1OLLA

Extracellular region of the human receptor nkp46
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
188
structure length
188
Chain Sequence
TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NK RECEPTOR
publication title Structure of the Human Nk Cell Triggering Receptor Nkp46 Ectodomain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/receptor
total genus 36
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2003-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ollA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ollA01
5E6IB 1T22B 3UDWC 4OD1L 1EUTA 4X6BA 1JNNL 4NFDA 5BOZG 4Z95H 2GT9A 2W65A 5LXGH 3QIWC 2DLGA 4L3EB 3T0EC 3QRGH 1DE4B 1DQQA 1EEQA 4K8RC 1E4XH 4X4YA 4LIQH 3QEGL 3OAYK 4WO4D 3ZKSD 3TBTA 2Y9RT 4WW2F 4EN3B 3QEQA 2Q3ZA 2HTKD 5MERB 5EU3B 3FJTA 4M1GL 2IH3B 3GMPA 5FXCH 3TVMA 4E5XA 3ARSA 4RMSA 4ZSOE 3RWHB 3QUYD 3V7AE 1MRCL 5IK3B 2NY2C 2BVEA 2YBRB 4MQXD 1M05B 2X42A 1P9MC 3S97C 1SJHB 1BLNA 4ZPVA 1U8MB 3HUJB 2BVQA 1QRNE 4R7DB 3DTXA 4TNVK 4RBPH 4KRPD 4G6FB 5BZWB 4QRQB 3B5HA 1P5UA 1KJVB 4AT6B 4PJXE 2R1YB 4MNGE 2YWZA 2LQRA 2D4DA 1N0XH 2K9UA 1VADB 1YECL 1UJ3A 4N1EA 1YPZE 3U9UA 3QJFA 1H8SA 4PLKC 3I50L 4WHYH 4GRWF 4M7ZC 2BDNH 4JM2C 2H1PH 1G6RH 2F58L 4G8EA 1CQYA 3B3IB 3MLYL 3V9FA 3F7RA 2QQLH 4TSCL 4WV1B 4D0DB 2R0ZH 5E9DD 1NCBH 4NWTL 5D5ME 4LKCB 2PTTB 1RZJC 1K8DA 4QTHA 4QRSA 3NPSC 4BZ1L 2WMPA 2NLJB 5ITBH 1YN7B 3C60B 4LF3B 1TJGH 2XKSA 3C9NA 4MXQC 4N9OB 4M6OH 3EGSB 3U83A 5B22A 1NFIA 3DUHA 4U1SB 2IAND 1G6RA 1A1OA 5EG6C 1T0MA 1T7WA 5CJXC 1YY8B 4HBQA 4NHCH 4DN3H 4E41E 3CZFA 1J05B 4ZTOH 1RUQH 4KAQH 3SO3C 3FQUB 4UDUB 3BO8B 4HMEA 4LQFH 1WICA 3VFWA 4DWHA 1UWEL 3SGDI 4I2XB 4ERSL 1NDMA 3AFLA 3QCVL 2XICA 3OX8B 2H2SC 4KPHH 5C0AD 1MFCH 3JV0A 4QHUB 3GUTA 2F8OA 1A5FL 3LS4H 5DUBA 1GGCL 4HG4J 1MLCA 1B0RA 3HZMA 4LRIC 4YXHL 1CFQB 2RFXB 3MOAH 3KLSA 4M6AA 5IBTL 4ALAL 4Y5XC 5CCKH 3TCLB 3STZA 3ZDXE 4PJAE 2A6IB 3QFJD 4Y8DC 3SOBH 5TF1L 4NQEA 1AXTH 2EDXA 1KG0B 3D0LA 2APWA 1I7UA 4I0PB 4Z7UF 5ESVB 5HI3D 1KLUA 3AMLA 3JV4A 1MCKA 3UO1L 4I4WB 3QCUL 5TE7L 1NCAH 4PRHA 1XT5A 3BW9A 5C09D 2YKLL 2GIYA 3W9DA 5HHOE 5GRVK 3UTSB 5DR5H 2VISB 2WINA 1ITCA 3DO7A 2X9WA 3WNKA 4PJFE 1V7MH 4X98A 5HGHA 4RAVB 4G9FA 3P77B 4S0SD 1C16B 1A3LH 1HHJB 2EIZA 1QKZL 1FPTL 3VE0B 4J1UB 2E7CA 3A67L 4KDWA 1KTLB 4MJ6A 2AEIT 3HMWH 5INDA 2CRZA 4PRIA 2R9HC 1X4ZA 2X1PA 3O6FB 4ZFFA 2W59A 2G2RB 1NLDL 4AENA 1UC6A 2HFTA 1MLBB 1EUUA 3FB8A 3TO2B 2VXUL 4CMHC 3W0WB 5HTSA 3TGXA 5HDBE 1OWRM 2WIMA 4W4OC 3FRUB 4DFHA 1NC4B 3QDHA 3RUGF 4BFEA 3V6ZB 2A0LD 2RJMA 4DGVL 4X9GA 3B9KB 4JFEE 5DMGD 3O2DL 5TGBB 3LH2L 3VCLB 4N8CH 4QRRE 1RHHA 3FFDA 1D5MB 1H3UA 5FB8A 1Q9KB 4ZAKC 1OARL 5AYUH 4XZUA 1K4DA 2HVKB 5IG7B 1OGTB 1KCUH 4M62L 4F8QA 4LARL 1A7OL 3O8XC 5DJDA 1PJ9A 3UPCA 2CXKA 5ITFB 3QDGA 5HPOA 1F11A 4P23D 2FL5A 3ZE2E 3LS5H 3OAZK 3DX8A 2ID5A 1INEL 4APQD 4LVHC 3X3GH 1MJ7H 2HKFL 2XWBB 3TP4A 2WK2A 4KI1A 4KUZH 4MDIB 1VEPA 3QUXB 4QNPE 5FKPA 5KW9L 5DK0B 1U95B 3M17B 4LSUH 4U7SA 1JYWA 3L3GB 1XGRB 4F9PC 3CFDA 3MXVL 5CSBA 4DZBB 4LMQE 4R4FH 3SJVE 3UP1A 1CLZH 5FUZL 5DVNA 4LCCB 4GQPH 1BJ1J 4OGAD 4YHPB 1NGYB 2XG4A 3S35L 5JQ6L 2EDDA 2P5WE 1KCVH 4OIIH 2AXFB 3M07A 1IL1B 3EAKA 1HOCA 1A4JB 4FZEH 4L3CA 2GSGB 1MVUA 3EIFA 5HI4D 3P0VH 4NGHL 1OAQH 5DHXB 4QRPD 4HEME 3GMQA 4DAGL 3VFGL 4ODXB 4U05A 3TN0B 5DS8A 1D6EB 4HUXA 3U82B 2P49B 1ORQB 2RGSA 5IGXH 3ZKMC 3VFMA 1HHKB 3MRPB 2NY7L 5C0BD 3D3VB 4KVCL 1CTOA 1MFNA 3PGFH 2ZOLA 4LDLB 4TUJA 5D1QA 1AJ7H 1UCBL 1CICD 2E7MA 1P4IL 5FGBA 1YMHA 1AGCB 3RU8H 3VFVB 3L3HA 1EX0A 2BNQB 1UVQB 2SEBA 3MRDB 1U58A 3U4EA 3O41B 4UTBH 2HRLA 2YXMA 4YPJA 4PJ7B 4RISH 1U8KA 4ZYKA 2Z31C 5E8PA 4C56B 4ODUB 3WDJA 4FHBD 4XP4H 1V5JA 5I1DA 2NNAB 5DJAA 4DQOL 5HGBB 3TYGL 5EZLA 5FUOL 5CAYB 5JNYA 3OKLB 4Z9KB 5C7XL 5EIVA 3AXLA 3FHAA 4PPTA 3OJDB 4P2RA 4LOUC 4YR6B 4Q6IB 2EE6A 4R3SA 4ZXBC 4HQQL 3P9MA 1FZKB 4CMMA 4G7VH 3H9SB 1INDH 1MEXL 9CGTA 3VXRD 4P3WA 4P46D 3QNXA 5FF6B 4NZJA 5F7DB 4Y4HB 5MEPB 4M61A 4NJ9H 2NXYC 3O3AA 3VXTB 3VXPA 2Q86B 3KDMA 3U48A 3RJQB 5FYJD 3WDHA 4Z78B 1P1ZA 3U0PB 1YY9D 4XGZB 3ZKNC 4PJCB 4OF5A 3TH3T 3V8OA 3H9HA 5I16A 5DF0A 4B53A 5GS1A 3P4NB 3UJIL 3AM8C 2DQGH 3EO0B 5DYOB 5F3BB 1JPGB 2YR3A 4P5TB 3ZMRA 4PJEB 4OGXH 2XT1B 2A74B 3TNNB 3PNWB 5D7IF 5ESAA 1S9YB 1I85A 2VDNH 1T7XA 5EC1B 5IJVB 2VE6B 1U8PB 4IIQB 5DRXA 4POYA 3GSVB 5I6XC 1ODAA 2DS4A 3TVMC 3KGRA 4QRUA 3NIGF 4L3EE 2OLDA 1KIRA 5T3XH 3HG1B 1NUGA 1S7UA 4OKDA 5CEZD 4OZIA 4XCYA 3C5JA 3OHXB 4JRYA 2EDLA 3IGAA 2XXMB 1T5WA 1RUAH 4OLWL 1A7PL 3X14B 4ONGL 1JF1A 4U1IB 1S7WA 3PWUA 1XGYH 3UC0L 3FTGB 4ODTL 1CGSL 2M2DA 4XBGB 3JBG7 4OLUH 4NRXB 3T04D 1TTUA 3SGDH 1FFPB 1CE6B 2M1KA 3QDJB 5FOBB 2YA1A 4JZOB 3HUJE 4ONFL 1I8IA 3VJ6B 1EAPA 1AKJA 5D70L 1UJ3C 4JY5L 4JG0L 4P5MB 2WQ8A 5FO9A 43C9B 4HK3N 4JN2A 4OF6A 5ISZA 2OX5A 4MA1C 5ICXB 3MTRA 3CGTA 3MRLA 4K7FA 1IM9B 3MNVA 4L29B 3MR9B 3E3QC 2JIXA 2QKIA 5SX5K 4N0YH 5EA0L 1IEHA 1FIGL 3HRZB 3QUML 2CIIB 4OQ1A 2J4WL 3WIHL 2FIKA 4CU8A 5FFLA 2GTZB 3MRGB 1VPOL 1R24B 2FECI 1NUFA 3MPCA 2H32H 2QHLA 4ELKB 5E2UH 5J11B 3GMLB 1DJSA 4RAUA 3WNOA 3QDAA 