1OLLA

Extracellular region of the human receptor nkp46
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
188
structure length
188
Chain Sequence
TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/receptor
molecule keywords NK RECEPTOR
publication title Structure of the Human Nk Cell Triggering Receptor Nkp46 Ectodomain
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2003-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ollA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ollA01
3KGRA 1HN1A 3IAPA 4JFYA 1FZJA 5GS1C 3WIIL 3JTSB 1MCBA 5HPOA 5GJTL 4WO4A 3QDGA 4KZDL 3WUWB 4I0PC 3DETC 5JPNB 2NY0B 4JDVB 4X7DC 1IL1B 1IGMH 1TPXC 4YDLB 3G5XB 3TH3T 2P49B 2WBJB 4KQ4L 3LOWA 4Y5XB 4J3XA 4U3HA 5ANMB 4TSAL 1HHHA 3SQBA 3WNKA 1PLGL 2MNUA 2JB6A 3FN0H 3EDKA 1IVLA 4HIEB 4NDMB 5EN2A 1ZLWK 3T1FB 1CFQA 2N1KA 3MRGB 4K9EC 2GKIA 3N50A 3NIFE 4LSSL 2NY4C 3QZWB 3BZFA 3NIDF 1AQDA 3VG9B 2B0SL 4TSCL 5JOFA 4HWEL 3WFBL 3RVVC 1CL7H 2XN9B 3JBG7 3HCVB 2R2HA 5ESQA 3CAFA 1AE6L 4LASL 5IFHL 3G5VA 4X6CB 4GAYA 3CSYA 1YYMH 3MRCB 5TDOB 3EJYC 3UJTL 3HC0A 5IHZA 3FN3A 3LQAC 2HMID 1AXSB 4JHBA 1X44A 1P2CA 1T20B 4O51B 5CBAA 4RGNE 4NJAL 4PJFB 1KELL 4MA3A 5C0AD 2EKJA 4EI5B 3MRQB 2WP3O 5I1LB 4JREC 1VEPA 1MUJB 2PW2B 1Q8MA 5IB1A 1CGSL 2G9HB 1G7PA 1QSFE 4NQEB 5ACLA 3C2SA 4CL7A 2WAHA 1DFBH 1DSFH 5B38B 1NGZB 3RRQA 2MOVA 1LO0L 4FMFA 5KAQF 4ZYKA 2KH2B 3TYFA 3ESUF 4NP4L 5H94A 2XI9A 5E8NA 2AJYL 3VRJB 1WAAF 3F12B 1Z9LA 4Q9BA 4P2CG 4OF3A 1MHPL 4WVRA 4XAWL 4ZAKA 3AREA 1U8OA 5JPMA 1AGFB 3QAZB 5T3XD 4JCLA 2XXMB 3VRLF 4YXHH 2A9NL 4PJ5A 2EECA 1GOGA 3MUGB 4Q6IA 4RRPG 1FFOB 1KTLB 1E6JL 4L8BA 3OHXA 2ZOLA 2C3WA 4F2MB 4ODWA 5GSRB 5ALCH 4H5SB 2FEEL 1EEQA 1IEAB 4RGOL 1J0ZA 2Z8SA 2HT3D 5T1KA 1IC4H 3T0DA 1NEZA 5CD3A 2B20A 2I60H 4WW2A 3E6FB 3QUXD 1TJGH 4PRDB 3H3PH 3BP6B 2VZVA 4KRLB 4TQEH 5EU7E 5HYJE 4PJBA 4RMSA 1H3VA 4OZFA 1F8TH 1O5DT 3T3ME 4EDXA 4TRPL 2IANE 2DDQL 1CTNA 1KIPA 2X4OA 4NWTH 1KJ3H 4OIIH 2VXTH 4J6RL 1D6EB 3STBA 3BH9A 1N0XH 3NFSH 5DRNB 3U0PB 2GK0B 2YPLD 3IYLW 4K3JH 4TSBH 1QR4A 3G5ZB 3WLWD 3QNZA 4N8VA 3BEWA 2DQGH 1LP9B 3C6LA 4JFQB 5KSUA 3U83A 2AJVH 1MCWW 1F3JB 4XC3L 1FNEB 3G08B 2FIRT 5SWZB 2X89A 5TPWH 5D1ZD 1UENA 4JM2B 2BP3A 1UWXH 4NO0A 4PR5A 4RX4D 3I3BA 4KI5C 3QUMB 4J1UA 1NKRA 3H9SA 5KN5B 5JORA 3SCMB 1D5ZA 3UPRB 1CE1L 1IGIL 2AJXH 3ZDYE 3VFMA 2V5YA 1S9XB 3RGVD 2IMMA 5A3IC 1J8HE 5HI3D 5C8JB 2X70A 3Q5TA 4PJ9C 3UYRH 5ID1B 1FZMA 1G7JB 2ENSA 5B22A 2ADJB 4HUUB 2VITB 1N6QH 3O41A 5E7BA 1F6AB 4X8XA 5FB8A 4Y8AA 2XQYK 2APFA 5D1XB 3PQYD 1PKOA 1A7OL 1WWWX 2OQJB 4OCWL 4LDOB 4MDJA 5E9DD 2P24A 4K3HA 4PJHB 1JGVL 2Q1EA 3S36L 1IFHL 4XGZB 5IQ7L 2UY6A 1FJ1B 4O4YL 3UPAA 1T89A 5D93B 4YUEL 4DW2H 5DD0L 3CLFH 3EOTH 2HVJA 4HUKB 3MFFA 4LLUB 4LRIA 5DQ9A 2HN7A 3S3SA 5IJKA 2OM5A 4F15C 1EHXA 5A1AA 1GGCH 3ZTNL 3D6GA 3RWHB 2OK0H 3CDCA 3CDYA 5E6YA 2IPKB 4JCMA 5E08H 1BFVH 1PSKL 3QIBB 3MACL 3QXTA 1TXKA 4QO1A 4ORZC 2J7LA 3WHXA 3H7LA 1TJIL 4Y19B 3PGCA 4L3CA 2R0KH 3QISA 2MKWA 4RFNB 1V7ML 3G6JA 3VXOB 1A9BB 1KJVA 4UOW0 5SX4H 1IGYA 4DGYL 4F58H 4L5FL 4LU5H 3GSUA 2HT2D 1WLHA 4J4PA 3BE1H 1X4ZA 5KOMC 4R90L 5JMOC 4PGBB 3QDAA 3X17A 4PJXB 2Y72A 3ULVL 4PRAB 4U6XA 1UWXK 5EBGA 4MD5B 1Z3GL 2NYYC 3U9UA 3QFDB 2B2XL 1J87A 3MJ8A 4KGJA 4XXCA 3UZEA 5LJYH 1OTUD 3RVWC 4R4FL 5EZLA 2YD7A 3MRFA 4X80H 4YXLH 4W4NA 4EUPG 3VWKB 3ULUC 2DQTL 1BM3H 2ICCA 1YYLL 4PRHD 4EKXA 3HUJE 1I7TB 1MH5A 5IHBA 2VLME 4KJYB 3SDXB 2F54E 4Y88A 5HYSG 2V2WA 3UJIH 3GMLA 4RQQB 4PJ8D 1JHLH 4N0UE 4FOMA 3O3UN 3IGAA 2X89D 1QSEB 2Z4QB 4UTAH 2DQDH 4Z7VA 3VXUA 1DZBA 4P48A 1ITBB 1W72A 5JW3H 1UT9A 2YC1A 3TFKD 4PY7B 4BH7B 1DEEA 5JXEA 2R0LL 1ZSDA 4F37K 3HE6D 2NXYD 4RAUA 1BFOB 2AI0L 4JPIA 4J8RA 4FXKB 2X7LA 4YHKL 4UAOB 4JG0H 1YEDA 3NPSC 4WTXA 5E03A 3MLWL 3LKQA 4LLWB 4ZTOH 3QQ3B 1IC5L 3BEVB 2BDNL 3GFUA 5HDLA 4LLDB 3RWEB 4V2CB 2OR9L 3X3FL 4HD9A 4NRXA 1GGBL 3S88L 5T5NG 5JOPD 12E8L 3X14B 4QXTA 1X5FA 3HE7C 4LEXH 2HFGH 2UWEB 1G84A 4FTVD 1KN2L 2IPUG 4V1DA 4IRZL 2YUZA 1LK2B 2HKHH 5IIEB 1P7QB 4YFLI 1F97A 1MCDA 2J8UE 1KXTB 1HSBA 1T1XB 5GGRB 4RAHA 5DVKA 5CGYC 4HK3J 3L6FA 2DIBA 5CSGA 1CICB 4FQQB 4M6MH 5E7FA 1UCBL 4LLYB 4TVPH 3KPPA 4WFED 4I48B 1QLFB 3L5XL 3VH8A 4XPFH 1I1AD 1AHWA 1T03H 4LKXA 2XXCB 3PHOB 4KAQL 4WV1A 1QFOA 5F9DC 4ZXBD 1FFNB 2MHAA 3BGFC 4NQSA 2WANA 4F7CB 5IBLD 1EUUA 1XGPA 4YC2C 3DIFA 1MRFL 5HHQB 2WBWB 2L4OA 2W38A 4Y16D 2EC9U 5L8KB 1YNKL 4HGKC 4FFZL 3RVXD 5D7LA 4XWGH 4P4KD 5C7XL 3UEZA 5I17A 1A7RH 3QJHA 5F1IB 1JZ4A 3BKJL 1NC2D 2HJFA 2O5YH 4GAJH 5T5NF 4Y4FB 3S96A 2ICEA 3IJHA 5C0AE 2FX8L 3TCXA 1V7NH 3U6RA 1J5OH 4P23C 3BWAB 1NAMH 3HFMH 1MFAL 1UJ3B 1I9JL 5T1MB 4CW1B 3B6SA 3W2DL 1N8ZB 2E6PA 3REVB 4BQ6A 4C59B 3PGDA 1KPRB 2EXYC 3I2CH 1NGYB 4KQ3L 3HPLB 4BQBA 1YNLL 5KVGH 5J1SC 3W5NA 5D2NE 4UU9A 3IFOA 4PP1D 4DKFL 1BQLH 1ZGLM 3P0YH 3T2OA 2R56L 4G42A 5B4MD 2DQFB 5FAAA 2R0ZH 5EFIA 2B5IC 4EBQL 1UH2A 4WNQB 5EZIH 1A1MB 1QVOB 4QRSB 1M4KA 3GKZA 4FNLH 4KKBC 5TE7H 4G6AD 3CFEB 3CFCH 4R7DB 2A6KA 2A1WH 5EO1A 2P7TA 4PG9B 15C8L 2BY1A 5TF1H 3SY0B 4U1IA 3LPWA 5J6GB 1OSPH 2Y6SC 3LEYH 2FB4L 4XCNA 4ELME 4FS0A 