3OZ9H

Crystal structure of anti-gp41 fab nc-1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQSGTELMKPGSSVKISCKATGYRFSSYWVEWVKQRPGHGLEWIGKILPGIGSTSYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGYYGPTWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab NC-1 kappa light chain
publication title Crystal Structure of anti-gp41 Fab NC-1
rcsb
molecule tags Immune system
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oz9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oz9H02
5T1LA 4PLJD 3KPLB 5DJ2A 3U0WH 1KIRA 1HOCB 2NY0C 4HG4J 2EE9A 1YMMB 4NZRL 1XGQB 4OUOA 4HJ0D 4HXAH 4U4BA 5FB8B 3BKYH 2X7LB 4Z8FH 2HG5B 5IMLA 2OJEA 3W0WE 5ERWB 4MSWA 5D7JA 2JELL 3QWQB 3KPRE 1IGFL 1LP9B 2VXUH 1Q9KA 2J4WH 4XNUH 4JGJA 3EYQC 2FX8H 1U58B 1GVIA 2G5RA 3BPOC 2GAZA 4L4TE 3QEQD 1NGZA 4MDJB 1HHKB 1NEUA 4HD9A 4U1KA 2PXYB 1MRCL 1R3KB 4NCDA 5EIQA 5EBMA 2XPGB 2OTPA 2OXHA 4OLXH 4JFDE 1KYOJ 4YHNB 1KTKE 3SGDH 3QDGB 1H3VA 1G7QA 1I7RA 2FH6A 5B21A 4K8RL 2XQYG 3H42H 5AG8A 4V1DD 5DMGD 4PRPE 1BFTA 2P8MB 1X5ZA 2D7TL 1TPXC 3IRZA 4G8IB 1FO0L 2XZQH 4U1JB 1XCQA 2YXFA 3T3PE 3UO1L 3A67L 4HWZB 3DOSA 3QHZL 1NCDH 3DURB 2H32A 4AZ8A 7FABL 5C09B 5I17B 5C07D 3T4YA 1CK0L 1PAMA 1OQOA 2VABB 3QEHB 4WFED 2V2WB 2CD0A 3S4SG 3O8XC 5H8DA 4HFWB 4P5KB 3RIFF 5F7EH 4Y5VA 1EGJH 1TVHA 3IU4H 2NY2C 3K80A 4YDKH 1N8ZB 5L9DL 3QXAA 4F7CB 1MUJA 4O2FA 1AI1L 3OGCB 5DVNA 5T3XE 1OSPH 4U6XB 2IAMA 3ZDZE 1XIWA 2AQ1A 2VDOL 5ALCL 1OP3K 3ULUH 3MXWH 2DD8L 4NKDB 4ZDHA 2YBRB 4NRYA 2V7HB 5GZNC 2RFXA 4FG6C 4HMCA 1IGIH 1P1ZB 1AGFB 2NZ9C 2X1XR 3LQAC 4PBWD 2FCBA 5JA8B 5SX4H 4CL7A 3MLVL 3IDXL 4LCCC 3W39B 5EU5B 4P4KA 3UEZA 2DQDL 4P2OC 3HZVA 4LIQH 5E8EB 1HIML 2X9YA 3MC0A 1V7ML 1X4ZA 3Q2CA 5JW5A 3PNWB 2UWEB 1F90H 5TH2B 4PGBA 3C8KA 4QLRA 3LQZB 4LSPH 5F1OB 1NGQH 2BVPA 4JZJA 2ZP0T 3P9WB 4WUKH 3PHOA 3STLB 4AEEA 3OR6A 3W9DB 2DTSA 1HN1A 1JNLH 3W11D 2B4CH 2Q86A 2NX5D 2VQUA 1IBGL 3QZWG 3QI9A 3WO3B 5F7NC 5FHBH 4WEBH 2HT3C 4OI7A 1R0AL 2GFBB 3LQAL 1R3HB 2EDDA 5GS1A 2FJHB 4KJYB 1UACH 1I1AA 1Q9LA 1NBYA 4M1GH 3TYGL 3TVMB 2HT4D 4OKDA 1FN4B 3WFDL 1UZ6F 2AJXH 4ZO8A 2CDEA 4UINH 5KAQG 1F4WL 1A14H 5EC1B 2Q76B 3SDAB 4ZTOL 2IADA 1KNOB 2KL6A 3HN3A 4O4YL 3FQRB 1I9RL 4HIXH 3CSYB 4ODHH 1I1FA 3UX9B 2B8OT 4IMKC 4HGKC 4QHLA 1BMGA 1WWCA 3LDBC 4NT6B 2DLIA 1RI8A 2DDQH 2HN7B 4Z7OF 2JB6B 3KPMB 1RIUL 1LD9B 4XBEL 3T0BA 2R56L 3SO3C 4LNVA 1JCKA 1UCTA 4KTDL 4CADB 2DWEA 2KQMA 4PJAA 4FFVD 4OD1L 1ZLUH 4YHYC 1MI5D 2YA1A 3HG1B 4RAUB 4I3RL 5GS2H 4YNYB 4HLZG 3WJLA 1HWHB 2MCG1 3VXRB 3BWUC 3CFBA 5I1CL 5F9DC 1AO7A 2QL1A 1FNEA 2NY1B 1LEGB 2BJMH 4J3SA 2NTSP 2FECI 2I5YH 2E27H 5GRUL 3MLUH 4BFIA 3UTTD 4MYWB 5I71B 4GXUM 1MCBA 3HR5A 1CLOH 1RZIA 3O11A 3MLYL 2EDQA 5IESL 1J8KA 1X5AA 1S7TA 3PGCA 2EKSB 5D96C 5JXAH 1ZHBA 3NAAH 4NJ9L 1IAIH 4GH7B 4Y1AA 4PJEE 4UOW0 5IBUG 3PQYE 5EZLA 1JHKH 4TUOB 1TJIL 1A2YB 4JFOB 2CLZB 1QR4A 4CVXA 4NC1C 2Q8BL 4EN3B 3DTXA 3PV7A 1UKSA 4OLUH 2ZOKA 2ZUTA 3D25B 5EZIL 2GTWA 5AZEH 5I18H 3ZTNH 4L9LC 1P4LB 3V7MA 3O3DA 5GHWH 1SEBB 4OAWB 3L3DA 2DKMA 1UEYA 4G6AD 1J5OH 1BEYH 2H3NA 4U1GC 2CKBL 5IMOA 5IMMB 4QRPD 2LAAA 4AENA 4LCIL 4X6CB 2FO1A 3RWCA 3QR2A 1BBJB 4ZUTA 1MCIA 3DX8A 2GJ6A 5C92A 4QHUB 3NGBC 2CDGA 1CFVL 1ZKAA 1AD9B 3HC0B 4N0CD 3CLFH 2P49B 4ELKB 2PO6B 2HTLD 3L95B 1VACB 4JFXB 1RZ7H 5FA4B 1RV6X 3KJ6L 1G7JB 1BGXL 4FABH 9CGTA 5I6XB 4DUVA 4K7PH 4R90L 3N85H 1QOKA 4V2BA 3MLWH 3ARBD 3QIUA 5FUCE 1A7OH 2FLBT 3ORJA 4JM2D 4UU9B 3CUPA 5CUSL 4PJ5A 5FYLL 2HTKD 3QQ9D 3QJFB 1TQBC 2VYRE 2DBJA 3RFZC 5IVZB 5ISZE 1WIOA 4X6EA 5I1DA 2DQJH 3RVVC 3QUXB 1ZT1B 3CMGA 1CYGA 3TM6A 3M1BB 1T4KB 4FQJL 3CX5K 5BS0D 4GKOA 1J1OL 3DYMA 2BVOB 1OP5K 1UVQB 4WHYG 4NN5B 5CJOH 4ZSOB 3VG0H 3K3QA 2P1YA 5KAQF 3BWAB 3C5ZB 5CWSB 5BVPH 1X5FA 3DRQA 3QDME 4WENB 1Y6KR 3BQUD 3T1WA 3P0VL 1I8LA 3BP5B 3WNLA 2VH5H 4W6XB 1EVUA 4XCYA 1KJ3H 2XKUA 1J7VR 3EZJB 1IC5H 1MF2L 3D39D 5B22A 1BD2E 5I9QB 5F72S 1S9YA 1XGYH 1OCWH 4NGHL 1T21B 3OKKB 4ZXBA 3FT2A 3R1GH 3LAFA 3RA7H 4Z6AT 2AXGB 2PXYC 3E3QC 5IMKB 4WWKA 1VKXB 3BGAA 2B2XH 8FABB 4PJIB 1AHWB 1BP3B 4GG8B 2XY2A 5GGSY 4IOIB 5MEQA 4MA8L 3STZA 5HVHB 5ITBH 4QXTB 3P4OA 1J1PL 2FYYB 4BK4A 1QUNA 1QRKA 3RWEB 5C70A 3MRCB 1KEGH 1FGNH 4QEGA 4R96B 2HFEA 3LKOB 1U91B 4MAUL 2XG5A 5BO1H 1I9JH 4GW4B 2HVJB 1XF4A 4LAJH 4GS7B 5JUEL 2QADB 5JOPE 1U8PB 4KUZL 1ORQB 2V9RA 4Q9BA 4XP5H 1NAMH 1XR8A 3RWDA 3VXMA 4F58L 5LGKA 2DIJA 1YEGL 3K74B 4QCIA 5IB3A 4MXWH 3GSUA 2ZG3A 5ETUA 4HWBH 2D31B 4TNVK 5DRWA 2EICA 1M4KA 4M02A 2FSEB 1YEFL 2YXMA 1RVFL 5DRXB 4U7SA 2FHCA 2ICEB 4W4NA 4LQFH 4A6YL 4JKWA 3L5IA 3SJVD 1IM9D 1F8TL 4F2MA 1CTNA 4Z7VE 2UYLB 2HWZH 5IBTH 3C9NA 2XICA 3G5ZA 4DVRH 3I85A 1KOAA 1PYWA 2P5WB 2P48B 4WUUB 5I1KH 1QFPA 2LU7A 2P8PB 4NBYB 4PJ8A 4Y19E 2Q3AA 1KCVL 2O26U 4M5ZH 4YHML 1NCCH 4OI8A 1D6VH 3D5OF 5IF0A 1JHLL 1XZ0B 4Z0XA 1CU4L 3WO4B 4KKLD 4XPHL 1MJJA 1A7QL 3MGOA 2JJSC 1RK1B 3BE1L 2P43B 2AKRB 4BK5A 4M6OH 3WFCL 2ESVD 5FUOH 3S3SA 5BJTA 5ANMA 5LGJA 3VW3H 5HGBA 1MQKL 5E5MB 5JPNA 2N7AA 2ZUWA 4D2NA 4P4RB 5IIEA 1LK2A 5GZOC 5HHOA 4OZIB 3H8NA 1L7IL 3JWOH 4IMLA 4PG2C 3HRPA 4NQXB 35C8H 3F7RA 