1OLLA

Extracellular region of the human receptor nkp46
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
188
structure length
188
Chain Sequence
TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NK RECEPTOR
publication title Structure of the Human Nk Cell Triggering Receptor Nkp46 Ectodomain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/receptor
total genus 36
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2003-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ollA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ollA01
3PHOA 2CRYA 4BFIB 4LCWB 3GHEL 4W6WB 2XXMB 4M6OH 1ZA3A 5FYKH 1FORL 1OTUC 3AAZB 2D03L 4Z77B 4UILL 4X98B 3MLRL 4PJ7A 1A7BA 1VEMA 4YXKL 4G80A 4LVEA 1FPTH 1KN2L 3RX8A 1IM9D 5HHXL 5IB4B 1J88A 4NPYB 1I7RB 1CWVA 1T03L 4IIQB 3FT2A 5HYSA 5T3XH 5DMGD 2PYED 1FVCA 2VLJA 4XVUC 5C6TH 4GG6F 3CFCH 2VLKD 3S98A 1NUFA 2DMKA 5JDSB 1WISA 5IQ9A 2GJJA 4NHCH 3NTCL 4O51A 4PLOB 4PJEE 1VGKB 5MERA 1WLHA 4HMCA 5J3HC 3CZFA 4GKNA 4TN9A 1CD0A 1NFDA 3DSNA 5LBSH 2NY0D 1F4WH 2VZ1A 3MZGB 4LFHG 3ALPA 4JB9L 1RK1A 1P4LB 4GRLD 1PYWB 1G7HA 1OAYL 3MRPB 5HPOA 2YD1A 4POZD 4AEHL 4PLJD 2C3VA 1OQOA 4BH7B 3P4NA 1FC1A 4M5ZH 4UV7L 3OZ9H 3MV9E 1ZHLB 2ZSWA 4PJ5D 4CMHC 3P4LA 3QI9A 4WV1A 4AH2B 4PRIE 4KXZI 2AERT 1G7IB 3DO7A 4FQQB 2DWDB 1ONQB 4ODWA 5TF1H 1LP9B 4ZFOB 3VU2A 5IVXF 4MCYA 4MD4B 4OGZA 3EO0A 3OHXA 3ARGA 1CFNB 1QFWM 5E00A 4P57B 3QIWD 4QRRE 2FX9H 2ERJC 3WN5A 5DQDL 5EIVA 5D1XC 4NKMB 2GSIB 5JPMA 1YY9C 2W65A 4GRMA 3KWWA 2YWYA 2G9HA 3BHBA 5IW1A 3DRTA 1DQMH 4Z7NF 1PZ5A 3QG7L 4WFFD 2NLJA 3FFCB 4NO2B 1WZ1H 1S7WB 2BJML 4RRPG 1CXKA 2R1YB 1I8LA 3CXHK 4PB9H 5I17B 2XACC 1BZQK 2NX5B 4MAUH 4H8WL 5DJ2B 5BZDB 1ZHKA 3TH4T 3GRWL 4KGLA 1N26A 3DXAE 1IC7L 5I1GL 3DWTA 2NY7H 5I8CB 4JRYA 1Q9WB 4KK5D 4P2RB 3CVHA 1H0DB 4L4VE 1AXTH 2P47B 1QRKA 3MLUL 2E7CA 4IOFC 3ZDYF 4ZAKC 1PEZA 2VKXA 3QRGL 3U4EB 2NY1D 3VG9C 1Q0YH 2DBJA 1VFAA 4HF5L 2A73A 4M48L 3E2HB 1LE9A 3VWKA 4XP9H 4FQJL 4MA8H 3ZYJA 3BGMA 3SDCC 5JHDD 5EC1A 2XKUA 1IAIM 4M6NH 1RU9H 5IB3B 1XR9A 3MCKB 3BD3A 5JOFB 4BFIA 3ZKQD 1T83A 4LCWA 4XCFL 5TF0A 3SGJA 3PE9A 4GG6B 4L3CB 4BSJA 3HG1D 3AAZA 4Z77A 1SJXA 4X98A 3HMXA 1FCCA 3FN3A 4I77H 2VLRB 5IB4A 4NPYA 1I7RA 2W9LA 2XA3A 3DVNB 4IIQA 1E6JL 2QQNL 3QDHA 2R23B 2ZUUA 4KH2A 2J5LB 5JDSA 4M3JA 2VL5B 4CNIB 2AQ3A 4MB5A 2HTKD 1MIEL 1A7QL 1VGKA 5IEHB 3IFOB 1W72B 2EO1A 5JUEL 1BMGA 1P4LA 1PYWA 3OGOE 3MRPA 4X8JB 5EULV 2FX7H 4YDIL 4ZUUB 3O4LE 1IKFH 1CLOL 1PQZB 5IVXB 1YN7B 4K3HA 3MJGX 3QH3B 2P5WD 4BH7A 2CK0H 3ZHDA 2AJYH 5IJVB 1JP5A 2EXYC 5I8OL 4UTBL 1ZHLA 1W0VB 5C9KA 5TE6L 2HJKB 4AH2A 1G7IA 1P7KB 4FQQA 2DWDA 1ONQA 5I1KL 1LP9A 4ZFOA 1TFHA 5HDBF 2I5YH 2N4IA 3PL6D 1II4E 5A3ID 5IP4A 4MD4A 3IFNL 1CFNA 4MJID 4EN3B 4XBGB 4P57A 3LZFH 4R3SB 4L8SB 2GITB 1ZTXL 4UT6H 1HYRC 3JWDL 4NKMA 1LO2L 2GSIA 2WMPA 1YEDB 2XTJE 4PD4K 3UZQA 4DEPB 3U83A 4Y5VC 2DQHH 1I9IH 2R0ZH 3WKMH 1BJ1J 3FFCA 3TYGH 4NO2A 5DRXB 5FGSA 4WUKL 1S7WA 1BFOA 2R1YA 3MJ9H 5I17A 5C1MB 2NX5A 4GKSB 3K46A 5DJ2A 5BZDA 4K2UL 2DICA 3I3BA 5ADOL 1DJSA 4Y2DD 4A6YB 1NAKH 5I8CA 3TT3L 3T0AA 1JZ4A 1J5OH 1Q9WA 4P2RA 5DMJB 1H0DA 1R0AH 3K8KA 5L88L 5SWSD 3D18B 4M6MH 3V8OA 5KSBB 2YA0A 5BV7L 4X9IA 3T04D 4XWOC 3U4EA 5K9JH 4IMLB 1NCBL 4HW6A 4XP6L 3EDFA 1B0RB 1N0XH 4R7DB 4GG8B 5IB3A 1LEKB 3UC0L 3MCKA 2BSRB 5B3JF 5JOFA 4OQ1A 4GKZB 4GG6A 2MCPL 4L3CA 3ULUL 2E7LA 1X5AA 4BZ2H 4PJAE 3I3DA 4CKVX 1MCLA 3B9VA 1C7TA 1JGVL 1KT2B 5FYJE 2BRRH 2VLRA 4H26B 4MMZC 2EYTB 1DTUA 3DVNA 1P6AB 2Y23A 2R23A 5C0AE 1IGMH 1JMXA 2VL5A 4CNIA 1DQLH 4OT1L 4JQVC 4KDVA 5KAQF 3VI4F 3PGFH 4NUGH 5IEHA 3D9AH 4HS8L 3IFOA 4RGMC 3ULVH 1S78D 1W72A 2I27N 3AMKA 4FS0A 3KYKH 4LSQL 2UZXB 4X8JA 5E99H 3GBNH 5AYUL 4ZUUA 3TZVB 1PQZA 4K9EC 4X9FA 5IVXA 1YN7A 3B5HA 3QH3A 5FGCB 5IJVA 5LKNA 4CU7A 4XAKD 4E41D 1W0VA 3WLBB 1KELH 2HJKA 4AG4L 1BP3B 2XY2A 1XGYL 1P7KA 3DLQR 2PKDA 1H3TA 4OFPA 2E9WA 3MV7E 3BQUC 5D7LD 2C4XA 2A9NH 5KANG 4OD2B 4WJ5B 5LGHL 5I71C 4EN3A 2P49B 4XBGA 4J4PC 4R3SA 3CZJA 2VAAB 1E4XH 4NKQB 4L8SA 2GITA 3PWPD 4TVPH 1MCNA 5B4MD 4NP4L 4K3GA 1UG9A 1OTSC 5E8DH 1YEDA 2VMFA 4DWHA 1YC7A 3HI5L 2FEEI 1VPOL 4G6JH 4Y7MA 1KB5B 3E3QE 1YPZB 4I2XB 5DRXA 5LJYH 1HI6B 3CVHL 3LS4H 4GKSA 1ZLWH 1G9NC 1VADB 1QTYT 3HE6D 1Z0NA 3T1FB 4A6YA 4NT6B 1E4WL 1DQQB 3O41B 3DHMA 3SDAB 1Z9LA 4AT6B 1MJ8L 2Z8RA 3D18A 2JELL 4UT9H 4PRAB 4NZUH 4TPRL 5KSBA 4JY4B 2IH3B 2FJFB 5F6HJ 1PKQE 5FYLE 5IR1B 5J06A 2YA1A 4RNRB 3RPKA 1BIIB 5C08B 1C5CH 1IFHL 4IMLA 5CJQL 1X3DA 1B0RA 3RIAK 2BXYA 4MXVF 1J0HA 4R7DA 4GG8A 1LEKA 2DS4A 3HMXL 2BSRA 4M9OA 4P9MH 5FYJU 4J12A 4O2CB 3TJHD 4GKZA 2R4SL 1FNEB 4KZEH 5GZOC 5ISZD 2BFVH 4X6DF 1TJIL 4FRWA 1OARL 4ZO6A 5FECB 2D2OA 1L9NA 1KT2A 4TNVF 4PS4L 4HFWB 3UTSB 2P5EB 4H26A 2EYTA 4X4ME 4JO1H 1RZKH 2VXQL 4YHMH 3IDYB 1RZ7L 3L3JB 4HIXL 1A7RH 3IETB 3QCUH 1T89A 1DEEB 1DQTA 1JZ2A 5T3ZH 1D6EB 4AMKH 5TQ0H 3GHBL 1B2WL 4AM0B 1D9KC 2MCG1 5FOBB 4PRPB 2BMKB 3J8F7 3DVGB 3TZVA 1KB9K 4HWEH 4ZFOL 4JKMA 3HA0A 4JPKH 2R4RL 1MCPL 2NR6D 1JN6B 3WLBA 1MFCH 1NANH 3S36X 1MCBA 4K3JH 3M8OH 3RU8L 2AEIT 4H0IA 4OD2A 4WJ5A 3RNQB 1Q9LB 1W8OA 2R1XB 4QYOB 