5C0ND 4MJ2A 1Z5LB 1ZANH 1PVHA 3KWWA 3WS6A 3WXVH 5ADPH 4U1MB 1XZ0B 3B9EA 1QD0A 2WWKO 2YD1A 1U8LB 3VCLA 2DICA 5E6IB 5MERB 3THMH 4CNIA 1BOYA 3CX5J 1OF2A 1D5BA 5DA0B 5E56A 3RWIB 1FV1B 3HRZA 1VCAA 4V1DD 5I6XB 2HVKB 3O11B 4N8CH 5IW1A 1UFUA 4ZS7H 1MF2L 3IXTA 2Z31D 3ARFC 2DQEH 1A5FL 5T3ZD 4AEIL 2J5LC 5IB4B 4RMTA 1UXSA 3ROLA 4E0RB 1C1EL 1NFDF 5ESVA 3V6OA 2X4TB 4HWBL 2CDEB 3O6KL 4LFHG 5KS9B 1I7UB 4GAGH 4P9HC 1ZGLA 1JBJA 1EXUA 1IQDB 4Y4KC 3U82B 3T0BA 3ZDYF 2X10A 1A22B 5TH2A 1NLDH 4XNZB 2V2TB 1KOAA 4LMQE 2DBJA 2ICWB 1NAMB 3HMWH 3LPGA 1HSAB 4I2XB 4G8IB 2ICES 4JRYD 1P4LA 2BNQD 1N4XL 2H1PH 2PR4H 4L4VA 4ZPVA 1A1NB 4O2FB 3RUGB 1RJYB 1MHHB 2BFVL 2E6JA 2F19L 5D7IF 5E00A 5JW5B 4N9GA 1SEQL 1QG3A 4F7MB 5FCUL 1FG9C 3WIHL 3IKKA 5I1JL 1KEGL 1I3RA 3LSOB 2DI9A 3T4YA 5INDA 5ID0B 1J7VR 5CUSH 4APQC 3MROB 4TULL 1QR1A 1RUQL 2DM4A 4TUOA 4QRRA 4HMEA 2AJ3B 4YHPB 5ETUB 3RDTD 2HLAB 1CGTA 4JFDD 3L9RA 4NSKA 5EO9A 2X4PA 2D03L 4Z5RB 2A0LD 1B0RA 1JPSL 1S78D 1KT2A 2R2BB 1B0GB 1DLFH 1SY6H 5IKCB 2YD6A 3KG5A 4C56A 5HHOB 5BRZA 1LEKA 3BJLA 4R9HA 1WZ1L 3ARBC 2QADB 1SBBA 4PY8I 4MMZC 4BELD 2P47B 1AGDB 4PJIB 4U6VL 4ENEC 4O02L 2NY7H 4G6FB 1KLGA 1A7PH 5AAWA 1MRDH 1ZHKB 4WUUD 1GHFH 3HNTL 4PJ5E 1ZHBA 5SV3A 4HUNB 3JV0A 4HUWA 4ZOBA 1K6QH 3FZUD 3SGDH 1X5YA 1ND0B 2LU3A 3FQTA 4DEPC 3KYMA 1NCDH 3FFCD 4KVNL 3BYYA 3RWJA 2GUOA 1WZMA 1KCRL 1Z2KA 2VSCA 3PWNA 2YD8A 1ORQB 2R4RL 2KKQA 3EO1A 3U36B 4WTZA 5EC2B 2CUMA 4NHUB 1OT2A 1P7HL 1WQVT 4O5LL 3LS5L 3NAAH 5HSFA 2X9YA 3V0WL 2FJHA 4LRNL 4AG4L 5HDOA 2W9EH 1BECA 4K9EH 3OG4B 4PJBE 4MAYC 2XQBL 1OD9A 4XBPA 5EO0A 1ZGLP 1KJ2A 4BK4A 3HNSL 4XCCL 3HUJF 3AXLB 4LMQI 2A9ML 3QUZC 5I1IH 3IDIB 3OAUH 3PWLA 3QHZH 5F9OL 3DXAD 4PRHE 4ZUWA 1P7KA 1R24B 2X1XR 4GUPA 5C08B 1GJIA 5E2VH 3NCMA 5FGCB 1OAKH 2ORBL 4HCRL 1XGYH 4X7SH 4HUVA 1ED3B 1BEYH 5HPMB 4JFOB 1J0IA 4K94H 1KB5L 3GUTA 1K8IA 3UTTD 3KPMB 1AD0B 3QDMD 3P9MA 1XGTA 1R5VB 3H0TB 4MCZA 3P4MA 2AQ3A 3H9SE 4HJ0C 1K85A 3D85B 3RQ3A 4KK5D 1NGWA 1IGML 4NN7C 3X12A 3CPLA 3MRMB 4LPUA 4EXPX 3QIWA 5BS0A 5EBLA 4TTDD 1BQSA 3EZJB 4Y2DC 2CLVB 3CDGA 3M1BB 2DL2A 2F53A 1G7LB 1G7MB 3K4ZA 5MENA 2J4WH 3FN0L 4FQLH 1EJOH 3CZJA 1FE8L 4JFFB 3RWCA 4DN4H 2DB8A 3GSXA 4MHHI 1T2XA 1YQ2A 2W9LA 3BP7B 4LHUD 3O6MH 2XKNB 4GQ9H 4BSWA 1T3FB 1CL7L 4OQTA 4QRRD 2J8UF 3OKMB 3FO1A 1U3HA 5HI5D 3H2WA 3WFDL 2NNAB 1AFVH 1YYML 1Q1JH 3QP3A 3F7VA 2ADGA 4ZSOA 4QHUA 3QI9A 5D7KE 2EE6A 4P3DB 1WBXA 1X5XA 3RVTC 1YMHB 4WFEE 2PNDA 2IADB 3DURA 2X4QA 5IMOB 5IQ9A 4MNQA 2NXZD 2PTTA 3MO1B 4X7TA 4Q2ZA 1FL3A 4X7FC 1QO3B 4LPTA 5CEYA 2CLRA 4I3GA 1EEYB 1IAMA 2MFNA 4DWHA 2PUQT 1KEMH 3KJ4C 3MV8D 2ZSWB 3G6JE 5C86A 1DSFL 1C16A 1S7TB 3V4VL 3MREB 3IJSA 2X42A 3GMMA 4PG2C 1NUGA 1EX0A 3MBEC 4NQCB 3GSNH 4L8DB 4YGVA 3VJ6B 4MAUH 1PGRB 1KNOB 2ZSVB 2VZSA 1RJLB 1SJEB 3DMMB 3O4LA 1NC4D 1L7TH 5ICZB 4YXHL 3ZT5A 1J1OH 5J11C 4OKDA 3OMZA 3L3IB 4UNTA 2ZCHH 1FN4B 2ZCLL 3L3JB 3KJ6H 4EI6A 3X13B 1WITA 5K33A 2LU7A 3CFBA 3MJ9L 2DKUA 4M61B 1U8NB 1PG7H 1DR9A 3LN5B 1UH3A 5IBTH 1MCCA 5HHPA 2BSSB 1AJ7H 1IC4L 2D7QA 3O8XC 2I60L 4OTXH 3V4PL 2PETA 1TJGL 1WFNA 1WGOA 3W39B 3FQWA 1JE6A 3H3PL 4TQEL 1CU4H 1F4XH 1EGJA 5LWYH 1CFTB 4X9GA 4GW4B 4J12A 1F8TL 4X5XB 3G04A 4Z7VE 5CMAA 1CD1A 25C8H 3D5OF 3VXUE 4NKQB 1ZA6B 1CQKA 4NWTL 5MHSD 2XNAB 4J3UA 1LE5A 1QOKA 4OIIL 2UYLA 2VXTL 1JV5A 3FB7A 4LARL 1M71B 4WI8A 5GGVH 1N0XL 3NFSL 4XNMB 3WDJA 2W0LA 1XF3A 4WFGD 1WBYB 3QO0A 4MD0A 1S3KH 4K3JL 4TSBL 4ELMF 3SEPA 3KR3H 1K4CB 5FF6A 3ECBB 4WDIA 3SDDD 1MCOH 2AJVL 4QGTA 2NY3D 3D18B 1ROWA 1Z0NA 5TPWL 1A02N 5GGSA 3OXSA 1AXIB 4RGNC 2DJUA 5D7JC 5HD8D 3FB5B 1PYWB 5F9WC 2CRZA 4X0KB 1EHAA 2W1NA 4I9WD 1JPTH 4IRSC 4RA0C 4V1DE 3WL9A 3MZGB 3RAJH 3NFNA 1I4FA 1S9VB 4MNHA 4XAKE 2OTUA 1BREA 2BNRB 1JHTB 3NCBB 4D8PA 5FOBA 4GO6B 3DTXA 1N6QL 3EJJX 4JGJA 3FRPA 3MRIB 4C57C 4CDGC 5CILH 3TVMD 3BPNB 3R0NA 1LEIA 3GM8A 3GSNB 4U6YB 2GAZB 4X6DB 2E7BA 2CIKB 2AEWA 3BP4B 3WBDA 3ZKMD 1YDPA 1PZUB 4MNQD 1KCVH 3HLAB 3T0EA 3O2VL 4ORGA 1TZHB 3AS3A 3GMOB 5CZXD 1EUTA 4DW2L 1PKQB 3CLFL 3EOAB 4IMLB 3EOTL 4L9DA 1ONQB 3VA2C 5I66A 2G5BA 4M7JH 5EUKA 3HB3D 4XTRD 5E5MB 1A7BA 2CXGA 5D7LE 1GGCL 2VQUA 1AC6A 5F1NB 3HZKB 2I25N 2OK0L 2BRQA 4I4WA 1NEZG 3VXRD 2G75A 5E08L 2E5EA 1T1ZA 2P4AB 1BFVL 4JQVC 5E8PB 1EFXB 2NZ9C 4P2RB 5C2UB 3L7EB 3HZVA 2K9UA 4OZFG 1HQ4A 3S35H 2R0KL 1T22A 3S4SB 5EU7C 4IRJB 4EN3B 1JNJA 4WRLA 1G1YA 5D96B 2NTSP 4F58L 4Z76A 1TNNA 4LU5L 2P1YA 5DVLA 1WCQA 4FRWA 4JZNA 3O2DA 3BN9D 3BE1L 2V17H 4Y4HC 4QF1A 5JTWA 2BSTB 4N8VG 1AI1H 2XTJD 5MEOA 4JFPA 3O0RH 5C6TH 2FO1A 4U1KB 3RI5K 4C83B 1G7IA 3TO2B 2XG5A 1JZ8A 2QV2A 4G6KH 1RZJH 2FL5B 4X80L 5C6PB 4YXLL 1IKNA 1NCAH 4GBXA 2XA8H 5H35B 3KVQA 3VFVB 1XCQA 2AK4B 3FFCE 2BVUA 1BM3L 3F8UB 2H3NA 1IM9D 4HWUA 4BH8B 3FO9A 3BHBA 3WFEH 3SBWA 4WW2F 4LPYA 2I26N 4LBEB 3UJIL 3BT2H 4K3GA 1FZKA 4PJBF 3JTTB 1EVTC 1JHLL 2V5SA 4G5ZH 4AL8H 4WGWB 4JQXC 1MJJB 2DQDL 4JVPA 4DVBB 4OBSA 2W0PA 2VL4A 3RZCA 1U6AH 5JW3L 1MFBH 2RFXB 3ILPB 1AQKH 3L3GA 5BV7H 4DCQA 3WJLC 1CD9B 3MA7A 4RNRB 3Q0HA 1GH7A 5EC1A 5L2JA 1LNUB 2VLKB 3DX9B 4LEOA 1A6VH 2FZ3A 1H3XA 1U8JB 3V0VA 2GITA 1RHHB 