2A83A 4Y16A 5JDSA 5A16B 1GPOH 4BSVA 1HNFA 2E9BA 3NCMA 2V2WA 4GAGL 4ZFZA 4Z7NF 3GMNA 5CZXD 2BY2A 4R8WL 1KPRA 1YNLH 3MJGX 3LKNB 4EJ1C 1IKFL 1QLRA 3V5DA 3ZTNH 3PHSA 1U8LB 1FBIL 3C8KB 1AP2A 2E9IA 1YEHL 2DM3A 3T4YB 4RWYH 2H32A 3KYNB 3VFRA 5FEBA 1DBJL 1Q9OA 2BVYA 4O58L 4Z0BH 1NGXB 1ETZB 1BD2D 4HH9A 1WFTA 4B41A 5J06A 3OKMB 4I2XE 3HS0A 1JZ8A 4U1NA 2HWZH 4LLUA 2V2XB 1I1AA 1BFOB 5IFHH 1U3HA 3I02B 3GSOB 4BYHA 4MS8C 1AD9A 1CU4H 3KPRD 3BGFB 4L1DA 4UTAL 4X4ZA 3IFOB 3CFBB 4WU5B 2X70A 3G9VA 5D7KD 5E00B 4R26L 3G5ZB 5E8NA 4PRPB 3O2VL 1MJJB 1NBZA 3NVQA 3T0AA 1I1FA 4NN7C 4X7TA 3GMMB 2FJGA 5D5MF 2OTWA 3VI4F 2F74B 5GS3A 3V7MA 1NJ9A 2X4UA 4WI3A 3BKYL 3UTSE 4N90D 4FS0A 3I75A 2F53B 3S34H 1I8KA 1WT5A 4XWOD 4Q0XH 1XGQA 2W9EH 2FYYA 3RKDC 2HH0H 1DTUA 5JMOC 5HSFA 4KJWD 3IF1A 4OCYL 1LVEA 4XAKD 2VITA 1JGVL 3IFNH 5D72L 4YBHA 4XPGH 2R2EB 5EOQH 1W72L 5E8EB 3FQTB 3C6SA 2GITA 4BQ9A 2ADJB 4U2ZA 3MBEC 5C08B 5I0ZA 4DK6A 2I60H 1WC7A 2H45A 5BS0A 3MRFA 4KMTL 3W0WE 1BREA 1KB9J 3ZDXF 1DQMH 1M7XA 2B5IB 3LKPB 1NMAL 1RI8A 2VLKA 4G43A 2ERJB 1UA6H 2R0KL 2EH8L 1DQDL 4WTXA 4WI2A 1S8DA 1P4LA 2YD6A 2D03L 3V5KB 2VIRB 4QRTB 3NFSH 1Q1JH 5ANMB 4ETYA 4ZUUA 3RGVC 3VWJA 1PBYA 1CLCA 3K8LA 4HGWB 4M43L 4XPTH 3GBLA 1KELH 4MQ7A 3MACH 3MMEA 1OAXH 3OWEA 2RIKA 2GUOB 3L3OB 4GT7A 5LGHH 3QPXH 4WO4B 3B5TA 5EB9A 4XBPB 3QXDB 2FGWL 5DSCA 4ELMA 1U6AH 2AQ1A 1A22B 3BZEA 1TNMA 3QUYB 4OAWB 1E4KC 1LEKB 3DBXB 2BSSA 1G7LA 4JFOB 1HSAB 2ORBL 5IB3B 5D7LA 3ULVL 2PF6A 4JQIH 5LBSH 5IOPA 3NTCH 1IGTA 3VRLE 5K59E 1DCLA 4U6XB 3VW3L 3IRPX 2VC2H 3IAPA 1KXVC 1Z9MA 2YPKB 5F7MC 4HXBL 3MNZB 3QQ4B 4TULH 3B2VL 5C6TL 3Q5OA 3PWJB 3MRHA 5GGSA 3REWA 3G6JA 3LQAC 4P2OB 1OOAA 3HPJA 4PG9B 2D7TH 4AG4L 2GJJA 2R69L 5SWSA 3T65B 4NKMB 3CMOL 3GB7A 3D25B 1A9EA 4RMQA 1FIEA 1IT9H 3BZDA 3CSPA 3RIFK 2DYPD 5KS9F 4U1MB 5EULV 5GJSH 4UOJA 5KVDH 4EI5D 3C87A 3QFDB 5FGBC 4HFWA 2J12B 1A1NB 2ZNWA 3H3BC 4U6TA 1ZHNB 4X6DB 4L8BB 3D3VE 4HWZB 5JHLH 3MGTB 4KTEH 4LSTL 4B5EA 4NCDA 2CKBH 3A6CH 3ARFB 2DTML 2X2YA 2H8PA 5L2KD 4GKSB 4D0BB 3P4OB 1JNLH 3IJSA 3GSWB 2XYCA 3EOAA 4WU7B 2BNQE 2MHAA 1I7RB 1K2DB 2ED7A 5JW5A 4PJ7E 4U1LA 3ULUD 4GAYA 4PD4J 4C56E 4QNPF 3BEWA 4J23A 4QO1A 4X6BB 4EIGB 4JCLA 1R5WA 4MJIA 1UACH 3TH4T 3NGBC 1DQQB 2CKBA 2VXQH 3UBXG 1S7QA 5INCB 3TBYB 4WEBL 4PJGE 4FTVA 2YMXH 3L9RA 5C0AB 3TBTB 5CD3A 3QEQB 5IB4A 3EW3B 3K3QA 3GMPB 5F6HI 2QTEA 2OR9H 3WXWL 3JWOC 2XZQH 4JY6A 1TJIH 2NXZC 1FC2D 1KIUA 2AK4A 3Q6FA 5D7JD 3RNKA 1A6TB 1BLNB 1T7YA 3GJFH 3OG6B 5TDNA 3QFJB 4ZPVB 3H9SE 1G0DA 3EUUA 3IDMB 3SDAD 4N1HB 2ZUYA 5I17A 5T1KA 1UB6B 4OCMC 3LEVH 3BYTA 3QHFL 2FHCA 2BRRL 4PJCE 1MCWM 4JKPL 3U9UB 3QJFB 3GJFA 5C70A 3FB7B 3QEUA 4XXDB 2YZ1A 3C6LA 4CU7A 1JYVA 4PJEE 1FGVH 1BWWA 5TH2B 2ZUTA 1ZGLP 1BQHA 3EOTL 5JXED 1BBDH 3V0WH 4LVEA 1J86A 5E8OB 3RVXC 3QI9A 3ALWA 3ZE0F 1BFVL 1O0VA 3V7AG 4XP9H 4YHYC 4X7CC 4FQXA 1F00I 3CFEB 5IMOA 5KSAA 1S9WA 4DN4L 2NY3C 3QO1A 4M8QB 4CVZB 1F6LL 1KF9B 5F21B 4K3EL 4D9QE 3QDME 3SQBA 4WTWA 5KG9A 1NDMB 3TJEL 1L0QA 2JB5L 5F88A 3BH8A 1V7NL 3MLVH 1E6OH 4KVNL 1ERNA 4WI6A 1WBYB 4UU9B 1YEJH 5L7XL 1YQ2A 5DUBB 3GIVA 4G3YH 5D1ZA 5KJRH 5JO5B 2B4CL 1Q0YH 2HLFC 3D18B 4PYHA 3TPUA 4H20H 5JHDD 1KN2L 1RIHH 3OF6A 3BXNB 4LLMB 4K23L 2BOCA 3H9ZA 4PLJD 4FQHB 5D9SA 3WL9B 5BV7C 4APQB 3QIBD 1L7IL 3QWRA 1UH3A 3RBSA 1I7UB 1DFBL 3KLAA 2K7QA 4NQSA 1KLUB 2DQFA 3JV4B 5HDQL 3H3KA 3L3JB 4Y16C 2Z93A 1CG9A 2W07A 4G42B 4M6ML 3MXWL 2FR4A 3BW9B 4X7EC 3PWPD 4PJIF 1DBML 3ZO0A 1FFOB 5ETUB 5AYQA 3MODH 1MFEL 2WINB 4U0RB 5FO7A 4CVXB 4UV7L 5AD0A 4M7LL 2Q76A 4Y5YA 4LL9A 2KQNA 4CNIA 2C9AA 5EO1B 2CDFA 3AREA 4KQ4H 3U36B 1J0ZA 4KY1L 2KZ1B 4R0LA 3Q6GL 4MJ6B 2CGRL 4QRPB 1E27A 1I1AC 1U3HC 3BZ4A 3DETD 4NP4H 4LKXA 5F44A 1IEBA 4ZFFB 4AENB 1D5ZA 5FV1L 5C0BB 1B6UA 3FB8B 4JFHD 3RWEB 1JZ4A 4NYLA 2NCMA 2XA8L 4X8JA 2FRGP 4NC1E 4M6NL 2GJ6A 3OAZH 2AABL 5CP7A 1ZTXL 3VGAB 1T80A 3DWTA 3S4SG 2CDEA 1ZHBB 1QTYT 3DYOA 5IBLC 5EO9A 1RHHB 4PRPE 5FB8B 1UM5L 2V2TA 1NFKA 3HB3C 1K4DB 3NCJL 3FAWA 3IDYB 1KCSL 4MD4A 3ROLA 1R3IL 3QG6A 3F6LA 3I9GL 4XCFL 2B0SL 1JI1A 3HNVL 3RI5F 3WD5H 5EIIA 4IRSC 4ZMAT 4HGMA 3OKKB 4QXWA 1WT5C 1AGBB 3F12B 1F11B 5IHUL 2VDQH 1KENL 3E2HB 1LK3H 2VXTL 3P0GB 4DKEL 4OV5A 3TA3A 1QO3A 4S1DC 5I1CL 3M45A 4S1QL 4O5LL 2F53E 5FKPB 5I1GH 4L1HA 4HJJL 3HR5A 1RULL 2YC1A 4OJFH 1HYRC 3CFDB 1EBPA 4JREC 3LQZA 3LEYL 4LSQL 2D7NA 4P9HL 4NZUL 3ZTJG 3LV3A 4LSPH 3FCTB 3EO9L 1FZJA 3GMOA 1SEQL 5F9JA 1PDKA 1R5IA 4KKCC 4HIXL 5DUPH 4YHKL 4KKAD 4MCYA 1HOCB 4OFIA 3J8F7 1JWUB 5C08E 1DUZA 4Z7VA 4RZCA 2NY5L 1GIGL 2YOCA 5E2WH 3HC0A 3VWJC 5DS8B 3K2MC 4HUXB 3ESUF 2UY7A 5DD1L 5SWQB 4S10A 4M48L 4HWEH 2LTQC 4JKLA 3R1GL 2C3VA 3KPMB 1XMWA 2FBOJ 4TUJB 3SHSA 5D1QB 4N9GA 4R9HA 2DD8L 4F9LC 4LPTA 5HYSB 1JGLH 1LNUA 3TZVC 2JJUA 1YMHB 3DVGB 3UZEA 5MHSD 3L3HB 4HK3J 4KKLD 4ZPTA 3U4EB 3F58L 1RU9L 4Z8FL 2F54D 5K9QI 4J8RB 3O6ML 4ZYKB 1T2JA 4HXAH 2CR3A 1GAFH 1YUHA 4XPAL 3BT2H 1MCLA 3TM6A 4JHBA 3L5IA 2IQ9H 3ILPA 3ARXA 1OHQA 5GS0D 4OQTL 3JWNC 4NQCD 4PJBA 4NZTH 4PY7B 1YYMH 5JW3L 5JNYB 1IMHC 3KXFD 1MY7A 4M7JH 4E9LA 1LP9F 4KGJA 3AXLB 4G6AC 4KJQD 2LAGB 2DKSA 5E95B 3KR3L 