1OLLA

Extracellular region of the human receptor nkp46
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
188
structure length
188
Chain Sequence
b'TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NK RECEPTOR
publication title Structure of the Human Nk Cell Triggering Receptor Nkp46 Ectodomain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/receptor
total genus 36
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2003-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ollA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ollA01
1LO2H 4HUWB 4IHOA 4WUUD 3SGDH 3N1MC 5EG6C 1CDCA 1DBAL 5HDQL 1BZ9A 3ZTNL 4O51B 3EYQD 4R4ND 3JWOL 5DC0A 2VXSH 5CJQL 3MRRB 5F1IB 5LXGL 4P9HC 3GMLB 1X9QA 3EZ8A 3EOBB 4IIQA 4IOSD 3IJYB 1XIWB 1PVHA 1JGUH 3QIUD 3S7GA 4FQLL 4NQUA 1EBPA 3FO0H 4OLXH 1WLHA 4DGYL 4RBPK 4YDJA 3TT3L 1ZTXH 1RMFH 2IJ0C 3MJ9A 1ZLVH 2VL5A 3L3JB 1IT9H 1QLRB 4IJ3B 5KANI 5AEAA 2A6DB 5L2KE 4H5SA 1KLUB 4NZRH 3I3EA 4PJEB 5CINL 3RWJA 4YGAB 4KJQD 4NC0B 2PF6A 3MZGB 4TULL 4DGIL 5HHQB 2HRLA 5FO8B 1M7DB 4X5LA 2ZUQB 5I76B 3EYFA 1D9KD 1KN2H 5CWSB 2O5ZL 1XGTB 1JV5B 4KU1A 5MEOB 3D5OF 2QSVA 4MA8L 3WFZA 4XPHH 3DTXA 1IRAY 2XA8L 4TQEH 3EDDA 4HUVB 3WIIL 3RVWD 5ITBH 2W9LA 3L3HA 5D9SB 3A6OA 4YAQB 5KSAD 2AJVL 4PJFA 4WWID 4NGHH 4C57C 4HWEH 1JFQL 4X6FA 3C5SB 2VH5L 5F1NB 4NPYA 1JUFB 1U93A 4N68A 1DQMH 3ULVL 2F5BL 2CMRH 4XPGH 4ESKA 2E9WA 1P4IH 1H5BA 3OKEA 5F6HJ 3VXMB 2X40A 5E1HB 2EYTB 4B7IA 3HMXA 4MZ2A 1VADB 1DTUA 4D0BA 5E8PA 3UO1L 4XVTL 4Q6IC 4YXLH 1DBAH 2B0SH 1X7QA 4OD1L 5HDQH 3ZTNH 4RX4A 1T5XB 3JWOH 4QRRA 5CJQH 3LD8C 5JW3L 3WMSA 3TIDA 1DCLA 4P2OD 3CMOL 2EIEA 3FTGA 4FQLH 2H32B 3OTTA 5AAMA 3O0RL 2GJZA 4S1RL 4DGYH 1RIUH 2EDWA 3QH3B 1JMXA 3SGEI 2GK2A 3UTQA 1FV1A 3P4MB 7CGTA 3R06A 2C4FU 5CINH 2PYEA 3L5WA 5D1ZD 4NO0D 5DMGD 4TULH 5CILL 4DGIH 3W81A 5GZOD 3ALWA 5DO2C 4ZTOL 1HH6B 2AAVA 3GK8L 2Q3AA 5FB8A 3IKCA 4LLAA 2AXFA 3WEXB 4NN5B 4XCCL 4ENED 3UXFA 4L4VA 3UTZB 3TIEB 4RMQA 4DZ8B 3MJ8B 1MJJA 3P0VL 3WIIH 1M7IB 1H3TA 4D9RD 1A7QL 1GZQA 3LAFA 3PJSA 3BUTA 2VB5A 1CN4A 2AJVH 4PR5B 3C60C 3L5HA 5DK0B 4JFXA 1MJ8H 3SGJA 5FM5M 4XP4L 4FFVD 4XHQA 3QEHB 1KCLA 4K3JL 4I0PD 5CGYC 4ZUUA 1DQTA 1BD2B 5E7BA 3HAEH 2WAHA 5C6WH 5D7IA 4NBYB 2Q3ZA 4Y2OA 3LQZB 1G9NL 4P99A 3CCHB 4DEPC 5CSGA 3ZL4L 3JTTB 3UO1H 2RAMA 2JCCE 2ZPKL 3RVVC 5ITFA 4OD1H 5IV2B 2EE6A 2F8OA 1TJIL 2G5RA 4J8RB 2AERT 4XNYL 5IJVB 4IOIA 5JW3H 3R8BB 3QJHA 5EPMA 3IJSA 4HIEA 4EOWL 2VDQH 4KK8D 4MXWL 4OJFL 3CMOH 3ME0A 1FIEA 5E9DD 4I0KA 3VD4A 4OZ4B 3O0RH 1ZVSB 4S1RH 1FHGA 6CGTA 1M6OB 4M6AA 5D93B 1EVUA 1FGVL 3B9VA 4JY6B 1DUZB 1RJCA 3FOMB 5AD0B 5MERA 3LKSA 1N2RA 1BJ8A 3VWKC 2QQQA 1CLYL 7FABL 5EA0L 3UPAA 3FO9B 4OFDA 4U1KA 5J6HA 1AQKL 1D7FA 2DB8A 1JF1B 4JN2A 4WENB 3SDCD 4L5FL 4WO4B 4ZTOH 1D5ZB 1RZ8B 3GK8H 2BY2A 1NBYA 4LNRA 2WP3T 4HUNB 1WFNA 4XCCH 2A38A 4IRSA 3KPSA 3SDDC 3PWPD 4Y4HA 4ZS7L 2GITB 1GOFA 2E27L 4WFED 3P0VH 4P46D 3CFJA 2QQNL 4HWBA 1A7QH 2QR0A 2QQLL 3GMPB 3RPKA 5BQ7B 4GBXB 3HB3D 2HG5A 3BP4B 5E6ID 3MGOB 3LZFH 4Q97A 1F3JB 3HE6C 4RMVA 5GS1B 1JZ8A 3K4AA 5I16B 1L4IA 5JXAH 3PXJA 2RFXA 5L88H 1X5AA 1MHHB 4F8TA 1JGDB 2QQKL 1G9NH 1BLNA 5JTWA 3B9DA 3PUCA 2BSRA 2AK4A 3ZL4H 3ET9F 2ZPKH 4K55A 5GGTH 5HYJB 5IMMA 2H3NA 4JY5L 3BQUD 3SDXA 4JANB 1TJIH 3P2TA 4XNYH 4KZDH 3WO4C 5E2TH 1PKQE 4OJFH 2F54D 3FHAA 3BWAB 4P5TA 1S8DB 1A9BB 3RZCC 1JIBA 1FQ9C 4CVZA 4O9HL 2DI7A 3PNWB 1AXTH 4QHMB 3HNTL 5DLML 4FQHA 2VISA 1U36A 5DI8A 1CLYH 7FABH 2PYFA 4LSVL 3I2CH 4Z7VA 1AQKH 4S1DD 3MRPA 2OK0H 4HJ0D 2P8PB 2VWEE 4XP1L 1FAIL 4PJXE 2NW3B 3CX5J 3QXVA 1BWWA 2ICWA 1BHGA 2ESVA 3P9WB 4LP4A 4PD4K 4J4PD 4AJ0A 1UVQA 4KMTH 4CADA 3C5ZA 4ZFOL 3MV7D 2C3GA 2BCKA 1C08B 2EH8L 1X3DA 2QQNH 1HOCB 2QQLH 3B9KC 1ZHBA 4PLOB 5IFJB 4K9EC 3KS0J 4QNPF 4GH7B 4TSAH 4Y2DC 4XTRC 4M62L 2A1WL 3T4AB 1P1ZB 2WUCL 1A3LH 3ARBB 2P5ED 1X5XA 3VA6A 1XF1A 3V6OE 4NNXB 2W0FA 3MRIB 4Z7UF 3MLUL 1SJEA 1EGJH 4ELKB 4L8SC 2FEEL 3G5ZA 4XAKD 3TT1L 4XWOD 2DQEL 1U8IB 2DQIH 5DUML 3F5WA 2Z31C 3VH8G 2JB5L 2NXYB 3KPNA 4UINH 4YO0A 3KYKL 5T1KB 1CD1B 5DRNA 3JWDL 4JFFD 3D2UA 4ZAKD 4JHZA 4KMLB 4OGAC 1S9YB 4O9HH 3QUYB 4F9PC 3HNTH 3UCRA 5IVZA 1S9XA 1TZHA 3BXNA 4LSVH 2LAGB 3TN0B 2V7HB 3CXDH 1KT2A 1GAFL 3V5KA 4XP1H 5DFVD 4AIZA 4S2SB 2GTZA 3MYJA 4FFWD 1F6FB 4MD4B 3D85D 3WDJA 2VXQL 2OLDA 4OZFB 5C08B 1DN2A 3WNMA 1G9MC 1WBZB 3TFKC 4CDGC 4L4TA 4QHUB 3IYLW 2K9UA 2ZOKB 4JCMA 2KZ1B 4OCMC 5DHYB 1VFUA 4HUMB 4L3EA 4NQDE 1UB6A 3SQOL 5IMKB 3QIBB 3S4SG 2WUCH 2OJZL 2B4CC 4I48B 4XMPH 3FQUA 4QGTA 4M8VA 4OCRL 2DWEB 1N8ZB 4Y5YB 4P2QB 3MLUH 5HHNB 1ZANL 2Y07L 4RAUA 4U6VL 3ZKNC 2FYYA 3BGFC 3EJZD 3U0TA 4YZFE 3NPZB 4EI6B 1VFOA 4U0RC 2Q6WA 2DQEH 1FL6A 1IKFL 3O4OB 2FWOB 1CE1L 5K9JL 1NC4D 3KYKH 4YBQD 5LCVL 3RWGA 1G7LA 3MLVL 5I74B 3P11L 1X6NA 3JWDH 5ANMA 2VLRE 2VQ1B 3U2SA 1HSAA 4X5XB 1T21B 3MV8A 2BVUA 2NY4D 3T77B 1WAAF 4P59L 3TLRA 2XWBA 2GHWB 1QSEE 2BX5A 4EEEA 1P6AB 2X4NB 4OIBA 3GMMB 3PIQB 5J9PA 5I1DA 3HG1A 2GCYB 4MNQE 2BFVH 3TBTB 4ZO7A 4UT7L 2ZG3A 3RX5A 5C07E 2VXQH 4PJ9B 5DVKA 3STLA 3HUJA 3D87B 4JDZB 3F12A 1F6AA 3QI9C 3WS6C 1C5DB 5C70A 4LIQE 1P2CA 