4JVWA 4JG0L 1I8KA 3F65A 1NL0H 5IROC 4CVWA 3O6FC 1SMOA 5AAMA 4L4TB 3V6OE 2BY3A 3JWOC 2ATKB 5EORL 3EHBC 4ZQKA 2CRIA 3QFJB 3BW9B 3FFDB 1UQSA 3IAGC 4ZO6A 2HFGL 4JO1H 3RIAF 2HKHL 2BSED 4JRXA 3W0WB 5FYJH 3I3EA 3QUYD 2XZCH 4PREA 5HVWA 4YPGA 2GK2A 4R97C 4CKVX 1KXVC 3MRNB 4LCCA 5GZND 4MZ2A 5E2UH 4L8CB 2Q6WA 1HXMB 4WUKL 4M6ML 1U8PA 4D0CA 4TVPL 1KIUA 4FQXB 1L9NA 1TVBB 3SE4A 1T03L 2FGZA 5DRWA 1TETH 4POZD 3HI1A 3WN5A 2BVYA 3FJTA 4L29A 3N9GL 2VR9A 3JV4A 3MRBA 1WEJH 2DLHA 4QGYA 3WNOA 3KPSA 1U58B 4G80B 2FATH 3UTOA 4JDZA 3MNZA 4KXZI 4QRRE 2X4UB 1OWRM 1NMBH 4TNWK 1IQWH 4KC3B 4S0TD 3RWGA 4UT6H 1Q9WA 2RGSA 4HKBA 1OPGH 4FFWC 4HIJB 5GGUA 5J8OA 3MNVA 2HT4D 3CFJB 4F3FA 5EBWA 1OAQH 1A7RL 5C0GB 4ZUVB 3F62A 4C56E 2A74B 1OLZA 5BRZE 2O5YL 4GAJL 4JJ5A 1PG7X 2GJ6A 5BQ7A 2EICA 3IT8D 5DUPL 3NN8A 4M7LT 4KDTA 1U8KB 2V5MA 4JM4H 1V7NL 2NY2C 1UYWH 3ZZ1A 3F7YA 1NAML 3HFML 5KSVA 3G6JF 3QXDB 1BJ8A 3TA3C 3GM0A 1MI5B 1X5ZA 3B4NA 5MI0B 1P4IH 2NY5C 1D5XA 4GBXD 4LVHC 5IW6B 5IB5B 3I2CL 2RAMA 5BV7B 4I18B 4OCMC 5T5FH 4QT5A 4Y1AB 4LSTH 5KVGL 1KN4H 1X5GA 3SO3B 2Z92B 4U7KA 5I71B 1BQLL 3P0YL 4OAWA 4G9DB 2X4RA 2FWOA 3PWPD 3VWJC 2WINB 3MZTA 1U3JA 5F7KC 4QRQA 3TV3H 4P9HH 2R0ZL 4PLKD 5EIQA 3SKNA 4AIZB 4UQ3A 4PGEB 5CWSA 5EZIL 1UKSA 3VD9A 1JGDA 5CZVH 1AY1H 3MGOA 3S37H 5C07B 4FNLL 4XRCB 5TE7L 4RMQA 3MLRH 3QEQD 1FP5A 1JPGB 3V0AC 3CFCL 5I30H 2GJJA 2A1WL 2Z9TA 3SDAC 3BDYH 5D7SH 5DJZB 1QFWM 4Z77A 1LO5B 5TF1L 1OSPL 4WTWA 2CDFB 3LEYL 1RZ7L 1TMCB 3PL6B 1CK0H 4BQ9A 3CXDL 4QTHB 4QTIH 1ZANL 3WXVL 5ADPL 4Z7VF 4HBCH 3VH8G 2EIBA 5F89A 3ZHLA 1L6ZA 3SJVB 2PXYC 3S97C 2GCYB 3T2QA 1S7VA 5DRZA 3THML 1IAOB 1UB5B 2EH8H 5ALBH 4N8CL 2R8SH 4GT7A 3IETB 3ZL4L 2PYFA 4ZS7L 4G9FA 5DZLA 2IQ9H 3E2HB 4PRIA 1LVEA 4NRZA 2DQEL 3VXMB 4QRUB 5BS0E 3P4NB 1V3LA 3EFFB 3QULA 2GTZB 2F53E 3BPCB 4OGAC 5MENE 4GAGL 5J12B 2JJTC 1T4KA 1AO7A 1HHGB 2YUWA 3MRLA 5CD5C 5FA3B 1AKJD 3AM8A 4XB8A 3TZVC 3GGWA 2GSIA 1NLDL 4GW1B 3CFKA 4M6OH 3IRZA 3TIEA 4YX2H 2IC2A 3HMWL 4E42B 3FTGA 3TO4B 3EZ8A 1BFTA 4MSWB 3S35X 2YRPA 1XF4A 4M8QA 5FA4A 5ICXB 2H1PL 2PR4L 2VABA 4NNPH 3RWDA 4HFWB 3VG0L 4ODHH 4S1RH 4JO2H 5IWLA 4KU1A 1RIUH 3KNBA 4S1DC 1U8QB 4AQ1B 4U6HB 5DVMA 2F5BH 2W0FB 3VW3H 3ARGA 1OTTC 1KCUH 3WLBB 5D5MB 5KANG 1J0YA 2C3VB 5SWSB 4PUBL 4AENA 2NY6B 3QDJA 5CUSL 4S2SA 4F57H 4MNQE 4OLXH 2C1PA 3C8KA 4GQPH 2H32H 4WWKB 4K7FB 4J3SA 1VACA 1JGLL 1GRWA 4HXBH 2IBGA 3OXRB 1FSKC 3EO0A 4Q74A 4EQ2A 1DLFL 1SY6L 1LK3H 2D0HA 4R4ND 1X7QA 1TZGH 3LDBC 5GS3A 4CN4A 4U1GC 4XVJL 3UROR 3VXRE 4F7TA 2APBA 2NY7L 2BVQA 2DLIA 4D0DB 4FQCH 4F33A 1A7PL 3JUZA 1CLCA 5HJ3B 1GHFL 4NQTA 1UH4A 4Z0XB 3K1KC 1KCSH 1K6QL 1DLHA 2L7JA 4XMKH 5DJAB 3UJJL 3KPQB 4WFFE 1WCBA 1NCDL 4UT9H 4DGIH 4LVEA 5DJ8A 3MRHA 2DTSA 1NJ9A 2WUCH 4WO4C 1HYSD 4QHNB 4QHLA 4WU5B 4OFKA 1Y6KR 4JY4A 4H0GA 1CGUA 2HTLC 5J57B 4D94A 5HXMA 1BVKA 3NAAL 2YS4A 3SQOH 4LVNB 2W9EL 4K9EL 2ZWLT 4TVPD 3T3PE 2VLJD 3KXFD 3GRWH 2I9LA 3GBLA 4Y5YA 4YFDB 1M7IA 4GRWE 4G8EB 3EJZC 5C3TA 4ZNCD 4TUJB 5CJXA 1SJHB 2VDKH 2OR8A 1BD2B 1ZVSA 4BZ1H 1RV6X 1JGEB 2PYEB 4ZDHB 3MYJA 1LEGB 4DUXA 5I1IL 4K2UH 2PW1A 2BMKB 3LEVH 5F3BB 2CKBH 1OAYL 4HLZG 3VGDA 2G2RA 3RVUC 2A6IB 5IMMB 5E2VL 3C60A 1OAKL 4NOBA 4DUVA 3SGKC 1XGYL 4X7SL 1BEYL 5D1QB 35C8L 1SJVA 3TBWA 5DT1H 2VDQH 4XNYH 4CU8A 5GS0D 4POUB 3L5JA 2A83B 1OM3H 4C4KO 2BHZA 1FBIH 4FZEH 3H6JA 5BVJB 3Q3GB 1S7WA 4PLOB 4JFEB 1BOGA 3GJFA 3EGSB 5C0IA 2H32B 3G5YA 2ADIB 4K8RD 3UBXA 3UTSA 5DZOA 1SVCP 1YECH 3MRKA 3H42L 2Y25A 3PIQB 4LCWA 2J4WL 4XBGB 3BGMA 4FQLL 1AGBB 4DN4L 1S7RA 4DOHE 2FECI 3IDNA 3OQ3B 3O6ML 3BRFA 4UDUB 3IDMA 4R0LA 1PDKA 1HHJB 4WHYH 4ZAKC 3AREC 3ABZA 2ZG2A 4QHMA 1AFVL 2FJGB 5GS1A 3K74B 2G60H 4R3SB 1Q1JL 5LGHL 4OZGE 1BJMA 2OZ4H 1L9MA 3GSRB 4O2CB 3RNQB 4K7PY 5IBUG 1I9IL 4WTZG 1T5WA 3O3AA 4C58B 1J10A 5IB2B 2OSLB 3IDJA 4Z7UA 1SM3L 4WW2C 3DECA 5FOJA 1AGEB 4QOKB 5JQHC 3DVNA 5IMKA 3BD3A 1I3GH 4P46D 4PP2A 4M03A 4QCIB 1S7SA 3QNYB 2OL3H 4U3CA 4WI5A 3S37X 2QQKH 3RA7H 4AJ0A 1VFMA 5HGDA 2ESVA 3GSNL 5I1CH 1A9EB 3P3YA 3ARDB 4MAUL 4GG6A 4OM0H 3O9WA 2YD4A 1AGCA 4HH9B 2J6EH 3H9ZA 1L7TL 3KYNA 3RTQD 3DOSA 4F8TA 1NBZB 3C6LC 4PB0H 4PTTA 1IGTB 1R3HA 3C5ZB 3HC3H 5I74C 3B9KD 1DBML 2ZCHL 4MB4A 1IE5A 4R7NA 1X4XA 3KJ6L 4NCC2 4PRBB 1FVDB 5K9OB 5B39A 3AAZA 4TNVF 1PG7L 2EH7H 5IBTL 4I5BA 5I1AA 3L95B 3DGGA 3LKSB 5J9PB 1AJ7L 1INQA 2FX9H 4NQVA 2SEBA 2VE6A 4OTXL 3VGHA 3FQUB 1OARL 5I1GH 3NCCB 1CU4L 1F4XL 1YN7A 3PWPE 5BJTA 3NCFB 5LWYL 1G7HA 1UVQB 2EYSB 2H6PB 3LKPA 4X4MA 3OSKA 1T21B 5IEHB 1A6ZB 1ZEAH 4DTGH 1REIA 1ZT1B 1YJDC 4YHOL 1JYXA 5DYOA 5D2LA 1RPQA 3L5IA 3IU3A 1YY8A 2P48B 3D85D 5GGVL 4KK6C 1S3KL 2VZTA 2PO6A 5INCA 3MLSH 1MCLA 3KR3L 5CJQH 2UVEA 1T66C 1Y0LB 1T89C 1MCOL 5KSAA 3PABB 1EK3A 1Q9KB 1UJTA 1RZGA 4ZFZB 1NBVL 1CG9A 4LRIC 4GW5A 5IJKC 3SDCB 1DQLH 1D5IH 1QFUH 3BDBA 3GIVB 4WFHE 5I8EA 5T1DH 5B8CA 3GSOA 3LV3B 4RWHA 4V2BA 4KMTH 5C0EA 2B8OT 1XGQB 3OKNB 5F7DB 4YBLC 2R23B 1JPTL 1KBGH 1R5IA 5JQ6H 4UINH 3RAJL 1H15B 3MGTB 4YDIH 2QJDA 5LGKA 4IOSD 1IT9H 4N0YH 1N64H 3ZKQD 4I0PD 3RKDC 2OL3B 3DETD 3MV7B 1XMWA 4J4PC 5CILL 3QJFA 1ZHNA 4OD1H 5C0FB 1ADQH 3WNPA 