1E9OB

Crystal structure of bovine sod - 1 of 3
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDDERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTSTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
total genus 41
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9oB00
1UXLA 1XTLA 1YAZA 1DO5A 1E9QA 2AQSA 3T5WA 1TO5A 1BA9A 3ECVA 4U4IA 3CE1A 1SPDA 2ZKXA 2Z7YA 1F1GA 1N18A 4A7UA 1CB4A 2C9VA 2JCWA 1OAJA 2C9UA 2XJKA 1CBJA 1IBHA 1N19A 1S4IA 4N3TA 1UXMA 2E47A 1SDAB 4BCYA 1IBBA 5KBKA 2SODB 1PU0A 4OJAA 2WYZA 4A7QA 2VR8A 1OEZW 2Z7UA 1QUPA 1XTMA 2JLPA 2GBVA 1SXSA 2Z7ZA 1YSOA 2VR6A 1SOSA 1YAIA 1TO4A 1SDYA 1JK9B 4MCNA 1KMGA 2AQTA 1HL4A 1B4TA 1AZVA 2ZKWA 2ZKYA 3H2PA 5CU9A 3GTVA 1E9PB 3PU7A 3HOGA 3QQDB 1E9OB 1BZOA 3RE0A 2WZ0A 4A7GA 2WYTA 3MKGA 1HL5A 1Q0EA 1PTZA 2ZOWA 2WWNA 1E9QB 2WZ5A 3LTVA 3CQQA 1OZTG 1SXAA 2Z7WA 3L9YA 1P1VA 1IBDA 2LU5A 4A7GF 2AEOA 1B4LA 3S0PA 1Z9NA 2AQPA 4MCMA 1F1AA 5KBMA 2Q2LA 2K4WA 5KBLA 1F18A 1MFMA 3F7KA 3H2QA 3ECWA 1JCVA 2WZ6A 1SXNA 2GBUA 1SXCA 4BCZA 3KH3A 4A7VA 1Z9PA 3GTTA 4A7TA 1SXZA 3CQPA 3KM2A 1DSWA 2WWOA 2WKOA 1EJ8A 3GZOA 3GZPA 4L05A 2APSA 2AQQA 3K91A 3KBEA 2VR7A 2R27A 1COBA 3KH4A 3GQFA 1ESOA 2XJLA 1OZUA 3MNDA 2WKOF 4B3EA 1U3NA 2AF2A 3SODB 2AQNA 1IB5A 3ECUA 1F1DA 3F7LA 4FF9A 2V0AA 4N3UA 1JK9A 3KM1A 1PZSA 1IBFA 1SXBA 1RK7A 4OH2A 2C9SA 4A7SA 1XSOA 2E46A 3HFFA 3L9EA 2AQRA 3HW7A 1L3NA 2GBTA 2NNXA 3QQDA 1E9PA 4BD4A 1E9OA 3KBFA 3GZQA 1SRDA 1OALA 1FUNA 1EQWA
chains in the Genus database with same CATH superfamily
1S78D 1DYZA 2BVQA 2XQYK 4POUB 2EIDA 4XP5H 1UT1A 1F45A 3ECVA 5IFAL 3MV7E 5E5RB 2W65B 4NGHH 5I1AA 3M46A 3HMXH 5FM4A 1XBRA 3O2DL 2G75B 1TUPA 1A1MB 4I3RH 1S4IA 3C6EA 1X44A 3WL9A 4DFIA 4MA7L 3JV5A 3QXVA 2ZCKL 2GTQA 3U7WH 2YAOA 3RUGA 1ULVA 2WINB 3FB7A 4JG9A 1D2PA 1YEHL 3CN0A 2EE2A 4S2SB 1JN6B 4MAYC 3VFWA 2EIEA 4PB9H 1FV1A 2D3JA 4YMPA 4E0RA 2NY0C 1EXHA 1G9MH 4PJDF 3NJFA 4WTXA 3ARFD 2HFFB 3OKKB 4L9LB 4PJBA 3RUGE 1WA0X 3IPBA 2DD8H 3DGDA 3ESOA 3OKOB 3C8KA 3EFFA 1NLDL 1AIFB 4ONFL 2IEPA 4TLSA 4CNIA 3EGXB 4PI2A 4ZW7A 2HP4A 5F1IA 5F9OL 2XXFA 3KJ6H 4BWWA 4PJBE 5JPNB 3L3HA 4FFWD 1XV8A 5IROC 3OX8B 4PM1A 2VB5A 1F90H 4LKXA 3V55A 5LGHL 1R1CA 4JJHA 5C70A 2Z0UA 4W9GC 2X6UA 1SVCP 3PG2A 2FQDA 1OTTC 3LZQA 1ZV5A 3DDFA 1SJHB 2DTML 2V3FA 4PW4A 4XHJC 1DVFD 1OXYA 4U1NB 3WJJC 5GGSY 5L4IA 1JWMB 1WZLA 4IMKC 2JKNA 4P9MH 3SHSA 3R4RA 5IZ7A 3SGEI 1CYWA 4LCWB 5I8EA 1IBZA 3L3JB 4Y5VB 3B9EA 5IHWA 3WEAA 2I85A 4DCQB 5J57B 3CDGA 4G11A 1HTYA 4HWBL 1Q1JH 4L3EB 2BSTA 5DD3L 2QQKH 4OZGA 3ZLQC 1FFNB 3BKYL 3NA9L 2OTUB 4KKQA 1VENA 5CFHA 4X0KB 4YAQB 3KGTA 5D6DC 5LAXB 3S48A 4UOZA 3C5ZA 5F7EL 3CVHA 1M7DB 4XPBH 2CUAA 1DQVA 3MRDA 5DJYB 1S7SB 2QSQA 2AV1B 2HZHA 4JREC 5TDOA 3WHXA 2CJUH 4AGMA 3IJYA 2OCCB 1QEWB 4QHPA 3COOA 5LBSH 1CDGA 4NFDA 3U46A 1IGCL 1R47A 1N70A 1JPFB 1KCRH 3IDMA 2BDNH 1BREA 2ADYA 1HAUA 2R0ZH 1A9EB 1I8KB 2OYLA 3MFFB 3F5WA 5KVMC 2NY4D 3DNKA 4PJ8C 5IB4A 1JTOA 5HHVL 1WO2A 3GMQA 4AYFA 4M56A 1FFPA 3OKMB 4WIQA 3UJJH 2ZOKA 3MOAL 3WMQA 5KVGH 4JCLA 3ZT7A 5AZEH 2YD7A 2XYBA 4JHVA 4G6JH 1YQVH 5C92A 2WD0A 4YHIA 4HP5A 4JFYB 1O5DT 2Q1EA 2AMGA 4AM0Q 4PRDB 3T09A 2Z8RA 1N10A 3HHSB 4CA4A 4YDVA 2GSIA 5DMIH 1PIFA 5FDWA 1QQDA 4RGNC 3TASA 1WA2X 2PTTA 4MHHI 3RGVB 5ERWB 1E28A 1GZHC 5AL0A 3ULUD 3OLEA 4KX7A 1U93B 3BSGA 5A2IH 1YNLL 4PY8I 5CSZA 3AXHA 3BKCL 3B8SA 4ZMAT 2AV7B 4HJTA 2AQTA 1KENH 5AALA 3SKMB 2JKTM 5H37G 4X99B 3D9AH 5ALCL 3VYNA 3NEXA 3DX6B 4KY2A 1UJ3C 1MW3A 5JW4N 4ODHL 12E8H 1H15A 1ZPLA 3PAYA 4NOBA 3KYOB 4XB3A 2QGDA 5GGUB 4PGDA 3TA3B 1HSAB 3OHMB 3KL5A 1X6LA 1NBCA 3I9PA 3TIEB 5I19H 5MERA 3ZRCC 4FQXC 2GC7C 3P11H 2J8OA 4XRCB 2Z31A 3RDTA 4R4BB 3RZCC 1OZTG 5KSVA 3DSNB 1I9EA 4MJHA 5F89B 5IW3A 2VH5L 4NN6C 1JFQL 1NJ9A 4GQQA 3LN9A 3E7JA 4XPAH 3FNKA 1UUSA 4BSVB 3EFDL 3MCYA 2ZUSA 1ZGLM 3PHQA 5DVLA 3MRCB 3EFOA 2A4ZA 4R8WL 5E8PA 1J8HA 2EDBA 1DBAL 3PGCA 2H32H 4TNEA 1BJMA 3GI9H 2OR8A 1R5IA 4J3OF 4DUWA 4JVUA 4TUJA 2V7NA 3CVHH 4ALAC 1J8HE 3OR7A 1F4YL 5J3HD 1BZ7B 4OCRH 4RZKA 2EYSA 3KBEA 3CXHK 5H37A 3S37X 2EC8A 3CDFA 4I4WA 4M5SA 3OAUL 4JEGB 1EVTC 4D0DB 1E5ZA 3RBSA 2ZUXA 1WK0A 4MD0B 2R69L 1KLFB 1A21A 2XPZA 4JLRB 3QXWA 1FH5L 1RZIB 3AG1B 4JHUA 4DF9A 3JTBA 2AXGB 2EE6A 4U1IB 1S5HA 3QPQC 3TVMD 1NCCH 3RVVC 3SOTA 2NNAA 1EEYB 4KZDL 4MXVF 5CM1A 3ARGD 1CDCA 2UUDK 1HHKA 4AENB 5EIQA 2JCCF 4LP4A 1NGXB 5IHZA 1FNEA 5B1JA 2CDGA 4QHUA 2OXGA 3OZKA 4I0PD 4WHTA 5AVRB 5J1AA 5EBWB 5F7LB 4OBSA 4ZSOA 3WNLA 2CR3A 3PQYB 1G5AA 1NAKH 3LZNA 1ROWA 3HG1D 2FUTA 3OJ2C 4BWUA 4HCIA 1AANA 1E4WH 4FGMA 1GCYA 4ZX6A 4JHAL 5L2KB 1HHIB 3FU5A 1RZ7H 5IJVB 2B59A 1UM4L 1EVUA 1CE1H 4ZSOE 4WCYL 2CJSA 4ANVA 3O3BA 5E2TL 4ZS7L 1ZVSA 5CJOH 5FUCC 5HHOD 2X4QB 1CIDA 3BOVA 2QLVB 4WFFD 3X12B 5TPWH 1U8CA 3QG6B 4GG8B 3AB0C 2E6JA 1Z5LB 4PG9B 4KXZI 5JIDA 3RP1A 1T5WB 3MRQB 4LAJH 3GEFA 2G3XA 1CLZH 7FABH 1TZ8A 4UIMA 3H9SD 1QSFA 1TFHA 4M5ZH 4MNGB 4OLUH 3SJVD 1N12A 5EU6A 3SY0B 4MBRA 3QIUD 2E7HA 1MRCL 4YPGA 3KWXA 1PQZB 3ZT5A 4DJMA 3TEWA 4GBXB 1QSFE 3L3KA 4PRNA 2WZ0A 1CF8L 5HY9A 3TBYB 3CUPB 3V52H 3MMEA 2YD4A 4F8LA 