4GAJL 1T83A 4P2RB 2Z8SA 3DSNA 4U1HA 1HSBA 4L4TD 4XHJC 3PP3K 4KK9C 3P9MB 4M5YL 2ZUSA 3EFDH 2MQ3A 5F7UA 3PF2A 3B2UD 3BIKA 5CGYC 4TVPL 1NCTA 3O3AB 3NFPA 3VXPB 1EO7A 3L7EA 3GRWL 1TQCC 1KTKE 4P48A 1P1ZB 1EERB 2VWEE 1OGAA 3H9HB 3T1FB 1WIPA 2VZVA 5AZEH 3UTTA 5GS1B 5E9DE 1KBGL 4LPVA 3GO1L 3ECBB 5ERWA 3NAAL 5J6GB 4I77L 1T3FB 2ENYA 2DDQH 2MCPH 3DVIA 3PGCA 2P8MA 1RUML 2HRPL 1R6VA 4Q9QL 4GXVH 5FHBL 4ODHH 1MCCA 1CTNA 5DO2D 3IDGA 3U4AA 5ESAB 2IANE 5J12C 1MAJA 3BSZH 1I8MA 4YHLH 2BHUA 5EBWA 2MCG1 3WFEH 1DANT 5DRXB 3NA9H 3FOMA 3EYSH 1AR2A 4DKFL 3SDCB 5K9OA 4ODSH 3IKCB 1OP3H 4QRUB 1BD2B 4XPHL 1LO3H 2DL2A 4RMRA 25C8L 2ZUQC 1KIRB 3IXTA 2NY4C 1UM4H 1LHZA 1N0LA 2BXZA 1KEGL 4PJ8D 2WNGA 2HG5A 5C0AE 5I75C 5TDPA 2VDRL 3D2UB 3QEQE 1BECA 1VERA 1NC2D 1T5WB 2GI7A 5C6WH 5ICYA 1JF1B 1FDLH 1NGQH 1S7WB 2ZCLL 3KPRB 4D3CL 4OD1H 4H0IA 4LVNC 2J2ZA 3MJ6A 3QFJE 1B2WL 2FGZA 1I8IB 1EAPB 4KRMB 1HILB 3BYYA 2V17L 3CD4A 1AIFB 2FX8L 3QEGH 5E03A 4JN2B 5E1HB 2VRAA 2P8PB 2P42B 1T66C 3O0RH 4H25A 3C6LC 4M1GH 1Y6MR 4BFIA 4P2CG 5C09E 5TE6H 2JIXB 1K5NB 3NPZB 1GGIL 3U1SH 1MRCH 3QI9C 4K8RL 1G1YA 3MFFB 4RDQF 1DSFL 3AC0A 1DN0A 3DRTB 2GK0A 5GGQH 4D9RD 1MVFA 5JIKA 1UWGH 3L5HA 2G9HA 35C8L 4N68A 5KSAC 1HE7A 1W8OA 1XR8A 4XP1L 4OZ4B 4OLXH 4OZFB 4OF7A 4JO3H 4J4PD 1YECH 4OZHA 3RWJA 4U0QB 2DLFH 4LHUD 5DRWB 1KLGB 4P23A 3N9GL 2EYTA 3Q3GB 1QLRB 3V5DB 4P3DA 1H5BA 3EYVA 3DURA 1VFUA 3RKPA 1FN4A 3ARWA 5T1LD 1FZOA 2W0PA 5IB2A 5DRNB 3GHBL 4TSCH 4UUJA 5FDYA 4URTB 1Q9OB 1WK0A 4NWTH 1X5ZA 1UB5A 5D1ZC 2MSPA 3CU1A 3HS0B 5D1XC 4BZ1H 2QQNL 4P2QD 1ZK9A 2OQJA 3DGGA 5CEXA 3WFHB 5IVZB 3S36L 4YDKL 3SY0A 3UTQA 2PYEA 2R0LL 3LKSA 4YNYB 5HYQA 1RZFH 3TT3L 2WAHA 1AD9B 3EO1B 3VD4A 1F90L 3CFCH 1G6VK 4HK0B 5ICZB 4G80A 1RZJL 1T1XB 2F5BL 2X70B 2CXGA 5T33L 2XQYK 4RGOL 1NBZB 3SCMD 5KN5B 1EVTC 1I1FB 4ERSH 4NC1C 2ARWA 1IZKA 4X7TB 4WFFD 2R1XA 3QCVH 5L0QB 2OTWB 4HWUA 1T21A 2EDQA 3H0TA 1A5FH 2ZZUT 1XF3A 1IGML 1DQLH 1GGCH 3HC3L 4JM2F 2AEPH 1G0XA 5AWNL 1IAOB 5DUML 2RQ8A 1CICA 4YXHH 2QL1A 3AREC 5GS2D 1NJ9B 5IBTH 3PV6A 2GTWA 1FO0L 2XTLA 4YHOL 4X4ME 2HT4D 3QA3B 3THMH 2GY5A 4LRNL 1WIOA 4PJHA 5IHBA 3UEZA 5CHNA 4OZGB 4CL7A 2V9RA 3OG4B 1BF2A 3GSQA 5F6IB 2HKHH 3VXQB 3CFJA 1CGWA 3VDCA 5IVXB 1NLBH 3QCUH 2DYPB 1MIEL 4QRPE 1ZT4A 3NMEA 3U6RA 2BRQA 5TE7H 3FT2B 3U46B 1Z0NA 4S11A 2VL5A 2HMIC 4LLDB 4CJ1A 1XGTA 5BMFH 1UEMA 1LO2L 5J3HD 3C6SB 2GITB 3VU2A 5FYJH 5CS7A 4L9DA 4Y4KC 4YDIH 5DD3H 5C0BE 1HINL 4JPIA 4O2CB 1N5YH 1ZGLM 4YK4B 2RR3A 3MO1A 2XN9A 5CLTA 3OB0K 4M5ZH 5DGQA 1XF4A 2OL3H 1FPTH 5CJQL 2VLKB 2X4NA 5A3ID 1FL3B 3DXAA 1WAAA 3KYAA 3OB8A 4MXWL 4P46A 3P30L 1S8DB 1P4LB 4FFYL 1QP1A 4RGNB 5H35A 5T1DL 1HYSD 2ATKB 4KK5C 3QIUA 3O3UN 1SEBA 2RHEA 1R3LB 15C8L 3EYUL 4WHCA 3RVWD 2I5YL 2GKIA 3MMEB 1X7QA 3T2NL 2X40A 3HTLX 2VXUH 4MAYD 3BD3A 4K3HA 5CWSB 3V6FB 3OSKA 4Z77B 4OB5H 1FYTA 3UZVB 4KRNA 3SDYL 3CUPA 4JQXA 3WS6A 3O4OB 1ZAGA 1A3RH 2DIAA 4QYOB 1JYXA 4DGVH 1AGFA 1LEGB 5I8OL 2BC4A 2H2PD 3JWDL 5CEZH 2BSSB 4LCYA 2VDOL 4H1LH 2LU7A 1MIML 3HA0A 5GSVB 4I3RL 5D7JB 5EUKB 3O6KL 3S35X 3T8XA 1OARH 4YBLC 2EDJA 4G6KL 3IKKA 2BMKA 5F6HJ 4D9LL 4K2UH 3TWCH 4CW1B 5DQDL 2HTKC 5I8EB 3DIFA 4IJ3C 4LARH 1A7OH 1B6DA 4WY7L 4H1LA 4MQXC 5GGSB 3G6JB 4W6WB 1INEH 3HPJB 3ISWA 1E28B 2HKFH 4MJ5B 5CGTA 2A6KB 1A9EB 4KRPC 5F96L 4X7FC 4JVWA 5E94A 1JMXA 5FYKD 4K71C 4LVOB 1OCWL 2X89A 1M7IB 4R96A 4JO1H 2XNAB 4TPRL 2VJXA 3BIAX 3PWVA 4Z7OE 1KJMA 3OR6A 4HT1H 5D2LA 4R4BB 4NN5C 2HLAA 3OZ9L 5JQ6H 1KJ2B 2MPAL 2YEZA 2DLIA 3KPSA 3CDGB 5F7HA 3AUVA 2I9TA 3HNTL 4JFZL 4NGHH 5JW5B 3OL2A 4U1LB 2ICWI 4JFXA 3VWKD 3BEWB 5TPWL 4NO2B 3U9PL 1R5WB 4MJIB 2DM7A 3MUGB 2HN7A 5KSBA 1I4FA 1RFDL 3P9LA 2NY7H 1S7QB 4K9EC 2IJ0C 3G5VA 4YGAB 5I1JH 1LE9A 4IOSD 3L9RB 3BFOA 5MENA 1P4IH 1LO5A 3WHXA 4AL8L 4NHUB 3ETBF 5IB4B 1JUFA 3K2UL 4R7NA 3RP1A 3VFSA 3UPAA 3HLAB 1JPSL 3IT8D 4HF5L 4P2RE 1IEAB 3SKOB 5JHDB 1BZ7A 3R4DA 5HVHB 3CFIC 3H7BB 3ARTA 4Y5VA 2AEQL 4JN1H 3ARGD 5DEFB 4I0KA 2VH5L 3KHQA 5IT2L 1C5BL 3QIBB 1ZOXA 1NAML 3EOBA 4L4VD 3C2AL 4FXLA 3P40A 5T1KB 2JJSA 4BFGA 1J0JA 2BHYA 3IAGC 2NY6D 1J5OL 2ZCKL 1DEDA 3TIEA 5C7XH 2DWEA 4OKVA 3BHBB 5EU7C 3WEXB 4P2YA 4PV9A 4Q9RL 2ADIB 1IILE 4PBVC 5TQ2H 2VOTA 1H15A 4BK4A 5IMMB 4XNYH 5EUOB 3TEUA 1TCMA 5EZIH 1MI5A 1Q9LA 1MF2L 4HV8A 4JGUA 5DFTA 1BQHB 4MVBD 1TVBA 3PJSB 1GXEA 3D85D 4BZ2L 1T5XA 3MLUH 1KV3A 4YFDB 1EJOL 2CSPA 4DGIL 1DQJA 1XF5A 4AK1A 5HPMA 5EBGA 4IRJD 1MRFH 4EUPG 3RNQB 1YEIL 4FQXB 2OJEA 3UJIH 1BD2E 1MHPH 3VXMA 5IB1B 1XCTB 4F57L 5IMOB 1RSFA 1S9WB 3QO1B 1MQ8A 1PW3A 1HQ4B 4HPYL 3TO4D 4JDVA 2MQCA 5JORA 2IMMA 4IMLA 1G7PB 1RUPH 3E0GA 1K85A 1MCJA 3BPOC 4RAHA 1KC5L 2CDGA 4RMWA 3KPRE 5KG9B 2WIIA 2BCKB 1CK0H 1TTFA 1K9TA 5D7KE 4EOWH 1D7FA 1CFVL 2PO6A 4JANB 3GIVB 1BOGA 2EKSA 2AJYL 2B1HH 5BJTB 4X6DF 2HVJB 5E8DL 2A0LC 3G5XA 3DMMA 2A73A 2WUCL 4NO5A 1JF5A 1A7PH 1BAFH 1CFNA 1UQSA 2BOCB 5EPMB 3U7YL 3EZJB 2Z91A 3UC0H 3MRCA 2W0LA 3KLAB 1CIDA 2V7HA 4Z95L 2YA2A 3GMRB 2EICA 5LXGL 4K7PX 4U3XA 1CG9B 5H37H 3QRGL 4ONFH 5BZDB 5D70H 3IDIB 1VGKB 4WJ5B 4LIQL 4JY5H 4GG6A 4JG0H 4P23C 5GIRB 1I1YA 2VLJA 1MJUL 4XAKE 2ZUWA 5AD0B 1DLFH 