2YN3A 2P44B 3GNMH 1HDMA 2ERJC 4NQDB 3FT4B 3MR9B 5J13C 1J86A 4KTEH 4RFEA 1FLRH 4MA7H 3KPSE 3KPRA 2VISB 3GJEB 5GISH 2Q7YA 4X4YA 2ARJQ 2Q8BL 5IMLA 2NY4D 1D6VH 4XXCC 5F3HB 4N0FB 1U91B 1NFIA 3HI5L 1KIRB 4M7JL 4MJIB 1ZHLB 3U46B 4DGVH 2VIRB 3RVVD 3L3HA 4NQXB 4WJ5A 3KPLB 3OB8A 4DFHA 1TENA 4PTUB 4P5TB 4KROB 3DVGA 3EJYD 3BKCH 4N68A 1MELA 4GAFB 1VHPA 2ZUSA 3B5TA 2BXYA 1QSFB 5D6CB 2GJ6E 1IGJA 1BX2A 4HJJL 4O2EB 3SKMB 5TDNB 3S35L 3WYRA 3VMOA 2F58H 1QRKA 4L3AA 3WE6A 1L7IL 4HKJA 1FZOB 2H9GA 1G9NH 3WD5L 4HQQL 4N8PA 2Y7QB 4M7ZB 4IIQA 1Y18B 2W65B 3ME0A 4XXDB 3SE9H 5JXEC 5H8DA 4U1SA 4ERSH 2BZDA 5C0DB 5A40E 5JIPA 3KS0H 3BUTA 1AI1L 5ERWA 1A6AA 3VXSA 3C87A 5F1OB 4P5KA 1XGRB 1MLCA 5BZWA 5C6TL 3VFNB 4AMKL 3TBYB 3UAJC 1EZVY 5FO8B 1DVFB 5CP3H 2EXWC 2LAGB 4HGMA 1BQHA 5IW3A 4G6KL 4BFEA 1RZJL 4K07A 1NCAL 4PRPA 4KRPC 3J7HA 1U8HB 4CBPA 5IFJA 3CX5K 4M93C 2VQTA 5H37H 2NLJB 3BQUB 5EU4B 3CFDA 3DWTA 4EEEA 1B9ZA 4L9LB 1E4JA 4YIQB 3WFEL 1KG0B 2GFBA 3L3DB 1XF1A 2IANB 5LGJB 4QRPD 3BT2L 4XVUC 1ZWIA 3KHQA 2ITDB 3T3PF 3FRPG 4AL8L 2AERT 4R4BA 3RNKB 3HZYA 4GRWF 2EO1A 5KTEH 3QIUB 4NM4H 3QBTB 3TJEH 4L1HA 4HZAA 2VLJE 1WFOA 3KXFE 4JHWH 3WJJA 1KF9B 1R3IH 1MFBL 2VDPL 4R2GB 5BV7L 5C09D 5EU3B 3QH3B 3R8BB 4U7MA 1DDHA 2EKSB 3S3JA 4WV1C 3TIDB 5IP4A 1IRAY 1A6VL 3I85A 4G9FE 2V7NA 1XCTB 2C26A 4PRIE 1TVHA 1FO0L 1NL0L 4KDWA 3W82A 5F6IB 5C0CA 5E4IA 3D2UA 5DEFA 4P3CL 4CDHA 1J1XH 2DLFL 3ZYOA 3ILQC 4RBPH 2BCKB 4XZUB 5JDJA 5TF0A 4H0HB 1AO7E 3PF2A 2ADFH 4JO1L 4H26B 2Y07H 4KI5D 5EIIA 4PRNB 5L2KA 4OD2A 5IJVA 3E1F1 1W0YT 1QRNA 2NY5H 2XZCL 2XT1B 1T1WA 4MQSB 2ZOKA 4YHZH 5E2UL 5JHDB 3QQNA 1JN6B 4OKVB 1U8IA 1DQQB 5A3ID 3JTSA 4PJ9D 4GRLB 1TETL 3CVHH 4GLRI 4XPBH 4LLQB 3KYOB 3WUWA 5KVDL 1C5DB 4S1SH 3QDJE 2P45B 2H2SC 1WEJL 4JDVA 1I8LA 4WHTB 1IL1A 5I73C 1KLUB 3P11H 2VN4A 2FATL 3G5XA 3MLYL 1FDLH 2WBJA 3A6BL 4Y5XA 3C5SB 2OXGA 4BM7A 5ANMA 1I7RB 1IQWL 2GHWB 3HE7A 3D3VD 4UT6L 2GY5A 1JZ3A 3A6CL 1OPGL 5GHWH 1QLEH 3VFUB 2CR3A 2DM7A 4NO2B 2ZKHL 3ALXA 3DV4B 4HIEA 2KL6A 3T1FA 3MRGA 3UPCA 2EIZB 1JF1B 3QZWA 5CBEB 3BKMH 4RFOH 1M1SA 4HS8H 1X5KA 4QWWC 3DBXB 2JJUA 2XN9A 3HCVA 3AMLA 4JM4L 4N0CC 3D48R 2WZPD 4E41B 1PZ5A 1UYWL 5IB3B 4X6CA 3SGEI 3BGAA 1HWGB 2IGFL 3MRCA 5TDOA 3WS6C 5EU6B 4MWFB 1AXSA 4WCYL 1HH9B 5IHLB 2VLRD 1T20A 4O51A 3TP4A 2J8OA 4PJFA 5T5FL 1ZA3B 2IAMB 1MCIA 4OUOA 1D9KB 2X5PA 4LSTL 4FMKA 3BO8B 5LAXB 4EI5A 1MRCH 3MRQA 5I1LA 4RBPK 3S8WA 1KV3A 4K71C 3TV3L 3DX7A 2G9HA 4P9HL 1MVFA 4WI7A 4NQEA 3L1OH 4U05A 1F11B 3V6OC 2UZYB 3IAQA 4XNUL 5B38A 3UX9B 1AY1L 5CZVL 1JF5A 2NYYD 1F3RB 4ZUTB 5I30L 2R9HD 1N2RA 5EUOB 1PX3A 3EYOB 3TYGL 3BDYL 3RVWD 1R5WB 5DJYB 3F12A 3U30B 3WEXB 4LP4A 1XIWB 3TN0B 1FNSH 4UI2A 3GIZH 1AGFA 3P77B 4LVOB 3ULUD 1CK0L 3MUGA 1QFWI 2QSTA 4HCRA 1FFOA 1KTLA 4HBCL 2R2CA 4M48H 4F2MA 3T77B 2P5WD 4MGXA 1G6RL 5GSRA 2IBBA 4H5SA 1IEAA 4GKZB 4L8SB 2ATPB 5ENWB 5DHVH 3SE8H 2BOBB 2EH8L 5ALBL 4ZTPH 3W11C 2R8SL 1YMMB 5T3XH 3W0WD 3WCYA 4CRPA 1JUFB 3VFWA 1UWEH 2IQ9L 3E6FA 1F42A 4AIOA 4PRDA 4GXUN 3BP6A 1G0XA 4P2OB 4I0KA 3UTSE 3UYOD 4NM8L 3MJGX 3DROB 5IF0B 5FO7A 4LCWE 3S5LB 4RZCA 1FGNH 3V6FB 5L6YH 5C0JB 1D6EA 3OJ2C 3LN4B 2J8UB 5DRNA 3U0PA 2GK0A 2JCCB 4OZ4B 3UDWA 4TOYH 4NOFA 3TNMB 4DAGH 5HYFA 3G5ZA 3H7BB 3QCVH 1AH1A 3LZFH 4YX2L 1H5BB 2MQ0A 5MP6H 2PXYB 1LP9A 5I75B 4JFQA 2LQRA 3DNKA 1K5NB 4JO4H 3HE7D 1FNEA 4NNPL 5BVPL 3G08A 5SWZA 4S1RL 2AXFB 4YNYB 4JM2A 1RIUL 1RAMA 1RMFH 1QYGL 4X5LA 3OZ9L 2F5BL 1KSRA 3VW3L 3QUMA 3GEWB 4ZFOL 1VERA 2JB5H 4HPOH 1KCUL 5EH1A 3QUKB 3D39D 3RHWK 5KN5A 4H1LH 4XPTH 3MMEB 3UPRA 5CGYD 2DLTA 4F57L 4Z7UE 1MJ7H 5EBMB 1S9XA 4OLXL 3G6AB 2AJSH 3PV7A 5C8JA 5ID1A 4HXBL 2JIXD 1G7JA 2GSGB 2ADJA 2VITA 5EU5B 1PEZA 1F6AA 5C0AB 3V2AR 1DANU 5D1XA 2YUXA 3KLSA 2VZ1A 2OQJA 2ESVE 1TJHH 3WO3B 4L3ED 3D87B 1TQCC 3IVKB 1HWHB 4PJHA 1RZFH 4XGZA 2VMFA 4GG6E 5HY9B 2H26B 4FQCL 1OY3B 3QQ4B 4MDIB 4LLUA 3GHEH 3HRPA 2Z8WC 5D2NB 3TC9A 1KCSL 4NZDA 4ZOAA 4XMKL 1QBMH 2IFGA 4P23D 3RWHA 4UT9L 4DGIL 4PJAE 4K23H 3PJSB 3ZDXE 2IPKA 2WUCL 4IS6B 1U3YA 3L3OB 3QIBA 1MSPA 2EXYD 1MCFA 4UQ2B 8FABB 1DANT 4Y19A 1A4KB 4JLRB 5KG9B 3NA4A 5BOZG 1CDHA 1S8DB 3VXOA 3SQOL 1A9BA 4XB7A 1CS6A 5DUBB 3GRWL 4HFUH 5DI8B 4X4ME 4ODXB 1DBBL 4FHBD 2VDKL 4BZ1L 5CIPH 1CDBA 2EYTB 5CGTA 3HN3A 4PGBA 5D2LE 4PJXA 2E8YA 4K2UL 2CXKA 3MYZA 2QL1A 3QUXB 4PRAA 3SGJA 5TFSH 1KUMA 3LEVL 4LCIL 2CKBL 4NC2B 4KKBD 2CO6B 3HNVL 3QFDA 4NO5B 4PBXA 1U3HC 5T1LD 1R3LB 3IXAB 3JUYA 5E8EB 4JFYB 5GJTH 1R3JB 4KZDH 5LBSH 5C3LD 4YQXH 3MGAA 3QI9C 2Y6SD 2VDQL 4XNYL 2YPLB 3VWKA 1BAFH 4H1LB 1I7TA 2XPGB 3DV6B 1FBIL 3SDXA 4KJYA 7CGTA 4TSAH 1JZ6A 4WI9A 5F9JA 3MCG1 4XWOC 1ZE3C 3IFPB 1YEEH 1FPTH 1N6UA 5D1ZB 1B6DA 4X9HA 5EN2B 1DUZB 2DLEA 2FHCA 1CFQB 4PJCB 1QSEA 2Z4QA 1YECL 3KYAA 1FG2B 2XWBB 3CU1A 5MEQB 5JOFB 4JPKH 3GSVB 3ARFD 1H9VA 4PY7A 4BH7A 4HDIA 5EA0H 1NSNH 4YO0A 3RGVB 4NZUH 5E24E 1INDL 2QKIB 3H9YA 4LLVA 2R1YB 4FXKA 3WHE1 4HHAA 3O2WL 4Y4KD 1P2CB 4NJAH 2FSEA 3KPRE 2NTFB 4LLWA 1GZPB 3QQ3A 1RVFH 4JRWA 3PQYB 2G60L 3BEVA 4LLDA 2OZ4L 3NCYS 3RWEA 1TCRB 3EW3B 1S5HB 4HUXA 1NMCC 2FIKB 1BIIA 1OWWA 3IS1X 3X14A 1UZ6E 4YE4L 