5EU6E 3UTZB 1ZDSA 1QBLH 2HFTA 1V3KA 4MXQD 4W68A 4G7SB 1N4XH 3UZEA 4IKLA 5JW3H 3E8UH 4YUEL 3BQUD 1OE1A 2XQYG 4PW3A 1T0MA 2I60H 4N90E 5BRZB 4RAUB 1TQWA 2ZJSH 4GSXA 5FHBL 5EU3B 3ILQC 4HV8B 4Q0XL 4DZBA 3T3PB 3HPJB 1MUJA 2NXYB 5AVXB 5I9QC 3JV0A 5H94B 4FP8L 2DQJL 3U9UA 4YXHH 1A3ZA 4QXGH 1BXXA 1OB1B 1U0QA 1P5UB 1Z9LA 5B1AB 4BKTC 1ACXA 3G6JA 4MD4B 4R2GD 4JFXA 4LSRH 4JFOB 4HK0B 4JQVC 5I1KH 3QUZA 2K0RA 4FQIH 3HC4H 3LRSB 4K73A 4ZO8A 3S88H 4MDIA 3GQFA 2XN0A 4NKIH 3K2UH 4RFEA 1NICA 2FATL 3P0YH 3V0GA 3ZQWA 3G6JE 3EH2A 1C5CL 1ZLSH 5GS0C 2AQ2A 4TTDC 4AMXA 1E67A 2DDQH 3VFTB 3WY4A 4ZTOL 1S7RA 5CR1A 3DMMB 2PN5A 4KJWC 4OFYA 4GYBA 2I24N 4HDIB 4FCHA 4O2FB 5HHNB 3V7AE 1UA6L 5ABZA 2VIRA 1DLHB 3K71B 3ZDXE 2OULB 4K5OA 2BVYA 1KB3A 3JWOC 2I07B 4JANA 2XQYA 1JF1A 3MLYH 1P4BL 2YGNA 5JZ7C 3Q1SL 3V4UL 2X4SA 3NCMA 2QELA 4L23A 4JZNB 1WITA 3BZ5A 3VE0B 4F7PA 1CCZA 4XP9H 4EI5D 1L6XA 4N9GB 4AGLA 2PR4H 1I1FB 3NFPA 4AXWB 4Z0BH 1G6RB 4HPOH 4R0LB 1A2YB 1FFRA 2NW3A 4PGEA 1NPNA 4L4JA 3W3BA 2VISA 1UT9A 4K7PH 3CJJA 4P4KD 3STBA 2JKLA 2JXMA 2P5WB 3BLPX 3MVSA 4LLYA 5FX3A 2MJWA 3V6ZB 25C8L 5BUGA 2CKBA 5D7LD 4P3DB 4HS8L 4XPFH 4DW2H 1WIUA 2DI8A 2R8SL 3MOBL 4OZFH 5FGRA 1KCLA 2EDKA 5AOIA 3MA9L 4IBTA 4DGVH 1H3WM 3WE1A 5D7SL 4ODVH 5J9PB 2BVEA 1PZAA 1EBAA 3V0WH 4AZ8A 2CGYA 4NQDD 4F2MB 4NPKA 3GMPB 4HKZB 1OL0A 3NQKA 4JO5A 4M48L 4TSBH 4UM9A 5BMFL 4HVBA 1IBYA 3ATBA 2A6IA 4WI9A 5T1LD 4R83A 4HH8A 4CVZB 2J12B 1M6OB 4PJFB 5IBLD 1CT8A 4LASL 4A55A 4K7PY 4DKDC 3CDZB 4DO5A 2G2NA 4Y2DB 3ROOA 5GZND 4Y2OB 4OFPA 3TF4A 3S35L 4C56A 1W0WA 2XY2A 4FI6A 3VQMA 1QRNA 3C5ZC 5AWNH 1ZV2A 2M2DA 4XNYH 3V95A 3QFGA 3VTAA 4UM8B 1J87A 5SWQA 4ZAKC 5G5DB 4FZEH 1GJUA 4DT2A 4BFIA 1CE6A 3GXTA 4X98A 3TLRA 4JFEB 2X89A 1AGFB 3Q8CA 1S9WA 2E7MA 3CSPA 1T1WB 5MEND 3V7MA 1LO3H 2MPAH 5ID0A 2GY5A 3MLUL 4AM0A 4AMWA 5KYWA 1TTFA 3LH8A 3R8BB 2Y7QB 3MACL 3GRBA 4PJEB 3QEUB 4MD5A 2DLIA 3BP5B 3T1WA 4JY6A 2PCYA 4LFHG 4FD0A 1T0OA 4C55A 2W0KA 2VQ4A 2WM0A 1FFQA 1SNRA 4NJ9L 2EDYA 5F7AA 2D2OA 5AUMB 3UG3A 4HALA 1RJLA 4ZUSA 4S1RH 4IRSA 5F6HI 3VG0L 4KQ0A 1AKJA 4JQIL 3QUXD 5EUOA 1G7HA 1RLWA 4QCIA 2BNQB 3IGAA 5IMKA 5KS9B 4DGYL 1TOXA 2C4XA 1JF5A 4AYGA 3QE5A 3BFOA 3NFNA 5F2FA 4RDBA 3V5DA 2DYRB 2WXLA 4TXVB 3LKNA 5C86A 3M8OL 5F9AC 5FA3A 5EUOE 1CDYA 2BCMA 5TF1H 4ZW8A 1IL1B 1S8DA 2YXVA 4DAGH 5EH1A 1LVEA 2BOCA 1OAJA 5C6PB 3PUUA 1JHKH 2DBLH 3C09C 4NJAH 5K9OA 5KSAB 1UWXK 5DMKB 2AXWA 2OTPA 3L3OC 3VD5A 3GXMA 4B5EA 4EZLA 3I6GB 1TJIL 1KN4L 1BMWA 1MAJA 2OM5A 2VM3A 3U2JA 5IVOA 2WYZA 1FNHA 1MCEA 1GS7A 2BNRB 4ALAL 1L7TL 3RDTC 5DGRA 2C9QA 2IPUK 1NMBH 3H42H 1SXSA 2BK8A 3NESA 5I1GH 3QJRB 2F54B 4F9PC 2XV2A 4POZC 5E8DL 3VD4A 3B2DC 5IW6B 4PJAA 1WFOA 7TAAA 1XL4A 5E08L 1CFQB 3QCVL 5E1AB 4NZUH 1JPST 2IG2H 1TJGL 2EH7H 3GI8L 3EYQC 5F1SA 3MRPA 4TLUA 5DRZA 4Y5YB 2E7BA 2QSCL 3L2NA 2E5EA 4PJAE 3KPRB 1Y18B 5A43C 4HPYH 4FABL 1UJTA 2EEFA 1OTUD 1SDDB 3GXDA 3NAAL 4PJXB 1BOGB 5SX5H 2QGEA 1W72A 1MLBA 3U6RB 4FNUA 2H6UA 2X40A 2WLMA 4UAOB 2Q2LA 1A5FL 3EGDB 3FFCA 5J11C 5CKGA 2OA9A 2BHYA 3QULB 3ZRFC 4LF3B 4KKZA 4LO9A 3HC0B 1TETH 3GTTA 4L8CA 3QS2A 5BZZA 5GRJH 4GFTB 2BHUA 4U1JA 2FEJA 1OPGH 2HLAB 4D0CB 2FHFA 3X3FL 3RB7A 3RIFF 4K71C 3FFCE 2VC2H 2FEDD 4UT6L 4RMRA 5LLIC 2JKIS 3V4VA 5GGTA 3GLDA 4BXSV 5EEXA 2KC0A 2VLKA 5AKTA 5C7ZA 5JDSB 5KJRL 3UBHA 1KB5B 2CO7B 3T0EB 4X4XA 2DQGL 3LRKA 5IV2A 2IH3B 3J2PA 5B1JC 3ZIMA 3BWSA 1J9CT 4Z76B 5HVFB 1TCMA 3LQZB 3SE8L 1CD0A 2WXPA 3KPPA 2GB2A 2HCZX 2VLKE 3QWQB 4LCCB 4ERSH 4FLRA 3SGJA 1H9DA 4RMBA 2Q0ZX 4RGMB 4P4RB 4XCFL 3RIKA 1N68A 3RX7A 3QIBB 4IIQA 1JHTA 2Q8AH 3T3ME 5JXEA 1Z9SA 4CGUB 1AZCA 5CN1A 4YLCA 4G8AC 2OJZL 3RU8L 5ISZB 2F8XC 4GW4B 3H55A 3BVUA 5FKPB 4YR6A 2KUTA 4M1DL 1TTCA 4YOKA 4ACPA 3WJMB 4OJEH 2X2YA 3BO8B 1AQKL 2H6PA 1UB5A 2VLRA 1I9RH 2YAFA 3BVNA 4GRMB 3KPOA 2XN9A 3UYRL 4LPVA 1P6FA 1QD0A 1SFHA 1FL5A 4TLKA 5IWLC 2NY3D 2CIKA 2VLRE 5LNEA 3S4SA 1A14L 1NEZA 1ETZA 4O02L 3IDJA 2XN9E 5DHVB 1PBYA 2R2CA 1R4XA 1F4WL 2PF6A 5GS1C 4QYOA 5MP6L 3MLZH 1LP9A 4LESA 3ABZA 3HCVA 3TBVB 2XWXA 2G4GA 5DA4A 4PB0L 5FO8A 3NZ8B 5GS0L 4PJ7A 4TN9A 3D4GA 4N85A 2Q5BA 3DJ9A 3H3PL 1TR7A 1LP9E 5JW5B 2BNUA 1P4IL 3CCHA 3QXTA 3V6OA 3J8F7 3HZVB 3QQDB 1CMOA 3DI2B 1G0YR 4NQVB 1H8OA 4KTDH 1NBVH 2UWEF 4PJ7E 2HKFL 3JWOL 2G9KA 2Y7SA 1E9QB 4CVXA 4G43A 1W72H 4PR5A 3HNTH 4EDXA 3V6OE 2EDLA 4GW5B 4H44C 5K69A 1HWGB 4LP5A 4XO8A 3X14A 3EOTL 1C08A 2D7NA 2UZYB 2G3NA 4MVBC 3ULVD 1NMAH 3IJHB 3MJ7A 3WUWB 2VZVA 5D4HA 2W65A 1FIGH 4HK3N 4DKFL 3B83A 3SN6N 3KVQA 3U0WH 1LO0H 2HJKB 2AEIT 5CJQL 4YVUA 2G75A 1KBVA 1A1MA 1FBIH 1F41A 2YEQA 3V4VH 4DN4L 5GGTH 1EJ8A 3NCYS 4PV9B 3I6SA 2D4DA 1E6OH 2WINA 3P77B 4HSQA 1OKEA 1NPJA 1YUKB 4OGXL 4S2SA 1JN6A 2NY7H 1M2VB 2VE6B 5F7HA 4N24A 4XN8A 5KW9L 1F86A 2HFFA 3OKKA 4AE1A 3FRUA 1FZKB 3OG4B 4L9LA 1YJDH 3WEOA 4ABWA 3OKOA 4G82A 3NCXA 2J5WA 4KXCA 3X13B 1EDYA 2LAGB 1AIFA 2E75C 3GMNB 4LOUD 1FIEA 1C16B 3EGXA 2B15A 4N8PA 2HVJB 4XNXL 5JPNA 1VFAB 5AYTA 2XHNA 3OX8A 1WZMA 1BEYH 1BBDL 3N04A 3NH7H 2AKRB 2EC9T 5J89A 2VDPH 3AM8A 2OQJB 1LO2H 1EZVX 2WO3B 2BVPB 4AVJA 4PY7B 5FV2A 