4JR9L 4E42B 3EFFA 1IGYB 1U0QA 4Y5YB 1JPTH 5DJ0B 1YC8A 4NDMA 2Q1EA 3KPNB 1F97A 5EA0H 2AVGA 4FXKB 5J13B 4LCWD 1FIGH 4LCUB 5DJ8A 1A6VL 4R0LB 3QUMH 3WIFB 3WIHH 5ABDE 1E27B 5MI0C 2ZUVA 1JTTA 3BZ4B 1CL7L 3OPZH 4OGAC 1IEBB 2XZZA 5C0GA 2HJKA 4LHQB 1JV5B 1D5ZB 5EORH 1NCNA 2C1OB 5FO8A 4X8JB 4UBDD 2GJ6B 3QUMA 3WIHA 5CP7B 1IKFH 1A8JH 1B0GA 1T20A 1XIWA 1NGWA 2BDNL 4O2EB 4XCNB 2H1PL 2WP3T 2F54B 5GISH 1BVLB 2Z8RA 4H5SB 2VUYA 1ZT1A 2NY0B 4W81A 1RZIA 1F2QA 5DD0L 3AU1A 1CICC 5ITBL 2LFGA 2JCCA 4NQCB 1F8TL 4MD4B 4PJ5D 3ULUH 1H0DB 1LEIA 3MUHL 3PL6A 5HI5D 2H6PA 4M6OL 2V5YA 5EIIB 3ZDYE 5A2FA 5DQJA 4FFZH 4PGEA 1OLZA 5T3ZD 2WW8A 3CH8A 4XTRC 2N1KA 1JWSB 4Y2DA 3TA3B 1AQKL 4DN3L 4R4ND 4ZTOL 1RUQL 3T0WA 4O2FA 2P1YA 4Q6YA 1I9EA 4QT5A 4EDXA 2WANA 1J18A 4LQFL 4R26H 1KIQB 3HR5B 1LDPL 2A2QT 3I84A 5ESQB 5DVLA 4NN6B 4OZGE 3RTQA 4J3WA 4LFHD 4KPHL 7FABL 4J6RL 4LDEB 3ET9F 4Z7WB 5LGKA 5KSUA 1ZHLB 3SDXE 5IVXE 4WWKD 5F1IB 4PGCA 3SPVB 3V6BR 3Q5YA 3VRJA 5CCKL 5B8CA 1AGEA 3BKYH 4NM4H 4MCYB 5FM8A 4P46C 2IAMD 1N3NB 2VZSA 1N4XH 5DRZA 4Z7VB 2Y36H 1UZ6E 1N59A 3S7GA 2I9LA 3QIUC 5FA3A 3VFOB 3VXNA 5D96C 2VLKE 2H9GB 1D3CA 4JB9H 5GRJL 3CJJA 1UWXH 4G8GD 4OCYH 4HW6A 1S3KH 4QXGL 1JGVH 4KH2A 4IHOA 3LVEA 2KKQA 4JQXC 3WS6C 1FVDA 5E7BA 2KL6A 4G8FB 1CFSB 3MBXH 3O2WL 5SV3A 4YO0A 5GJTL 4WFHD 1I3GL 1QRND 3QT2A 1V7ML 2BZDA 2IBZX 3L3IA 4PJ8B 2ZG2A 5LG1A 1Y6KR 4KMTH 1DLHB 4LLWB 1NMAH 1NC2B 1C12B 4AQOA 3WO4C 3ULSB 2R0KH 1DQDH 5FUCE 2ITDA 1EPFA 2YUXA 1YN6B 2Q8AL 3HMWL 4GW5A 5C71A 5JXEA 3JTSB 2F8VA 1J11A 1WLHA 4MX7B 3LPWA 5J0BA 4XH2A 2XTJC 3BAEL 4ETQB 4M43H 4ORGB 1NEZA 2UYLA 4K94C 5BQ7B 4YE4H 2GAZA 1HQRA 1RIUH 1HSBB 3FO9A 5CJOH 3VH8G 2DIJA 3L3DA 4ZQKB 2FZ3B 5E2VL 4YDJA 3G6JE 3REVB 4POUB 5D93B 4H26A 4N8CL 2N4IA 1ZA3A 1BM3L 2ORBH 3FQWA 4IOFC 3ULVH 1FJ1B 5AYUL 1QBMH 2CK2A 5ILTH 3ILQD 1KCUL 3SKUD 3VW3H 4JPWH 1VEMA 5I0DA 4JGJA 1U8JA 4LPUA 3LKOB 3UTTB 4E41D 2BVOB 5ERWB 4HXBH 4JDZA 1F4WL 3T77A 2R23B 4KHXH 2ED8A 3B2VH 5FCUH 1AO7A 3CDYA 3LS5L 1EV2E 2OR7A 3PGCB 2YS4A 1YMMD 1WWCA 5DQ9A 4AG4H 2D0FA 2R69H 1RVFL 2WWKO 4I5BA 3OKEB 3C5ZA 4LSUL 4DVBA 3FT3A 5EH1A 4DVRL 4U6HA 2PXYA 1H3XA 3BQUA 1QSFA 5EBWB 5T1LB 3RQ3A 2W9DL 4R4FL 2WBJD 5HHNA 3FQRB 1VFMA 1HHGB 3LQAL 4BZYA 1I1RA 2J8UA 3FO2A 5CZXC 3IXTB 1ZVYA 4YAQA 1IGJA 2YPLA 2YRZA 5C0RH 4LSTH 1XGPA 4NPYA 3MA9L 4UV4L 2DTMH 4FZEL 2A77L 4Y5VC 4OFKA 4HLZG 3D39A 3RVTD 2FO4B 3P0VL 5J9PA 3EDDA 4XVTH 5EC2B 5I1AB 1EHNA 4QHLA 4GRLA 3TBVA 4X6CA 3EDFA 2EE2A 4IRZL 3V4UH 1PYWB 5JHDE 5HHOD 3KJ4C 3GK8H 3VGHA 4WW2B 3WMSA 3VD3A 2FATL 3ROOA 1XH3B 1NUNB 4F3FA 3SBWC 2FJFB 1G84A 3GM0A 1OT2A 4Z7OF 4H25B 3BX7C 1MY5A 1E4JA 4XRCA 3EYOB 1MAMH 3WXWH 4IMKA 1T2XA 3OXRA 1XAUA 3WDIA 3GEWB 1S9XA 4LNVA 5T5FL 4TUKL 2W60A 3VGEA 1DN0B 1FAIH 4P4KA 2GK0B 5EUOE 2Y6SD 5B4MD 4NO0A 2Q7NA 4KXZI 4NQDA 3T3PF 3AAZA 3DROA 1JWMA 5C3TA 3JWOL 5TF0A 3G5YA 1BQLH 1FFNA 2BRRH 4Y4FD 1FE8H 4QGTA 4OFVA 3MOBH 4OZHB 1KTDA 4JKPH 4AY0A 1J0HA 5FM5M 1YDPA 5MEQA 1C5DA 4YHIA 2AJSH 2ZSWA 1T6VN 3IAQA 1INDL 3LN5B 1U3YA 1H5BB 3EYVB 4JFHE 2FH6A 2EDKA 1OSPH 1FZOB 4NJ9L 4HZAA 1WCQA 5IB2B 4NC2B 3QO0B 3QQ9C 4MB4A 2PO6C 3HE7D 1MCBA 1RJLB 1UB5B 1UEYA 3M8OH 2D0GA 1G0YR 5E24E 1BFVH 2FIRT 2DQGL 4ZD3H 3UTQB 1N6VA 4PP2B 1G7IA 1ES0A 3WJLA 3C08L 5E0QA 4MAYB 4MNQD 4G80B 3RWDB 3SJVD 1F3DH 3FOLB 1ONQB 4K3EH 2VDNL 4MCZA 1SYSB 3G08B 3GJEA 3UAJC 3MRNA 3FFCA 4O02L 2R1XB 2JB5H 5IFAH 2EDFA 2Y06L 1OTUC 1V7NH 4KVNH 4Z76A 5IMLA 4DK3A 4KZEL 5DVOA 3G04A 1T21B 2K1MA 3H0TB 3VD5A 4CAGA 1A7NL 1QVOA 4PJDA 3S96B 2EIDA 2XIDA 2B4CH 4MA8L 5I1LA 1EDQA 3PV6B 4W6YB 4U2YA 3MJ7A 1IARB 4XVUC 1UXWA 1RUAL 1Q8MA 1D5BB 3OB0H 5H2BA 4K23H 4PJHB 1IFHH 1YNTB 3QUZA 5E6YA 4HZLB 2F5AH 2CQVA 4OLUL 1DFBH 2DQJL 3GSQB 4UAOB 1EFXA 4B0MM 3EHBC 1B0WA 1VCAA 3HMXL 2CRMA 4L9LB 1ZA6A 1D5XA 2FJHA 3MV7A 3P9WB 1V3KA 2X4PA 3LKQB 5HHPA 1C1EL 3CX2A 1DBMH 1XGTB 1RQ5A 1FQ9C 1XIWC 3DV4A 2DQTL 2UWEA 4LHJB 5BV7L 4JZNA 3K1KC 5F89A 2CRIA 3QNYB 1XR9A 1BGXL 4M7LH 1CDGA 3MO1B 3I3DA 5I73B 1S9VA 1ZVSA 3MLSH 3DX9B 3Q2CA 3RDTD 1QYGL 5SWZA 5FYLD 1TTGA 1XF4B 2GJ6E 5E6ZA 5MHSE 4EI5C 3T0BA 3HZYA 5H35B 2BNUA 2F54E 2HT2C 2CGRH 2PW1B 1X6NA 5DD5H 1CDYA 1EK3A 3VWKB 1FNHA 2V9QA 5E2UL 1JPFA 1SEBB 4WTZG 2VLRD 1T04A 3S5LG 2HTLC 4NQCE 1GPOL 2VZTA 2AJUH 1X7QB 4PTTA 1F4XL 1H3WM 2XA8H 3KXFE 1YNLL 1FYTB 5FM5O 5D2NC 4M93C 3ULUC 3CUPB 2AABH 4GRMA 1ZTXH 3ARDA 4Z0XB 1ADQH 2BC4B 4NNXB 1QEWB 1OSZA 3O9WA 3N0PB 1OTSC 3ZKXC 4PRAB 4L4TE 2CH8A 2EO9A 3V4VH 5I1KL 4HHAA 1A4KB 3ARGB 3EYFA 3WS3A 2AXGA 3NCJH 2NPLX 4WI8A 3RX7A 3WUWA 1KCSH 1R3JB 2JELL 3F7QA 3I9GH 2B0SH 3HNVH 4Z7WE 2YZ8A 3BUYA 2PTVA 3MRRB 1ADQA 1CD0A 5IHUH 1ZGLA 1WSST 4DW2H 5LAXB 4DKEH 4YEEA 2J5LC 4C57C 2R2BA 4PRBA 5EU6A 1PX3A 3SDAC 4HIEA 4YIQB 4Z7VE 5C0IA 4FNLH 4UIKH 4HJJH 4XX1G 1VSCA 4Y19D 1MCHA 4Y7MA 2GSIA 5F93C 1MHEB 4EN3D 3B83A 2GJZA 3IJHB 5KAQG 3FN3A 5AEAA 3D85B 3T1WA 3MV8A 4XNZB 5J1SC 3GKWH 2YD8A 1SEQH 3AGVA 2GFBB 4JHAH 4IRJB 4HIXH 3AS1A 2QSCH 5F9WB 1WJ3A 1YZZA 1I9RH 1ZWIB 2DRUA 5FKAB 5I9QB 1UZ8A 3VI3F 4L4JA 1BZQK 4NT6A 3KNBA 1OB1B 2IC2A 4Q0XL 5D6CA 5JXEC 4F7MA 2FEDD 3TO4B 5GGTH 4ISVB 