1JHKL 2W60B 3LKOB 3R1GH 3F6LA 4LP5A 4X7EC 3X3GH 2F8OA 1LK2A 3I6GB 4NZTH 2FLRT 5I2IB 5HI4C 1QA9A 5IIEA 1M05B 1AIFB 1P7QA 1T1XA 5GGRA 1K4DA 4KDVA 4NP4H 1I3GL 1WWCA 1IGCL 2R2EB 4APQD 2ILLA 1A3LL 4U49A 1CICA 4FQQA 5E8NB 4KZEL 5BO1H 4LLYA 5DO2C 4I48A 1NANI 1HE7A 4OF0A 3RA7L 1RI8A 5CIPB 3K3QA 5I1CL 3PHOA 3VGBA 5AD0B 4LOUC 4Q6IB 1FFNA 4OM0L 4Y5VC 1HK6A 4F7CA 2J6EL 3BZDA 2PCPB 3VXSE 1A7NH 5HHQA 4RAVB 2YK1L 2H8PB 4RGOH 3EYQC 3ARBD 4PB0L 3UO1L 5BZDA 3HC3L 4NWUH 4ENED 4X4XB 1IC7H 1E28B 1A4JB 4PRPE 5BXFB 3GMQB 1D7FA 5CD3B 2VLRE 4UZGA 2EH7L 3VXTB 2DYPA 1I8MB 4Y4FA 3WFCH 3UBXG 1HOCB 1AR1C 4PJBB 3BIKB 1G0YR 3QWRD 4XPHH 3BWAA 1UJ3A 5I1GL 5T1MA 1HHIB 4ZPTB 4CW1A 2FYYB 1N8ZA 4PRHB 1KPRA 1ZEAL 4DTGL 4PLJC 3BZ4B 1CBVH 3MJ7B 4PGCA 3HPLA 3BN3B 2OX5A 3AB0B 1U8MA 4JR9H 4Y89A 5F1KC 2YXFA 2QQLH 3C6LB 5KSUB 3HG1D 4PJ8B 4MAYD 1G9MC 3T0EC 3RL2B 4MJ4A 1LO4L 5CJQL 4YDVB 1CWVA 2DQFA 4YBQC 3FO2A 3QUZD 4YHIB 4WNQA 3ULUE 1A1MA 5C0CE 1DQLL 1D5IL 1QFUL 1QVOA 4QRSA 5T1DL 5BW7A 1JZ2A 1IGIH 2X4NB 3IJYB 4R26L 3OR6B 3CFEA 2Y5TB 3HE6B 2NXYB 4R7DA 4M8VA 1EO5A 3IKCB 1U95B 4PG9A 5HYSA 2D7PA 2X70B 3C5JB 1D5MB 1FZMB 3K8KA 4NFDA 1KBGL 5JQ6L 3HMXA 5J6GA 4UINL 3FOLB 4YDIL 5L2KE 1A64A 2W91A 5KSBB 1IT9L 4N0YL 1QRNE 1AC0A 1JWMB 1N64L 5DD5H 1O0VA 2AW2A 4HJ0D 2VWEE 4IOIB 4U1MA 1XZ0A 2P8LB 1JGVH 3S36H 3JSSA 1IFHH 5IQ7H 3BP5B 1AXTL 1NCWH 1U8LA 1OGAD 4FTVB 5MERA 1Q38A 3RX5A 4J3OC 3RWIA 1ADQL 1FV1A 4Y2DD 2HVKA 3O11A 3GNML 3DRTB 5DQ9B 1VEOA 4OM1H 4KTEL 5HYQB 4G8GD 1EAPA 4MA7L 3ZTNH 5GISL 5AYQA 1D6VL 4UILH 5IB4A 3PHQB 1K3IA 4E0RA 1RK1B 3FONB 2X4TA 5B39G 2CDEA 1I1AB 5KS9A 1IKNC 4IHOB 3V52H 4ZXBB 1IQDA 2ZUYA 3RGHA 2A2QT 3WHXB 1NCTA 3BKCL 3VRIB 3I6LD 1V7MH 4Z7UF 1YN6B 1JTOA 4DGYH 4Y16B 5E1AB 5T3ZH 1IGYB 2V2TA 5E4EC 1HSAA 3RVTD 4I2XA 4ODTH 1DTUA 1RIHH 1MEXH 2F58L 4X6CE 1LDPH 2BSRB 4M1DH 4P4KB 4ODUB 1A1NA 1G9NL 4X6FB 5AZEH 4O2FA 3RUGA 1NPUA 1NC2B 1RJYA 5JW5A 3RZCC 1CGWA 4P99A 4F7MA 4D0BB 2HJKB 1MCSA 5ESAB 3ULVF 3SE9L 4PJFE 2DYPD 3LSOA 4ERSL 5ID0A 2D9CA 4KHTH 3U7YL 4GG6F 3MROA 4L3EE 3CNKA 3C09C 3MBED 3P4OB 4YHPA 2HLAA 4DKEH 4DJMA 4FQHB 1JZ7A 1EO7A 4MD4B 5GZOC 3FHAA 3ORJA 4NQEE 4Z5RA 3ZDXF 2R2BA 1Y6NR 3QB7C 5HHOA 4M4PA 1JWUA 1ZAGA 1FCCA 1QSVA 1AGDA 1JWSA 1S7XA 3KPTA 4PJIA 4B0MM 5IVXB 3TJHC 1WV7T 4RMUA 4LQ1A 5K9QI 1INEL 1ZHKA 4YLQT 4LCCC 1EPFA 4YHYC 5KTEL 3EDFA 3BPLB 4NM4L 3OG6B 1ND0A 3TJEL 1EBAA 3O8XD 2AI0H 1R3IL 4RAUB 5D2LF 5J06A 1X6LA 3SE4C 1OP3H 4UNUA 1ORQA 3MLWH 3WN5C 1YEDB 3GBMH 1E4KC 4NNYB 1IC5H 3U36A 5EC2A 4HS6B 4K3DL 4NHUA 3B43A 4KXZH 5DJ6B 1MHEB 4BKLB 5E2TH 12E8H 4B53A 2BVTA 4IRZH 4V1DB 4UB0H 4J2XA 3AXLA 5L0QC 4ONHB 1MY5A 2Z31B 3P73B 2ADFL 4JQXA 1R24A 2JK5B 4KDTC 4M3JA 2YD2A 2Y07L 5CCKL 3TH2T 4RGND 3L6FB 5D7JD 5C08A 2FNBA 1LP9E 2NY5L 4NNXB 1BZQK 4LSQH 1AHWB 1VADB 3LS4H 5HPMA 1OT1A 3B9AA 4IRSD 4JFOA 2EDXA 2RR3A 43C9A 2BOCB 4J3VA 3K2UH 3CSPA 3KPMA 1AD0A 4UBDC 3HAEG 4HSQA 3H0TA 3CVHL 4S1SL 5IROA 3O6FA 4JRYB 2BNQB 4PV9B 4QEGA 1HNGA 3P11L 5CSBA 1BQHG 2XWTA 4EOWH 2CLVA 3SKOB 3M1BA 3QJHB 3U9PH 1G7LA 1G7MA 2LFGA 1QLEL 4HULB 4JFFA 3S96B 1UZ6F 1Q9OB 4X9FA 2FO4B 1MFAH 3BKML 4FFVC 2XKNA 4HS8L 5LG1A 1I9JH 2OCFD 3BISA 4ELKB 3N1QC 3RDTB 1T3FA 4JFDB 4PJHE 4MA1B 1QNZL 5CJ8A 4HLZH 4D9RE 1UXWB 3OKMA 3WO4C 2NNAA 1RJCA 1OP3K 4XCFH 2GTWA 1B4JH 2BVOB 5I9QC 4P2QD 2NZ9D 4H8WC 4HV8B 1UWGH 4OLEA 3O4OB 2OMNA 4P3DA 1YMHA 4YXKH 2R56H 1RSFA 3F7RA 5HYJD 4OLZH 2IADA 1DBKL 5IMOA 3BAEH 4JFZH 3FCTB 3MO1A 1XF5B 4WUUB 1QO3A 2M1KA 2VDNH 4Y4HD 2HP4A 1EEYA 2DLGA 5FECB 1DL7H 3UTZB 4TPRH 3VFPB 3FFCB 3L1OL 2ZSWA 4MQXC 2VOTA 1II4E 4CVXB 3HS0B 3MREA 3QXUA 1LE9A 2L0DA 4NQCA 4G7YH 2ZCKH 4L8DA 1CYGA 3VJ6A 1MWAH 3AM8C 1EO8H 2AK1H 4BUGA 1S9YA 4OFYA 1FNSL 1RJLA 1SJEA 3DMMA 1N5YH 3GIZL 4Z78B 2ZUVA 5ICZA 5FEBA 3L3IA 4CNIB 4RGMC 1N5AB 2RHEA 4PV8B 2DD8L 4NN5C 5M94B 1SVZA 4M48L 1G0DA 1FN4A 4WU7B 5IWLC 3L3JA 3OJDB 5IW1B 3WUWG 3S36X 3ARGC 3DXAB 1MF2H 1A2YB 1J8HD 1PW3A 5F96H 4KRNA 2AV7B 5FK9B 3SE8L 3X13A 4M61A 1U8NA 3LN5A 4KV5F 4NBZB 1ACZA 4W4OA 2BSSA 4G8FB 5T3XL 4HWBH 3O6KH 4M7KH 1UWEL 4M43H 5JLZB 3IDYC 2CIIB 3W39A 1KJ2H 3UTTB 1CFTA 1U93A 3DX8A 4GS7C 4GW4A 3QA3A 3QDMB 4NGHH 4X5XA 4ZO7A 3S34L 3QZWG 3AS1A 1ZA6A 2CRYA 1FGNL 1XH3B 4IDJH 2MQ3A 4OZHB 5L6YL 2AJZA 3MV9A 4L1DA 1M71A 4XNMA 3O6FD 1N4XH 1RK0B 3FT2B 4TOYL 3VGGA 2Z93B 5SWQA 5EDXA 2QBWA 2Z35B 5BOPA 1TVDA 3QCVL 3LZFL 3KPOB 3EO9H 5MP6L 32C2B 3ECBA 3EHBD 3CCHB 4HWNA 3B9VA 5I76B 4LFHD 5FCUH 3D18A 1IAKA 1RU9H 1E0OB 3OGOE 4RDQG 3MX0A 3GMRB 4LHUB 1RMFL 2PN5A 4LLAA 4OLWH 2JB5L 2YPKB 3FB5A 1PYWA 4QRRB 5F7WC 5C0BD 5GS2H 1FC1A 5HGBB 4X0KA 4XPTL 1S5IH 1T0PB 1A3QA 1T1YA 4BFGA 2X4PB 3Q2CA 4LSUL 2AJSL 1S9VA 4KKAC 3E6HA 2B7DT 3VGEA 5B38G 2G5RA 5CAYB 1XR9B 2BNRA 1JHTA 2BVPB 4C56B 5DEZA 4Y5YC 4U2YA 2CPCA 3MRIA 4ODBD 4Z7OF 3MLVH 3RVXC 2XA3A 3GSNA 5CJXC 2NXZB 4U6YA 3X11B 1MWAB 2CIKA 3BP4A 3MCKB 1KLGB 1TJHL 3HLAA 5JDSA 4FFWD 1TZHA 4OUUA 4TNVK 3MV8B 4HUWB 3GMOA 4X6CF 5DK3A 1MLBB 5BQ7B 2OBGA 4NFBA 2O26U 2K1MA 5JA9A 1PKQA 4IMLA 3EOAA 3C60C 5TE4H 3ZYZA 1KGCE 2XKSA 1DQJB 1ONQA 2F54D 2P5EA 3GHEL 4N90D 5E5MA 4ZUSB 