4D0DA 5EUKA 4M8VA 4PB0L 1JPGB 4S1DC 4RRPA 1NCAH 4FQIH 2IGFL 2Q87A 2J5LB 2A73A 4JHBA 3ECBB 1SJXA 1C16A 5DD3H 5JW4M 4Y5YA 1TVDA 4HV8A 4LVNB 4MA7H 5E6YA 3RL1A 3V6FB 3G08B 4O02L 2IBZX 5F88B 1RK0B 4X8JB 1T0NA 4JDZA 4POZD 4JHAL 4PTTA 5IEKB 3RAJL 3F58H 2IPTH 4GRWE 5ESAB 2B1AL 3TVMC 4F15B 1Z0NA 2FX9H 4TTDD 3SDAC 2NY6B 3ARDB 1I3UA 3MRIB 3RVXD 4LAQH 3FO2B 1UKQA 5SX5K 4YXKL 3UYPA 4D3CH 1A9EA 4Z78B 1EUUA 4GXVH 1BHGA 2LAGB 3A6BL 2VLJD 5DUBA 4CNIA 1CD1B 3SGJC 1T1ZB 4Q74A 4TOYL 5FF6B 1GZPA 5KOMC 1ZA3B 4NKOB 2Z8SA 1F58L 5GGQH 4PP2B 2DYPB 1AGEA 4LLAA 3TLRA 3NN8A 4NUGH 3WS6C 4EDXA 3TT1H 3HI5L 2YA0A 4NUJB 4DVBB 3BFOA 1LP9E 4JFEA 3BP7A 4PRAB 5DI8B 2AK4B 3CGTA 4TSBL 1KIPB 1UZ6E 1QBMH 3MLSL 4UAOB 3N06B 3HUJF 1YEKH 3GKZA 1FFPB 4HH8A 1CL7H 5DXWA 1N6QH 4J3UA 4HG4K 2R23A 3KPSD 3KAAA 4S1QH 6FABL 2NY1C 3GHEH 2HJFB 5TE7H 1DP0A 2HYMA 2J88L 4MDJA 3PABB 1FLRH 3LS4H 3GUTA 5I71C 1EGJA 4OIIL 1JYXA 5TDNB 4JN1H 1HKLH 5JDJA 5C0CD 4M62H 4NP4L 1WFTA 1YNTA 3SKNA 3ZE1F 1F6AA 2VAAB 1JFQL 3M8OL 4XTRD 1N0XH 4R4FH 3N1PC 5FA3A 3ES6B 2A6KA 4Z76A 4EN3C 3T77B 4GRLA 4GQ9H 1KYOK 3A6CH 3TYFA 2IQAB 1PLGH 5E8DL 3GO1L 5IG7B 5C8JA 3ZKND 5ESVB 2D03L 4BZ2L 1NAKH 3BDBA 2JCCA 3FO9B 3MACH 4UQ2B 4X7FC 1QVOB 3V7AG 3CK0L 4G8GD 4ODVH 4XNQB 1EHAA 5BZDB 3DO7A 4HFWA 5EFIB 4F3FA 2ZPKL 2WBJB 4Y7MA 1JGUH 3LCYA 2HFFA 4M4PA 2VXSH 4OT1H 1Z3GL 5E8NA 3VXQA 1FVCB 3HNVL 1N8ZA 3FO0H 1X6LA 2CR3A 3F12A 4UT6H 5I1LB 4YHOH 4YHZH 2XZAH 2E3VA 2PO6C 1XGPA 4XP1L 2DQTH 4D8PA 1PQZB 2AK1L 3QNXA 4U3CA 3NOIA 4YPGB 5JIKA 1AGFA 5FDWA 4G7VH 3HI6H 3AXLB 4Z7WA 3REVA 3I50H 2K7PA 1NGPL 4LL9A 5EUOB 2CO7B 2A38A 1E6OL 1LNUB 1S9XB 5DC0A 3VD3A 4LCUB 3OJDB 3QUXC 3PV6A 4M00A 5I76B 4DKAA 2QEJA 2Q7NA 2VE6A 4NJAH 3RY5A 4NWTH 5HBBA 5FKPB 3L7EB 5A16B 3PWUA 4NN5C 1R6VA 2UWEA 2WUCL 5TH2A 2NW3B 4CMHB 4FMFA 2ZUSA 1Z5LB 3C5ZC 2YPLB 5HI3C 4NZTL 4X9IA 5ENWB 4HIIA 3VI3F 5GGRA 5SWSB 2IPUK 3I75A 3I02B 5I66A 1VPOL 3BUTA 1QNZH 5CJXC 3ULVC 1DQQB 3EOAA 2VLMD 5F7DB 2FBOJ 4GW1B 1MY7A 4YQXH 4LPUA 2PR4H 1RSFA 4LRIC 4NKQB 1I3GH 5DFVC 4X80H 5BRZB 1Y0LB 3AREB 4KJYA 4TSAL 3WFZA 4KZDH 4GAYA 1JE6A 1CGWA 1AHWC 1S5IL 3MROA 4Q9QH 2VC2L 4EVNB 2VLKB 4UIMB 3RGVD 1QFUL 5E2TL 2R0WH 2Q76A 4FQ2L 1UYWH 3ARWA 2XA8L 4MAYD 5CJQH 1QLEH 1VENA 4WO4A 4HLJA 1UGNA 4C56E 4GS7C 3HE6A 2APXA 2VDNH 3VCLB 1EO7A 5DFTA 3VXNB 2QADC 4NHCL 4TUKL 3L3IA 4P3CL 5CSZA 5EORL 1JNHA 1EHNA 2DLFL 3WS3B 3H3PH 4QKXB 6CGTA 3ULVL 3HB3D 4URTB 1AC6A 2PW1B 4M03A 1T89C 3GI9L 4QY8B 1VFMA 4ZD3H 3TCXA 1DL7L 1I3RB 3BOVA 5JHDE 2BSTA 2WLYA 3WEXB 3OXRB 3HAEB 5AD0A 4AJ0A 1RUKL 1XCTB 3ARFD 3GJEB 1TCRA 3F7VB 5C71A 2H2SD 2BC4B 2R9HC 2DRUA 3B8SA 3T3MF 1J8HB 5HVFB 5DJZA 4ZO6A 3SY0B 3HG1A 5TDOA 1BZ9B 4LHUA 5E1AB 3C5JB 4UDTA 5AUMA 3UBXA 4KK6D 1MCRA 1AKJD 3L7FA 4R3SB 1CD8A 3DUUA 4PREA 1MH5B 4KRPC 4UNTA 2I9LB 1JZ3A 3WO4C 4NQDB 3BKCL 3MNWB 5FCUH 2WANA 2QSVA 1JWSB 2W0FA 4NQCA 4FZEH 4OF7A 2J6EH 2F19L 3L3OA 2D7QA 1QRNB 4ZUVA 5MENB 3FFDB 3J8F7 3MRNA 5TDPA 5MEOA 5HHPA 4NQTA 1OTTD 4QRRB 4UDUA 3G6AA 4G9FB 3HKFA 5K9OA 3DX9B 3T0XA 4XMPL 5IHBA 1A0QL 3VXOA 3KWWA 1FV1B 4LPCA 1PX4A 4JB9H 3D25A 3SGDI 4LASH 3WIIH 1P9MA 2QHRL 3MYZA 5EO1B 3OX8A 1YA5A 5EA0L 3H9HB 2J5LC 4HKZB 1ZGLA 1S78C 3WHE0 5LKNA 2AI0L 4ESKA 1QSZA 1CXEA 5M95B 3I9GL 1KLGA 4ZUUB 4X6CA 3U9PL 4JO4H 4LVNC 4LCWD 1MCLA 1BBJA 4MJID 2OMBA 5GJTL 2XWBB 1SQ2N 5HYSA 5I8CB 5FGSA 5E5UB 1DQJB 1TJHL 3HC3L 4F15C 2A0LD 4JKKA 5CBAA 2A77H 2FECL 4D9QE 5F7LB 1VACA 4DKEH 4PJAF 4U6VH 1G7JA 4XT1C 5FUZH 1KN4H 3MUY1 4PJXB 1FORL 1YYMH 3VFSA 3BO8B 4U05A 4HIJA 3U2SA 4X4YB 2V7NB 2CH8A 4TVSa 3QEQB 4PRDA 1YQ2A 1ZT4B 3DXAA 2BRRL 3T08A 5CS7A 4RX4A 2V2TB 1R5IB 1CFSB 1KPRA 3QJFA 1R24A 5IHLB 3E8UH 5T5NF 3NH7L 5EO0A 3O45B 3MREA 3RDTB 5FYJH 2XA3A 1WFUA 3BRFA 3ULVE 1ZT1A 3U0PA 3O4LB 2PYEA 2XZCL 3M1BA 4PRBB 4K3EL 3OF6A 3X11A 4PUBL 1ITCA 1Q72H 4MWFB 1S8DB 4V1DB 1ZA6B 1DLFL 4HT1L 3G6JA 4U7KA 4L8CB 1RZJC 3GSQA 4UAOC 5B8CB 3CPLB 3MLRL 3DSFH 5B3JE 2WBKA 4PGDA 2OTUB 1MHCA 3HC4H 4UB0H 1EZVY 3P77B 1WUNT 4ZS7L 2C1PB 3BP5A 1DBAL 4JVWA 5DMKA 1GZQB 5C0RH 1CFTA 5C07B 1INDL 1NAMA 4PG9B 1CR9H 3FCTB 1YYLH 5FOJA 1P7KB 3TFKC 4HWBA 3BEWB 4Z7UB 3T0AA 1DSFH 1VKXA 5C0IB 3PP3H 8FABA 3RI5K 2EDFA 5CINH 2D7PA 2H41A 4OLEA 1LO5A 4IOIA 4BQ9A 4GMTH 4L5FL 4K7PX 2FYYA 2H8PB 3U4BH 3U7WL 3ZKQD 1N26A 1FG2A 4PFEA 1I8KA 1EO8H 5DJ8A 1W0VB 3HUJE 5BXFA 4U1MB 1RZJL 2R0ZL 5EZOH 2AJ3B 4F7TA 5SWZD 4Z7NF 3EO9L 3TNMA 1D9KD 4K23L 2Q8AH 2IALB 3BHBB 3GBNH 2Q6WB 2F74B 3IDMA 2EH8H 1YPZB 4GW5A 3K46A 2VITA 2BNQB 4KVCL 4RRPG 5IGXH 3BISA 4PGEA 4L8SB 1A6UH 4QT5B 3TN0D 5E94B 2DTML 4DGVH 2CLRA 1MCCA 4OIBA 1CFNA 1E27B 2R4RL 3MRBB 1E4WL 1UCBL 2K1MA 3SDXB 1MREL 1ZSDA 4OLVH 4XHJD 4PJGE 4HW6A 4L9DA 1IEBA 1SBSL 4LSSL 3IDNB 2IPKA 2QJDA 5T1MB 1NANH 1JIBA 1DBML 4LLWB 3U79A 3I6LD 1FVEB 4DGYH 4WUUA 4QNPF 4M1CC 2IAND 3QCUL 2FBJH 1HEZB 5HHXH 2R0KL 2GI7A 3WMSA 2EXWC 1G7MA 1XZ0A 2YC1B 1TIUA 4MD5B 3V0WL 3FFCA 1S7RA 1A6VH 1QO3A 2X4UA 2X4TB 2NNAB 2J8OA 5EBWB 3MLXH 2HH0H 3V52L 3BIKB 3QG7H 1F3DH 1S7WB 3MV9E 3WUZA 3PP4H 4P4RA 5DT1H 3FQWA 3IFOB 4BFGA 5ICYB 4CMHC 1IEAB 4MS8D 3RL2B 2XWJA 4OD3H 