1E9OB

Crystal structure of bovine sod - 1 of 3
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDDERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTSTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9oB00
1B4TA 3KBEA 1PTZA 1SXSA 1DSWA 3KH3A 1YAIA 1S4IA 3ECUA 1E9QB 2E46A 2V0AA 2Z7UA 3HW7A 1BZOA 1CBJA 2WYZA 4MCNA 1SXAA 1XTMA 1P1VA 2Z7ZA 1JK9A 1PZSA 1E9QA 2C9UA 2GBVA 3ECVA 1Z9PA 2WZ0A 1AZVA 3F7KA 1F18A 1TO4A 2ZOWA 1L3NA 1SPDA 1ESOA 3K91A 1QUPA 4N3UA 1KMGA 2WKOA 3L9EA 3HOGA 1MFMA 1XTLA 4A7UA 1F1GA 1IBFA 3KM1A 4U4IA 1E9PB 1IB5A 1F1AA 2APSA 3CQQA 1BA9A 1B4LA 4A7VA 4MCMA 2WZ5A 3GQFA 1OAJA 3L9YA 1XSOA 2ZKYA 2AQPA 5KBLA 1HL4A 1N18A 2GBUA 3GZPA 1SXBA 2JLPA 3HFFA 2WWNA 4N3TA 4A7QA 1FUNA 2GBTA 2E47A 1OEZW 1CB4A 1OALA 3MKGA 3KBFA 1SXZA 1HL5A 1IBDA 1SDYA 1SRDA 1U3NA 4A7SA 1SXNA 4OH2A 1TO5A 1YAZA 3S0PA 2AQRA 2Q2LA 2AQSA 2VR8A 3GZOA 1COBA 2WKOF 1E9OB 2WYTA 4B3EA 2WWOA 3H2QA 1OZUA 4FF9A 4OJAA 2Z7YA 2Z7WA 3LTVA 2AF2A 3GTVA 1E9OA 1RK7A 1E9PA 1Z9NA 2AEOA 3QQDB 3GZQA 1IBHA 2XJKA 5KBKA 2AQTA 2K4WA 5KBMA 2WZ6A 2LU5A 1SXCA 2AQQA 2ZKWA 3QQDA 1UXMA 4A7TA 3F7LA 3T5WA 4L05A 1F1DA 1JK9B 1UXLA 1DO5A 3KH4A 2XJLA 1N19A 2VR6A 3H2PA 1PU0A 2JCWA 4BCZA 2ZKXA 3CQPA 3ECWA 2AQNA 2NNXA 4BD4A 1YSOA 1SDAB 1EQWA 3CE1A 1JCVA 1EJ8A 3GTTA 1OZTG 3SODB 5CU9A 3PU7A 2R27A 2C9SA 3MNDA 1Q0EA 2C9VA 3RE0A 4A7GA 2SODB 4BCYA 3KM2A 4A7GF 1IBBA 2VR7A 1SOSA
chains in the Genus database with same CATH superfamily
1GZQA 2BMKA 4QRQA 1SJEB 3FQ4A 3LXCA 2OMXA 4F7CA 1WS8A 2YD9A 3AS0A 3QUXD 1F3RB 4BEIA 4O2CA 1FFOA 4P2AA 1Q9OB 3PWUA 1YPZE 4KNUA 2IPTL 43C9B 4HJJL 1AD9B 1UWGL 2QDWA 5A2JH 1SMAA 4GRLD 5DT1H 3TF4A 3R06B 3KWWA 5ELIA 2GT9A 1N0XL 2FJHA 4IBZA 2VW7A 1KB5B 1U8CB 1MAJA 4HUWB 4NN7B 2D3JA 4P3DB 5K9OA 1HQ4A 2YKLL 3I9GL 1ZT7A 3FNKA 4UIMA 4HHWA 1EZVY 4JO8A 4Q89A 3NSDA 4BK5A 2XFXA 3FT4A 4MZ3A 2EEFA 3GINA 1VZHA 4GIAA 3E6HB 4RISH 2HFEB 1JNNH 1OAJA 5F9OH 4HLEA 1ZSHA 3L6FB 1SJEA 3FQTA 1UYWH 4BELD 4I87A 4OCSL 3QIUD 4RZCA 3VSUA 4CILA 1KBBA 2LV4A 1Q9OA 1OGTA 1TTGA 3CDZB 3EH5B 3FTGB 4URTB 5AL0A 1TVHA 3C5SB 5GGVY 2A4ZA 4R9HA 2Y7LA 3POCA 4PG2C 4L4TB 2FJGB 3FO0H 3MROA 1KPUA 3TPUB 1E28B 1B0WA 4Y2DA 1ES0A 2R23B 4X6BA 5AAMA 4CVWA 5DJ6B 2VR8A 3UBXI 4AW7A 1YLBB 4DKEL 2ZP0T 5F1SA 4HUWA 4Q9CA 3LRSA 3CIAA 2NY3C 3QUML 4P9ML 3SPVB 1CD9B 2F53B 2KMWA 3EYSH 4TQEH 3BUDA 4NM8L 1FV1A 3UZEA 5LXGH 1JRHI 4HWEH 2TRYA 3WJLA 2RB8A 1LP9F 5I2IB 2D31B 1FDLH 1E6JL 2JKIS 3E6HA 3CFDB 3KHOA 2Z4QB 1XXDC 3UMNA 4I9XA 4E9WA 1ONQA 1NBZB 2P5ED 5DQDL 1Z9MA 2OXGB 4UQ3B 4CSPA 2EILB 1P9MA 4HPOH 4NI3A 2H0JA 3CDZA 5BRZD 4NRYB 1WFUA 1P5VA 5IB2B 1KY6A 1G1YA 1HSBB 1XH1A 2AXJA 3NBNA 2FJGA 1UWXK 3G08A 1NC4A 2VLKE 5IFJB 1DQVA 3C5ZD 3LYRA 2XZAL 4TQPA 2R23A 4J3OD 4BINA 3PWPB 3H0TB 2FWOA 2WXRA 4Z3GA 4IJ3C 4LQFH 3FCSA 5KSBF 2C9SA 1N8ZA 4TUJB 1E4KC 3S3SA 1HILB 1E4JA 3ZDZB 3MLWH 4OZ4B 5GZOD 5I2IA 3QWOA 3O3EA 1TVBB 5DC4B 1AXTL 2WQSA 3CPUA 3NTCL 5DUBB 2Z4QA 5G4OA 4OGAD 3DJ9A 3LXUX 3L3HA 4O2EA 1NBZA 4OSUH 4HIJA 5DJDB 4EBQL 4PJAB 3T4AA 3TA3B 2ENPA 4HPYL 3LRGA 3V0AC 4NRYA 4JN1L 1TZHB 1PEZA 5FOJA 2DMGA 1HSBA 1A02N 1IX2A 4HGWA 2WNGA 4R4FH 1LO4H 3Q13A 4JL2A 5IFJA 3GSNA 3N1GC 3O4OB 3WIHL 2I5YL 5F97E 4XAWH 3H0TA 2V9UA 3FTYA 4YNYA 3UCRA 5F6IB 4AIXA 5K9JH 3QQ3A 3NG5A 3EYOA 4QXUL 4JO2L 2WIIA 5T5FL 3QZPA 4TUJA 5DJYA 5HJDA 1MRFL 3W5MA 2QLVB 3K46A 1F8TH 4OCRH 3L4CA 3ES6B 1W72B 3SN6N 4X9BA 5DJ2B 5D1QD 2V2XB 3CTTA 1AD0B 3C6LD 1R3IH 1FYTA 3NA4A 5DSCA 3T3ME 1X4YA 3HZYB 3TYGL 2CO4A 3ISYA 5MEPA 1TZIB 1CGXA 1N68A 2ATPA 2ARJA 2XIBA 1XGRB 4HFUL 2BIOA 4J5VA 2VXUH 1RUQL 2EINB 2GSIB 3SBWA 2ICWI 5DFVD 4HD5A 4GKNB 2A9NH 2BS8A 4N2LA 5BO1H 3ALPA 1YMHA 1VA9A 4P2OD 5DJ8B 4D0DA 4MCZA 1G9MH 4U4BA 5JQHC 3X13A 5A16B 1F90L 4I0KA 1NLBL 2GEEA 3O45B 3V4VH 4CC1A 3AUWB 1S5IL 3EFOB 3UJJH 3B9KB 3O3AA 2AF2A 3BQUA 5J6HB 3TBYA 1BFVH 3A6BL 5D9SB 4C59B 4DVRH 3V4LA 5DJ2A 4DP0X 3SDXA 3KD4A 1NUFA 3C2AH 3R1GL 4LLYB 1UH2A 2EDOA 3T2NH 2HH0H 3AVEA 4B7IA 1OQXA 1XCQA 5D7JA 3LZFH 3CZUB 5M94B 1KLFA 2G0LA 2VDQL 1XGRA 2Q3AA 4WKZB 4EJ1C 3BD3A 2BW5A 5CJQL 2PWFA 3NJIA 5FV2A 1QBAA 2GG1A 3E38A 1XX9C 5CS7A 1FAKT 2OR9H 2ZX5A 4ZD3L 1TJHL 2JQMA 4JDTL 2DAVA 2P47B 2RH0A 4QIRA 5GS2D 2PXYB 3RGVB 1RP8A 3FJTA 1OSZA 1FH2A 3JWNC 4PBVC 2P48B 1MFDH 3BW9B 4X4XB 5A16A 4PJEF 5C0AB 3O45A 1JGDA 3UC2A 4PJ8D 4KNQA 3EDKA 3HLAA 1JK8A 4AEEA 4J3VA 3UYRH 3SDDA 2FNBA 1YNTF 5D9SA 2V7NB 3ZUNC 2Z92B 4UDTB 1FQ9C 1MY7A 3CHSA 1F5WA 1UXSB 3APDA 3NIDE 3KPNA 2ZSWA 3WDHA 4BK8A 2BZ7A 4DZBB 3B37A 1G7LB 1KJ2L 3QFDB 4K5NA 1CDBA 3FO9A 3X1EA 4WKZA 1ORQB 5C0CB 2XQYA 1HCFX 1MREH 2GTQA 2IBZY 4XPBH 3VX1A 3MJ7A 3EYUH 4GKLA 3GHEL 3LKRA 3WJJA 3FQXB 3RGVA 5CJBA 4PRHA 2PXYA 3HMXL 2WYHA 4OB5H 4UANA 1JPTL 4IMKC 4MNQB 4ELMF 3DSNA 5FYJE 3GS7A 3HHMA 3BW9A 5FYJD 4BSVB 2ILLA 4DP7X 1A7QH 5KG9A 1HHHB 4H25A 4RRPM 4HIXL 1XGYH 3BAXA 3CVDA 4KRPB 1M57B 4P2RE 1JPGA 4P2YA 3ZE2B 5DHXB 4YLBA 2AFNA 2Y1YA 3JYBA 4C47A 5TPWL 2K6ZA 3FHAA 5I30H 3G6DH 2L7JA 2D7QA 1MCSA 5F7MC 5DK0A 3O6ML 5J4MA 4PJIA 4JHVA 2C9RA 1C16A 1BIIB 2G3MA 2PTUA 4MNGE 3QFDA 1RZIB 