2XOTA 3OJMB 2R4RH 1NAKH 2EDBA 1QBML 2NY2D 4PJFF 1PX4A 5KZCD 4K23L 4RDQF 1IEBB 1B6UA 3LS5H 3TA3D 1NC4B 3V0WH 3L3KB 4AG4H 5E8PA 3BPOB 1EFXA 2DOCA 3NIGF 4P2RA 3NGBB 4LAJH 2XQBH 3L7EA 3MRRB 1N3NB 2BNUB 3J8F7 3S4SA 4EN3A 2VXSH 2APVA 5F7YC 5F9OH 4HFUL 1R3KB 1I7ZB 4ZUWB 1ZT7B 3VXQB 3U48A 3VWJD 3UZVB 3STZB 3OKDA 1Q0YL 3FQRB 4JFXB 2BSTA 1KPVA 3RWFB 1UZ8B 5L88H 5TFSL 5ACZB 4R0LC 4ZFFB 4HUVB 1KB5H 5E5UB 3BSZH 4AK1A 1T04B 4U1KA 3SDAD 4C83A 2OP4H 2QEJA 3FT3B 3P4MB 1EA9C 2FL5A 5LBSL 5GGSY 5ISZD 4YQXL 4AEHH 2IPTH 1EBPA 3MV9D 2EO9A 2FCBA 5H35A 3VFVA 1BAFL 2AK4A 4Y2OA 3MRJB 2VDRH 3QIWB 3SDDB 2PXYD 4MNGE 1EGJH 1T5XB 4LBEA 2NY3B 4IDLA 4GRWH 1FE8H 1YEEL 1FPTL 5FDYA 3JTTA 3DVIA 3OB0K 2RQ8A 2WK2A 2QSQA 1F90H 3V9FA 1MJJA 4DVBA 3MV11 4EXKA 2IFFH 4YH6A 4JPKL 5JIKA 3ILPA 5JHLH 2RBLA 2RIKA 4S1QH 1NDGB 5EA0L 3WFDH 5DJXB 2XQYG 2O93L 1NSNL 1U3HB 3ULVC 5HVHC 2B1AH 4RNRA 3SGKA 4PJEB 2MCPH 1HIMH 1LNUA 4NZUL 4OGAD 4Z0BH 1RY7B 3O9WC 3DX9A 2M8XA 1X5IA 1LP9F 3F7VB 1U8JA 3QWOB 1ULVA 1RHHA 5CD5D 3NZ8B 4NUJB 3TVMB 4WEMB 3DHJA 3TZVD 1RVFL 4JM2F 2A77H 4L4TA 1JIBA 3LRSB 2ATKA 5KS9E 3PDDA 4MNQB 3BH8B 5IHUH 1YZZA 2IWGA 3QFJA 2V2XB 1W2KT 3BW9A 3FFDA 2C9AA 2KZWA 3R1GL 3LHPH 2DMCA 2VNCA 1CFVH 3N06B 4S1DD 3X3GL 3NCJH 4NZTL 2VXUH 1WTGT 1OTTD 4O00A 2ZPKH 1C16B 3V4VH 4ZNEA 4I2XE 4XP4L 1HEZB 1IGFH 3ARXA 1JMZA 1NBYB 2YA2A 5D9SB 3MRNA 4N5UA 4LIQE 4L8CA 1NGXB 1IJ9A 4U31A 3VXRB 1HHKB 5BO1L 3RUGE 4KVCH 4FQXA 4X83A 1TVBA 4JPWH 1I1CA 4PJHF 1I1FB 1CFNB 1OLLA 3CUPB 2PO6C 4XCYA 2ZCLH 5ABDE 1KB5B 4G80A 1FHGA 5HGHB 1CDIA 1A7NL 2ENYA 2X4UA 3SPVB 4CJ0A 2F74A 5KSAC 3MJ9H 5CZKA 4NWUL 3OKEB 5B8CC 4HIJA 5HHPB 4OIBA 1W0VA 1IC7L 4P2QE 3CFJA 1L4IA 5C0GA 2XTJB 4ZUVA 3V4PH 4RIRB 5IT2H 4HKZA 2A74A 2HA1A 3WFCL 5K9JH 1U8KA 3HR5B 2VQ1B 2C4FT 4PJIE 4XPHL 2QSVA 5A2LH 1K8DB 3QXDA 3O2DH 4WO4D 1MI5A 3QDGD 3BD4A 3RY4A 4AM0B 3V79C 1ZS8A 4LARH 3QR2A 2D7NA 3IF1B 4OCRH 5IW6A 5IB5A 1CBVL 1IM9B 1WFTA 2HTLD 4I18A 3TNNB 4PJXF 3VFTB 4JR9L 1X5HA 3MFGB 4Y1AA 2MTPA 1NH6A 2QQLL 2Z92A 3UMTA 4G9DA 3EJZD 1IARB 1HXYB 5F7EH 1NFDE 4OFPA 3ARVA 5HHXH 3C9NB 4AIZA 2N7BA 5HHME 3T04D 4PGEA 4DKDC 5C07A 1DN0B 4XRCA 3RIFF 3KLDA 1JPGA 5FO9B 3RVUD 3HPJB 3TBTB 3GSWB 3NFNB 4NKMB 3SDXF 2HYMA 2DRUA 5DJZA 1ETZB 1A6WH 2BJMH 1OHQA 1LO5A 1MCWM 1OCWH 4UV7H 2CDFA 4NN6B 3U4EB 3PL6A 4ODVL 3F5WB 3VGAC 4QTHA 5FYKU 5D7IE 1W72L 2HRPL 5DD5L 3MXVH 3SJVA 3ZHKA 4IIQC 3RJQB 2GCYA 3O2VH 1NCWL 4XMPH 4KWUA 1GC1C 4OV6F 1IAOA 1UB5A 3RU8H 3BZEB 1B3JA 2VZUA 2WQRA 3QUYB 3IETA 4I0CC 4OZGB 5CGMA 4OM1L 3MLZL 4EJ1C 3QXVA 4NKOB 1VDGA 1P1ZB 3VXMA 5F7UA 4F37F 2EIDA 4KPHH 4QRUA 1I85A 4UILL 3W81A 4CMHB 3P4NA 3EFFA 1I8IA 1A0QL 2GTZA 1YEHH 3RPIB 1NGPH 1AD9B 3BPCA 3BRGC 1CVRA 1TDQA 4ZAKD 3ARED 1L6XA 1QHOA 3V52L 4JFFE 1HHGA 4PJ5D 2GYSA 5FA3A 5DUMH 5C0BE 2B4CC 4GW1A 2VXVH 3O81A 2OI9C 2DMBA 5T3ZL 2NX5A 2EDTA 4JZJB 4WY7H 4E42A 4ODTL 3TO4A 1UADC 1RIHL 1MEXL 1LDPL 1IM3B 4M1DL 5ICXA 4HFWA 4Q9QH 5AZEL 1QLRB 4I3SH 3WFZA 5ACMA 1U8QA 3DUSB 5T1KD 5IFAL 4U6HA 3WJJC 2WM0A 2OS7A 3P30H 3WLBA 5D5MA 3GMPB 2C3VA 5SWSA 5E8OA 4U1JB 3QG6B 2VDOH 4KHTL 4UUJB 3BX7C 3LKRA 2EDLA 4WW1B 4WWKA 3I9GH 4K7FA 2Q20A 4X5WA 5AEAA 3ULSB 1KTKE 4DKEL 1ZOXA 4GBXB 3VI4E 3OXRA 5FV1L 4DZ8A 1XCQB 5HGAB 4X98B 3CSGA 4IJ3B 4N90E 5DJ2A 5B3JF 3HTLX 3C6LD 3ALWA 4NQCE 5AUMB 4UV4H 4Q7DA 1FZKB 1RZIB 4NYLB 3PWPB 1T80A 4M4RA 1F58L 1EH9A 4NO0D 2ZG1A 5HJ3A 3L7FB 3H9SD 2VWEC 3QEQB 4Z0XA 4X6BB 4CVZB 3L5WB 3KPQA 1WBZB 5EC1B 2ARJB 2NY1C 4LEOB 1H8OA 4GLRH 5BMFH 5TGBB 4QHNA 3QG7H 4CGTA 1C08B 1M7DB 4XX1G 3GBML 1BF8A 1RURL 3MOQA 5DK0B 2NY0C 1I8LC 1J12A 1ZT4B 5EORH 3MPCA 1P5VA 4YDLC 2WBJC 4ETQA 4Y5XC 5E2TL 1WZLA 3ISWA 4KK6D 4G8EA 4UB0L 3EIFA 1T66D 4TUJA 1SJHA 5ISZE 1Z0MA 1JGEA 2PYEA 4ZDHA 1LEGA 3MV9E 3VG9C 1NCCH 2BMKA 2BC4A 4YPGB 5D7KD 5F3BA 4ZFGH 4WUKH 4E9LA 3SGEH 5IESH 1A1OB 1SYVA 3FB8A 4KI1A 3TBVB 2A6IA 1OAZH 3O3EB 3WS3B 1G7QB 4MLSA 4LSQL 2WNGA 1GOHA 3LS4L 5D1QA 2J12B 3N1MC 3N9GH 3WN5B 4D9QD 1AKJB 1GGUA 2HWZH 3G6DH 3K2UL 3TEUA 2A83A 3KPSB 2AQ1A 2F9BT 3MNZB 3Q3GA 5GSVA 4EI5C 3RKDD 2NX5D 2YXMA 4JFEA 2ZUUA 4J4PD 1IAII 4M00A 3EGSA 4HKBB 2H32A 2ADIA 4WI6A 4EOWL 1BLNB 2YUVA 3B5HA 2BNRE 5KS9F 3U9PL 43CAB 2EE3A 5GS0H 3PIQA 4U0RB 4W6YB 4LF3B 1JK8B 5DUPH 1I3UA 1AGBA 1OP9A 4X8JB 1MFCH 3MTRA 4KY1H 1TQBC 5DMKB 3VFSB 3FQNB 3QWQB 4UDUA 3DO7A 2YRLA 1HHJA 4K8RH 4OF7A 1QPPA 3S6CA 2VDLH 3QAZC 5DJDB 1YQVH 2FJGA 3I02A 1QFPA 5FYLE 3AU1B 4OCSL 4XCFL 1PKQE 2H45A 1NMAH 4QY8A 4QT5B 1XGUB 1B4JL 4R3SA 3RUGF 1TZIB 2P5EE 3BWUC 2GW5A 2IBZY 1UWGL 4O2CA 3ZT6A 3RNQA 5FIEA 4YXKL 2MWCA 1FAKT 3VI3F 2VO5A 3ZE1E 4OLZL 1YEFH 5IB2A 3BAEL 4JFZL 2OSLA 4D9LH 1T83A 3VXUD 2VDNL 2FEDC 1JGDB 1AGEA 1DL7L 1YC7A 4TPRL 5J0BA 5JXED 3OKKA 5GXBB 4RA3A 4QCIA 3QNYA 5K9KB 4B50A 3HHRB 3K8LA 1LO3H 4XNQB 4G7YL 2ZCKL 4GRMB 3OKOB 3UAJD 1A9EA 1RZ7H 3CZFB 3WO4B 1MWAL 3CXDH 4PLNC 2EXWD 1EO8L 2AK1L 3ARDA 3UDWC 4PJIF 3I50H 4DKAA 2APWA 4WWID 2OTWB 4OCXH 1N5YL 2CR6A 4HH9A 1CDUA 4KRPD 2XWJA 3JV6B 2VKXA 4HXAH 2VLJB 3KXFB 3IFLH 1U42A 1NBZA 3TT3H 1IGTA 4EIGB 3C5ZA 2V9QA 1SQ2N 3QDGE 4JM2C 4UOW1 4PRBA 3ZL4H 