 2AXFA 5FV1L 4NRYA 1VFOA 3MA7A 4PLKC 1ND0B 1P5VA 3FO1A 1CGTA 5EH1A 5SWSD 2YK1H 4K2UH 4B7IA 5C2BL 2P1YA 1RZ8A 4JKWA 3QIUD 4L8DA 1FFRA 3MREB 3V0VB 4XPTH 3VFVA 2DYPA 3BKCL 4M6NH 4IRJA 3TH3T 4FQ1H 3MBEC 4G7YL 3M8OH 3QQ4B 3GBMH 1S5IH 5HGHA 4FFZL 5C0CE 2P8LA 3ARFA 2B1HL 2VLJD 4TQEH 3CMGA 1XF2A 5I17A 1D9KD 2X44D 2JELL 3MR9A 4U6YB 2YD9A 1XIWD 2W65A 1OQXA 5B38A 1EO8H 3VFOB 2VSDA 15C8H 5F88A 4RGOL 2ATPB 3QQ9D 2NXYD 3BZ4B 4UU9B 3T4YA 4RGNB 4RQQB 5BRZB 2Y9RT 1I7RA 3RGVC 4RAHA 1OSPL 3L3GB 3O41B 2YUZA 5F9WC 2DICA 3Q6FB 5F1KC 4RFNC 4LLWB 5DQDL 1MUJB 3DV6B 1OLZA 5D7SH 4ETQB 3IXTB 2VITA 3JWDH 4PRID 4PREB 3O4OB 3ROLA 3BZEA 1D5BB 4P2RB 2DQJH 3MBEA 1YY9D 4QRSB 5EUOE 3MJ7A 3SDDC 1YY8B 3NCEB 3LSOA 3KXFA 1C5BL 4QRUB 1PYWA 4F7EB 1OAKL 2DS4A 1MI5A 5T1LD 3RWCB 3I75A 4PJGE 4RMTA 4R26L 3IS1X 3KJ6L 3HB3D 1JV5A 4QXGL 3F5WB 4KK8C 4LFHD 3OXSA 5F7UA 5ESAB 4MQXC 3IFLH 2R4SH 1H3UA 1G9MC 2X5PA 4IDLA 4ERSH 2JJSC 2X42A 1D6VL 1NEZG 5GISH 1MCQA 5JHLL 3N1GC 4HGWB 2AEQL 3VFWA 4LLQA 2APTA 4NWTL 1NCBH 1BJ1H 3PV6B 5GGQH 2J8UF 2BOCA 4IHOB 4PGCA 3RGVA 2Y72A 1XGYH 3U0PB 3VI4E 1YJDH 4HV8A 3L5WA 3MZTA 3QWRA 4IRSC 4G7VL 4OLWH 4ELMB 2AJVH 3LD8B 1T5XA 4FQHA 3O45A 2HTLC 3RX8A 3FQUA 3F6LA 5GGTL 2HT2D 3PHOA 3C6SA 3BIAX 3EDFA 3SDDA 5DJYB 2FLBT 3UYRH 3TH2T 1YPZB 5A2KH 4JJ5A 5JW5A 2DQHH 4HWZB 3AS1A 4KKLC 4LPCA 4YHZL 4J1UA 1N6UA 5IROA 2ZNWA 3MUY1 2G2RB 4OGZA 1IFHL 5F97E 2P7TB 1UJ3A 5DK3A 3TGXA 2VZUA 4WHCA 3RUGA 2NNAB 5KSUB 1SHMA 4GMTH 4YHIA 5I1EH 5I1JH 2V17L 4O9HH 3OR6A 1J10A 3INUH 2CKBH 5J89A 5IV2B 3DYMA 1KB9K 4JM4L 1JZ2A 3IDIB 4JRYE 1IEHA 1QSFE 5E8OA 1AIFA 3QXTA 1N3NA 2VDLH 3EJYD 3ZKQD 5F3HA 2VKXA 2EE9A 4X0KB 1MWAB 2VDPH 5FUOH 4APQC 4LDEB 1IC5L 4Z8FL 4FG6D 2BMKB 2ENYA 3OHXA 3S5LA 2MCPL 3V0WL 5EU7E 1UB6A 1OAXL 2AQ2A 2FGZA 4NKDA 1K4CA 1U8HB 2ATKB 4PRAB 4UV4L 5D96C 4PP1C 2Q8AH 4ZPVB 3VFNA 4NN6B 1MCKA 3GFUA 5EBMA 5E2JA 3GSNL 4DTGL 4HCRA 3ULUC 3SDXA 3MUZ1 3V95A 4PJEA 4LSQL 4X5XB 2R2HA 3V6ZB 1L7TH 1KBGL 2R15A 3GRWL 3VXTA 2C3XA 3ES6A 3I02B 3C5SB 4OQTH 3RTQC 1K85A 4ZFGL 3QI9C 3NPSB 2OR8A 5GIRB 2A6KB 5BZDA 1R3LB 4NOBA 1U8KB 1ZS8A 4HKBA 1F42A 5HPOA 3R8BB 2WP3T 2FO4A 2UYLA 1SYSA 3MRIB 1RK1B 2YPLB 2XKNA 3HC3L 2E27H 1LDPL 5E2VL 4ZXBC 3KPPA 5EPMA 1RIUH 5E9DE 5EOTA 4JAMB 2IG2H 5T5NF 2YPKB 4APQA 4KK9D 3RY5A 4AIXA 4KHTH 4L4JA 1YEHH 5ALCL 3OV6A 1V8HA 4YDKL 5KS9B 4UBDC 1CGUA 4PJDE 1U95A 1FG2B 4OD3H 4Q0XH 5EWIL 4FABH 2AJZA 2FJHB 1RFDH 1U9KA 3FFDA 3C9NA 3WBDA 3IDUA 3GSXA 1HHGB 5I8KL 4P9ML 3UTTE 1NFIA 3MRFA 1ZHLB 2A74B 4BYHA 1BZQK 4PRHA 3IDYC 1D5MB 3TPKA 2F5AL 3HC0B 3G04A 4GW4B 3V7MA 4JFYA 1IZKA 5ICZA 3NFNB 4GRWE 1JZ8A 1OY3B 5SWQB 1ITCA 1TETL 1WF5A 4XNXL 3RTQA 3TA3C 5IMLA 3QI9A 1ERNA 2C7UB 1QBMH 3PL6B 4JVPA 4U3CA 5D1XB 3VXNB 3NMEA 4MNGE 4PJ7F 1PJ9A 4NRYB 1F4YL 5EA0H 1KLUB 2YRPA 4NNYA 1U92A 