3T0EE 3C5JB 2RQ8A 1XF1A 2BIQA 5E00A 3TURA 3POHA 2XRAL 3GD1C 2NX5D 3GMNA 1N6VA 1RJZB 1X9LA 3PL6B 4HU2A 3K5SA 4AEHL 3FQXA 5F3FA 1T0NB 1KIPA 4MNQA 5TDOA 2IMMA 3TONA 4BSVA 4X6CF 2EDDA 2X9YA 3H4FA 3N5AA 3QCTH 1KYOJ 2ZNXA 4ZFOB 5HYSB 3Q1SL 5HHNB 3K2MC 3BC9A 1NAMA 3QC5X 1MI5E 2J88L 1IEHA 4OTXH 1MI5D 4G1EA 3AAZB 1ZLSL 4HUXB 2B3IA 1JZDC 4N8VG 5DVKA 4AUUA 4PLJC 5D4QA 1IM3A 1XGZA 3T5WA 1PKQE 1KXQE 4HUUA 2PKDA 3N44F 1G9HA 2Y7QB 3HKFA 4U49A 1CQKA 3DHPA 4EF3A 4AEIL 4J3TA 5E2JA 5IMLA 4LLQB 2CLZB 2DIJA 1YJDC 2A6JB 4X4KA 5C8JB 1PAMA 2Z1KA 3FUFA 4DN4L 5D6DA 4HH9B 1BVLB 2J7LA 1RJZA 3PL6A 4W9JC 5KN5B 3MOAL 4I18C 1WBYB 2MTPA 3PU7A 4DQOH 5TD4A 2V2WB 4NQVA 2EDTA 5SWSA 4OM0L 4UB0H 2DLTA 1VPOH 4P04A 2EQDA 2FD6L 5DA0B 3HPLA 2EVGA 3ZQXA 2VQ1A 4DPAX 3RY6C 1FF5A 1N5YL 3INUL 5JPNB 3EYVB 5HYSA 4LEXH 1Z66A 4OUUA 2LT9A 1DQDH 5D71H 5IVOA 2R69H 4PJXB 3CFMA 3AAZA 5J1AA 2VDLH 3TBTB 5I17A 3CK0L 1UGKA 4J23A 4LO9A 4OZIE 4HKBB 4KXBA 5KVEE 3JTSA 2XTSA 5IFHH 4PV8B 2XWTB 4NQDE 3FKUS 2FX7L 3K7UA 3LXAA 4NQDD 3VSQA 3VXNA 1VFAB 4N8CH 1RIVL 1CVSC 1O9WA 1BVLA 4HH9A 5IB4A 5KN5A 3NQKA 4G2AA 1FO0H 5C0IA 4H8VA 4JMXA 1GRWA 2P9RA 1M71A 4LVHC 5DHEA 3S3DB 3K6FA 4PRDA 2X2UA 1O6SA 3O2DA 1EANA 1RD6A 3DOHA 1F4WH 2YQ3A 4P4KD 1NFIB 4DP2X 2ZXWB 5JTWA 3FSZA 4UBDC 5DEGA 4PJXA 3LB6D 1S2EA 4TOYH 2J4WL 1ORSB 1PVHA 4UM9A 4PTUB 2AJXH 4QRPA 4FZEL 3KPLB 4Z5RB 2DN7A 3C60B 3FCGA 2FGWH 3KXFB 5T3XL 2PN5A 2YN5A 1UM5H 1EAJA 2FYVA 2XWTA 4JB9H 4PV8A 3MO1A 3H42L 1M7UA 3UBXB 2FYYA 1CFTB 5DYOA 2PO6B 2Y1VA 4MQ7A 4NUJA 5B39G 4XCCL 3JWNG 3RIFK 1I7TB 2BNQE 5J06A 1O6VA 3ZTNH 1WTLA 2YPVL 4MDRA 2BNQD 3BZEA 4P5TC 5I75B 3QEQE 4R26H 4LLWB 3QEQD 3RWHB 3MJ9H 1DBMH 4I1RA 1SF3A 4HIHA 5I23A 3BH9B 5EOQL 2UZYB 4RESB 4ODUB 4IOIA 5IJBC 3LS4H 1YEJL 2F7PA 2X4SA 2WOYA 3N42F 3PE9A 3JWDL 3HCVA 5CCJA 1QNZL 2PPFA 4QTHA 3V0DA 1KJ3H 1K6QL 1SLUA 4ONOA 4PD4J 5FUOH 4GW5A 2Y07L 1ORSA 1TSHA 3HE6A 1G7PA 1WZAA 2OZ4A 4PR5A 3KPLA 5LNEA 1NCBL 2D7PA 3MYJB 4YZWA 1OAKL 5C0NC 2LTQB 4Y4HC 5TQ2H 4PLOB 3QHZH 3SYOA 1I7TA 4FCHA 4GOSA 4GEJA 2GK0B 2OI9B 2UVEA 2QVMA 2Z35B 3EFDL 4KK6C 3UXFA 1F0LA 3KBEA 4CC0A 1V7NH 1XO8A 2KERA 3SPGA 4M6NH 5JO5A 4TTGA 1FC2D 3CU1A 4Z7UA 5B21A 2IV9A 2XDHA 5KVEL 4JPKH 3KPRB 3VH8G 4HT1L 3CXDL 2NMSA 3FFCE 3VFUB 3ORJA 5J11B 3DX6B 3FFCD 5E1IA 3O6KH 1NJ9B 2VDKL 5I24A 2OMTA 3ZE1E 1S7WB 2O5ZH 2WZ0A 3LJ3A 2YD6A 3VRIA 1C5BH 3FRPG 3MYJA 4QRAA 2EVJA 5KVFE 1FFRA 3FTUA 1ED3B 4GQ9L 1QWNA 1UKSA 3AWFA 1PD6A 1F13A 3CHXA 4YO0B 4BDVB 5E7FA 3BRFA 4CC4A 1MCPH 5TK2A 3BSZA 1N67A 4NRZB 3C09B 5B8CC 1JWSB 1AXSB 2ATKB 3BVWA 2DBLH 2LU7A 5DZ9A 4ISVB 2IFFL 4PW4A 5KBLA 2HN7A 4A7QA 2KBGA 2Y36L 4AYDC 1I8IA 4XBPB 1UUSA 4BK4A 2IOMA 3LH8A 4P07A 5HXMA 1GGUA 3L95A 3MOBH 3PQYE 4BUGA 4AVKA 3K8MA 5LAXB 5KYWB 4HJ1A 4APXB 4G8GE 4BH8B 4BH7B 2ZJSL 3DDFA 4G8GD 1I1FB 3S0PA 5AWNH 2YD3A 4IBWA 5DTFB 4Y4FC 5A3ID 4PJEB 4QHKJ 4NQXB 2BP0A 1RLWA 3A3YB 4LGRB 1VF5C 5KVDL 3LIUA 4XXDB 1PZ5B 3F7YB 4JFFA 4OY9A 4Y16C 5EA0H 4WTWA 5C07A 3WFHA 5FUZL 1YNTB 2DS4A 3FMGL 1P7QA 1F97A 1NLDH 5T33H 1U4FA 3MTXA 1WC7B 3CG8A 1NPUA 3PXLA 1PCSA 2JB6A 4QR7A 1CTNA 4JFQB 4ISVA 4XPAH 2KUTA 3OGCB 3WBDA 3IDXH 3WXVL 3S35L 3Q6GH 4ZO7A 3BT2L 2J56A 5IW1B 5L4JA 5A7BA 3MCKB 1AGCA 4M1CC 2DYRB 1DBKH 2GSGB 2NT1A 3STZA 1A5FH 2QVFB 2ZOTA 3VW3H 4PWIA 4APXA 1JAEA 4QAMB 3MV7A 4ELMB 5E2UH 1G9NC 5I19H 1EJ6A 2UWEB 3DVNA 2YD2A 4JPQA 4X42A 5I9QC 1RXLA 3GXDA 1QASA 2AGJL 3QPXL 3VU2A 3GO1H 5C6WH 1CFSB 2IADB 3QJSB 1PZ5A 4WU5B 4Z3EA 2J44A 1UOLA 1T1WA 2NY2C 1YNTA 5EV7A 5AVWB 4Q74A 4F9PA 3HNVH 2J3SA 3INOA 1N4XH 3F58H 4JHBA 4JFZL 2APBA 4NSKA 3QZBA 4LCUA 4K3HA 4I77H 3UTSB 5FHBH 5GRWA 5I0YA 3MCKA 1JHKL 2K45A 4YC2C 4AGMA 4AKOA 2AK4B 4NO5A 3QZWG 3DTUB 5EDXA 4GUCA 5AKRA 4ELMA 3LQZB 1BVNT 5FECA 1NEPA 4UT7H 1QHQA 2UWEA 3S4SA 5IHUL 4N3UA 4X6CB 5TE4H 3RX8A 2DD8L 4CMMA 2YLHA 3REWB 3THMH 4JAMA 3K8LA 4O9HH 5HJ3B 5E9NA 2FGZA 4ETQA 3ZHKA 1EJOH 3H6AA 4XODA 3H3KA 4GSRA 1VESA 2ZWLT 3LN4B 1OWWA 3QIBC 5DI8B 1KG0B 1DLFL 1J8HE 4B6ZA 1J8HD 3S9DB 2BNRA 5JXEC 5EZJB 3IF1A 3N44B 3U30B 5D1XA 1P4IL 3MKGA 1CDCA 3V7AG 4FQJH 4MAYB 1NIAA 2AQ2A 5JHMA 2DKMA 2I24N 5B3JF 2V5MA 2VRKA 2N56A 3T0BA 1U92B 3BSGA 2AK4A 2X4PB 3HPJB 4S2SB 4KTGA 4ZNEA 32C2B 3TO2A 2E0PA 5BCAA 3LKQB 3K3QA 5IVXF 2GFBB 1JGIA 3V6ZB 4KQ3H 2MWCA 2QQNL 3RPIA 3ABKB 4JZJA 1NCWH 3BE1L 3X12A 3WEXA 1JYWA 3BWUC 3ZL4H 1KXVA 1QFHA 2R2BB 3MRCB 3LQAL 4B9KC 4NXSA 1HEZA 1KG0A 4FHKA 5FO9A 4BZ1H 5F71A 1SDDA 3US1A 4H44C 5SWQA 4ONFH 3ZDXE 5I1HH 5I6OA 3CXHK 2IXQA 2Y6SD 4M1GL 4F8NA 4K94C 4HC1A 5IV2B 1AP2A 1L3WA 2DQGH 1Y0LB 4MAYA 2DQIH 2C3VB 3B1UA 4F37K 4H1LH 5CJ8A 3ML8A 2UY7A 2FH8A 3CBRA 1U8PA 4DT2A 1HH9B 2ORBH 1I3VA 2Z8RA 4P23A 2UX7A 2X89A 4NQEB 32C2A 3FF7A 4MJ5A 5CNHA 1CXEA 2X4TA 1S9WA 2JJSA 3IAGC 1HYRC 4YR6B 5EU3B 1MJ8H 3MLXH 2X2HA 4GUQA 2YZ8A 3KDPB 2BERA 2WBJA 2N1TE 1XDTT 2H2SD 4GQPH 4FJ6A 1BPLB 2MKLC 3M88A 3SDAB 1KIRB 2R2BA 4HJEA 3DOSA 1T83C 3BWUF 4IIQA 4Q56A 4OW6A 2CM5A 2HG0A 4AI7A 7TAAA 2JLLA 4GW4B 3BIKB 2QKIB 1QRNA 1R33A 3ARGA 1JNNL 5F9OL 5IV2A 2IDUA 2HAZA 3QJXA 1HXKA 2C3VA 1UYWL 