3FN0L 4Q9RL 1OY3B 2VAAA 3I6LE 3VGBA 3EO9L 1IEAB 1S7QB 2B4CH 4C56E 3JWNC 3DMMC 3K1DA 1ETZB 1J8HD 1MJUL 4QT5B 4KKLD 4BA8A 3VRLE 1OD7A 1ZA6B 4MJ2A 1KB5A 5CZVH 2VZUA 4I1NB 4OLYL 1RFDL 5BW7A 1YPZA 1BREA 4MDJA 4I2XA 2I07B 3TESA 2CK2A 2HT2C 5EBLB 1H8NA 1HI6A 4WFGE 2F54D 4QY8B 3VH8G 4H0HB 5E5MB 2R2EB 1C5BL 1VADA 3NCJL 5EZOH 3S37L 3BD5A 3T1FA 4GBXD 3HHRB 4NT6A 5E2JA 3NFSH 4NZRL 4DQOH 4ODSL 1DQQA 1TXKA 3O41A 3SDAA 4AT6A 5DMYA 2DMCA 4PRAA 4PFEA 3PUCA 3INUL 4JY4A 4U6YB 1PLGH 2IH3A 2FJFA 3E8UL 4QRPE 5CUSL 5IR1A 4XTRC 4U6VH 2F8XC 4RNRA 1U9KA 1BIIA 4WI7A 5C08A 1MCCA 4GOSA 4X6DB 2GYSA 3NIGF 4JG0L 2DJ4A 5TGBB 2ZCHH 4ZTOL 2K9UA 2PO6B 4LPYA 4A2MA 5DK3A 3A67L 4O2CA 1A14H 5I1CH 1FNEA 3MLSH 1RIVH 1CF8H 1EV2E 4IJ3B 5GJTL 3H3BC 5FECA 4HFWA 3UTSA 2P5EA 1TTGA 1UT9A 3TWCL 1ZGLB 2QEJA 4ZTPH 4KTEH 2BNRD 5TFSH 2V5YA 3L3JA 5D7IF 5E70A 1W72L 3FN9A 3IETA 1DEEA 1D6EA 2LAGB 3QQNA 4ZOBA 5DUML 3MLXL 4AM0A 3VXQB 5FOBA 4G7VL 4PRPA 2BMKA 5DSCB 1T1WB 4ODVH 3SDDC 2YPVH 4Y88A 3BP7B 1P7QD 2BNQB 4WTXA 3DVGA 3N85H 1X7QB 4DAGL 1ACZA 5BS0D 1AC6A 3HTLX 2PXYC 3R06B 2ZNWA 2B7DT 5SWZE 1JN6A 3C09B 1WFNA 5T5FL 3MR9B 2X9XA 4N0UE 2OYPA 4PJHF 1CGXA 3EIFA 5DJ0B 1NAMB 4Z76B 5JHLL 5B8CC 4FA8A 3LKNB 1QSEB 3LEVH 3RNQA 4WHCA 1Q9LA 2R1XA 3ME0A 1WTGT 4MXWL 4PJDF 4QYOA 4ZFFB 1FHGA 4F58H 1EBAA 4AEEA 4XP5H 3QEGL 3QULB 1IEAA 1S7QA 3FCTB 5F70A 4ODBD 2LVCA 3SJVB 2OJZL 4IRSB 4KK6C 1ETZA 3G6DH 5E8NB 4QT5A 3LEXB 3KLAB 3VXRE 1ZA6A 1CZ8H 5LG1A 25C8H 5C0BD 5FB8B 3SDYL 2ZCLL 3WD5H 1CN4A 1LDSA 5KSAB 3S4SB 2I07A 4A6YL 2VZOA 4N8VG 4GSDL 5EBLA 2H32H 4LOUD 1BAFH 3RRQA 1FAIH 3CSYB 4QY8A 2AKRB 3GSRB 3O6FD 5E5MA 2R2EA 4OD3L 2AEPL 1FBIL 1REIA 1BM3L 4MS8D 1WBZB 3ARED 1IAII 5HD8D 3U9PH 2YD5A 4ZO9A 1MI5E 2CPCA 4DCQB 1JYVA 1UWXK 3HC3L 1NEUA 3O2WH 5DMKB 1K8DB 1HYSC 1A4JB 9CGTA 4GAFB 1T6WA 4L3EE 4U6YA 2VDPL 1UA6H 4AQOA 3EW3B 1D6VL 1GAFH 4W81A 2D9CA 3GKWL 4X6DA 1CDYA 3ZKMC 1A9BB 4OGAD 2APWA 4OZHE 1HWHB 5GRJH 5TGBA 2VXSH 1F3RB 4UOW0 2PO6A 3MC0A 4OCXL 1GZPB 3SE9L 1GOGA 3B43A 4WI6A 3RY6C 1F90L 5D7IB 3ARDC 4OCNC 3U7YL 3GGWB 1Z0MA 1BF2A 3JWOL 2GY7B 4LQFL 2CIKB 3FO0H 3O8XC 1U8HB 1QP1A 4Y4KC 2CRZA 4R97C 4Y8AA 3SE8L 1ZGLA 3UPAA 1OD9A 3TNNB 1M05B 3LKQB 1TZIB 3MZTA 1J7VR 4OLZH 4JQXC 2Q8BH 2DQJL 4KI5D 2EECA 1YQ2A 2PW2B 3VXQA 3THML 4MNGE 4RFOH 2VLJD 3GI9H 2D4DA 5DSCA 1T1WA 5DVMA 4NO0B 3BP7A 3DV4B 3EFFB 4PJHB 1NGPL 1OCWL 2BNQA 2J8UF 1X7QA 4KAQH 1I1RA 3QJHB 3R06A 1V8HA 4LF3B 4PJDB 3TBYB 5KZCB 1UZ6E 5IFAH 5E8PB 3HZKB 4U1SB 3MR9A 3TBVB 4YHYC 1TQCB 1AIFB 2DQCH 4MB3A 5DJ0A 1NAMA 4Z76A 3HB3C 5L0QC 3LKNA 1QSEA 4PRHE 3LV3B 4TNVK 4ZFFA 3BW9B 4P5TC 3QULA 2H1PL 1S7TB 2D4FA 3FCTA 2ICWI 3TA3C 4PJIF 4QTIL 3SJVA 4IRSA 4Z7QE 1FFQA 2C1PB 3ARGD 3KPRE 4OF7A 5E8NA 2D7TH 1KTDB 3P40A 2NY2C 2VDQL 3LEXA 3KLAA 5E2TL 3ALWA 3VFGL 4CN1A 3BN9C 4XPAL 3IXTB 5FB8A 1OAUL 2I60L 4MCZB 5KSAA 3S4SA 4AIOA 2HRLA 3OB8A 2NY5L 4O9HL 1YJDH 3JZ7A 3CSYA 1JGEB 2AKRA 5B21A 3GMOB 3GSRA 5F9AC 4O00A 3VXSE 1NDMB 4KJQD 1WBZA 1AO7D 2MSPA 4DCQA 1M7IB 4CBPA 4H1LH 3CFBB 5ITBH 5DMKA 1K8DA 1A4JA 5DC9B 4LLVB 4ONFL 3RDTC 3V0VB 4JRYD 5F7KC 4JO3H 1F6LL 4M7KL 3MRBB 1X4ZA 1QFUH 5KTEL 4JO4H 2BRQA 3RTQB 4WHTB 1A9BA 4ZFZB 3HNVL 5FKAB 1SJEB 2IBBA 1IT9H 1GZPA 1KCVL 1K6QH 2XN9B 5CGYD 5D7IA 3GGWA 3MRLB 3VWKD 1IRAY 4N1CA 5GQBA 2XZQH 2CIKA 1U8HA 4P3CL 3TPUB 1JMZA 4LLWB 5EOQL 1J10A 4LGSB 4OI7A 4LCWD 2DLGA 4Q6IB 5E4IA 3TNNA 3BPLC 3SY0B 4XVTL 1M05A 3LKQA 4NQUA 1TZIA 2QADC 4J3VA 2Z8SA 4LASH 2HP4A 4DGVH 4J8RB 4NFBA 4U49A 4OSUH 5F89B 2J8UB 4JGMA 3P11L 1HWGB 1J1XL 2PW2A 1OP3H 3ZT5A 4JY5L 4TTDD 1FNSH 1G7LB 4EI5B 4NO0A 4PJEF 3EFFA 3DV4A 4PJHA 3DECA 1QOKA 1FP5A 4F37F 1BD2B 3QQ9C 2W92A 1FH5L 2DKSA 3QJHA 3PNWB 1OP9A 1ZT4B 4LF3A 4PJDA 3TBYA 4K7FB 4I9WE 1U6AH 5DURB 1WEJL 5HI3D 5E8PA 3HZKA 4U1SA 4ZUTB 3TBVA 1KOAA 1AIFA 4PJIB 3P0VH 1T1XB 1Q94B 3TVMB 1A1MB 1BQSA 2YN5A 2FZ3B 3OAZK 3PWJB 3QIBC 5L9DH 4WI4A 4XVJH 5MHSD 3LV3A 2VWEC 5HYFA 3BW9A 4OF0A 3MRMB 3IXAB 1OAZH 1OF2B 1RZJL 1UXSB 4M4RA 1S7TA 2X4OB 4NHUB 3L6FB 3FMGH 2DI7A 3I2CL 3EOAB 3EFDL 2C1PA 4UQ3B 3ARXA 1KTDA 4XPFL 3RX7A 4LCUB 2QR0B 3N9GH 1E4KC 3F62A 3DYMA 1SEQH 3IXTA 1G7JB 4MCZA 4OLVH 2DBLL 3WFEH 3K74B 1D5ZB 3DTXB 5CEZL 3V4UL 4LPCA 5JW3H 1JGEA 4TQEH 4JR9H 3GMOA 2FX8H 4NM4L 5CD3B 3MOAL 5GS0L 1NDMA 3VXNB 1Z3GL 1TJHL 2FEEL 3FFCD 2Q20A 4D8PB 3H3PH 5KJRL 5EOCL 2NCMA 2ICWB 2HFFB 4P3DB 1M7IA 3CFBA 2NX5D 4IOSD 1NMBH 4S2SB 2ID5A 3I02B 4GAJL 4P23B 1MCIA 3OAYH 4LLVA 2GT9A 3V0VA 4RGOL 4UI2A 1JGUL 3MRBA 1NSNH 4P2RD 3IVKB 4X80L 4LHUB 3VA6A 4Z7VE 2W9DL 3RTQA 3BDYH 4WHTA 2KZWA 3FT3B 3S7GA 5DEGB 4KVCL 4ZFZA 3K0WA 5FKAA 3KPSE 1SJEA 4LSPH 2XN9A 1S7RB 3MRLA 1AC0A 3TF7C 3WNKA 1KTLB 3C60B 3TPUA 2HLFD 4J23A 3FQXB 4LLWA 1QSFE 5IJKA 3G5VB 4Q6IA 4JG1H 4K7PX 4Z9KB 3SY0A 4XAWL 4JZNB 3ARTA 1JGLL 3PGCB 1D5IL 4PJEB 4J8RA 5F89A 4YBQD 2J8UA 2HTLD 2HRPH 5EZJB 5KN5B 2GHWB 3F6IA 4U6TA 5F1SA 4RIRB 5EU6E 4YE4L 2BNUB 3HKFA 4YHKH 3PABB 1S9WB 1GCFA 3SOBH 5FUZL 1G7LA 1RUAL 4EI5A 2AI0L 4EXPX 3M17B 3HMWL 3LQMA 3ZZ1A 5FYKE 3KHQA 3QEHB 1BD2A 3MV9B 1NAML 3D85B 5CINH 3PNWA 1KCKA 1ZT4A 3EAKA 4PRIB 4YZFF 4K7FA 3BP5B 