2B5IC 2PYEB 2W9DL 4C4KT 3L3HA 4PD4K 5F7EL 1QFHA 4N0YL 4K71B 3VFVB 2ZUQC 5EZOL 2NW3A 5GS0D 1PKQE 5FB8B 1MELA 1QBLH 4FQPA 3E3QE 4KMTH 3HPLA 4PRBB 4PGDB 1K3ZA 3PJSB 1S7TA 4X6CB 2ZSWB 5F1OB 1MIML 1T7YA 3ARFB 2HRPH 4BH7A 5I17B 5DJDB 2EYSB 3BP6B 5C92A 1DL7H 3ZO0A 4NQXB 1LD9B 4OUUA 1T83C 1BZ7B 3O4LA 5TE7H 4JGMA 3TA3A 3C2AL 1EA9C 3T09A 3P9WB 2BX5A 1MCHA 5C07B 3WIHA 2FCBA 4HHAA 3MXWH 3G5VB 5IMMA 1DQDH 3RZCB 4OFYD 3BE1L 4DZBA 1FYTA 1HNGA 2AJYL 4O02L 4TULH 1M7DB 3BIBX 4K94H 4ODBD 5DJZB 4XCEB 4TVPL 4C56A 4IDJH 2NZ9C 1W0WA 4E5XA 5ADOH 4TSAL 4UB0L 4MB5A 1Y6MR 1Z9MA 3IF1A 3SDCC 4Y5VC 1AO7E 4MGXA 3I6GA 1HXYA 4LCWD 1QG3A 3D2UD 4MCZB 3QJHA 3VRLE 2G5BA 1QLFB 3B8SA 3LKNA 2B2XL 4Y4KD 4CAGA 1MI5B 5DD3L 4GW1A 3I75B 4XVJL 4CL7A 3GKZA 1GRWA 4AL8L 1XGTA 5MP6H 1IM3A 3VU2A 2ERJB 2CK0H 4U0RB 1PX4A 1Q72L 3HNTH 4I77H 2BNQB 3UZEA 2VYRE 1T83A 1KXTB 1C12A 4JN1H 4WEBL 2X4QA 2V5YA 4MCYA 3LRSB 4GSDL 1OD9A 4WENB 3B5GA 4JRYD 3PGCA 5F1NA 1V7NL 3IETB 3HMXH 3V4UH 1GGBL 3LQMA 1A64A 3LMJH 3NFSL 3QZWB 3NIDE 3VH8B 1AGBB 3TBVA 4HV8B 4ODSL 4P4RB 1OAUL 3GIZH 4KFZC 2DOCA 4KROB 3ZLQC 1E28A 4JM2D 3HE7C 2BRRH 4DK3A 3RWJA 4KJQC 4WU5B 5K9JL 4YPGA 2CLZB 5B21A 1GGIH 1BFVH 3O8XD 2BSSA 3S35H 3SDCA 4Y5VA 1GIGH 4H20H 3VD3A 1JGDB 3HKFA 4BZYA 3T08A 3BGMA 5DUBA 4A6YA 1I9IL 2WM0A 2IPTL 1QFWH 4KUZH 2DM4A 3KG5A 4ZUUA 5TQ0L 4LCUA 4GKZB 4M7LT 4JJ5B 2ITCA 4OF5A 5FOBB 2WQ8A 1I1YA 2MCG1 5JOFA 1IBGH 2VRAA 2OK0L 3P30H 1KENH 1T0NB 2HH0H 1TFHA 2RR3A 4AEFA 3D18B 4F33A 1Q9KB 1A3RL 1UJ3B 4Z77A 1IM9A 4CVZA 3H3BC 35C8L 4ZQKB 4CMHC 3GJFH 4AM0A 3L3OA 5CP7B 4YHIB 1P2CA 2BHUA 3EYFB 1A21A 3OR6B 4BQ9A 2V6HA 3CZFA 4NQSA 3EOAA 4G8IA 4FQLH 2XXCB 2DIAA 2JIXB 4N68A 4UDUA 5FV2A 1R3JA 3S37H 2P5EB 3LPFA 1YMME 4KXZI 5E9DD 3KLAA 1LO0H 2OX5A 3L6FA 5L88H 1UWGH 4HBCH 3BPLC 5F3HB 1FL5A 4EI5C 5GSVB 2BJMH 2MFNA 3HE7A 2XWJA 5C09E 1RZIA 2YPVL 1YEGH 5HI3D 1XF4A 3C8HA 3DBXB 4O2EB 1HKLH 4JZOA 1DQTA 1D5IH 3OHXB 3S5LB 3I9GH 1UB6B 3X17A 4WV1C 3TT3L 1HQRA 3UTTD 4WGWB 5I8EB 2E8YA 2HJFA 3GSUA 1KCUL 3MCLH 4MA7L 1SVCP 1UWXK 4ELMF 1F00I 1S7WA 2R2HB 4MXWH 3QUZC 5FK9A 5GRJH 4M4PA 4OZHF 3VXTB 4XAKE 1SMOA 1T0MA 3K2MC 3KHQA 2UVEA 5ID1B 1XGQA 2VDML 1T21A 3V52L 4GT7A 4HKBB 5IBTH 3GMMA 1YPZF 3VFPB 1KTDB 2FO4B 1SYSB 1MJ7L 4OCWH 1BF8A 3C8DA 2C9AA 1MCEA 3LQAH 4QYOB 5EOTB 4OTXH 4BSVA 3MFFA 4EI5A 1GC1H 4YR6A 4X9HA 1VB9A 3JWOL 5HGBB 2NCMA 2PN5A 3TNNB 4U6HA 4U31A 4U1NA 3O2WL 3EJZD 2AJZB 3FFDB 4M6AA 5FECB 1XCTA 3IDNA 2X4OB 4WV1A 1ORSA 1MCBA 4OF6A 4MJ5B 5C2BH 5IKCA 3OGCA 1DN0A 1K9TA 3BKCH 1DN2A 1T7VA 1EEQA 5IB2B 4LRIC 1I8IB 1IGCH 1KPUA 3G04B 5DDHA 4G7YH 4WO4D 3QUZA 1MF2H 1X9QA 1WFUA 4FFZH 4GQPH 4QTHA 4JFPA 3LKQA 5FM5M 5HY9B 2IAMB 3U79A 2JELH 3S96A 2OJZL 1NH6A 1QPPA 4LLVA 4XPAH 4RGOH 1KJ3L 3MRQB 1UCBH 4OI7A 5F1IA 2X1WL 1CGSL 3QXUA 2N4IA 1NDGA 