5I75C 2YPLE 2NLJA 4GG8A 3FQTB 35C8L 4XAWL 1HNFA 3K8LA 3RTQC 1EXUA 4HZLB 4FQ1L 4JHWH 3FJTA 4GMTL 3RVUD 4FA8A 3PGCB 1WCBB 4WEBH 4BZ2L 5DVOA 4EZMA 5GS2D 5J4MA 1ZT4A 4X7TA 2JIXB 2VITB 1U8HA 4UB0H 2VUYA 1DQJB 2ZUVA 1NCCH 4OCRH 1FZKA 4Y5VC 1HK6A 5FYJL 3QYCA 1ZANH 2Y07H 2VSCA 2B1HL 3ESVF 1X5FA 4U6VH 5D1QC 5EIIA 1KYOK 3AROA 3U46B 4JFDD 2X4PB 4MD5A 3DGGB 3MNZA 4DKDC 4M8QA 3VG9C 3BP7B 3WUWA 5ALBL 4JG0H 2XZAL 1IKFH 1NBVL 1E28A 1NGPL 3AXLA 1MCLA 2ZUSA 3UZQA 3RIAF 5CGMA 1F58L 4PRHA 3P11H 2PO6D 4AEEA 1W72L 3W9EA 4Y19E 2DQGH 5IGXL 4DUXA 3C6LC 4X8XA 5HBBA 1RURH 4PIRF 5EORL 4U05A 2DQJL 5GGSY 4HIHB 3V7AE 4U1GB 4WGWB 3QT2A 4BSWA 4NNYA 5DMIL 1RAMA 2ADJB 2J1KA 1PBYA 3OV6A 5FXCH 1BFSA 4RFEB 3WJJA 1KTDB 4HLZH 4YK4B 4KJWC 2V2XB 4OF0A 2EDTA 2H6PB 3V5DA 5GS0D 4GRMB 5KS9A 4KV5F 1A2YB 2Y5TA 1ZGLB 2VLKB 4ONHA 2P42B 3AMKA 1T3FA 4UDTA 3TP4A 3RWEB 35C8H 3CFKB 1FYTE 2X7LA 5IJKC 3DBXA 4FQ1H 4ONOA 3FCTA 4GMTH 3JUZA 3L9RA 2CDEA 4POUB 4NQCE 4FRWA 4LKCA 2AJYL 1FO0B 3IDYC 4Y4FA 3B2UC 4LOUC 3MV01 2BDNH 3G04B 5D2NC 2GAZA 4IEFB 5DFWH 1QRNE 4FQIL 4QHLB 4BSVB 1T66D 1S7SB 2N56A 1OTUD 5ALCL 3QXAA 4LBEB 5D2LB 3S96B 5CP7B 5IVXA 5DQJA 5GGVY 1FFRA 1TENA 1P4LA 5ALBH 3TPKA 1YN7A 4WEUD 1MHCA 1NBVH 1NGPH 3IDXH 4UT9L 4P2RE 1F58H 2AABL 4QXGH 5DS8B 2IALA 5DVNA 3OJVC 5BRZA 3M45A 3FQXB 5IGXH 3KS0H 2BJML 1V05A 3P4NA 5EORH 3SKMB 2ICEA 2DQJH 4W4OC 1BJMA 5GRZA 1WTGT 2SEBA 4XX1G 2FH8A 1S7XA 2D3VA 3V5HA 3VRIB 4WCYL 4PJBF 4ALAL 5CAYB 4LQ1A 3F7PC 1F4XH 3IDIB 2I07B 2XNAB 4RX4D 2G2RA 4QRRD 3EZJB 1CZ8L 3PDDA 1XF4A 3VXUB 5EOTA 3CSYA 3IFLL 4YPJA 3BSZL 2H32H 4AEHL 1T04A 3DVFA 2HMID 5ESAA 3GHEL 3P9LA 1X4XA 3O11B 5MP6L 3IVKB 3SGKC 2PYED 5GHWL 3NFSL 1R3LB 4JAMA 4S1QL 3ELAT 4JQXA 4P3DA 2AJYH 2OR9L 2EC8A 1A7OH 4RFNC 5I2IA 3LCYA 3P40A 5D7LE 1WAAE 5DC9B 4L4VD 2Y06L 2H41A 1CR9H 4Q6YA 5DTFB 1L6ZA 4LPTA 3VFRA 5CUSL 2HJFB 3CDGA 5ALCH 5IMOB 5BXFA 2HTLD 5IEKB 2VABB 1EX0A 2JE8A 4FQQB 5HGDB 5D1XC 1UJ3A 4FQXA 4UT9H 1CFNB 2DD8H 4PJ5D 1NDGB 1JI1A 1CQYA 3F65A 2AABH 5MI0B 4BH8A 3WE6B 4PP1C 2HVJB 3PGFL 3O41A 2BJMH 4YUEL 5CEZD 1PKQB 1XF5B 3DI3B 1Q9KB 5BW7A 3GHBL 1CGTA 1CFQB 1AQDB 3DUUA 4PJ8C 4R3SB 1T5WB 1Q0YL 4PJGE 1WK0A 2X05A 4WCYH 3TO4C 4ALAH 1FL3B 5DZNA 3RWFA 4IMLB 1HHHA 1YDPA 4LSRL 2A6KB 1TVDA 1PAMA 5DJ8B 4IOFC 4G9FA 2DM3A 3PV6B 4HWZB 4R2GB 3I84A 4HCRL 3ILPA 3D39B 3O3AB 3BSZH 4NKOB 4AEHH 1MRFH 4XGZA 3RP1A 2H45A 2OI9B 1HWHB 1U8PA 2WWMD 3GHEH 4ERSL 3P77B 2CRMA 3DXAA 4QT5A 5MP6H 5KBNC 5EH1A 5GHWH 3NFSH 4LLMB 1PG7W 1LDPL 1LILA 3KVQA 4S1QH 4P23A 2D03L 43CAB 3DROB 1B0RA 3ZE1F 4AENA 2OR9H 4M5ZL 5FYLE 3FO2A 3MJ7A 4JKMA 1VGEL 1Q9OA 5DQDL 2KQNA 1T1XB 2OTUB 5I8CA 4IRSD 3KPSD 2BVOA 4JJ5A 4JPKH 4BJLA 4PGBA 4Z5RB 5CUSH 2ERJC 1YPZA 4XBPB 4L8CB 1FZMA 3DO3A 1T0NB 2P5WB 2BRRH 5MHSD 5KVFL 4KRPC 5I66A 3OR6B 4YC2C 4JFPA 1I8IB 1NGYA 3PGFH 3U30C 4I18A 4MA7L 3GSXA 1FLRL 2JF1A 5F88B 4YUEH 2DLHA 2JB6A 4H1LA 3WKML 4JY4B 4KDVA 3GHBH 2P24B 5FYKU 1CDUA 3E6HA 1UC6A 5F7KC 4DCQA 5JUEL 1QFWL 3ZHLA 4APQA 3MFFA 4OM0L 4GW4B 4LSRH 2YKLH 4LSSL 3L95B 4KK9C 1SJHA 3QIWC 1A22B 4HCRH 1RV6X 1OGAA 3J7HA 1D5XB 3ARFC 4P5TD 5JORA 1KSRA 5FA3A 3GIVB 1ONQB 4ERSH 3BHBB 1CG9B 2BVEA 4X9FA 3VGGA 5FUCC 5H8DA 4J23A 4KKNA 1UADC 3BUYA 4MCYA 1FSKC 2J6EL 2C3HA 1U0QA 2VDLL 1WBXB 1GPOL 3MROB 1VGEH 5DQDH 1KIQB 1WF5A 1X4YA 4O58L 2NTFA 3WS3B 4AEFA 3ZDZF 1R3JA 2ESVD 2OR7A 1PSKL 2YA2A 5E03A 2UZXB 2R56L 1FVDA 3C5ZD 5CP3H 1OWRM 4P48A 3EGSA 4B50A 2OQJB 3D0LB 4GQPH 1ZT7B 5HYIA 1HCVA 5KVFH 1P53A 3VCLB 2PW1A 4U1HA 1BIIB 2NXZC 1EAPA 3HZVB 2IANA 1AGEB 4R7DB 1IKNA 5TQ0L 3MYZA 3WKMH 5EC2B 3ABZA 5DJXA 3G6JA 3KYOB 3UMTA 1LEKA 4GO6B 1MAML 1YC7A 2VLRB 3DMMC 3LKNB 4OM0H 3JXAA 1U91B 4HPOH 2YD9A 3PHOB 1QSEB 1CL7I 4LSSH 1E27A 5E8OA 1WFTA 5F7EL 1IL1A 2C1OA 4LLUA 2CR6A 3MCKA 5CJ8A 4NUJA 3W2DL 5I71B 4HW6A 2GUOB 5IF0B 2R0WL 3UYRL 1HNGA 3D2UD 5BO1H 1JK8B 4PRPE 5A1AA 3QEQE 3BZFA 3GMRB 4B53A 5KSBA 2FGWL 1IM9A 3RHWK 2VR5A 4TVSa 1QTYT 5DVMA 5GGRY 3EHBD 4XVJL 1WFUA 3HNVH 1C12B 3QJFA 4M4RA 1CGVA 2VDLH 1CF8L 1DN0A 2YD3A 3VGBA 5F8QC 4IRZH 4Y7MA 1WICA 5GGRB 4JHBA 5IVOA 3SE4C 4HMDA 5DRWA 5I30H 4XNQA 4R6UA 3VH8A 1PSKH 4OZFH 4KDTA 4U6TA 2R56H 4R8WH 2XOTA 4WUUE 3MACL 4GXUN 2V9TA 4L4TD 3VXRE 4YIQB 4KRLB 1A6TB 3V0AC 4GW5A 2BNRD 4L3ED 4CU8A 2A6DA 5IBLD 3WHXB 5KN5B 5TQ0H 2BY1A 3O8XC 2P47B 1PW3A 1L9NA 4GMSL 4JR9L 5TQ2H 5I8EB 1XGPA 5CCKL 1BJ1H 4Y19B 4GUPB 1MAMH 1MFBL 1RUKL 1JNNL 3WLWC 2FIKB 5TPWL 1CFTB 5C9KA 3C8DA 3THML 4PJDE 1G7HA 1RJLA 2ZSWB 3ILQC 3U1SL 4JO3L 5DR5L 3AS0A 4X4YB 5D9SA 1D5MB 3W2DH 4ZUWB 3WKNA 5CFHA 1N0XL 2IMNA 2R0WH 3UYRH 1TQCB 4U1MB 3PDOB 4Z7UB 1W72A 2DYPA 5F1NA 4HKZA 3S4SA 1FNEB 4OZGF 4U0QB 3MV8D 1ZVHA 2PXYC 5DK2B 3ARDC 3MSPA 1KCSH 1Z9MA 4NC2B 1U3ZA 4Y8DC 4F7TB 3ARYA 3BP6A 1FYTB 4Z7WF 3HG1D 1YEFH 4U1JA 3FN0H 1BQHG 1FG9C 4KQ4H 1P7QD 4IMKC 4NQCB 4MYWB 3OAYK 1T4KB 4JRYD 5EU3B 4Y1AA 3LDBC 1CFSA 1CICC 3QQNA 4QTHB 5FO9B 1D6EB 4XC1H 4MDJA 4M02A 2FJGA 4HBQA 1AD0A 1UM6L 4NRYB 3MACH 3B2VH 3MRGA 1DBML 3ULUL 1WZLA 4IDJH 3TBSB 3DURB 3QH3A 2CD0A 1MJUL 1KCKA 4Q6IA 2XQYG 1JRHI 3CVHA 1R6VA 1XF3A 4P2RB 5KVMC 4MB4A 4WWKC 3QQ3B 