4KRLB 4QGYA 3AMLA 4QRUB 2GJZB 1YYMH 4LPTA 4LARL 4ZUTA 3TO4D 3HFML 4PJIA 1T1XA 4NN6C 1Q94A 3TVMA 1A1MA 4O4YL 1IJ9A 5IW3A 5T3XE 2FZ3A 3PWJA 1C7SA 2RIKA 5F7MC 4QRRB 4PIRF 3WIHA 4FG6D 3M45A 3R1GL 2FBJL 2B1HH 5I19H 1X6LA 3MRMA 3IXAA 1OF2A 2WZPD 1UXSA 4P4KC 2X4OA 3P0YL 2HT4C 2L7UA 3L6FA 4NHUA 3EOAA 4NQTA 5EZLB 5GGVH 4UQ3A 4EN3D 1DQJB 3EOBB 4N68A 4D9LL 1RJZB 4LCUA 2QR0A 1EFXB 4LLUB 5DLML 5TE7L 4UIKL 2GQHA 3V6OC 1UYWL 3L1OL 1G7JA 4X9GA 2D0GA 3GSWB 5HI5C 1NBQA 1D5ZA 3DTXA 3DXAB 5ALCL 1NC2D 1XCQB 5CD3A 4J1UB 1NGYB 1IGJB 2ZUQC 3OJMB 3VXNA 4XI5D 4JM2C 4D8PA 2YA2A 1J1PL 4R2GC 4L4VB 3MOQA 4C83B 2ICWA 3G5YB 2HFFA 4P3DA 5D93C 5J9PB 3ZKXB 1TVDA 4S2SA 1A3LH 3I02A 4XX1G 3HZVB 4P23A 5I8EB 1OHQA 3RJDA 5ILTH 4UAOC 4I18C 3RVTD 5EORH 2Y07L 1HHJB 4G7YH 3IVKA 3H42L 5EA0H 4LHUA 4BZ1L 1RIHL 3FT3A 2Y5EA 5DEGA 4N0CD 4OGXH 4EI6B 4KTYA 4L4TE 3BPOB 5DJCB 4XVUD 5GGQL 1NQBA 1S7XB 1S7RA 4XRCB 1F42A 4F57H 1BJMA 2V9RA 2H41A 4JFFE 1KTLA 3C60A 5KW9H 1KEGL 3FQXA 3X13B 1F97A 3G5VA 3O9WB 4JZNA 4PUBH 5TPWL 3PGCA 4PJAF 2BVQB 1OW0C 4W6XB 4PJEA 1IGCL 1JWMB 3GSVB 2UWEE 3S36L 4KKBC 5EZJA 2R1WB 5KN5A 2HG5B 4RIRA 2BNUA 5FYKU 3H7LA 4L5FL 1KCSL 3SO3B 3PABA 1S9WA 1SY6H 3DGCR 2R2BB 1OAKH 4HC1A 3O4LB 1YEHL 4X7SL 3DPBA 4AL8L 4I0CC 4P2YA 3ARBB 3M17A 1J1OL 3HN3A 1LO3L 1U2HA 3QEHA 3MV9A 4CMMB 3D85A 4PRIA 4L4JA 4NC2B 3BP5A 2DIJA 3QDGE 4FZEL 5C09E 5SX5H 5HBBA 3MODL 2K3TA 3O2DA 3QQ4B 1HK6A 3NZHH 4QRUA 2GJZA 5FM5O 1N5AB 1NBVL 1P5VA 2VRAA 3IS0X 3TZVD 3V5HB 4QEGA 1QFWL 4MA3B 3QCTL 3EYUL 3BMWA 4QRRA 2BHUA 1H3VA 4WUUE 2B4CC 3GEWB 1GOFA 1I1YB 2V17H 1F8TH 1S3KL 1DBBL 1BBDL 4G42B 1IKNA 1R3IL 2XTJB 4XB7A 4G6ML 1C5DB 5EZLA 1DQJA 3EOBA 1RJZA 4TSAH 4LLUA 1EFXA 4QXWA 32C2B 2WBJB 2GK0B 1YEKH 1X5HA 1GXEA 4ZS7H 3C6SB 4KROB 4KKAC 3C6LB 3GSWA 4HBQA 4OQTL 3MBEB 3BGFC 1BX2B 4LSVH 3DXAA 1XCQA 2EE9A 1FV1B 4J1UA 1NGYA 1IGJA 3IFLL 2VLLB 4L4VA 1EPFA 2F58H 4C83A 5LVEA 3G5YA 5J9PA 3T0EC 1AGBB 3F58H 4F80A 1BQLH 3HZVA 4XMKL 5I8EA 4FFZH 5F9WC 1MFEH 4TSBH 5DF0A 1TJGL 4RQQB 2NY6C 2D7NA 1HHJA 1J05B 4LK4A 3EJYD 7FABL 5J1SC 3HNTH 1IAIL 5D72L 3NFPB 4EI6A 5DJCA 4TYUA 3KPPB 1CFVL 5J1AB 5F9OH 2P8MB 3LB6C 3VFWB 1S7XA 5C08D 3HUJE 2EH7H 4XRCA 1PG7H 3WL9B 4OUUB 4KVNH 4PJAB 5EBMB 5AYQA 3PJSB 4CW1B 5F7DB 3X13A 3LH2H 5C0AB 1YNLH 3D5OF 1KJVB 1I85C 3L5XL 3O9WA 5FKPB 2FHFA 2BVQA 3OQ3B 2DJSA 1JWMA 2YMXH 2XOTA 3GSVA 4OIIH 4PYHA 3UTSD 4HJ0D 4QXTB 2P5ED 3CK0H 2R1WA 2VTFA 3WUWB 2HG5A 3W9DB 1NGWB 1NUGA 1EUTA 4FP8L 3AUVA 4EUPG 3NH7H 2R2BA 1A6ZB 1EJ6A 4GO6B 3CX5J 1YYLL 3O4LA 3QHTC 3ARBA 1MHCB 2DQEL 1FZMB 1H3XA 4FQXC 4OLUH 4CMMA 1KJ3L 4PRPD 5DT1H 3RUGF 5F6IB 1T0MB 1KBGL 2V5TA 3QQ4A 3WIHL 2F5BL 3VDCA 1N5AA 3MV7B 3V5HA 3EJZC 4MA3A 1DBAL 3GMMB 1P9MA 3D25B 2OK0L 3RP1A 1A7NL 3JUZA 2JIXB 5BO1H 1I1YA 3DETC 2Z8WC 4Y0GA 2VQUA 1MCJA 5CCKH 4G42A 4QWWC 4XBEH 4OCWL 4FHBD 4JKKA 3ULVE 1C5DA 1XIWB 32C2A 2WBJA 2J4WH 1CGUA 4WFEE 4WO4C 2GK0A 1QR4A 1L4IA 5HGGS 3K2UH 1A1OB 3WXWH 4FQIL 5L2KD 3C6SA 3GJFK 3D1MC 3C6LA 6FABH 3CXDH 4PTUB 1Z2KA 3EDDA 3MBEA 1BX2A 3VRLF 1A6UL 3MA9L 1FV1A 1NCWL 3HR6A 2VLLA 4YAQB 3WFZA 5GISH 4K3EH 3ZYIA 3GHEH 1FORH 1A3RH 2AAVA 4PJ9C 4NYLB 1WTLA 3TV3L 1AGBA 3NZ8B 2D03H 2XYCA 3CFIC 1Q1JL 3RZCC 4TVPE 1TITA 1JNNL 1PKQB 3D2UB 4YXKH 4KDWA 1KN2H 4LRNL 1FZKB 1T03H 4RQQA 3TCLB 5D7JC 1J05A 5HYIA 5CEZD 4BH8B 4FABL 1AD9B 5GS0D 3MCLL 3NFPA 1DFBL 2A2QT 3O11B 4M7LL 2AJ3B 4I0PC 2DI8A 3KPPA 3FB6B 5J1AA 2P8MA 3VFWA 1TZGH 1IGYB 2DQFB 2XG4A 3HI6L 5IMOB 3WL9A 4OCSH 4OUUA 1TNNA 4PJAA 4TRPL 5EBMA 3UTPD 4XNZC 4JB9H 1JPST 3AS2A 4PY7B 1BZ7B 1YEFH 1OAYH 3PJSA 5I30L 2RR3A 2PO6D 4CW1A 1UADC 4PJGE 5F7DA 2AK4E 3IF1B 5C0AA 3SPVB 1KJVA 2A0LC 3EYOB 4QHKJ 5FKPA 4UUJB 4F9LC 3B2VL 2JCCF 3BKYL 4HC1L 2HYMA 1WC7B 4QXTA 4WNQB 3WUWA 1ODAA 4OZFB 3W9DA 5DD1L 1NGWA 1DP0A 4OKDA 1A6ZA 2LU3A 3U7AA 3SGKC 3U30C 3RNKB 4KJWD 3O2DL 4G8EB 5KOMC 1MHCA 5AWNL 1FZMA 4GS7B 5D2LE 3PIQB 3ZE0E 4LEXL 4GW5B 2FATL 1U8KB 1T0MA 3LD8C 1KGCE 2BNQD 3QG7H 3MV7A 2JLLA 5E6ID 2N1KA 1EXUB 5DC0A 3GMMA 3QUMB 1I3RB 2D7QA 4FQHB 3D25A 3TIEB 1CDGA 1X4XA 3CAFA 2PETA 1GIGL 2JIXA 5FCUH 3GRWH 5T3ZE 2HJFB 4C56B 3TLRA 1JBJA 4C4KO 2NYYC 4MJ5B 4P59L 4QOKD 3RKPA 4IMKC 4JHBA 3FRUB 4QNPE 2Z0BA 1QSED 1XIWA 1MNUL 2V5MA 3UCRA 3MLUH 2Q6WB 1H3GA 5HDOA 1L7TL 2CQVA 1A1OA 3U6RB 3QRGH 4L9DA 1CIUA 3SJVD 1ZVYA 3WSQH 4M48H 4GRWF 4PTUA 3QAZB 3QPQD 2PW1B 1DL7H 4UV4H 3O6ML 5BOZG 3NMEA 4YAQA 5DD5L 5KSAD 3VWJD 2R9HC 4L8CB 4NYLA 5C0CE 2AJXL 5CBEB 4WI3A 4DN3L 3NZ8A 5F44A 4YBLB 3OF6D 3MREB 4QRPB 1PKQA 3D2UA 1T6VN 1YECL 1B0WA 1N7MH 4IDLA 1FZKA 2X1QA 4Y4FB 3I85A 1BQHB 3TCLA 2BSSB 1GC1L 3UX9B 3L9RB 5C07E 5H94B 4BH8A 4XT1C 5FO8B 3LQZB 1AD9A 2JB6B 3MGOB 1L7IH 1N4XL 4L29B 3O11A 1CIDA 1A7QH 1G6RH 2AJ3A 2XY1A 3FB6A 1AXIB 1IGYA 2DQFA 5IMOA 5AG8A 3DV6B 3DURB 5FAAA 3WLWD 1JYNA 1UJ3B 1HKLL 4PY7A 1I8KB 1BZ7A 4X4MA 4YDIH 4H88L 5E6ZA 1CLOH 1VCAA 2B0SL 1DUZB 3IF1A 3U2SB 1RUKL 2WK2A 1I1CA 3SPVA 1HN1A 4Y5XB 3S8WA 3EYOA 2DQGL 4UUJA 3KPTA 2DQTL 1NLDL 3GK8L 3FZUD 1WC7A 4WNQA 4OZFA 3NCMA 2EYRB 1UKSA 2FYYB 3VFUB 4FFWD 3MX0A 3CC5B 1AGFB 2AV7B 1ZTXH 5DVKA 3RNKA 1R5IB 4G8EA 1LO2H 