4QWWC 1T1ZB 2ITCB 3OKNA 1OXYA 3SCMD 4I8DA 2GJJA 1D5ZB 2FECL 5E4IA 3GUTB 2IALA 4XVOA 4PJFB 2DJSA 1G4MA 4M1DH 1MWAH 5KJRL 1INQA 4HEPG 4YR6A 3NCFB 1AIZA 1BMZA 3N42B 5DVNA 4BFBD 3AREB 1IGMH 2PWDA 3SDCB 1QW9A 5E6ID 1KIRA 3ROLA 2X7LA 3EYSL 3H3PH 4TQEL 5F0JB 1EHXA 2ZG3A 3ABZA 4M7KH 5T3ZH 5LXGL 2CHWA 2XVKA 1T20A 3VXQA 7FABH 5H35B 1FDLL 4GW4A 2AXGB 1A64A 4YDKH 1CICC 1GS8A 1MDTA 4N2EA 5ALCH 4TLKA 1N64L 3FHEA 3PG2A 4JG0L 1XGQA 4U1SA 3U7YL 1HZHH 1NC2D 4XBGA 5SWZE 2ITCA 1J9QA 4HPOL 1D5ZA 4OZFB 4GEIA 3MUZ1 1QW8A 2W07B 3GUTA 4KAQH 2H32A 3ASWA 4PJFA 2LAGB 3DUUB 4FQ1H 4U1HB 5G4NA 5IW6B 3GMRA 2IPKA 2QFRA 3RTQB 5LNDA 2VKXA 4ANXA 2FO8A 4JO4H 4EI5D 3QJRB 4KO7A 4HXBL 4LQFL 4MSWA 2K3HA 5I1JL 3JSSA 2A4CA 1TCRB 2CH8A 7PCYA 4P9HH 2EYRB 4EUPA 4PG9A 3V5DA 1GC1C 2NW3B 3MLWL 4RMWA 3WNLA 3BD5A 3L5WA 1T22A 2AAAA 4RMTA 1JWMB 2MQCA 3QXWA 1SEQH 3CN0A 3FU0A 1KACB 1BQ5A 5M95B 3BUTA 3QPKA 4JRLA 1AZNA 4OSUL 4ZMZA 3DRQA 2F58H 3IRPX 3MU3A 1QTSA 2FZ3B 4NUPA 1ZD6A 3WIFA 3IDUA 3QJFB 1GIGH 5FO8B 4R4FL 1LO4L 3DUUA 2NY4B 4U1HA 4PJ9D 4O5LH 5IW6A 2ADFH 2NW2A 3QUYD 1JZJA 3P30H 2ZXQA 3RTQA 1BZ9B 4JBSA 4X4YA 4XAWL 5HGGS 5MEND 2F9BT 1BFTA 1U93B 4K4KA 3FDWA 2EH8H 1YEIH 3R18A 5FO7B 2EDXA 2WHVA 4OGZA 4M7JH 5AVRB 5KYXA 1F8TL 2DQCH 2NW3A 1WBZB 5JHBA 5KS9A 4G71B 1QVOA 2QJDA 3CJJA 4LSUH 3PHQB 4LMQE 3F7KA 1JMZA 4CW1B 1J5OL 1H3PH 3MLSH 3L5IA 1ETB1 2FDBP 4LEEA 3AGVA 3L7EA 4HMCA 2IWGA 1F4HA 3ASOB 2VXUL 3PDOB 5DVPA 4W9ZA 5F1NA 2VWEC 3CSBA 3G6AB 4AYFB 3RNKB 1FL3B 3L4UA 4X0KA 2B59B 5JLZB 1M2VB 3PUCA 2J6EL 2ZKYA 1G9ML 3PABB 3MLZH 4OCLC 2YAEA 2L0DA 3UGEA 4BK5C 3QAZB 3RI5F 3SGDH 1U93A 1DFBH 2FQGA 5JW4M 3CDGA 2CD0A 5EN2B 2H26A 3GIVA 5CEYB 1UCBL 3GXFA 1WFIA 1YNLL 1OF2A 2HG5B 1RAMA 3OLIA 4FYTA 4P5MB 3T2NL 2HH0L 3OF6A 1I3UA 3LZFL 2F1BA 4L8DB 4F2ME 3DHMA 3GJEB 1AQ8A 2BWDA 2WVVA 1U2HA 3M6DA 3MRIB 3N1FC 1NCUA 2OR9L 4Y2DC 4A6YH 3WHE0 4X83A 5JLZA 12E8H 1GYAA 3DOIA 4NKMA 1MFDL 2D8KA 3FFOA 1ZIAA 2XKNA 1TENA 5LGYA 2IANE 2AXFB 3WJLC 1ZCRA 2IAND 4G5AA 3NUKA 3KGSA 5IQ9A 4W9GC 3UYRL 3WOVA 5ICZA 3SDYH 5EC2A 2J8UF 3ARBB 2DJ4A 4IKNA 1HCYA 2O6EA 2OJZH 4LHUD 1C1EL 2V5SA 3HC2A 4K5LA 5DFTA 3VXRA 1P9MC 5EORH 2FX9H 1K4CB 4LLUB 2DI7A 1WPCA 3FU7B 5F7LB 1A1OB 3PGCA 4BBWA 1SY6H 1MREL 3SE4A 3X11B 3A22A 1B2YA 3BPCA 2Y72A 4XPBL 1B3IA 5ANMA 3RDTD 5D5MA 5I73B 1DQKA 2VXTL 2XWJB 3EYUL 3VFRA 4AYEC 2HA1A 2KPWA 3TPKA 1BVKA 2PYFB 4KK5C 4OB5L 1BBJB 1GXEA 2ICWJ 4PW3A 1CBJA 1T21B 2B16A 1A7QL 4ACTA 4YXKL 2X6UA 1UVQA 2VO8A 2DI9A 3MUUA 3T04D 4B0MM 4AV5A 2WMPB 3ZOAA 4WUUB 2HVJB 3IJHB 3UDWC 5HDQH 2A9DA 2Y25A 3DI2B 3ARBA 2GC4C 1M1XA 3G6DL 4N86A 5I30L 4OKVB 1WD8A 5IVXB 3T4AC 4QUOA 2BLFA 1XBRA 1D9KD 3QEGL 1IAIH 3GI9L 2VN3A 1RU9H 2Q8AH 3FU7A 3JV0A 5AVTB 1RPKA 4AIZB 1D7BA 1I8UA 4PJHF 4HCFA 2EXTA 1A3QA 3KR3H 2IGLA 3VFNB 2EEXA 3FQYA 1OTUD 5IKCB 2X1QA 4HX1A 1JVOA 2DH2A 2J57A 3AG3B 4NS0A 4MMZA 5E95B 4A2HA 4HBCH 3QCTL 1Q9LA 1R9FA 1LEIA 3ROOA 4Y1TA 4JKWA 1P4LB 1S9XB 5JIMA 1WCQA 4RFNC 3WAKA 2DLGA 1P5UB 3EO1B 4JQXC 4OTXL 2HVJA 2WQXA 3IJHA 4GRWH 4WUUA 1ZKAA 1CLZH 3O11B 3OKKA 3RZCB 5I6LA 1M6OB 4OFVA 1HHKA 5T1LB 3G04B 5HP5A 4RIRA 4YXHL 1EXUB 2WN2A 3HG3A 1ZA3B 3SBWC 4L3CA 4KX9A 4NX0A 3HG1B 5AW1B 4UUJB 4W9FC 3CSYA 1Y7VA 3IDIB 3GXNA 2H3XC 2HJFA 3IE9A 1XT5A 4MD4B 3V55A 2NZ9C 4C55A 2BDNH 1E5UI 2JXMA 3U1PA 4ZTOH 2Q0ZX 3ZRFC 1U30A 1LE5A 3TZVC 4DQOL 4YHKH 4PRID 4ADGA 1GW6A 4UB0L 5EULV 1VPOL 3BQUC 1AQDB 3D5OF 4OCYH 5AD0A 3PDDA 2W5PA 5JDJA 1WA1X 4FLHA 5D2LA 2AQNA 4AIEA 4AVJA 1DQDL 1I1RA 5GIRB 3D0VB 5D7JC 4E9VA 2N1KA 4NN5C 3WO3B 1OANA 5CILH 1AR1D 1ZANH 4X6DB 2VDLL 1IJNA 4U2ZA 5T1LA 3B8SA 1CGTA 2X38A 5FIEA 3QUKA 1A3RH 4P4RB 5TFSH 4EZJA 1E5AA 2J25A 1CD1A 2ZZUT 1ZA3A 1IQDB 3CZEA 4JFEB 4ZFZA 5J9PA 3CWGA 1YC8A 3HG1A 4M5ZH 3V5KB 4H88H 1I3GH 1Q90A 3GKZA 4N8CL 1UD8A 4XZUA 3US0A 3O81A 4H8QA 4MD4A 4PFEA 2B77A 3P2TA 4PJ7F 4Z3FA 4ODWB 1BX2A 3HRPA 2JCCA 1OHZA 2ZXCA 3O2VH 4MQXC 2I07B 1FO0L 4NQCE 5T1DH 2JI1A 3N1PC 3L4VA 4NQCD 2P5WE 2Y4SA 4BHUI 4B9PA 1KBGL 4HS8H 4NO0B 3T09A 3SDDC 3WHE1 1J87A 1F4WL 2WUCL 5EIQA 2IDFA 3NN8B 4PJDA 1OTSD 5HYJD 4GPVA 4TOYL 1UA6L 4OCMC 1UB5A 4U33A 4X6DA 3NSYA 5FDYA 2RR3A 2AJXL 1DL7H 2OMUA 2EKJA 2GYSA 2FGWL 2FIKB 4IKJA 4W4OC 1UM5L 5BVJA 2F5AL 3BLPX 1IQDA 4JB9L 2C9PA 2VN7A 2VYRE 3UERA 1E2ZA 3VWJD 5I15H 1XCTB 3QORB 2W0LA 1U3ZA 1WHOA 5IJKA 2D7NA 2CDFA 4PGDA 4NM4H 3ZTNL 1ND0A 5L8JB 3HBPA 4R26L 3QG6B 5GRUH 1DBML 2CXGA 3RVXC 1GMIA 3BH8A 3D18B 1S7VA 4NO0A 3E6FB 4TQHA 5EEWA 3LOWA 2NLJA 1QX1A 3SKMB 5SV4A 2ID5A 2VUOA 1YUKB 1I7ZB 5CBAA 1XVSA 1KJ3L 3KWVA 5FUCE 1RIUH 1KOAA 5C1MB 3UADA 4KC3B 2VR4A 5AVSB 1AFVH 3ARXA 3NCWA 4WWKD 1CYXA 2FIKA 2XN9A 3BKYH 1PW3A 1UOWA 4AYBA 5F3HB 3D3VA 4MCYB 2EIKB 5DEJA 3ZUCA 4G8EA 2DL9A 4OLUL 5TQ2L 4YH6A 5LN8A 3UJTH 3EG9B 1XCTA 3QORA 3QHZL 4YOKA 1NBYB 4ABVA 4PWFA 4A2GA 4HEME 1K2DB 1AKJD 1V7NL 4KBPA 4M6NL 3L5XL 2OL3B 1SEBA 3E6FA 5B1CA 3WLBB 3WN6A 4TNEA 3ZYZA 3KEDA 1W0WA 3S5LB 3SKMA 4ELKA 4JPKL 5CHNA 4H0HB 1KYDA 3TJEH 1PY0A 2XTJB 5IBTH 3O6KL 2PWHA 4XVSH 3WFDH 2N7AA 3NZ8B 3P73B 1KXTA 4U1NB 2YD8A 4A63A 3NCJL 2O5ZL 