4JFXB 4U1GC 1CD1A 1GIGH 1L6XA 3UTZB 2PR4H 3QNZA 4U6VL 2HH0L 5JOFA 1FVCB 3KLDA 2HN7B 4M48H 4OZGF 5KSBB 1I4FB 4XPGL 4NWUL 4WCYH 5IWLA 3O6LL 4F7TB 3G5VB 2EZ0D 2DD8H 5IVXF 3PWNB 4F33A 3OGCB 4YWGH 2I60L 5HVFB 4CVUA 5GGTA 4C4KT 2J88L 1HEZA 3F7YA 3F58H 4Z5RA 4X7DC 4Z8FH 5J8OA 2CO6B 3LIZL 1VEOA 5JW4Q 2P5EA 1JP5A 1UA6L 4RNRB 4GKZA 3BPCB 1UZ6F 5GRZA 1TVDA 4RCAA 32C2A 5CJ8A 4KKBD 5HYSG 2DLTA 5JW3H 4NUGL 1IJ9A 1NSNL 1NQBA 1KELL 4OKVB 4D9RE 3MACL 1R3KB 5J57B 4GBXD 1OAXL 3ULVC 3QPXL 4H1LG 1UG9A 5C8JB 3C5ZC 5HJ3A 4PLJC 4HAFA 4ZNCD 2HP4A 1QA9B 2PXYC 3DUSB 4M5YH 3PGDA 1H15B 4ONHB 1Q9LB 1J8HD 5B3JF 4ELMF 1HKLH 3LMJH 2IF7A 4JQIL 5LBSL 3GRWH 5LWYH 1T5XB 4KXZH 5DJZA 1RY7B 1DQJB 1VFAB 2VC2L 3H6JA 4QOKA 1DVFA 2FX7H 1KCRL 3SEPA 1AD0B 1N6QL 3GO1H 4TULL 4U1KB 4J3VA 4I77H 4TUOA 5LGJB 3JVGA 2V9TA 3NBNA 4P2QE 1RUMH 2HRPH 4Q9QH 4JDVB 5CILL 4OGYL 3V5HB 2D7TL 4GRWH 3GRWA 4I0PD 3M1BB 1TZHA 4PJ9A 3L7FB 1IAII 2CIKB 5HHMB 3VFNA 3G6JF 3CH1A 4DFIA 4L8CB 1VESA 2CDGB 3CVHB 5KVDL 3R8BB 4L8SA 5DFWH 4GKNA 2WIIB 1FCGA 3O4LA 2JTDA 2QEJA 3OKOA 3MRIB 4UILL 2L4OA 4PS4H 1IRAY 1CGVA 1F4AA 1OAYH 2NX5A 2NYYC 2Y1VA 25C8H 1F3DJ 4IMKC 3I6LD 1WBZA 4YZFF 1KEGH 4JAMA 1MCNA 2CKBL 3A6CL 4Y1AA 5JR1L 3DMMB 2HJLA 3AB0C 3UBXI 2A73B 1U2HA 2R8SL 4P4KC 1WWBX 3SDDB 4PBWD 3MSPA 4P59H 1CFNB 3WN5B 5IMKA 3BP4B 4G9DA 1X5FA 2ZCLH 3MRCB 4R2GB 4D3CH 2V7HB 3KPPB 1QLFA 5EOCH 2V5TA 1OF2A 2ENSA 2XFXB 3QQ3A 5CIPB 3O6FD 3BMWA 1XCQB 1B2WH 4LLVB 1CQKA 3L5XL 3PHOB 1ZV5A 2IPKA 4J3SA 2V17H 2PW2A 4F15B 1OLLA 2OS7A 3IU3A 2VLJB 1NC4D 3WKMH 4N8VB 4WWKB 1HDMA 3N1FC 3WV0A 1JRHI 4YDLB 1TJIL 2BNRA 1UXSB 4JFFD 4HJ0D 2L7JA 3MJ9L 4K8RH 5HY9A 4F2MA 4ZFGL 2V7NB 1SVZA 1JZ7A 5DJ8B 3KYOB 5F7FA 2VSDA 2ZNXA 3S36X 4JKMA 4GG8A 1CXIA 2XPGA 1GZQA 3BRDA 1BEYL 3LEVL 2HAZA 3TYFA 4YEFA 5JLZB 4G8GB 4XP1H 2C4FU 4ODVL 3IVKB 3N1QC 3RX5A 1U8HA 3EJZD 2NZ9C 1RK1A 5FO8B 4IOIB 3FO0H 3B8YA 4KK6D 4BUHA 5ELIA 1B0GB 3NN8A 1R0AL 3OKDA 4K3DH 5BVPL 1ZE3C 4C58B 1BBDL 1KN4L 3V0WL 1ORSB 1RZIB 2Y4SA 4BKLA 1CGUA 4H8WH 1SBSL 1DL7L 3GNMH 1ZLVH 1PVHA 3W5MA 3HE6D 1WFOA 2QQNH 3A0OA 1LEIB 1NL0H 3PL6B 4KKLC 4XP9L 2E5EA 3S36H 5DQJB 3BZFA 2E27L 4YDKH 3QCTH 2R0LH 2ZOKA 2XXCB 3D69A 4Y2DB 4QXTA 2OZ4L 1WFUA 1I7ZA 3TN0D 4O2FB 3LZFH 4QT5B 3JXAA 2F5BH 5IV2B 3GDBA 2B4CC 4Z7UE 4MWFB 1CE1L 1X3DA 4PJHE 2DM4A 3B9AA 3MCKA 4NC0B 3IJYA 3RTQB 2X4SB 3CXHJ 2VQ1B 2NMSA 5CSGA 3ARBD 2D3VA 2BNQD 3IXAB 1VA9A 5GRVL 5FYKE 5AWNH 1ACYH 1P7QA 1Q0YL 5DUMH 3ZL4L 4MDJA 1XF2B 2O61B 5B8CB 1R5VA 3O11A 1AGEB 1FO0H 4YHOH 3MC0A 3B2UC 5H37G 5C0CA 5DRZB 5EU4A 5ID1B 4LRNH 3FB5A 4NBZB 1Z5LA 1D9KD 1MCWW 1N59B 1YMMB 2X4QA 3GBMH 5FA3B 3VXNB 4WUKL 4JO4H 1YJDH 4JHZA 4MZ3A 3KPLA 4YUEH 5HDOA 4D2NA 1CL7I 3QIWD 1MIEH 5JDJA 6FABL 3CXDH 4CUCA 3RL2A 1FO0A 3RI5K 3T0ED 4CADB 3MODL 3GSXA 2B2XL 3DJ9A 4WNQB 1FVDB 4TN9A 3ARDC 4LEXH 1OPGL 4FABL 4N5ED 3TBSA 3DO3A 2ATPB 1IQDB 3RUGE 3E6HA 3L3IB 2ZG3A 4Y4HD 3FO1A 3S9DB 4KQ4L 4WUUA 1P84K 5CJQH 4X4XA 3QH3A 4DGYL 4M3JA 3GSUA 3P30H 4FFYH 2ITDB 5T1DH 6CGTA 5L6YH 4X6EA 1ZS8A 3PABB 3I3BA 1W72B 3D0VA 2PCPB 1KSRA 4XH2B 4HEPG 4D8PB 15C8H 3EYUH 4P5TD 3HI1B 1RJYA 2I5YH 5CP3H 3T3MF 4L4VE 2UYLB 1CDJA 2GAZB 3H8NA 4NO3B 1BIIA 3VG9B 3VMNA 3SDYH 1J0KA 1EEYA 2W0FA 3RFZC 3HAEB 1G7QA 4JM2D 3JWDH 1INQA 2BVPA 4I3RH 3C09C 3FZUD 3VXUA 1F6FB 5CP3A 3HG1D 2P7TB 3VA6A 1YEFL 4D9LH 1F5WA 2IALB 4KZDH 5HHVH 1U8JB 1NMCB 4Q58C 4JDZB 1CLOL 4FQQA 1X44A 5DZNA 4D9QD 3TIDA 1LK3L 1EEZB 1DDHA 4UOW1 4Y4FB 5CEYA 2JE8A 2R2HB 5GZNC 1CXEA 2R4RH 5EFIA 3DVNB 3I6GA 4V1DA 4M02A 5KS9B 1CXFA 1QHOA 3MRJA 2N7AA 3QDJD 1G1CA 4F7CB 5EDXA 5F96H 4KRLB 3T09A 3W11C 2C1PB 4U6HB 3BQUB 1QSFB 1QNZL 3QXAA 4XAWH 1FNLA 5I71B 1S5HA 1OCWH 2A9ML 3O81A 4R97C 4J4PC 1W0WA 4LSPL 2J8UB 4TPRH 1G7JB 3FO2B 1QSEA 5KSBE 3QAZB 2P44B 3FT4A 4YAQB 2V5MA 3VXSA 2YPLB 3DX6A 4BM7A 5DUPL 5C0DA 1JGDB 3IETB 4QF1B 3VFUB 1S7XA 5J9PB 2VDKL 1DBBL 2W0KA 4DCQB 4QHLB 4GRLB 1IAIH 4MNQB 4X6CB 3C5SB 3NFNB 4Z7VF 5TPWH 1JHKL 3U9PH 3DUUB 2XRAL 4YHZL 4HWEL 4S0TD 5IFJA 3CAFA 1QLEH 4QHMA 1N6UA 5ACZA 1ND0B 1M6OA 2ZUUA 3MA7B 5I8KL 3EKCA 1JGLL 5T1MA 4TRPL 2LVEA 1CF8L 4DUXA 5DLML 4AL8H 3E8UL 3K2UH 5TDOA 5IW6A 2IH1A 1EAJA 4M8VA 4HXAL 1GAFL 1SJVA 5KOMC 3SCMC 3OXRB 5HHQA 4K9EL 4I9WD 3RY6A 2IQ9L 5T3ZH 5D6DA 2W60B 3CCHA 4XC3L 2C3GA 3CK0L 3PWLB 2BJMH 1DVFC 4LP5A 3ZHDA 4NZTL 2VH5H 3X11B 4ZO9A 4JRXD 1C5BH 4A6YL 1NAMH 2G5BA 4NQDB 2P24A 2JK5A 5IB5B 5F9OL 2NR6D 4ZFOB 1JWMB 4M7JL 2R4SH 4PJBF 3UBXA 3TLRA 2ED9A 1J5OH 1FFNB 4PJ5A 3I6KB 3QWOA 3W81A 2UVFA 4NQTA 2HT4C 4I48B 1EGJL 2IFFL 2XWJA 3HCVB 2RCSH 2QADB 4PJ9C 3PIQB 5EN2B 1JRHH 5HGAA 4YHIB 1C7SA 4PRPD 4L8SC 5D7IE 3EFDL 1NAMA 2ESVA 1DP0A 1MF2H 3RDTB 5GXBB 1Y18A 4NQXB 1CXLA 5HD8D 5HHME 5EZJB 5JXAL 5IR1B 4BZ2H 5J3HC 3LN4A 3NIGE 4ZAKD 3K46A 4KHTL 1X4YA 4DGIH 2APTA 3F7VA 4XP5H 1MRDH 1YQVH 1Y0LA 3ZKQD 3OMZA 2VLRB 4RFNC 1P53A 5JPNA 2F53D 3O8XD 4X6FA 1WCBA 2MCPL 5KSVA 2AKRB 4GXVL 5A3IC 1EHLL 2IAMA 1CWVA 1WZMA 3P4MB 4F58L 1HYSC 1FV1A 2YUZA 4ZOEA 3BSZL 4YHLL 2BSRA 4OSUH 1KC5H 4GOSA 3O45A 2AERT 1RPQA 3RWFA 1AE6H 3EYSL 4ODSL 5IMLB 3T2QA 4X5LA 1LO3L 2HA1A 5C08D 1HI6A 