3MU3A

Crystal structure of chicken md-1 complexed with lipid iva
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
EWPTHTVCKEENLEIYYKSCDPQQDFAFSIDRCSDVTTHTFDIRAAMVLRQSIKELYAKVDLIINGKTVLSYSETLCGPGLSKLIFCGKKKGEHLYYEGPITLGIKEIPQRDYTITARLTNEDRATVACADFTVKNYLDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Protein MD-1
publication title Crystal structure of soluble MD-1 and its interaction with lipid IVa.
pubmed doi rcsb
source organism Gallus gallus
total genus 30
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3mu3A00
3VQ2C 3WEAA 3VQ1C 2E56A 2E59A 5IJBC 2Z65C 5KWYC 1WRFA 2HKAA 5IJDC 3MTXA 2F08A 1XWVA 5IJCC 1NEPA 1A9VA 3T6QC 1AHMA 3M7OA 3ULAB 1KTJA 3WEBA 4G8AC 3RG1C 2Z64C 3FXIC 3B2DC 3MU3A 1AHKA
chains in the Genus database with same CATH superfamily
1PZCA 3B2PA 4M03A 3IDGA 4PJEA 1BHGA 1A1OA 3NQKA 1AFVH 1N6VA 1UM5H 4G9FA 4GAYB 4KKAC 2QSVA 5CJOL 1JXFA 3BWAB 3Q3GB 3V2AR 1WUNT 3HZMA 5IW1B 2W5PA 2XRAH 4U6HA 3PL6B 3TA4D 5JPMA 1FL5A 1JMXA 1BQKA 1CXLA 3GIVB 3UTTA 4AK1A 4BSVA 3T0EA 3ASNB 3U7WH 1YSOA 4HV8A 1UT1A 5IMOA 3QPKA 5FCUH 2EDTA 7PAZA 4WV1B 2XWJB 2FO4B 4KTGA 4FYTA 2YEZB 2B39A 4UM8B 5AZ2H 3QR0A 2E46A 4FN0A 4KZ0A 5FK9A 1EAJA 4NWTL 3SDXB 2AC0A 3UAJA 2DLFL 1XL4A 2J12B 1S3KL 2UY6A 3D51A 3RTLA 4F7MB 2EC9U 3DYPA 2JCCF 1N9PA 1JTTA 5CZRA 5GRUL 3GJEB 3WNIA 2VN5A 5JHDE 1JDCA 1S9WB 4M62H 1OL0A 4RGND 2GBAA 3CDGA 2XY2A 4Q8BA 3T71A 3WOVA 2FL5B 3PWVA 1G6VK 3KYNB 3V79C 2OSLB 1LO4H 3CLFL 3B3IA 1HHJB 5DHVB 3MCG1 4HPYH 4M8UA 3IDJA 3KVDD 1GYUA 5IGXH 3G5ZB 1CD1B 1NIAA 5C0CE 4UOZA 2YARA 4MFHA 1IC4L 4MS8D 1NEZG 1A2YA 2ROYA 5KEZA 5IK3A 1V55B 1OPGL 2CLZB 1XH2A 2W94A 1UCBH 1LE9A 5KW9H 1QO3B 1WUZA 1CLOL 5DMIH 4GEJA 4B9YA 4ZAKC 1IM3D 3SY0A 2XTJB 4M93C 4OT1L 1ZVYA 4IMKC 3VFRA 4MYWB 3RDTD 3ARBD 5JA9A 3UGXA 4X8GA 2GIXA 1WSST 5CLWA 3TEUA 4A55A 1MVUB 4UQEA 3S5ZA 5MHSE 4OGXH 2F18A 3J07A 4AGMA 1AZZC 3GMLA 1MCDA 3VGAB 4F92B 4E5XB 2H6PA 5F9WB 1QWUA 3LH2L 4KPHL 1RJZA 2XLLA 3F12B 2JK5B 4PRPD 5F88A 2CO4A 3CDYA 3I50H 4F2MA 1IAII 2GK0A 3B5TA 4M7JL 3VMNA 2HLFD 1C16B 