5DHVB 4CVWA 4OV5B 2FBOJ 2YHGA 1CFTB 1FDLL 3PIQA 4P2OB 5SWZB 5GZNC 4LGRB 3HRZB 4LIQE 3GUTB 4GW5A 1U8KA 2V5RA 4LDLB 2DM4A 4N0UB 4F7MB 4F9PC 1RJLB 1VENA 2C3GA 1S7UB 4WWKB 3ROOB 1H3WM 1EXUA 4JO2L 4WUKH 3ORJA 1SJHB 3QUXC 3GSXB 5JW4R 3QUMA 1I3RA 1QO3B 4FQHA 3TIEA 5GSVB 2V7NB 4Z7UE 1UZ6F 5KZCD 2EIEA 1IVLA 2A6KB 3C2AL 2HJFA 1VERA 4C56A 5KAQG 1MJJB 4JRWA 3G6JF 4MJ5A 2CMRL 4YWGL 4XVSL 3FRUA 4U3CA 3RGVB 3VXRB 3KJ4B 5L88H 2Q6WA 3KPLB 4ZG1A 5BV7H 3U6RA 2C1OB 5DMGC 2X42A 4Z7QF 3CLEH 1NCBH 1MHHB 5F96L 5H37H 2PW1A 4XTRD 1U8OB 1XF3B 3UC0H 1OAXL 1OSZB 2NY0C 1I1AB 1MI5B 4QCIB 4R4ND 2MCPH 4L8CA 5CP3A 3F5WB 4GRLC 4JFHE 5CBEA 4POZC 2R2HB 4L3EB 5E6YA 3K7UA 1I4FB 3MREA 4PLJC 4QRPA 5BQ7B 1JK8B 3WFBL 3U0TB 4AEFA 4Y4FA 1BQHA 3TEUA 2BSSA 4K7PL 3L9RA 5H94A 1MRDL 4OZHB 1NCAL 4PJFE 2VDOL 3L3IB 3LQZA 5FO8A 2JB6A 3AY4A 3EOTL 3MGOA 4GXVH 4URTB 3ZTNL 4L29A 2D31B 5FYJL 3V9FA 1RHHB 1NL0L 1FYHB 1QUNA 3QIWC 3UEZA 2FCBA 3IDIB 3H3KA 4I8DA 3RTQD 1CE1L 1KCRL 3DV6A 3DURA 1UJ3A 3QUZB 1I8KA 5K93A 3T0XA 3VMOA 4JKWA 5E2UL 5ALBL 3T2OA 4YHOL 5C3TA 1NUNB 3TC9A 1DUZA 2XN9D 4DGIH 3U2SA 1HCFX 2VO5A 3QNYB 3RAJL 4Y5XA 4EDXB 1JV5B 1YDPB 3WKNA 2B8OT 2BERA 3CMGA 2BVEA 5I0ZA 3T08A 5E7BA 1MWAB 4MNGB 2VABB 2AGJL 1JL8A 4WHDA 3O4OC 5T1LB 1NLBL 2Z4QB 5LGHH 4WFHD 5F1NB 2EYRA 2FYYA 4QTHB 3VFUA 4DTGL 3VXTB 1FNFA 2A1WH 3AC0A 3CC5A 1AGFA 2AV7A 4YPGB 1P1ZB 4KK5C 1A7PH 1R5IA 4PGDB 4NP4H 5DHVA 3BE1L 4OV5A 2CJUH 2WANA 4Z78B 1CFTA 5GGTH 4P2OA 5SWZA 3HI5H 1YMME 3HRZA 3Q3GB 3GUTA 2A9ML 1FNGB 2FR4B 5BRZE 1VPOH 4EI5D 4N0UA 4F7MA 5A16B 2NY1C 1RJLA 4J3UA 1S7UA 3G6JB 4WWKA 3ROOA 5GRUH 3VFSB 2AJVL 1BD2D 1SJHA 3GSXA 1OM3L 3NABH 4PRHB 3TM6A 1QO3A 5GSVA 2V7NA 3CVHH 2AXJA 5DURD 4K23H 3V4VH 2DL9A 2A6KA 1U8IB 1WVZA 1BWWA 1MJJA 1JNLL 3KPRB 2RBLA 1NFIB 1E4WH 2YZ8A 3O3UN 4RMRA 3RGVA 1CICB 3AXLB 5B39B 3VXRA 3DO3A 1PFCA 1MJ8H 2H9GB 3ZKND 2JELH 4TPRH 3KPLA 5INCB 4RISL 3VXME 1NMCB 1NBZB 5ERWB 1MAML 4KRMB 3NIFF 3NA9L 2C1OA 3U0WL 4BELD 1CFSB 5BZWB 2YK1H 3SKUD 1URLA 1MHHA 5CJQH 2FEDD 3VXSB 3CDGB 1U8NB 5E5RB 2VDRL 2DDQL 3BESR 1U8OA 1XF3A 4UT7L 4NRZB 1Q8MA 2UUDK 5IFHL 5FYLL 1OSZA 4LRIA 1I1AA 1MI5A 4QCIA 3SGEH 4Z7OE 4K8RH 5LGJB 3F5WA 2ZKHH 1TJIH 2R2HA 1OARH 3MXWH 2XQBL 4L3EA 3ZE2E 1I4FA 3PWLB 3B3IB 5BQ7A 4ZXBB 1JK8A 2WBKA 4PS4H 1FFRA 2IQAB 2O5ZL 3U0TA 5DWUL 4FTVD 2VXQH 12E8L 3KR3H 3QUYB 2RCSH 2VDKL 4NZTL 4OZHA 2R8SL 3L3IA 2H8PB 1NEZB 4IRJD 4P23D 2UZIL 3PL6C 5A3IC 1YEIL 4OZGE 2D31A 5GPRA 3GHBH 1B2WH 1RHHA 2HJLB 5DUPH 3IDIA 4Z7VF 3REVB 4R0LB 4HXAH 4ALAL 4Q9QH 3QUZA 2DLFH 4HEME 3RI5F 4PBVC 2ED9A 4B50A 3WIIL 1DQDH 3EDJA 3QNYA 3ULSB 1AP2B 4EDXA 1JV5A 3WBDA 1YDPA 4EDWL 3A6OA 3C60D 5I18H 3RQ3A 1MWAA 3UZVB 2FHBA 1KENL 5D96C 4MNGA 1UACL 2VABA 1OSPL 3KYAA 1AFVL 5T1LA 2Z4QA 5F1NA 4JFDE 2NTSP 4QTHA 4Y2DC 3VXTA 4YPGA 3EO9H 1P1ZA 4PGDA 4KTDL 4Z95L 4M1DL 4YFLI 4NJAL 1ZVHA 4EBQL 1FGVL 4Z78A 3O2VH 4BFBD 1MJUH 3Q3GA 3QUML 4GMTH 1JYWA 1VESA 1FNGA 2JTDA 2FR4A 5A16A 5L2JB 2KPNA 1RFDH 3G6JA 4NO5B 4OLYH 3VFSA 4HWZB 3QQ3B 3MV9D 4PRHA 4M6AA 4PY8I 4PRID 3MUJA 2P48B 1FO0B 2B2XL 2N56A 1C5BH 1U8IA 3NCJH 3CLFL 1KC5H 3KPRA 1NFIA 4NZRH 4XZUB 4ODSH 5GRZA 5HHOE 4QRRD 1U91B 1CICA 1FE8L 3AXLA 4G9FE 5B39A 1EDQA 2H9GA 4UDTB 1INQB 1HHHB 5INCA 3INUH 4U1GC 1NBZA 1X5FA 2ZOLB 5ERWA 2CH8A 3E8UH 2APXA 3ZHLA 1HSBB 1CFSA 5BZWA 4JG0H 1CXLA 3VXSA 2CLVB 3L3DB 3CDGA 1U8NA 3W5NA 3A6BL 3IAQA 4NRZA 5HI4D 1KJMB 3UBXG 1JTTA 2PTTB 4XNYH 4YHNB 1WF5A 1YEJL 4RA3A 4LNRB 2EKSB 2A77L 5LGJA 5GIRB 2EC8A 3MTRA 4NCDA 3B9AA 1BOYA 4QLRA 1JWSB 4R4BB 5GJTH 1PSKL 3PWLA 4UQ2B 4HIHB 3B3IA 4ZXBA 1NMAL 2IQAA 3MLWH 3JUYA 2Y1VA 4Z7VB 4L4VD 4JRXE 3S88H 3QUYA 3S35H 5ADPL 1JWUB 1W72H 2X9WA 1WIUA 3KPSB 2H8PA 4XNQB 1NEZA 1GGYA 1QQDB 1KFAH 2EEBA 5E1HB 3MXVL 5FA4B 4KV5E 4U1HB 2Z31B 1HINH 2FLRT 3QDJE 2HJLA 3BOVA 1YEEL 5FUCE 3LQAL 4G7VH 3REVA 4R0LA 3K3QA 5B4MC 4POUB 2VJXA 5D1QB 4R7NB 3TBTB 1UM4H 1QSFB 3MO1B 4HS6B 4YDLC 4DAGH 1IC5L 2XG5A 1A0QL 4P4RB 3TBWB 3ULSA 1AP2A 3R8BB 2YD7A 4C59B 5T5FH 1H8SA 2VDLH 2FDBP 4PREB 5AG9A 5IKCB 5EU6B 4F7TB 4LAQH 2IG2L 2E9JA 3VFRB 5JHLH 1U2CA 1EAPB 5C6PB 2R29L 3O9WD 3QEUB 2BVYA 3HE6C 4X4YB 3AM8C 3QIUB 3F7RA 2UWEF 5I1JL 4KDTA 3HRPA 2YS4A 2OI9B 5D7SL 4ZYKB 3G08B 5JR1L 1DSFL 2DLTA 1DLHB 4Y4HB 1YMHB 1S5IL 1KCLA 1UKTA 5L2JA 3ARBD 2R0LL 4NO5A 3SDYH 5IROA 3QBTB 1OP3K 4HWZA 3Q5OA 3QQ3A 4HKBB 4LPXA 5MP6L 4KRPB 1SMOA 1FO0A 2AEPH 3TJHC 1O7VA 4NNXB 1ULVA 5DRNB 2XQYK 4BFGA 5I73C 1MUJB 1IQWH 3T4AB 4XZUA 2XWJB 3TH3T 2P43B 4KMQA 3NCEB 1U91A 3UP1A 5IWLA 4JQIH 3WJJC 1N64L 5KVMC 4UDTA 1BJ8A 1INQA 3U7WL 1HHHA 2ZOLA 2QQKL 4YX2H 1X6NA 2HA1A 3FO1B 4RBPH 3FB7B 1MFBL 4MAYB 4WU7B 2XTJD 3GIVB 3GKWH 1HSBA 1RV6X 1P4BH 4OF3A 2CLVA 3L3DA 5E7FA 4XPBH 2J8HA 4KPHH 3X3FH 1V7ML 1KJMA 4OCXH 2PTTA 1L0YA 3P9WB 4YHNA 3SE9H 1BQUA 5DD3L 4KROD 4LNRA 2EKSA 3C6LD 4CJ1A 5DGRA 3U7YH 5GIRA 2OR9L 3MBED 1JWSA 4R4BA 3LRSB 5FIEA 2GSGB 4UQ2A 3N1QC 4HIHA 5KVFL 3MLZH 4KC3B 1LVEA 3SE8H 1GH7A 1KXTB 2NR6C 4Z7VA 1RZ8B 5C6WH 2PUQT 2YZ1A 1JWUA 3QXWA 4DGYH 4H20L 4L4TB 3MYZA 3KPSA 4XNQA 2Y06L 1QQDA 5FA4A 1ED3B 4U1HA 2VXUL 1A5FL 2Z31A 3B6SB 2F53E 