4H0GA 3ZYIA 1CFVH 4PJDB 4ZSOA 4NRYA 3QULA 2C7UA 4QHNA 5E8DH 5C07A 1UXWB 2HFEA 4FMFA 2LE9A 4GS7B 5DZLA 2H2PC 4ZOCA 1NGQL 5I19L 5H2BB 2XWTB 3QUZB 3RPKA 4OFYA 4JFYA 4ZUSB 1ZLUK 2CUMA 5CBEB 4XCEB 4PJIB 3PHQA 2A6JB 4PJXA 4GUPA 4EDWH 2FB4H 1ZA6B 1P7KA 1D5XB 2FJHB 4Y19B 4NKQB 3BPNB 1YPZA 3VGBA 1TCRA 1T0PB 4HKBA 1A2YB 4JDTL 1U8NA 3DV6A 1HHIA 4Z7NE 3O0RL 1MJUH 1RZKL 2UWEB 1WTLA 2VYRE 4G8GE 3IDJA 1CGYA 1ZT7A 4JR9H 3QP3A 3QZWB 4HIHB 4U7MA 3VFTA 3QEHA 1RJCA 5TE6L 2F19H 4I18A 3VDAA 1T1YB 1S9VB 3U1SL 3VG0H 5SWZB 2Z31D 2ITCB 1MWAH 4WI4A 3JTTB 4WFHE 1A6VH 3HZYB 1S7TA 1N64H 5GGQL 4WDIB 5EWIH 4KUCF 3G9AB 3AS2A 1UWGL 4GW4B 5FECA 4MQTB 3EDEA 4G7YL 3IFLL 1CL7H 3PQYD 4HS6A 4FFWD 1IM3A 2YSSB 1S5IL 1MUJB 1T04B 2X1XR 3LRHA 4OI9A 4OLXL 3RVVD 5LJYH 4K55A 1TFHA 4JO3L 2XQYG 2WM0A 4H8WC 4PTTB 4P2OD 4E41A 5JMRA 2DLFL 2IPTL 2YN5A 4D0CA 5EOTA 2UY6A 5C0EA 5BCAA 4MAUL 2EYRB 1V3JA 1Q9WA 4OZHF 4ZXBD 4ODWA 2BX5A 3BPLC 2XOTA 2FWOA 3BP7B 3O9WB 3QISA 3F62A 5C0FA 2PYFA 5J1AA 2OXHA 1PEZA 2NXYD 2DMBA 5DD0H 5EO0B 3VRIA 4HHAB 3EYFB 3BJ91 4XPBL 4ZOBA 3VI4E 2AJVH 4GW1A 4GO6B 3ZKND 2GW5A 5HGDA 1F8TH 4F7EA 3ARFD 3BUYB 4OV6F 4PJAA 5IQ9A 1RZFL 4U7KA 3HC4L 2AJ3A 4UIMB 3T0XA 1ZGLB 3CFCL 4LEOA 4GBXB 8FABB 3MRMA 1AQKH 1SQ2N 3GI8L 5DJXA 2H26A 1J1PL 1IC5H 1KJ3H 1AHWC 5C0IB 3S4SA 5KVFL 3ARVA 1LDPH 1RZ7L 3NA4A 1YMME 3X12A 5HHOA 1J8HB 4YPGB 4MD0B 2NY6C 1PSKH 7FABH 4J6RH 5DHVB 2GJZB 2OI9B 3WNLA 3QEQD 2CUIA 2FO1A 2AK1L 4GQ9H 1MPAL 1DQLL 4KMLB 4PJFA 2AEPL 3TVMD 3TESA 1QHPA 3BH9A 4PGBB 1TPXB 1YJDC 5I76A 1NGZB 1TZIB 1OM3L 4CU6A 5JIPA 3THML 1EXUA 1JNJA 2IADB 3ZTJH 2HJFA 8CGTA 1KXQE 5DJ2B 4MVBC 4XXCA 4MXVF 4NUJA 1FGNL 4N5UA 2DIBA 3LPGA 2HKHL 5JOFB 4PJHF 3RZCA 5GRJH 1NLBL 4P4RA 2YHGA 4QXGH 4YXLL 1IE5A 1J0YA 4PTUA 1T4KA 5BMFL 3LAFA 4F33B 3LDBC 4JZJC 4LAQL 5FYJL 3O2WH 5DD3L 4YDIL 2ZSVB 5GJTH 1N5YL 1HEZB 1I3GH 3F7YB 4JFEA 5IW1A 4LPYA 4M5ZL 1TQBB 4QRRA 1A9BA 4KROB 3R06A 2OL3L 4J3OC 2P5EB 1Q94A 5FGSA 2OP4H 4EVNA 4W4NA 3QG7L 5JOPD 5C9JB 5IM7B 1P6FA 4KFZC 2VABA 1LP9B 1U8IB 32C2B 1HXMA 2Q8AH 4RFEB 3WUWG 4NQVA 1WAAF 1RJZB 2X7LA 2XQBL 4A2MA 1IKNA 4OTXH 1N8ZA 3JWDC 3QUKA 4FN0A 2QSTA 3UTPE 3BAEH 1QG3A 3OXSB 5F7YC 1PD6A 2Y7QA 3FQXB 1T1ZA 2ARJQ 4RQQB 5JUEH 4OB5L 1FNSH 1KTRL 4YC2B 5DJCA 5E4IA 5HJ3B 4O51A 4HG4K 3CFKA 2EXYD 1A3RL 4KJYA 5I15L 3MBEA 3NIFF 5E2VH 5CEZL 5KS9E 4BQBA 5FOJA 5JIHA 4JFFB 1BM3H 2W38A 2P47B 2HYMA 4K94L 4YX2H 4K2UL 1N7ML 3TWCL 2P5WA 2PNDA 3O3DA 3MYJB 5GGRY 2H3NA 3CLFH 3OR7B 5E4EC 1F4WH 2LU3A 5DMIL 4PGDA 1WIUA 1IVLA 3RGVA 3A6BL 3BWAB 1PZ5A 2FHBA 3ARPA 4OLZH 1FNFA 1QD0A 2NW3A 1U93A 4EI6A 1W0VA 3BDBA 3MROA 1RVFH 2WWMD 3B5GA 1F3JA 2FD6H 4DVRH 3QJHB 4X80L 1JGEA 4PRHD 4MNQE 4X6CE 3CSGA 3O4LB 1ROWA 2W9DH 4HUVA 3HI6H 1E4KA 2BXYA 3MREA 4HUWA 4JO1L 4MB5A 3LQAH 3MRQA 3V6OE 2NX5B 4LGRB 4Q2ZA 4UDTA 1MNUH 3WFDH 4HT1L 3HE6B 3VMOA 1BVKA 1WBZB 3ZT6A 4JAMB 4G9FD 3RL1A 4UV4H 3MA9H 3RY6C 4LHUG 1IGIL 2HJLB 4N0FA 5D6DC 1J1XH 2A77H 3QHZL 4F37F 5D2LF 5IMKB 5T5NF 4GH7B 1Q0XH 5DGRA 4GXUM 5I74B 4IRZH 4YDVA 4N0UB 4HUUA 4KI5E 4PRID 1QLFB 2XKUA 3JV6A 3UPRA 3FB6B 2VERN 3RKDD 1JZ3A 3TCXA 2GY7B 1ZMYA 1LO0H 2FATH 3BVNB 5I1JL 1NDGB 1EEUA 4A2LA 4DEPC 4NQDE 2D2OA 2VZOA 1A21A 4X9BA 5KSBF 3ARBB 1OAZH 3MGAA 3BGMB 4U1JA 4DZ8A 2HFGH 3WYRA 4RGMC 4G6JH 4WFGD 3ABZA 3DYPA 4U49A 2F15A 2FSEA 1KPUA 4PG2A 3X3FL 5CBAB 5HY9B 4J3UA 4JN1L 4OLEA 4HS8L 5T5FH 4TUKH 1F2XK 3LD8C 5ALCL 1D9KB 2C4XA 4NIKB 3MLRH 3FN0L 3ZE0E 2XPGB 3TC9A 1GZQB 4NRZA 5FYLE 1B90A 1K8IB 4N0RA 3QDGD 3H3PL 5IQ7L 3JWOH 2FBJH 2OXGA 1DUYA 4M9PA 1FVEA 3QIWB 2GCYB 2IAMC 4KK8D 3T0EB 5I2IB 4TOYL 3O3EB 4O9HH 2P43B 1AI1H 2VLRE 2B39A 2OJZL 2J1KA 5TQ2L 4FQJL 1LE5B 5E6IA 1T22A 3GSNL 4XNYL 4ZUTA 5DMYA 2GHWB 5I66A 5EZIL 4LLQB 4AM0B 4MHHG 3LHPL 4BKLB 4L3EA 1DE4A 2NY2B 3DOSA 3NCCB 3BMVA 3MLUL 4DUVA 1CD9B 1U8OB 3BRFA 4HX1A 1T0NB 1MRFL 3X17A 1VACA 1MHPL 2FDBP 4LLAA 4X99B 2IH3A 1KYOJ 4MNHB 4P9ML 4HMCA 1JK8B 3QXUA 4PJDE 2ZOKB 3C08H 4QXTB 4YFEA 4M4PA 1M05A 3K4ZA 1RUPL 3HUJA 1VFBB 4R7DA 2L7UA 1W0YT 3MCKB 4OLVL 4QRQA 4M7ZB 5D1QD 4JM2B 1CK0L 2Y72A 4O02H 4AEEA 4EOWL 4AT6A 4YLQT 1WV7T 2Y06H 3PDGA 4PJIE 2Q7YA 4KZEH 2R1YA 1FSKC 1IBGL 3ORJA 2IQAA 1A7NH 4OD3L 1VADA 1URLA 4I18C 4Y19E 4ZO8A 3PDDA 4WHDA 1P7QB 2B1HL 4QKXB 3NPSB 3T2PA 4MA8H 3O11B 2AJZB 4YBQD 3FHQA 5AUMA 5BXFB 4E0RB 1BAFL 5EU4B 3FB5B 3B3IA 1Z5LB 1WZKA 2A6DB 5I1HL 4WV1A 3MV9B 4RBPK 5SWZE 2DQJH 5F97E 1HH6B 4LKCA 2PTTA 1MHHB 4OCWL 4PFEA 3SO3B 1K6QL 1YN7A 1C08A 3C60A 3HMXH 2WUBL 4HKXB 4LF3A 3IDUA 3NCEB 1FO0B 3IFPA 1C1EH 4P2RD 3LRSA 1P7HL 3GSXB 5IJKA 4U1SA 4NCC2 4TNWF 2DQTH 1YY8A 1DLFL 5BV7H 4OUUB 2EXWD 4GG6F 3NCBB 1A6AB 1BP3B 1JPTL 4RRPG 1BGXH 5H8DA 1J05A 3FQUA 2J6EL 4FXGB 4K3JL 3BO8A 1QYGH 4Y5XB 4WUUB 3HMXA 43CAB 4I2XA 5K9JH 4X4XB 1QSZA 2WBJC 1RK0A 2YXFA 4ORZC 3OX8A 2ZKHH 4X6EB 3SQOL 2E8YA 3OPZL 1KACB 1LO4H 1A14L 2NY1C 3JV5A 5AAMA 4M1DL 3U7WL 5EORL 2RFXA 3QPQD 5C2BH 1RJYB 1ZLWH 3BDXA 3TCLA 1F4XH 1BIIB 2A6IA 4YQXH 4Q74A 2Y5EA 2EC8A 2DLHA 1KG0A 3WSQL 4HKZA 5GISL 3PDOA 2W0FB 1G7QB 5ESVA 3RVUD 4HD9A 2AQ3A 1J88A 3SDCD 4I4WA 3IDXH 3OV6A 2AW2A 5HVGB 1REIA 