1SJHA 3OM3B 1AS8A 1JRHH 2GVYA 3KBPA 1E40A 3DROB 5JHBA 4U1NA 4XC3H 1JWMA 4YSCA 4Y7OC 1BF8A 2VDLB 2UXVA 1JIBA 3AG3B 4LCWA 4YVNA 1GGBL 3KLAA 4HKBB 4F2EA 3PIQB 1CWVA 3L3JA 2CZNA 4Y5VA 1B2WH 2VUYA 3CAFA 4CDGC 4F57L 4IK6A 1NEUA 1PZDA 1NOFA 4DCQA 3VQ2C 3WAJA 1DSYA 3X3GL 4BJLA 2YPKB 3VD1A 1CXKA 1FFNA 1YNTB 2OTUA 1DANU 3A6OA 2O6EA 5BPPA 4HKXB 3O2WL 4X0KA 3LN4B 4YAQA 4PWIA 5LAXA 2K45A 1OP4A 1M7DA 3RRQA 1T80A 3P2BA 4NNXA 1R3HB 4FKEA 5DJYA 1S7SA 2AV1A 3KDPB 4LRIC 1A0QH 2WQXA 1VRSA 2XZCL 1QEWA 3C60D 4OM1H 2A7BA 4L0ZA 1T03H 1DQLL 4JZJC 3OAYK 1JPFA 2IQAB 4G8FB 5E24E 2QVFB 3MKGA 3I02B 1A9EA 2HUHA 5DO2C 1LEIB 1I8KA 3P0VH 2CHXA 3HZMB 3SPIA 4IQHA 4H8PA 1H3PH 4QJ5B 4F8PA 1PAZA 1DUYB 3MFFA 2EABA 5CD3B 1MCQA 1REIA 5AYUL 5A2BA 2X4RB 3OKMA 3QJUB 4HBCH 4XNAA 4AEEA 4PJHB 1XZWA 2UZIL 4XVSL 3SZ6A 1KXTB 4NX0A 1JCVA 2BWDA 3RFZB 4NLAA 1KC5H 4JFYA 5PCYA 5FLVA 1R0AH 5IQ7L 1GYVA 1VGKB 3A6BH 5CFAA 4PREB 1MJ7L 4DIXA 4JO3L 4HMCA 1FCGA 2E9GA 2QDVA 3HHSA 1CU4H 3LZFH 1B6DA 5E9AA 3VRLF 4HX1B 3EJUA 2IPUG 3CX2A 3O6MH 2W0LA 3RGVA 4X4MA 1DLFH 5ERWA 2AVGA 4WO4D 1IM3B 1QBML 1QSZA 2PW2A 1U93A 5GRVL 1WWAX 3GJFB 3T0BA 5DD3H 2KZWA 5JA9A 3S8FB 3V0VB 5CS7A 2AV7A 1P7HL 4XN5A 3SKMA 2V9QA 3MZGB 4X99A 1L5GA 3DX6A 4X4ME 3ARVA 3KYOA 2Y6SC 1GGYA 5GGUA 1HSAA 3TA3A 3TIEA 4DGIH 4M1GH 1ZWIB 4J6IA 3V0FA 5IVXB 4IYKA 4JFFB 4XRCA 4R4BA 3SDDD 4D0BB 2L7QA 2WWKT 4WW1B 5DFTA 3DSNA 1TYEB 5F89A 4FS0A 3K6SB 5AB0A 3MLRL 5AZ2H 4WI3A 4JRFA 3U6XA 3P1VA 4XBMA 4JKPL 4BSVA 3D8MA 3KBHE 5E94B 4BYHA 1FZJB 2JJTA 2WB7A 3MRCA 2GJRA 5GGRB 4BE5A 5HBBA 2AAVA 5DFWH 2B4CH 1Z7JA 4WW2B 1MY5A 3K4ZA 5EZOL 1Z3GH 3LAFA 4XNBA 1XDTT 1RFDL 3C5SB 2QKSA 4N0RA 1I8UA 4A7QA 3AAZB 3WG7B 1FPTH 3L4YA 3ZE0F 5GGQH 2AS5M 2R4RH 1AD9B 2D73A 1BZ7A 5BV7B 1ZMYA 1TO4A 4XZUB 4XC1L 4GG6B 1JXDA 2NUPB 3U4EB 1FF5A 4D0DA 2ARJB 2AFNA 4MD0A 2EKSB 1KLFA 1HE8A 2PR9A 4JLRA 1S7VB 1RZIA 4M62H 4MYWB 2AXGA 4H8WH 4U1IA 4QHNA 5I1IH 3RE0A 3JWDC 4KUCD 1VGEL 1TENA 1I4FB 1EEYA 3CHRA 1B4JL 4D9QE 2G3ZA 5FYJU 2Z7WA 3AUWB 4AENA 4ZW3A 1L3WA 1DBML 4WI2A 4E9LA 5L0QC 1NGXA 2WLKA 3EYUH 3OHXB 1D6EB 4Z7VF 3EXLA 4KTEL 1F6AB 5EBWA 2L04A 4AK2A 1MFMA 5DHEA 3PQYA 4RFOL 3TO4B 3RFRA 1IM9D 4N25A 4PJDB 4GAFB 2QTVA 3GYRA 1KXVC 5L2KA 1HHIA 2YK1H 4CU8A 5IJVA 2FJUB 4X6CF 5JW4Q 3GKWL 3TYGH 1A66A 3PQYE 2HMIC 3IKKA 4N2DA 5HYSG 2X4QA 2R1XB 1JNLL 2ZP9A 5CCHE 4KKCC 3X12A 5L2KE 4GIOA 4R8WH 5EB9A 3QG6A 5TFSH 2RR3A 2JKSA 4GG8A 1Z5LA 4PG9A 4W9CC 1YECH 3W81A 3ULVF 4DEUA 2HKHH 1T5WA 3MRQA 4GT0A 1WIPA 5CINH 4HSCX 1CS6A 5I17B 1GJWA 2BWQA 4MB4A 3TFBA 4JRYB 4MNGA 4PSPA 2KYIA 1MW2A 4G6ML 3QIWD 1JYWA 2G9HB 3SY0A 1KWKA 2WXRA 3H9HB 5FDYA 1HCFX 2E27H 4RBPH 4D7BA 4XBEH 1PQZA 1M9WA 2J20A 2WMPB 4GBXA 2Y1VA 5GJTH 1QX1A 3TBYA 4MNGE 3CUPA 3D05A 3UTZA 2V5RA 4LLVB 1UWXH 5D7JD 5L6YH 2IH8A 1J5HA 1UGNA 2VLJD 2AK1L 4KDTC 1N18A 2B9AA 4MX7B 3PGFH 5BRZA 2ZXDA 4KO7A 4RAUA 4WSGA 4WWKB 4X7FC 3RB5A 5AAMA 3ZSTA 1MCLA 5EU3A 4Y4FB 1EGJL 4HV8A 1O6SB 3HPJA 1DBKH 3ME0B 4MJJA 4R26H 1DZ0A 1YG9A 5H94A 4HULB 4QRRD 1UG9A 3DX2A 4IS6B 5BRZE 1KDIA 3LB6D 1MG3C 4OJAA 4ZODA 5IY5B 3GK8H 2NLJB 4FX5A 1OB1A 4N0YH 1P5UA 1FVEB 2WAHA 4LDCA 3U0TB 4HUVB 5ENWB 2XSKA 4MD4A 5CLWA 3IDXL 3IFOB 4OVUA 3T3PE 3V0IA 4JFOA 1UWEL 4HK0A 1JTTA 1NC4D 1UM4H 2BIQA 3LRSA 4Q7DA 3X1FA 5JUEL 1L9QA 4W9KC 5FYLD 3KNBB 5I73B 4K5MA 3VFTA 1X6NA 3QZPA 5EOCL 3A5VA 2WCGA 3DMMA 3WNIA 3ZSSA 4JKKA 1QKZL 4HDIA 5HHNA 3QQ9D 5PAZA 3HRZB 1DLHA 2N7BA 3K71A 3FUHA 2V6HA 2CKBL 2NSQA 2X09A 2I07A 2IBZX 3NYKA 5TE4L 3M7OA 1CTNA 1MIEH 2FYYB 7PAZA 4J3TA 1RI8A 1UT2A 2VERN 1J48A 1H3TA 1UA7A 3T8VA 4JZNA 4XI5C 5AOZA 3VE0A 3QUYB 4N9GA 2A77H 5BCAA 3GD1C 1I1FA 3VU1A 4AXWA 3QDMB 1A3LH 1G6RA 4R0LA 1A2YA 2P5EB 1ZLEA 4RISL 4TUKL 5EWIL 2QADC 3CFQA 4MQ7B 1BD2B 3VI4F 5HDQL 3V6ZA 2A74C 2P5WA 2WOBA 2F7PA 4P3DA 3A22A 1UCBH 5T3XE 4XXWA 3WXWL 5JPNC 1NL0H 5I1JH 1L0YA 2BIIA 1OQOA 1NCOA 2P5WE 3ECUA 3AM8C 3Q3GB 5J9PA 2JSFA 2EXTA 1U8LB 3GRWL 4F2MA 4BQBA 1OGSA 4HKZA 3H7LA 1M57B 4A7SA 3UC0H 1PZUB 4OJCA 3ZY7A 3CHXA 5BO0D 3NZUA 4ZJ9A 3B6SB 4PJFA 1M6OA 2ZG1A 4CVZA 1E8YA 4WUUB 4F2ME 4NO2B 4G80B 3CDZA 5F7WC 4G7YH 1G9NC 3VWKB 4P2AA 4N68A 1BIHA 4Y2DA 1E5YA 3K0WA 3MNZB 4NZTL 1ZD6A 3UOAB 4Y2OA 5KANG 1JXFA 4PJFE 1HEZB 1T83A 2PO6B 1UA6H 2MTPA 3TN0D 3R06B 2VXVH 4JUTA 1Z0MA 7PCYA 3EXJA 2K6ZA 1NCWH 3FO0H 2OYMA 5AVUB 3WOVA 3ARXA 4UM8A 4N3TA 2LV4A 1BDYA 2QQNH 3IFPB 5G5DA 1XX9C 1MJ8H 2G2PA 4MJID 3RKPA 3W1ZA 4JPVL 5JHMA 4JFEA 4OCMC 1AGFA 4FHJA 3P02A 4MXWL 1T1WA 4H8WC 4Y16B 4MNHB 1FLRL 3CXDL 3RNQB 2Y7QA 3OLIA 4PJEA 2JCCB 4EE2A 2ODIA 3QEUA 5D1XC 3BP5A 4JFEE 3QUMB 1YY9D 4KMLB 3MLSH 3K4DA 3Q7JA 4W81A 1IRAY 4KXDA 3VTMA 2IV9A 2FRGP 1CK0H 4PCSA 3B5GA 4PJEE 5AUMA 4P3CL 3L5XL 4O9HL 3GJFK 3U4BH 2Z1PA 3IU3B 5FB8B 4GS7B 4OZHE 2B5IB 3FYEB 3CFEB 3L5HA 4D8PB 2BNQA 5KS9A 2KDGA 5AW9B 1R3KB 1NLBL 3VAEA 5T3XH 2AXFB 4S1QH 5KJ4A 3RGVC 1G6RH 1J1XL 2OJ1A 2X38A 1IL1A 2BNQE 5KS9E 3DJSA 4R5VA 3TZVD 1I9IH 3CZLA 2KL6A 1BCIA 4AW7A 5KSAA 3T6QC 5DMKA 5FYJH 4UOW0 4YWGL 1OANA 3I6GA 3S7GA 4ODSL 1TIUA 5HI3C 4E9XA 3RVTD 5CJXC 3TU6A 3SQRA 1HKLL 4TVPL 