4NQXA 5EOCJ 15C8L 5D71L 4JGMA 4G3YH 1X5GA 5FGCB 2R8SL 2W9LA 1IAII 3K8MA 2F54D 4H8WC 4ODBD 5JW4Q 3TJHD 5KVFL 4IS6B 3QIWD 3V6FA 2BNRD 1XR9B 5F88A 3BSZL 1ZHKA 3VFMB 5IEKA 1G9MC 4RQQB 1Z2KA 1ETZA 2B20A 3EYOA 1X6NA 1MI5B 3SDCD 2Y5TA 1RHHA 4Q58C 2X05A 4PTUB 3ARDA 3MRIA 1A7NH 3MUZ1 5A2FA 4BA8A 3CMOH 4X7EC 4OCYL 3ZDYF 1KELL 2NYYC 4X83A 1UM6L 4FTVB 1KT2A 1GGBL 5IVOA 4BFEA 1TITA 2IBZY 1Q0XL 5TPWL 2X1WL 1KJ2B 1T1ZA 1U6AL 3UTTB 4NKIH 1BVLB 5F9WC 3SKMB 3N50A 4LRNH 4YFDB 4CKVX 5GIRA 4QRTA 3QG6A 3MRGB 1J88A 3B2UC 4X4XB 1WZ1L 1UWGL 3DJ9A 5I1JL 2Y36L 2M8XA 3AVEA 3CDGB 2X4QA 3QEUB 4UUJB 5ALBL 1OGAD 2R4SH 3ZL4H 2XNAB 2YK1L 5CZXD 3T0EB 1QSEB 2W9DL 5HDBF 3U48A 1G9ML 1UM4L 5H2BB 1OAQH 1A3RL 1P84J 2BK8A 5CZVL 1XF3B 5BZWA 5LAXA 4JRYA 3MBEB 1ORSA 5ILTH 1BFOB 3QFJB 5MEPB 4XBGA 1JBJA 1IT9L 1B90A 3BJLA 1N5YH 2H1PH 3V95A 2V5YA 4JO2L 3TO4D 1EFXB 3E0GA 3PDDA 5JQ6H 5HVGB 4G42B 2NXYD 1CLZL 2YUVA 4LSTH 2YZ1A 4JCLA 1J87A 5TQ0L 1JZ7A 1IGYB 3CVHB 1A3LH 5IB1A 2FB4L 2OJZL 4FZ8L 1MJUL 3SGKC 3VFUA 3HNTH 5D70L 3ZKMC 3GKWL 3OKEB 5F44A 43CAB 3WXVH 1QEWA 3OB8A 5IVXA 1MVUB 4O2EB 5JDSA 5ICXA 4X9GA 5D6DC 3FB8B 3B9KB 5J9PA 1O5DT 3QXDA 1I8IA 3BPCA 2FJGB 5J57B 2EIZA 2BNUB 5F97E 3MUGB 1M7IB 3T3ME 4XCCL 1LEKA 1E4KA 3SDDB 1F2QA 4CGTA 2V6HA 3HMWH 1K4CB 2GSGB 2YD8A 1U9KA 4YXLH 4POUB 1JF1A 4CDGC 4MNQE 2ATPA 5F96H 3WYRA 5E2VH 5IQ9A 4MA3B 2C3VB 2A6DB 2F53D 5ADPL 4I4WA 2Z91A 2F5BL 4W68A 2HVKA 1BZQK 4P2RD 3V7AE 5GRWA 5FDYA 4PLJC 2WBJA 3P4NA 4GAJH 4LKCA 5HHNA 2CRIA 1T7WA 1KXQE 3ARZA 4XXDA 4ONFH 3P0YL 3WUWB 5B39B 4PYHA 5ACMA 5I2IB 1S5HA 4Q0XL 1QBLH 3BQUB 4M8QA 1F6LL 3BZFB 1JNNL 2R0LL 2VXVL 4OM0L 5C08B 3VFWB 4X99B 5ID1A 3L3GA 4FQHB 4JPVL 5LJYH 5IEHA 5E6IB 4HKJA 4K7FA 4YPGA 4WU5A 4ZTPL 1DEDA 1NL0L 1EVTC 4WHDA 3PL6B 3QUZC 5E2WL 5INDA 4C83B 1RUQL 1OAUH 4NDMA 4YK4C 4OJFL 5JW3L 1LNUA 4Q9CA 4N8VB 2VZSA 3GSWB 1CGYA 1MNUH 2FATL 3RDTC 3HE7D 2D0FA 2AEQL 1DQDL 4I8DA 5DD6A 4IRJB 4XPGL 4FQCH 1N7ML 1D5IL 1DBKL 2EC9U 4JLRB 3MLTA 5KW9L 3GHBL 1C5BH 3O9WA 4RGNB 5B8CC 1FC1A 2C3WA 3MJ9H 2R2BA 4KJQD 1WIPA 5E9DD 2WAHA 3LKNB 4NO2B 4PJAE 4YUEH 5JOFB 1KGCE 5SWSA 5FO7B 3MV7D 3SKJL 3ULUF 5DEZA 1PZ5B 1IGTA 3EOYG 4LHUG 4X4MA 1Q9OB 3C2AL 3LKRB 4NM4L 3UBXG 1IZKA 2AJZA 1G7IA 2NY4B 1KJVA 3FHQA 1LO3L 3UTZB 3V4UH 1AO7E 3AREA 3PWVB 1INEH 5IFJB 2JCCF 3LKQB 5E99H 2W65B 2A9MH 3SDYL 1IM9B 3QSKB 1CDBA 1A1NA 4I48A 3NACH 4P59L 4WDIB 3OKMA 2DQCL 2MPAH 4P99A 2Y06H 4BUGA 1TQCB 4NQEB 3FT4B 2ENYA 4JY6A 3S37X 1KBGL 1H3XA 2G75A 4P9HH 4Y1AE 3NBNA 5EOQH 4YXHH 2KBGA 3OZ9H 2R2EB 3KYOA 3MV8D 4O58H 3D3VB 4XWOC 5ITFA 4K3HA 1A6TB 3TT3H 2ESVB 1D3CA 4AQ1B 5CEZD 3WLWC 2UUDH 2J6EA 1HQ4A 1FYTB 2WP3O 4OCXH 2V5MA 4Z7WF 5GRJH 3Q1SL 5F9JB 2MFNA 1ODAA 4NO0A 5F7MC 1KF9B 1VFAA 4KVNL 3QJHB 1FDLH 4QOKB 4ZG1A 1GGCL 1VEMA 1XCTA 4E41A 3O2WH 4JREB 1BX2A 1AIFA 4X7CC 5HYSG 1EEUA 1KC5L 1LO4L 3PGDB 3MSPA 5BV7H 2GJ6E 2H2PC 5EBLB 3AMKA 2BHUA 3QO0A 1QRNE 4Y2DC 3W11C 3V0AC 1HYRC 2UWEF 3QUYB 4PJ9D 3EO1B 4KMTL 2KH2B 1LDPH 2BOCB 2OP4L 3FMGH 1WWBX 2P8LB 1NCNA 4OCWH 5DD5H 1NFDB 1KPVB 5C0AE 4LKXA 3GJFH 5F3HB 4QYOA 5F8QC 1CL7I 2AS5M 4AG4L 3TPUA 4HUUA 3WFHA 3PJSB 3BKJL 3GB7A 4PJ5E 1YEIL 1BOGB 4JFDD 4P46C 4PLKD 1RIVL 4OGZA 4YDJA 1AR1C 3UPAA 5GJSL 2ZCKL 3FOMA 3HFML 1ED3B 5EBGA 1T66D 4PRPD 3MMEB 1W0WB 4TYUA 3QA3A 4DZBA 1RY7B 1U8QB 3DX7B 4YO0B 3F62A 4OFYD 2AXFB 2ERJB 4Y4FA 2BVQB 1CE6A 4FFYL 3TA3D 4KKNA 5CEXB 1OAYH 3U4EA 1GXEA 3Q6GL 1U41A 1FIEA 5GGRY 4PJXE 1QFWM 1T20B 4Y16D 3S35L 4PV9B 2MTPA 1FAKT 3HI1B 1HHJB 4IOFC 1YEHH 4HDIA 1XFPA 4TQEH 3O3EA 5H35B 1DQJA 5FM4A 3H9YA 4FOMA 1A1MA 1MFDH 3H0TA 4CN1A 2WUBH 2EDKA 5CP7A 5T3XD 2MSPA 3NIFF 4HXAL 3RTQA 4CVZA 1JNJA 3BKYL 4MJ6A 1MWAB 1WBXB 1Q0YL 3DV6A 4Z8FL 4G6MH 5K33A 4HEPG 4MMXC 3KPSB 5J12B 1LILA 3ZSSA 5IV2A 3OHXA 3ZE0F 1H3GA 2A74A 3DIFA 3JWDH 3QEQA 3C08L 3GMMA 2FX8L 1XF5A 2VZ3A 1UM5L 4LBEB 5T5FH 4EQ3A 1HNFA 3LRGA 4GBXD 1OD7A 3UCRA 3VXME 4R9HA 1JTTA 1MLBA 2KDGA 4OLXL 3WHXB 5I1HH 3OG4B 1S8DA 4V1DA 4JG1H 2W92A 1P4BL 4TSCH 3H9SD 3T0EC 1QLRA 3FN0H 4YAQB 4XC1H 1A6PA 1GAFL 3L6FB 1FC2D 3P77A 3MBEC 2C1PA 3ZDYE 3GMRB 3WSQL 1HSBB 1EEYA 5C07A 4G6AC 1GCFA 3TBVA 4G8GB 1WVZA 3KLSA 5D1QD 2ZSVA 3QQ3A 1CICD 3H9ZA 2CUIA 2NLJB 1KJ2L 3VGHA 1VFBA 1E6JH 2E7LC 3EDJA 1BM3H 2CJUL 2KPNA 1DFBH 4LNRB 4K94H 4QRSA 3IU4L 1GIGH 3D85B 1NDMA 3JV4B 4X6CF 5JQHC 2G5BB 3C60D 1NCBH 1TTGA 5HHMD 3B9KC 3TBTA 1OW0C 2XFXA 5ANME 1GPOL 5HDBE 1FL6B 1TJGL 3V0VB 1OSPL 1DJSA 1W0VA 4WJ5A 1KTLB 4JEGB 3ULUL 1WBZB 3SDXE 3MXWL 4FMKA 1HE7A 4K8RD 3SDDC 2AJ3A 2ZSWA 2EDWA 3BIAX 2Q6WA 2NY0D 5HHOE 3QYCA 3DVGB 4RFOH 5LXGL 3V6OA 3MCKB 2GTZA 4F57H 3QQ9C 4LSRL 1LO2L 1T83C 2F9BT 5I75C 5E00B 4K7PY 5F1NA 1X5LA 5E94A 3F7YA 1FNGB 1U93B 4C59B 4HH9A 1R5WB 4EOWH 2E7HA 1S7SB 2Q7YB 1R3JA 4OKVA 3EYQD 1UWEH 4HUVB 1OSZA 3CVHL 4LIQL 2ZJSH 3QNYA 5FGBA 4QF1B 3IDNA 4X7DC 4LLWA 1V7NH 4BH8B 3ROLA 1F90L 3BQUC 3KS0J 4LSPL 4OLWH 4DEPB 2IBBA 2NX5A 3JV0A 5KVEL 4WUKL 1QLFA 5E6IC 1L0YA 5DFWH 4OSUH 4AMKL 1OTUC 2YPKA 2OR7A 5IR1B 3S9DB 2AXJA 2B4CL 5LBSH 2YC1A 3PL6C 2W9EL 2CSPA 4XPTH 5GS0C 5DLML 4NYLA 1UB5B 5A2LH 5C0EA 1GC1C 5F9OH 