3VXUB 4JG1H 5I1KH 3VXOB 5DEGB 1ZHKA 2OSLA 3RVXD 3ULUL 3TF7C 1J8HE 4JRXB 3UTSA 2JELH 2CLRB 5DJ6B 4FFZL 4JRYD 3KWWB 1OD7A 3D2UD 3NZ8A 5E2JA 2JCCF 1L0XA 1X5GA 2VZ1A 4XXCC 5CEYB 3P77A 4V1DB 5FA4B 4FQ2H 3S98A 3RZCC 3VE0A 2ZUXA 4J1UA 1LK2A 4CMHB 4PRDA 3MRJB 2Y6SC 3B9DA 5T3XD 5B4MC 4JFPB 4BQ6A 1QACA 2XKNA 5B38B 4OT1L 2EEBA 1AKJD 2Z8VC 3K7UA 4OUOA 2APBA 3KS0H 4HPOL 5ISZD 4EZMA 1W0WB 1MH5A 1IGCH 3FQNA 1MLBA 5E2TH 5HHXL 4P5KA 4RIRB 3TO2A 1TZGL 4ZAKB 3W0WA 4BH7A 3VXSB 2JIXD 4EXPX 4AH2B 4NM4L 4PGJA 5LQBL 1N4XL 4IRSA 3V6ZA 3O8XB 1QPPA 4HIIB 1S7XB 2MKLC 3T0VA 1JZ6A 5KVGH 3AS3A 3B9KA 4Y0GA 4LLYA 3I6LE 2Y36L 1JNHB 1KNOA 1FG9C 3HE7C 2O5YH 5DJYA 1D5MA 1IKNC 4LVHB 4XMLH 4U6VH 4JB9L 1RIVH 1KIPB 2D9QB 2HVKA 4QHMB 1S3KL 4Y16D 4UB0L 4FFVC 4NWUH 3FRPG 1LP9E 1M6OB 2XZCL 3O6LH 4XBEL 2MFNA 2W92A 5ITFA 3MBXL 1CN4A 2WLYA 3Q1SL 4N0CD 5TFSL 1C7TA 2J88H 1CDIA 5L2JB 1MCIA 2XWBA 4JVPA 4MDIA 4OCLC 3QUXA 1KJ2L 3LIZH 4BSWB 5HHQB 1U95A 3ARYA 5F7WC 2DQUL 2ICEB 4UQ3B 4DZBA 1HXYA 4ZS7H 2G5BB 4JFFE 4QY8B 1YEKH 2P24B 2JK5B 3H42H 2JB6B 1U3HD 4ZUWB 4NUGH 5J7CC 4LCIL 4LCCA 2YN3A 3UBXB 5TQ0H 2VR5A 1NSNH 1NGYA 3QWOB 1T6WA 2Z4QA 2OMBA 3CPLB 4NSKA 4OM1L 1KT2A 2AXFA 4YE4L 1RIUL 4F9LA 5HGAB 4WW1B 1HZHL 3B8SA 5CJOL 3TZVA 4PREB 1NAMB 4L8DA 4ODXA 4TVPE 2ESVB 2GEEA 4M1CD 1D6EA 4PUBL 1LQSR 4OBRA 1Y18B 2Z31B 1HHKA 5IBLD 5IESL 3MRPA 1QBML 5ILTL 1CIUA 3D3VA 4OLYH 5CINH 3AMKA 4JPWL 3F7VB 2P45B 5J6HA 1K4CB 4X9IA 3G6AA 1G9MH 1KCRH 3PQYB 1AGCA 2CLZA 4KHXL 1N6QH 2BNQA 3MRDA 5JPNB 5FCUL 1MHCB 4PJ7A 3I2CH 4GLRI 5HYJB 2BY3A 5L9DH 3B9VA 4C56A 4X5XB 4ODUA 4OGYH 5CILH 2RAMA 5CD5D 2CRYA 3UZQA 4EUPH 1I8LA 2NNAA 4ZXBB 3U30C 3KPOB 3S37H 4BUGA 1HWGB 3ULVF 2K7PA 1KB9K 2RB8A 4PJGA 2E6JA 3MJ8A 4N0UE 5FAAA 3P0YH 2ADFH 2VAAA 5I18H 2NXYB 1GJIA 4UILH 1IC4L 3OAYH 3MX0A 4NRYB 3OJDA 1QFHA 3QULB 5BS0D 2C7UB 5C0RL 4QHNB 4PG2C 4F7PB 4EUPA 1A1MB 1I9IL 4Q6IA 5JR1H 2J8UF 5C07B 4KKCD 1BX2A 2VLKD 1TVHB 3H9SA 4FG6D 2R8SH 4XVTL 3RRQA 4RGND 1P5VA 3VXTA 3V4UL 1I7TA 2DI9A 4JFYB 4ZNEE 4QWWC 3RGHA 5E5MA 3N06B 4Z78A 3GK8L 1GC1H 1CFTA 3PHQB 2GT9B 2W65B 4GUPB 4XGZA 3VWJD 3U0PA 4PJCA 3GFUA 4X6CF 3L5XH 5IEHA 2YUVA 4LPXA 4X4YB 1YPZB 4P3CL 3S88H 5DYOA 5F3BA 5I6XB 1FZMA 5IF0A 1JPGA 5E6IC 4P5TA 3IDJB 3TVMB 3W9EA 1ZT7B 4E5XB 1MAML 3BKML 4PJEA 3F8UB 3VFTB 4O00A 3T0EE 4LDOB 5F72S 3ARQA 2YUWA 2A74A 3TNNA 3ZLQC 4C83A 4H0HB 4ZOAA 4KDVA 5D7LD 3MJ9H 5EC1A 2VE6A 4ZFGH 1Z3GL 2BVQB 1FAIL 4IIQA 3DTXB 4EN3C 3GSVA 4KI5F 4HDIA 4LFHG 1A7RH 1NFDA 1BEYH 1IM3B 1FHGA 1IGFL 1BQLL 3N1GC 4EKXA 4ODVH 1FE8L 3MOBL 1SHMA 1UJ3B 1H3TA 3FAXA 3MJ9A 4GXUN 3QDMA 5SWSD 5C0EB 5GRWA 3X14A 2AJSL 2FEDC 1V3LA 4U1IA 4MA1B 3FTGA 1Q9WB 5HVWA 4XMKH 1OSPL 4XBGA 4G8EB 4NRXA 4X0KA 3R0NA 1R0AH 3T4AA 1V05A 1CE6A 1HKFA 5FOBA 5BVPH 1KN4H 3VJ6A 2QV2A 3M8OL 2EZ0C 3VRIB 4HJGA 1SBSH 1K8DB 1DL7H 4QRSB 4QTHB 4MGXA 4PP1D 4PD4K 3MLZH 5HGDB 43C9A 3C9NB 1MJ8L 1MCDA 4ZD3L 3MUZ1 3WLBA 1A6ZA 5IQ9B 1IM9A 2E27H 1NFIB 2AJ3B 1G6RB 1A1OB 3HG1E 4I3GA 4WV1C 1T0MB 3MQIA 4CN4A 3CNKA 4ZS6D 5IKCA 2OZ4H 2V5SA 3CZFB 3PE9A 4OCNC 3HRZA 5DJXB 3C60C 3WNNA 3VFWB 2CIIA 4MJID 4KKBC 5C0JA 2GTZA 1CE1H 1PY9A 3MRGA 1NCDH 3MV9E 4RX4A 3X12B 1JYNA 1ZEAH 4BA8A 5IFAL 4JO2H 5IJKC 1EBAA 4S1RH 4FTVD 5H94A 3GUTB 3QDJE 1NMBL 5FHAL 3WNPA 1Y6NR 1MLCB 1B0RB 3HZMB 2OZ4A 3BKJH 3CVIH 3ZL4H 5D1XA 2NY4D 4K7PY 5I76B 1JTOA 3LKNA 4PJDF 3STZB 5FDWA 2YPVH 5JOEA 3C8KA 3KS0J 5DVKA 1A7QL 1IFHL 4NQEB 1FNEA 2F5AL 4JHWL 4NKIH 5CGMA 3D0LB 3ALPA 2OCFD 3K8KA 5T1KD 3DARA 4WUKH 3OKMA 2AV1A 4P4RB 4NJAL 4PRHB 2V2XA 6FABH 1BFOA 4NKDA 3W9DB 4NN7B 1WVZA 2B2XH 3GSOA 2CO7B 3DO7B 1FRGL 4FABH 1OPGH 4I0PC 1T66D 4JFEB 3C6LD 4X98B 5HGHB 5IW1B 1M7DA 3CFBA 3IFOA 4G9FB 4WU5A 3MLSL 2UWEF 3R06B 2EIZB 4PRPA 2D0HA 1MJJA 3K81A 1TMCB 3LY6A 5ENWA 2DLEA 3LSOA 3QI9D 4DGYH 5DD5L 2VABB 1IAMA 1MFBH 4WI5A 5INDB 1VFOA 4FMKA 2WLZA 4FQXD 4I9WE 4PRIB 1CLYL 2WBWB 1N8ZB 3VXUE 2F74A 5IHZA 2VDLL 2DKMA 5KSAD 5C92A 2AJUL 4JRWA 5BO1L 4JRXE 1I3UA 2YD9A 4TQEL 5DC4B 2F53A 5DJCB 3CFKB 3V0AC 4HIJA 4LU5L 4YGVA 2HT3D 3O3BA 4I1NB 3EYQD 1ADQL 3MBEB 4LGSB 4UT9L 2ZG1A 4V1DE 1WUNT 4Y4KA 1VHPA 3O6FC 4X7SL 3FFDB 3KYMA 3V4VL 3OJVC 3HRPA 4XZUB 4KTDL 5D1ZD 2XV6B 3VGFA 1YEFH 2IPUK 5E8EA 4FZ8L 2ADJA 5DJDB 1KUMA 2H3NB 3QDGB 3B9KC 1V3MA 4MA3A 1CLOH 2AJXL 3OF6D 3FL7A 2FL5B 3RGVB 4HJ0C 4WHTA 4DW2L 3DX8B 3CX5J 3LKPA 3QWRD 2NW3B 1U93B 4JFDA 1W0VB 1W8NA 4AIZA 5BRZA 1X5IA 3VH8A 4XC1L 4FNLL 4UIKL 1F3JB 4J3XA 3D9AH 3BD4A 1JGEB 3V5KA 2VIRA 1QNZH 4QRTA 1S78D 4HUVB 2A9MH 3CMGA 3HI5L 2MNUA 5ALBL 1M4KA 1JBJA 2O5XH 3GKWL 4Q2ZB 4KK6C 4LSSL 2GUOA 1YYLL 2FNBA 3VFPA 3KLHD 1MFAL 2QBWA 3QUXC 4JHAL 4WO4A 3NIDF 4RMTA 3S3PA 1ZLSL 1GZPA 2QSCL 3RL1B 4GSDL 1I9RL 3ARED 4KWUA 4L3CB 1A64A 4GLRH 3W39A 5ACLA 5ID0A 2D31A 4HUKB 1MVUB 4LK4A 4WI9A 2VDKH 3QUYA 1DBBH 2ZCHL 4OAWA 5DDHA 1LEKA 3DBXA 3GMQB 5GGTL 1HSAA 2R0WL 1TNNA 2PR4L 1A6UH 4YDVB 4HUUB 4LCCC 2YD2A 3JV6B 1J1OH 3UPRB 5F3HA 1JHKH 2YD4A 3P73A 4HLZH 5D4QA 2XRAH 4YHZH 3VFMB 4Z6AT 4WCYL 2ZOLB 2YPKA 2I24N 5I8KH 3QQ4A 5ANME 1PKQA 4TRPH 3PWJA 1CF8H 2GJ6D 4YWGL 2WSKA 5DLMH 2SEBB 3TN0C 1U58B 