4GMSH 4JR9H 4HIJB 5CMAA 4UQ2B 5CCKH 5FKAB 1MFBH 1RUKH 5F3BA 1JNNH 3CDFA 5TPWH 2HLAB 4KJPC 1RUPH 2XIDA 3TV3H 3THMH 4NN7C 4GW1B 2XQYK 1IGYB 1QO3B 4JO3H 2EC9T 1M7IA 5DR5H 5SX4H 4KKAD 1WT5A 1IGCH 5DSCB 4OLWL 3L6FB 4MS8C 4TUJB 5F7UA 1G1CA 4MVBD 4PRHD 1NANI 1J87A 4GKZB 3NCMA 3QEHA 5GGVL 4PG9A 2X9WA 4H0GA 5CIPH 3VXNB 3O9WC 1A1OB 1JYVA 3ULVD 3MXVL 1U8MA 3IGAA 3QEGL 4J6RL 4QHKI 5EBLB 1JPTL 4MLSA 1JPST 4HHAA 1M7XA 4TVPE 5B38B 1HI6B 4QRUB 1I4FB 1NFIA 3SKOB 5E4IA 2MHAB 2JJWA 4DGVL 2ENSA 3BGMA 5HI4C 5J06A 2DJUA 4FXKA 1KIPA 2CK2A 3MUGB 4HV8A 3TYFA 5HPOA 1XGYL 1CCZA 4X9GA 1XIWC 3GDBA 1YEGL 5CEYB 1UM6H 5D7LB 1DBMH 3ULUH 1EIBA 3HRZA 3V8OA 1M6OA 4XP9L 3EJYC 1DUZA 1MJUH 2X4UB 4IJ3C 4JRXA 4UZGA 4CDHA 4HG4J 1FDLL 5ICYA 5EO9B 5E9DE 3GNML 4LNVA 4KK5D 4BK4A 4Y4FD 4ZUTA 1A0QL 5H35A 4X6CE 3F7YB 2ZUQC 3FB6B 4YDVA 4RMWA 3WIFB 4JKPL 2YBRB 5A16B 3HE7B 2XG4A 4H8WL 1N6VA 1FNHA 2KKQA 1K4DA 4Z7NF 4FXGA 2GITA 4KZEH 3QNXB 4NQSB 5I6XB 5C0GB 2XWTA 2GJ6A 3IJHA 4PJAA 1PQZA 2IG2H 5F7MC 3H9SD 5BRZD 3C6SB 4QRSA 4HC1H 4XCEB 1RZJL 4PTUB 1J0KA 4ZDHB 2XZQL 1YC8A 3QEGH 4J6RH 1PKOA 3S3SA 3MNVB 3NCBB 4O4YH 2NY6D 5BZWB 4QHKJ 3U48A 1MH5A 4QXTB 1MREL 2EIBA 3ES6B 3CH1B 5FKPA 1T7VA 1NDMB 3RX7A 2J4WL 1XGYH 3NAAL 1OW0C 1YEGH 3BI9X 2NX5A 3VFSB 4BFBD 1K3ZA 5FYKL 4FG6D 1T89C 1JNJA 2EDYA 3HI1B 3AB0B 2CDGB 3P0GB 3MBEA 1MHPH 1FDLH 3KWWB 1DANU 2F54E 4TNVK 4HJJL 5EC1B 2HH0L 2JJTA 3GNMH 1A0QH 5DA0B 2P8PA 3CFIC 3OKDB 5DJ2A 1J05A 2F9BT 3S34L 1CLOL 3O45B 4GG6E 1QBAA 4I3RH 4WI9A 4NN5C 1INEH 4HUKB 4HK3N 1A7NH 2XPGB 3NACH 3SE3A 1P4BH 2YN5A 4FQXD 4XPFH 3N9GL 3U0PA 4NHUA 4XNXH 2QKIA 4E41E 2CO6B 1N0LA 2P46B 3MBXL 3GBML 3L5IA 3MV7E 1D5BB 4NKIH 1P1ZA 1P9MC 2XZQH 2IQ9H 3N1QC 4OKDA 1MOEA 3KPMA 4U33A 1DVFC 1HXYB 5TF1H 1A7RH 1K4CB 4HJGA 3B9KA 4P4KB 4JG1L 1AR1D 3HPLA 1KJ2B 4PGDB 4G9FD 1KPRB 4Y2DA 1WZ1L 2HJLB 2N1KA 1G1YA 1X5IA 5CSZA 3DRQB 1IEBA 2DKSA 1ULVA 1W2KT 4OCLC 4CMHC 5C0JA 2ZOLA 2H2PD 4G6ML 2VDOH 5E2UH 3AUVA 5DDHB 3UTPD 4UDUB 4E9LA 4DFIA 3EO1B 5EU7C 4HKBB 5F7DB 1Z5LB 4PJBB 5FHBL 4Z95H 3V6ZA 3DXAD 2V7NA 1T83C 1E4XL 5D93C 2Z8RA 5JOFB 4OSUL 1JNLL 2QADC 5J56B 3ZSTA 3QUYA 5CGTA 3SKJH 2YPVL 2YN3A 4B5EA 3KXFA 4HJJH 1U6AL 2HH0H 4P23D 3S5LB 4JFFE 2MWCA 3ZDYE 4Z77A 2J6EA 1G84A 3DVGA 3TN0A 1CTNA 2NZ9C 4J3WA 5F7NC 3VI3E 4WO4C 1EBAA 1U8JA 3S34H 5LQBL 2R1WA 2ATKA 3S3JA 4RNRB 4HK0A 2HT2D 1B2WL 3CFEA 1AC6A 5C08A 1VEPA 5FGRA 3IF1A 4F9PA 4PJFF 3VFTB 1WBZA 2I24N 1MI5B 2Z35A 3N9GH 1EEYB 1YEEH 4X99A 1Q72L 4MAYB 3I75B 5EFIB 3MBXH 3GBMH 4R90H 3BEVA 2EDFA 1HINL 1EO7A 1P69B 4CW1A 5TE4L 5KSVB 2P7TB 5GS1C 1JHLL 5EU4A 5IFAH 4HS3B 5C0AA 2NQCA 2YSSA 3VRLF 2DWEA 4PRPB 1T1WB 3QEQB 5GSVB 4Y5YA 4APQD 5JDSB 1I7ZA 5HHNA 4GKNB 5C0BA 6FABH 2OBGA 2R2HB 4J2XA 1AH1A 4JG1H 4AEIH 1S78C 4M7KH 1WZ1H 1TZIB 3CU1A 2JJUA 3V9FA 2EYRB 4KKCD 3TJHD 1OGAD 3BYTA 1QQDB 1AHWB 1QA9A 1G6RB 3D48R 4ODHL 2NY5C 5FHBH 4OGZA 2CLZA 1E4XH 2E5EA 4WUUB 3GSRB 1T21A 3GIZL 1K85A 1XGUA 1A8JH 3LH2L 4LCWE 4QOKE 5ID0A 3WNPA 4N1EA 1FFPB 4K8RL 1U6AH 1HQRB 3CC5A 2AKRA 2YZ8A 5E8EB 3MRBB 5ADOL 1VPOH 3E8UL 4FMKA 4LPWA 1IMHC 3QIUB 2B2XL 5HYQB 1NLDL 1BBJA 1B2WH 3PWLB 4QRQA 2CKBA 4KI5D 1RZKL 4YFDB 4N1HB 1OCWL 4NM4L 3DX6B 4JM2C 2CO7B 1AGCA 1WZKA 3Q3GB 3FQTA 1ZOXA 4PJDB 3F6IA 1T0PB 4AT6A 2IAND 1D9KB 4POZC 2M26A 2DIAA 3A6CL 5TE4H 2P8MA 1G7PB 4FABL 3ARBC 3MUZ1 2JIXA 5D7IF 2HVKB 1DSFH 2P8LB 2A6IA 1RUAL 2GY5A 2DQTL 3MR9B 5KSAB 1T1ZB 1CK0H 2HKHL 1JRHH 1FG2A 4WHTA 2X4PA 3RTQA 2W0PA 1KEGH 1IGFL 4E5XA 4ELME 4ZPTB 4OIAA 1L6XA 2NXYC 2Q7YB 4X0KB 4GOSA 2JK5A 1NCDL 4JFDE 3SCMC 2ITCB 1MQ8A 1MFAH 4LRIA 3CFBB 3BIKB 1IM9D 2CIIB 5BZDB 3VD5A 3LEXB 5D1QA 5CIPA 5D96B 2PR4L 4LIQH 3LH2H 1NANH 3OKOB 1FORH 1M71B 5INCA 3ARGA 4ODXA 5GSRB 2FR4A 1ZHKA 4P2OB 4GRLA 2YD4A 5ICXB 2B2XH 3PP3H 1DQDH 1IQWL 3FZUD 5GGSA 4HFUL 1GGIL 1F4YH 4MX7A 5DMKB 3N85L 4HXBL 1RZKH 2MMXA 1OCWH 2BNQA 3SKNA 4NM4H 3P4LA 3DX9B 4ZXBA 5D1ZB 4NO0B 4PRIE 1K3IA 4ODSL 3SDAB 3ZZ1A 3B5TA 1JZ2A 5D8JL 2J12B 4KY1H 2G5BB 2Y36L 2GW5A 4GAYB 3FONB 1FVEB 1KPUA 3A6CH 3QIBC 4OFYA 4FABH 2DLIA 5DEZA 4X4MA 5B8CA 5HGBB 2H8PA 3FQWA 1TJHL 1WUNT 1SHMA 4JO1L 5FYJD 2DQTH 3T3ME 2OTWA 2HFFB 4J3OC 4OD3L 4TTDD 1MY5A 5FGCE 2Z8SA 1DJSA 3GSWB 3SDXF 3I3DA 1IGFH 1Y0LB 4I0PB 1NC2A 2ZZUT 5B4MC 3HHRB 3O4OC 2IPTH 4I4WB 4ZUSA 1NUGA 2DMCA 4MDIB 3ZTJH 3GMQB 1NCDH 2C3VB 3NCYS 5I74C 2NNAB 2ED8A 4NRZB 2DYPD 4WV1A 5FUZL 2DJSA 1XR9A 1SYSB 3RUGA 3VXTB 5DUBB 3RIAK 1T20B 3MREB 2PR4H 2Y1VA 4MSWB 4PUBL 1U3HC 4FZ8H 1QVOA 5HHPA 1T1YA 4LMQE 3NABL 4ZNEE 5DEFB 4PJHA 4Y1AD 3BZEA 1IQWH 1S7QB 4HFUH 2ARJB 5LGJB 4K3HA 4PJ9C 3NH7L 4X6CB 1T7WA 3VA2C 3N85H 4MA3B 4G6FD 4JZOB 4NBZB 2VLMD 4FZEH 5GJTH 4G42B 2WM0A 4QRRE 1V3MA 3WN5B 4LL9A 5I1IL 1T22A 5DRXB 2MJWA 3SDCB 3U6RB 5IW1B 3OZ9L 3IVKA 3DX7A 3PWPB 3VXPB 2BSSB 4LCIL 5DHXB 1CGWA 4JZJB 1BQHA 3UJJH 3NCEB 4LHQB 1S5HB 4P46B 3F7RA 2PYEE 4JO1H 5C6PB 3T0AA 1LP9A 4OGYH 5C6TL 3RWIA 3E6FB 4FXLA 1ETZA 2FEDD 3RKDC 5E6IB 2W65A 1KPVB 4H0IA 4U3CA 1JJUA 5IB2B 4MNGB 3ZYOA 1H0DB 2VABA 5HDOA 3SGKA 5GGUB 2K7QA 4QLRA 1EA9C 3O3BA 4L4VE 3MRQA 4ZMAT 5B39B 5SWSA 2C1PA 1OM3L 5FUOL 3BE1H 