4WEBL 3QPXH 5E0QA 1L0XA 4OBRA 3WFBH 4R6UA 5CBEB 1V05A 3GIZL 3ZYZA 3RGVB 2EXYC 1KIQB 5T1DL 4Q6YA 2FWOA 4IRJC 2XT1B 2AJXL 4LF3A 4P5TB 4UINL 4JFEE 3VD7A 5JZ7C 1A14L 3LSOA 3QDJD 5DVMA 3O8XD 5B38B 1IEAA 4RGNC 3RL2A 3SO5A 2QBWA 1TETL 4DK6A 1U3YA 2NY2D 3N1GC 4M7LH 5JA9A 4IDLA 4OD2B 4YR6A 1A5FH 2EZ0C 3EBAA 3BIBX 2NY4C 3GMPA 1RMFH 4RBPK 1BVZA 4R7DB 1P4IH 5GZND 1D5ZA 5IOPA 4FG6D 5GS0L 1XT5A 5CJ5A 2NZ9D 1GC1L 3DPBA 2X2YA 4PB9H 4ZOBA 3RWGB 4F7EB 1NC2D 1MI5A 3KDMB 2ZOLA 4WRLA 3VD9A 3ET9F 2EYSA 3X12A 3GGWA 4MLIA 2X10A 4X0KA 1AGDA 1DCLA 4WW1B 3EHBC 3UTSA 4P2OD 2YD3A 4HX1B 2YD1A 3T4AB 1KN2H 4CN6A 4ZNCD 3ULUE 1U8NA 3NCEB 2X4SB 3OAZH 3FHAA 2YRPA 4ZS6C 4ALAL 5D9SB 3QQNA 2I5YL 1HI6A 5HGDB 5L88H 1PVHA 3MLUL 4NRXA 1HH9B 3EYVA 3WD5H 1CLOL 4EXPX 4X4XA 5ISZD 3QNZB 3KR3L 2JCCE 4HUKB 3BP6A 3IFPB 3CDGA 1OF2B 1MCOH 1G0YR 4H26A 1YQVH 1IGJA 4WGWB 1IAIL 2HT3D 5CD3B 3QHFL 4QTIL 4JREC 5JORA 4JRXD 4LIQE 3V2AR 3T2QA 3SKOB 3O3AB 3WKMH 2F58H 2JB5H 3BVNA 2Z0BA 3KYNB 3QUYC 3ZMRA 3CFDA 3MODH 5KSVA 2X4PA 5AZEL 3ZTNL 5K59E 4RMUA 4QRPA 5F1SA 5TJWK 3NFSH 5DA4A 1BD2D 1P84K 3L3KB 4K3DL 5CCKH 1FBIL 3AMLA 4I2XB 5EZJB 4BSWB 5J4MA 3TIDB 1IGYA 1DUYA 3TPKA 4NO5A 4Z7WE 4CVUA 1JWMB 2FO4A 1EJOL 3OKEA 4WI9A 3GM0A 2EO9A 5LVEA 4P57B 4MQ7A 1A22B 4MD4B 1IQWH 1U92B 3VH8B 1EERB 3O3BA 2JTDA 1PD6A 4N0UB 2J8UA 1M7IA 4XWGH 5JIPA 3ARBA 2P46B 1ZTXL 3RNQB 5GQBA 2FX7L 4JM2A 1DBBL 1TZHA 1KEML 1PY9A 3EDDA 5FV2A 2YUWA 4NQSB 2ERJC 4IRSB 4LEOA 4EI5B 4ELMB 2Z93B 1ZV5A 3AY4A 5JOPD 1M6OB 4LK4A 3EJZC 4MA3A 5EWIL 4JCMA 4TNWF 4F7MA 3HZMA 1NEZB 2YPVL 4PRHB 3GEWB 5BS0A 2JJWA 5FV1L 1FIGL 5C2BH 3U30B 3L1OL 2VOTA 2VMFA 3IVKA 4XH2B 4LSUH 3TCLA 4N9GA 2Z8WC 1KENL 3BPLB 3UC0L 4F37K 1D6EB 3GBMH 5C6TH 3BUYA 4PY7B 3VG0L 5CJOL 1HSAA 3MJ9A 2DJSA 1U3HB 4RNRB 1NJ9B 3GSNL 3ZE2E 1PEWA 3D39A 1OP3H 2FGWH 5K9QI 1RURL 2XKSA 4MZ3A 1OM3H 3X3FL 1B2WL 1C7TA 1R3LA 2DQFA 5DQ9A 5IW1B 5A1AA 2OK0L 3OKDB 5AEAA 4KY1L 1RJLA 1IC5L 5GSVB 2VDKH 4JAMA 4KDTC 5D72H 1XGYL 4KGJA 2AW2A 4XGZB 5TE4L 5EB9A 1OT1A 4P9MH 3RA7L 3DYOA 1IGMH 1UENA 2IF7A 3FZUC 5J6HB 4YHPB 5FYLD 1EMTH 1KXVC 2VR4A 2FHBA 4LVHB 1JI2A 4X5XB 1IC1A 3V9FA 3EFDH 2DQGH 1RZKC 4XI5C 4PRNA 1KEGL 1KCKA 4HBCH 2VIRA 5IVXF 3GMNB 3FQXB 3MO1A 4KDWA 3NIFE 5KVDH 2VDPH 3LKNA 1MCHA 2I9TB 3I2CH 3G5XA 1O7SA 1INQB 1EDQA 4WTWA 1WEJL 1MWAL 4LLDB 4YC2C 3ZE0E 3HPJB 4QRQA 2CRZA 1EXUA 3IDJB 3G5VA 3TP4A 1NBZA 4K2UH 4MXWL 3U4AA 5FYKU 2BVYA 4ZODA 5IFJA 5C0GA 4PGCB 3GRWH 3C6SB 4MCYA 3SJVA 1DLHB 2ATKB 2ARWA 3DHMA 1IM9A 3WKNA 5I1AA 3B6SA 2VR5A 5J1TC 4XAWH 3RUGA 4NQCE 2X41A 2BRQA 1I7TA 1RPQA 2P5EB 2IANB 5AZ2H 3JV6B 3RVVD 4F9LA 4X9BA 1CF8H 3LPWA 5GGUA 4DVRL 3O6FB 2UZXB 2YWZA 4JFPA 1XAUA 4LPXA 5AYQA 1QA9B 1MFBH 5CP3H 3Q48A 1JGLH 1YMMD 1NCCL 5IB4A 1N2RB 2O61B 4KJPD 3DGGA 4R8WH 1LEIB 1J1XL 3FB6A 5E1HB 1A21A 5FGRA 4ZUWA 4S10A 3PWPB 3GJFA 3ARYA 1WZLA 3MXVH 5DUML 1QKZH 4M3KB 5TFSH 5IJKC 1T22B 3OR7A 1U8IB 3AS0A 2WK2A 1DE4B 1WBYB 3O2DL 1UJ3B 5EUOF 3VDAA 3U46B 3VW3L 1RJYB 3O6LL 1QQDB 1AGBA 1FCCA 4LLYA 2EDHA 2Y07H 3FB7B 5CMAA 2A6IA 3V5HB 5IT2L 4RFEB 3CXHJ 4HPOL 4I18A 5FO9A 4C4KT 2K3TA 4Y8AA 5DMIL 3RIAK 3V6ZA 3WDHA 5KTEH 4DEPC 35C8L 2F54B 4FA8A 3LZFL 3QDGD 1DBJL 2QKIA 2BOCA 4FQIL 1F00I 3RX8A 2CMRL 4P2QB 5HPMB 3O0RH 5ACLA 5I73B 1W72L 3QIWB 5C0BB 4GMSL 1FE8L 4XVTH 2AV7B 5DD3L 1NFKA 4WW2B 3GSXB 3QUMB 4JGUA 2DIBA 5DSCA 1H0DB 2OL3H 3DXAE 5IJVB 5CZKA 3SDCB 1MHEA 3PJSA 5BVJA 4JFZL 1T03H 1G6RB 2XTJE 2IPTL 3HA0A 5C09D 1BVKA 1FPTL 4P5TC 3EO0B 1BWWA 5D2NB 1ED3A 2PYEE 3CLEH 4OFIA 3BXNB 4LAQL 5DEFB 4ODSL 4H88H 2VLJA 3G6DL 4RMRA 4L1DA 2XG4A 4D3CL 2YWYA 4E5XA 3G6JE 4GXVL 2V9TA 4KQ4H 3TV3H 2WIMA 5IWLA 2VKXA 1I4FA 2EDRA 2BVQA 4PR5B 3UTQA 4RMWA 4NSKB 1PJ9A 5GGQL 3V8OA 1SM3H 5ACZA 4ETQB 3EOTL 4NRZB 1T20A 3QUMH 1U95A 1NFIB 4BZYA 1ONQA 3EYFB 1K8DA 5C6PB 2FIKB 1A4KA 4LPTA 5I1EH 2H2SC 5J11C 1ZLWK 5K9QG 1G6RH 3TH4T 1YN6B 2MOVA 4LFHG 2WQRA 4CRPA 5C3TA 3HRZB 3QIBC 1DN0B 4JKMA 1BBDH 3AAZB 4WY7H 1TZGL 4HK0B 3VDBA 4JFFB 4HIHA 5CSGA 3KPSA 1T6VN 2D9CA 4EI6A 4KZEH 2BFVL 5JR1L 4X6DE 1MJ7L 4Y4HC 4YX2L 3S34H 1MAML 4YPJA 5HYJB 2NXYB 5GXBB 4CW1A 5L6YH 5GZOD 4S1QL 3KPOB 5JO5B 3DGCR 4Z77A 4X4ZA 3W5MA 4GG6B 4XVUC 1NLDH 5C0CA 2DAVA 1A6AB 4S1DD 4FP8H 3KLHC 4GRMA 3CFCL 1SVCP 3VGFA 3CCHA 1Y18B 4RISL 2CK0H 4EIGB 1S3KL 2C7UB 2ID5A 2VLRB 4NOFA 1TNMA 4F33B 2YUZA 3Q5TA 4R4FL 1LK3L 5EU6B 4YAQA 4KI5C 1OP5H 5FHAL 2Y5EA 1AXTH 2QQNL 1I7UA 5L7XH 1M71B 4L8BB 2EDXA 2Y1VA 1IGCH 4YDIL 3VRJB 1YECL 3NIGF 5IFAH 1VGEL 4XBPB 3SBWC 3NCYS 4GQ9L 3TVMD 3A6CL 1WTGT 1ZXQA 1PLGL 4YDLB 2F53B 4W70A 1JPSH 5L8LB 4G8GA 3BX7C 3MRKA 3SDAD 2DQEH 4XZUA 1WLHA 4TULH 3MACL 3E6HB 2XQBH 2XRAL 4Z5RB 2E9JA 1WICA 1T2QL 4ODVL 5AYUH 1JL8A 1JTPA 4KRNA 1PKQA 3H7BB 3ILPB 3K8LA 2X1OA 2CIIB 1C08B 3FFCE 4WNQA 2IQ9L 2VXSL 3JV4A 2WM0A 3ROOB 4JPKH 1YEDB 3ZT6A 4NC0B 4YHOL 5HJ3A 4YHZL 4HMEA 1FNSH 2CLVA 2HLAB 3IRPX 5FCSH 3RJQB 3GSRA 4C56D 4DCQB 1S7VA 4ZPTA 1HKFA 1FFQA 3BPNB 2IWGA 4UV7L 4Z0BH 4IRSC 4EI5C 1KPUB 3LPGA 2IG2L 1A4JA 3MCKA 3AM8C 3GSVA 3HI6L 1U8MB 4X98A 3QHTC 5D1XD 4B7IA 3MJ8A 4M48H 4MXVE 3L5HA 3HE7B 4NCC1 1XGUB 