2R27A 1YC7A 3MJ9L 3TNMB 1UD3A 1LLAA 2BNRA 1MH5B 3NJJA 1H6TA 4I18C 1U8MB 4JKMA 3BZFB 2VJXA 3ARFB 1IC5L 4M3KB 2F54A 2FB4L 2F1EA 2AI0L 3HS0C 2BNRE 5IW6A 4Q4EA 1EBPA 1CFQA 2CHZA 3FQ4A 5E1AA 5DZVA 3WNPA 2X41A 2EVHA 3JWDL 2J1WA 5MEOB 1F13A 4EOWL 2F54E 4Y5YA 2FSEB 4CADB 3OKLB 3KPRA 1Y18A 5A7BA 3MV8D 2VDKB 4PJXA 1PZ2A 1SDDA 2EEXA 2JI1A 3I6LE 1BOGA 1KYUA 4B53A 3VGBA 5AAWA 1AG6A 5I6PA 3PUCA 5F1OB 3CFKB 3U6RA 1DVFB 4A63A 3I50H 3KPRE 3EGDA 4TRPH 1MJUL 2AGJH 3QULA 4PJXE 4LF3A 2BY0A 1YEKL 3KWUA 3HC0A 1Q0XL 1VEPA 2VR5A 4U6YB 4D0CA 2IFFH 1GHFL 1KBKA 2YD1A 3OAYH 1UZ6F 1RPKA 5E2VL 2WLNA 4HT1L 1SDYA 5JDSA 1JGLL 2ARJQ 2WBWB 1CGWA 1KB5A 2CO7A 3T0EA 2F5BH 3MRIB 3FF7A 2IH3A 1TJIH 4Z76A 4YK4B 1DFBL 3LQZA 1B4TA 2J73A 4JN2B 3O0LA 5JIPA 1H6EA 2CMRL 3NVQA 1L0QA 4HUNB 1L7TH 4LCCA 4QHMB 3KEDA 4A7GA 4TULH 3T0EE 4P4RA 1FL3B 1H9VA 2IOMA 2IPKB 3LPPA 3QIBA 4UINL 4WI5A 1CBVL 3AU1B 2LTQC 5DZAA 3FH7A 3O9WC 3IGKA 1YEFL 1Z3RA 1QNZH 5ISZA 5ANMB 4XPHH 3OD3A 3QB7C 4GW4A 2NY4B 2QV4A 4YDNA 5FKPA 3QCVH 3S0PA 4XT1C 3WFDH 4KMTH 3WJMA 1A3QA 1INQB 3BO8A 2L8AA 3E38A 2YRLA 5ISZE 3US1A 2WO4A 2YA0A 4RA3A 5KVFE 3RNKB 1DN0B 5KVEL 3VW3H 3U48A 1UD4A 4GRMA 3FU9A 2ZOUA 4ILDA 2PWDA 4GSRA 5JDJA 3PWNB 3PXLA 4JO4L 4HJJL 4OB5H 3ZTJG 1IGIL 4XTRC 1T4KB 1JPTL 1CC3A 3RWEB 5DHVA 4G6FD 5F7YC 1D5BB 1JZ5A 2IADB 1U58B 4F8NA 5D55A 3Q06A 3FTWA 5FUZL 3UCRA 3X1NA 2Q76B 5AW4B 3AXLB 2QTEA 1OM3H 2OL3L 3ARBC 3TBVA 4B97A 5K59F 1CFBA 1IBGH 3FT1A 3ESNA 3NZ8A 1PX4A 3CSBA 3ISRA 3H8NA 4ES9A 4QWWC 1J5OL 3QWNA 5AAMC 5JW5A 1KIUB 5DK0B 1F3RB 1MDTA 3DOHA 3HZVA 3QQDA 3OKYA 4M9OA 1AD0B 2VLME 4NQVA 3MJGX 4IJTA 4X8GA 4D94A 4PRAB 1E9QA 2DQCL 2VXUH 3K5SA 3QPXL 4EXKA 1BYOA 3F01A 4ONHB 3BX7C 4GW5A 3C6SB 4XCFH 1SFDA 2NNCA 2WJ5A 3BIKB 3K6IA 5FYKE 3J27A 4KK5D 3US0A 4XPGL 2UZYA 1GMIA 4FNLH 2PMZA 3FQYA 3IJHA 3WUWA 4Y4HC 2WWKO 1KN2H 1E3ZA 1EJ6A 2HJKA 3GZKA 3ULUL 2HFGH 1G94A 1NTDA 1TZAA 4QAWA 1A02N 3DMMC 3FB8B 4WFHD 5HDLA 3GO1L 1MG2C 2MRYA 4CN6A 5GZOD 4PV9A 5DQ9B 4UT7H 4X2UA 1KV3A 1GC1H 4MKTA 1KB5H 3P77A 3ORJA 3VXUD 4LPWA 3MRGA 1MZYA 5HD8C 1M2VA 2VE6A 3HZ3A 4PRPD 2FX7L 1XCXA 3WTYA 5T1MB 1AZVA 3AVEA 1FZKA 4H0IA 3HOGA 5ESVB 4XBGB 5D7EA 3W2DH 5MP6H 3QEGH 3BE1H 2WUCL 3BMVA 4R0LC 4WQOA 3X13A 4H13C 2QLYA 4Z78B 5AFAA 3GMNA 4GAGL 5EZJB 1IIIA 1W16A 4N2IA 1C16A 1SXAA 4R4FL 5KVFH 3Q1EA 4K9JA 3ARGB 3IDNB 2HVJA 4MGXA 1VFAA 1G9NL 3EJRA 4M6ML 3KHOA 4XXWC 4XVTH 1AXTL 3UPCA 3V2AR 5EFIB 3HEIB 5CZKA 5J6HB 2AKRA 1TCRB 5D8JL 3WEBA 2OQJA 2BVPA 1JZDC 1KCVH 4I0PB 3CG8A 4PY7A 4XCEB 3DROA 1L9TA 3UIYA 1BQLH 4JN1H 3K80A 1FGNH 3ZMEA 5E7BA 5T5FA 5IQNA 4M8RA 1EJOH 3PIQA 2JK5B 4EUPG 5T1KB 2F5AL 4LLQB 1BZ9B 4CN1A 3PWJB 4L1LA 3U7AA 3CXHJ 1TNMA 4LKCB 2YPKA 4GMSH 5HHOB 6TAAA 1BV8A 5ALBH 3RJOA 1YNTA 2BJML 4P59L 4B3EA 1ZHNB 3IK2A 5CJQH 3ATDA 4HKXA 4HWNA 3LN4A 3ZHFA 4HOMA 2A6DB 2R29L 3ZZQA 1NDTA 1SF3A 4NQSB 3UGUA 1I3GH 3B7YA 1T83C 1R3HA 2O5YH 2NZIA 3HAEB 4KOCA 3SBWC 3TS8A 3B4NA 3H9SB 1JZEA 2BFVH 3E3QC 3ZKXB 4HJEA 3ESVF 3SJVB 4B6ZA 4QGYA 2VSMB 1SMDA 4M7JH 1I1AB 1HSBB 1Y07A 1AHWB 4XMXA 1BGXH 2IQAA 4NKDB 4V1DD 4G8FA 3TJHC 2WWMC 3I02A 3OXSB 2J21A 1LEIA 4MS6A 1IKFL 3HZMA 4KROC 4KKLC 4X7CC 4YIQB 5CD3A 1XH0A 2X4RA 2X6VA 5IHLB 2ZG2A 3ZTJH 1R5VB 5C71A 1Q90A 4PJHA 4QLRA 3JT0A 1U8HB 2TRHA 5IJKC 2WUBH 1KXTA 1BBDH 1D7DA 1XVSA 1BMZA 2F58L 3RFZA 2JQMA 1FAKT 1VJSA 2YAEA 1MDAA 5JR1H 2D31B 3DGCR 1FP5A 4X5QA 5IBTL 3RVXD 1VGKA 3VNYA 5C07B 4JRLA 4PJHE 4PREA 5F7MC 4EDWL 1KYAA 3DSFH 1C8PA 1QUPA 3Q8EA 2Y5EA 4LLMB 4XH2B 4R2GB 4Y8DC 3RVWC 2ORBL 3CVIH 3MKKA 1I82A 1PNCA 4F57H 2AEPH 2OSXA 4ZMTA 3WTTA 4CC4A 3GJFA 2NT0A 5DMJB 2Y7NA 3V0VA 1KCSH 3IS0X 3QEHB 2IWFA 4OZIF 2V2TB 3OGCB 4KDWA 5I2IB 5DURB 5E2JA 5K9QG 3NJLA 5IUSA 2EVIA 3HN3A 2HX9A 5HYJB 1OW0A 1E2VA 2EDRA 3V4LA 5JQ6H 1NBYB 1KGYE 1KPUB 1ZWIA 5IVXA 4JFFA 3QCTL 5KOVC 2FNBA 4D0BA 3LNDA 4WW1A 3N9GL 3WFEL 5JIHA 2XWTB 3K6SA 1FHGA 3VFVB 4EI5B 4NQQA 1Z9PA 5B22A 2L0DA 4JFFE 5E94A 5IVXE 3RAJL 5KWYC 1CICC 5C0RL 1FZJA 3T71A 5GGRA 1NKRA 4L48A 4P4KB 4DQOL 2H3NB 4WW2A 2V3EA 4QLWA 2ITEA 4G70B 2VR7A 4PI0A 1DQMH 2NY1C 3C5SA 4B9FA 3PJSB 4FADA 3WFCH 4OIIL 2UWEB 3AAZA 4HQQL 4MJ6B 3HRPA 1QEXA 1RMFL 3AJ7A 1KLUB 3LHPL 1AD9A 3L13A 4Q52A 3EO9L 5CZRA 4NP9A 1IAIH 4XZUA 1IC7L 1BZQK 3R1GH 4GG6A 2IMMA 4O2CB 4HJIA 5AAWC 1RUQH 2NUPA 3U4EA 4NQDB 1JNJA 5E9DB 5D2LF 1RZKL 2ARJA 2EKSA 2VO8A 2B20A 1CFTB 1S7VA 2Z8WC 3TBCA 4RLDA 1IC1A 5T1LB 4Q8BA 1RHHA 1ZTXE 4GG6E 2YXMA 1BQRA 4U1HB 4P5MB 1I4FA 5JXAL 3WIAA 2E7LA 2DMCA 2XT1B 5I1EH 5JHLA 2X44D 1I3RB 1JZJA 1KGXA 5I1CL 2ZF8A 2BERA 2FECL 2AQ1A 4Q6IB 4PLJC 4AJVA 3IS1X 2ENPA 1Q9OB 3OHXA 1D6EA 4X8CA 1GC1C 1F6AA 3CZNA 3T0EC 1XZ0B 2UZXA 2VW7A 3PJNA 2D0HA 3TO4A 4GO6B 4KV5F 4PJDA 5AOJA 2Z8VC 4LNRB 3U79A 3CBKB 5A2KH 1MFEH 5JW4R 4LCCC 1X5JA 4JPKL 1F42A 4DNLA 4OCXL 1IZJA 2VMJA 3QIBC 4DP1X 1U6AH 4JMXA 4HIJB 5MENB 2R1XA 3HZYB 2CA3A 3HUJF 4R84A 2JELH 3PDOB 4OKVB 2EXWC 2QHRH 2ZCHL 3B3BA 3GJFH 1AC6A 2DQDH 3IEAA 1DDTA 2J1XA 3KWVA 1NANI 5EU4B 4NI3A 3ZTNH 5I17A 2O5XH 2BWIA 1WH0A 4JRYA 2P7TB 4LQFL 1N5YH 2G9HA 4G6AD 4YBLB 3EBHA 4J8RB 