4CJ0A 1GZPA 5FUZH 3GSNB 3TBYB 4KAQH 1EO8L 1MIEL 4NO2B 4X6DF 4U1GC 3BQUB 4L1DA 4FHBD 4LSDA 1QACA 3BPNC 5IR1B 3MLWH 3VWJA 2V17L 4W6WB 5HHMD 4CNIB 3QO1B 3C60D 1ND0B 2UZYB 5D7IE 2F54B 1R0AL 3G5YA 4MJ5A 4FTVA 3NH7H 3H7BB 4OZGB 2GK0B 5HHOA 4LVNC 1KCVL 3KPOB 1UXWB 3D39A 4DZBA 1X6LA 2Q86A 5LAXB 1XGQA 3IDUA 3ULUC 1QKZH 1J18A 1MUJA 5T3XD 3LB6D 1AD9A 4JRXD 1ORQA 4YPGB 1II4E 1RI8A 3RVVD 2R15A 4LLQA 1U8KB 1FYHB 1BGXH 3W39B 1R3KA 1RK0B 4Q9BA 2X1XR 4PJ7E 1UWEL 3EOTH 3MV7B 15C8L 3BYYA 5C2UB 4FFZH 3RL2A 1U8OB 3SY0A 5H37H 1BX2B 3OKYA 1S7TB 3PF2A 1ZA3B 3MPCA 1VFBA 4O2EA 3B8YA 3TVMA 1UKQA 4YR6B 3DUSB 1JVKA 2GJ6D 1I1RA 2FNBA 4L8CA 5HY9A 4DFHA 1FL5B 3NMEA 3KPSE 3IETA 2P5EB 4ODWA 1FZOA 4LPXA 5I73B 3MLSL 1LK2A 3CVIH 1OM3H 5FUOH 4X4ZA 5TE6L 1OY3B 5ID1B 4GFTB 1IGIL 3SDDD 4Q0XH 2LVCA 1JTTA 3T0WA 5FHAH 1PYWB 4OF8A 1EO8H 3GSOA 1MIEH 4EUPG 1C16B 4N90E 4RISL 3OKNA 4OB5L 2V17H 4NM8L 3RA7L 2AV7A 5D5ME 1IGJA 2J2ZA 3O2VL 4GW4A 1KJ2L 1R0AH 2R8SL 2A77L 4JFFB 4ZAKB 3HUJF 5FYLH 3OKKB 2AK4E 2O26U 4HK3J 1KCVH 3L7FB 2X70B 2BVQA 1FE8L 2NX5D 3H3PL 4PRDB 1EJOH 2H9GB 1VACB 3CSBA 2EDDA 5JZ7C 5DYOA 3MBED 1U92A 5T5FL 5DJYA 5EU6E 3D85B 5T3ZE 1BFOA 1UWEH 4OFIA 3PWUA 4JPIA 4RRPG 15C8H 2C5DC 2Y25A 1PDKA 3FRUB 3AFLA 4Q9QL 2OL3B 4Z7VE 2CIKB 1DDHB 4FQCH 1EEQA 4WIQA 5E2VH 4LEOB 2OZ4L 4Q2ZB 5H2BB 2LV4A 2ESVE 1MLCB 3LPGA 3MLSH 4GLRI 5A2IH 5MI0C 4X98A 3HZVA 1JPSL 3Q1SL 3KYNB 2Z92B 4IRJC 3FFDB 3VFWB 5EZLA 1IGIH 3CDYA 5K59E 3ULVF 2Y7QA 4NKMA 3WFCL 2YEZA 3W11C 4N0CD 4YHZL 5F3HB 1C1EL 4RISH 4CMMB 1R5IA 1ITCA 1UH2A 3L3OB 3L5XL 3RA7H 3STZA 3B9KD 4KKBC 1NC4B 3U4EB 3O2VH 3UDWA 1JZ4A 3KPRE 4ONFL 1S3KL 1KJ2H 5ACZA 4Y2DD 5IESL 2A77H 3PWJB 3INUL 4C58B 1B9ZA 3I50L 2COQA 4R2GC 5JPNB 4K7PY 2VWEC 1Y6MR 2NY4B 3BH9A 2F74A 3JVGA 3HS0A 3H3PH 3EYVA 4P3CL 1JK8A 1DL7L 3FT4B 3QQ4A 1AO7A 2LABA 1CXIA 5C0CE 2EYSB 4H20H 1YECL 4G9DA 4TPRL 3KXFD 4CN4A 4QCIB 1N64L 2NW2A 4GAGL 4X6BA 4BFIB 4X8JB 3GJFB 3X14B 3N50A 4LPUA 2CLRA 2AI0L 1YY9D 4HIXL 1XGRA 2R2EB 1WCQA 4U7SA 5IM7A 4KTEH 1GSMA 4LCCA 5F9OH 3C5JA 5C9JA 3JTSA 4Q9QH 4AH2B 4OGAD 1LO5B 4CN1A 3BDXA 3V6OC 4ZSOE 5IVXF 1NMCB 1TLKA 3PWNA 2HT3C 1KUMA 1NGQL 1UT9A 1N5AB 2OZ4H 4KVNL 1NGXB 5E24E 4QYOB 3QDMD 1A6TA 5EO0A 3D18A 1R5WA 4W70A 4KUCF 1AKJA 3QO0B 1Z9OA 2OM5A 3Q1SH 1H3PL 4MCZB 4L4TE 1QLFB 1QR1A 2NZIA 3IDMA 4JFDB 5C0AD 2KL6A 5ESQB 4JN1L 2DI8A 5GZNC 1C1EH 1DUYA 4JPWL 2OR8A 5C0BD 4HF5L 2FSEA 4HGWB 4C56A 1H3WM 1CFTA 1GRWA 3I6GB 1L7TL 1SYVA 1YN6B 2PO6B 3KYAA 5IESH 3INUH 5CSBA 2DLEA 2UYLB 1SVZA 4M3KB 1D5MA 5DD6A 5C7XL 3RNKB 3WFHA 3O8XA 4I2XA 3VXOB 3UBXI 4TNWF 1A4JB 1W0VB 4P3CH 3T0XA 1DL7H 1PLGL 2ATPA 2A83A 4XXDA 4IHOB 5GGQH 4HXAH 4LSQL 1BZ9B 5JIPA 2NMSA 1SBSL 1ZWIA 2GYSA 1N64H 4WHYG 4IIQB 4JO4H 2DL9A 2O5YL 5ANME 4LAQL 2R4SL 3W5NA 3PQYD 4AL8L 4HIXH 3EDKA 3GI9H 4G8GA 1QPXA 4D3CL 1K5NA 1UJTA 4YDJB 1T4KA 2UWEF 5DEGA 4QTHA 1QFUL 4H5SB 3K2UL 4LFHG 2HLFC 3RWJB 2JLLA 1PG7L 2FJFA 5FGCB 3TWCH 4KVNH 3FHQA 4PG2A 3EYFB 5FA4A 3BT2L 1YA5A 1A7BA 1HHIA 2C7UA 1H3PH 2E7CA 4Y89A 3EDFA 3OB8A 5HI3D 2FLBT 3DTXB 4F9LC 3KAAA 4JN1H 1OAKL 3S35L 3L3HB 4DKEL 5C0EA 4JPWH 1YEKL 4PJFB 5IB4A 1OAYL 3WYRA 2FHBA 1B0GA 1OVZA 2W92A 4RSVA 3RTQD 4NPYB 4N8CL 1U93B 4M5YL 2QTEA 1YEHL 5I71C 5C7XH 1RJYB 3I85A 4M7LT 1H5BB 3OKEB 1QZ1A 2FX7L 1TZGL 3DSNA 4PY8I 3DETC 4NQTA 4R4FL 4EDXA 1A14L 1FJ1A 4D0BB 5D1QD 5E8PB 5JHDA 1ZT1A 3NA4A 3F62A 4LSQH 3SJVA 1X7QB 4DKAA 3O4LE 4PRHE 1SBSH 4QRRB 3S98A 4PRNA 4DAGL 3ARGD 5FFLA 2O5YH 4LAQH 2R4SH 3CK0H 2DWDA 4GRLD 3FTGB 3FB7A 3RDTA 1OTTC 2V5YA 4OTXH 4M1GL 1S5IL 3U9PH 4D3CH 2GJZB 4HH9A 2FGZA 5IROC 3V0WH 3K4DA 1RUQH 1QFUH 3UTQB 1FV1B 2WV3A 3R06B 1Q9WA 1DLFL 2BNQD 2PYEB 3MNWA 4ZXBD 3FT3A 3L5WB 3TH4T 1PG7H 1ZGLP 2OS7A 3MUY1 4RGND 5KS9E 4TUKL 2DJ4A 3BT2H 4I8DA 5FB8B 3IKCB 1UZ6F 2AXFB 4UNVA 3FRPA 4L4VB 3JSSA 1RY7B 4EXPX 3UTTA 5IFHL 1O5DT 5ENWA 4O00A 4PRBB 1MJJB 1OAKH 2C26A 3S35H 1GZQB 3PJSB 4DKEH 4KJYA 1YEKH 2YBRA 1OAYH 4JFXB 4PJ5B 1NQBA 5B3NA 4GAJL 1NC2D 4ZUUB 2V5RA 4N8CH 4M5YH 1YEHH 2BHYA 2X1OA 2VAAA 5D7IB 1H3VA 3N1FC 4EIGB 3UTOA 4XCEA 2VDNL 1ZLUH 1OPGL 4WU5A 1T2XA 1BAFL 3TBVA 5C0FA 5ITFB 3OBAA 5D71L 4IOIB 1U2HA 3MV9E 5EPMB 1QNZL 3IJSB 5J7CC 5JW5B 3V7MA 5L8JB 1A4KA 1S5IH 2AEWA 3O3DA 4A6YA 3ES6A 4EKXA 2MNUA 3D3VA 4YDLB 1YEDA 1DLFH 5MERB 3LKSB 1N2RB 1VCAA 4LHUD 3Q0HA 4OD2A 3QG7L 4WW2A 1NCTA 1ACYL 4U1KB 1E4KC 4JN2B 4TUKH 2LQRA 1U8NB 2E9BA 1RHFA 1NBYB 3DGCR 4LNRB 2QHRL 5EO1A 3E2HC 2V9RA 3KPSB 3QFDA 4IRSB 4OZIF 3EO0A 2WMPA 3G6JF 1MSPA 1KB9J 3CFJB 3O6FA 4CL7A 4N0UA 4LARH 2QR0B 4OZHF 2DMBA 4LMQI 1Q0XH 1ZLWK 3CXHK 5C0ND 5I9QB 2HG5B 3SDYL 1MQKL 1X5LA 3LEVL 5DUPL 4GAJH 2V9QA 5FO7A 3MRNA 1ZGLM 3IRPX 3MCLL 1EH9A 3BISA 2R29L 1ODAA 2RFXB 4UNUA 5SWSD 1CDGA 1FNGA 4EIZC 4BH7A 3VD9A 1MCFA 2EDJA 1BLNB 3MJGX 4U1NA 1LK3H 3GSNH 3EIFA 4OI9A 3UAJC 3VFOB 2VDNH 2BSRB 3P30H 1OPGH 4P9MH 5L0QC 1BAFH 3V6FA 2DBJA 4Z76A 5IMMB 2H3NB 3H9ZA 5FGBA 3SDXB 3Q6GH 3VWJD 5IQ7H 4NT6A 5DJ0A 5D1XD 1QNZH 5FIEA 5GJSH 4NN6B 3T09A 1MCPL 4GXVL 2GFBA 2E6JA 1HXMA 3EOYG 4P5KA 4PP1D 1HQ4A 1RJZA 1KPRA 3OWEA 4FTVD 4P5TB 4CVZB 1JGEA 1NH6A 5HHOD 2CGRL 