2Y6SC 5I30H 3T1FA 3UTPE 2BCKB 25C8H 3VXRD 4N0FB 3LN4B 3P4MA 3U30C 2NY1D 5K9KB 3RPKA 1JZ5A 4QXGL 4L4VB 1RD6A 4FHBD 3BPLC 4G6KL 4NWTL 3NA4A 1FH5H 1C1EL 5JIHA 1SY6H 3ALXA 3ZT5A 3MV7B 2GUOA 3RY6A 4E0RA 3X3GH 1W8OA 1LQSR 1U3HC 4G7YH 4JQIH 5H94A 5DUPH 3OBAA 3L5JA 2AJVH 1G7PA 4ZFFA 2X70B 3P11L 1TLKA 4OZHA 2R39A 5EULV 4D0BA 3PGFL 5CHNB 5GGTL 4PJDA 1MAJA 3QUKA 2PR4L 4EN3D 3REWB 3RWHA 4OGAC 1U8KB 2I07A 2ED9A 4NZUH 3PWNB 4WI5A 4BUHA 1I3GL 1ZHNB 4Q9RL 1TVBA 1T80A 3DROB 3KXFB 3JVGC 3ARVA 3ME0A 3HLAA 2VWEC 1MCDA 1AD0A 4MAYA 4F7PB 4K55A 2HP4A 3MJ6A 2QV2A 3TJEH 1P6AB 3R8BB 3FJTA 1UYWL 5E56A 4WVRA 3JBG7 4UMGA 1QLEL 2LVCA 1K8IA 3MV8B 1IVLA 1FZJA 4RWYH 3OKOA 5DD1H 3KPQB 2GY5A 4DOHB 5DR5H 1T6WA 2C1OB 5D5MB 3ESUF 3BW9A 2R69H 2PO6D 4JRYE 1J0JA 3H3PL 4F9PC 4J1UB 1NC4B 4R7DA 3DETC 4IDJH 1GYAA 1KLUA 2DQIH 1RQ5A 1L6XA 5HY9A 3IT8D 4ZD3L 3ARFA 3O41B 4OB5H 1JK8B 3S6CA 3MRHB 5F1IA 1CXLA 1NCUA 4MHHI 3VMNA 4U1NB 1MQ8A 4N5ED 1A47A 4RIRB 3W0WB 2YMXH 4S1SH 4APQB 1CT8A 4D9QD 1AKJA 3QUXD 5AWNH 3KPRB 5CLWA 3O6FC 5FM5M 5F3BA 2APBA 1YZZA 1OB1A 1NUDA 2HJLA 2A6JA 3EYUL 4L4TB 1NKRA 5CGMA 1EH9A 5HI3D 3C5ZD 4Z18A 5CEZH 4KROC 4P23B 3G5YB 3FB5A 1A7RL 3VFNA 2BX5A 4FFZL 4NHUB 5ABDE 4JFDB 4XPAH 4X7SH 3SE9H 4FZEL 3FT3A 3CC5A 1UJ3C 3ULVD 1DUZB 3IFPA 1OF2A 4Y5XB 3HMXH 3TNNB 5TQ2H 4LCYA 2FJFA 3VXUA 4MS8C 5HDQH 2ZNWA 2IBGA 4PRPB 3TBSA 4L29B 1WV7T 5DFVD 1CGVA 1E4XI 4NNYB 5IROC 4ODUB 2VISB 3O3AA 1CQYA 3LS5H 5JHLH 3FOLB 3ZZ1A 4GUPA 2P7TA 1OPGH 1OAZL 1R3IL 3CSPA 3X14B 3TO2B 4XP9H 3SCMB 1S7UA 3HZKA 4G43A 4LPVA 5J1SC 3H3KA 3MRLB 1WC7A 5I73C 4M6MH 4U31A 4BM7A 4LCWA 4GSDH 5EZJA 4MJIA 4WW2C 3CFKA 4M6AA 3UJIL 3OAUL 1AFVH 4QHNB 3MA7B 4XNXH 5T1KD 2FL5A 4JO4L 2QADD 4M61A 4ELME 4EBQL 2RBLA 5F71A 2ZCLH 2H45A 1LE9A 3IXTA 3VWKD 2G2RA 4ZYKB 5C0JA 2DBLH 5FO8B 3MRQA 3BKMH 4N0UA 5D2NC 1JUFA 4FQXD 1N4XL 5LWYH 2X4RA 2NCMA 2P47B 3N9GL 2W07A 4XX1G 1YJDH 3GFUA 3U6RA 3NCBB 2XN9A 2Z4QA 2O5ZH 1VADB 3W2DL 4LEXL 2R9HD 2XWTB 2DLEA 2X9WA 3IS0X 4ODXA 3L3HB 5IHUH 5I74C 2PTTB 1QHOA 1Q1JH 3DRTB 2PUQT 4U1HA 1SYVB 4X4ME 5ICZA 2VRAA 5TGBA 2GITA 4KRPD 5CZXC 4M1DH 5BW7C 5J6GA 4JG0H 3OJMB 3D69B 3QXWA 5E8PB 3LH2H 3IFNL 4XCEB 3ZT7A 1Q72L 4JPWL 2AABL 4PY7A 4J2XA 5T3XH 4OQTH 1ZANL 2ADGB 2X42A 4OF5A 1MFEL 3WXWH 1B9ZA 1F6FB 4KHXH 3HC4L 3QXVA 1A9BA 5D1QB 1ZLSH 1S7XA 1L4IA 5M7QA 1G7LB 2RCSH 1OAKH 3LKSA 5C0RL 1CZ8H 1CR9L 4ONHB 2JE8A 4KJWD 1YYLL 3MYJB 5D7KE 1N59B 4O2CA 2DM4A 4XGZA 4AM0B 4JR9H 5A3IC 1QR1B 4M93B 1FHGA 5I1IL 3GRWA 4Y8DC 3V5KA 4YHPA 3CH1B 3EFFB 4KI1A 3SE3A 2DOCA 4U49A 2MCPL 1S78D 5HGHB 2W0LA 4HPYH 5FFLA 3NABL 4WTZA 2PYFB 3V4VH 1H5BA 1KTRL 2O5XH 4UTAL 3RZCB 2YHGA 5SWZA 4PV8B 3PWJB 1AQDA 1D9KA 1IAMA 4LLVB 4N0YH 4NZRH 5DRNA 3RWFA 4FQLL 2NR6C 4QHMB 4W4OC 5EZOL 4KAQL 5CP3A 4E41E 1JN6B 4HUXA 2B1HL 4LOUC 3TN0A 2J8UF 1W2KT 2O93L 4YDLC 5J13C 3KYMA 1FZOB 1IGFH 4JM2F 4ZPVA 4LLUA 1SJEA 5IGXL 3VG9B 5CGYC 5D7JD 1NGYA 3FONA 3VFPB 3GIVA 3UZQA 1CG9A 2XYCA 4EUPB 1JWUA 1T3FA 4X8XA 2CXKA 1MRCH 1DLHA 1JRHH 2RIKA 5FEBA 1FZMB 2H6PA 1T7YA 4OLVL 5MP6H 5I8OH 2ENSA 1FL5A 2DYPD 4BZ1H 3AU1A 4X9FA 3S97C 4PGJA 3B3IB 3MTRA 5CKAA 3VE0B 2IANA 4K8RH 4G6FD 1CD0A 1FNHA 2AK4D 1P69B 2D7TH 1OD9A 1FO0H 2VQ1B 3NIGE 3HS0B 5DWUH 4GOSA 4HJGA 1QA9A 3BPNC 3I6GB 3DNKA 5HHXL 3A67H 3QHZH 4HKXB 2OTWA 3NCYP 3ARGC 3QQ4A 3TBYA 3R06B 5IHZB 4ZFZB 4R0LA 1P5VA 1A6VL 4OZFB 3RWJB 4GLRH 5L2KA 1CK0H 2OL3A 1DE4A 2V17L 3OKNB 2X4OA 4LLQB 3QG7L 1JMXA 4U1IB 4GKZB 1QQDA 4HUWB 4PJEB 3PQYB 1UEMA 3MA9L 5FYJE 3TFKD 1FFNB 2VL5A 1ND0B 3PP4L 3IU3B 5ECJE 1K2DA 5DT1L 5L9DH 3VFTB 1UQSA 2AV1A 1AI1H 1DR9A 3CFJB 3MRPB 5DVKA 2F54A 3MRDA 4PJ7A 3MUJA 2VDOH 5SV3A 2L4OA 3DYPA 4EQ2A 3LHPH 2IAMD 3QIWA 4RGOH 2BNRA 5CGTA 5D2NE 3MQIA 4K3GA 4P5MA 3BRGC 4YZFF 3QUMA 5DK2B 4UT7H 2MKWA 1F2XK 1MCSA 1U8LA 1SEQL 1MCWM 4PJHE 3MLVH 1M7DA 3IDXH 5IJVA 3SDCA 2DQUL 1G6RA 1F4YH 4LCCB 1X7QB 5D7LA 2Y23A 2DQDH 2YSSA 4ODWA 3IDIA 3QPQC 1X4XA 4NPYB 3EO0A 1F3JA 3D18A 4YBQC 4UIKL 4YDVA 4AEIL 4P2OB 4HAFA 1KJMB 4EEEA 5GRZA 3BXNA 1MAKA 1HHGB 2BSRB 3CMOL 3RUGF 2BVTA 2UVFA 4L3CA 4KFZC 1OAXL 5DO2C 3VWJC 4ZQKB 1MHPL 3KLDA 1REIA 1P7QB 5KSUB 3RKPA 3DVFA 2R1WB 4MNQD 5DJ6A 2DWDA 5JOEA 2FZ3B 1LVEA 3P9LA 4JM4L 5K93A 2EE6A 4CN4A 1S9VA 4HCRH 1C12A 1IBGH 3QBTB 5ISZB 2GYSA 4LSVH 2GK0B 1UXSB 2M2DA 4M1CD 1KCUL 3BDYH 1QSFB 1OGAA 4WFEE 3BH8B 3LQAH 4CU6A 1IQDB 3GMQB 5DEGA 2O5YL 5E5RB 3DUSA 1DN0A 1T0MA 1VGKB 3IGAB 3QDMB 3BZEB 4R7NB 4P3DB 4APQC 4ZFOA 4OZGA 1Z0MA 1EJ6A 1H15B 4N9OB 4XAKE 4ORGA 3WL9A 4D0CB 5KSAB 2ZUUA 2VLRE 1Q9WA 5EIVA 5F89B 4MQTB 1I9RH 3TO4A 4R2GB 1BD2B 4X6BB 1KCSL 3OL2A 3KHOA 3B2VL 1D5XB 4ZOCA 2H1PL 3NCJH 4O5LL 3EJJX 32C2B 2ADFH 5DK0A 2YPLD 5JQ6L 2H26A 1D5MA 4GG6A 4P23C 3T2NL 4BSVB 4LSTL 2NPLX 3LDBB 4OM1L 4C4KO 1H3WM 4HIEA 3V6OE 1FCGA 4KH2A 3DBXA 3HNTL 3PXHA 4JE4B 3QFDA 5KOVC 5ID0A 5DJCB 2E5EA 4HHAA 4HUMB 1T5XB 3X13B 1S7QB 4CMMB 1RJZA 5BRZD 4KK5D 1MRDL 3QXUA 3MRRB 3CDYA 2YUXA 4KXZH 1KGCD 1VFUA 2VLKD 1U8HA 2NY3B 5JNYB 3SCMC 2F53A 3OKLB 1R5VB 4FQQB 3WIFB 4YXLL 5DHVB 1PG7X 3OXSA 5F96L 3JTSB 3UPRB 1CQKA 5I1CH 4P2RA 4RAVA 1JGEB 2NX5E 2SEBA 