4AE0A 3H9HA 2RACA 1HOCB 4GAJL 4WO0A 4N1HB 3QUXB 1GGUA 2WMPA 4MA8L 3LY6A 2IBGA 35C8L 4JRYE 3G5WA 1JJUA 1SJXA 4NO0B 1N6QH 3WKPA 2F53D 4LLVA 4Z77A 2DYPD 1X7QB 4NXSA 5KG9B 4Z7WF 1YYMH 2FWLB 4HCFA 4KKRA 1AO7D 4MX7A 1JNNL 4WWKA 3AT9A 2XETA 4ANUA 4UTBL 5I6KA 9CGTA 3DECA 4NKMB 4Y4FA 1DBMH 3LH9A 2ZX5A 1EPFA 2BSRB 1O6SA 2XWZA 4TM9A 3ME0A 5FWRA 5CLTA 2V5YA 3GEWB 5IHUH 2EIKB 1U8PB 4IS6A 4TLTA 1K85A 1G4MA 5GS2H 2W9EH 4UZSA 5BZDB 2O93L 2NLJA 1VZIA 3VCLB 1FVEA 5C3TA 1KWGA 3U0TA 4A6YL 4HUVA 5ENWA 5BV7H 2ERJC 3IFOA 3QEQD 1F1DA 4LDLB 2Q3XA 4ZX5A 1J1OH 2O61B 1WJ3A 4GXUM 1SXBA 1R6VA 1LWHA 3HHRB 3DGGB 3NGBB 3KNBA 3N1GC 1M1SA 3U1PA 3UEQA 4EI6A 4UQ9A 5GGRY 1ZLWH 3AU0A 1QSEE 5DDHB 4MS8C 1UVQB 3HRZA 5JHLH 1JPSH 4K2UH 1GJIA 4NUMA 2FDBP 3B9KC 1LDPL 2EYTB 2FYYA 3QDJD 2QEJA 5IF0B 4I9XA 3VDCA 1K6QH 1T3FB 1UXWB 4Q2ZB 3W5NA 3ETSA 3S2CA 1D7FA 4IKKA 4LL4A 4J3OG 4J4PA 3QUYA 4LHQB 2X5PA 1IBBA 3VXQB 5FO2A 4XP6L 1DJZA 3QDMA 4TSCH 5E5LA 2VJ8A 4GRLD 4YBHA 3NPSB 3OMIB 1YA5A 2EDHA 4UIKH 5GRYA 3D51A 3LH2H 4MQ7A 1BD2A 1GIGH 5EU5B 5JO5B 3HE7D 4XVOA 3KD4A 3W0WD 3QARA 3QNYB 1KBPA 1OAZL 3QDME 4LSQL 4JBSA 2EACA 1JI2A 4FQCL 3P40A 4LSTH 2Y2YA 1WHOA 1XF1A 1X5XA 2E6PA 5TK2A 1GZPB 5JMOC 3RY4A 5JORB 3NQIA 3Q3GA 4NNPH 5DR5L 2QFRA 3EYOB 1U8LA 3JSSA 2A1WL 3UH8A 4KVCH 1TQCC 1EX0A 1KEGL 3KLHD 5JPMC 1U9KA 4F93B 2HVKB 3B6SA 5E8NB 3VNZA 1CIUA 1ZT1B 3F8UB 1Q72L 4Y4KC 3T8MA 1KELH 1INDL 4G80A 1XFPA 1A3RL 2MCPL 1IQWH 1ZDQA 3VWKA 1CR9L 4BBWA 1CGUA 1KYOK 2QQLL 3MNZA 5KBLA 3NCEB 4AH2B 3RPKA 3ZE0B 1QOKA 1HEZA 4K9EH 4FULA 2PO6A 5CUSH 5E1HB 3RWDB 3R06A 2MPVA 4BA0A 3RIFK 3SKJH 1RU9L 1QLRB 3DUUB 1CFNB 2YQ2A 4HCRA 5IQ9B 1L7IL 3IFPA 2Y5QA 3NJHA 4Q6KA 2EDQA 5CXPA 3ILDA 2CJ3A 1AI1L 4GAYB 4LT7A 4Y16A 3BT2L 4MNHA 2UV3A 4XWOD 3RNQA 1QWNA 4H0LC 2JCCA 1KUMA 3IMRA 3MX0B 4W70A 1IVLA 1UH3A 2ED7A 3QUMA 4G7RB 1WUNT 3CQFA 1OAQL 5JYMA 5L8LB 4Z7VB 3SDYH 3FU8A 1TZHB 1JS4A 4MXVE 3WD5H 3MNVB 1QVOB 4R97B 3JTTB 3EJYC 4UI2A 3RFZC 3KVDD 1SRDA 2CBMA 4OQTL 2ZAIA 4M61B 4GIPD 1KJ2B 4XBPB 3IU3A 5FB8A 4Y9GA 1FC2D 1A7NL 5BQDA 4Q9RL 5E03A 1KTDB 1ZTMA 2H3KA 4LBAA 3CFEA 4X6CB 4D8PA 1JGEB 1GYWA 4BQCA 1R3KA 4OW6A 2R0LH 3WO3B 4APXB 3S36H 4D8OA 3SDCC 2Q2EB 2AK4D 2AXFA 3MSPA 2B0SH 1XF2B 3D0VB 2XVKA 1NPUA 4W9JC 1RIVH 1OAXH 3KJ4B 2Y1ZA 4P46C 3SBQA 5I0WA 4ENEC 1CF1A 4CC4C 3GXUB 5LG1A 1ZY9A 4YHML 1WTLA 3K0YA 4ZPTB 1SUHA 5F44A 3WTVA 1RKRA 4IOFC 2QVKA 3SE6A 2B8OT 2HT2D 4Z7AA 2BP8B 2Q3ZA 3TNMA 2D3VA 2K3TA 5F8QC 1MH5A 1UWGH 1XGQB 4JPVH 5TE7L 4Y19D 4FQJL 4CSSA 5F7UA 5KANI 1U8MA 2ZKYA 1BAWA 2V33A 3BZFA 3ARFA 2G30A 2H2PC 4X7SL 3G6DH 5E99L 5GRXG 4YSSA 4YZFF 4LVHB 3AGVA 1ASQA 5BRQA 2FHCA 2Z34A 4LCIL 5MEOA 3TO2B 2F08A 2EUVA 2FSEA 3UC2A 4CADA 2P47B 2X6BA 3OKLA 2ED9A 3CVBA 1N0XL 3O2VL 4PRHB 1AMXA 3V6FB 5DSCB 2DI9A 3F7KA 4U6XB 1ZSHA 1PKOA 1MCPH 4AYEC 5BV7C 2DQTH 3CFKA 2FYVA 3MUHL 1DVFA 3L3IB 3NK4A 2OMZB 3NCFB 4X7DC 2Q86B 4H7VA 2NY6D 3J7HA 4EZMA 3S37L 5F7KC 5GIRB 3W57A 4L05A 1XIWB 3S3BB 5E51A 1HXMA 4MA3B 5EUKB 3L5IA 3RTQD 3LNHA 4U6YA 2E7LC 2EE3A 4IRZA 1HYSC 1ET7A 3UJIL 2FBJL 3NJVA 4NUPA 5G4OA 5HDOA 2GBAA 3B5HA 4N0UE 4QRTB 1FYTD 4YWGH 1H0DB 2X2HA 5LVEA 1TMCB 3BD5A 1NGPH 3OHXC 2Z8SA 3IM1A 1WS7A 2J72A 4JN2A 3P9WB 1S9KC 4FLSA 2H0JA 2QPDB 4HH9B 4QHMA 1W15A 3VACA 2G0KA 3ZYOA 4KQ4L 3FMGL 1FL3A 2PW1B 2IPKA 2ZP0T 2AQSA 3AU1A 4F24A 2EDFA 4EI0A 1CTMA 3VI4B 1JYNA 5ANMA 3UAEA 1UQSB 4Q14A 4MMXB 4CL7A 1AAJA 2HRHA 4K23L 5I8OH 1INQA 1UXMA 2X3AA 4Z3FA 4NP4H 1D5IH 1WWWX 4LOFA 3RNKA 1DN0A 1E4KA 1I85A 2EIBA 4FYSA 3THML 2V2WB 1VFOA 2OJEB 1DDHA 3PWNA 1KPVB 4Y8AA 3FN0L 1VACB 5FYKL 2OK0H 2MQ0A 2CCLA 3O4LB 1KIRB 3V4PB 1RIHH 1T4KA 2O72A 3QRLA 3KEHA 3RWEA 1PEZA 2ICES 3P4LA 1D5BA 2ZG3A 2IADA 1U58A 2JVUA 4N6RB 2Q76A 1OY3B 2W0PA 3AXLA 1BVNT 1E5AA 5I15H 4WO4B 5HPOA 4K8RC 1RZJH 4WWKC 2NYYC 5DD6B 3V9FA 1DBBL 2RHEA 4AEIL 1KIUA 4FE9A 5DK0A 1S3KH 4NCC2 3FC8A 1AD0A 1J5DA 5T5NF 1NGQH 4PRAA 2JE8A 5C0NC 2VDKH 3O0RH 1RUPL 2VDRL 5EC2B 2EUZA 4MRBA 4YHNB 4ONHA 4P5TD 3SDDB 3C6SA 4PW9A 2X2UA 3BIKA 3D09A 3TPUB 2R0WL 3Q2CA 1G1KA 2VXQA 3GB7B 4GQRA 1H8NA 2XQBH 3ZKMD 2G0LA 3U36B 5HHXL 1TJXA 1G7JB 4FQLH 1CLOH 2AJXH 3QP3A 2I25N 3GXIA 3D52A 3VFUB 2FWSA 3GGWB 2X4UB 3W82A 4IRZH 2MCG1 3FB8A 1UC6A 1NCDH 3POHA 1P9MA 3FOMB 3HRZC 4LEXL 1ACCA 1GY1A 2WVTA 4OLYL 1R46A 5DQ9A 5GGVL 2E7CA 5IJBC 2AERT 5B4MC 4P2CG 4U3HA 3FO2B 2GC4C 2ZUUA 1XGPB 1PZSA 1YEIL 3T77B 3D0LB 4FG6D 1JHLL 2AEQL 2L7EA 3GSRB 4AUUA 2BP0B 3V0HA 3EJZC 5T1MA 3C75A 5GISL 3LSOB 1X5KA 2YMXL 1ZCRA 3QUYC 5I6XB 1OCZB 5ESVA 4XBGA 2VDLL 2ZOOA 4JM4L 3MRJB 4N0CD 4N5EC 5T5FL 2JIXB 4Z7OF 2N01B 4OF5A 2CAKA 2APWA 1T0NB 4Z78A 5IOPB 5EZJA 4ZMYA 1EWHA 1KNOB 2VM9A 2VZUA 3ARGA 3IDNA 3TT1L 3CMOL 5IMMB 1QLEL 3PLYA 1D3CA 1DL7H 3GIZL 4KRPD 5EFIA 2BC4B 3VFNA 5J6HA 1GGIH 3ILPB 1TCRA 1QYGL 2E8YA 5F88B 5B1KA 4XCEA 1RULL 5GHWL 2ARWA 5TH2B 3H1ZA 2N7AA 3QPXH 4U6HB 1J0KA 1FZMB 3BPNC 1SZNA 2DWDB 5EO0B 4AW4A 1EV2E 4HD9A 3MXVL 2JK5A 4AIEA 1E4XL 5T1KA 4LLQA 5BO1H 1BZ9A 5BS0D 4PLNC 3PWJA 2G2RB 4KKNA 3NACL 4QUOA 4BGDA 4LPTA 1KZQA 4LKCA 4R5TA 4BFEA 5HHOA 1B4RA 4PU2A 