2AJZA 5TFSL 1MCQA 4FQHB 2VISB 5DI8B 3KPTA 2PYFB 3QG7H 3AY4C 4G9FE 5HI5C 1ACYH 2ZG2A 4Z7VB 4YDIL 3TO4D 3MRPB 5FYKD 4WFHE 1KXVC 3ARZA 5JOFA 5EWIL 3E3QE 2ICWB 4AIXA 2Y6SD 2ESVB 4KPHL 2DKUA 2ZCLL 3JV0A 4G8EA 4CADB 5E1AA 3C5ZB 4JHAL 4A2LA 4DTGL 4C54A 1EFXD 1ZHBB 5B22A 1AGBA 3HE7C 2G75A 1XZ0A 4UOW1 4PJCA 4XNUL 3S37X 3SDYH 2W38A 1A1MA 3QDGE 3TVMD 1MQKH 3LEVH 4OAWA 5I6XC 3TNNA 1F00I 1MI5A 2OZ4A 1OL0A 3LRSA 2R29H 1F2QA 3MRJB 1KG0A 2W0FB 3GKWH 4MAYA 3BFOA 4NNPH 4P4RA 3IFNL 5B21A 1YPZE 1UKTA 1GH7A 1SJEB 1BOYA 1PEZA 5CZXD 4Y88A 3G5ZB 4HS3A 1OT2A 1VGKA 2RGSA 3TO2A 2N7BA 1OTSC 3KDMB 4K23H 1TIUA 5I1JH 3F5WB 3OAZH 4LKXB 4F57L 4YO0B 3KPNB 4GXVH 3D2UB 5A2JH 3O81A 2HT4C 1F3DJ 2CGRH 4TSBL 3JWNC 1HEZA 5IVZB 4AG4L 1S9XB 1B88A 3VMPA 1TZHB 3BXNB 1JGVH 1HIML 5LGHH 4YDIH 1KT2B 4NJ9H 3AB0C 3MGTB 4K7PL 4AIZB 4EUPA 1MFDH 3LKOA 2GTZB 5EWIH 3MYJB 1OGAE 2X4QA 1UFUA 3QB7C 2NYYC 1EK3A 1HQRA 4PYHA 2EECA 5CD3A 2ZCLH 5ILTL 2B8OT 4JHAH 3K81A 1LD9A 3U4BL 4L4TB 4DTGH 3VW3L 1WC7A 2CH8A 2OL3H 4OLYL 1YMMA 1OWWA 5JPMA 4UU9A 4F7EA 2BNRB 4MJ6A 4L3EB 1KN4L 1UB6B 1I8LA 5HDBF 3WFBL 3QUXC 3FQUB 1ZLWH 5A3IC 4OCXH 4S1SH 2VZSA 2WANA 4KI5E 3BZ4A 1WWCA 3LEYH 4RAUB 3QWQB 4OLUH 5SV3A 2FYYB 2HTKD 1M05A 2YWZA 3U0TB 1I85C 4RRPA 4MD0A 5HVGB 5ISZE 2Q6WB 3ZKQD 1CFVL 1FL6B 3M17B 3CNKA 1LEIA 4Q58C 3MR9A 4F57H 2F58L 2I9LA 5GRVK 1KTLA 3RWGB 1G7LB 4MJIE 3G6JE 4OV6F 1MPAL 3EYSH 4R0LA 3VFMA 5FECA 3C2AL 4V1DE 5ANMB 5T33L 3RY6C 1IQDA 1UZ8A 3WFDH 1BQSA 1HSAB 3MV8B 3JV4A 2MQ0A 2UV3A 1U41A 3G9VA 2XWBB 1A6AA 5F7LB 1JNHA 4F2MA 1AO7D 5J9PB 5I1DB 3HG1B 4CN6A 4K7PH 1P7QB 3BDYL 1BVLA 4JRYB 4K8RD 5KSBE 3KLHC 4PYGA 1M71A 3STLB 5FDWA 3GJFH 3HUJB 2GT9A 3F12B 1QBML 3QDHA 1K2DA 1F6AB 5JA8B 1EJ6A 2ARWA 5F6IB 2JJVA 3NIGF 2NLJB 1DBBH 4GG8B 4LRNL 3VW3H 2CK0L 2DTML 2X9XA 1YEJH 4WNQA 4OLYH 5CLTA 1EXUB 5JQ6H 2JKXA 5DMKA 3IS1X 1KN4H 4Z78A 1OD7A 2R1XA 1MRDH 5GS2H 1F2XK 4PBXA 1ZT4B 2XY1A 3LVEA 4PJAF 1V7NL 5ETUA 5F96L 3WFBH 1U8HB 3H3BC 3SDAA 1FZKB 1AKJD 2A74A 5I1GL 2DQDL 3FB5A 5J13B 5C92A 4G7YL 5EIIB 3K8MA 4U49A 1H8OA 3EW3B 5CJXA 4MD5B 3MNZB 4M8QB 3WUWB 5E0QA 1VEMA 2ZKHH 4PJEE 3TA3A 1E28B 3AXLB 2F58H 3RJDA 4C56D 3GSWA 3GO1L 3W9EB 3PWVA 1WIPA 4LPCA 1VSCA 3S36H 2VDML 5GRVL 3O8XD 4HKJA 1AHWC 2NNAA 4BSWB 4NNYB 4PRAA 3VFNA 4EJ1C 1QFOA 4RAVA 4PJIA 4Z7OE 4ZTPH 4LEXH 3ILQD 4U31A 3EYQC 4R4NC 5JMRA 3RGVA 4KH2A 3V5DB 4XNZB 5GS0H 5AZ2L 5KS9B 2Y5TB 3D6GA 4ONHB 5IBUB 3QIUC 4G8GD 1EHXA 4ODVL 1T3FB 5DEFA 2YUZA 4UDTB 3HZYB 2H1PH 4LRNH 3SE9L 3VXME 2J88L 3MJ9H 2X7LB 5J1SC 3DBXB 5J6GA 3FCTB 3A6BH 3MRCA 3QWOA 3L9RB 2FRGP 4GT7A 2CDEB 3WFEL 4KJQC 5F96H 1GOHA 4LKCB 3I02A 4Y1AE 3KLDA 4N8PA 4Y4FB 3D25B 3F58H 1BFVL 5L2KA 3U6RA 1D9KC 2GAZB 2DQDH 4G7YH 4XHJD 3FQRA 3QXAB 4YX2L 4DW2L 5JOPD 5KW9H 5IVXB 5DQJB 1P4LB 4M6NL 1YN7B 3RVWC 1MHCB 4FQ2H 2HKFL 1RU9L 4G80A 5AYUL 1NLBH 1EUTA 1HKLL 1C7TA 2IALB 3H9SB 3QHFL 5BRZB 4WI2A 1LGVA 4R26H 3P4NB 3RKPA 5CEZL 2ICEB 2VDMH 2R4RL 3KPPA 1FAKT 2SEBB 2VLJA 1OSZA 1FIGH 1S7XB 2F53A 3V5HB 3TCXA 3HMXH 4PB9L 3AU1A 5JHDD 3SPVA 1JHTA 2NY6B 3U7YL 1MCOL 3SJVD 2ARJQ 5DRZA 4BZ1H 1YQVL 2IAMA 2G2RB 4NJAL 2W60A 4NO2A 5C3LD 3U4AA 2YD1A 2DLGA 5AZ2H 3FQNA 1BD2E 1XF4B 4GKOA 5EOTB 3CSYB 4D9QE 4OI8A 3RDTD 4P2OC 4UAOB 3HI5H 1OHQA 1SEBB 4ODVH 1NCUA 1T04B 3SE9H 5ESAB 2J88H 3P9LB 2FJHA 3MXWL 2MPAH 5E99L 2GK0A 4KHTL 4JAMB 1UXWA 1SM3L 1AJ7L 3WFEH 2BOBA 1X5KA 4P3DB 5D1ZC 3WDIA 3BO8A 3NIDE 5E7FA 2XYCA 2V2WA 5GZOC 4Z7WA 3O6KL 4XBGA 5I2IB 3V0VA 1U3JA 5HI4D 3ARSA 4ENEC 2UWEB 3D0VA 3UTTD 4R4BA 4LLWA 4PY7A 1TJGL 5TJWK 3CDGB 4JB9L 4DW2H 4J4PA 1YJDC 4K2UH 5BXFB 4JRXE 1AE6H 4GS7B 4M6NH 5CHNA 1ES0A 4ZOCA 1UJ3B 4RFOH 4FQXB 1S7TA 1C5CL 4Y4KA 1RU9H 3LN4B 3QPXL 4BH8B 5AYUH 2Q7NA 1HKLH 4FFVC 1DLHA 3LPFA 5C09A 3O41B 4YR6A 3UC0H 2BRQA 3DUSA 3GSQA 2VXTL 4I0PC 3H8NA 4EBQL 5CEZH 2L7UA 2R4RH 5INDB 2VQTA 3QZWG 4C4KO 1JZ3A 3DUUB 2ADGB 4JFYA 2UZIL 3P9MA 4UT6H 2NCMA 1GJIA 3RWFB 5J11C 1UM5L 1HHHB 1YDPB 3U7YH 1UCTA 1YQVH 1FC2D 4MWFA 4G9FB 5D7KD 5BMFH 1OAQL 5BV7L 1TVBA 5JW4M 3X11A 3ILPB 3EFFA 4KK8C 2JCCA 4XGZB 4HFWA 3ZKXC 4YHPA 2R0ZL 1T2JA 5A43C 1U8PB 3D3VD 3DXAB 3MXWH 1YYLL 1L7IH 4HQQL 4KHTH 3K74B 3PG2A 3NZHL 1SM3H 4TYUA 5HYJE 1AJ7H 1OAZL 3Q2CA 4PRDA 4U1LA 4P23B 1B0RB 4AENB 5IOPA 3FO2B 3MJ7B 1J1OL 3OKMA 1Q9OB 3SDCC 2Z93A 4R97B 5I8CB 2NX5E 2BVOB 4JJ5B 5AAWA 3X3FL 1N4XL 4PGBB 2WBWB 3SO5A 3K80A 1TPXB 4L3AA 3VI4E 4JZJC 4JB9H 3RWCA 3O6FD 3CLFL 4HWBH 1ZK9A 1LDSA 4XX1E 5EBMB 4ZOBA 4MQ7A 4P46C 4WI8A 4QF1A 2X2YA 3HC0A 1C5CH 5I1KL 5I66B 4M7LL 3HB3C 4JFPB 5CJBA 1NCNA 3JZ7A 1NGYB 4I18B 2IADA 3T2OA 3LS5L 3GSXB 2VXTH 1MY7A 4EBQH 3N06B 2JB6B 4H1LB 5D4QA 1F5WA 5I8KL 3E6HB 4AM0A 1IFHH 3H2WA 3NPSB 4DCQB 4M9OA 2UZIH 4F8QA 3ZE2F 4APQB 3MFFB 2Z92A 1BIHA 2WSKA 4MXVF 5DJCA 3K3QA 5EN2A 3BQUC 2VZTA 4NQVA 1OAQH 1OF2A 3LSOA 1ADQL 3ZLQC 1SJHB 3ZO0A 3RHWF 1KFAL 1NCBL 1P5VA 1UA6H 3VFVA 3LKRA 1OGAB 1KV3A 4PV8A 3A0OA 4G43A 5AUMA 1J0JA 5JORB 4H26A 5FA3B 1LEGA 4IRJA 2X09A 4JREB 2CJUL 4HQQH 5JPNA 2VDRL 3ZE0F 1YYMH 2BK8A 3BUYB 2VDKL 1DVFD 1OAZH 1P84J 3V79C 4S1DC 1J1OH 4HJ0C 2VSDA 4KXZH 2P43B 3WXVH 2NTFB 