3E6HA 5C3LD 2G9HA 5L8JB 2NYYD 2CKBB 4K3JL 5GRUH 1G1CA 1SVZA 3UJJH 2ADJB 4OCSL 3VJ6B 3MLYH 1K3ZA 5IESH 1SY6A 1DN2A 4Z7VB 4FN0A 4H1LG 1DQMH 4WHTA 1QBLL 1Q94A 1I9EA 3S96B 3B2UD 3RVWC 2H9GB 4Y19B 2Q8BH 3IXAA 5F6HI 3UZVB 4DCQA 4FNLH 3QDAA 3BESR 3ZTJH 5JMOC 5FECA 5EZIH 3G04B 3K4ZA 1J8HD 3E1F1 1N5AA 1OAUL 3HE7A 3NPSC 4LDLB 1IFHH 1OOAA 1JYNA 4L9LB 3QWOB 5CILL 3MNVB 4H1LB 4XNZB 3DMMB 4I0PB 3KJ4B 4LCIH 3L9RA 5ADOH 5J89A 1BECA 2P24B 1EFQA 4MA1B 1N0LA 4NQDD 4FQCL 5E9DA 3L5XL 1CDCA 1CFVH 1C5BL 1BFSA 1NH6A 3MV7A 3ZKMD 4PJCA 5CIPH 4ZAKB 2JF1A 2J3SA 3V8CA 1QRND 2Z31B 5D7IA 4EXKA 3KJ6H 3WJJA 4KK8C 7CGTA 1BGXH 5MEND 2WV3A 1T1XA 4NQVB 2WLZA 3TBWB 3IDGA 4R90H 4G9FD 4PP1C 4TNWK 4KKBC 4JO1H 3HZYA 1HCVA 3UTSE 1MCJA 2VDML 3NIDE 3OPZH 4H25A 1ZVHA 3PWNA 4XPFH 5CUSH 5C0AD 4K07A 4M93C 4S0SD 5FYLH 4GRWB 4HS8H 4J3XA 5E4IA 3PDOA 1XGRB 2CIKB 1I7ZB 3FTGA 2ICWB 1YMHB 4Q6IB 5HGAB 1UB6A 1RZFL 1Y6MR 5BCAA 4IM8A 2OCFD 3RZCC 4MB3A 1AJ7H 4NN6B 2VDRL 2LFGA 2OSLA 2WIIB 1A6WH 1CXKA 3P0VH 5EOQL 3S7GA 3OZ9L 5BMFH 3RKDC 4O58L 4TPRH 1T5WB 4XHQA 3TT3L 4RZCB 1MF2H 3VG9C 1HQRB 5DJDB 1HH6A 43C9B 4PGZA 5JXEC 1QBBA 4NGHH 4MCZB 4OCXL 4QRPE 1IAOA 4MNGA 4FXGB 3HMXA 3QUZD 1NGWA 3NFNB 4NOBA 4PJFA 4PJBA 5ESQA 4GKNA 1K5NA 4ZXBD 1HK6A 4A6YB 4JJ5B 3BYYA 1JPTL 4MA8H 3CSBA 2HJKB 3RDTD 4PJ9A 3O4LD 4I5BB 4AYFA 4MAUH 4J23A 3NZ8B 5E08L 5I0DA 1ZE3C 2NZIA 5F7YC 4W6WB 5JUEH 3FMGL 2J8UE 5DRZB 2QQKH 1KLFA 3ZYIA 1HXMA 4KUZH 5CSBA 2QR0A 1UXWB 5C7XL 3G5YA 4Y4KB 5D6CB 5DVOA 4F58H 1YEGH 5JPMB 4OZHF 1CVSC 4PJDF 3BJ91 2EEDA 4Y5XA 2DJ4A 4R4BA 2Y7QA 1ADQL 5E2UL 1YEFH 5BS0E 5D7SH 2HKHH 4L29A 4JO3H 4OLYL 4ODUA 3LEXA 4ONOA 3FO1A 5GSRB 2BMKA 4OFYA 5EU7C 1BZ7A 1NMBL 3HCVA 1A7PL 2CXGA 3TA3A 3MRJA 5IM7B 1EBAA 3WNNA 1F11B 1NBVL 3N1QC 3GMLB 2WINA 5CD5C 4S2SA 1JYWA 4Y16A 4YHMH 3D2UD 5I8EA 2R1YB 1FJ1B 1LE5A 1JHLH 3KPPA 1CLYH 4I13B 1MOEA 1KCRH 1CU4H 2EYTA 3S4SB 4QXUL 4XPHH 3TESA 1A7QH 3BE1H 3MFFB 4JANB 4JPIA 2M26A 4XWOD 1QPPA 1V3KA 3WFCH 3K1DA 1DDHB 5BQ7A 2BNQD 4J6RL 4TQEL 4DAGH 3E6FB 2E9BA 1MQKH 4ZYKA 4XCFH 4OQTA 3WLWD 4L3EE 3LN5B 2BVUA 4R26H 1HILB 2WUBL 3BD3A 4FXKA 2WQ8A 4G6ML 3MGAA 1L7IH 5FUCC 5KN5B 5EU3B 3QWRD 1G7HA 3VXPB 2HKFL 3C8HA 4XX1E 5DJAA 5CJBA 4HEME 3UAJC 3ZDXF 1IKNA 1GHFH 4CDHA 2IGFH 4KHTL 2H2PD 2YS4A 4GBXA 4JDVA 1AXSB 4YZFE 4Y2DD 1E4XL 4LSQH 5T5FL 1KB9K 4IHOA 4OCRL 5KS9A 3H9SA 4O02H 4IRZL 3MRFA 5I1HL 1J86A 1FL3B 3RAJH 4JG1L 4POYA 2EYRB 1MIEH 2B1AH 3IF1A 3IFLL 3FN0L 1BQHG 4KRMB 2COQA 2R1XB 5EIIB 2YRZA 4CBPA 3PIQA 2BHZA 4P46D 4JKPH 3RUGE 5KSAC 5EU4B 2UY7A 4R2GC 1G7LA 4JQXC 1AR1D 3CIQA 1CICA 5MHSD 4ONHA 3VXTB 3QZWB 3WN5A 3A6BH 1FRGH 4HF5L 1GSMA 3BDXA 5INCB 2WZPD 3IJYA 3VFOA 2IH3A 3C2SA 2ZUYA 2ADIB 5FAAA 1F58H 1KG0B 1T1YA 5C9JA 5HHVL 3C60A 4QTHA 1U8JA 3CXDH 4QHKI 4RA3A 4HGWA 1NDGA 3EFFA 3HI5H 1OHQA 4YHKL 4K94L 4KK9D 2JK5B 1GIGL 1P53A 2ITCB 2PYFA 4XXCC 2B7DT 5IW6A 1E28B 4ISVA 3BN3B 4TSBH 4JFED 2ZZUT 3F65A 1OWWA 4PBVC 5DC9B 4C56B 3ZHLA 4HS3A 2GIYA 3MLSH 1MLCB 1NSNL 4IOFD 1FO0A 4QHMA 1JGDB 2GSIB 1WZKA 4TVPD 5TE6L 5KVGH 3QH3B 2NY3C 4LLMB 2F8VA 5D1XB 5DJYA 2XOTA 4RFOL 1YNKH 1P2CA 1M05B 4F80A 2PETA 3RNKB 1JV5B 3RGHA 4E42B 1SJHA 1T7VA 4FTVD 4G9DB 5CKGA 1NCTA 2X1QA 4X6FB 5JHDB 4OIIH 5DS8A 5J06A 3BGMB 3JUZA 4MXQC 3VXSA 1CDJA 1UWEL 5D2LA 1NGXA 3P4LA 3IJHA 4NP4H 1RZGB 2DI9A 2Z35B 3THMH 2D3VA 1UZ8B 1JFQH 3M8OH 1I85C 1EX0A 5DQJA 4H5SA 5IB2B 1ZHLB 1EO5A 3R0NA 4AIZA 5KZCD 4YEEA 2Z8VC 3HS0A 1MVFA 3MNZB 4OSUL 3T0ED 3BZ4B 1QSED 2P42B 5CEYB 1ZVSB 3GO1H 1OLLA 2VLJE 4R97B 4Q7DA 1NUFA 1EA9C 4OF3A 5DHYB 5EU7E 4ZFZA 4BZ2H 4QRUA 4L8DA 3MBED 1BLNA 3QFJD 1FVDB 3CK0H 2OQJA 2PN5A 4XNZC 5I8KH 3WFBL 3DMMC 3VGBA 4I0PC 3KJ4C 4BFBD 3HPLB 3U0TA 4U1IA 2VLLB 3CFIC 2ZPKH 3QDJA 3CFEB 4MNHB 3O8XA 1EFXD 1FFNA 4MA1C 1Z3GH 5IBUB 1YY9C 4JN2B 4XP6L 1MFAL 5HYQB 2EE2A 4O51A 4ZAKC 1B0GA 3LV3A 4JZNB 2Z31C 1ES0B 4J3OC 4IIQB 4KWUA 2V2XB 4DGIL 3MR9B 2AK1H 2OR9L 3GM8A 3B9KD 3Q3GB 4HCRA 3MBXL 1A5FL 1FFOA 2PW2A 4WI2A 1L6ZA 2VDQH 3U36A 1RMFL 3SDDD 1ITBB 1T1WB 1II4E 5KSBA 3PF2A 1NGPH 4NO3A 4J8RA 1NC2A 4DN3H 2FH8A 5DDHB 3K8KA 4PB9L 4LCCA 4G8EA 5C0CE 1QP1A 4Q6IC 4P2OA 1QSFE 3RX5A 2VR9A 3LEYH 3MGTB 4NN6C 1CDIA 4W6YB 3BT2H 3FQUA 2PKDA 4G5ZL 4KJPC 1KN2L 4FFWC 2R1WA 1UH3A 2FZ3A 2FR4A 4Q2ZB 2OYPA 4JQVC 3PHQA 4X7TB 1KTDA 1MCPL 1L7TL 2GCYB 1RUML 3IETA 4JDTL 5C08D 5L88L 1P7HL 3EW3B 3LKPB 4CUCA 1VESA 3ULSB 5E6ID 3VFVB 1OTUD 1FZKB 4J7RA 1EAPB 1QFWI 3AC0A 3PL6D 4TSAH 4JRXA 2X89A 3O3UN 1SYSA 5GS0D 1MCNA 1DVFB 3L5WB 1MIML 1PKQE 1YQVL 4XC3L 2VC2H 3S36L 3ZO0A 1QFUH 1S9KC 4FQ2H 1OLZA 2F58L 2B0SL 2EXYD 2XA8H 4KGLA 2EDNA 1PGRB 4YHIA 4D0CA 1B4JH 2DMCA 4IRJD 3ZKSD 3L3JA 3SGEI 4RFNC 3MODL 1HINL 5JZ7D 2VNCA 1WCBA 4XCNA 4NHCH 12E8H 5DC4B 4RGND 4PJ7F 3NFSL 4P3CH 4I9WD 3O6KL 5T1KB 3DV4A 4IMKA 5CCKL 2GY7B 3B5HA 1B6UA 4Y4KC 4PRIA 3U9UB 1YNLL 1UFUA 3IAGC 1P5UA 3ULVH 4JZOB 2YD2A 3MJGX 4LSDA 3TZVB 3VWKB 2BVEA 1FYHB 2X4NB 2EZ0D 2NY4D 4FQ1L 4U0QB 2A9NH 2BY2A 4G80B 5D1ZB 4FQXB 3X13A 1S7QA 3F5WB 4AH2B 3HUJB 4MJ5A 5FK9B 4WV1B 3DVNA 3O6ML 1IILE 4G8FA 4BQ6A 4YH6A 4C57C 4MX7A 4DW2L 1KUMA 3ARXA 