4ANVA 1A4JB 2F7RA 4E41B 1NMCC 1DN0A 5D6DC 1C5BL 1SUHA 2DICA 5CMAB 4FQXB 2NQDA 1D2PA 1YPZF 5F3HA 1EERB 1TVDA 5EOTB 3R19A 4MCYA 1N59A 2RTTA 2XA8H 4L18A 3U4EB 1NBYA 2GQHA 1CLVA 1N26A 3C6EA 3QT2A 4Z7WF 5JMRA 4HKJB 1MCPL 3QG7H 4ODVH 4XCYB 2H1PL 3WD5H 5JPMA 4XN9A 5LHDA 4AV0A 4DKFH 4E9LA 1X7SA 3LSOA 1SJXA 3EH4B 3QULB 1WWCA 3ZK0A 3B4NA 4UQ2B 2I85A 3IMBA 3KPSB 5H8DA 4WK2B 3QYNA 3WLBA 3P3SA 3T6QC 2QQLL 4OD1H 4OGXL 5ENWA 3S5LA 4KKLC 3I50H 3UTTB 3NSFA 2WVTA 3A0OA 2BX5A 2VAAB 3GSQB 1XAUA 1DVFB 2ZP9A 4KKBD 3FC8A 4RLDA 1OAXL 5E5MA 5IHBA 1YDPB 3P73A 1AR2A 4NWUH 5AWNL 1TMQA 2JJWA 4E41A 4GSUA 1DEEB 3CFJB 1F00I 1CT8B 3ZHDA 3WLWC 1AZZC 5EOTA 5AYTA 5EA0L 4AW4A 3WN5B 5AG8A 3U1QA 4N0UE 4LB8A 1NLDL 3LIZA 2J8UB 1R3JB 1G7JA 4O51A 4XCYA 4GYBA 1H3GA 2VLLA 3OAYK 1N12A 3GPEA 1BLNB 1U8NA 3VQMA 3U36B 4GRMB 2VSMB 3MJ8B 3QJUB 3R0MA 4XPAL 2YARA 4LL1A 5CWSA 2D7OA 4AK1A 3KJ6H 4IBVA 3Q6GL 4JFTA 3EUDA 1FI8C 2MIZA 3QO1A 3TJPA 1SBSL 2NNRA 2PW1A 1MCDA 4DPCX 1PZBA 4ZTEA 3VW3L 2VAAA 1A5FL 1DVFA 4Z7VF 4Y9EA 4YPGA 1JHTA 2P24A 4O00A 3V0FA 3WE6A 2P26A 1N8OE 3MRFA 1C8QA 5E2UL 3GXMA 2LU4A 2Q8BL 5L2KB 1J12A 4X2UA 1SJMA 3BT0A 4Q6KA 4W70A 1YCSA 2XZCH 1SLWA 5G4MA 1OAQH 2ZT9C 3WXWL 3GSVB 1A4KA 3GO1L 2WNWA 3GT6A 3WMQA 1CXFA 2VLRB 3X17A 1JXDA 1BFSA 4LE8A 3AS1A 3WN5A 3DVGB 3L3KB 3T65B 1S9VB 1AGFA 4ZOBA 1R3JA 4H8WC 2H1XA 4F1ZA 1QSED 4LVNC 1BLNA 1N4XL 3F58L 3MJ8A 4XHJD 3UG3A 3HZMB 3V9EA 5FEBA 4WI0A 2VSCA 5FC9A 3WGVB 3TN0D 5EOCL 1TU2B 3CNKA 3MNZA 4I77L 5IMOB 2YFOA 3HE6C 1C5DA 5FHBL 1QO3B 3RUGE 3QARA 4PWJA 4DUVA 4PJHB 2NY1C 2XQYG 1MRCH 3EO9L 1G6RA 3QDMA 5HI5D 4KJPC 5T8IA 1UWXH 1TJIL 3RAJL 3WTXA 1K4DB 4NNPH 4JCLA 4ENZA 1GGCH 1R47A 3FU6A 2XWZA 5TE4L 2RHEA 4FNLH 3N85H 3RX7A 3THML 2GPZA 2JKXA 4O9HL 5AZEH 5K39A 3MNWB 4S11A 3UABA 1QSFB 1MCWW 4W9IC 1EJOL 4JREB 2Y6TE 4E5XB 2YGNA 2FBRA 4Q9RH 1MCNA 1AQHA 3CPLB 5AUMA 4R3SB 1AANA 4XCNB 2IWFA 4MZ2A 4BM7A 1LXMA 1ZHNB 2BZCA 2VMEA 3J8F7 3T1WA 1TZGH 2Z4TA 4ODSH 4ZO9A 5FX3A 5IMOA 4FQJL 3WNOA 3QDAA 3WIIH 1G7HA 1JZ3A 3MV9E 4GT7A 1Z3GH 2XY1A 3GQFA 3MV9D 1PNDA 4OF8A 3SY6A 3PHSA 3MJWA 3U2SA 4BKLB 2OYMA 4ZPVB 4FI8A 2A9CA 3TVMB 3ESNA 4W6XB 4L1TA 1AOHA 2XOTA 4CC4C 2UZPA 1MQKH 1PCXA 1WITA 2WO4A 4FQ2H 3V4PA 2EXWD 4JE4B 2P4AB 2ZCLL 3FHQA 4YBLB 5DHDA 1NCJA 1SXNA 1WFJA 2B15A 3HUJE 1TO5A 3SZ6A 4BZ1L 1BDYA 4B9JA 1PLAA 4ONFL 5I1HL 3LV3A 2JKNA 4I4WB 2NQ3A 2DQGL 2DQIL 4PQXA 1MLBB 3QDHA 2EDLA 3GXIA 3QEUB 4Y5VB 2H6UA 3NIFB 4PJ7B 1TYJA 2ORBL 1KTKE 4HJGA 3KLAA 4R90L 1U8HB 4IRJD 2X05A 3D2TA 4AQ1A 2H1LM 2XG5B 4Y2OB 2GY5A 1MJ8L 2PCFA 3ARZA 3BSHA 2WQAA 3MLXL 4FYQA 5JHDD 4ANWA 5BXFB 2YSSB 3VXUB 4HOZA 2YA1A 4OZHE 4FEMA 4QHNB 1VAHA 3IVKB 4I0PD 5DCCA 5HYSG 2NYZA 3TO4D 2OP4H 4A2EA 3KGTA 4XOCA 4B9GA 3CN2A 3HG2A 3HI6L 4DO6A 1J9SA 4IRSA 1LLAA 3SJVD 1MCLA 5CN1A 4MLIA 1PX8A 4U3HA 1PYWB 3EJZC 1OLLA 3PFUA 4M3KB 2IJ0C 4Q2ZA 3VWKA 1MXDA 4XP5L 2QKSA 4PWGA 4JRXA 3WI9A 4X5XB 5ITFB 1Q94A 5TDNA 1QR1B 3O3BB 3NIDF 4HQQH 1JDCA 1Q9WB 3VRLF 2A5UA 1BD2B 3BKJH 3C6SB 5FYLE 4OR1A 4Y1AE 5FYLD 4ABQA 4POZC 5BOZG 4Y1AD 5IF0A 4Y9FA 3I6SA 1QRKA 3EW3B 3FQWB 1HX0A 1NQBA 3DGGB 2V8MA 4LNVA 3VXUA 3ALWA 4F9PC 3NRFA 5D4JA 4HJ0D 5ETUB 1OE1A 1IGML 5F21B 3WSQL 3IVKA 4WHYG 4CNIB 3QUGA 1BP3B 3H3PL 5FO2A 5E0FA 4J8RB 4M7KL 1UD4A 1NDTA 1XIWB 3QUMB 1AO7E 5T3ZL 5F9JA 5ID1A 1XMEB 3SO5A 1URIA 4F3FA 2J1ZA 4F7EA 4YDKL 1FBIH 4JJ5A 3O41A 1IBZA 5ALCL 4JPIA 3RWJB 2IAMA 3S3PA 5DK3A 4ZI8A 2Q76A 1D5IH 1F3JB 1ZJAA 3L7FB 1AY1H 1N0LB 5EBWB 4FG6C 2WXLA 5EZOH 1XZ0B 2BK8A 4WFHE 4ANUA 1YEEH 1OALA 3C6SA 4WFHD 1PD0A 3BP7B 4FQ1L 1OB0A 5MERA 1KGYE 2ZUQC 3TBCA 1VADA 1F3DJ 5ETUA 4JO4L 5GGUB 3R4RA 4BUHA 1CGWA 1K5NB 2ENYA 5D1XC 2APFA 4P9HL 1QI3A 1DUZB 3FU3A 4YDMA 3QUMA 2NXZD 4AL8C 1GOGA 1HL8A 5EUKB 5IK3A 4L1DA 2LE9A 4FKHA 1Z9SB 4EEEA 1YPZB 3K81A 4F92B 1M7DA 2BVQA 4RSVA 3SKNB 2FB4H 1F3JA 1FNEB 3GK8H 4ODXB 4Z7WB 2NNCA 1KTBA 3LDBC 5IESH 3FH7A 4M8QB 5CIPB 1AGDB 2ED6A 1JPSH 1XF4B 3ZYJA 4XN5A 3GXTA 4JZJC 4EQ2A 1L6XA 2Q7AA 1GIGL 1TFPA 2J43A 4YHYB 2CAKA 5C0BE 5C0BD 1M53A 3TIDB 4O5LL 3E3QC 5E70A 2ADFL 4V1DD 3GFUA 4F2FA 3TF7C 4W4NA 2V9RA 1N6UA 5AW7B 3HB3D 1PLBA 1TETH 2KYIA 3OHXC 3WFBH 3WO4C 2EH8L 2ZG2A 1YEIL 3Q9QA 3BGMA 3V6OC 1HNGA 4M7JL 5DS8A 4S1RL 3CX5K 1I3RB 3BGFC 3QUXA 2DM2A 3QUZB 5I66B 1MCQA 1ODUA 1SOSA 3RVWD 5L4FA 3MLSL 5FYLL 4P23C 4LP4A 4ICWA 4GRLA 2D7MA 3IYLW 4FXGC 1FNEA 4ODXA 3VDAA 2V3DA 4M8QA 5CIPA 3OZ9H 2CO6A 4WWOA 2WINB 2WBJC 2YHGA 4N2DA 2OK0L 3D34A 4TNVF 5AYUL 3EJSA 3G5ZA 4XC3H 1U8OA 2ZYIA 1HKLH 1NGXA 1L7IH 1D5XA 1RULH 2B3RA 3TIDA 4ZX6A 3MLZL 4IIQC 1NM4A 3M17A 2IDTA 4MXQC 5HHVH 3LKNB 3WIHA 2O61B 1KLUA 1QBLL 2MH4A 1BVOA 1KMGA 3CXFA 4GBXB 1DFBL 3FSWA 1NIEA 1SVZA 3ZSSA 1KIQA 4XRCA 4Z7VB 4KMQA 4UV4L 4PS8A 1T2QH 1IB5A 1JNHB 3ARGC 3NACH 5HJBA 4AYMC 1LDSA 1UQSB 3PGDA 3B7YA 3VI4E 3QIUA 4Z7QF 1KBWA 2VN5A 2AVFA 3CFUA 4YIQA 4HV8A 3B3BA 3W5NA 1O5DT 5F44A 3PFQA 2DJUA 4GRWE 1RZGA 4L9LA 3BVXA 4PTTB 3EF7A 4ZODA 3TNMB 4HG4J 2VDQB 1N9PA 2VLKB 3VXTA 4ETYA 3C5ZB 1J05A 1SDYA 3V7MA 3VFSB 4A6YL 1MFUA 12E8L 4IKLA 3EKCA 5GISL 4XNMA 2AQSA 2Z31B 