2V5SA 1R3JB 3KJ4B 1SY6L 1YMHB 1FVDB 4G8FA 1H3UA 3DIFA 4WUKL 2D7OA 3EGSB 3CLFH 3WUWG 3IKKA 3KXFE 4HBCL 5GXBB 2PW1B 1URLA 2EH7L 3AREA 4U1HB 5I1KH 4YLQT 2BVYA 1EAPB 1LNUB 1DFBL 2DL2A 2IANB 4UBDD 2QADD 4TSCH 2IMMA 1KBGL 5L6YH 4YJZL 4LPYA 5FM5O 2FBJL 3RIFF 5DJXB 3G6JB 5I8KH 2NZ9D 5C08E 3QXTA 4Z7QF 1LEKB 3TBWA 3OKLA 3OXRA 5D7JC 1HHJA 4OFVA 3V6OA 1E27B 2GIYA 2MCPH 4XWOC 1IL1B 3CDCA 2C1OB 4XCFL 3MCKB 1X4ZA 3DX8A 4NUJB 1T2QL 1NCBH 4PB0L 2EE2A 2ZNWA 5DQ9B 4Z0BH 3WIHL 2EXYC 1WWAX 4G5ZL 3BZFB 5GIRA 3LQMA 4RGMB 5KSBB 4ZAKC 3TZVC 1IM9B 1ERNA 4P2QE 5C0BE 1F97A 4YBHA 1OSPL 2VDRH 1U3YA 2MOVA 2CRIA 4YFLF 3VXOA 4Q7DA 4ZQKA 5IUSA 2VDKH 1SVCP 1YZZA 3QJFB 3BIAX 1RZIA 1DN0B 3K7UA 2UY7A 3QRGL 4R96A 1L9MA 5DFVC 4BA8A 1B3JA 1GGCL 3QUZA 5F93C 5DRWB 4FFWC 4JVWA 4H25A 4J3SA 4XNQB 5EUOA 3VH8B 3HLAB 5JIIA 5DT1L 1V3JA 4QWWC 1LP9F 3L7EA 1N6QH 4JKLA 1YMMD 2XZZA 1OARL 4GW5B 1DFBH 1A3RL 4XZUA 1NSNH 2GTWA 4DOHE 1P84K 2EICA 2FEEI 1MFNA 2FBJH 2QHLA 4MNHA 1XGPB 4NQDA 5IWLA 1MAKA 2A9NH 4HWUA 3G5XA 3EJZC 5T1LA 1G7HB 4XP5L 1RJLB 3EYUH 5E5RB 4RZCA 1TITA 4XCFH 4JM2D 2WQ8A 5F44A 3QULA 3O3EB 4PB0H 3CX2A 4YBQC 3Q48A 4M1CC 5IQ9A 5L8KB 4OF3A 1W72B 2DYPB 4G5ZH 4HKZB 4POZD 3S4SB 1MFCH 2BXZA 1OSPH 1RJYA 2NY4C 4HZAA 1JPFA 1CD9B 4MA1B 3BP6B 3Q5OA 4WFFE 3QRGH 4U1JB 5EOQL 2G9HB 4TNWK 1XF2A 3KR3L 4TN9A 4Y1AB 5HPMA 1CFSB 4DVRL 5LXGH 5FYJU 3N0PB 1HN1A 3IDJA 1NGWA 4EI5C 4MDJB 4W81A 2VC2L 2FJGB 1AD0B 2F8VA 5DT1H 4G6FB 3MRGB 1GYAA 4XXCC 4G8IA 4MNQA 3SCMD 1ZAGA 2CSPA 3JV5A 3KPLA 3TT3H 5C07A 1NKRA 1OARH 2BERA 5K33A 4Q6IB 3SN6N 1NMCC 2VZ3A 2FL5A 3RVUC 4YHNA 3CVHB 2YPLA 5MEQA 1PEWA 1XF3B 3SDAD 3LD8B 2EKSA 4LU5L 4ZOAA 4YBLB 4BUHA 4QXWA 5CMAB 2IGFL 1NCAL 5EU5A 2IFGA 5F3BB 2BNQE 1MRCL 2VLKE 2O5ZH 2CDFA 3ULUE 2VKWA 4MA8H 2J8UF 3Q6FA 4XP5H 4PRBA 4RGNE 1FZJA 2XA8H 2OYPA 4BFGA 3TA3D 1L0YA 2XA3A 1MIML 4X4ME 4XH2A 4Y0GA 4PJ5A 5CKGA 4I77L 5FM8A 1JFQH 1H15A 5KSUA 2PO6C 5I0DA 2VH5H 1J8KA 4PG9B 4JQIL 3RZWA 5IB1B 4ZFFA 3ULVH 2F5BH 1U8MB 3IGAB 5L9DL 1J7VR 1I1AA 1BBDL 5D2LE 2I25N 4HHAB 1QSFA 2ADIA 4I5BA 2NY3C 3GKZA 5HHMB 1NFIB 1YY8A 3C60B 4XVTH 4HS6A 1KOAA 4M6ML 2A0LC 3BGMB 2YPKA 3T0BA 2C3WA 1I9RL 4FXKB 3RGVD 4YHIA 1MCRA 1KIPB 2IBBA 2A73B 1DBJL 4HV8B 4I1NB 4D8PA 4IIQC 5B4MD 3TYFB 3RUGE 3SHSA 5GS0C 2IFFL 2NY1C 4PD4J 5JW5A 4Y5XA 4TNVF 3HRZB 3V8CA 1GC1L 4WEMB 3M8OL 4DEPB 1KCRL 4JRXB 5ICYB 2A6JA 2ICCA 3IXAA 3NGBB 4PJHE 1U3HD 1KXQE 4RBPH 3GM8A 4ZUTB 1ZVYA 4LU5H 3OSKA 3QBTB 5CILH 5H35B 4H1LG 2IF7A 4YDVB 5L2KD 3VXUE 2IGFH 1E6OL 1NCAH 1U8NA 4UILL 4HX1A 1K4DB 5I8OL 2APBA 2ZCHL 4FXGB 3V4VL 1OTUC 2ORBL 5JMOC 5SWZA 1P7KA 2A2QT 2XWTB 2GJ6B 4ZS6C 1N3NA 1XR8A 1QRNA 3IJHB 4PJAB 1PQZB 5IVNA 1MIMH 1VFAA 4LFHD 2UUDK 1HYSD 3DSFL 4XP4H 3H9HA 3OXSB 4QRSB 5D7SL 4YWGL 1MELA 5J57B 3MFGB 3BGAA 4K3JH 3RFZC 4YHKL 3SDDB 3C08L 2DF3A 2B20A 3GEWB 2VLJD 3H9YA 2F53D 1KB5L 3DV6A 1H5BC 3DWTA 5D70L 2EDHA 5L9DH 1BBDH 3T0EA 3AS2A 3VFOA 4ZFGL 4D0DA 1MH5B 2IAMD 2IPUG 3VGAC 1I1FB 5FKPB 4TVPL 1DBJH 2VN4A 2IFFH 1F45A 4U6XA 4EOWH 4MXWH 2NX5B 3HA0A 2E7HA 2VR9A 1GC1H 2D9QB 2HMIC 2IPUK 4ZODA 4ODUA 1FGVH 3MBEB 4FQPA 1AXSA 3V4PL 4NCDA 3DLQR 1IC7L 2AXGB 3CUPA 1NBQA 5EA0H 4FTVE 3OB0K 2X9YA 3VFPA 4CBPA 5E5UB 5HHOE 4L5FH 1J05B 5DJ2B 4PLKD 2NY2D 3D39E 3MLTA 4UILH 5CJ5A 1TVHA 4ZS7H 5DD1L 5FYKE 3V4VH 3BD4A 2E27H 5KAQF 4HH8A 1JWMA 2WBJA 3PP4L 5C71A 1QR4A 1EEUA 4Y4KD 3U0PB 4L8DA 1QLEL 2QKIB 4NHUB 2XXMB 5K93A 3SGJC 2OSLA 2WUBL 4PP2A 2DKMA 3DSFH 4Y16A 5C09D 1MVUA 5D7SH 4YWGH 4KROD 5ERWB 5DD0L 4YHKH 1IZJA 1B4RA 3C08H 3MRJA 3KPMB 2GSGA 1KB5H 4OF6A 2QQKH 5D70H 3Q5YA 4HJGB 5D72L 3B9KB 2P5WE 2NY7L 4ZFGH 1SMOA 3D9AL 1L0QA 3HPLB 2F19L 4Y2DB 4HAGA 4JY5H 5CSZB 3KDMA 1JWUA 4PJGA 1A7PL 1IEBB 3T4YA 4LKXA 1ADQA 2CUMA 2ZOLB 2XZCL 3BVNA 5C0JB 1ZSDA 5JR1L 1XMWA 4QGYA 3V6ZB 4CVUA 2V7NB 5EULV 2WWMC 3QZWA 4XNMA 1ED3A 5HD8D 4YDLC 2B7DT 3T1FA 2GKIA 4W68A 5DLMH 3CFDA 1I7TA 3KXFB 4X6DA 1IC7H 5HYFA 3MODL 4Z77B 3DVGB 4NO3A 1FAIH 1U8JB 3MGTA 2R23A 2R1WB 1HILB 2ATKB 4D0CA 4HEPG 4HK0B 4OQTA 2QV2A 1U95A 4Y4HC 4WW1A 3CFEB 3C09C 1SY6A 2EDOA 4JVPA 3IF1B 1KYOJ 4NQEA 4S10A 2EH8H 2Z35B 4WFGE 4WTXA 1KTRL 2D0FA 1FFNA 1QLEH 4X99B 4WI7A 3QDMB 5I9QC 1J0ZA 2AVGA 5JZ7D 3BEVB 1UWXK 1CIDA 2BNRA 2E7LA 4M62H 1WBYA 2A1WH 5DA4A 4CW1B 4H1LH 5EU4B 5DD0H 3QEUA 5C0AB 3EUUA 1CXHA 2UUDH 2YSSB 2YA1A 4G3YL 1TQBC 3MLXL 1QP1A 1I7ZB 3QUKA 5C0BB 1WFOA 4JCLA 4ONGL 5D72H 2NY7H 5KJRL 1XFPA 3D9AH 1XH3A 3BEWA 1NGZB 2F19H 1EVTC 2Q87A 3TT1H 3M17A 1XCTA 3GJEA 5DUMH 2XZCH 3IAPA 2JB5H 5JR1H 1QA9B 3FO1A 1K8DA 1F13A 4NN6C 3WIHA 4BQBA 1MCIA 4P5TC 4WU7A 4BFEA 2NPLX 4L9LA 2CLZB 4IRJD 2PW2A 2XRAL 4NDMA 1Q9LA 1XGUB 1UKSA 5ID0B 2RB8A 3CC5B 2AKRB 3MODH 2IQAA 1RUML 4U3HA 4KKBD 1GAFH 3PQYB 1R24A 4DOHB 4L1HA 3SBWA 1P7QA 5K9OA 4JRYA 1BBJB 5DHVA 4QRQB 2CKBB 3OB0H 3RY6A 1AO7E 3C5ZC 1ZS8A 3OGCA 1AGCB 5DD3L 3IDGA 3ARED 3ZKMD 3KLAA 4AT6B 2X1PA 5C0IA 3I9GL 1QFWI 1N7ML 2P8MB 4NOBA 3SQOH 3B6SA 4P9HL 2OJZH 3UJTL 2J3SA 5D6CA 3OF6D 3QDJA 8FABA 4G3YH 2A6IB 1NAKL 4U4BA 3PL6A 4YEEA 4F3FA 4X9IA 3HCVA 5A2LH 4ONGH 5KJRH 1F8TL 1FG2B 4WHTB 1MNUL 2XTJD 3RTQB 5HJ3A 3QUMA 