2ZJSL 3BFOA 2VNCA 3PGFL 1AO7D 5GS3A 1XMWA 3GUTA 5IFAL 3O2DL 2G9HB 3QPXL 4Y4FD 3MCKA 4LCIH 3X12A 5KVEH 4U7MA 1FNSH 1F02I 1WIPA 1N59A 5ENWA 1MLCA 1PBYA 5I73B 2J8UE 1X7QB 1I8KB 4Y2OA 2D4FA 4LRIA 4X7SL 4MQ7A 5KSAC 5IBLC 3ARYA 4LHUB 1GHFH 1LVEA 1KIRB 3MRBB 5DK2B 5BVJA 1RI8A 3O4LB 1C5BH 5KS9F 1OAKH 2E8ZA 3FHQA 4OZ4B 4S1DD 5IB3A 4LSRL 3CPLB 3KJ6H 4M48L 1A7RH 3O6ML 3K8KA 4JKKA 3U30B 4MZ3A 2D0HA 3TIDB 2DIJA 3UTZA 4Y19E 1P84J 3QFJB 1D6VH 3VFMA 1NBZB 4LKXA 1IKFH 4LSTL 1AFVL 1II4E 3NA9L 4JG1H 3E1F1 3RI5K 2NXZD 2PO6C 1CXKA 3RVWC 3ZKXC 3U7YL 1ULVA 1W0WB 4NWTH 4HFWA 2Z91A 3I6GB 2HP4A 3QJHB 3VXUA 1PSKH 1W72L 1GGTA 2ZOLA 1FZOA 4Q2ZA 4MS8C 1VGKA 4FTVA 3C08H 4HK0A 4WI5A 5I1AA 3UC0H 1FHGA 5KSAA 4LOUC 2OR9H 1S3KL 5CLWA 5EC1A 1QACA 1YYMH 2BY1A 1VDGA 5H35B 1BQSA 1YDPB 1C12B 1CL7I 1IKNC 5J8OA 4P5MB 2VERN 2QTEA 5DEGA 1M6OA 2MNUA 4QT5A 4W68A 4X6CF 2LAAA 3BN9D 4YHZH 3WLBA 2CUHA 4KUCF 2CUIA 1YMMD 5DUPL 3WO3B 3MJGX 4KRPB 3KYMA 1DJSA 3OSKA 2Z4QA 4H8WH 2JJTA 3IKCA 4NT6B 4FQCL 5C09D 4OD1L 4U1MB 4QRPE 2PO6A 3GBNL 1TZGH 4BSWB 4KKBD 2A83A 3GSQB 4ZO7A 4JR9H 5FCUH 1NEZA 1UQSB 3B3IA 1MRFL 1LK2B 3ZTJH 4HIXL 2UUDH 2KH2B 1T20B 4TNWK 3N9GH 5E2UL 3O81A 5FKPA 4LHJB 4IEFB 3FB8B 2IBBA 4JO3H 2EC9U 1FJ1A 3FTGA 4RBPK 4RFOH 1A6ZB 3DV4A 4F33B 4LHUG 4YFDB 5T5FH 5J9PA 5ESQA 4XAKD 4UIMB 2J2ZA 4UV4H 1BAFH 4AM0B 3FL7A 1P4LB 1BBJA 1IKNA 3CZFB 2R0LL 1JN6B 5IIEA 1S78C 4X7CC 2IADA 3GSNH 4I2XE 3VG9B 4DTGH 4JKLA 1DVFD 3TZVD 1HHJA 4MSWB 4UDUB 4LSQH 1GGCH 5ALBH 5CIPB 3MRPA 3WO4C 4MNQA 3V7AG 4WGVB 4NWUH 2VL5A 5T1MB 2AW2A 1HH9A 3GRWH 1MHEB 3L6FB 3BRGC 1FL5B 4ZFGH 4TVSa 2P42B 1BOGA 5AG8A 4U7KA 5AG9A 4UQ2B 5KSBB 4G8FB 1F58L 3O6LH 2DMKA 4KTDL 3ZYIA 1XF4B 3CFDA 2MHAB 3PHQA 2CMRL 4MWFB 5F1SA 3OKNB 1CQYA 3KPNA 5B39G 2PTTB 4GMSH 5C0FA 3VWJA 1QYGL 4F2MA 1HQRB 2OXGA 3MC0A 1C08A 1WAAE 5FO9B 5T3XE 1IAMA 1T66C 2XZQL 4NO0A 1OGAE 1M4KA 4KJYB 1T2XA 1CIUA 5HYSA 1DLFL 2A6JA 5ALCH 1X5LA 5HHNA 4YDKH 5HDLA 5EBGA 2KZ1B 3ARGD 3SE3C 4PJ5D 2VLRE 3O6KH 3MJ9L 3FO2A 2AEWA 3QHZL 5I8KH 4NJ9L 4S10A 2H9GB 5HHVH 3MV7D 1L7IL 2Z93B 1BREA 4EXPX 3W9EA 3HI1A 3HG1E 2NR6C 5DI8A 2F5AH 3T65A 1C7SA 4OQ1A 3G9VA 2W0FA 5I8CA 2VLMD 1VCAA 2X89A 2D7MA 4AG4L 4U6XB 1SY6H 4D9LL 3VMNA 2DWDA 1KTKE 4OCXL 1YYLL 2HWZH 3WFBL 3SPVB 5I6XC 2NW2A 1WBZB 2EIBA 4Z0BL 5L9DL 1EAJA 1FZJA 5F21B 1U3HB 2YXMA 4ODXB 5CKAA 3O0RH 4R96A 4IIQC 2IALB 4HH8A 1F4YH 2CR6A 4X6DE 1KYOK 2LAGB 1XCTB 4JPIA 3PGDB 4P46A 5F7EH 4Z7OF 2BVEA 3DX8A 4DKDC 3MX0A 3P77B 3LQZB 2R69H 1BWWA 1AHWB 2R1YA 3I6KA 5DDHB 4MAYD 5BQ7B 4PRPE 3SE3A 1JE6A 1UGNA 2YD5A 3EZ8A 4J3SA 2E7MA 2VLKA 4QTHB 2NX5D 1N8ZA 2V7HB 5GGVH 1ZT1A 4MDIB 3SJVE 1Q38A 3VXRE 5EU6A 3ULSA 2IFGA 2VH5L 4XCYA 3FQTB 5EU3A 3PDGA 5DSCA 3LPGA 4BFEA 2R0ZH 4E41B 4L3ED 4FOMA 3CVHA 3SKMA 2APWA 4PLJD 3ARDD 1WV7T 3V5KA 1FBIL 