4HS6B 3QULA 5JNYA 3OKLA 1R5VA 3QO1A 4LGRB 3JTSA 3W5NA 5HHQB 3FQTB 1YEJH 1JGEA 1AXIB 4U6HB 3KPNB 4NQED 4BKLA 3DARA 4AEHH 3EHBD 4XMLL 1IMHC 3LRSB 2VZTA 4JY4A 4M7JL 1F5WA 1J05B 3BKCH 4KRPB 5FYKD 2WW8A 4OZHE 4JRWA 4PJGB 5E8OB 1EPFA 3VJ6A 5C2BL 4PJDE 3D3VD 4ZS6D 1JHTB 4NIKB 4OIAA 4AT6B 1ZWIB 3W82A 3EOBB 2NQCA 1EAJA 4LSUL 4OZ4A 3LVEA 3S5LA 5EN2B 2UZYB 3RVTD 2BSSA 5C6TL 3FQNA 4GT7A 1FYTD 5CIPA 5C0DB 5I19L 5I1GH 4XMPH 1YUHB 1A0QH 1U36A 1HDMB 1JRHI 2JIXB 3CZFA 4QOKD 1OM3L 2D4FA 1QYGL 4WI4A 3KYAA 3WE6A 3KLAB 4OZGF 4L4JA 2ARJA 4RMTA 2VDKL 2QHRH 5EA0H 3NPZB 4YHLL 4PPTA 4L9LA 2EIDA 1CFQB 1TENA 2AI0H 2YN5A 3QUYD 2GJZB 2ICWJ 2ZG1A 3NFPB 3MV9B 4GG6F 4WFGE 3C6LB 1XF2A 5GJTH 2CDFA 1FAIH 3Q6FA 5J1AA 3CJJA 3SEPA 4OFDA 3EFDL 1TJHH 1VDGA 3HC3H 5T1LB 3CD4A 5DJ2B 1KIRB 4M6NH 4HBCL 4U7MA 1EIBA 1MEXL 4IOSD 2VDPL 4B53A 5DYOA 4IEFB 3B9DA 2Z92B 4DKDC 4NQVA 1X5JA 5IMLB 1CGXA 2DN7A 3NMEA 1PSKH 4MSWB 5D7JB 1OTSC 4XVJH 4WWID 3EGSA 3ZDXE 1Q9KB 2BRRH 5IB5A 1BAFH 4K2UL 5HSFA 3GRWL 4U1KB 3H6JA 1XGRA 3EJZD 5EBMB 2XZCH 4K3EH 4TNVF 4G6FB 3OTTA 4XAWL 2VN7A 1I1CA 1DLFH 1G7QB 4HT1H 4JHZA 3KPLA 4HMDA 4OCNC 5DMYA 1I7RB 1N64L 1D5BB 3GSOB 5F7HA 1HOCA 3OF6D 1YMMA 3VXUE 1XGQA 4XP4L 4NWUL 5FB8A 4DKFH 1IKFH 2X7LA 1XCQB 2HG5A 5D1XC 4ZS7H 5ERWA 1CFBA 5IKCB 2H32B 1LP9A 4OLZH 3WNMA 4RBPH 3WDIA 4O00A 1U58A 3T4YB 5EOCH 3S88L 2DS4A 3OV6A 3INUL 4LCWE 1HHKA 4MJIE 2PXYA 5T33H 4Z7OE 1R3KA 3LIZH 1TVHB 2GQHA 4J4PC 2PNDA 2XPGA 1K9TA 2DM2A 4YHNA 3QXAB 3FZUD 3QDGA 1MUJB 3U7WH 4I5BA 5KTEL 3PHSA 4OF8A 2IAMB 3BD4A 1MCQA 1XIWB 5T3ZD 1RZJH 1GOGA 2R0ZH 4ZDHB 2ICES 4RMQA 2P8MA 1RUPL 4G8IA 4PJCF 3EO9H 5DRZA 4NRYB 4U1JA 4XI5D 4MQSB 2RFXB 1JF5A 4BELD 5D7IF 2NTFB 4HWZA 4R97C 4P2YA 3DURA 4KVCH 5HI4C 1BJ1H 5F9AC 2XN9E 4LHJB 2DTMH 5C09A 5I17A 3GK8H 2BSED 2Q3ZA 2VABA 3QEHA 4GJTB 2C3GA 2V2WA 4P4KB 1E4WH 4D9RE 4P5KA 3U1SH 4ZNEA 3HZVB 4LSSH 2QTEA 4ONGL 5JW5B 4F7CA 4I3SH 1DBMH 4DN4H 2WP3T 4YJZL 1EUTA 3OGCA 4MNQB 3QP3A 3D85D 3C8KB 4IIQC 4U6XA 5IM7A 1LHZA 2BVPB 4JZJB 5IBLC 3NA9H 3PHOB 4NKDA 2YBRA 4MVBC 5F6HJ 2GT9B 1ZK9A 2V7HA 2R0KH 4AIOA 1AP2B 2Q86B 1P1ZA 1SM3L 4KXZI 3QI9B 3ARRA 5D93B 3MZTA 2JJSA 3FFCD 3S37H 3V52H 5GS1B 1YEEH 3W39A 5EU5A 5I1EL 4N5EC 1I1AB 1Q9LB 3K2MC 1HILA 3HNSH 5E8EA 4PJFF 1PEZA 4PJBF 4WY7L 1H3PL 4OF0A 2X6MA 3PNWA 2EC9T 4KZEL 5DTFB 15C8H 4ODTL 5K9JL 2QSCL 5A2KH 2Y9RT 5SWZE 4PG2A 3LQZA 5D4QA 2R8SH 4U6YB 3STLA 2XXMB 4QHLB 3W9DA 1G0DA 1I3VA 4CVWA 1I9IL 3SE4C 5KVFH 1QFOA 5F7UA 3UTPD 4FP8L 1V5JA 4XNMB 5T5NG 1RHFA 2GFBA 1R3HA 3BSZH 3B83A 2FJHA 1DVFC 1WFNA 5GISH 3AFLA 2DWEB 4PJAB 1AXTL 3TVMA 1FN4A 4HC1H 1SBBA 3VRIB 1TNNA 5E03A 5EC1A 2OZ4H 3I6LE 3SDAA 1PKOA 1KELH 1UM6H 5TF1L 1KNOA 1GGBH 3U7AA 2LU3A 4P5TD 3FQRA 3QZWA 3CSYA 3CFBB 1Q0XH 5TPWH 1AO7B 4BQBA 1U6AH 1FNEB 3SGJA 4NT6A 2CRYA 2MQ0A 3MX0A 5F9WB 4BFIB 3NCFB 4H8WH 3TZVC 3BAEL 3C87A 2HN7A 3VWKC 3WS6A 1J0YA 3HR5B 2JK5A 4WFHD 3O11B 1UWGH 2D9QB 2JB6A 3KPMA 5I1JH 5L2KE 2Y36H 5D1ZC 4FQXC 1LD9A 5LGHL 3PGCB 3DX6B 2YK1H 4WV1C 4C56A 4CADA 1G9MH 2Y25A 4Y1AB 4PS4L 1AY1L 5EZLB 1EHXA 1KB5L 2GHWB 4CVXB 2WWMC 4NQUA 3DTXB 1U0QA 1V3JA 3MV01 1YDPB 2ZOKB 4UV4L 3QIBD 3PUCA 1V3MA 4RAUA 2JJVA 4YNYA 1IT9H 1VEOA 2GTWB 3BRDA 4JRYD 2XIDA 4PJ7E 3VXRA 3O3DB 4JO2H 4M48L 4M7KH 3L3DB 2XTLA 1CLZH 1LEGA 2KZ1B 3FAWA 2EC8A 4Y4HD 2H3NB 2BNRE 5TQ0H 2BXZA 4AENB 2FB4H 1MJUH 2AJUH 5D70H 3GKWH 4ZUTB 1WK0A 5KS9F 3DX8B 2YA2A 4XVUD 2GJ6B 4KQ3L 1FH5L 2EKSA 3KLHD 1ZHLA 3U83A 4X5LA 5D7LE 4G7YL 3HAEH 4JQIL 4XCCH 4TUOA 5DUPL 1A2YA 4JFOA 2CLZA 3MNZA 4KJWC 3BZ4A 4EN3A 2AJVL 1GGIH 5CEYA 4KI5D 2MMXA 5C0AB 3MOBH 1DEEB 3DUHA 3QIUB 4GAGL 2VZUA 3AROA 2V5RA 1UWXK 5SV4A 3CUPB 1P4LA 2J2ZA 4NZUL 1KFAL 5ADPH 5CFHA 1SEBA 2CPCA 2F5BH 2Z9TA 4OAWA 4PJ5B 2VERN 1CGTA 5IMMA 1Z9LA 3C6LC 5I1DB 4GO6B 5IQ7L 2A2QT 3W9EB 4YBHA 3P0YH 2E6JA 1FLTX 1UKTA 3TJEL 1ZGLP 4QHUA 1L9NA 4Q0XH 3RWIB 3HC0A 1A8JH 1AD9A 2R0LH 2VXVH 4OM0H 5DK3A 4ELKA 2PO6A 4JPVH 3L95A 4JFXA 5DR5L 5FA4A 2JLLA 5C0NC 1XGTB 3JSSA 5D7JC 4ZTPH 2R69L 4XCYB 4OZGE 3WIHL 5E2WH 1RUQH 3QUZB 4UU9A 1S9YB 4PYGA 4N68A 4OJFH 5JW3H 4IRSD 4ZXBB 4EI5D 1G9NC 2DQIL 2RJMA 3FT2B 4YK4B 5D8JL 5J3HC 4WWKB 5DURD 2AEQH 2BDNL 5IVZA 3V4PH 1DQDH 3QUXA 4XPGH 5MEQB 2Y6SD 3STZB 1N7MH 1UG9A 4PRHD 4MB5A 1T4KA 2UVEA 1BQLL 1D5IH 3P4OB 3P2TA 2BVOA 3GHBH 5D2LF 4MGXA 4RMSA 1UVQA 4ZSOA 5SX4I 5AWNL 4MMZC 3CAFA 3BWAA 3C5ZA 5CWSA 1XF4B 3OG6B 1RFDL 3SKJH 5HGGS 3ZTJG 2JJTA 2AP2A 5BOZG 2WNGA 1URLA 1NMCB 3C2AH 4NM4H 1U3HD 4OTXH 4KC3B 5CJXA 4MZ2A 3VXMB 3RWDB 1XR8B 2YD5A 2V5SA 5DQDL 5IB3B 4QCIB 4X7SL 2MNUA 1UA6H 2DQHL 4P2RE 4LRIA 3D9AL 1T21A 3OKKA 3GSUB 2AXGA 5DRWB 3L5WA 4Y5VC 3HTLX 5IMKA 5TQ2L 4QHKJ 1G9NL 1ZS8B 4OGAD 4PJIA 1AHWA 5MERB 1ZLWH 4GG8A 4P59H 2APFA 2C5DC 2DQCH 3S5LG 4QXTA 4YGVB 4ZFGL 4F2MB 1NMAL 3RWEA 1JYVA 3MRCA 2IAMC 1XIWC 4NM8L 4R96A 3MCLH 3D2UB 1U8OB 1LMKA 1U91A 3G5ZB 3LKOA 1KBGH 4GW4A 2AXHA 1PYWB 2HVJA 2E7BA 2FD6H 1OARH 3MLZL 2NY5C 2QQLL 1X5HA 1X5YA 5KJRH 4M6ML 4RCAA 5IF0B 1U8PA 1ORQA 1RULL 4Z0XB 1AFVL 3CDCA 5HI5C 4K9EC 5I15H 3B5GA 4ERSH 1MJJB 4I1NB 3MGOB 3Q1SH 5KSBF 1CDGA 5DZLA 5BJTB 4KVNH 