4P0DA 1ZMYA 4W6XB 4E5XB 5CKAA 3DVNA 2HT3D 3M1BA 4UIMB 3RI5F 1KC5L 1CE1H 5I1EL 5K9JH 4YHLL 1KLGA 2JK5B 5LCVH 3MLVH 2ADFL 4LVEA 3VGHA 2VYRE 1LO4L 4I0CC 2XRAH 5CIPB 5D1QB 1LE9A 3QFJA 4C56E 4WW2F 4P59H 4DWHA 4QNPE 5I1HL 5INCB 3ARGB 4ODXB 3QHZL 1RUMH 2FR4B 1ZHKB 4GRLB 3QUZD 2WW8A 4UT7H 5GGSB 3BJLA 3MA7A 3CJJA 4Z7UE 5HGGS 3QXUA 4MX7B 3FN3A 2BNQB 3SKNB 4JDTL 5KG9B 3BKJL 4ZXBB 5DD3H 1KJ3L 4QY8A 5J1AA 3HZYA 2CRYA 3BD5A 4N5UA 2G60L 2Z0BA 4XAWH 4YHML 4BKLA 4RGNB 1V3KA 3I9GH 2XWJB 1KPUB 5IBLC 1N7MH 4BZ2H 3VXRA 3CVHL 4HGKC 1S7WA 3UJTH 3T8XA 5B8CB 4ZO9A 4PGEA 2H8PB 3FQWB 1DEDA 3D25A 3JBG7 3CH8A 4NQDD 3VDBA 2OTWB 5FYJH 2Q8BL 2Q8AL 2A9ML 2NR6C 4XVSL 2B1HH 5T1LD 4UIKL 1F8TH 2ZCKL 1MNUH 1S9VA 5D6DA 1NC2B 2XZAH 4AIOA 4ZUSB 1KC5H 1JP5A 4YHLH 2OP4L 2DDQL 4M6OL 3U7AA 5JOPE 3NN8A 2IBZY 1W72H 1NPUA 4WV1B 1L0XA 3H9SA 1XR9B 3RUGB 3BW9A 4D2NA 3NBNA 1EHLL 2CQVA 1G9EA 4PREA 2F5AL 4J3TA 1QVOB 3BZDA 5HHPB 3SQBA 5DMIH 1T1YB 1T03L 1DQQA 4KK6C 4DK6A 2C4XA 4PJHB 3GRWL 3BZEB 2AW2A 5GISL 1QFPA 2DQCL 4XC3L 3JWOC 1W0WB 3O6ML 2Z8VC 1F6LL 5FDYA 3RL1A 3NZ8A 1BZ7A 2DM2A 3SJVE 4MNQD 5F6IC 4ZG1A 4LHUB 1WVZA 1SEBA 2PTUA 4HS8L 2ED9A 1CXEA 4JGJA 5C07D 4PJCF 1DE4A 1T22B 4YHMH 5T3XL 1IE5A 5KZCD 4K3EL 4JFZL 4X7FC 1NJ9A 2XI9A 4Q74A 5K9KA 2LU7A 3DX7B 3FOLA 2YPLD 3CVHH 1BJ1J 1NMAL 5HVHB 4RDQG 1U58A 1BQHB 2F15A 5SX4I 1I3VA 4MB3A 3OX8A 1H3XA 4KHXL 2L0DA 2NY0D 1LP9B 2Q8BH 3JV6A 3RWIB 4FQIH 2IBGA 2UWEA 1ETZB 4UIKH 2ZCKH 4HMCA 2AEIT 2W65B 3MC0A 1AR2A 5IG7A 3QQ9D 4JFQA 3KJ6L 3O3BB 2XFXB 1SMAA 2OP4H 2DDQH 4M6OH 3LN4A 3UTTE 1HHGB 3MRQB 1Z2KA 5SWSB 4MVBC 4ORGA 2C1PB 1GZPB 4RFNB 5ABDE 3KYMA 4KKLC 2HFTA 5FK9A 4MB5A 1XCQA 3LIZL 5IIEA 3ULVC 5INDA 1F4HA 2F5AH 1I1AD 2ADGA 5TDNA 4NZUL 5ICZA 1KB5A 3VWJB 1QSFD 3RWHA 5I1CL 4RQQA 1NUDA 1LE5A 1T03H 3I6KA 5D1XB 4K3DL 3BPLB 3WJJC 2HFGL 3UPRA 3G5YB 3SOBL 1IJ9A 2BY0A 4YHOL 2DQCH 4JM4L 4FTVB 4MJ5B 4XC3H 4XB7A 4ZPVA 3O6MH 1CZ8H 4XNZC 5T5NG 2YOCA 2YRPA 5HHOB 5K9QG 3ZSSA 5FM4A 4DZBB 3IFLH 1QYGL 2Q86B 2WP3O 4RA0C 1XGQB 5D7KE 1LO3L 3TO4B 2FLRT 3GI8L 1MUJB 2CUHA 5T3XH 1AD9B 4K3EH 3X12A 4X5WA 1ORQB 4EN3A 5AWNL 4XCNA 2MSPA 4LLQB 5JNYA 2V2TA 2VIRA 1R3KB 1V7ML 4RMTA 1NMAH 4KK5C 4Y4FC 5F21B 1BF2A 1UQSA 2CRZA 3RL2B 1AXIB 3SY0B 4OFPA 4KHXH 3VU2A 5IBTL 1EFXB 2Y06H 1VFBB 4O2EB 4XI5C 2X4TA 1J5OL 2PNDA 3TVMB 4NC1E 5FF6A 5SWZD 4JM2F 5EBMA 5HY9B 2MQCA 1QRND 2L7JA 3IETB 2I26N 4ODWB 1NUFA 2IPKA 1FZOB 3QNZA 2VMFA 5JXEA 1LK2B 3BN9D 4KV5E 5JW4N 1BQUA 5EBWA 4N0UE 1ZLSL 4M61A 3WSQL 4GRWF 2J8UB 1KENL 3GSOB 3VGDA 2VXVL 3T0ED 1Q0YH 3OKNB 3PE9A 1G9NC 2AV7B 1IGJB 2NY6C 4K9EL 5IMLA 5HGHA 3IFPA 2HFGH 3F7VA 2EEAA 2ZSVA 5HHVL 4JM4H 1Y6NR 3DPBA 4MXQC 4JLRA 1B0WA 3IU4L 5IKCA 1LHZA 3FMGL 2BVQB 3TPUA 3MLYL 4U7MA 1QYGH 1IAOA 4LCYA 2YC1A 1FLTX 1LO3H 1M1SA 1S9KC 4FG6C 4N5ED 5DYOB 1U92B 5JLZA 4I13B 5DJYB 1IAKA 4JFEA 1LDPH 1V7MH 4JQXC 1IAIL 3DYMA 5EOCL 5BCAA 2D03H 4DN4L 1BFOB 2FB4L 4M5ZH 3KPQA 1RD6A 3PWUB 4JPIB 4OCYL 2HJKA 4TRPL 3B8SA 3BESR 4TUOA 4PJBE 4YNYA 1YMHA 1NKOA 1IC4L 1A1NA 2WBJD 4GS7C 4IS6A 1E6JL 3DRTA 5DJ6A 4GG6A 2ENYA 4KGJA 4JGMA 5FAAA 5I0ZA 1UJ3C 5HI5D 4FQXC 1INDL 5E56A 4OIIL 5M95B 4Y16D 1LNUA 4X98B 4DKFL 4QRTA 4YHYB 4M7ZC 1ZLSH 4MA7H 5EZLB 1REIA 1FLRH 4O2FA 4R9HA 2Y7QB 3WSQH 4OZIA 5BW7C 4E41A 4PJCE 4NKMB 1IM3A 2YEZB 1KENH 4HT1L 9CGTA 1G9ML 5JUEH 1R5IB 1MJ7L 3R1GL 3EDJA 1QFWH 4PJIF 3STZB 4S11A 4OZHA 1MI5E 1YEIL 5ACZB 1AFVL 1AR1C 5DF0A 3S88L 5EZOL 3TESA 3L3GA 5HHVH 5I1AA 3IS0X 5MEPA 3HZKA 3FB8A 4X83A 2B4CL 3ROOA 3IU4H 2H2PC 3BH9B 2F74B 3E3QC 3HS0B 1D6VL 3MLYH 5DQ9A 4YQXL 3C9NA 3EYVB 4FQJL 4YXKL 3NCCB 2AQ3A 1YNTB 2WQRA 3QQ4B 4UV7L 1AO7B 3G6AA 2WIMA 1UM4L 4G9DB 1A02N 4XPBL 2NW2B 3BKYL 2J6EH 1IAIH 4NKDA 4P23C 4X6BB 2BC4A 5BS0A 5E6ZA 2CLRB 1GPOH 1UG9A 1XGRB 3PDGA 3T65B 4OCYH 4K71B 4LVHC 5IM7B 3TYGL 4LCCB 5FV2A 4R97C 4NRXA 3AM8A 4TRPH 1Z0NA 4O58H 3C5JB 5C9JB 3JTSB 4LP5A 4ZD3L 2CKBL 2HT2C 2HAZA 1TPXC 3TZVA 3G5VA 3HLAA 1IGML 4NQED 3PWNB 2C4FT 3NTCL 4OCWL 1HWGB 5HYSA 4Z9KB 3IFOA 5EO0B 3L3KA 3D18B 1R5WB 4OIIH 1M4KA 4JJHA 4PLNC 4L8BA 1AKJB 3BAEL 1I1YA 4I18C 4IDLA 5E94A 4UV4L 1QR1B 1ZKAA 2K7PA 3IDMB 3UBXA 1I1CA 1HHKB 25C8L 1YMME 4HT1H 4YGVA 1ZLVK 4M43L 1G9MH 1DUYB 1MJ7H 3R1GH 4APQC 2FSEB 2UVFA 5IW3A 1VFMA 4C56B 32C2A 5I15L 3RIFK 2XXCB 1SYVB 2FECL 4G6JL 3ZE1E 5J8OA 1F11A 1WSST 5EZOH 1TNMA 2BOCA 5F7EH 1SJXA 5F71A 1E4XI 5JQHC 3PV7A 5DD6B 1G7MA 3O3EA 3QUXD 1IILE 1VKXA 2VOTA 3WFHB 3O8XB 4I2XB 4F58L 4KKCC 3VXQA 3IAGC 3TJHC 3FFCA 2E9IA 3VDAA 4FQJH 4YXKH 4XRCA 1YUHA 3JWDC 4LHUG 2ATPB 1N5YL 3I3BA 2A83B 2FGWH 5EZJA 4UV7H 4XXDB 1O0VA 4JREC 1RFDL 1UM4H 4XVJH 5EB9A 4TOYL 1ZWIB 4X80L 4XPBH 2DLTA 3MLZL 3BKYH 1TCMA 2ZG1A 1CF8H 1J1XL 4EVNA 4LSTL 5TDPA 2N7AA 3ZYIA 4G8GB 1UWGL 1K5NB 2G9HA 4QOKA 2HFEA 4LCWA 3CZFA 5DEGB 2K1MA 3KJ4C 2CKBH 5M7QA 1MEXL 3GBLA 3QG6A 1KJVA 4KI5C 1T7XA 4OUUA 2HRPL 2FJFB 4OCWH 1MWAL 1LO2L 5FA4B 2WWKO 3QXDA 1HHIB 1X5HA 2C7UB 2VR4A 1IKNC 1CDYA 2ICES 4JKWA 1I8KA 3LV3B 5F7WC 2BZDA 2YK1L 3KLHD 3QDJD 25C8H 3ARWA 1RK1A 4M43H 1JGUL 1KNOA 2OTPA 3PL6D 5C0EB 2KH2B 3FO0L 4OLXL 2QEJA 5IB4B 3PABA 4GAFB 1B0GB 