3DIFA 5D7LD 4B50A 1QD0A 1GYWA 3N06B 3RY4A 5K9QI 4XPHL 2V17H 1DBBH 2J20A 4G6AD 1MJUL 3MRJA 4LLAA 2O61A 4AT6B 4NAJA 3DHJA 3O0LA 3GSOA 3FQUA 3UIYA 1JNHA 3SDYL 2P5EA 4KXCA 43CAA 2YEZB 1Q9KA 4JFXB 4U1IA 3GSRA 2HWZL 1DJIA 4MXVE 1OW0C 5DD5H 4BSWA 4AX3A 4QRUA 5C70A 3V0JA 5EORL 3X3FH 4PBWD 1S7QB 3STLA 4TLUA 4DO5A 4PVLA 4A7TA 4ZFGH 4PTTA 1JK9B 1KJ2B 1SY6L 3ULUE 2LABA 5BQ7A 2XX1A 3ULUD 1LK2A 3QDGE 4ZMVA 3C5ZA 4ZW5A 3II2A 4ACPA 1YN7B 4J3BA 2VRQA 4XBEH 1IKFL 3H9YA 1YEKH 1M9SA 4EVNA 3EXJA 3LZRA 1OZTG 4PGEA 4PI2A 5C71A 1NWPA 2R27A 5GZOA 5F7AA 3UYOD 4PJ5B 4AT6A 5I1IH 1LEKB 1XGPA 5D7IE 3VTTA 4YHLH 4DETA 1G1OA 5HDQL 3GSXA 4TVUA 2YEZA 1JGLH 4KVNH 5F9WC 5GRVK 1LM8V 3FQNB 3V9CA 3HI1A 4NQSA 1IAIL 4NKDA 1XAKA 1S7QA 1RU9L 2Q8AL 4AJYV 4MAZA 2Z7ZA 5AW0B 5JOEA 1JK9A 1KJ2A 3D69A 4PN6A 4RRPA 3HBQA 1NUDA 4LVOB 1F41A 3JWNH 3Q5TA 4OIAA 3H6JA 4QRSA 4HUVA 2PTTB 4Q0XH 1B4JH 4YX2H 5J6SA 3MRRA 3T8VA 1MFVA 2VOTA 1AKPA 1B6DA 3B9AA 4EKJA 1IAIM 4HBCL 5EBMA 1HHIB 5D1QA 3BZ4A 3T6ZA 3KBHE 2RIKA 2DRUA 3C6LA 4KHXH 4CBPA 4KWUA 4LAQH 4U6YA 1UH4A 2DQEH 4HJSA 3TV3H 1OGSA 4L8SB 4NHCH 1KUMA 4O2FA 4XMZA 4WWPA 3EAKA 1CLZL 1BQHB 3VYPA 3QFJE 3ZW3A 2VDOH 1CE6B 3WJMA 1SLVA 4KHTL 4I2XB 4L29B 3MXWH 1H0DA 3IN2A 3EFFB 3VFGH 4XMUA 2DQHH 4XWOC 1I8MA 2QVTA 4P2OA 1OSPH 3ZLQC 3TXAA 4BRVA 2OSLA 1MVUA 4N0FB 4C83A 1J7VR 3NOIA 2BDNL 3GM8A 2VDPB 3MBWA 3K4AA 2OMZB 2BNUA 4YHKL 5GQBA 2BSBA 1VFUA 2L7EA 4OCYL 4WW1A 5IM7A 4L4TE 3HA0A 5E1GA 2HLEB 4L4TD 3QNZB 5MHSD 3K72B 4PRAB 5J13B 1C7SA 3WHXB 1HHIA 3DROB 4WWNA 4K23H 2FJUB 4KK8C 3W3BA 3NIDB 4X98A 2CUIA 4KTDL 1H6EA 3RFRA 3BRDA 3C87A 2PPAA 4X8GA 2F53E 5CILL 1ZANL 2CG9X 1MH5A 2F53D 3CVHB 5HHOB 1WK0A 5EO0B 2JV6A 3F3HA 4WTZA 5TFSL 3QGVA 35C8H 2VH5L 3EFFA 2GSMB 3GYRA 4MKMA 3WG7B 4H7VA 1O7DC 3LH2H 1FCCA 4TNVK 5GSVA 4M5ZL 5C2BL 3FTSA 1I3GL 1NANH 3P9LB 4H88L 1Z6JT 4G6KL 1U8MA 5DMGC 4Q4IA 4JQIH 2VLME 4P48A 4KZDH 1HHJB 2VLMD 3EHBB 4PJ8A 3O2VL 3D87B 1KELL 2FECI 2IPUG 5C3IA 5T1DL 3O3DB 4KX7A 4WFEE 2BCKA 4P2RB 4KY2A 3DSFH 1EX0A 1V7MH 4WFED 1OM3H 4HS8L 2DLFH 2IQ9L 5F1OB 1OAUH 5EO1A 25C8H 3ESPA 3BAJA 4LDCA 4IW4C 5IB1B 1SNRA 1H8OA 3PWPE 5I76A 4OLWH 3PWPD 1RZ7L 1U8IB 2E7BA 2E7MA 1JGEA 4MNGB 1NL0L 4PEEA 3T0EB 2HX9A 4HKXA 3GB7A 1EA9C 1DL7L 1IGTA 3ECBA 3ZDZE 5JW5A 3SE4C 2ED9A 1FSKC 1P1VA 1YJDH 4FL4B 4PP2A 3KMDA 3WEBA 2XV0A 5LAPA 3U48A 2CHXA 1RP9A 1VFOA 4QRTA 2O30A 5I15L 2AJVL 5MI0B 1GPOH 1KZQA 2QR0A 4L1SA 4NM4L 1HHJA 4PJAE 3R8QA 2E6JA 3T2QA 3APNA 3TA3D 4KY1L 1SOXA 3NCYS 3F8UB 4M3HA 2R2EA 5GRUL 3BHBB 2GI7A 1HNFA 1MI5B 5ESVB 3RHWF 1XF3B 2CR6A 4MZIA 4G8IB 5D8JH 3ARDB 5F7WC 4CN1A 4XGZA 4AE0A 4UOW0 4HW6A 5CD3B 4TMPA 5I6XC 2XZZA 4KJWD 2E9JA 2GCYB 4CMHC 3ZQ9A 3OJVC 3K2UL 4QXTA 5FFGA 3ZGIA 1RIUL 4MNGA 3T0EA 1AGBB 1MF2H 1KCSH 5C0RH 4PYHA 5KSUA 1AFVL 2WBXA 1Y6MR 2NX5A 4FMKA 2FEEL 2Y23A 3MN8A 4TF4A 3TTYA 2J8OA 4BJLA 5DD6B 2HRPH 3QR0A 4FQQB 4P2QB 4QHLB 3CLWA 4GW1B 3US9A 1OAYH 4MMZC 4UI2A 1II4E 2W9DH 4EUPG 1F6AB 3AS2A 4K7PY 2YPVA 4LDOB 2OYPA 4KXDA 3BWSA 1MI5A 4HJTA 2CA3A 4R2GC 5CP7B 1SFDA 2IV8A 3Q3GB 4LOUD 4D0CA 2K4WA 3AMLA 3IDJB 4DKDC 5D93C 1EFQA 3TJEL 2EVHA 4JRYE 3OKOB 4Y7MA 1PKQA 1KXQA 2OTUA 4JRYD 2AV1B 3B9KD 2G30A 4OZFG 3WFDL 4F9LA 4H26B 4G6FB 4UV7L 1RZJC 5CP3A 1Q1PA 1IE5A 4N5ED 2VERN 2VDKB 2X41A 4OLVH 3F2LA 5ECGA 4ZK8A 2YJQA 4LFHG 3QWRD 3TX4A 3BWZA 3FOLB 5LCVL 4PCTA 1W80A 5EZLA 3WNKA 1U2YA 3A24A 3GTTA 1IC5H 3P3TA 4MA1C 4X9FA 3ZQWA 5K9KB 3RWGA 3U6RB 2R2CA 4GW1A 2WXGA 4JKLA 4BFEA 6FABL 2NUPA 2FSEA 3SPHA 1R5VA 3KG5A 4L4VE 5E6YA 3KM2A 1CURA 4LF3A 5B1JC 1NDMB 4L4VD 2CK0L 1ZWIA 4Z7QB 4QF1A 1DLHA 1M6UA 5CKGA 4B9CA 3I3BA 5EU7E 1AHWA 2FJFB 5DRNB 3RGVD 1E8ZA 4XPTH 3QDJB 4OD1L 1BEYL 4N87A 4XCEB 5C0AE 5C0AD 3I50L 1NEZA 4XNQB 4AQZA 4OZIA 5IIEB 2AV1A 2NSMA 3UYPA 2A6KA 1HOCA 3FBQA 4NQDA 1KJVB 4YBQD 3X3GL 4LBAA 4NWUL 2DQJH 5C3TA 2C26A 4U31A 3AFLA 1IC0A 3L3OA 3UPCA 3E8UH 4KI5E 5FA4B 4Q4EA 5CD5D 2DMCA 3U6RA 4NC2B 5C0CE 1SMDA 2K4AA 3P0VL 5C0CD 2WUBL 1NCAH 1NGQH 4HK3N 3T9WA 4P4KA 2ARWA 2APTA 1FNAA 1Q1JH 3LZPA 4WNQA 5CM1A 3H55A 4Y4KB 2V2TA 5DRNA 4POUB 4AJWA 3MLRH 4JFUA 4MNQD 1N2RB 1GJUA 3FAXA 3KJ6L 5DEFB 5EUOF 3RP1A 4GG6F 3IS0X 1ZHBB 5I16B 2ITFA 4S0HA 1I8KB 4OF0A 3I6KA 3RWIA 4FE9A 3NA9L 4ZW7A 3U7WH 4KRPD 4P05A 2YXFA 1TTBA 4GS7C 3ELQA 4Q6IA 5LJYH 2V7HA 1YN6B 4YXLL 3QRBA 5IJKC 2BNQA 1D2OA 5DGQA 1OAQL 1OKEA 1C08A 3QEQA 1A6ZB 1CN4A 3VFTB 1WA0X 4HSQA 5CSBA 3H53A 4R7NA 4B5EA 3B2DC 4JPVH 2FCBA 3FYIB 1LDPH 4LCCB 4CSTA 3TCTA 4HALA 4NBYB 5DJAB 1HOEA 4YUEL 4XP1H 3T71A 4HCRA 5C0EB 4I48A 3W1ZA 3D51A 2ADIB 1IL1A 1N2RA 1L7TH 5HSFA 3LS5L 5ALBH 5E8PA 2VITA 3ZE1B 3MFFB 2C34A 3HC0A 1MRCL 1B88A 2AK1H 2KPNA 2CUHA 3I02A 3OAZH 5JW4N 4W6WB 3N43F 1U8QB 1FNGA 3W0WE 1LEGA 1MAMH 1YN6A 1GGCL 4HMEA 3W0WD 1QFWH 3FZUC 1IARB 3N85L 3JT2A 5AZEL 3VFTA 5JW4Q 1XB8A 3NK4A 3QQ4B 4K9JA 5DJXB 4N6RB 3RHWK 3EOTL 4NJAH 2OM5A 4LCCA 4HXAH 2B4CC 5E4OA 4E2OA 4Q9RL 5DJAA 2H0EA 4F80A 2Y06H 2WJ5A 3EDEA 1HJBC 3S34H 3VB8A 5C0EA 3FFCA 3K80A 3PQYB 1UXWB 4FFVC 3X14A 3HW7A 1TZGL 4HLZG 5AW4B 5IG7A 4GUPA 1CFQA 5LG1A 1ZEAH 