5HJ3B 5BCAA 2PR4H 3QO1A 1BQHG 4IIQA 2Y7QB 4K07A 2JB6A 2OL3B 5DMGC 5IB5B 4KU1A 3U0WL 4YXLL 4JKMA 2V9RA 5GPRA 2AJYH 4O02H 1N59B 5ENWB 3W9DA 1U8MB 2ICCA 1CE6A 2GAZA 4OZGA 3BKYL 1NUGA 1RU9H 4MQ7B 4TSAH 4UB0H 3UXFA 2EDLA 5KZCB 4PJXE 4OFIA 1SBBA 1LO3H 4AJ0A 2B2XH 1RZ7L 1WTGT 3V6OC 2DLFL 4RNRA 2RBLA 5DD3H 3BJLA 1D5XA 4OGXL 2H6PA 4QGTA 1F3DJ 1UB5B 3NFPB 1SMAA 1Q72H 4XP5L 1NCDH 5E8EB 3IAQA 1LE9A 3UTZB 4QRPD 3S36H 5EFIA 2MOVA 5HXMA 5ETUA 5CGMA 1KUMA 3ROOA 2DQIH 5DJAA 3VI3F 4GUPA 4JHZA 2GFBA 3TM6A 2BRQA 3VA2C 1D5ZA 3VXUB 2ED8A 4NQEA 2NY4B 3FQWA 5I1CL 4BH8A 2CDGA 3H9SA 3N1QC 3RQ3A 2EC8A 4BQ8A 4DKFL 5K9JH 5I1AB 4UOW0 3QUYB 1H3WM 3HE6C 4KI5C 1NSNL 4Q6YA 1HOCB 5EIIB 4NP4L 5GJTL 5GRUL 3D39B 3G6DL 5BZWA 3GSVB 1DBAL 3BMVA 4O51A 5DJ0A 4NUJB 4F80A 3KPSB 4N9GA 3WKML 2HRLA 3FFCA 5A16A 2L0DA 5DEGB 1M6OB 4QT5B 2FYYA 3WLBB 5FO8A 1PY9A 4MHHG 3U4BL 2EDDA 3SQOL 3L7EA 5C08B 5D6CB 1QRKA 5E24E 5HYJD 4P0DA 4LMQE 4YBLC 2WZPD 4N0RA 3B43A 4D8PA 1H0DA 5E94B 1NJ9A 4IMKC 2VQUA 3CFCL 4HG4K 3I2CL 4GAYB 3V4PL 1NAKL 3KWWA 2A83B 2J6EA 4PJHE 2VXVL 3QO0A 4JCLA 4K3EL 3ZDXE 5JA9A 1QQDA 5JW4R 2DLGA 5FYJU 5MERB 2Q76B 1CS6A 4XP6L 4QWWD 5T3XD 4U1JA 4UUJA 1OGAD 5FKPB 4NRXA 5JHDD 1TZIB 5EULV 5HD8C 2WUCL 4PJ9C 2VLRD 5J9PB 3OZ9H 4F37F 2DF3A 5F9OL 3TT3H 1FZMB 4H1LB 1HZHL 4M43L 3HG1D 5D5MB 5IB4A 1KCUH 2AK4B 4UOW1 5IW3A 2VWEC 4MA7H 4QTIL 1U8LB 4JG0L 3WUWB 5BS0B 1PZ5A 3ARUA 5CZVH 1PX3A 1RZFL 2HTKD 3MRPB 4QRQB 2EIDA 3EZJB 5F44A 4IMKA 4AENA 1ZA6A 2I9LA 1NMCB 1BOGB 2XNAA 1F2XK 1S9WA 3TN0D 5FUCE 3QCUL 4N8CH 5EU4B 1Y18A 1DZBA 3ZDZE 3KPNB 2HT4C 4DKAA 1R5VA 5D72L 3U48A 3VWJB 3G5XB 1AI1H 1E6JH 4F2MB 2R0WL 3VXME 4I3SL 4K55A 1FAIL 2P5WA 3LRGA 1GVIA 4YPJA 1OT1A 4LSUL 4R2GB 1VKXB 3MYJA 5T3XH 2GKIA 4PRPD 3MRGB 4F7MA 2F19L 4BQ6A 3HZMA 5DRZA 4PJ9A 3C60C 4XHJC 3O2WH 5FA3A 3RY6C 2AJ3A 4R0LC 4XPBL 3N1MC 3EFDH 2VAAA 4HWEL 1LEKA 1F2QA 2COQA 4XBGB 2J1KA 3EDEA 1I1AB 1UZ6F 3QULB 1U8JA 3SJVD 4PJBA 4MJ6A 1ZANL 4YZFE 1YNTA 5DURB 3GMOA 3EO1A 3C6LB 3SE8L 1UKSA 4X4XB 25C8L 4BSJA 4L5FL 3OKMB 4IOIB 4UTBL 3VXOA 1M71B 4URTB 1JF5A 1AY1L 4NM4L 4YAQA 4NQCA 4ZSOB 2XZCH 4X8JA 5JIPA 2IGFL 3CSPA 4YDLC 3OF6D 3BW9A 4NC1C 2FECI 1J8HB 3VE0B 4NO5B 4CNIA 1FZJB 2AXHA 5JDSB 1WJ3A 1FNLA 1CDUA 3D25A 3HI5H 3K1KC 2PF6A 3LKSA 2OTPA 5HGDB 2VDQL 2FSEA 3Q1SL 3FOLB 4R96B 3ARBC 2FO1A 4I48A 3TBSB 3DGGB 1KJ3H 1P7QB 4P46B 5E1AA 4GG6A 4DEPC 3UAJD 1CGSH 4GRLB 4AY0A 1U41A 1I75A 3FT3A 3QIUC 3PGFH 3MRMA 4M62L 5HDQL 4FXGB 1DQML 1AKJA 4JJHA 5IFAH 3RY6A 4PJIE 4NOFA 4KGLA 4R0LA 3QPXH 1EHNA 5KSBF 4QOKB 1N8ZB 2NTFB 3TJHD 5GRZA 4HC1L 4H1LG 4P3WA 4JFXB 2IPUG 2GSGA 3ARQA 4QLRA 5IB1A 1MJUH 3DIFA 3MA9L 4X7SH 3SHSA 3WUWG 4G6FB 1D9KC 2QSTA 4XCYB 1JYNA 4OM0H 5C0GA 1BECA 1B4JH 1KCVL 2PKDA 5CP3H 5GGSY 1P9MC 4YK4C 3EO9L 4EN3B 2IBZX 2VSCA 2E9IA 2F15A 