1FVDA 2A6JA 4OT1L 4GG8B 2NW3B 4XAKD 4OCLC 1TTGA 4XVUD 5K9OA 5DD1H 5F96L 4E5XB 2RCSH 1JP5A 2AK4E 5GGQH 3SCMC 3L95A 3LKSA 4JKPH 4QHKI 5DC9B 5J9PA 4YFEA 2ED9A 2EDFA 4M7KL 5ITFB 1NFKA 4M43L 3KLHC 2DBLH 5FM8A 3MRDB 3FQUA 3E3QE 1N7MH 2VRAA 1KJ2L 2X41A 4H25B 1X5AA 2C7UB 4AT6B 1UVQA 4NGHL 2EYSA 2H6PA 5L7XH 5IEHA 1T21A 2OYPA 1A6ZA 5IOPB 1MAKA 3JVGA 4YBHA 4LGSB 5I1KH 4IDJL 4XI5C 5D1XC 2AEPH 4PJ7B 4QXUH 1ACYH 2EYRB 3FTGB 3MBXH 5FKPB 4M8QB 3VG0H 5D7LD 4PBVC 3P9LB 3EO9L 3ILQD 3LD8B 1Y0LA 3CIQA 5D93C 3SHSA 3O3DB 3N1PC 3PABA 1Q9KA 2OLDA 3R06B 4PUBH 4NJ9H 1RU9L 4N9OB 2OZ4A 1B0WA 3GIVA 3SDCA 1GAFL 4AENB 2QQNH 3LV3A 4L4TE 3QEUB 4FFYH 4OLWL 5IG7A 1XGQA 1AR2A 2EDOA 2C1PB 1P84J 3OKNA 1JGLH 3QFJE 4LHQB 5F7DA 1OW0A 1S5IL 3PWUB 5E2WH 3NZHH 3QIBC 4ALAH 1ZLUH 3KS0J 3CSBA 1H15A 3MGTA 4RFNC 2NW2A 2X40A 4Y8DC 2OL3A 1DN2A 3MV7A 4XVJH 2H2SD 4OIAA 1DCLA 3MLVL 2AQ2A 1EVUA 1E4XI 2JE8A 2DM2A 1BBJA 4W70A 4NQDA 3SGJC 5TQ0L 3FT4A 3MR9A 3OF6A 4MYWB 3JV5A 4P46B 4HS3B 2CD0A 3UJJH 2YA0A 1LQSR 2VISA 3UC0H 2CK2A 4U3XA 2DQUL 4XVTL 5TE4L 1DE4B 5F3HA 4N0FA 1U91A 3BD5A 4MJIA 1KIRA 3U46A 5IEKB 4QWWD 1NJ9B 5D8JH 3ZKXC 4NQXA 3KPLA 1GZQB 1NAKL 4N0CD 2DTMH 4PTUA 4A6YH 4P5TA 3VWKC 2HTKC 2VXQH 1Q9LB 2LVEA 4F9LA 3MCLH 3RTQB 1BVKB 1XAUA 5D6CA 3KYKH 5GGTH 1CZ8H 2Y9RT 4O2EA 3SKMA 1JTTA 1PEWA 3IRPX 2LTQB 5TDNA 5FFLA 3B9KB 4KJPC 3VI4F 4MCYA 1NBQA 1J0HA 1FZOA 2VXSL 2D4FA 3D1MC 1DQTA 2Y7QA 4YDJA 4HF5L 3K0WA 1OAYH 1Y18A 2FECL 1WFUA 1Q0XH 2W65A 4XXDA 3LQAH 1VKXA 1FVCB 3DRQA 2FX7H 5C0DA 1ZXQA 4Y1AE 5L88L 3MODH 2C4XA 1CXHA 3D0VB 1RZKC 2Y5EA 35C8H 3FL7A 3GBNL 3CXHJ 1XGRA 3VFNA 3BSZL 1FYTA 1NUDA 1M6OB 1J05B 4UAOC 2DQCH 3TBYA 4M1CC 1T7YA 4KK9C 2OP4L 5FO8A 1DVFA 1JL8A 4YK4B 3UTQA 1ZLUK 1Q94B 4AEHL 2IPTL 5C07E 4CUCA 1U8HA 4DZBB 1ZMYA 2X6MA 3QYCA 3DLQR 1BVLB 3M8OH 5CEXB 2NLJA 3BQUA 4L4VD 5EU4A 3ZSTA 2VDRL 4YEEA 1MJUH 2XFXB 3H42H 1YPZB 2R1WB 4L9LA 1EGJL 4YIQA 1KG0A 3L3DA 4UDTB 4FQPA 2IANA 5FYJE 5LGJA 2XZZA 1IKFL 2ITDA 2VAAB 5HDBE 2HFFB 2I9TA 1CDGA 3RNKA 1U92B 3W11D 1QACA 4G43B 3H8NA 1F90L 3IDNB 3NMEA 3QIUA 4LGRB 5SX5H 1CICC 2IFFL 5J3HC 1NANH 5JHLL 5EU3A 3QH3A 4S1QL 4QHMB 3U2SB 2EKSA 2B1AL 3U1SH 3TIDA 2MCPL 1HIML 5GS1B 4LNRB 4X9IA 4Z0BL 5LGHH 3GI9H 5F8RC 5FUZH 5IVZB 4I0PB 3GB7B 4GKNA 1XCTA 4C56D 5BRZD 3SKUD 3KHOA 1I9IH 3EOBA 4GKSA 3EYFB 1SJXA 1TPXB 1W0WB 2A77L 3E8UL 4JY6A 4RSVA 4A6YB 3MLXH 5DFVD 4LPWA 1SM3H 4OGYL 4M62H 5IHUL 4XZUA 4D9QE 2YEZB 5MEPB 1QZ1A 2NMSA 2YD9A 4M6AA 3LHPL 4Y4FC 3OF6D 3DVNB 3S4SG 5IMKB 1CFVL 3B8YA 2AKRB 2NY4B 3NCJL 4H26A 1B90A 2VXUL 4PRNA 2NX5E 2ZPKL 5A16B 1IGFL 1UJ3C 4EVNB 5DS8B 2KBGA 5B21A 5JHDA 1JN6A 1BGXH 4OKVA 2AEIT 4OV5A 2HFTA 1DQQA 4KVCL 1MCPH 1G9ML 4JPWL 1OQOA 5DTFA 4GRLA 5D5ME 5SWSE 4LLQA 3KYOA 5ELIA 3ZTJG 1C5DA 1DBMH 4WHTA 3TT1L 2WBKA 4ONOA 4JREB 4R7NB 4JZOA 3C5SA 4PJAB 3UYPA 1PJ9A 4HX1A 1I7RA 4BZYA 3NA9H 2FLBT 3VFUA 5BW7C 3DV4A 5C92A 3EYVB 3ZE1F 5HHVH 1INQB 2WSKA 4U6TA 3NFPA 2QQQA 2EIZA 1JF1A 3NACH 4P0DA 5IT2L 5DJ0B 5CBEA 1OARH 1DUYB 1MQKL 3LAFA 2V5RA 5K9JL 4Y0GA 5SX5K 5BJTB 3DBXA 1G7HB 4IBLT 3ZO0A 5F88B 5GJSH 4NKIH 1FYTD 4E41A 5IB3A 3FMGL 1F4HA 3CU7A 1C12B 4KGLA 1T7XA 4YHOH 3O2DL 3S7GA 1GC1H 5D2LB 2KUTA 4HPYH 1IC1A 3PDOB 5EU6A 4MWFA 5JO5B 3WSQH 4OCRL 1HH9A 4Y5VA 4HEPG 5GS2D 4BA8A 5E6IC 1QBLH 1ZA3A 1HNFA 2IAMA 3B2VH 3QIWD 4NKDB 5BS0D 3WNMA 1D9KA 3D25A 4KJQC 3BO8A 2WWMC 4QRPB 1BF2A 2F53D 3OWEA 4PY8J 5MEND 1NBVH 1NCBH 5FUCE 1DBAH 5F7EL 1H0DB 5CHNB 4GMSH 4JO3H 5HHXL 2OMBA 3BI9X 3OX8B 2Q87A 3GDBA 1F11A 2Y06L 3LRHA 5C09B 2B4CH 5M7QA 4ZUTA 1U3HD 4WEBH 4JANA 5EPMB 2B39A 4ESKA 5EUOA 3EYOA 2PYEE 1WTLA 2GT9B 3CH1A 3E0GA 3MOBH 1R5WA 4JEGB 5DJYA 3WEXA 5I18L 3LEXB 1A6WL 1XIWA 2HFEB 2QSCH 3TN0A 2BJML 4ONFH 4XNZC 3QI9D 1XR8B 1OCWL 4UV7L 5ECJE 4HIHB 2N4IA 5DR5H 3P77A 4P4RB 3SE3A 3OGCB 3V5KB 2AV1B 2WIIB 2GJZB 3QJFB 3MXVL 3Q1SH 2YD5A 3T77A 4DUWA 1FFRA 2V9TA 3PXJA 4XWOD 1HDMB 4DFIA 4XMPL 4GKZA 5EOCH 2PTUA 4L8SA 5ENWA 3UTPE 3RU8L 4OZIB 2Q8BH 1YEIH 2OJEB 1YMMA 5IMLB 1R0AH 3UXFA 3HI5H 5DFTA 1JUFA 5J7CC 1CIDA 3VD3A 3ULUH 2D7OA 2CDGB 4JB9H 4JFEE 1RUMH 3V4UH 2Z8RA 4P2OA 3T2NH 4MA8L 5BCAA 4KPHL 1V3MA 3V5DB 2QTEA 5FM5M 1YEHL 1VB9A 1NGPL 3DROA 4PJ9B 3S5LA 4ETYA 3O4LD 3R8QA 1MCQA 1C7TA 1IGJB 4HJJH 4LSRL 5C0RH 5C0JA 5C71A 4F7PB 3LN4A 5F93C 5DUML 4ZOCA 2D0FA 1L7IH 1LWRA 2QADC 4M5YH 2JCCA 4OZ4A 3WE6B 3TNMA 4WFFD 3WD5H 2VXVL 3H7BA 4HQQH 1H5BA 3D3VB 4OF5A 4WY7L 1A6TB 5EOTB 1K5NA 1RULL 5JZ7C 4UNVA 2AXFA 4YNYA 4Q9QL 4I3SL 1OGTB 3PXHA 5E94B 3P0VL 5HI4D 1MFDH 5I16B 3P30L 2ZUTA 1JPST 4F15B 3T09A 2Z91B 4AMKH 5JA8B 2IALB 3MMEA 2VDOL 1UB6B 4ZO9A 3G6AA 3HZMB 1PY9A 3I9GL 1LDSA 3QXAB 4TVSa 2VLRB 1UM6H 4LOUD 5EU5A 1HZHH 2O61B 3MRPB 5C0AA 1UM5H 2OJZH 5D72H 5IGXH 1CXIA 3EYQD 2WLZA 4UV4L 3IVKA 3DGCR 4OGZA 4KMQA 2BK8A 3O6LH 3T0AA 1QKZH 5HY9A 3EYSH 4PJDB 5EULV 2H26A 2ZUWA 4EDWL 1ORSB 2VDPH 3QQ4A 2AEQL 1KTDB 1E6OH 4MDIA 4R8WH 3QRFM 4YJZL 3VDBA 3F7PC 1B4RA 4ZS6C 1AR1D 4G7VH 2I27N 5IK3B 1MJ8H 2Y23A 3DO3A 2VTFA 1L0QA 4LSPH 1F02I 3IB4A 3PJSA 4PJGA 5BMFL 1LD9B 4IS6A 3QG7L 1FO0H 1NDMB 3L3OA 1TVHB 1WF5A 3BVNB 2DKSA 1F2XK 