4N0RA 1ICTA 2VW6A 1G9NH 1Z3GL 2F08A 1PIFA 3BQVA 3FN9A 2Z6FA 3VM5A 3DRTB 1GYVA 2WXOA 3P2DA 4M93B 1NBVH 3ELAT 3ZT7A 4P57A 4HUCA 5JPMC 2CKBA 3B2MA 3QJOA 1OCWL 2BVYA 5J3HC 4WDIB 3M7FB 2GAZB 3IDYB 4WO4B 3Q8FA 5TH2B 5I1EH 1VZIA 2AABH 4PMEA 1A1MA 2BHFA 5DMYA 5LNGA 5JHAA 1TNNA 3ALXA 4MNHB 1LP9E 5E6RB 3BN9C 2VZ1A 4ZUSB 2HTLD 4CSZA 3AB0C 3NCCB 4G8GA 3DUHA 4NKIH 2GC7C 4K5OA 1JYNA 1MLCB 2A0LC 3CX5J 1R3KB 3FB8A 1CBVH 3DRTA 4LPVA 4WY7H 1M4KA 2XACC 3FB5B 3FO1B 4WK0B 5EEUA 3M1CA 1H8NA 2CA4A 2DBJA 3C60D 3EGXA 3KXFD 3GTVA 5DHVH 1TSRA 1E9OA 5I71C 1DQLL 1DVUA 2GAZA 3AADB 2OP4L 5TH2A 5I28A 3WIAA 5KSBE 1MHCB 2PO6D 2CMRH 4KGJA 4LSVH 2P3YA 3IJEB 4F15C 3B5HA 4ZFOL 2QHLA 4NC1C 4ZO8A 3CN4A 2QADC 4KZEH 1YHPA 2ADGB 4IGBC 5IROD 3CQPA 2JK5A 3LPPA 3O4LE 3UTQA 1UUNA 3O4LD 4GP4B 3JZYA 4HQQL 4AVIA 5E08H 2QMJA 1F58H 3G6JA 4X9IA 1BQSA 2X1WL 4BFOA 1P4UA 3BPOC 3MVSA 5I1DB 4XHQA 5EEVA 4L8CA 3AWGA 3FO1A 1XFPA 4BFGA 3IMUA 1M7IB 1MIEH 4APQB 4YN3A 1G43A 3QS2A 4CVXB 1NCCH 1PL3A 3SKOA 4DJMA 3GLDA 1CDGA 4YK4C 1UG9A 3MRQB 2PP8A 4JFOA 3EOBB 3KLLA 3Q2WA 1MHHA 1JFQH 4CGUB 2V0AA 4JKMA 3SO3C 1X5AA 4ZW3A 3NP4A 3V5HB 1IUZA 4K94H 3VMOA 5E5UB 1E67A 4X4ME 3U0PB 5HVFB 2HTKD 4P59H 3CN1A 3OXSB 1XH3B 2ADGA 2F18A 1V27A 3BO8B 4ZOAA 1FZMB 1D5IL 4JPWH 5CCHE 5IQLA 2L7UA 3KPRE 4HK0A 3KPRD 4NO2A 3KVQA 2P44B 5EZOL 5H37A 3OMAB 1YEEL 2NTFB 4MQTB 2YN3A 3NZSA 3TS8A 3IU3B 2H2PC 4LIQE 1J5IA 1E9PB 4ZS6C 4APQA 2UZXA 2CLRB 3BMVA 1WGVA 3OKLA 1O6TA 2JVUA 4KU1A 1J8HA 5IT2L 2W9EH 2A74A 3AT0A 2NY5C 3GJFH 4ZAKB 3BKMH 3VAEA 1NSNH 2MFNA 3VXPB 4KROC 4MJ6B 4QHMA 4U6VH 5AKTA 5I1GH 2WM0A 5KSAC 2XIIA 2YRLA 2H9GA 1QSZA 1KFAH 4XX1E 3VQ2C 1G1CA 1GYCA 3MJ6A 2IIJA 4JKPH 4YHOH 1IKNA 2GJ6E 4P5SA 4R4ND 1GW0A 1SQ2N 2WB7A 1JNJA 3DDGA 3IGAB 1A6VH 1BECA 1A3ZA 3OSKA 5E1HB 5IR1A 2VNCA 3BO8A 4DGUA 4N9GB 3SYAA 1M3JA 1O7SA 2K6WA 4AQAA 1EDHA 5GGSA 5IESL 2WW8A 3ZRSA 3AQZA 1XEUA 4NUGH 1JPSL 4Z76B 2YOCA 5HDOA 3RVUC 3KPMB 3P2BA 3QEHB 3SQBA 3IU3A 2VT0A 1E9PA 3DMMC 3VGAB 4FMVA 4P99A 1JRHL 3RNQA 1YZZA 2XVGA 4KRLB 1D6EA 5AW3B 4XNAA 4LBEA 1GZPA 1L9SA 5IHLB 4NI6A 1X7QB 1U3HB 3HC3H 3VXPA 1QLEH 1W8EA 1DQQA 3Q05A 5HYQB 3HHSA 1OOAA 5E1AB 4N25A 1KENH 3MA9H 2MHAB 4ZFFB 1HS6A 3RFZB 4OF6A 1UA3A 2FWUA 4X5WA 4H5SA 5F9AC 3SYPA 3W9EB 3O8XB 1TTRA 4AQ1C 4ZS7L 4N2GA 2KLSA 3OZ9L 1I85C 2VSDA 3A4FA 2ENJA 1VRSA 3QNXB 4JZNA 4S1QH 3KPMA 4XC3L 5E6IB 2W0FB 1HKLL 4NUMA 4OI8A 1F11A 1U95B 2QZ5A 1L7IL 1RULL 1RV6X 2Z8WC 5EUOB 2L04A 2EIBA 4JHUA 1MOEA 4GG6B 4NNYA 1NBCA 4IRSC 5HHVL 3DX2A 5E7BA 3S5LG 2CALA 2BHYA 2B08A 2VL4A 3V4VB 3OB8A 4J39A 3VWKC 3PWLA 1E8XA 4ZDHB 1VGKB 2AI0L 2A6IB 4M61B 4TNWK 5HDWA 3UZVB 3L1OL 4IMLB 1NC2B 4QTIH 5E1AA 3SCMA 5SWZB 1BWWA 2XQ0A 2MHAA 1PDKA 3Q8EA 5IUCA 4LP8A 4XVJH 1KN2H 3K71B 4M5YH 5HI3D 4GAYB 1INEH 1AGEB 3CDYA 2BFGA 3UTSE 4HWZB 3SPCA 4PP1C 5GRZA 3QRGH 3UTSD 4Z6AT 5C97A 5DMIL 3OZLA 1JPEA 1IBFA 2X42A 1K85A 2DQFA 2AK4D 5E6IA 2W0FA 4YDIH 1U95A 1JGVH 4JANB 3FOMA 4M43L 1ITCA 4I3GA 2FHBA 1Q72H 2J6EA 1CPUA 4X6CE 5KYUB 1J8SA 1UKQA 4RFOH 2V17L 1DBBL 3GZPA 3CV5A 4NOFA 5LG6A 1MHEB 3N0PB 3EGSB 2OMWA 3ARQA 2W80C 4X99B 5IQMA 5DD0H 4LOVA 2IAMC 1T0MA 4M61A 1QBMH 1CFNB 3N43B 2GUOA 3NIGF 1NC2A 3VXSB 1Y18A 2CHNA 1J9CT 4PGZA 3KCPA 5DD5L 4M8RA 3NFSH 2BSRA 3JVGA 3X3FL 1MWOA 3DYMA 4AYGA 1M2OA 3LVTA 1M05B 3SD2A 5CBEB 4KJYB 1X4ZA 4UOJA 4MAYD 3HE7C 3ARFB 2XZQH 1TKWA 1EH9A 4B0MB 1BAWA 4WVRA 5EPMB 2QHRL 3QNFA 3IDNB 3VFMB 4EI5A 4NRXB 3LD8B 1KEGH 3G9VA 2YR3A 2M2DA 3UIZA 4EMZA 1BXUA 1JF5A 4K7FB 4PY8I 4QHUB 2CO7A 1GVIA 5J89A 3OBAA 5I1IL 3NGBC 3P0YH 4U1KA 2OR7A 3DYOA 1CMOA 2YMOA 2UXFA 4A39A 4YHLL 2A9BA 1V55B 4X8XA 4FLSA 1DBAH 1JGLL 2ZF9A 1XGTB 3OM3B 2B8OT 1EEYB 3IDMB 1Z5HA 1MCHA 4X6FB 4IKKA 2R8SL 2Y7OA 1JV5B 2WBKA 1YY8B 1E27A 3B2UD 1M05A 3MODL 4ZQKA 1UOKA 5AVZB 3C75A 4PJ9A 3DX9A 3MXVH 3ZE0E 5ABZA 3ULVC 3QUYA 5FM8A 2YS4A 5MENA 1FVEB 5DHYB 1B4JL 3L2LA 4NRXA 4XE0A 1JZHA 2AMGA 3B8YA 4NQED 1LVEA 4RCAA 1CIUA 4XZ4A 1XB6A 1P2CB 3VRJB 2MCG1 2YO3A 3TNNB 5C0GB 4GKSB 3QUXC 4KHXL 2J5LC 4LAQL 2DQEL 4N2HA 1TQBB 4NHCL 5LGHH 1KTDB 5JQIB 4G82A 4MA3B 1Z9PA 3IJSA 3SDAD 5HDBF 1QR4A 4GRLC 3Q44A 4NZDA 4JR9H 4PIRF 3RWCB 3UC0H 4ECNA 2N4IA 1HDMB 2OPCA 1U91B 2ZG1A 2QZQA 2R2HB 3MXWL 5GGQH 3VFGL 5L0QB 2DQHL 2OXHA 2HVKA 4PWKA 3VD3A 3GBMH 2ZSVA 1OSPL 1QQDB 2ADYA 2E7HA 3RX9A 3O9WB 3DBSA 1EO7A 1W8NA 3NFNB 1PD1A 3HR6A 3IK2A 4Y5YA 1FVEA 3U46A 3BIBX 5FF6B 4MX7A 4TVPH 3CDFA 4Y9GA 5J1SC 4YFEA 2DB8A 1ETZA 1R3LB 4GG8A 2WXNA 2E6PA 2KZ1B 3TNNA 1TF4A 4G80A 4AZ8A 1NBQA 1I1CA 3QIUC 2CDEB 1A22B 3ARED 2AV7B 1FCGA 4ORZC 3SDCD 2X4UB 4F2MA 2VMFA 4CAGA 1EO8H 2AVGA 4CBZA 4L9LC 3C8HA 5TE6H 2YWYA 3H9SE 1JF1A 2H4EA 2WAQA 1JHLH 2VDLB 1U91A 3GSNH 4BE6A 4NWTL 3FBKA 4MD5A 3LH2L 1MRDH 3PPEA 3P4OA 4JJHA 3QXAA 4N22A 2HJKB 3AG2B 3ZR6A 3QR1A 3NFNA 4JQIL 2I9TA 3OAYH 4ZMNA 4KZDL 2F7OA 4KKRA 4C54A 5C08B 4IOSD 2AQQA 2IANA 4OQTA 5GGTL 3MV8B 4RGMC 1XR8B 3FUDA 1XQ4A 3DSFL 4X7SH 1FO0B 5B7MA 1OM3L 4YAQB 3MA7B 2DLFL 2BOCB 3UAFA 5F1IB 25C8L 1QYGH 1Z7JA 3BAEH 4LHUA 1UM6H 3BX7C 4OLWL 3BJ91 5F7KC 1CQYA 3IEAA 3D05A 5BW7A 