4PBVC 5I15H 1RMFL 4G6JH 4N0RA 3CLEL 3U1SH 4U2YA 4ZUVB 3E0GA 2YXFA 4M93B 2JCCF 3ZDZE 1G7IA 1N0XH 2BNUA 4JRWA 3HAEG 3DHJA 5CJOL 4EDXB 3NIFF 4D9RE 1N5YH 1FJ1B 4ELMA 5JHDB 1ZT1B 3QFJD 4NYLA 5IB1A 1BZQK 4EQ3A 5HYEA 3SJVB 1RFDH 2FHCA 5F1OB 3AGVA 4TOYH 1V8HA 4TQEL 3ZT7A 3MCG1 4PRNB 1INQA 3MLZH 1FGNL 3SE8L 3AAZA 5CD5C 2DWDB 4O2CA 2KBGA 4LSTH 3FB7B 3VXSA 3C60A 3RDTB 1UWGH 4HH9B 3GRWA 3U79A 1LMKA 3EOAA 3FZUC 1U9KA 4JKKA 1PJ9A 2A73A 1JZ6A 4KDTC 1MEXH 4POYA 4PJIE 1Q9WB 3OJMB 4KRNA 2HRPH 3B5HA 3H6JA 3MNWB 3FT3B 3HZMA 1P4IL 4BSJA 2YUVA 2QSQA 3D69A 4A2MA 1MWAH 1OT1A 4C55A 2D4DA 4YXLL 2B0SL 5AYQA 3VXRD 5I17B 3T0DA 3X13A 2YK1H 3UTTB 4PRIA 4S0TD 5ENWB 3LKPA 4I3SL 1CT8A 3RPIA 3CFCL 5T1DL 1G0XA 4KJYB 1IGTA 1FP5A 3RBGA 4BELD 4TTDC 1RIUL 4UOJA 2YZ1A 3ZYJA 1LVEA 4CUCA 3CLEH 3MQIA 5LJYH 2R1YA 2B5IB 1VA9A 1OOAA 3VWKA 4OLWH 3TM6A 2ZP0T 2VAAB 4X9HA 3PHQA 3PWPE 5JW4R 4KUCD 3QNYA 5CJOH 4WFEE 3OXSA 4MQXD 5GGVH 4DQOL 1MCDA 1Z3GL 5LBSL 1NEZG 4WU5B 3SDDA 1B6DA 3TBVB 5C0FB 3TNMA 2IWGA 3MXVH 5F9AC 4F7PA 4XWGL 1JPTH 4MA1C 1AGFA 2WIIA 4MNGE 1FGNH 1XAUA 3ROLA 3SE8H 1TETL 2ZNXA 1A4KB 4OBRA 1MJ8L 1S9WA 2VLJE 4DGVH 5L2JA 2F53E 3O3DB 4A6YB 2VLLA 1I1FA 2EDQA 3D3VB 2X4RA 3HE6A 1YEDB 3ARUA 4PJXF 4ZNEA 3REVA 4OD2B 4WW2B 3OAYH 4JPVL 2Q1EA 2B1AL 4XP9H 3TJEL 4EDWL 2E6PA 5C0DA 2AGJL 5EO1B 3QFDB 3EO0B 2AXGA 3VGEA 4I3SH 4LLVA 4YBLC 4OLEA 4OZGE 2VDPL 2VDQL 3O6FB 3CFCH 5T1DH 4N0UB 2BSTA 2DTSA 4JKPH 4PTTA 2XICA 4H8WH 4LCUA 3ZHKA 2VZVA 1HYRC 3RZCA 1EHNA 3TH2T 2FEDC 4Z7WE 2Z9TA 4LHJB 1GIGL 2LU4A 5FO7B 1IC5L 1WT5C 3MRNB 1MCEA 5FOBA 3VG0L 1FNGB 4K94L 4BH7B 4U1NB 1S7VA 2DRUA 2PUQT 5IHZA 4DQOH 1RZJH 1Z3GH 5ERWA 5LBSH 1UGNA 3V6FB 4Z76B 4QHNA 5C09E 4XWGH 4NT6B 2FIRT 4MHHG 5DJ0B 3NFNA 1TETH 2J5LB 2P5EE 4WJ5B 2GFBB 3KNBA 4DUVA 1HXMB 4P5KB 3LZFL 1HQ4B 1RJZB 5EUOF 1MREH 5ACLA 4N9GA 3GUTB 1JGEB 4TVPD 4RCAA 5BJTA 2AJZB 2J4WH 3NAAH 5JXAL 5F89A 5L88L 2HYMA 4DUWA 3F7QA 4XAKE 1DVFB 4JPVH 3K4ZA 2B1AH 5FYKH 4HIIA 3TJEH 4EN3D 3LB6C 4L8SA 4LDLB 4EDWH 2AGJH 3NGBC 1S7RA 3RAJL 5JO5A 5GGTL 1N59A 4KZDL 1EPFA 4G8EB 3NIFE 5E1AB 5E2TL 4CMHB 1BPVA 2OJEA 2Z31A 2VDPH 2X42A 1CLOH 1HILA 5KAQG 1AGBB 1I3UA 2M8XA 2X4OB 3EAKA 2G75B 5IW6A 1XZ0B 4XVUD 4PJCB 2AXJA 4PJ7A 3L5JA 4CKVX 1A1MB 3QPQD 3HC4L 4OAWB 2QADB 1AXTL 1GIGH 2APVA 3TNNB 2Y9RT 4WDIA 1IC5H 1JF5A 3FT2A 3LRSB 3I2CL 1PZ5B 4GBXC 3VG0H 1KG0B 3QDMA 1Y18A 4L3CA 5JXED 2OK0L 4YZFF 4P4RB 4K94H 3B9EA 4FNLL 5FV1L 3C8KA 5KANG 5ESVA 4ETQA 1VGKB 3TO2B 4KMTL 4W4NA 1OB1A 3WL9B 5L8LB 4HKXA 3T0VA 1IEAA 4TSAL 1NGZA 4F37K 1LO0L 2EC9U 1A9EA 4HEME 3BKML 2BVPA 3GGWA 5F9JA 2KPNA 1A3LL 4LAJH 5D5MA 4G6MH 1HEZB 4Z7NE 3GSVA 3UZVB 2IH3A 1EGJL 3QXWA 2APTA 3MRKA 4EUPB 3LKOB 3MBEC 1JNLH 4OSUH 4PGJA 2X4QB 4JFED 2YPVH 3RAJH 4LLYA 4HUUA 3GM0A 2JJTC 3DNKA 2DOCA 2DQIL 3RBSA 5CD3B 4JZNA 3VFUA 1LD9B 1MFEL 4UINL 2MQ3A 3PQYA 5LQBH 1MCWW 5EU6A 3V6BR 1WC7B 3B83A 3WJLC 1YMMB 1TFHA 5JPMB 4UU9B 4F7EB 4MJ6B 2AJ3A 3OJDA 1NBZA 3HC4H 3SE3C 4U1SA 4MAUL 3MRMA 2J7LA 3ULSA 2PCPA 4K7FA 1FNSL 1U8LA 1Q72H 5IHLB 3CXDL 3LPWA 1I75A 3BZ4B 4AMKL 4OM1L 1HINH 4FNLH 3BRGC 1QFHA 1M05B 3K1KC 1JHLH 4E41D 1GGUA 1J12A 4MD0B 1AIFA 5C0RL 1OGTA 4N0CC 2YHGA 2R9HD 1LEIB 3QI9A 3WS6A 4JM2B 5LWYL 4MQTB 2DN7A 2I9LB 1KTLB 1AP2A 4MMZC 4R0LB 3VFMB 5FECB 3BRFA 1LO0H 4HUXA 1A6ZA 3BKMH 4UMGA 1IQDB 1UZ8B 3WBDA 4UIMA 5EIQA 3JV4B 4XMPL 4GRWB 3KPRA 2XTJE 1A6AB 1JNHB 4Y5VA 1BM3L 4F2MB 4ODHH 5MENA 2ZUYA 5D7JD 3QUYC 3RVTC 3GIZH 1BVLB 1GL4B 2PTTA 2E3VA 3GSUA 1QEWB 4HLZG 1CU4L 3FRPG 1QUNA 4K8RH 5E2WL 5FDWB 5BS0D 2E8YA 1KIUA 2GT9B 3TN0C 1K2DB 5ADOH 1MFEH 1YY9C 3E8UH 5C0CA 2EXYD 4NCC2 3SCMB 1NLDH 4DK3A 4AK1A 4E0RB 4WNQB 3TZVD 4F7MA 3C6LA 1HZHL 2IEPA 4Z78B 4U6YA 3RNQB 2R1XB 1UB5A 2VQUA 3RRQA 5KG9A 4MAUH 4P5MA 5ETUB 1KLFA 1ZXQA 1NAMA 5EUOE 5C3TA 3LKQA 1FNSH 1W0YT 1MWAA 2A74B 4XPTL 1DEEA 2QL1A 5EBGA 4ZSOA 4OM1H 4AMKH 3FB5B 5DXWA 2WINA 2BFVL 2XWJA 3HR5A 4X7SL 3QCUL 1HDMA 4NWTL 1HKFA 4M48L 2Q20A 3QAZB 5C0RH 2WZPD 4QWWD 4URTB 3IDNA 4Y5YC 3TA3B 1RUAH 1C8PA 5KVGL 5LWYH 2I9TA 2HKHH 3PGDB 3PWVB 4JHWL 3O2WL 5IK3A 5IJKA 1FPTL 4WEBL 1JMZA 1Z0MA 2AV1A 2XTLA 1UCBL 4ISVA 4UB0L 4HKJB 3HPJA 3FFCD 1NCCL 1Z9LA 3CX5K 3OJ2C 4XCYA 4PRAB 1BM3H 3VFNB 4G6KL 1FCCA 3PXHA 5D2NA 1OLLA 4RAVB 4PJIB 3RI5K 4PJFE 4X6EA 5C86A 4P2CG 1J88A 1YQ2A 3RGVB 1K8IA 5F72S 1CU4H 5E2WH 4JG0L 4Q9RL 1QG3A 5I1LA 3DHMA 2W91A 3HFML 4LLDA 3LHPL 4P57A 4TTGA 4M1CD 1IAMA 4QOKD 4LCWD 3VRLE 1FBIL 1GGIH 2DQGL 3DV4A 1W0WA 2CUIA 1HZHH 1RURL 3X17A 4NSKA 5J6GB 4HXBH 3MRCB 4OKVA 3QWOB 3UEZA 2X4SA 4W4OA 3C8HA 1U3HB 3I02B 1KIRB 4LHUA 3ECBA 2WK2A 3TGXA 4ODSH 3CD4A 5D8JH 1A6WL 1WIUA 5L2KB 4XPTH 2Y36H 3U9UA 1ACZA 2I5YL 4X7SH 4NZTL 3QCUH 5HI3C 3FQRB 4EI5D 1T6WA 4NWTH 4M48H 4JGUA 4KRMB 1CD0A 1TJHH 4LASL 5CEXA 2EEDA 5KVGH 2P1YA 4O5LL 4OD3H 4G80B 4HLJA 5F9WB 5FEBA 4PJGF 2QSCL 4MJ2A 1JWSA 2D7TL 3O2WH 2VO5A 3GMNA 1FPTH 1U8QA 4L29A 2GY7B 3U83A 3ARXA 3KPPB 1A6PA 1Q8MA 2WBKA 2XFXA 4LF3A 4HGMA 1UCBH 1YNKL 5T1MA 1C5BL 1HHGA 1OSZB 1U42A 2L4OA 2VLJB 2F53B 5DO2D 3SGEH 3FL7A 2BDNL 4LRIC 5JA9A 1G7JB 4G6KH 3AU1B 3SPVB 1JHTB 1EAJA 3MUJA 5DRZB