5ANMB 5LGJB 4P4KC 1T89A 5HGBB 2D31A 4GKSB 2DBLL 2FSEA 3DETD 5FK9A 3JWNC 3SE8H 4NO0D 1GGCH 5JPNB 5DRXA 2ICEA 4MJ2A 5IIEB 3ZE1E 1LK2B 1LO4H 4O9HL 5HHOB 5E9DE 4OGXL 4IMLB 4E41D 2UYLA 4NNPL 1BREA 1YJDL 2BZDA 3KHQA 5EUKB 3ARTA 4JZJC 4MJ4A 3SKUD 4D0DB 1QFWL 4KMTH 4Y2DB 4OGYH 3HHRB 2P5WA 2OP4H 4ENEC 2P5ED 2FNBA 1OQXA 2P8PA 5D7IE 4D9LH 1FSKB 2A73B 5IHUL 3O6FD 3I3DA 2NY5L 2CUMA 3QI9C 4Y5YB 5D93C 5E8OA 4HV8B 3RL1B 4AG4H 3I84A 1I8MB 1RK1A 4K9EL 5GS1C 3RIFK 2AKRA 5LQBH 4KROD 3PWPD 4JDZB 4TN9A 5IW3A 3BKJH 4PTTB 1I1AC 1X44A 1C5DB 4DK3A 1RIVH 4OQTL 1CDUA 4P46B 3RU8L 5GJSH 2ZCKH 1DANU 5E5MA 1YUHA 4WTXA 3ETBF 1NCWH 3HFMH 1KULA 5F21B 4WCYH 4OZIA 1PDKA 1XMWA 3QRGL 1OAKL 3UZEA 1JPGA 5DUBB 1EEZB 4CNIB 1KACB 1CFQA 1GZPB 3S3PA 4RGMB 3Q6GH 3ECBA 2HRPH 3NN8B 1AGCB 4LU5L 3S35H 4EDXB 4P2QD 5DGQA 4ETYA 4YWGH 1O0VA 5C0BD 4JFEB 3G08A 3IKKA 1RK0A 4KK5C 4X8JA 3RI5F 2O5XL 4LARL 3UBXI 4U2ZA 4MNGE 2A1WH 1G84A 5I0ZA 5ESAA 4PJFE 4N0YL 2VZVA 4PJBE 4UILL 5L2JB 2APVA 3QISA 1H9VA 1Q0YH 2Z92A 3E2HB 4YIQB 2MHAB 3FO2A 3IKCB 5IK3B 3WJLC 3RTQD 4OV5B 4WFFD 4Z78A 1MELA 3D0VB 3VI3E 2DMBA 3C08H 2R23B 3GBLA 4MQXC 1CD1A 3BP4B 3KS0H 3T8XB 5FF6A 1UM5H 1B0WA 1ZA3A 4NKOA 1YY8B 4PP2A 2DYPA 3GUTB 2BOBB 4J12A 5DF0A 1JRHL 3QCTL 1MRFH 4S1RL 5MP6L 5I8OL 4NUJA 4DVBA 4BZ1L 1F02I 5DI8A 4PRAA 5C86A 1YNTB 2AK4A 3SKNB 1P4BH 1F6AB 4OFVA 5LG1A 5KZCB 1D5BA 3GSOA 3OAYH 4Z7VF 4TVPH 1KIPA 5FA3B 1GAFH 4L1HA 1NPUA 1KV3A 2A6KB 1GOHA 4Z76B 5DVLA 5DWUL 4GRLB 3WSQH 4H0HB 4DTGL 1ACYL 1C5CL 3TH3T 3TYFB 1CXFA 5IKCA 1FFPA 5C8JB 2HAZA 5JLZB 1K6QH 4JFFD 2JCCB 3STBA 1KJ2H 5H37H 1TMCB 4HZAA 5HYJD 2HJFA 3DO7B 4UQ3B 3PABA 1CBVH 2APWA 3KGRA 2CJUH 4F3FB 5TDNA 4YFEA 4AEFA 2HFFB 2W0PA 1MPAL 5A3ID 3DVIA 5E8NB 3VXQB 1PY4A 1FNFA 1UT9A 3F12B 4LFHD 2VAAA 1GPOH 1TJGH 1Z9OA 2XQYK 1M7XA 1XGPB 4XAKD 2VLRD 3ES6A 4D8PB 4YFLI 3QNXB 2YD4A 5EU6D 3LHPL 3T77A 4QGTA 4RGOL 3VGEA 2NTFA 1ZLVK 2IQAA 5FDWB 3QIUC 5LXGH 5IG7A 3V5DB 2NR6D 4LSRH 1LO2H 4Z7WB 1IJ9A 4UT7L 3REVB 5ESVA 1BIHA 4LOUD 4EDWL 1CI5A 5I75B 3FO9A 4UQ2A 1QVOA 4LVOB 5F8RC 3EYSH 4XNQA 3VA6A 5GS3A 5BZDA 1F4YL 5CJ8A 4YLQT 4JFYB 3CNKA 5EFIA 2DI8A 3PV6B 4GRWF 5CGYD 3CVHH 5KS9E 2GK2A 2ORBL 2VE6B 3H9SE 1FVCA 5F7FA 3PWUB 1JGVL 3SPVB 5I1LA 4MNQA 3GI8L 1UADC 2HT2C 4HIIB 5KVEH 5GGRB 1PQZA 1I1YB 4AMKH 3I75B 3TWCL 1I8LC 2EDBA 5I66B 2GT9A 1AP2A 2DJUA 4HCRL 2XKNB 2EH7L 5IUSA 2W9EH 3F6IA 3EOAB 4LSVL 4TUJB 5DLMH 3AXLA 2ITDB 2E9WA 3BDYL 2DL9A 5EUOA 4ZXBC 1LP9F 3QEGL 3ARGD 3GIZH 2GEEA 4WWKC 1S9XA 4GAYB 5C2UB 1ZEAL 5T1DH 3MROB 4LCUA 4AL8L 2BXYA 3OJDA 2CO6B 1BFVL 5HHME 5I76A 2VKWA 4KUCD 4HC1A 4CJ0A 2IH1B 2OZ4A 5FKPA 3L7EA 3IDYC 5A16A 1WJ3A 1TETH 2NW3A 5J56B 3O2VL 5DTFA 4UT9H 1Z5LA 4WO4B 2YPLA 4L4VD 1HZHH 1G0XA 2WBWB 5ENWA 3HE6B 2AJSL 4GXUN 4U6YA 3NCJL 1NMCC 2ADFL 3I02A 3L3IB 5CSZB 1F4HA 1JNHB 3T0WA 1CGSL 1J18A 1PFCA 2B39A 1DQQA 2E6QA 1GH7A 5F7DA 4GW1A 4XNMA 4LGPB 2E7CA 5E95B 5GS0H 1GC1H 5BRZA 3Q5OA 1Y0LA 4XNYL 2AJYL 4HKBB 3GMOB 2BSTB 3SOBL 3CH8A 2NY7H 4EVNA 2VLKA 5AD0B 3KXFD 3VXSE 4UIMA 1TCRB 4Y2OA 2FGZA 1B88A 4K71B 5D2LE 3VRIA 5KANI 5DJZB 5TDOB 4LHUB 3QPQD 5AUMB 4UDTB 4YBQD 3UBXB 3MOAL 4XMKL 3L7FB 4PJ8C 3UTSD 3VCLA 3ALWA 3DUUB 4PREB 3VXNA 1MFCL 1RU9L 1J0HA 4ALAH 2VXTL 5DO2D 3VWJD 3SQOL 4M43L 3WS3A 3UJJL 5AAMA 1BQUA 2W0FB 1MCFA 1IC7L 4NQCB 2PW1A 3KR3H 3L3OB 2LU4A 4JY5L 4QY8A 1DQML 1NC4D 4ZUVB 3MRNB 3DX6A 5TDPB 1I3RA 1TZIB 5HHPB 5MEOB 3RVUC 3LMJH 3WEXA 3QHFH 1SMAA 3OXRA 3HAEA 3QDJE 4QTIH 3G6AB 1RIHH 4UDUB 1FNLA 5K9OB 2WSKA 3GJEA 3VXOB 3F7VA 3M45A 2BC4A 4Z95L 2RGSA 3KWWB 1J8HA 4FNLL 1YDPA 3SY0A 1H8OA 2E8ZA 1BZ9A 5E1AA 3C5JA 3W0WD 4APQD 4BSJA 3OX8B 4Z7NE 1FSKC 4R3SA 4UBDC 5FYKH 1IFHL 3KPRD 1ZGLB 1DQLH 1MH5A 4K3DH 2I9LA 1FBIH 3SQBA 2JJUA 4Y5YC 4NQDA 1KLGB 3CZJA 4L4TD 3MNWA 5ADOL 1EJOH 1JWSA 5KSBE 3SGKA 4P23D 3D1MC 3P30H 5J8OA 5HYSB 1QRNA 5MENA 3FFDA 1KXTB 5D6DA 4B7LA 3SN6N 4QRRA 5CBAB 5IVNA 4G9FA 3GSNB 1OL0A 3DX9A 1NKOA 3F8UB 4LDEB 5CLTA 1ZTXH 2FX7H 1DBBH 1FV1A 1KEMH 5EH1A 3VFSB 5C0AA 3VD5A 1DEEA 4JO1L 4HIJB 3U2SB 1A1OB 4QNPE 3VGDA 2LV4A 4PRDB 5HVWA 3OPZL 3DXAB 5EO1A 5EWIH 4XPFL 3H9HA 1PG7W 4HKZA 1QPXA 4RGMC 4KK9C 1EZVX 2XTJB 1CE1L 1KPRB 2YPVH 3SCMD 1R24B 4HS8L 2IFFL 5EO0B 3MREB 5ELIA 4ZUUA 1FIGH 3BGFB 3L1OH 3U0PB 2PYEB 3W9EA 2XWBA 3X11B 2VZOA 4MDIB 1KENH 3UC0H 4AIXA 1AQKH 4B5EA 5I8CA 2VSCA 3RWIA 3G6JB 1AJ7L 4N1EA 4JRXE 3U0WL 4HQQH 3GSQB 2OM5A 2HMIC 1HNGA 4PGDB 1MHCB 1A6WL 3GSNH 3E2HC 3OJ2C 4HWUA 1XGTA 2CGRH 1RURH 3X3FH 1B2WH 5BMFL 4PJXA 5DMKB 4TPRL 2OK0H 1CFTB 1NAMB 3BO8A 4KY1H 1XEDA 3RVWD 4LP4A 1W8NA 3M07A 4X4YA 2V7NA 2CQVA 3QUZA 2VXUL 1ZT4A 2J4WL 5TE4H 4XNUL 3GDBA 2V2TA 1R5IA 1CFSA 2VJXA 2CK2A 4Z7QF 2OS7A 1EEQA 3O45A 4PRIE 3RDTA 3PWLB 1LO5B 3O4LA 4L3ED 4PRBA 3ARQA 4MWFA 4HBQA 1ZA6A 4X6DB 1FG2B 1I8KB 3ULUC 4L8CA 5B8CA 3CPLA 5DJ8B 5BXFB 3H42L 5A43C 4WI7A 4EKXA 2OTUA 3BN9C 4GRLC 4F7TB 4N8CH 2XZQL 3TNMB 1WEJH 2P4AB 2QQKL 1MWAH 1BF8A 3IDMB 1GZQA 4UNVA 1Y6NR 4GW5B 2VITB 4HFUH 4YC2B 1NCDL 4PG9A 1WTLA 4PGEB 4KK8D 3FCTA 1P7KA 2DF3A 4XVSH 2CLRB 4PP1D 1CFNB 4KKBD 3BEWA 4Z7UA 5KANG 5C0IA 1ZS8A 5F7EL 5D7SL