5E8DL 1HHHB 4P4KB 3M17A 4M48H 2Q6WA 5JMRA 5J12B 3O6MH 1HYSC 3QO1B 3LN5A 1NC2A 4NSKB 1YC7A 3ARBA 1J5OL 3DNKA 1YJDC 2CIKA 4LP5A 3QP3A 1T04B 1CR9H 1J7VR 3GK8H 4O2FA 1IT9L 3NA9H 3R1GL 4M7LL 5SWSA 2EXYC 3QIUA 1NBVL 4KWUA 1LP9B 1WCBA 2BNRE 4WI4A 3G9AB 3W0WB 2A77L 5D70L 1W2KT 3B2VL 3CFBB 1CLZL 3V5HB 3MLTB 3V6FB 3RL1B 4ZFZB 3T0VA 2Z0BA 3VRIB 1D5XB 1U58B 3TFKD 2H6PB 3B9KB 4BKLA 3LHPL 1I4FB 1T3FA 1HSAA 1D9KA 5CILL 1S3KH 4N5UA 2ZUTA 1DFBL 2YD4A 3HB3C 1XIWA 4FFVD 4EBQH 2EDWA 1IGIH 4S1QH 2I07B 3QUXD 5TH2A 5CCKH 1LE9B 1P9MA 2JCCA 1QPXA 2NY6D 4DQOH 1NCWL 2W38A 5ETUB 4GJTB 5INDB 3JV6B 2ZPKH 4NBYB 4GUPB 1RUQH 4ZS7L 4P59L 5DUPH 1P7KA 2DD8H 4OM1L 1RMFH 1G6RH 1K3IA 3DTXA 3P4LA 5F96H 1CU4L 4HS8L 1D5ZB 1G0XA 2P24A 3BEWA 5C0AE 4FQCH 4QY8B 3BRDA 5DMIH 3CDCA 3KXFE 4HIHA 1FC2D 5ID0A 3H9SB 4CU6A 3T0EC 5E5RB 4OFPA 3KLSA 4PRIA 4W6WB 4S0TD 3WV0A 1MRFH 1CFSA 1JL8A 4KXZH 3SGKC 5CEXA 4HIXH 4YC2C 4KKNA 3RIFF 5I1KL 5M7QA 2DWEA 5E2UH 1HQ4B 4Q97A 1C5CL 4N9GB 5F6IC 1T2QL 3KPQA 4K3HA 5DJ2A 3SDAC 2FYYB 5FO8B 4N0CD 2RGSA 5T1LA 1KPVB 3L7EB 4M7ZB 2D03H 5A40E 4G3YL 5C8JA 2YUXA 3KLHC 3OKYA 2C1OA 2F8VA 4I3GA 1MLBB 2YWZA 3VWKD 4PY8I 1NJ9B 2CKBA 1F11B 2XFXA 2PXYD 32C2A 3X3GL 4L4TA 2EDRA 3KWWB 1FLRL 3JUZA 4PB9H 3REWA 4LLYA 1XCQA 5CGYD 1DBKL 1QQDB 4PG2A 5CBEA 5JW3L 5FGSA 4HUXA 3VXMD 2J88L 4R97B 2VKWA 5DHVH 1KV3A 3MLVH 1LE5A 4ZUWA 4RBPH 4BFIB 3EJYC 1GGUA 4I13B 4NKOA 2WIIA 5GGSA 5IBUB 3T0EA 1F58H 3MMEB 1G7JA 2YKLL 4WHYH 2X9YA 2CLRA 1EMTL 4MA8H 5KVFH 5C0IB 2BVTA 2M2DA 3D3VA 1I9JL 1QYGH 2JJUA 2HMID 3SGKA 2W0PA 3E6HA 5FYLE 4TUJB 5AUMA 3RUGE 5JLZB 2H26A 4XNQA 5DVLA 3QDGB 4J8RA 5IB4B 2GJ6E 3W11D 3NCJL 1TPXC 4W81A 1UM6H 1SM3L 4YNYB 3H7BB 3OKLB 4L9DA 4Z7WA 5D7IB 5EN2B 4FQXB 4K8RC 4LQFL 1JTPA 3CDYA 1ACZA 1I3GL 4M3KB 4OQTA 2KDGA 4ZUVA 4HX1A 3LKOA 2DQTL 2OP4L 4M4RA 4UTAL 4GKOA 1Y18B 1M7IA 4QHLA 5GGUA 1FORL 3DVNA 5BVPH 4UMGA 4XNMA 4M1DH 5EORL 4V1DE 1R5VB 2GJZA 3DOSA 5H2BB 1T1XA 5FAAA 3PWPB 3WFBH 4ODVH 2M8XA 4Z0BH 4R3SB 4EUPG 3MYJB 1IQDA 1F4WL 1MEXL 2RCSL 5GHWH 4NFDA 1I9RL 2FR4A 3VDAA 4BUHA 4JANB 1JZ3A 1OB1A 3SDXE 1HHKA 3H9ZA 4NNXA 4PJEE 3MOQA 4ZTPL 1AQKH 5FYKL 4UZGA 3ZT7A 1WITA 1JPST 1U8JB 3UBXB 3ARTA 4MJ6B 1IGML 5B39A 4BFGA 1I3UA 2X2YA 1RQ5A 5JIIA 3CX5K 5L8LB 1WZ1H 3C5JB 1L9MA 3TBTB 5IW6A 3QEUA 4D94A 5FF6A 3QT2A 2OI9C 3Q5TA 1S7VA 4JRXB 3DXAD 4NQCB 3MV9A 4X8JB 2ZUVA 2NY0C 2BVYA 3P11L 4P2OC 4OLUH 2BOBB 3BP5A 1TJIH 1KCKA 4IRJD 2EYTB 4RA3A 4B0MM 5D9SB 3BKJH 2VH5H 1A0QL 3I85A 2J8OA 3WIFB 1P4BL 2B4CL 5D5MF 2EC9T 3F7YA 4N0FB 4M5ZH 4YDIL 1BFOA 5E1AB 3K0WA 2N7AA 1A1MA 3CGTA 3RPIA 2LABA 4LEOA 1FBIH 4K94C 3BPOC 1EEZA 1SBSL 3ARSA 1KXQE 2BNRD 4Y5YC 2NY5H 3BKMH 4LNRA 4CDHA 1ZHKA 1H3PL 1ZHNA 4PRHE 3U36B 3ULUE 3P9MB 3AB0C 5FHAH 4TSBH 2FWOB 4QXTA 2ARJA 1ZSDB 4ODHL 5DJXA 1KF9B 5TDPB 3OAYK 