3THMH 4ELME 5I1EL 4HK3J 2BCKB 3QNZB 4X6FB 1A02N 4JFFB 5IUSA 5D1QA 4R7NA 1A6VL 3EUUA 2WWKO 4MA1C 3TBTA 1QSFA 3TGXA 4I3SL 1NGPH 1OCWH 3MO1A 1FLTX 4HS6A 3OBAA 1MWAL 3MLTB 2WNGA 4U05A 2GTWB 1MHEB 4KKLC 3EBAA 3HUJF 2HVJB 3HR5B 5A2FA 2Y9RT 1ND0B 4P4RA 3TBWA 4WI2A 1ADQA 5A2IH 4C57C 2UWEB 4M43L 3MNVB 5FYJD 4PREA 4XPGL 1N6VA 4GMSL 5IKCA 5EU6A 5IMKB 4ZMAT 4F7TA 3VFRA 4ZQKB 4N8CL 5C0AD 3IDXH 3OWEA 1Z9SA 1EAPA 3QEUA 1DVFB 4DKAA 4X4YA 2YRZA 1DBJH 3QIUA 2IMMA 3DX6B 2L4OA 2H1PH 1KB5H 4ZYKA 4QTIH 4F2MB 3G08A 3LDBC 5C09B 3QDGB 2VDQH 1DLHA 1BFVH 5ELIA 4Y4HA 1MFAL 1YMHA 4ZUVB 2W0FB 5E2TH 5HVHC 3VFGH 3QZWB 3VXPB 2A6JB 4BQ6A 4XPAH 4IRZH 1C1EL 4PLKD 3RWGB 4OLWL 4WUUB 4O58L 2NY5H 4D3CL 4HKBA 2IANE 4MLIA 5GS1C 3BPLB 5CEXB 4F3FB 4FZ8L 3QFJD 4JN1H 3CX5K 4JPWL 4AY0A 4AK1A 3MV7D 4JQXA 4NNXA 5DJAB 2ZG3A 5DRNA 1MUJA 4QXUL 2E6QA 1E4XI 3T4AA 2XWJA 3MRHB 2JIXD 4WEBH 2OP4L 3FO1A 3FB7A 4MAYA 4WU7A 1I3UA 3GIVA 3MCG1 2WUBL 1XIWD 4Z7WE 1W0WB 5KTEH 3L5IA 1AI1L 1D7FA 1NGXB 2J6EH 1CLZL 2YEZB 3SGDH 4LLMB 4JKPH 1CD8A 2C4FU 2AEQL 1LDPL 5DGQA 4YHLL 5IEKB 1NCCH 1I9JL 3WE6B 3MV11 2PTVA 2YOCA 5DQ9B 5HHVH 2Z9TA 1KNOB 2NZIA 1CFQB 3LRSA 2GSGA 4P3CH 5DO2D 3V8CA 2JJVA 5J6GB 5EOQH 1RHFA 4PJBF 2XA8L 3HAEB 3RVXC 1E4JA 3UTTD 1F4AA 5MEQB 2W07A 1EO7A 1RZ8A 2DN7A 1QVOB 2HFGL 1KPUB 4XVTH 3LEYH 3W2DL 3MRIB 4U3HA 5FV2A 1E6OH 1QYGH 4L4TA 1CGWA 1UWXH 3CSPA 5D9SB 1DCLA 1MCDA 1YNKL 2E8YA 4KFZC 3FRPG 3P11H 3FJTA 1ED3A 3AVEA 2ZJSH 3B6SA 3TCXA 3HUJB 1QPXA 4F7CB 5E95B 5CJXC 4JY5H 2MQ0A 2MFNA 2BCKA 3F8UB 3QNZA 4X6FA 1GJIA 3MRNB 4JFFA 1FN4B 3F7YB 4K55A 3O6KL 5E08L 1WZMA 4Z5RB 3MLTA 3OXSB 2GTWA 1MHEA 5CD5D 1R3LB 3LHPH 2HVJA 1RURL 3HR5A 1ND0A 3NACH 4B7LA 2E27L 3S34H 3H6JA 2UWEA 3BUTA 3MNVA 5T1KB 1FAKT 4PJGF 1V05A 5IMKA 1AQDB 4LOUC 4ZQKA 4HKXB 5F7WC 2Q87A 1H8OA 2R39A 3O6FC 3JWDC 2PR4H 1DVFA 4LVNC 4IM8A 4MS8C 4WCYL 3AREC 2BK8A 5HD8C 1RZJH 3DX6A 4C54A 1MFNA 4OF8A 5E4EB 4N0YL 4GXUN 5D2NC 4F2MA 4HZLB 5D7KD 3I2CH 1A7OH 5D7LE 4XNXH 5C09A 4XPFH 5I6XB 5DZNA 4ZUVA 2W0FA 1FO0L 3Q5YA 3QZWA 4J3OC 4Y19E 5DS8B 2A6JA 4TOYL 3PWPE 3D3VD 3VXPA 4MSWB 1MQ8A 5CSBA 1T7VA 3RWGA 5D2LF 1NANI 1EVTC 2DBLH 4WUUA 1ORSB 4L9LC 3X3GL 5IESL 5E8OB 3V4UH 5CEXA 2VB5A 4F3FA 4NM4H 2ZG2A 5A40E 5GS0H 2X6MA 4KKAD 1LK3L 1K4CB 5DJAA 2LQRA 1RULL 4ODUB 1H3PH 1KIUA 3BKMH 3KJ6L 5BV7C 3KYMB 4WTZG 4W68A 3MRHA 3BH8B 5SX5K 4G5ZH 4GAJH 2ORBH 4C56D 2KZ1B 1CDJA 5EIQA 3T0ED 2HWZL 3D39E 3VG0L 4QNPF 4D0DB 4X80H 5F9JB 4KI5C 4OI9A 1W0WA 2W9DH 4FQLL 1NGXA 2DD8L 3L3OB 2YEZA 1SBSL 4OKVB 4LLMA 3ULUC 3MRKB 4LDEB 5IEKA 1A3QA 1A47A 3WE6A 1AR2A 3EGSB 3RWHB 5DQ9A 3M1BB 5FV1L 5J57B 1F2XK 1KNOA 1F45A 2LTQC 3OKNB 4WW2F 1CFQA 1R5WB 1N5YL 4YHZH 3N1PC 43CAB 2EKJA 3DJ9A 5J6GA 4KMTL 5C0JB 1E27B 3HAEA 2X4QB 5MEQA 1QVOA 4HG4K 1KPUA 2NY4B 3G6AB 3MRIA 3RGHA 3GMRB 2W60B 5D9SA 4QRPD 3OR7B 2L7JA 4LP5A 5C3LD 3SKJH 3CDFA 4DFHA 2WSKA 3HUJA 4F7CA 2P45B 4Y4FD 4YE4H 3QI9C 4WV1C 2YC1B 1NCNA 3IJHB 4KHXL 3MRNA 1FN4A 1RUAH 2ED7A 1ADQL 1M4KA 3F7YA 4N9OB 4PJGB 3NCYP 2AK4B 3ARGC 4Z5RA 3OXSA 3FAXA 2ATPB 1R3LA 1G9EA 1EERB 4R2GB 3WN5C 4F33B 4LHQB 5T1KA 4LARH 2AK1H 3BWUC 1AQDA 3HFMH 1C12B 3QO1B 5FYKL 2GTZB 4HKXA 1HILB 3BIKB 3ARQA 5GRWA 1JZ5A 3R1GH 4KJQC 3MQIA 1GHFH 4ONGH 5F97E 1I8LC 2A83B 2BDNL 5HVWA 1VFBB 1EO8H 5D2LB 5T3XL 3OJVC 4HZLA 5DK2B 3VFNB 5C6TL 2DLIA 1I3GL 3CFCL 4KGJA 4FQPA 4YO0B 5DLMH 5AUMB 5TE7H 4UIKH 1T2XA 4JN2B 3UDWC 1I3VA 5JLZB 5DS8A 3CVIL 4WVRA 4MSWA 3L1OH 5MI0C 4BJLA 1F4WL 4P2OD 5SWZD 4DFIA 1ORSA 1IC4L 1HQ4B 1EEZB 3PWNB 5E8OA 1W2KT 2YPLE 4RAVB 2CDEB 4WWKD 5CGYC 1TLKA 1A22B 1K4CA 2DKMA 3SDXE 3VWKC 5ICXB 4ODUA 2IPKB 4P46B 3WNPA 1KV3A 4M5ZL 5E56A 5BXFB 3KYMA 3OV6A 3OZ9L 4Z7UF 1G6VK 3OAZH 3BH8A 1W0YT 2KQMA 2UV3A 1UEMA 3VD5A 4NQVB 4CVZB 3ULUF 1H15B 1T83C 3SGJC 4MB4A 5TF1L 4X6CE 4D0DA 3RGVD 5F9JA 1QFPA 3AS1A 4PV8B 4WW2B 1F2QA 4OCRH 1NFDF 2NXZB 3L3OA 4OKVA 3EOYG 4IIQC 3MRKA 3OB0H 4TTDC 5GGQH 3U82B 5IHZB 3EGSA 1MSPA 5C0CB 3RWHA 1CGTA 3M1BA 4XMPH 4PYGA 4S0TD 3OKNA 3REWB 1R5WA 3CSBA 3V7AG 2YKLH 3UAJD 3W81A 43CAA 1KEGH 1T20B 2EDWA 1WZ1L 1I1AD 5C0JA 1MI5D 1E27A 5AZ2L 5C07B 4GW1B 2X4QA 2D7MA 1P7HL 5HI3C 1ES0B 1U8JB 3G6AA 4KJPD 2ITCB 1IGCH 3WS6A 3GMRA 2W60A 1F4YH 3OR7A 4LGPB 3S36H 1QG3A 4S10A 2VXTL 5GRXG 2YC1A 1AXTL 1GVIA 1Y18B 4PJFF 3QXUA 4ZS6D 3IJHA 4N0RA 5GHWL 3E0GA 1JGDB 1HNGA 2CKBH 3QJFB 4PJGA 4AL8H 5DTFB 2AK4A 4RMTA 1XEDA 3WO4B 2ZCKL 1J1OH 35C8H 4RMWA 1LO3H 1Q0YL 2ATPA 2LVEA 4V1DE 2AXHA 4BSWB 4XP9L 2IPTH 4D9QE 3BN3B 4F33A 4M6NL 3EYSH 3MODH 3QUZD 2ICCA 3ZDXE 1NBVH 1MEXH 4DKFL 1C12A 3QO1A 1BFSA 2JJSA 3QCVH 1QFWH 2FRGP 2GTZA 3W39B 3QCTH 5DJYB 1HILA 4NFDA 3BIKA 2NY6B 3ZL4L 1F58H 3AFLA 4HLJA 5EC2B 4MXQC 1S3KH 4I77L 1DBBH 2AJSH 2A83A 1R3IH 4PP2B 1VFBA 5D2LA 4G6MH 5DK2A 5T1LD 5BOPA 3VFNA 2FECI 5KBNC 3BMVA 5FUOH 1FYTD 4PG9B 4YO0A 3BZFB 1MCOL 5AUMA 5K33A 3K1KC 4JN2A 4PJ8B 2FWOB 5JLZA 3NA4A 1UM6H 5KSVB 3GM8A 2KUTA 4Z7UB 1JUFB 4HS3B 1HQ4A 1EEZA 3PWNA 2XZCL 1H5BB 2V5SA 3PV7A 2NXYB 4RAVA 2FX7L 4UNVA 2CDEA 3IFLH 4O2FB 1BPVA 4X7DC 2BY3A 3E2HC 1GOHA 5EOCJ 2CK0L 3RA7L 2AJYL 5ICXA 5CEYB 5IB2B 2IPKA 4P46A 4PRHD 