4M7KL 3MXWL 2BRRH 3QHZH 3T8XB 3DO7B 1ZHNA 3VWKC 2FVNA 4J3OC 3ULUH 1K5NB 5F0MB 5B8CB 2AJVH 2A6DA 2HTKD 2PKDA 4NQSA 5LXGH 4NHCH 1H6UA 2PO6C 3BH4A 5HHOE 2I32A 3U2SB 3HAEA 4RMSA 4M5YL 4WFFE 2VERA 3SJVA 4HEPG 1VFUA 3ZX1A 3QIWB 5GQBA 2RJMA 4F7CB 1I1AA 1HSBA 1T7XA 1AHWA 2N56A 4HIQA 1TQTA 4NKDA 3Q9PA 3C08L 3P73B 3OJDB 3ESMA 1T2QL 2A9AA 3IFLL 3LVTA 3EZ8A 3OXSA 1HK6A 1HN1A 4KKAC 3SJVE 5IBUG 3VFOB 1IFHH 4W9LC 4FOMA 4JPWL 4KUZL 4NC1E 2VXQH 4Y16C 4YIQA 3VH8G 4ATWA 4UQEA 1T89C 3FYIB 4HJ0D 4JFHE 5FGCB 4A7TA 1R5VA 2DICA 3BH8B 4NKOB 1U8HA 5DS8B 4NEHB 5E5UB 3VRIB 3FULA 5LQBH 1BVOA 4WVRA 2D31A 3CZFB 2CG9X 5EN2B 4F2FA 4QRRB 5C07A 4GS7C 1LGVA 4ZUWB 4LLMA 4XH2A 4MLSA 3NJIA 3U83A 1JAEA 1JF6A 4MB1A 4OU3A 4AYBA 1NC4B 3PL6C 2WSDA 4HEPA 1KTRL 4XMZA 5C07E 3ZTDC 2GJ6D 1HVXA 4KK9C 1GPOH 4XNUH 1OD7A 1JE6A 3DETD 3GZQA 3QEHA 2V2TA 1OALA 4WHCA 3OGCA 5I16B 1AZBA 1JL8A 1QATA 1UZ8B 5I2IA 1DO5A 3LPFA 2RCSH 4IBLT 4U7SA 3HBZA 5HYJA 2ZKXA 2Z7YA 4LP8A 2M8XA 2VGLM 4XGZB 3HBQA 1TQBB 1NBYA 1KPUA 4ACTA 2CU9A 2JCWA 2CUMA 3BIBX 4H88H 7CGTA 5KBDA 4UTAL 2O5ZH 5IW1B 2YMTA 1EH9A 3QPKA 1QHQA 5HYJE 2VN5A 2WLZA 2XWTA 5LWYL 1U4FA 3VFVA 1MF2L 4DZ8B 1ZTXL 4NWTH 4PWHA 4EI5A 4HOZA 1OTSD 1XAKA 4YX2L 2W95A 3NSFA 3QWRA 1MFDH 2KLRA 4DVBB 3KXFD 4CMHC 4P4KA 5DD5H 5FYLL 1WG3A 4MJ4A 2H3NA 5CCKL 4D2NA 4YXLL 3C6LB 2DY2A 1NEPA 3D2TA 4NQTA 5SWZD 4O2EB 3LJ3A 2FLBT 2GKIA 3PJSA 5AW2B 2UWEA 3FUEA 1AGDB 4MJ6A 1YCSA 4BQ8A 3FS9A 1SLXA 1ET5A 1KLUA 3BD4A 5AL8A 4NZJA 3BRDA 2QDWA 1BAFL 3HAEH 3TH2T 2ZPKL 4EZKA 4Z5RB 2CD0A 4O2CA 4NRZB 1R33A 1QFUL 2J88L 4NQDA 5DEZA 5E9DA 5JLZB 2UWEE 4DPCX 4JDTL 2YUVA 4Z7UF 4YJZL 1CFTA 2DB8A 2ORBH 5T1LA 2E7DA 5J7CC 3BPLB 3KLDA 3VXRE 1BFTA 4U1HA 4LEOB 2Z9TA 1GGCL 4P5MA 4NQDE 4LOEA 5E9DE 3TC9A 3WS6A 4MCMA 1NOAA 1EUUA 1Y1UA 1H3GA 3T1FB 3ZR6A 1I3RA 4AZUA 4P5RA 3L08A 4Q6IA 3AC0A 2P3YA 3VM5A 2KZ1B 4XXDB 1Q9OA 3HB3D 1SXZA 4KVNH 2RMNA 1DSWA 4P9HC 1XZ0A 2CK0L 4JRWA 2HG0A 5KBPA 4X5XB 2FD6L 3QCTH 4LNRA 2DJUA 4MAUL 2W94A 4MDRA 2VABB 4TYUA 1YYCA 1J1PH 5K9QI 2WY3B 5KTEL 2R0KL 4HS3B 3G5YB 5MENA 4HIJA 3MLWH 3HZYA 3VQLA 4ZFZB 4E36A 3PDOA 4OKVA 3RJQB 1JYXA 3ETBJ 2D2CC 2BX5A 3G3LA 2D0GA 1MREL 1V7MH 2AEWA 3VG9B 2EP6A 4KZEH 4K8RL 3K8KA 5MENE 3MN8A 5EC1B 4XMLH 2V2XB 2P7TA 1E4KC 2R9HD 1KCUH 1I85C 1RMFH 3LHPH 4J8RA 1HOCA 3IE4A 1OLZA 4FG0A 5FM5O 1D9KD 4FFYA 2APFA 1HINH 2J5LC 3CLEL 4RA0C 4YSRA 1EDQA 1U3HB 3QUXA 4S1SL 2CBPA 3SE9L 4YHOL 3CLWA 4NO0A 4NM8H 1SHSA 4LRNL 3SQOH 1X7QA 4XCNA 1OWWA 2E47A 3BAYA 2OV0A 3RWFB 5KG9A 4J3XA 2VDMH 3W38A 1GXEA 1E4HA 3MC0A 3UTOA 2IPTH 4GKOA 3TZVB 4NKMA 3QCUH 2BSRA 3ZKND 4TSAL 5I0YA 3MRLA 2FT8A 4ELMB 5MHSD 4JRXD 3PV6B 4H1LH 4GUPB 1U8PA 3QG7L 2GUOB 3VFGL 2VDQL 5BZDA 3ALXA 5DC9B 4U2YA 3VCLA 2BH0A 2B2XL 3LXUX 3EDDA 3L4VA 2Y24A 2DLHA 3AADB 3FHAA 2PYED 2JWYA 4EBQL 2O61A 4DK3A 3SPGA 3CU7A 3CFIC 3GS7A 4HBQA 3ZTCC 1Y7VA 1ID5I 1JZ6A 3QAZB 3DGGA 4YNYB 5AAPA 1A7OL 4HAKA 4OCSH 1AYOA 5ADPH 1S7TB 1ACYL 2A9ML 4WU7B 2ZCHH 2BS71 4YS4A 4CKVX 4MQTB 5ILTH 2G5UA 5DDHA 1NC2D 4BIKA 4MAYD 1UVQA 3Q6FB 2K7PA 1B0WA 1RY7B 2NY0D 4OY9A 4LOVA 3S6CA 3T9WA 1KCBA 4XN9A 5AG9A 4H26B 4JO1L 5F8RC 2VUKA 4K3JH 4DO4A 5DEGB 3MV8B 4NUGH 1FGVL 5GRWA 5IF0A 3BKJH 1T3FA 1UXWA 3QJHB 4Q2ZA 1WD8A 4KGJA 3UDWA 3KR3H 1K5WA 3VXQA 5IROD 4I3SH 2BZDA 1YDPB 2ZAGA 5JYLA 4OF3A 3Q2LA 2VNCA 4RX4A 4OZIB 3KYMB 5EU5A 3AABA 5JO5A 1G84A 3IDYC 2A38A 1CFVL 3GSVB 4D7PA 3QNYA 3MBEB 1WIOA 4MB3A 3ARGC 4XHJD 3ZQXA 2R1WB 1GAFH 4FFVC 4G7VL 4P8QA 1FJ1B 1GZPA 2MKWA 1XAUA 1KG0B 2CHNA 4FQHB 5T3ZE 5JORA 4OLWL 5B1BB 2CR6A 5BUAA 1J9QA 3EYOA 3RX8A 3NFSH 4BD4A 3ZKSD 1MRDL 3MLXH 1KY7A 2KT6A 3MUJA 5CZVL 1XXDC 4HCRL 3VA2C 1JBJA 2HRPL 1AXSB 5C2BH 1KFAL 3BSZL 4IDJH 4XMPH 4HPHA 3WIHA 3HFML 3QHFL 5E8NA 2NYZA 1ZT1A 2FNWA 2J8HA 4ZMNA 4Y9BA 4WKXA 1UFGA 1TVBB 3LZOA 4N8CH 3UL4A 4BRJA 4OJYA 2B1AL 3L4UA 1XF4B 4J6RH 2R23B 4AH2A 1PY4A 1S7WB 4FXKB 1GW0A 1F3DH 3T0AA 1QLRA 3DUUA 1CFNA 4JPIB 5DC2A 5IQ9A 5IGXH 1WV7T 1OT1A 4N2GA 3ZKXC 5D2LB 4N2LA 3GF8A 1R5WB 4K7PX 3ZE0E 5FC9A 1I1AC 2VR6A 1A64A 3F12B 4NC1C 4PJ8D 4LCUB 2RQEA 4HJSA 1QFWH 1KTCA 4ABQA 1KV7A 4GAYA 4JG1H 3PAZA 1JGIA 1NIEA 3MODH 4G6FB 2KH2B 5CEZE 2FGZA 1OCWL 2VW6A 2FAUA 5FGBC 4DSYA 5F3BB 3GTVA 4U0QB 2AJUL 2F8IA 2FBRA 3MX0A 4J2QA 3CFCL 4R90L 5DUMH 1N64H 3N85H 1CXIA 4KZ0A 4Z7VA 2Y07L 4JHWL 4JY4B 1UYWL 1TZHA 3GBLA 1JMZA 3VSUA 3MNVA 2E86A 1QVOA 2ZCLH 1WEJL 2ATPA 3A67H 1A9VA 2PP9A 2KPWA 1IGYB 3EAKA 4ICWA 4LSPH 4JK0D 4IJ3C 2GEEA 3G5VB 4M61A 1I1CA 4RGND 2W5PA 1KJ2A 4XBPA 4GSDH 4XX5A 1KTDA 3ERXA 4X6CA 2ZUWA 4P05A 1JGEA 1MQKL 3EHBB 1P5VB 3DBXB 4APXA 3HUJB 4PJ9C 2M1KA 2LE9A 2DOCA 5DFVC 3O6FD 1R3IH 3C2SA 1P6AB 3LKRB 5I8KL 1XF2A 3D0VA 4WNQB 4X6CE 2OMVB 4UT9L 5F9WB 3SCMC 1ZIBA 4HXBL 4PWKA 3RHWF 5EIVA 1KPRB 2UX6A 4ZPTA 5EOQH 5DI8B 5HHPB 4YFDB 1X3DA 3WNMA 3RZCD 4S0SD 4QKTA 4ODTH 4X50A 3ULVE 3JVFC 2K1MA 5G4MA 1RU9H 1E7UA 1X5IA 4NM4H 2BP8A 4JO2L 3MJ8B 1C5BL 5EIIB 3WSQL 4JB9H 4K94H 3V10A 2F8VA 3VXUB 3KW8A 1YO4A 1XGQA 4PRPB 4LU5L 5I30L 4KRLB 4IBYA 4LVNB 4Z7WB 3VXME 5I0ZA 3QGVA 1GCFA 3UBXB 4EI5C 3M1BB 1Q0YH 1RAMA 