1P1ZA 1ZA6A 2YZ1A 4JY5L 3RUGF 3RDTA 1YJDL 4BCYA 4WV1A 1RZKH 3EXLA 2NY6B 3IBEA 5FK9A 4J3OC 1L0XA 4NBXB 3F5WB 2C1PA 1UZ8A 5IFAH 1TXKA 4U1MA 4JG1H 3IKCB 2AP2A 4YGAB 5A6MA 1GPOL 1PS3A 4DH2A 4QY8B 4Y4HD 1ADQA 5GZOC 1FVDA 4HIEB 1T80A 3H7LA 3M1BB 1MPAL 2ITDB 2C7UA 3NABH 2M83A 4OGAC 2NY4D 5D8JL 2YMXL 5JW3H 5F1IA 1OP3K 1DO6A 4OD3L 1SOQA 5BRQA 2UXTA 3X1NA 1DZ0A 3PYCA 1D9KA 3OLGA 2VDRH 2Q6WA 1MF2L 1KCSL 3K0WA 1I8LC 2D0HA 1BXVA 5I1AB 1YO4A 4GXUM 2XC8A 2HLAB 1IV8A 1YYMH 2ERJB 3MFGB 2HRPL 2HLFD 1Z5YD 5CLXA 1MKFA 4NJ9H 1E2VA 5CO1A 5FYKE 3DBXB 3VYOA 5FYKD 5KBDA 3KZ8A 5I8CB 3LCYA 4R0LB 3VFWB 4QRFA 5AW5B 4QY8A 2W9DL 3LZNA 5D1QC 1KULA 3C6LC 1TEYA 4ZXBB 1RPUA 3BZ5A 1PSKH 1EXHA 4N8PA 4GB9A 3HBGA 3F83A 1X3DA 3T0WA 4ELDA 1VZGA 1CD0A 2BFVH 1S9KC 1I1AB 1T7YA 3CFTA 4DW2H 2FEJA 3OKEB 3NYKA 1QABA 4PJ6A 4LCIH 3U7AA 4KGLA 5DFVC 5PAZA 3PDGA 2VM9A 4Y19E 1W6LA 1XHHA 3NAAH 2ZWYA 5J6GB 3OWEA 1E4XI 4JM2F 4P2OC 1CGSH 2BIHA 1FL6B 1PNCA 3UAEA 1T4KA 3GZQA 3ESMA 1S7UB 4PRIA 2Y2YA 4X7FC 4C4KT 1BOYA 1IC5L 2R56H 3E9TA 3P3UA 3KLDA 2P5WB 2IH8A 2X87A 4X8JB 2CO3A 5I8CA 2YEQA 1SYSB 5CXPA 3NCEB 4NT6B 1NCOA 2VR6A 4OZHF 4DPBX 4ZXBA 4PV9A 3AXIA 4P5RA 2BWQA 5DMJB 3EBIA 3DV4B 3Q5YA 4XPTL 3NEEA 2UZIH 1MZZA 1GL4B 1YUHB 3MBEB 3AY2A 4QXWA 1RURH 3MUHL 3OKEA 1H3UA 1I7UB 3NJHA 3F00A 3VMPA 3SGDI 3QS3A 4MJJA 2AKRA 3MREA 2CUAA 3VWJB 1CDUA 3IDGA 5J6GA 1UZGA 2Z34A 3SOTA 2DQJL 1UENA 3FSVA 3OAUH 4JGMA 3PJNA 1KSRA 3DURB 3E8UL 2XTLA 3D50A 3NRPA 5KANG 4UZGA 5DWUH 4PJ8C 3UJIH 1HYSD 1CGVA 2UVFA 1MFEH 2O72A 1WUZA 4NQCA 3VD2A 2MNUA 4QD2E 3O6LH 1VGEL 2B0SH 2P46B 3BPNB 1NGQL 4X50A 1G7QB 1NAMH 3L9BA 1JVLA 3NIGB 3PHOB 1Q1JL 4MMXC 3TEYA 4PGCA 3CZLA 3DV4A 3GF8A 3VSTA 2VN6A 3KDMB 5J0BA 3O0RL 5EU6E 4FP8H 4YHPB 2X40A 5ICYB 2P7TB 3QCUH 3S3BB 4JHWH 1QFOA 2R4RH 4P8QA 3EH2A 1X5HA 2Y1ZA 5IREA 1OPGH 1JPFA 3EJYD 4NYLA 4TL4A 3VWJA 4GAJL 2Y69B 4NN6C 1DBJL 3MPCA 3F7VA 1MJJB 5A2FA 3BEVB 4OLYL 2HZHA 2VQ4A 2HCZX 5FCSH 5FXCH 3GMPA 3WAJA 3E7JA 1NMAL 1RZFH 3TFKD 1SF5A 4JPVL 3T8XB 3Q8BA 3U4KA 1LDPL 2AJYH 2EIEA 4PWHA 2OMYB 5JR1L 1MSPA 1MCKA 2HKFL 4KV5E 5DQJB 4WI9A 3PHOA 3U9PH 4XP1L 4EDXB 4LPYA 5J12C 4N24A 3ECQA 3CFCH 3IN0A 3HS0B 1BMWA 4W68A 4ZOEA 4WWKA 2B20A 1I4FB 2AK1L 3VXMB 1LO3H 4J3OG 1LWJA 1EUTA 3QW9A 1O75A 2P28B 2P8MB 1A6WL 3DV6A 4LLMB 3VA2C 3RZCD 4GQQA 1DDHB 4XNZB 5F70A 2EUWA 3U0TB 2Y22A 2OX5A 5DRZB 3TOPA 4NKOB 1J9TA 3O2DH 5JHLA 4XOEA 1IAII 4UT9L 1AKJA 1UXLA 1EAPA 4HEMA 4PIBA 2G2RB 4S0TD 4NJAL 4WHYH 4UT6L 3WGUB 1Q38A 2G3XA 1ASQA 2Y06L 1BFOB 5LWYH 4LSSH 2WJ7A 5BZZA 4EDXA 3CE1A 2HFTA 1ILUA 4N2KA 3DECA 4GJTB 2Q7NA 2EH7H 1A9EB 4FXLA 3LEVH 5DC0A 4G43B 5FA3A 4WW2F 1DANT 4KVCH 4F9LC 2FWSA 2NSXA 4PJGE 1RK0B 4JQVA 4DEPC 1ZEAL 5K5YA 2PR9A 1NOAA 4QT5B 1G9NL 4RRPG 3MRGA 1T6BX 1GY1A 1U8JA 1KDJA 1ET5A 3EOAB 4HJIA 1DDHA 4R5XA 3ZVVA 1NBVL 4JUSA 1QLFA 2E46A 4N0UB 4GFTB 1DQIA 1DJZA 1QA9A 4WUKH 4Z78B 2RFXB 2P43B 2N0MA 4YEEA 1PMYA 3BZDA 4JFEE 4D94A 2WD0A 4H8WH 4JFED 3U2JA 2EKSB 3RVVD 3WKQA 4KKQA 1AHWC 2BHZA 1U33A 5I1EL 1ZVNA 2AABL 2FEDD 2FHCA 2NXYB 3L4TA 1F18A 3I2CH 1SHWA 2OZ4H 3FT2A 2WP3O 4UM8A 5ISZB 4G43A 2DLIA 3Q8AA 2WQVA 4LSRH 5LN4A 5AW2B 3GGWB 4NKIL 5IOPB 2XQBH 3TBSA 3VI4F 5INCA 4AMWA 3L3OC 2O4EA 3ZYOA 4H1LB 1CBVL 1KGCE 5KEZA 5D1ZI 4FXTA 1KGCD 4WY7L 1T5XA 3V6FB 3SE8H 5C7XH 4GRWF 2OTWA 4Q97A 4LQ1A 4N0UA 2K9UA 1F42A 5B38A 1F6LL 3ATBA 5GGRB 5F7NC 4P4KC 3ZTJG 3WY2A 3EYFA 3D39B 3LXBA 8FABA 1WAEA 2O5YL 4OH2A 2BVTA 1A7RH 2DKSA 3LB6C 3E1ZA 4YDJA 2CMRL 4LSVL 3NT0A 1BQHG 5EN3A 3RUGB 4CUCA 3IT8D 4FFWD 4BZ1A 2YAFA 4WTZG 5MP6H 4KZEL 4OFDA 1OIOA 3HNSL 3EDFA 5D2NA 5MEQB 1HXYB 5A2AA 4Q6IC 5DO2C 1UHVA 3GGWA 4AY0A 5IOPA 5E08L 4AJVA 3SIKA 3L1GA 1F58L 3O6FB 1FFPA 2CQVA 3BSZH 4N2AA 1HE8A 4LSPH 4R6UA 2GB2A 1NKOA 5BVPL 1MIEL 1FG9C 1MWAB 2AMUA 3UPRB 4WFFE 4X9GA 4K8RD 1HHGB 1KCRL 4WFFD 1NCCL 3B56A 3PV6B 3TYFB 3QUHA 4NZUH 3BFWA 1JTOA 3P02A 3NJMA 3OTTA 4BD4A 2QSCH 2HXAA 1F4XL 2TSBA 3IAQA 3TN0A 4HU8A 2N0KA 5IUSA 3I74A 4JZOB 1EUUA 4K94L 2WTOA 4F33A 6CGTA 5LBSA 4K5PA 5DRXA 3OKDA 4ZX4A 3WEOA 2QQKH 1RZ8B 4OLXH 5TDPB 4P59L 2YBRB 2KDYA 3UCQA 4X7TA 5D96B 3WS6A 1HXYA 1NFDF 4JPWL 5ESAB 1V5JA 2XTJE 3DJSA 2XTJD 1WAAF 3FH8A 2Y5TA 1R34A 5IHZB 2XWCA 3LX9A 4YBHA 5IHHA 3KJ4C 1HN1A 4KO9A 3D25B 3H7BB 3NPSB 2E6QA 3ATAA 2K8QA 3LN9A 2W9EL 4B97A 4FQXD 3V4UH 1NSNL 3FTWA 4HEPA 1JUFB 1XZWA 3TCLB 5I1GL 3H56A 1KFAL 3BP6B 3GSWB 4JM2B 4JZOA 3MCLH 1FJ1B 4JKPL 4KVPA 1XTLA 3VFVB 3MV9A 4OAWB 3VD4A 1RZ8A 1WCBB 5TDPA 4IRJB 3KPSD 5T1KB 2YBRA 3L9YA 1Q0YH 4CGTA 1OCRB 1QTYT 3EJCA 1DVTA 1NH6A 1HAUA 4MTMA 1UADC 2AQPA 3FO2B 1S46A 5ESAA 2E7DA 1CXKA 4NUGL 4NZTH 5E94A 5GS1C 3HAEB 3OSVA 3UTTE 5A2BA 3UTTD 2CCWA 1KBKA 2XWEA 1HI6B 3MRDB 3QZMA 4OZHB 3RL2B 5KOVC 1UM4H 2MOQA 4DN3H 3B83A 2HJLA 3HUJA 3SGEH 4B3VA 2A83A 2VJXA 1NAKL 2DMHA 2DDQH 5AB9A 3DLQR 1YAZA 3I6GA 4CADA 3BAKA 3HC3L 3IFNH 3IJ8A 4R97C 1JUFA 1QLEL 1DUYA 2HSIA 1DJSA 2J8UE 1FJ1A 2ZE0A 5IEHB 5D6CB 2NR6D 5I74B 2C7FA 3MA9L 4RAVA 1DQMH 1R1CA 3AGWA 5A3IC 5HY9B 1CLYH 1H5BA 4IRJA 5T1KA 3QIWB 4RGNC 2W60B 3MQIA 1RZPA 3L9RB 3N1QC 