5IHLB 5BXFA 5LGKA 1CVSC 3HC0B 1C08B 3E1F1 3P9MB 2HLFC 4Q97A 1MF2H 4CVZA 1FL5B 5M7QA 4NQVA 1H15A 4G8GD 4LVOB 3ARRA 3LPFA 4JPVL 2IFGA 2I5YL 4X83A 4NO3B 2E7LC 1CICD 1SYSB 5JA9A 4YBQC 4PV8A 4WW2A 5D5MF 4BUHA 4WRLA 2HTLC 1DUYB 3BRDA 1EHLL 5D2NE 2VZSA 4D9RE 3CX2A 1JF6A 1FFOB 1CFVH 5IHZA 1T4KB 5C0CA 2J5LC 1N2RB 4MQSB 5J4MA 3VXSD 4GLRH 3F12B 3REWA 1I9IL 2R0ZL 3WKML 3CIQA 5L7XH 4JZJB 5E2WH 1T20A 4HT1L 4Z7OF 4KQ4H 3P4OB 5C07A 4GW1A 2EC9T 4PJFB 1MVUB 1T2JA 5BVPL 3L5XH 3I9GH 1ES0A 1U8JA 2VN4A 3ZE2F 2ITCA 3RPIB 3RVUD 4YXHL 4ZXBD 4KU1A 1NAKL 1UM5H 4LAJH 4KJYB 3QNXB 4FG6C 2D7OA 4M5YL 3QUYD 4FP8H 1R0AL 4XXCA 1Y18A 2KQNA 3GNML 4M6ML 3T2QA 1YYLH 1JGDA 3QJFA 4OZGF 3S6CA 5DTFA 3DYOA 4LLDB 4EN3C 1FIGH 5K9JL 3QYCA 2XKNB 4XH2B 5FHAL 5IT2H 1SM3H 1NCDL 4RFNB 1KJ3H 4L8SC 4BSWA 2HKHH 3ZE1E 4HLZG 2FGWL 1CLYH 1FNHA 3ILQD 4R90H 3WIHH 2F5BH 4BK4A 4E42B 4DEPC 1CVRA 1DBAH 1ZSDB 2OXHA 3W39A 4Y5YB 5DJYA 2OK0H 1A7NH 1INEH 4BZ2L 4CGTA 4XI5C 3JTTB 3EDEA 5EC2A 2BRRL 5DVNA 4YC2B 2DOCA 4G43B 4OCWH 4PP2A 1CXIA 1YMMB 4R8WL 1U0QA 5BRZB 3EHBC 4PG9A 1BQHG 3BZFA 4XX1E 1QBML 1DQLL 4NKIL 4PJ8A 2XTLA 2FWOA 2WBWB 5IF0B 3RVTC 4NUGL 3UJIH 2MPAL 4U1KB 2V2TB 3ZDZF 2Q3ZA 3D9AL 5KSVA 3ULVL 4Z7UA 4W4OA 3SBWA 4I9WD 4N0CC 1JUFA 4HS3A 2Y5TB 3KYKL 4J6RL 1KN4H 1CL7L 4BKLB 4EKXA 1H5BA 4B5EA 4YFDB 4DUVA 2WV3A 5M95B 5SV3A 1NCWH 4O2FA 3CJJA 3TN0B 5CEYA 5IB2A 4KQ3H 5D5MB 3HC0A 1C08A 3TV3H 2YD2A 3P9MA 3FL7A 3VXMB 1Q1JH 3UMTA 1N6UA 1FL5A 3CDYA 3T3PF 4MGXA 1AO7E 1LNUB 4NO3A 2QQLH 1SYSA 5JTWA 4FABH 3MCLH 1T1YB 1DUYA 3ZSSA 5KANI 4TVPL 1DFBH 4XHJD 4Q6YA 4D0BB 1YC8A 2EE3A 4X8XA 1QFHA 3Q48A 3JWOC 1FFOA 3S3SA 1T4KA 4NKDB 2E7MA 1T89C 2GW5A 1J87A 1N2RA 2EDOA 3HI6H 4XC1L 4ODHL 3L3GB 4TRPH 3F12A 4G6JL 4YJZL 4JZJA 1EX0A 1QBLL 5J7CC 3P4OA 1T3FB 4PJFA 1X5LA 1MVUA 2YRLA 1TQBB 4MX7B 4OM1H 1IEBB 3TZVC 3RPIA 4OZGB 1JPSH 1KJ2B 4ODTL 2I9LB 1JHTB 4XMLH 5TE4L 4KJYA 4N90E 4U2YA 4FOMA 3QNXA 3HE7B 2ENYA 4XPTL 3V5KB 3KXFD 1V3KA 2OXGA 1MRCL 4NM8L 2IGFH 3KPSD 4NZUL 4M1CD 1JNJA 2Z31D 1MCFA 3NPSB 4LLDA 5D8JL 5AWNH 5HPMB 1CDHA 1AY1L 2XKNA 4XH2A 1C5CL 1TPXB 1INDL 1FQ9C 4LEXH 3GBMH 1EH9A 3FQRB 3U36B 5D1QD 3H2WA 2MWCA 1QSFD 3JV6B 3H9ZA 4Y16B 5T33L 4E42A 4RRPA 4RMUA 1ZHBB 5GGSY 4YDVB 4F15B 1ZSDA 4JFDB 3R0NA 4Y5YA 4NN5B 3WJLA 1GIGH 2OMNA 5BW7C 3JTTA 5IBUG 4NGHL 1ZEAL 2ARJQ 3WNMA 2P4AB 3ES6B 4QKXB 5EU6D 3TP4A 5J8OA 4G8FB 2N7BA 4G43A 5DA4A 1RZKL 3HCVB 5KSBF 4HUVB 1YMMA 4S1DD 2UVFA 1MNUH 4DUWA 5BRZA 4LSSL 3QIUD 5MHSE 2ZUYA 5T3ZL 2NY5C 5IF0A 4EVNB 1L7TH 3S5LG 3EJYC 4U1KA 2V2TA 4LKXB 3SDAC 1LP9E 1BF8A 1DANT 5J13B 3QXDB 4U33A 2DQDH 5CBAB 2Y5TA 4BKLA 4Y4HD 3OL2A 1B4RA 5EWIH 1ZMYA 1P4IL 3O6MH 1PG7W 5JW4Q 3HC4L 5T3XD 3V7MA 5HHOB 4HWEL 5E5UB 4G9FB 3TN0A 1T2QL 4JPKL 5D5MA 4DN3H 4U31A 4KRPD 1RIUL 4MQXD 4E0RB 5L6YH 3VXMA 3KDMB 2OLDA 1MFCL 2OTUB 5H35B 1LNUA 1JE6A 4L8DB 5C86A 4CVUA 4HJ0C 4ONOA 5DFVD 3IAGC 2DQIL 3C5SB 4GQ9H 4FXKB 1EEUA 1X5XA 2Z35B 4D0BA 2B4CL 4K71B 3IDYC 3P2TA 4MAYD 2M1KA 3SQOL 4NKDA 3L3GA 5T1DL 4Q7DA 3GJFH 3ZKSD 1HKLH 3OKYA 4OFKA 3T2PA 4JZOB 4JRXB 1Z9OA 2W0LA 3QISA 2B0SH 4B0MM 1T3FA 4EQ3A 2Z92B 3P9LB 5E94B 4MX7A 3EZ8A 1IEBA 2X4RB 4H1LG 4OZGA 1NLDH 1R24B 1KJ2A 1CGYA 2IALB 3STBA 4NQDE 3KS0H 3QDJB 2I9LA 1JHTA 2OR7A 4RMVA 3NFSL 1GSMA 4DQOL 3HE7A 2MHAB 3V5KA 2D0FA 2DM2A 1BGXH 1OVZA 1SMAA 4M4PA 2EEAA 3PHSA 4L4TD 5B39G 4YXLH 1PKOA 1S9KC 4MQ7B 2CRMA 4U6VL 2IFFL 5HPMA 1CBVL 3KLSA 4ELMF 1MJ7L 2EH8H 2EIBA 4OTXL 1FDLH 1YPZF 3UTZB 4V2BA 3FQRA 3U36A 4JFFD 3N1MC 5IGXL 3NBNA 1T0NB 3QT2A 3W82A 3GI8H 2ZCHL 3JV6A 1MVFA 4Y16A 1YZZA 4LSRH 2YD9A 1ZHBA 4JO2H 1CE6B 4YDVA 1A14L 1RZJC 4JFDA 3MLSL 2O5XL 1RIVL 5HHME 5EU7C 4LIQL 5E03A 3GSOB 3Q6GH 2BP3A 2CGRH 1MCQA 1FSKB 2EDTA 3ES6A 3K2MC 5DQJB 5GGSB 4G8FA 4OFIA 5TFSL 2CMRH 3HCVA 4HUVA 4XVSH 4NCC2 3BUYB 3G9AB 4X7FC 4EVNA 1NEZG 2Y6SD 4LKXA 5D1ZB 5GS0C 1L0QA 4IDJL 3QXDA 2QHRL 3NPZB 5C09D 2ICWJ 2XQYG 1PW3A 5CBAA 5F96H 4JFQB 3SE3A 1IEHA 2J2ZA 2WWMD 2E6JA 3N85L 1LO0L 1VSCA 1AKJB 5HHOA 2VDNH 4G9FA 2VC2H 3MRJB 3TPKA 1HEZB 1AHWB 5CJ8A 4MNQD 2PO6C 4E0RA 3KDMA 3AROA 3GMNB 2OTUA 1JZ3A 5D71L 2L0DA 3WFBH 2MKWA 3BWAB 3DX8B 4X99B 5H35A 3QA3B 3LEVL 4IJ3C 1ZHNB 4K7PH 4S1RL 1BEYH 1JVKA 1WZLA 4L8DA 5DXWA 3C08H 3IJSB 1AH1A 3EOTH 3MUHL 3ZDYE 3C5SA 4FXKA 2Z35A 4HUMB 2EDFA 4LCIH 2NNAB 5ID0B 4Z7WF 4ETYA 1AGEB 1IARB 4KJWC 2IAMB 5CGTA 2LU7A 5DZOA 1CZ8L 25C8L 1RUPH 4JZOA 1MRFH 4JRXA 3FB5B 3VGGA 2Z92A 3RAJH 3P9LA 2Q8AL 5E94A 4HIEB 2X4RA 3WDIA 5E6IC 2KH2B 4NWTL 1R24A 2IALA 3QDJA 2F53B 4ELMB 3ET9F 3ARZA 5F8QC 2AGJH 4LDOB 2MHAA 3C09C 2J88L 3D87B 1FC2D 1P84J 3HZMB 3C2SA 1UA6L 4MQ7A 4UTAL 4ZDHB 1GAFL 4P99A 2R2CA 3UTZA 1HHKB 1T0NA 5C0GB 1NPUA 2VXSL 3WO3B 4UNUA 1WIOA 2IQ9L 4IRSC 5J56B 3P30L 1KTKE 4NUJB 3QPQC 1CE6A 1EBPA 3VH8B 1CDIA 4R96B 4CU8A 2XV6B 3FO0L 3GSOA 4WEMB 1MCEA 2IEPA 5T1KD 3SEPA 5KSAC 3VWJC 5DQJA 5GGSA 1HH9B 4LU5L 2J12B 5HDBE 1HKFA 4UDUB 3U4AA 3BZ4B 3IS1X 3T1WA 4OLZL 2Q8BL 2V9QA 3BUYA 4RDQF 5IB1B 2EDYA 2HH0L 3VW3L 1LD9B 1C8PA 1MAMH 2RB8A 3NA9H 3NGBB 3BPNB 3UYRL 5LQBL 5D1ZA 4RFOL 3BXNB 2IANB 3LN4B 3U0WH 4OB5H 3AB0C 4JFQA 2DLEA 5SX4H 