1IC7L 1I1RA 4WUUB 1VEMA 4XVTL 2OJEB 4MAUL 1J12A 1DBBH 1KNOA 5MEPB 4HWBL 5JOPE 1YQVL 2VISA 1F5WA 1RUML 2J8HA 2C3VB 1CFTA 4PLKD 4DWHA 1RZ7H 4XPGL 3ARED 4GKSB 2PW2A 4HXBL 4MA1B 2JE8A 1OCWL 4P2OA 3B83A 4I0PB 1A6UL 3IJSB 4OGXH 3M17B 1W0VA 1ZVHA 5BV7C 3LN5B 3MBED 1NL0L 2HJKB 4E42B 4XP5H 3FONA 1J1XH 5C0AD 3KXFD 4WI6A 1PG7X 4PR5A 1E4WH 4JFEE 3RU8L 5BOPA 1TCMA 5SWSB 2R2CA 4MX7A 1W8NA 4Y5YA 4L3AA 1WCBB 2OXHA 4RFEB 4G6ML 4M9OA 4Z78B 3JTSB 3BZDA 1G9NL 2A9NH 3BZFA 1YEFL 1MCNA 3G6JE 2GT9A 3HAEH 3BDXA 1BQHA 2NY3C 4LL9A 4Q6IC 1IL1B 5HYQA 2VLJB 5DJ8B 1RIVH 1KLGA 1VFUA 4YE4H 1NSNH 5E5MA 1BJ8A 1G7HB 1HSAB 2WLZA 2O5XL 5GJTH 3VFSA 5GRUH 2ED7A 3EGSB 3G6DH 3TT1L 2FJGA 1XIWB 3V4VH 4KY1H 3CZJA 2FEEI 1EVUA 3EOBB 3QEGH 5TH2B 4MXVF 3H6JA 3QWRD 2JCCB 4ALAH 4JPVH 1TZHB 1WVZA 1RUKL 3WKMH 1WISA 2F54E 2OSLB 1FYTE 4ZOEA 4ONFH 3QNYA 3U4BH 3HMXA 2NXYB 1KC5H 3SQOH 5I0ZA 2I9TA 4FZ8L 4C56E 1P7KB 3DX9A 3P4OB 1A3LL 2BFVL 3DTXB 5CWSB 4QF1B 4D0CA 3SDDD 2ADJB 3IU3B 4GW5A 2P24B 3EYOB 3F65A 1KSRA 3SKNB 2I25N 4F8QA 2XY2A 3CFCH 4QHUA 4XH2A 3ZZ1A 5D7JC 4JM2C 4G8GA 3QISA 1I7TB 4HIIA 1N64L 2VXVH 4JFQA 4PRIB 3NN8A 4K3EH 3SKOB 4KK8D 4BQCA 5SWZE 5IHBA 4MQXD 1U42A 5FYLD 3DHMA 2XN9A 4X80L 4XP6H 1CVSC 3TO4C 4LCWA 4FXKB 3X3FH 2GJ6D 3D2UA 3GMLA 4M03A 1EO5A 1OT2A 5DJ2B 4OZIE 2WP3O 4LBEA 3I50H 1P6FA 3PXHA 5B3JF 1KTLB 5J6GA 5E1HB 4YBQC 4XGZB 1ZLWH 2B0SL 3O3UN 4GXVH 5F9OH 4NKMA 3GJFA 3ZSSA 2C1OB 1LP9F 2D0GA 3O2VL 4IRSD 1B2WL 4ACPA 5AZ2L 1A8JH 1RJYA 2CKBB 4M43H 3VFTB 4GBXC 2XFXB 1T89A 5ACZA 2HTLD 2UVFA 32C2B 3I84A 4CW1B 4F7TA 1IRAY 2YA2A 4WWKC 4V1DD 3OAUH 3REWB 4XRCA 4UQ3A 5I30L 4JRYA 5GZNC 5CBEB 3DSNA 6FABH 4C83A 4NZUH 1AD9A 3BD3A 3LQAC 1E27A 4NNPL 3KPRB 1GC1C 5J1AA 5D7JA 4KKLD 2I60L 4JM2A 3SO3B 1FNGB 2H45A 1AGFA 1N2RA 2WBWB 1PFCA 4GQ9L 2H1PH 5FM5O 4XMKL 2PYFB 5D72H 4Y4HD 2E6JA 4A2MA 3O8XA 2R0WH 2EKSB 3BP4A 3BPNC 3TO4A 1F4AA 4B50A 5BO1L 3ULVF 3UO1L 4LSUH 5DD5L 5ISZE 3CFEA 5DEFB 3WNNA 2LVEA 3BAEH 5E6ZA 1SJEA 4Z7WB 1CD9B 1B0GB 2AERT 3IFPA 3MGAA 4C4KO 4HWEH 3V5DA 1N6QL 4HFUL 3R0MA 2F53A 5EOQL 1I1CA 1RK0A 3T2NH 5IOPB 5JTWA 1IGJB 4LVNC 2J7LA 1JNNL 1AXSB 4APQD 1P1ZA 3SE8H 4YXHL 4DAGL 3IS0X 25C8H 2AAVA 4WWKA 4UTBH 4QHLB 5IK3B 2WWKO 2GJZB 4J23A 1T1XB 3PG2A 3ZSTA 3LKRA 1W8OA 2IGFH 4PP1D 3KDMA 5E9DA 2Y07H 4P49A 1CYGA 3OJMB 3RKDC 2BC4B 3DPBA 2FX9H 1X6LA 1ZWIB 4X98A 2NTSP 1IQDB 2R0KH 2BVQA 1NAMB 3ULUD 2FR4B 3LKPB 4G8EB 3Q1SH 5ITFA 4G6KH 4PJDA 5M94B 5I76B 4NNXB 2HVJA 3VGEA 2RAMA 3R4DA 4MD5A 4LVHB 3PWNB 1K4DA 2QSCH 2BERA 2DQCL 3DURA 3R06B 4P2CG 3RTQD 3NABH 1B6UA 3GJEA 3QI9D 1EAPA 2PW1A 2DBJA 3WN5C 3HPJA 1QSZA 5JOPD 5HGGS 3HZVB 5IW6B 2A9ML 4M6ML 1QSEA 3S3PA 4K9EL 5FYJE 4H5SA 3UPAA 5I19H 4X5LA 4ZXBD 2EXWC 2WAHA 4NHCH 3O3BA 3QB7C 1NBQA 1KJ2B 1UCTA 4NQDE 1FAKT 3BP5B 2LTQC 3IFOB 4P2QB 