4FFTA 1BLNB 1SBSL 4OLZL 2BO0A 1PSKH 4PGZA 2DEYX 4QRFA 3MREB 5JNYB 2H9GB 4LK4A 5SX4I 3TO2A 3SPVB 1NA8A 5C0AD 3DX8B 2W88A 3BAJA 2YAHA 3NK3A 1HJBC 1JZFA 1M53A 4PRHA 5DSCA 1ZANH 4GAAA 5T33L 3WIIH 4U6XA 1NGYB 1WRFA 3HR5B 3MV9D 3QPQD 1PU0A 4OCYH 4P23D 4PGBB 4P9HL 4A68A 3G04B 3IPFA 4LBEB 3RVVD 2Q86A 3L3IA 2OMZA 5C6WH 5ID1B 1RZGB 3B5TA 5HSFA 4PRHE 4OGAC 1FORH 2BIOA 3MA7B 4FKHA 1OCRB 1UKQA 5IIEB 4R96B 3NRPA 1KT2B 5GIRA 4MMZC 4NQXB 1XIWA 4YDZA 4MA3A 3UTPD 5EUKA 6CGTA 3EH1A 3VO0A 4F15B 4AYSA 1IAMA 4D9LH 1G7PB 2FL5B 1MHPL 3TTSA 3WS6C 1H3VA 1P7KB 1U8KB 1E90A 5CIPB 2NRDA 4KGLA 4X80L 3NABL 4MDJB 3N55A 5ABDE 3MTRA 4QRTA 4G6KH 1H0DA 4Q6IC 5CP7B 1EFXB 1Q0EA 3NN8B 2P80A 1EEZB 3LTVA 4TOYL 3U9WA 3T2LA 4EVNB 4LZKA 2YPVL 1T22B 2R7EB 1KJ2H 2CPCA 2IH1B 4HH9A 1TSRA 4UUJB 5I23A 3NSCA 4HFUL 4V1DB 4HK3J 2PW1A 3KLSA 2R56H 2QSVA 4BUGA 5B38B 5F72S 3F04A 2DEWX 3GSOB 3VI4A 3RIAK 3MRKB 3JYBA 1UQSA 1FRGH 4MMXA 2VXSH 2OSLB 2WBJB 1WVZA 3FONB 4FDWA 5E99H 5IVZB 5ITBL 1JGVL 3ULVH 2CO3A 2J1ZA 3IJ7A 3UJTL 4KHXH 3LNGA 5AW7B 3VI4E 3R7QA 3GZOA 4HYTB 4YO0B 1P6WA 2FEEI 2V9RA 2WAQA 5I6MA 2AC0A 2V2WA 4AIOA 1BX2B 2OJEA 4UWQB 4AMKH 1MCRA 2ICWI 4LLAA 4YBLC 3GMRB 4NN5B 5AVWB 3E6FB 1VACA 3NTCH 3P30H 3O4LA 3K8MA 1KIRA 4UU9B 3V4PA 1JVOA 4N3UA 3QK0A 2H41A 3IF1B 1JGUH 2BY3A 2H32B 2X42A 3S37H 1MWAB 4NENB 1BAGA 4IGBA 4TUUA 4B9JA 4F33A 5JOFB 1NUFA 3ILQD 3PF2A 5FIEA 4N6RA 3HIZA 3O4LE 1FG9C 2F6AA 2COVD 4WO4A 4GP8B 4A39A 2EH8H 4XO3A 2B7DT 2YGQA 5DD6A 1FFOB 5EBGA 2WSPA 3MCLL 1T1YB 4XP4L 2XFGB 3MV7D 4K3EL 5LCVL 1A4BA 1BF5A 3QO0B 6FABH 3OZ9H 3IBEA 2DWEB 2X0WA 3BDYH 4ANKA 5EC2A 1VPOL 5GS0D 4YHNA 1KOAA 4TTDD 3SDDA 4OTXH 2NY5C 2DQHH 2J25A 3TPUA 3WTSA 4KJWD 3GB7A 4FYQA 2OR7A 4PCKA 1GS8A 2OFQA 3U36A 1J9TA 1VERA 1G7JA 3FUDA 1F00I 3VSTA 2DMHA 2ADFL 3NGBC 2JLPA 4A38A 2Y3NA 3VFUA 2GTZB 3GGWA 2X4UA 4QRAA 4B0MM 2C7FA 4F37F 3EUUA 5JZ7D 1A6UH 5I82A 2YS4A 2JLLA 1TG8A 4ZO7A 2GITB 4M6NH 4OM0H 4HIXL 3CHOA 4UNVA 1DBJL 3FOMA 4TNGA 1PZ5B 1OARH 3AWEA 2F19L 1CGSL 1NSNL 4H8UA 2VDOL 5CU9A 3FO2A 2ITDB 1TTBA 1XGPA 3DX3A 2GK0B 3T77A 1UOVA 3D0LA 3OXRB 3O3EB 3GSRA 4PLKC 1V3LA 2BP0A 1HE7A 2WZ5A 1X9UA 2XC8A 4UANA 4ZOCA 3UDWC 1XMWA 3LSOA 5I18L 4KJPC 1N7MH 1VFMA 4BFJA 2L7UA 4Q9QL 2JB5L 2WXOA 1VAHA 4NFCA 1H5BC 3MRJA 2JIXA 1T0NA 2R15A 2PPCA 5IOPA 2YUWA 1KNOA 5DJZB 4X4YB 3DO3A 1Y6KR 4G9DB 5DS1A 3APFA 3R18A 1X4XA 3GKZA 5IMMA 4HF5L 4QGTA 3NZHL 4UNTA 5CBAB 2XWDA 2YFOA 4XNDA 4N2FA 2BC4A 4DTGL 4G83A 3ILPA 2ZWSA 5BVPH 3DHJA 2CIIB 2I5YH 4N6QA 5F88A 3OC8A 4GOSA 2MQCA 3LD8C 3CBRA 5TH2A 5JIKA 4U6HA 1RK1B 1TJHH 1FZMA 2DWDA 4KAQH 4GIAA 2BW4A 5DT1H 5M7QA 1X5ZA 2QVIA 3EF4A 3PYCA 5HDRA 3U2IA 4LSVH 2G2RA 4FERA 5C7XH 5INDB 3C5ZD 3LV3B 5HDBF 4HISA 4ZD3H 1IGML 2MOVA 3T8XA 3MNMA 3DO7A 1IC4L 4I0CC 4MSWA 1LE9B 1K5NA 3BFQG 1J12A 4ZAKD 5B8CA 3BCDA 1BP3B 5BNXD 1EMTH 1UURA 4YDLC 5DMGD 3II2A 1ZHBB 3LPWA 4LEXH 4IRJB 3U2SA 3P3TA 1X4YA 4MA1C 4A2MA 3QIWA 4F7CA 3DTUB 1EHNA 4I48B 4WGVB 5GJSH 3P73A 3VTTA 3OJDA 2Y0SA 2D7TL 4B9PA 1T1ZB 4ELKB 4RCAA 3VFOA 2F53B 3BWUC 3FAXA 2DYPB 3LDBB 3QJSB 2CLVB 2YKLL 5FPIA 4P2OC 2DQEH 4FA7B 1LNUB 2RBLA 2XTJE 2ICEB 2XVGA 2VRAA 5D1QE 3S34L 1AO7B 1MAMH 1NMCB 3BH8A 4OLVL 2FO4B 2PWGA 3PABB 4H20L 2NZ1A 5DS8A 1MCOH 1HILB 5D6CB 3VRIA 4WZ9A 5F71A 2F7RA 2CDEB 3ARWA 3NCBB 5EZIH 1UZ6E 3AREC 1IGTB 3GHBL 3T4AC 5FGCE 2BVOB 3CZFA 3IDGB 3BZEB 5EN2A 4QRRA 3VWJB 5FECB 4BUQA 3OKDA 3ALPA 4QXUH 1SEQH 4Z95L 3RTLA 4ZUWA 5AW5B 3R7RA 3T2NL 1M4KA 2H8PB 1I8MB 1X5LA 2P43B 3BAWA 3QEQB 1BM7A 4OZFB 2OCJA 4UV7L 2ZNXA 1NC4A 4LSSH 4QRRE 1TZIB 3LIZA 1T21B 4LVOB 1Q1PA 1O0VA 1N67A 2QPSA 3FL7A 3PV7A 2VN4A 1MNUL 3MJWA 3I85A 3H3KA 4M7KH 2ZUTA 1ODAA 1MW0A 5LN8A 1MFBL 1VF5C 1AZUA 4Z6AT 5I16A 1KCKA 1UZ8A 3BDBA 1ECZA 3O3DB 5EORH 4BCXA 1DR9A 3LRHA 4Q89A 4R7NB 2NQ3A 1TPXB 1DQQB 4QRUB 3ML9A 4KJQC 2M26A 4XGZA 1OIOA 2VMFA 3FQWB 1TFPA 3BAEL 3BVTA 3B2UC 4UQ2B 4POZD 3GC3A 3QDJB 4AL8L 5F3HB 1PF3A 5IW1A 2GY7B 2OZNA 3LS5H 3KPQB 1T5KA 1IEBB 4DZ8A 3OKEB 3SQBB 3EYQD 3LMJH 4HFWB 2CRZA 2ED8A 1LO4H 2CM5A 4N2KA 1WCBB 1BQHB 3PP4H 1URLA 4XVUC 2C3HA 4DVBA 4FXGB 1J9RA 3QJOA 1TMQA 4AQOA 2LR4A 4OD1L 4WEUD 1A9BB 2C1PB 1NAMB 3TJEL 3C6LA 4LVHC 3W0WB 2DV6A 4TMPA 2DL9A 4O2EA 3ZDYF 2JTYA 5K59E 5KBNC 4FZ8H 5K1VA 3VFMB 2H2SC 2E46A 1AGDA 1D6VL 2WXNA 2FX9L 3E2HC 1N8OE 4GXVL 3FKUS 3S8GB 3GBMH 3FB5B 3BUTA 43CAB 3SPHA 4AK1A 2X0UA 4Z5RA 3JZ7A 4QMEA 4NRZA 1VA9A 1UB6B 1QPXA 5JLZA 3IWUA 1C1EL 4K3DH 1FNGB 1HHJB 4N26A 5IESL 3BH9B 1G1OA 2V37A 1MRFH 3OJMB 1QMUA 1MCIA 1XIWC 4LEOA 3P9LB 3CZGA 3RKDC 4U1LB 2LFEA 4WTZA 3ATFA 4OD2B 4CVWA 3T1FA 5IUCA 1JZGA 1WFMA 2Z65C 2ADIB 5FCUL 1R3JB 5CILH 1O7DE 3N06B 3BI9X 3K6FA 2GSMB 1FG2B 3NZSA 4IHBA 4N8VB 3SGDI 5IMOB 1F4HA 2CJTA 4U0RB 4X5XA 1JG9A 1WWBX 2I27N 2V9TA 4GI8A 4F9LA 2XBZA 3FSZA 5HGDB 1AQDB 1ZJBA 2VABA 4QRBA 3STLB 4Z7OB 4OKDA 4LHUB 4FFYL 4HS3A 5F6IB 1X9LA 3G5YA 3WXVL 5DQDH 1JUFB 4ZFZA 4BFBD 3LIZH 2V5TA 3H4FA 4HZAA 3O6KL 4I2XB 2IXQB 5FYLH 3QYNA 1WFUA 2Y25A 5EU6D 2D8KA 2GFBB 5HTSA 1WZ1H 2O4EA 2VRKA 1GW6A 4X8XA 3BWAB 5EC1A 2V2XA 2CGRH 1PVHA 3RUGF 4YSDA 