3OAUL 2DDQH 3UYPA 2QKIB 3BP4B 3TFKD 3L5JA 5IFHH 2F19H 3F7PC 1AKJA 4KKCD 4KAQL 4P9HL 3RVWD 3WLWC 1MH5B 5I2IB 3MRJA 1HEZA 1AHWA 4WI9A 5IFAL 4M9PA 4U3XA 3GMNA 4ZFGL 5B38G 1QKZL 2DQCL 4YK4B 2QSQA 2O5ZH 3BWAA 3DX8A 5DWUH 2CUIA 4X99A 3HLAB 4Z7WB 1IMHC 3PQYE 3QA3A 3HS0B 4XC3L 4LSUH 1CU4L 1ZHNA 3AGVA 1L6XA 4WFED 4NZTH 3FZUC 2KBGA 3IJSA 3DROB 2P7TB 2UZIH 3LKOB 1F3DJ 4JFEE 2NNAA 1FLRH 5ID0A 1OL0A 4FFWC 1AGEA 2D7TL 5M94B 3PG2A 4NN7B 4ALAH 3QXAB 2IAMA 1UZ8B 3LS5L 3VGHA 4RBPK 1KJ2L 3FB5A 3TT1L 1YJDL 1QBBA 3ZTJH 4S0SD 2CRIA 4L1DA 1PX3A 4HIEA 3MJ8B 3KS0J 5B3NA 3E6HB 4MJ4A 2F53A 1KENH 4S1SH 4ELMA 1EVUA 3T8XB 2YD8A 1AFVH 5ITBL 3PP4L 2VIRB 1PD6A 4U0QB 2NY4D 4MNHB 3RL2B 1TQCC 1HDMB 2R0KL 1KLFA 3H9SD 3JTSB 5JO5B 3HZMA 2E9BA 5J12C 3VI4E 1U95B 2WUCL 4KTDH 5T5NF 3W0WE 4M1DH 4ZDHA 3BSZL 4NJAH 3BRFA 1QFUL 3VXUE 1FGVH 4JO4L 1EEQA 3QUMH 1FZOB 1HHKA 4AZ8A 4OLEA 5C0GA 4U7SA 5C0FB 1ZVSB 4RGNB 1IT9L 2AK4D 1NJ9B 4N8VB 4LVHB 4NUJA 2W0PA 3VH8A 3OSKA 4OGYL 4R96A 1B4JH 2MJWA 4XCNB 4OIBA 5AD0B 2B2XH 4F8QA 1V5JA 2X4TB 4R4NC 1RSFA 5DJDB 1IZJA 1HH9A 5D7LB 3RIFF 2NZ9D 2EDXA 1QR1B 4UDUA 1BVZA 3BZ4A 4HD9A 1FE8H 4Q9BA 4HLZH 4LASL 3EZJB 4DGVL 4Y19B 5IB1A 4OSUL 4CJ0A 3PWPB 4OI8A 1LD9A 1LHZA 3NAAL 5E9DE 1UCBL 4BM7A 3BXNA 2IANA 3LN4A 1KGCD 5C2BL 1DDHB 3OPZH 5FF6B 2QKIA 3BP4A 3GJEB 5KS9E 1CDCA 1HZHH 3UJTH 3RTQC 5IHBA 5L2KE 1MH5A 2A77H 5I2IA 1UWGL 1U6AL 2BY2A 4APQB 4XP1H 3K4ZA 2V2XB 4E9LA 1PSKH 4OJFL 3G5ZB 5C0ND 3SDXF 1NMAH 3D39B 3P0VL 2I9TB 4Z7WA 3HLAA 15C8H 1EHAA 1YN6B 4P46D 3HS0A 1X9QA 5ADPH 4XVJL 3QEQE 5DI8B 3PXJA 1MCWW 2ZUVA 2DRUA 4TUKH 1OAZL 2WQRA 5IJKC 3RVXD 3DROA 1WK0A 4DJMA 1RI8A 2P7TA 4Q6IC 3QWOB 3LKOA 1VACB 2QV2A 4EIZC 2BZDA 2PF6A 3LQAH 4HXBH 2ARJB 1VFOA 3GSNB 3N9GL 3VRJB 3QXAA 4FNLH 2NXZD 1UZ8A 2OCFD 1MQKL 4HAGA 1SEQL 1CXEA 1B90A 1FCGA 2B5IB 3KLHD 4OLVL 2XZAH 2ZSVB 2UUDH 5D4QA 3WFEL 1S7VB 1A0QH 5FXCH 4EI5C 1RZFH 3B2UD 4M8QB 3MJ8A 1F00I 4Q74A 5GXBB 1HH6B 2CR6A 3E6HA 4FFVD 1LE5B 1J8KA 1Z5LB 2COQA 3T8XA 4YHIB 1LEGB 5C07D 3DSFL 3T0VA 5JIPA 4JDTH 2RAMA 2R29H 2VIRA 5AZEH 4MNHA 3RL2A 3NN8B 5C92A 1HDMA 3DX9B 5JO5A 3JTSA 2FD6H 3RHWF 3TVMC 2K7QA 5I1JH 5EZIL 1U95A 5D7SH 1YA5A 1JTPA 1NSNL 5JIIA 3ZKNC 5JR1H 1DSFH 3EYQD 2ATKB 1FZOA 2ESVE 3BJLA 1GGIL 1JHKH 2CD0A 5C0FA 4NQSB 1ZVSA 4Q0XL 2I25N 1OP5K 1NJ9A 4N8VA 3CD4A 1AJ7L 2FEDC 3RWCB 4LP4A 4GAGH 2AXGB 4XCNA 4GRWH 4DKEL 5AD0A 3LKRB 3ZDXF 2R15A 2X4TA 5DJDA 1EMTL 5D7LA 3C5ZB 1QR1A 2GJ6D 3HAEG 4LHJB 2MQCA 1N64H 1FFNB 4Y19A 3DIFB 4NBYB 3PWPA 4RMQA 3U7WH 4JREB 3GSUB 4NZDA 3ABZA 1K8IB 2VR4A 2G2RB 4XWGH 4QOKE 5EO1B 2ZUXA 4FQCH 4IRJC 4KUZL 4P23C 5J11C 2HKFL 2YPLB 1DDHA 3SOBL 2DWEB 2VZTA 5FF6A 4PJ8D 1WCBB 3SDXB 3GJEA 4ODXB 2EDNA 1U3HB 4X4ZA 4P49A 2EDRA 5CINL 3KVQA 2DB8A 1H3UA 3DI3B 2YXMA 3ULUD 1OAQH 4APQA 5JQ6H 2V2XA 1G0XA 1YYML 3SO5A 2NXYD 4X6CB 4EQ2A 3G5ZA 5GSRB 4GBXB 5DA0B 3D39A 2I9TA 3GMLB 2OZ4H 3VGFA 1YN6A 2FL5B 2EDEA 1J9CT 1EK3A 3BAEL 5DI8A 3C60C 4H20H 1ZWIB 2YUZA 5MENE 1KEML 3QG6B 1OWWA 1ZT1B 3QWOA 1A5FH 2NY3B 1VACA 4U1NB 3BH9B 4FQ1H 3CUPB 1PJ9A 3ARFB 2AEWA 3N1FC 2WP3O 4U0RB 5E2VH 2ARJA 5GGRY 3GSNA 3VRJA 2DQUH 2UYLB 1JRHH 5C7XH 4IOIB 1A6VH 1XGUB 4I3SH 3QI9D 5FFLA 3LPGA 1TIUA 4LFHD 2ZSVA 1G9ML 4NDMB 4JFHD 1RVFH 5I75B 4C4KT 1S7VA 4OZIE 4HPYH 4M43H 4M8QA 4GFTB 1X5JA 4DOHE 4M62L 4GMSH 1HH6A 4JEGB 1LE5A 1Z5LA 4NBZB 3CU7A 1I9EA 1LEGA 4YHIA 3V4PH 1T04B 2QSTA 1A3LL 3NN8A 3DX9A 5IVOA 1NCUA 3O6LH 4JVUA 1I9RL 4OLXH 4ISVB 5ILTL 2XT1B 5HDQL 3DI2B 1M7XA 4V1DB 2WLYA 2QBWA 4YHPB 3RFZC 5IK3B 3U48A 3GZKA 4Y89A 4FFYH 1OWRM 3S9DB 2ATKA 3C87A 1IKNC 4OGXL 1KCUL 4HMDA 4QHLB 5I74B 1EHNA 2J1KA 4NQSA 5IV2B 4CRPA 3O0RH 4OLWH 3RWCA 4Y8DC 4NJ9L 3ZE1F 2AXGA 2A6IB 1R6VA 5HI4C 5C2UB 2GAZB 4OD1H 1G6RB 1HIMH 3LKRA 4FZ8H 4JPWH 3TJEL 5I1HL 4QXUH 3C5ZA 4Q9CA 4PUBL 2X4UB 2VAJA 2NMSA 3T3ME 5EU3B 4HK3N 4BQ8A 3RKDD 1FFNA 2OP4H 3DIFA 2LE9A 3QUKB 3V6ZB 3GSUA 1FGNL 2XRAL 2XICA 1K8IA 3QHZH 3LKSB 4M1GH 5CZKA 2G2RA 3ZKXC 1J18A 1YMMD 1JNHB 5EO1A 2WUBH 2WQ8A 2GIYA 3OMZA 2YPLA 2DWEA 1CLZH 4CL7A 2YN3A 3KYNB 1WCBA 3SDXA 3CFJB 4ODXA 1BOGB 1I9JH 1ZANL 3IDNB 3UPRB 1U3HA 4UB0H 1WFOA 1WT5A 4GUPB 4M03A 3BPOC 4U1IB 3T09A 2VXVL 2NW3B 1TMCB 4X6CA 1GC1C 1OTTD 5GSRA 4GBXA 4FN0A 2XA8H 3GMLA 4KK9D 4JFZH 3ZSTA 1T21B 3TN0D 2HFGH 2FL5A 3W2DH 2V17L 3VXMD 1ZWIA 1YNKH 3QG6A 4JANB 4XNUL 1ZT1A 3HPLB 5F93C 1UEYA 3O9WC 2GCYB 2R56L 4HH9B 4U1NA 1AGDB 5IMLB 3BH9A 3CUPA 3O3AB 3ARFA 1JHLH 1P5UA 1EA9C 3SGEI 1MIMH 2UYLA 1TETH 1GGTA 1YEKL 4IOIA 1WJ3A 3V52H 1XGUA 5E08H 3MACL 3WHE1 4ZS7L 3SO3C 3FOMB 1PZUB 4NDMA 2OL3B 4NZJA 3BT2L 2QJDA 4XHQA 1RURH 4J3XA 4YH6A 5GGRB 5A2KH 3ARBC 2QL1A 3VRIB 5CAYB 2NQCA 2M8XA 3FAWA 3OB0K 5CKGA 4GT7A 2F58L 4DZ8B 1T04A 1DBKH 5CLWA 2EE6A 4TSCL 1BQLL 2B39A 1Q38A 4FFZL 4ISVA 1P9MC 4YPJA 1PX4A 3VGAB 1MFEL 4TSBL 4V1DA 3B9KB 3J7HA 2APVA 4YHPA 5GRVL 3HE7D 5IK3A 2XWBB 4MXQD 3HNTL 4M7ZC 3KNBB 4OQTA 3V0WL 4QHLA 2XTJC 3B8YA 2ARWA 5IV2A 1GGCL 5F9OL 3JV0A 1T66D 1VGEL 3PP3K 4KVNL 2A6IA 5EUOE 3X3GH 2H6PB 2GAZA 3U4BH 4P5MB 1G6RA 5IQ7L 3R0MA 4Y16D 1RJYB 4KROC 1NGQL 5DR5H 1LK3H 3C6LC 1RULH 1J0ZA 1FFPB 