4XX1E 2HLFC 4LLMA 5D1ZB 5AYUL 4CN4A 2XACC 3GI9L 4UBDD 2X1PA 2X4NA 3WNLA 3UJTL 3F7YB 3PIQB 4JFED 2V7NB 1JYVA 1CFQA 3EO9H 4JO4H 1AGDA 4I1NB 5D7IF 4UDTB 1FE8H 4BZ1L 2X4PB 3TESA 1PKQA 4GAGL 4LNRB 1QR4A 4LVOC 1I8MA 5KBNC 4Q58C 4HKXB 3ZKSD 4K7FA 5K9OB 5C0CB 3CXHK 2DQFB 1R5WB 3L5XL 3NZHL 4C55A 2DB8A 3E2HC 5E8PA 1NBVH 3WN5A 3IDJB 4LCCC 2RIKA 3QEQD 5DR5H 2VISB 2C1PA 3UTOA 5D70H 4ZUTA 4X6BA 3FCTB 1JWSA 3SGDI 1I3RB 1I8LC 4U4BA 2C3WA 1CLZH 4OZFB 3K4DA 5ECJE 4XVSL 2F54D 2IAND 1FYTD 3FN3A 4BA8A 4JZJC 1OAQL 2XA8L 1VFAB 1LQSR 2AK1L 3KPMA 1V7ML 1Q94A 5E00A 4PTTA 4C56D 3LHPH 5LCVH 5TDOA 3IYLW 5CILH 3CFKB 4Z0XB 1VEPA 4WY7L 1KCSL 3FONB 1NC4B 2FEEL 5AEAA 4HWUA 2W59A 5IR1A 1NCWH 1EDQA 5D1QC 3ZYOA 1XR9A 5MENA 1S7QA 2NXZC 5SWZD 3JXAA 4ZS7H 4IS6B 4GH7B 1LO2L 3MRHB 5HHPB 5ELIA 4Z7NE 1AO7A 5EUOB 5ICXA 4WI7A 4ELKB 2IQ9H 2GT9B 1FSKB 4ESKA 1I1FB 1UXWB 4Y4FA 4ZDHA 2VXUH 3G5ZB 3H3PH 4YEEA 2LV4A 4LCCA 4PJGB 4WCYH 5DJCB 1G7LA 4J7RA 3VFSB 3WFDH 4LP4A 5IFHH 5JZ7D 1T0PB 1A3QA 3GDBA 3LOWA 4Z7VA 7FABH 3NIFF 5I1KH 5SX5K 2VL4A 3SY0B 4MYWB 2YEZB 2FRGP 4JZJA 4NCC2 5E56A 1PDKA 5HBBA 3KYNA 3QNYB 4YHNA 2NZ9D 3X11B 3GMQA 3U7WH 3IXAA 3SDCD 3IU4L 3U46A 1CG9A 4D0CB 2OTWA 1MWAL 4Q9RH 1I7UB 2D9CA 3TBWA 4OCMC 4NZTH 4WHYG 3ALXA 5E7BA 4MNHA 5D1QA 1FLRH 3HNVL 4FTVE 3MOAL 2VC2L 2BP3A 1YEKL 4KKBC 2PTVA 2J88H 3RRQA 5DGQA 2O93L 4QRTA 4WW2C 3D2UB 5ISZD 1MFEL 5L0QC 4Y4KB 5GRXG 5CBAB 3SGJC 3U1SH 2YKLH 1Q1JL 1IQWL 1EFXA 1EEYA 5DD6B 5JPMA 1CICC 1EMTH 1ZE3C 3QQ3A 1I9JH 1IAIL 3VXSE 2GHWB 4EIGB 1JPGB 4LSSL 5I71B 1QFOA 4JDZA 3ILQC 1YNLL 3HR5A 4LARL 5I1HL 4M7JL 2DBLH 3GSNA 1AR2A 4KJQD 1MFBL 1SM3H 3TYFB 3BXNA 4JRYB 5JNYA 1GSMA 1QSFB 3TZVC 1RPQA 3VCLB 5HSFA 3GRWA 1CT8A 2HVKA 3BJ91 1AD9B 1RSFA 2A1WL 3U2SB 4Y16D 5F9DC 1S5HA 1PQZA 5J1AB 2OP4H 4L3CB 4KHXL 4UTAH 5IEHA 4HJJH 4KAQL 4HK3J 2JCCF 1AGFB 5HI5C 4WDIA 1FORH 1REIA 2VTFA 1SEBB 4OV5A 1WQVT 5F6HI 1KB5L 2ICEB 3O8XB 4FFYL 1HINL 3BP4B 2HA1A 1LK3H 2P49B 3H9YA 1G1CA 4WW2A 3MLZL 1OSZA 1BBDH 2E7BA 2DIBA 3MGTB 1YMHA 4HF5L 3CH1A 5FYJD 3RA7H 1U8PA 2HLAA 4XP1H 1AJ7H 1A9EA 3VXQA 1D7FA 3V5DB 4MNQE 5CZKA 4NQDD 1TTFA 4EI5D 1IGMH 4BZ2L 4CMMB 1A7QL 1YEJH 2VQTA 4JY6A 4OCYH 3T0XA 1P1ZB 3C8KA 3TYGL 4P5KB 1A6WL 1MJJA 3BGAA 3ZHLA 2XI9A 2QEJA 1ZOXA 1SY6A 3K46A 3MRRA 3TZVA 3LKRB 1OGTA 1UM5L 3TBYB 2QSQA 5B8CC 5E9DB 5BJTB 3CSYB 3CUPB 1BWMA 1TXKA 3GIVA 3HMWL 3QYCA 3SCMB 4NN7C 3RVTC 3BP7A 3GMNB 1UM4L 1EVTC 1H5BB 2QLVB 4PJDB 3QDJE 2C3HA 3QUZD 4MD5B 3GBLA 4JGUA 1HE7A 5KSVA 1K4DB 4YDIH 4YO0B 3IVKB 1LO5B 5FOJA 3DURB 5C9JB 2QKIA 3GJEB 2GW5A 1SBSH 1JNJA 3UTTB 4NZDA 1FFPA 2X10A 2D7TL 4FZEL 2EE2A 2V2TA 1EH9A 3HN3A 5J0BA 5KJRL 3C09C 4GRWB 1TVHA 3FZUC 3V79C 1U2HA 4PJ5A 1OP5K 3O3BB 1IC7H 4TPRL 2Q8BL 3KYOA 3JV0A 3PP3H 4XCCL 4OBSA 2H8PA 4XVTH 3MV7A 5HDBE 3HCVA 4HWBH 1HN1A 