2BVTA 3B34A 1M71B 3DUHA 1KYOJ 2E9IA 4QIRA 1UZGA 4ADGA 3IXTB 1ZHKB 1EXUB 1U3HA 4DKTA 1C5DB 3HMWL 3UP6A 2H3XC 3KH3A 1RZFL 2X0VA 2MNUA 3MYJB 2G60H 2NY5L 4IGBC 5J5EA 1NBQA 4W6WB 2OMNA 3RWFA 4E2OA 2ENYA 2BZ7A 4YFEA 2D7PA 1ESOA 4GJTB 3TZVA 5IFHH 5AW0B 4PG2A 15C8L 3JBG7 1FO0L 4ETQB 3N2JA 1NDMB 4ELMA 2Z91A 2FWUA 3PV6A 4GUPA 5AENA 2BSED 5ITFB 2GUOA 2VQ1B 4OGQC 4ABVA 2OPCA 1TTAA 5E7FA 5D71L 2X9WA 3RY6A 5ANHA 1PG7H 5DZNA 4GW1B 1OP3H 2XDHA 1QFHA 3CK0L 4K0OA 2VC2B 4ELME 5D70H 5TK4A 4Y19B 2VDNL 4O4YL 5LDUA 1N3NB 2EVGA 3FFOA 3ARDB 2NMSA 4BZ1A 4YNYA 3T5WA 4QF1B 3H2WA 4PP1C 3IJ8A 2PETA 8PAZA 1IILE 1S7TA 3F7PC 4WU7A 4EXPX 3WFBH 3L9BA 1H8LA 1PD0A 1ZEAL 4A7UA 4RRPM 3Q6FA 2AJ3B 4DOHB 5TQ0L 1CUOA 4H26A 3M88A 3NEEA 4ZW5A 1ZVYA 4BH8B 5DEGA 4ELDA 3MV8A 3BEVB 3LQAL 3CPUA 4C4BA 4PTUB 3QJHA 3SD5A 4W6YB 3DX4A 4S1SH 5DWUH 4AVIA 1QFWI 3QORA 3L3GB 4DPBX 4XAWH 2NY6B 3MV8E 1YDPA 4LRNH 4L5FL 1E5BA 4OZIA 2DIJA 3F58L 3RTQB 3KYMA 1HZLA 1BWWA 4GQ9L 4E41B 1AR2A 2H1PH 3GSVA 3GBNL 5TE6H 1OQXA 3ABLB 3MBEA 2VXTH 1YMMD 1SEBB 2R1WA 3CLFH 4UF7C 1FDLL 3FQ1A 1A7QL 2WYTA 1FJ1A 1W6WA 3Q48A 2HRLA 4FCAA 1KG0A 2V9UA 4KDVA 5D93B 4OZIE 1L0PA 4FQHA 4ONGH 4YZWA 2VDQH 1SYVB 3CN3A 2WZPD 1HIML 5CGYC 3FQTB 1A7PL 5KYXB 1DANT 4JMNA 4LQ1A 4KC3B 3EJQA 1AXSA 5CEZL 4L3FA 2XIDA 5JW4M 5J1TC 4G3YL 1KXQA 2VWEE 3ARZA 4Z3EA 2G3MA 4G2AA 1TVBA 1LWJA 2OZ4H 3RGBA 4URTB 4WTQA 2A9MH 1XF4A 5LUMA 5MI0C 1I31A 2R23A 4NBYB 4DETA 2KHAA 2QSTA 5D5MF 1S7WA 1KXQE 2UXGA 4FXKA 4FLHA 1KGJA 3WAKA 2OW7A 4CDHA 5B8CC 4LAQL 2FSDA 1PPIA 2X89D 5DO2D 4OFQA 2A99A 5D1ZB 1W0YT 4JPIA 4WNJA 4WAFA 5D2LA 1EAJA 4OGYL 1R5WA 4LEEA 3KHQA 1XGYL 5FKAB 4Z7UB 2BSCA 3F12A 4LCUA 4OCWL 5FWQA 1HFUA 2XTJC 3HNSH 2IAND 5D1QC 4ZMPA 5D2LE 2C8NA 4L4TD 1S6NA 5F3BA 4PWEA 2AJYH 2NQDA 2ZXWB 5AB2A 1W8NA 1O6VA 1IT9H 4BZ1H 3A23A 4G8GD 3GSNL 5E8EA 1INEL 5D72H 5GGSA 5K1JA 1JV5A 4JKWA 5EIIG 1X5MA 2HH0H 4JY4A 4K3GA 3WY3A 4HD5A 4XMKL 3RY5A 3HI6L 1IGYA 1ES0B 1EHLL 3MRBA 2YRZA 2WYIA 2ENJA 3G5VA 1CB4A 3PGDB 4NC0B 4PS4L 4XVJL 3T0XA 3MBWB 5DUPL 3UBXG 3FUMA 4LSDA 4WWOA 1MOEA 4DKEL 1GSKA 2C5DC 1U3YA 4BZ2A 2UYLB 4QXTB 2WK2A 1HZHH 1P5VA 1RJZB 4KV5E 3DBXA 2VAAB 4P5TB 3S97C 1ETA1 2DLFL 1NCHA 3HUJA 1S46A 2YQBA 3D39D 3DYOA 2IJ0C 1NCBL 3TWCL 1FSKB 2B3RA 3FAWA 4GUOA 1RPUA 1BPVA 4WEBH 1EO8L 3LKRA 3VI3F 3BHBB 3PWVB 4DEPB 4WNQA 1NGWB 1XTMA 1UXSB 2RGSA 2OMVA 2Y6SD 3HLAB 4YDKL 2MMXA 2ZYSA 3D69B 4BK5A 1F3DJ 1GYAA 5C97A 3HUJE 4LFHD 3SDXF 1KPRA 3QA3B 2EDDA 4J12A 2RD0A 5CHNA 5DI8A 3ZW3A 1DN2A 5HHPA 5HYEA 3QXAB 5J12C 3EYSL 3TEUA 1K72A 1TQBC 3MJ8A 5EIIA 5E70A 3VXUA 4N4YB 4M7ZB 4DVRL 4WFHE 1SLUA 5I66B 4PRPA 4XNQB 1ASOA 1EUTA 3BFWA 1SVBA 3NA4A 4CSZA 4Z7WA 1S9YB 1AVAA 1S9XB 3UBXA 3M1BA 2CGZA 3EYFB 3VXUE 1BLNA 1M05B 3OWRA 2CXKA 5DJ0B 4LIQL 4TVPD 4AITA 4MBOA 5AW8B 3FSOA 3MREA 4PRPE 2FJSA 2H9GA 4Z7QF 1WICA 5J13B 5JNYA 1CN4A 4Z7WE 3RWGB 4JM2C 5BZWB 3SPVA 4QRPB 3C6LC 1UYWH 3DX8A 2BHZA 3SB3A 4WTWA 1I9JH 1WLHA 4KRPB 2WWOA 3WTWA 4LGSB 1NGYA 4NHUB 4Y9CA 3SO3B 3HR5A 3FFCD 4EIUA 5B38G 5HXMA 1AOZA 4KK6C 3HI1B 1AIZA 5KAQF 2GJPA 3ET9F 4U31A 1M2OA 3HC3L 1FAIH 4PGBA 5L8JB 3G04A 3IU4L 4LBEA 2E0PA 3VDBA 5ID1A 1ADQA 1RZGA 2A73B 3F3HA 3C2AH 3MA7A 1BFSA 2JI2A 5IIEA 3L4TA 5J06A 2Q7AA 4JR9L 4R96A 1KT2A 4RAVB 1U8QB 4WF7A 4K5LA 4NQXA 3NCJL 4Y1AD 3BPLC 2B1HH 4PUBH 4XWGH 5BS0B 2VLKD 1O7DC 5TQ2H 5I8KH 4TNVF 3N3EA 2J6EA 5KVGE 1G7PA 2FL5A 2JFCA 4UOQA 3FK3A 1D7BA 1P7KA 4QTIL 5CIPA 2VO5A 5HYQB 4FI7A 3F83A 4MDJA 3KBFA 1GTFA 3MYZA 4PJ5A 2HJLB 1YEGH 2PWEA 5GRUL 2P9RA 2Y72A 5CP7A 1EFXA 2NNRA 3NN8A 1EEZA 3DVFA 4L1SA 3QRFM 4EVNA 5I1HL 2XVBA 3WSQH 4GT7A 1PY0A 1T22A 2F7QA 2R7EA 3IT8D 4F9LC 2IH1A 4KKCD 4PJ5E 1MAKA 4UUJA 3OPUA 3BLKA 1MXGA 3JZYA 2NY2C 4V1DA 1FCCA 1ZLUK 1OK0A 4BZ2H 5B38A 1U8JB 1SM3H 4NRYB 3FH8A 3GSOA 3MRKA 1O9WA 3HJ0A 5IVZA 4ZTPH 2OSLA 2WBJA 3FONA 4JFDD 4KJYB 1IEHA 4BEIA 1AFVL 1NUNB 5I74B 1IAIM 4V1DE 3BD3A 4E9YA 3AG4B 3PNRB 3OPZH 3RLSA 5E6ID 1UGKA 1HC1A 3A21A 3LS4L 4YO0A 3CIAA 4IBZA 5L9DL 4P2RD 1BX2A 1P53A 5CLYA 3U1SL 3BP4B 3RQ3A 1KCWA 3BUQA 5SX5K 3GMRA 3UPRB 4GI9A 3E6FA 1V7NL 3L7FB 1BEXA 3LEYH 4UU9A 3IF1A 1U3HC 2H32A 1AP2B 2N7SA 3UPAA 1MWAA 1RLBA 2AMUA 4NENA 2A0LC 1XD0A 5JOFA 4LXFA 2WWNA 4NPJA 3IJSB 1YY8B 3MV11 2GJ6B 3HS8A 2X05A 3ZYIA 5T1DL 4OZGE 3P54A 2VOTA 2NR6C 1FFOA 2MIZA 1T1YA 2PP8A 2VR3A 1EZLA 5EA0L 5A2LH 3JT2A 3EF7A 4PIBA 4AQEA 3QO0A 3ECWA 2DWEA 4WUKL 1CVSC 5D2NB 1W8EA 4DK6A 2V7HB 5C6TL 1A6VL 3RY6C 2UXFA 3CXFA 3DYMA 3LXBA 2VZTA 4D3CL 2IOOA 4JE4B 5HVHB 4Z8FL 3BKML 1ADQH 2DQFB 1NBZB 3WCYA 4X6BB 2DQUH 4JHBA 1BM3H 2OR9L 5DLMH 5K9JL 1VHPA 3LZLA 5K5YA 3OWEA 1BZ8A 1ODUA 5FUOH 2GTZA 3R4DA 3TH3T 3KXFB 2BY1A 2W91A 2J6EH 3WN5B 2P5PA 3EJJX 3Q9QA 2GITA 5AKVA 4OCNC 3UJTH 5SWZB 4XI5D 2C9PA 5CIPH 4HJGB 1PZ5A 1JFHA 3TIDB 1CJYA 3B37A 2B14A 4QKXB 1IMHC 3T6WA 1TKWB 2ESVB 1E27B 2ITDA 4AG4L 2QADD 2GK0A 5AYQA 3O6LL 3OXRA 3O3EA 4ZFGH 1BJ1H 2WLLB 4UDTB 4KZCA 1CGTA 5D9SB 3QORC 5LN4A 1BFVH 5DMYA 5DJZA 2NCMA 4X4YA 4G9DA 4B0MB 3FO1B 1OGAD 3MRHB 4JPQA 4BWTA 1FE8H 5CBAA 3MBEC 3TA4D 2J4WL 4AGNA 3QJQB 3N41F 4O5LL