3E8UH 4P2OA 1U8KB 3NZHL 3T65A 5E8PB 3CU7A 5IBUG 1AGDA 1KPUB 3D25A 1FORH 2NY0D 2VNCA 2WBKA 4K9EH 4U1MA 2JJWA 4XC3H 3CK0H 3QFDA 5I1DB 2EKJA 5DJAB 4XT1C 5E9DA 3RPIA 1A1NA 3T0DA 4HS3A 4A6YH 1ZHNA 1UKQA 5EZLB 5F9OH 4L8BA 2D7MA 1DUYB 5LKNA 4HWZA 3BDYL 4XMPL 5A2KH 3NGBB 2NTSP 3TA3D 3DYMA 1EGJH 1H3VA 3DI2B 2IFFH 5CUSH 3P4OA 3MLWL 3PQYE 3GSWA 1I8LC 1X6LA 4R3SB 2EDYA 2IANA 1LMKA 1K2DA 4CMMB 1G9MC 4ZUTB 5I66B 5HYJE 3LRGA 5B39G 4A6YA 3QNXB 5B21A 4M61B 1HKLL 3LMJL 1WF5A 4XHQA 3KDMB 2NXZB 4K3GA 5LWYL 1S7RA 5JXAH 5AAWA 1EGJA 5INCA 3TBYA 5C2UB 4Q6IC 3RA7L 5I16B 4HX1B 4KHTH 5C0AA 2FX7L 4N5EC 5DFVD 1VACB 3WFBH 4X6DE 2AAVA 2Y25A 3KJ6H 4Y4HC 3V4PH 2BOBA 4JVUA 2EIBA 5CZKA 2LVCA 2Q3AA 5C07E 1EHLH 1A6TA 4F58H 3QFJA 3IDMA 1QFUH 2UUDK 4NM8H 4AMKL 2X05A 2FCBA 4CBPA 1UB6A 1MCSA 1WEJH 3VD9A 4P5TC 3SO5A 4NBYB 2Q7YB 5EU5A 4PS4L 1OAYL 1X9QA 2ICCA 2IQAB 2C3WA 5C09A 4YXKH 1GC1C 1S7UB 5C0ND 4OZIB 4U6YA 4XCYB 4HMDA 3C5JB 4G6ML 3FB7A 4LASH 4JRYB 2DJSA 3IGAB 4XXDA 4IIQC 5AUMB 4YHYB 4P59L 1IQWL 1GGTA 5SX5H 5I19H 3GJFK 3DX7A 5TH2A 1L0YA 3PWUB 4OM0L 1AQDA 3FZUC 2NY3B 3BP6A 2VL4A 2VDPH 4NZRL 5EOCL 5E8OA 3TFKC 2R39A 4LIQE 2VR4A 1AKJB 1C08B 1W2KT 5A2IH 3IFPB 1GHFH 5FO9B 1SVCP 3LRSB 4HBCH 3CFEA 4JDTH 5ISZB 3MRLB 4K7FB 3WKML 1RZKH 5A43C 4M8QA 2YRLA 3MNVB 4CVZA 1Z6JT 4ZTPL 2VXVH 2QKIB 3L5WA 3L1OH 3ZE1F 2VQUA 1QOKA 2EECA 1OGAD 1RK0B 2FIKB 3FONA 3E3QE 1WBYA 4UU9A 5GZOD 3UTTD 5BV7B 4QTIL 4G7YH 3IFLH 1GOHA 1S5IH 4RAUB 5JOPE 1FP5A 3GKZA 2A83B 5JO5A 4Y16B 3QZWG 5FYKL 4IM8A 1SJXA 5JDSB 3D18A 4HFUL 4BSVB 4ZFZB 3FO0L 2V2WB 3GMNB 2IPTH 5D71H 3V2AR 1KPRB 3BXNA 4YFLI 4LLMA 3LKRA 1X5AA 4MAUH 5BOPA 4FQHA 5DTFA 3ZHLA 3WL9A 4HKZB 4APQA 5ADPH 2G5RA 5AZ2L 3PDOB 4OI8A 1AP2B 5J11C 2H32B 4K3DL 3DGCR 3VFRB 3L3JA 2CJUL 4G42A 1EA9C 3QYCA 4H8WL 3GNML 4HH9B 5JW4R 1FG2A 4XPBH 1ZHKB 2OSLB 4U1NB 1FFOA 5ETUA 5EIQA 1NL0L 2R56L 1MQKL 4LLUB 1GRWA 4WTZA 4X4MA 1I1AB 4KJPC 3S5LA 4CVXA 1U3HB 3QCTL 4XP6H 4M9OA 3NZ8B 3MV11 3HC4H 5DA0B 1RZGA 1AH1A 2Y5TA 4KV5F 5EO1A 3LZFL 3HFMH 3U36A 1CS6A 1LK2B 1C5CH 3GI8H 5FGCB 4PRDB 1J1PH 3H7LA 5E8NB 2VTFA 4BK5A 2XKNB 4OBSA 4QRPA 3IS0X 4NQEE 4Z18A 5KVFH 5DI8A 4AJ0A 2NR6C 1RZ7H 3ALXA 3IYLW 1KFAH 1L9NA 2FJGB 4L5FL 5FYJU 1G9NL 4NKOA 3BGFC 3P11L 4JY4A 1MH5B 2VO5A 2AK1H 3FQNB 1MPAH 5C0BA 4P5KB 1ACYL 3GI9H 4PRHE 3RWEA 2A1WL 4BH7B 3ZZ1A 2X4UB 1BMGA 1EO8H 4KUCD 1OM3H 4IRSB 3I75B 4MJ2A 4JE4B 1I8KB 4LLYB 1ZHBA 5M7QA 1KNOB 4G9FE 5HD8C 1VGEH 1XGQB 5E70A 5DJYB 3GBML 4HULB 3SE3C 2FYYB 1FGNH 5IROC 4JO4L 1UKSA 1YJDL 3IF1B 4YUEL 3SE9L 1BBJA 2VITB 3CXDL 2FH8A 2IBGA 4YXLH 4NOFA 2NZIA 1U42A 3BKCH 3OKKA 1AGBA 4PRIE 3F12A 4LEXL 4JREB 4LAQH 4XCCL 1WC7B 1GSMA 5BS0B 3MRFB 1B88A 4LQ1A 4TSAH 1S7VA 2B7DT 4G43B 3VXRA 1T03H 3QG7H 4S1SH 4WFGE 5L6YL 1HXYB 4FQCH 3C2SA 1AY1L 4PBXA 3V79C 1Z9OA 2PYED 4ZUUB 3FCTA 2XQBH 3SE4A 3VWJB 2B5IC 2Z4QB 4MQ7B 4NSKB 2LTQB 2ERJC 3WFCH 2OL3A 1KT2B 3KVQA 1JWUA 3A6OA 4HWBH 3QDGE 4JCMA 5DSCB 4RFOH 4ELMB 3TZVB 1L7TL 2OR8A 4KGLA 5I15H 4L8DB 3BZEB 1G7LB 2X9YA 5D7LB 5SWQA 1K3IA 1TIUA 4K94H 3KPMA 5IOPB 4WO4C 1IGTB 1N7MH 5HYSA 4HWBA 4KZDL 4FP8H 5HHVL 3SKJH 5J6HB 2P8LA 3G6AB 2CLZB 3DVGA 1QPXA 1EHXA 3QUYC 4J7RA 5DMIH 2X4OA 4J8RA 3MRHB 3A6BH 2R4RL 4PB0L 4XTRD 3REWB 1J9CT 5SWSB 1WWAX 3GB7B 1WISA 4FFWC 4PY7A 4X80H 4XAWL 1QFPA 4PJGB 3WBDA 3MJ8B 3RVVC 4HFWB 4POZD 1RMFH 2VAAB 4MZ2A 4P2OC 1YEDA 1NKRA 1TJHH 3MRKA 3BI9X 1TQCB 4EUPB 2XN9D 2H8PB 2VWEC 2DQHL 5TJWK 1IGIH 3IJSB 1BX2B 2DB8A 3EOAB 3D1MC 3QHZH 3DXAD 5DXWA 2MHAB 3K1DA 2BHZA 2F8XC 1IAIL 3BP5A 4GAYB 1I7TB 4HCRL 4M00A 2AGJH 3QIUD 5E5MB 2B1AL 1CFTB 3T3PE 2I07A 1QLEL 2QJDA 3ARFC 3T1FA 3CIQA 2CKBB 5IEHB 5J12B 3CVHL 2K3TA 4ZDHA 2WP3O 3ECBA 5ADOL 5JZ7D 4C59B 2MOVA 4FTVB 5J6GA 3RAJL 5CD3B 1T3FA 1KB5L 1FYTD 3DNKA 1FZMB 2V5RA 5IF0B 2QQKH 3W9EB 1FFRA 3NCYS 1F58H 1GGBL 3NABL 2ZUQB 2NY4B 1H3PL 4JY6B 4C83B 2AK4B 3Q6FB 5I75B 1UM6H 3RNKB 3X3FH 4S2SA 5T3ZL 4EBQH 2E8ZA 1F3RB 5TDNB 4GKOA 3Q5TA 2BJML 4HS8H 5ALCH 4HDIB 3FN0H 2R1WA 3SDCA 5I17B 3IKCA 1BD2A 1NFDB 2R4SL 3H3PH 2X1WL 4LVNB 5IQ7H 3AVEA 3MFGB 2XTJD 1CDHA 2RCSL 3MRBA 4RDQG 3MV01 3D2UA 1DANU 2GK2A 1SY6H 4RWHA 3GJFB 4TOYH 3PP4L 4AEHH 3QDMB 4Y2OA 3SBWA 1JRHL 1AC0A 3QEUB 1MREH 2OJZH 4XNMA 3KPRA 4FQJH 4FQ1H 2VDML 2E9WA 3C6LB 3LQMA 3GSNH 3NCYP 5HI3C 5L8LB 4X0KB 5CMAA 1DN2A 3T4AB 4MB3A 2X89D 4U3HA 3K4AA 3LHPH 1HILA 3KYKL 3QI9B 4HJGB 1OP3K 4IOFD 1AIFA 2CPCA 1SY6A 4XP5L 1MRDL 4KDTA 1F4HA 1XFPA 1GVIA 3KAAA 3WLBB 1YQVL 2P8PA 3KPSD 1A6ZB 4V2BA 3GSNA 4P9MH 4OFPA 4XPFL 3STBA 5KSAB 1QUNA 2RBLA 4OZFH 4OZIE 2BSED 1K5NA 5IKCB 3OAUL 3HZVA 1FAKT 1H8NA 1PG7L 4JRYE 2DQDH 5JW4M 3MFFA 2DQCH 1T7ZA 3UYRH 3DRTA 5C0JB 4OSUL 3V8CA 1D6VH 4OLVH 1AE6L 5F88B 3RWCA 4MYWB 3BH8B 5MEND 5H94B 4OZ4A 5E5UB 5T3XE 3TNMA 4NNYA 1OWWA 4OZFA 1A3QA 1IBGH 4K7PL 1JTPA 3DI3B 1MAKA 4OD3H 5D1ZB 5DRWA 5D1XB 1LD9A 1KLGA 2EXYC 3Q3GA 3TPUB 5ISZE 5E08H 5FDWB 5DURD 5DMGC 4UZGA 1CXHA 12E8L 2PETA 1FNEB 5FIEA 5D9SB 5I1HH 1Q38A 1RZKC 5DRNA 4J12A 1G9EA 4NQSB 3FKUS 2DQFB 4Y88A 4OCWH 1DBKL 2FB4L 4EDWL 2Z93B 1K6QH 3TT1L 2AV1B 2WUBH 2FR4B 3WFHA 5IVZA 4JLRA 1B9ZA 4WVRA <