4MNGB 1RUMH 3AXLB 2X4NB 2V2XA 4MJ4A 1FGVH 4UINH 4UT7L 2WMPA 2FH6A 4YDVB 2J4WL 3QIWB 5IVNA 3G5YB 4XPGH 3WHE0 4AEHL 3DRQA 2VR5A 5B8CA 1NGQL 3FB7A 1MQ8A 3QNZA 4Z7WF 3F7PC 4PLJC 1C16A 2DQUH 2G5RA 1GZPA 4ZNEA 3VD4A 1U93A 1PKQB 3LAFA 4FFWC 4ORGB 2FHFA 3DECA 2YSSA 3P0YH 1NL0H 5C0BA 4K7FB 5F71A 4P9HL 1JHKL 1V5JA 9CGTA 2EDOA 4JHAL 3LV3A 3EAKA 2VLKE 5GS1A 3WFCL 5KAQG 5E8PB 2Y06L 2PETA 2EKJA 1X4YA 2I26N 3OKKA 4G6MH 2C1PB 5DK0B 2VN7A 4DKEL 5EU6E 1JWSB 1R5IB 2GSIA 2XG5A 1NANI 4PY7B 2ICWJ 2R2BA 3BIKB 4WO4B 5CUSH 4O58L 3BEVA 3HNSH 1IZJA 4P3DB 5T3ZE 2NX5A 3WDIA 3VGAB 3DX6A 4PRNB 2DLTA 4ETYA 4BM7A 4YFEA 3MGOB 3VD5A 2X4UB 4PYHA 2MKLC 2OTUA 2O5XH 1UG9A 2IMNA 4XCNB 3HTLX 3STLB 1R0AL 4I4WB 1A7NH 2D2OA 4CADA 3P4MB 1UZ8B 4B41A 3F7VA 5CKGA 4R4BB 1RUKH 1ACYL 5IR1B 3L5JA 4L3EA 5FKAA 3K7UA 1XR9B 4FTVD 3ARDA 3CK0L 1KELL 2Y4SA 4LSPL 5I75B 5JMOC 1T1ZB 3FO9A 3OAZK 5D2NC 4OZGE 5KSAD 4JY4B 1A3LH 4ZFOA 1HEZA 1QA9B 1AO7B 5HPMB 3WHE1 5ICXB 3MRNA 1AQDA 1PGRB 1U8OA 5CINH 1A9BA 1ZT4A 4Y4FB 4ZDHB 2C26A 5DVKA 4LDLB 2WLYA 1X5AA 4NIKB 1FNEA 5EO0A 4ONGL 5JPNB 3VXSD 1G9ML 2CDEA 4OLVL 5DQ9A 2EEDA 1LEIA 3JSSA 4HUMB 1T03L 4P3CL 4ZO8A 43C9A 2MTPA 5DFVC 1CIDA 1X5FA 4OAWA 4S1SH 4HXAH 1AGEA 2PO6D 5CSGA 3KS0J 5I1IH 2ILLA 2B0SH 1WZLA 4XNUH 1DEEA 4K3GA 1RHHA 4ZYKA 2CIIB 2IH1B 4ZUSA 3QJFB 1NUDA 4MS8D 4NQEE 4PJ8C 4QRPA 3ZE0E 3D69A 4EQ3A 1XZ0A 1I7ZA 1JVKA 4PGEB 5D2NA 5LG1A 3P9LA 3ZL4L 1RZKH 3ISWA 1MHCA 3WFEL 1MFCL 1WSST 4H88H 1J05A 3QG6A 5AAWA 4LRNH 3A67L 4HCRL 4RRPG 4XXDB 3V6OE 3JWOC 1OF2B 3FFCE 1XGRA 2OQJA 1BJMA 2NY2B 4GQ9H 2E9BA 5JPMB 1CQKA 3QQ3B 3M1BB 4KQ3H 1GOGA 1TQBC 2O5ZL 3NCMA 1CFNA 3ARPA 3BVNB 4M8QA 3UO1H 5EUOF 1Y6NR 1FVDB 4XT1C 5J6HA 4OIIL 4I2XA 5I2IB 3MV8A 4OI8A 2KL6A 1N6QH 1YMMB 1WFOA 4PJGF 4PP2A 5HYJA 5J3HC 4RCAA 1G0YR 1ZGLA 1PQZB 4PJ8A 2P45B 5KOVC 5C09B 1KXVC 4NO0D 5IEHB 3QDJD 1KN2H 4ODUB 4OJFL 5IEKA 3QG7H 4HPOL 4JFDA 4KI5E 3PDOA 4FQIH 4YUEH 3SE9L 1NCUA 1MFDH 1NLDH 3UTQB 1XR8A 4P2RD 5CEZE 1OSZB 5HHQB 3SBWC 1JK8A 3V2AR 4K3JL 1EHLL 1Z5LB 3VI4F 1OGAA 1U8PB 2HLAB 5K9KA 1H8SA 1PG7L 5JHDA 1O0VA 1A9EB 2X89D 3VXQB 5B4MC 1LEGA 4EDWH 1OPGH 1U36A 2VLRA 5C0EA 4XP9L 2DQEH 4YHPA 1W0YT 3JV5A 4WNQB 1FIEA 3BT2H 1QFWI 3RNQA 2BCKA 2VDKL 3NTCL 4JY6B 3C8KB 3O9WC 4LF3A 1XH3B 4Y1AA 2BDNH 2VIRB 3WD5L 4K9EH 2YBRB 3EDJA 1DVFB 3LIZL 4LASH 3D87B 3SOBH 3WJLC 1Z0NA 1VACB 2KUTA 1OGTB 2XWBB 1MVUA 2Q86A 1BD2A 1BVZA 4WEMB 3IDGA 3MRJA 4S2SA 1TENA 3TO2B 5TFSL 4QHMA 3ME0A 1JYWA 4OLXL 3GB7A 2P5WE 1VFMA 1T66D 4D2NA 3BP7B 1NLBL 3FT2B 1JUFB 3MROB 4NQVB 5AYUH 5GGRA 3MNVB 1QSVA 3DJ9A 3QUMH 4YHKL 4M5YL 1BVLA 2A0LC 3QIBC 3RVUC 4ONOA 3MRLA 2X7LA 5KSVB 3KNBA 4X6DA 2VLKD 1A14L 3WE6A 2QKIB 4MHHI 3SBWA 1YEIL 4MB4A 3WCYA 4PJBE 4DOHE 2NY7H 4QHNB 1NGYA 4GAGH 4X99B 2VWEE 5EU6D 2XZAH 4RDQG 1WFNA 1CDGA 4HUWB 4P