4K8RL 4Y1AB 1N5AA 3VG9B 5JHDA 4XNDA 2VISA 4GP5B 2COQA 4NC0B 3HAEA 1T2JA 2EE9A 2JQAA 3GKWL 3DX4A 1TZOA 4J4PA 4S1QL 2ZNWA 4WKXA 3C08H 1PGRB 3TO4A 2EE3A 3DUSB 4WJ5B 1G5GA 2C3GA 3OGOE 5L2KE 5CZKA 4YDLB 5L2KD 4Z0BH 2PMZA 3P77A 1GZHA 2YC1A 3SJVA 2NNAB 1AO7B 1IEBB 1EJ8A 1GC1L 1JTTA 2IG2H 4AL8H 3OAWA 4XOAA 1JP5A 1MY5A 2WNKA 3ILQD 2OL3L 1AXIB 1PKOA 2VLRD 4J28A 3QH3A 2ITEA 5DRWA 4AE1A 3QB7C 1A1NB 2JMRA 5A6IA 4QTIL 5IEHA 2LOEA 3FS9A 5D6CA 4GSXA 4JFPA 3GMMA 5HY9A 5H94B 1B0GB 1KN2L 1KNOA 1U0QA 1KXHA 1INEL 2W60A 3GXUB 4Y1AA 2F8VA 2J6WA 2KH2B 3QXTA 1MFAH 1D7FA 1CFBA 3QRGL 4IU2B 4OT1L 4Q52A 1NM9A 1Z3RA 1WG3A 2Z91A 3M86A 4DCQA 4WI6A 3DO7A 3EBGA 3F84A 4ODBD 2X10A 4M4RB 4ZMPA 2JF1A 3JWOL 5JYLA 3DUSA 4J1UA 4LCWE 4YDIL 4A6YB 1ML0A 4WJ5A 4LCWD 1KC5H 4ZMOA 1VKXA 5E24E 1Q72L 2DQMA 4KK5D 2NNAA 2ZCKH 3N40P 2B1AH 2X4QB 3UTZA 4HC1H 1FVCB 5JIQA 4F2EA 3IMTA 4Z8FL 3WKNA 1QSFE 2M26A 5DD0L 1QSFD 3ARVA 4YSUA 1QBML 2DM3A 3ATEA 1A1NA 3NJGA 5EB9A 1AC6A 1QFUL 3NFSL 1OO2A 5GSRA 4DF9A 3BUYA 3DJRA 3VCLB 3APFA 1L5GA 1HL4A 2WWNA 4HOMA 3ULSA 4IU2A 4U6XB 4OCWH 1ZIBA 4I85A 2ED8A 2XZQL 2VB5A 4ZPTB 1HL5A 3D85B 2JSFA 3IXTB 5F3BA 3AXHA 3G5YA 3KL5A 1U3NA 4BFRA 1RJYB 3SKJH 2M1KA 2A74C 1KEGL 1VEMA 1EFXB 1BQLH 1ZJBA 2B5IC 4WW2B 3TVMD 4YSTA 6PCYA 4GIOA 2AW2A 1BEXA 3OR7A 2D2OA 1PLCA 4N2CA 2G3NA 2HP4A 5HD8D 3P0YL 1IKNC 2VL5B 4HCIA 4H0IA 4A2MA 3JUZA 3CSFA 3ZSTA 2EDRA 2AEOA 4AXWB 3F7PC 3RKPA 1P7HL 1QWHA 1EGJA 5LXVA 2XN1A 4BFIB 1UJ3B 3TBBA 3IMWA 1GGBH 1GHFL 2EE6A 4GI6A 5FM5O 1RFDL 5EMYA 2X12A 4UTAH 5C0BA 2EIMB 1IJ9A 1OK0A 3MXVL 3VG0H 1LWRA 4JLRB 4TSBH 3BVNA 3KNBB 4V1DA 1SHMA 4PJ7E 2NNXA 4X7EC 1T7ZA 1KGWA 3L5HA 1ZXKA 4YFLI 3E2HC 4G8FB 3HLKA 2Y6SC 3E8VA 3ZKXB 2GVYA 1BREA 4R7DB 3KYKH 3VI4B 4PGBB 3CMOH 1ZTXH 3FB7B 5LGHL 1PY9A 1T66D 1T1YA 1PTZA 2OCFD 4GRWB 2AHIA 2H32H 4M7LL 4N6QA 5FB8B 4JR9L 1J1XH 2CLVA 3GMOB 4F7PB 1NPJA 3MUGB 1EHKB 1HEHC 1OE2A 2FVNA 4J7RA 1VFBA 3TEXA 5CFHA 1HQRB 1CI5A 3GBML 3PS6A 4MCNA 2RALA 4EAEA 3SZKC 3IRZA 3OL2A 2H45A 5F7DB 2GIYA 5MEOA 3CH1B 1K8DA 4M5SA 3PP4H 4P46B 3TWYA 3Q7JA 1M9WA 4KI5F 4EUPH 1JD9A 1YEFH 4KK9D 3EYQD 3S3CB 1BD2E 5IMKA 4TVPL 4X9HA 1BD2D 4G8FA 4YFLF 1N10A 4JFSA 2XWBB 4HKZA 1OB1B 1EEQA 1YQ2A 3Q48A 3HN8A 5E6UB 2ZX7A 4FZ8H 3SCMC 3IAPA 3W9DB 4PY8J 1U58A 4DFIA 3UBGA 2ADJA 1EO8L 1Y07A 4PRBA 1MW3A 5D1ZB 1BQKA 3KPOB 1IE4A 1EK3A 1EZSA 3N55A 2VDNH 4MD0A 1XIWD 5TE6L 1EZLA 3QDGB 1JHLL 1D5BB 3GSNL 4O02L 4DFHA 2J72A 1HQRA 3KVPA 4XVTL 3MGTB 1MRDL 3VVVA 1BMGA 5IBUB 4Y9BA 3TT3L 5F7DA 4FQPA 3CH1A 2BRRL 5CZRA 4WCYH 1RMFH 4K2UL 4EN3B 3FT3A 3K8KA 1JF6A 3KVDD 1UZ6F 4JM0A 4X7SL 2PCPB 4NQTA 4TSCH 2VN4A 2UY6A 5FW6A 1DANU 2O6DA 5EU5B 1L9MA 1NFDB 5GGRY 3PWNB 1QYGL 4DVBA 2P1YA 3Q0HA 1UM6L 5HHPB 2Y5EA 3W9DA 3JVGC 4TQ8A 4ZT1A 3HR5B 4LLDA 3FUHA 4Y5XB 3PWJB 3HRZA 4H13C 4PSPA 4PJIE 2WLKA 3KPOA 5EBLB 4U6HB 3VDBA 4RWYH 8CGTA 4FQHB 5JMOC 4IOFD 5CEZH 5IFAL 4JEGB 4P5KB 3VXOB 3RJDA 4EI5C 3FU9A 1OTTC 2LFGA 3NFPB 4RAUB 4Z7WE 4QYOA 4KJQD 4Y89A 4KRMB 3TH4T 4JO5A 1PY4A 4AMKL 1VACB 3BOVA 4JFWA 1HE7A 1ZS8A 3L48A 5F0LB 5D7IA 3W56A 3NABL 5L8LB 4IM8A 5D70H 5GJTH 4IJTA 1VENA 5JW3L 1DTUA 2EC9T 3QFJB 2GTZA 1SN2A 4XNXH 2FR4B 3OJDB 3TASA 1LYQA 2VDRL 2E7LA 3HR5A 3VI3A 4Y5XA 4AGLA 5H37G 5JNYB 3T2PA 3MRBB 4PJ9C 3QUZD 3FCTB 3S88H 1IAOB 3QUYC 4J3WA 5AAPA 1J1PH 2YK1L 1G7MB 1MFCH 1YYML 3FONB 3LEYH 4QCIB 5AW6B 43C9A 3AXLB 1AD9A 4NAQA 5IEKB 1IEAB 4KQ4H 2F5BH 4NJ9L 5TJWK 3R06A 1WAPA 1SGKA 3BLBA 1UASA 1A25A 1UT1A 2LQRA 1Z5LB 4D9QE 1VACA 3AMKA 3N40F 1KB5A 2NYYD 1U8CA 2LR4A 3BCFA 1PSKL 1DFXA 3U83A 2HT2D 4P3DA 4G9FB 1OM9A 2CJ3A 5LVEA 1YEWA 2BFVL 3QZLA 3T77B 4M4PA 3MRKB 3WTVA 3ZIMA 5IJDC 1A4AA 3RVTD 4DW2L 2FR4A 1VCAA 5E2TL 2XKSA 4LCIL 1UC6A 4X6EB 2Y9RT 4GBXD 4PWEA 3CHOA 4EXPX 4Z7VE 3DNKA 4B96A 5KVGH 1SHXA 2HFEA 3NAAL 1B0IA 1OEZW 1CO1A 3L6FA 3MRBA 1CGSL 1H6UA 4K7PL 3ZZSA 4LGSB 2C9XA 2BP3A 3FTGA 4HH8A 4XBMA 4Y5YC 3C5SA 2ICCA 2BS9A 5FOBB 1HH6B 4Z0XB 4L4TA 4RZKA 2WWOA 2EIZB 3TPUA 3FQRB 4OFYA 2VLKD 1E28A 3WLWD 2W0KA 3SYCA 1DVYA 3D52A 5DJ6A 3LEXB 4ILDA 4JO1H 3DGCR 2WNXA 4OLZH 4BQBA 2UZIL 3SPVA 2Z31D 2F53A 3P11H 4R4BB 3T77A 3LKOB 2C3HA 3U0WH 5CZXD 3ABLB 4ZUWB 2WZ6A 1RURL 4JGNA 4YFDB 4DP4X 1WLHA 2D31A 4HAFA 3TWCH 1R46A 3QI9B 1SVCP 3CFDA 3NVQA 4GNKB 1ZT1B 1A6UH 1ET7A 1LQSR 2R1WB 1MCOH 1MIMH 2OXGA 3OAUL 4Q58C 3FTZA 4UQ3A 4AK2A 3CFQA 4M7ZB 4WHTB 1JXGA 3UJIL 5IMMB 5DWUL 1MFEL 1Q4NX 1YQVH 4CDGC 4M6ML 5IB2A 4K9EH 5LCVA 4LGPB 3EJPA 2B0SL 5AB0A 5FFLA 1J18A 1NAML 2F54B 5I6KA 3MX0B 1QUNB 2XV6B 3DWTA 3PWPA 5SX5K 4LRIA 4GSDL 3TJHD 3LEXA 5HGHB 3QRLA 3MLUH 1TQCB 2A73B 3D0LB 4K71C 4GY4A 4NIKB 1IGYB 2Y7SA 2FT8A 1IBGH 1S78D 4R4BA 1EAQA 1HILA 2EEAA 1RZJH 2MNJB 3QCUL 4OZ4A 3MRLB 5I6NA 4JHWL 3RDTC 4WV1C 4DO4A 4PJ5E 2R4RL 1TVBA 4D9LL 4FFZA 4PJ5D 3F01A 1JXKA 5DUBA 1E50A 3V0HA 1OPGL 1CYWA 4ZNCD 1RUAH 1W8OA 4OM1H 1S5HB 1RSFA 2PR4H 3I3DA 4TRPH 2C9UA 1CUOA 2OMVB 3HI5H 4PGJA 5DJDA 4LT7A 4PJAA 3IPEA 4WHTA 2VMDA 5G5DB 3TA3A 4A66A 4K3DH 3UEQA 3GLZA 1L3NA 1TZHA 3FXIC 4PY7B 4NENB 2ZYHA 1RZFL 3CZFB 2ZF8A 3IFLH 2AJYL 1J5HA 4