4NC0B 4P3CH 4PLJD 4UQ2A 8FABA 5J4MA 4YR6B 1BZ9B 2DLFH 4ZG1A 2ED8A 1A4KA 4JLRA 5KG9A 1VENA 2P5WB 1S8DA 1ERNA 5DJCA 4ISVB 5DUBA 1KLFA 4F7EB 5F8QC 5CEZD 2E9IA 3T0ED 3G9VA 5DI8A 2EZ0C 3EDEA 4YBQD 2EYTA 5T33H 1EDQA 2DM3A 3QUXA 1NCCL 5DMIH 3KDMB 4L4VE 4ZFGL 4PPTA 5E95B 2YRZA 4U4BA 5HDBF 4DK3A 5IESL 2EIEA 1IZJA 1RUKH 3D0LB 4H8WL 1OAZL 1R3LA 2YMXH 3IXAA 2P43B 5E8EA 5KANI 5F70A 2F8VA 1R3JA 5IVNA 5DHXB 5KVDH 3O3BB 1E4KA 3NPSB 2HWZL 3ZMRA 3G6DL 2YPLA 1AP2B 3MLYH 4Q9RH 3A6BH 4H1LA 2XPGA 3DV6A 4Z7WB 2AXHA 1EHLH 5JW4Q 3A6CH 4NRYB 3GKWH 3HE7B 5KAQG 2PF6A 3IFPA 2ZKHH 1BZ7B 3CC5A 5D1ZA 1QBAA 4CU7A 3MV01 4FQIH 1DUZA 4RX4A 2ZUQC 4PJCA 1FG2A 5GS0L 2XWBA 1N6VA 3D39B 5MEQA 3MV7E 1MFCL 2Q86A 3P40A 5E2JA 3WIFB 3DI2B 3GSVA 2JELH 1RUPL 1S7UB 4KY1L 1RHFA 4P59H 1PZ5B 2IGFH 4XP9H 3RGVA 3I75A 2HLFC 1I9RH 3Q6FB 3VMNA 4K8RL 3LH2H 4M7LH 2QKIA 4NQDE 2JIXB 3DMMC 4YHNB 2R1YA 4KKNA 4WCYH 4LKCA 2VDLL 1YQVL 1QFWL 2D31B 3BGFB 3ARZA 2NTFA 1GZPA 3QUMH 4YC2B 1NMAL 5FKAB 3PQYA 2VR4A 3C08L 4MJIE 1A14H 2R29H 4OLYH 4K94C 4DQOH 5E9DA 1TCRA 4L3EB 1S5HA 4PIRF 2KQNA 5D5MF 2R1XA 2FIKA 1DQDH 2W60A 1YEFL 1FO0B 3LKOA 4GSDL 4W4OC 3DX7B 4LCYA 1MVUB 4D9LL 3I6GA 4LQFH 2DWEA 5HBBA 4XNUH 2C3HA 5I2IA 3RZCD 4LAQH 1M05A 1TNMA 1AIFA 4ZUUB 1A6UH 2DKMA 2C5DC 3CK0H 2WV3A 3EAKA 1ZLSH 4P23B 3TYGH 2UZXB 1TQBB 2R2EA 1N2RB 1WWBX 4OSUH 1JZ5A 1SHMA 4JE4B 5FGSA 4JJHA 1D3CA 1LO3L 5CIPA 1X3DA 2YOCA 3W9EB 4FABL 4WFHD 5AD0A 5GZOD 3C6SB 4LCUB 3I50L 4XT1C 3Q48A 4OCXL 1UEMA 1G6RH 5I8OH 2FRGP 2PCPA 4HXAL 1GXEA 3IFLL 2AGJH 4DN3H 4RAVA 3TT3L 3S9DB 2H8PA 1FYTE 4BYHA 1QHPA 2WIMA 2XYCA 1CLYH 3DI3B 5DQJB 4I1NB 5L9DH 3TJHD 4X4XA 1E28A 2B5IB 4JRXD 2D7TH 1A4JA 2EE9A 4NCC1 1ES0B 5BXFA 3VE0B 1NCNA 1UC6A 2IQAB 5DD1L 3H3KA 3GMQA 3VFWB 1UM4H 5JNYB 2DN7A 3IDGB 2RCSL 5DQDH 4OFVA 3VXTA 1I8MA 5GGQL 4JKPL 1JF6A 1HOCA 5T1LB 3BIKA 4NM8H 1LMKA 5FYKD 1HH6B 3B2UC 3QPQC 2DBLL 4HIIB 5FO7B 3FAWA 1N7ML 3MQIA 4RZCB 5I8KH 1HHIA 4ZPTA 1UKTA 2FYYA 3K4DA 5L7XL 5JR1H 4PRHA 1F4WH 2HAZA 3BZ4A 5TDPB 3KPSD 3MJ7A 1S9WB 3BPNC 3VFOB 4DVRH 5I1KL 1T0NB 2AEPL 1MAJA 4QXUL 1ACYL 3I6KB 4R96A 3MBXL 2LE9A 1OQXA 4PJ8A 5BVPH 3RL2A 5F7NC 1P9MA 3MLTB 3U0TB 1QYGH 2BXZA 1BP3B 4ZSOE 3OZ9H 4YDVA 2OXHA 4J23A 4YHIA 4CMMB 3LPFA 2DQJH 2GJ6D 4JGUA 4NJ9L 5KVMC 3SO5A 1J0KA 3ARFB 2X4NA 2QQNL 3IJYA 2J5LB 3OR6A 1CXKA 4FFYL 2Y5TA 3T4AB 3HE6A 5I8CB 5HDQH 3IKCA 1U95A 4LSVH 3C5JA 4Y4KB 4N0RA 3NZHL 5E2WL 1D5MA 4ALAL 3FOLA 4AQOA 1CDJA 4UBDD 5KSBA 3LQZB 5GGRY 4IRJC 1MREH 4EN3C 1JWMA 1JTPA 1MPAH 5D96C 2WP3T 1QBBA 1SYSA 1DBJH 4IOIA 2P8LA 5JHDE 1KFAH 2J3SA 1KCKA 3D69B 3BP5A 4FTVA 3O4LE 4KUCF 1RZKH 5C1MB 2BVEA 1E27B 2X2YA 3TBSA 1MY7A 3IDXH 3DRTA 3BOVA 1G6RB 2C3GA 4JKLA 4F8QA 3WKMH 5HYQA 4APQB 4BQ8A 3UC0L 4HAFA 2E7LA 4FFVD 3PHQA 4MQ7B 1HINH 2WQ8A 2W0KA 1RK1A 1JNNH 3FONA 4QNPE 1I1AA 5DHYB 1OL0A 5D8JL 2DTML 2QR0B 4A6YL 4IHOA 4ZXBA 4FQ1L 3KLAB 1FQ9C 2VXQL 3VRIA 4P5MB 3MCLL 2BERA 4U1HB 1YN6A 2CH8A 5ICYB 3STLB 5DEGB 3KYKL 4Y16A 5E1AA 5GGTL 3MA9H 3ARBB 1CZ8L 4CVUA 3MUZ1 3FRUA 4NZRH 1PD6A 3E3QC 1DBBH 4E41E 5DRXB 2BSRA 4P4KA 4ODUA 4X6FA 1ZTXH 4U1LB 1WK0A 5FDWB 2E6QA 1NC2A 4G6JH 1HI6B 5EU6E 4G9FD 4LCIH 2B1HH 3HNVH 2EDRA 4PRID 4WHYG 1FIGH 1Q0XL 4D0BA 2HJKA 5ESAA 4DEPB 4I3RH 3LQAL 2FX7L 2D2OA 2R9HC 3RIFK 4FXGB 2FR4B 2I07B 4MS8C 4MQXD 3MODL 2CMRH 2FGWH 3PP3H 3ZKXB 3P4OA 4ZFOB 1AO7D 4NPYB 2DAVA 2DQCL 2MPAH 4FQHA 4KTDH 4MD4A 1A8JH 2D9QB 4MX7B 5E70A 1BJ1J 2E8ZA 4W6WB 4HK0B 3C2AL 3HG1B 5F9JB 1H3UA 4MAYB 4N1CA 5E99H 3M8OL 5EUOE 2E7MA 2AXGB 1MJUL 3PNWB 3QUZB 2LVCA 5CJBA 3U4BH 5IVXA 1FH5H 1C7SA 3ARGD 5GIRA 3QO1A 1CT8B 1MHCB 3DJ9A 3QDJD 4HDIB 2HJLB 2I24N 3ZHDA 2P8MB 4YO0B 1KPUB 1INDH 5CEZE 2YHGA 1J8KA 3T0EE 4PGZA 4FQXC 4LLVB 1SEBB 3O2WH 4Q0XH 3GMNA 4HHAB 3VXNA 3VMPA 3GK8H 3U1SL 3MOAH 2FSEB 4NNYA 4HJGA 1YMME 2WW8A 3GI9L 4HS6A 4MJ6B 5FUZL 3UCRA 2F8XC 1KJMA 1KIQB 3UP1A 4EUPH 4KKLC 3B3IB 5DJ6A 1MHEA 4HUXB 4BKLA 4NN7B 1OGAB 4YE4H 1JHKH 1BIIB 3C8HA 1RZJC 1VEMA 2EDHA 4Y2DB 4CN1A 3MLXL 4QRTA 2IEPA 4M62L 4ODSH 5EZOH 3HMXH 4ONHA 3INUH 4OF8A 1QA9B 3LRGA 4G8GB 2VR5A 2Z31A 3P73A 1K4DB 4JKKA 2JCCE 2X44D 1IGCH 2FBJH 2PKDA 3CX2A 5K93A 2JK5A 1A3LH 4KZEH 2A6DA 2VDMH 1OAXH 1GL4B 4NNXA 3NIFF 3K4AA 2P8PB 1OB1B 3PGFH 3PWVB 1VADA 5MI0C 1BGXL 1PQZA 2CKBB 2K7PA 1BBDL 2BOCA 1FORL 3PP3K 3FQXB 5HHNB 4KKAD 4U0QB 1MCPL 5BV7C 2CGRH 4I18C 3ESVF 1YY9C 2YK1H 1VA9A 4PGDB 1CGVA 4NIKB 3SO3C 1U36A 2CLZB 1CVSC 3WFHA 4JRYA 3UO1H 3IDUA 2BNQA 4K7PH 5I71C 4GOSA 4PV9A 5DMJB 3LIZH 5BZDB 5KOVC 1MOEA 4KMLB 4FG6C 3SKOA 1IILE 3NA9L 3QEHB 3KJ4B 4OJFH 2DYPB 2VAJA 3M17B 4W68A 2NR6C 5HHVL 1HCVA 1TIUA 5IUSA 1Q9OA 3BUYB 4U2ZA 3C60D 3NACL 2FO4A 3BXNB 2YR3A 5CSZA 3MBEB 3QNXB 4ELKA 3RDTA 4JFDA 4LIQH 1UA6L 5F71A 5DZNA 1PY4A 1UXWA 5GJSL 4NKIL 5JW4M 1QPXA 7FABH 3PL6C 3GSQB 2ITCB 5FHAH 4PGCB 3SN6N 3RL1B 1GC1L 2BVOA 1U8MB 4HPYL 4RISH 2EC9T 1JYNA 2ARWA 1NUFA 5J11B 2O5ZH 4HV8A 3WSQL 4JHZA 4M9PA 4MJ5B 1FL6A 1LO4H 4QYOB 5FUOL 1QBLL 2VSDA 3UTSD 3B2VL 2KQMA 4UIKH 1G9EA 4PJGE 3K8MA 4H88H 3FO2B 3FCTA 4KJWC 5T3XE 4LCWD 1XF5A 1RJZB 4WUUA 1NCBL 2CSPA 1DBAL 3E2HC 5FECA 4R26H