3S35X 1YNLL 3MBEC 4JFDD 1LGVA 3SHSA 2X4UA 5EU3A 4LPWA 3JBG7 3QUKA 4OIIL 3V6ZA 1AR1D 4O5LH 3WCYA 4BUGA 2ZZUT 2HWZH 3LKSA 4N8PA 3VG0H 1JNHA 3MUGB 2OQJB 1MELA 2CLZB 2UZYB 1OGTB 2DIBA 2KDGA 1G84A 1RK0B 3KYNA 1SBSH 4TULL 1A6WH 3CFJA 1RUQL 3ESUF 4JCLA 1BOGA 5FOJA 3IDNA 3UPRA 5C0EB 2VLRD 4CDHA 3V79C 5DT1L 4AEIH 4GUPA 3KPOB 4LCCB 4U1IA 5FHBH 2YD6A 1N5YH 1FIEA 2NW3A 1AO7B 4NRYB 5HHOD 3IT8D 1T21A 4G9FD 1TTUA 2R69L 4OF5A 5CJOL 4LSTH 4X4XB 5BO1L 1ZLVK 1MPAL 3GSNL 4JANA 5CCKL 5J0BA 3HPLA 3Q0HA 5I9QB 5H2BB 4H25B 1RMFH 2GCYA 4HH9A 1AGDA 4Z0BL 5IMLA 4FTVE 3O3AA 4HWBH 2GFBB 4Z8FL 2CUMA 2J4WL 3BEWB 3Q1SH 2G75B 5LWYH 3CSGA 4H0GA 1DZBA 3K2UL 5H37G 3WXWL 3SE4A 3I84A 3Q6FB 3HPJB 3FOMA 2R0WH 4LLAA 2ADGB 2OL3A 6FABL 3CXDL 3WDJA 2B1AH 1ORQB 5GGRA 1S9XB 1KXVC 2Y7QB 3B4NA 2AP2A 4PLKC 5HYSG 3MV8E 5TQ2H 3V6FB 3VRIA 4X6EB 2VUYA 4HV8B 5C0RL 5GISL 3P73B 4YIQB 4K3EL 4JRXD 4N1HB 1KYOJ 5F6IC 1A3RL 2DTMH 4DZ8A 2V2WB 5A1AA 5EOTB 5KVDL 1QD0A 4G6AD 2DJUA 5IHUL 3QDJD 4HFUH 2BDNH 3MRGB 4HULB 3B9KA 3HNSH 4M3KB 1BBJB 1I3GH 2XWBA 3KNBA 4TTGA 1M71B 3DUHA 1KXQE 4U7KA 1LO4H 3CVIH 1XIWC 2JK5B 3EHBD 1TZGL 3R4DA 3E3QC 4OCSL 1R3HB 1IC4H 2H6PA 4P5MA 5KVGH 1IGIH 4NRXB 1YEFL 3QXVA 4KRNA 4R6UA 4TVSa 1RJYA 1CTNA 4P2QE 4JKLA 4OAWB 4IBLT 1FFPA 3GDBA 5F3BB 5HYQB 5DO2C 1UH2A 5DMIH 5EDXA 3TBSB 5IM7B 3RX5A 2O5YH 1Q72H 1QBAA 4J3SA 1ZGLP 3MUGA 4YNYB 2OQJA 2CLZA 1OGTA 3T77B 3WFCH 1RK0A 3RIAF 1QHOA 2CIIB 4NQCE 3L95B 1JI2A 5D1ZD 2EDLA 3CCHB 2JKXA 5C0EA 2Q86B 3KPOA 4LCCA 3STZB 1XFPA 4PRDB 4UINL 1EIBA 2IF7A 1SJVA 2K1MA 5CD5C 4X5LA 1AO7A 2EO9A 1OT2A 1AKJD 4NRYA 1BFOB 4HWNA 5GGTA 5AZ2H 4MZ3A 4X4XA 43C9B 5FCUL 5CS7A 5K9QG 4FMKA 4JAMB 5H2BA 4H25A 3UDWA 4EUPB 3LPWA 2VXTH 2JJTA 4G6KH 5I8KL 3S3PA 4KZDL 5JOPE 2GFBA 5GHWH 2ZUTA 3BEWA 4IHOB 2G75A 2QSCH 4NNYB 4IEFB 1MCKA 2O61B 3WFHB 2ZCKH 3BGAA 3CH8A 4X7EC 3Q6FA 3HPJA 5CILL 2V9TA 2ADGA 3WSQL 4HGMA 1XGPB 4HQQL 1ORQA 2IAMD 1DL7L 1QLEH 3OKDB 1S9XA 4UV4L 2Y7QA 2AW2A 4NQDB 5DZLA 3V6FA 4GS7C 4X6EA 3LY6A 4HV8A 4DKFH 3P73A 4YIQA 4R4FL 3IU3B 2NW2B 2V2WA 3KPQB 2PNDA 3GFUA 3ZL4H 5EOTA 4XGZB 2F15A 1G7QB 1KPVB 2J8OA 5FO9B 1N7ML 2EEDA 1N0LA 2F53D 3MRGA 5HHNB 4F37K 1D3CA 1CTOA 5GGUB 1BBJA 1M71A 1MCOH 1IL1B 1LMKA 1L7IL 1G6RL 3PWUB 4PG2C 2JK5A 4BYHA 3RY4A 5E0QA 5HHMB 4WGVB 3LOWA 2VWEE 1R3HA 4YZFE 3FONB 2XZCH 4NRXA 1ACYL 1P84K 1XGRB 3NOIA 3SDAD 1JYXA 3TO4B 5DK0B 4OAWA 3QAZC 3ETBF 4CDGC 4ENEC 3RA7H 2EE2A 5ETUB 5F3BA 5HYQA 5EBWB 5F9DC 1CK0L 4DK6A 3FQNB 1RUMH 2C3XA 4KUCF 4EOWH 3TBSA 3UTOA 4JPVH 5IM7A 1B88A 4YBLC 1JPTH 1U3JA 4YNYA 4RWHA 1ZLSH 1EHLH 3NFNB 3T77A 3R8QA 4CN4A 5I0DA 4Y4FC 2CIIA 1OLLA 3L95A 2IAND 3CCHA 3HAEH 3AY4C 2D0HA 2Q86A 4WY7H 1MFDL 1NC2B 3STZA 2J7LA 4PRDA 3SCMB 1X5YA 4M93B 4C58B 3MYJB 4HT1H 3C8HA 3X11B 1UJ3C 3L3HB 5BVPH 2YUXA 43C9A 5I1IH 1JTOA 4FMFA 4OM0H 1ITBB 4YXHH 4JAMA 3LQAC 3H8NA 2OR8A 5IW6B 4Y5XC 4EUPA 3SGDI 3MLVL 4M5YH 5BCAA 4XBPB 2OL3L 5D6DA 5DDHB 3GNMH 5CZXD 4IHOA 3W9EB 4P2CG 4NNYA 3MLYL 2VYRE 2O61A 3WFHA 4I3RL 4LPUA 5FHAH 1UJTA 3CLEL 3GIZH 1XGPA 1NCDH 4DVBB 3JVGA 3ZHKA 1EHXA 2CXGA 3BKJL 2FGWH 3OKDA 4ELKB 4NQDA 3QDME 1OQXA 4P2OC 3VFPB 3ARUA 3IU3A 8FABB 2NW2A 2OSLB 3KPQA 2UY7A 5C8JB 1UKQA 4WWKC 2PYFB 4XGZA 1G7QA 1KPVA 4X7TB 5FO9A 1I7TB 2ENSA 2A74B 5HHNA 5JQHC 3ZMRA 4CMHB 5F7EL 3UTQB 3OKEB 4U4BA 5GGUA 2XZZA 4R8WH 1XAUA 1IL1A 4GXVL 1QBMH 5MEOB 4NKIH 3VDBA 1MLCB 4UILH 3RGVC 3PWUA 3MLRH 2MPAH 4M7LT 1T7WA 2X09A 4NNPL 4U2ZA 1UC6A 3KJ4C 3IDGB 5HHXH 5CIPB 2ERJB 5D1XB 4J6RH 1CL7H 3FONA 1B3JA 5EFIB 2DM3A 1XGRA 4HKJB 3TO4A 4RGND 4ZD3L 4J3WA 5DK0A 3NTCH 4DGIL 5ETUA 4X5XB 3UAJC 5EBWA 5F7NC 2ICEB 3V7AE 2Z91B 3V6OE 4ERSL 4LRIC 1I1AC 4PY8J 1BWMA 3QFJE 5TH2B 3FQNA 4Y1AE 4MVBD 2WWKT 1EEYB 5GS3A 3WNNA 4AEHH 4KJPC 2X1OA 4OV6F 2P46B 2A1WL 4Y19D 4ETQB 3NFNA 4UV7H 1A7PL 3UYOD 1WFTA 2CJUL 1Q9OB 4RSVA 4ZS6C 5GGTL 4XC1H 1SVZA 4ODHH 4ZAKB 4M7JL 1C16B 3PDDA 1NC2A 3SCMA 3VG9B 5KS9F 1CXFA 5GRUL 4MDJB 2QSVA 3PQYB 1QBLH 3MYJA 5DQDH 4QRSB 1ZLUH 1PY9A 3NABL 3SDCB 3X11A 5JXEA 3L3HA 4LL9A 3QUZC 5JIHA 4K23L 2OM5A 4APQD 3V4VL 3EYVB 5DJXB 5JW4N 2VQ1B 4JFEB 3D39D 4ODTH 2SEBB 5TE4H 1TVBB 5IW6A 1DLFL 4XCYB 1FG2B 4XPTH 3UTTE 3WYRA 2FJGB 4XBPA 2BJMH 5DDHA 4NM8H 1MRCH 3W9EA 4H8WH 4YGVB 4K94L 1IBGL 4BQCA 5D8JH 1IC7H 2XPGB 1AY1H 3HI1B 5I1GH 5CGMA 4DVBA 2YK1L 1INDH 4ELKA 5T33H 1FG9C 3D0VB 3OKMB 5SV4A 3VFPA 8FABA 4K8RL 3BRGC 2OSLA 2ZKHL 4XCCL 1T7YA 5C8JA 4IRSD 1A21A 3MXWL 4HF5H 2PYFA 4MQTB 4NGHH 1ZEAH 3W0WB 4FQJH 4X7TA 5F1KC 1I7TA 4ZUSB 2A74A 3VXUB 2BVUA 3UTQA 3OKEA 4HSQA 3KR3L 3MRRB 2RCSL 3IGAB 4XCFH 4LSSH 1IQDB 5K9KB 5MEOA 4JHWL 1MLCA 5FGBC 1OGAE 3BI9X 1CICC 1A8JH 5DUPL 4ZODA 4N9GB 3IDGA 5CIPA 5D7KE 1LK2B 4HXAL 4Q9QL 3RUGE 5D1XA 1NMCC 1E6JH 2QQNH 2DLFL 5EFIA 5CP7B 3UJJL 1P4IH 4HKJA 3DGGB 3HC4H 4MJ6B 3D3VE 5HGAB 1MIEH 4Y5VB 5KSUB 1DQDL 2APFA 1T2QH 4X5XA 1EFQA 2ICEA 1RIUH 2Z91A 3VGDA 3RZWA 1GGUA 1TNMA 1KF9B 5I18L 5JUEH 5TH2A 1IGTB 5E9DB 4OZHF 3LRHA 1EEYA 3C5ZD 4AQ1B 4MYWB 3RVUC 1T80A 4ZXBC 1P6FA 4PBWD 4ETQA 3OJDB 5KS9B 2HT3C 5IBTL 5I8OH 4UTBH 5HDLA 2DQIH 5TE6H 3QUYC 5L2KB 2VUOA 3SQOH 3N1GC 4EZMA 1Q9OA <