2OP4L 1VDGA 4XMZA 5IFJA 4FTVE 4HIQA 3N43B 3TC9A 4KH9A 1XCTB 4XO5A 4CJ0A 1SQ2N 4M7LT 5DYFA 3NJIA 3QXUA 1WT5C 4K7PL 5JHMA 3TTSA 3SYQA 1CFVH 4CNIB 2W65A 3CBJB 4JM2C 3FHAA 3EO9H 5FYLL 3SPCA 2QMKA 3L8QA 3CFJB 5CBEA 1U8IA 2XWCA 2NY0D 4OD2A 3GSRB 3MUZ1 5B8CC 3ARUA 1AY1H 1LJMA 2BOBA 1DO5A 1PKQE 1NH6A 5KVGE 3BT2H 2OMNA 5K9JL 3PPEA 4Y19E 4FXGC 4LARL 3CHOA 1RP8A 2ZJSL 4ZFOL 4I2XA 5BVPL 4X5WB 4URTB 4KK6D 1YQ2A 3B43A 3GXMA 4P05A 5IMKA 4Z0XA 3F7LA 5ITBL 4HMDA 5D9SA 4WKZA 3K4DA 5FW8A 1P7BA 3C2SA 5ALBH 3SQBA 4F20A 1LHZA 4L4TB 3BVVA 1ET5A 4WW2B 4GKNB 4QTFA 3V6FA 5I76A 2IPTH 2X1QA 3L7EA 3CX2A 3EIFA 2WVVA 4MJIA 3SO3B 5JYMA 1I1AC 3O3EB 3B9KB 4U1KB 2WLJA 4EIGB 5HYSA 4DZ8B 3IJSA 5LG6A 1NAMB 3EOBA 3B5HA 4TTDC 5D2NC 1IEHA 3WDJA 1AQHA 3PU7A 1BOYA 5AW3B 1MHEA 2QZQA 5HHNB 1OP5H 1LQBC 4PJAF 4LKCB 1O7VA 1FNLA 2NQDA 1EMTL 2Y2WA 4HPOH 2MFNA 3F7VA 3GNMH 1SUJA 4J4PD 1O6VA 4YSDA 1CGWA 2HRPH 1NCUA 1QX1A 5F96L 1C8PA 1S7SA 1W80A 3UCRA 3BLKA 1NINA 3KBHE 3TBSB 2UXFA 2VQ4A 2BOLA 4K5LA 4FQ1L 1AD0B 4LGSB 4PV1C 3HNSH 5J6GB 1YECL 2QSTA 3O2VL 2ETWA 3KWVA 3RPBA 3PWPD 4WIQA 3PFUA 4CSSA 2E8YA 5F0MB 1RSFA 3QJSB 4UT9H 3CC5A 4JFEB 4KMLB 1JS4A 3QZWG 1VFUA 5FO7B 3FH7A 3ZDZE 3GK8L 4M6ML 4NO3A 1AC0A 2DQDH 2NY2B 1DEDA 2UY7A 3EG9B 4UQ9A 2WN3A 4CN1A 3OAUL 5BZWA 1IBDA 2K45A 4OZFH 2HX9A 4HUCA 4NM8H 4G8FB 5AB0A 2WKGA 3PREA 1YNLL 1PAZA 4OH2A 4X5XB 5DHYB 1GZPB 5ALCL 3S96B 2XG4A 3MTRA 1FDLL 1Z5LA 1A6PA 3RPKA 1CLYL 3L3GA 3WO3B 3E6FA 1SJXA 4JY4B 1X5XA 2X40A 1QMUA 4G80A 3POCA 2YSTA 4FL4C 5DD3L 2VIRA 4L8CB 1D7CA 4M5YH 5I1KL 5KTEL 2E7LC 5ICYA 2V17H 4M7KL 2C3WA 1KJVB 2IPKA 3FCUB 3RVUD 2H32H 2PWGA 4O51B 3TBVB 4C56E 1AKPA 4OLUL 4DAGL 3C60D 1J1XL 3L17A 2FSEB 4FXKC 2FBRA 3UBFA 3W82A 1YEEL 1TNMA 4UT6A 3RX9A 4DQAA 1OCWH 4H1LH 3BFQG 2WIIA 4HK0A 2G3ZA 3RU8L 1ID2A 1QFUL 2ZOKA 3ESPA 1AYOA 1UEMA 4C83A 4OQTH 2N7SA 4L1TA 3Q7JA 5F7DB 4XNZB 4U4IA 3MROA 2CBMA 2C3VA 4XXCA 4O9HL 5FHAL 1R5WB 4GSRA 3BAWA 3TWCL 3HN5A 2G3NA 3P4OA 4KQ3L 35C8H 4MD4B 4ZPTB 1BQHA 2Q86A 3RG1C 5HP5A 2J57A 4LKXB 1JNHB 3ROOB 2XQBH 5D6CA 3VQ2C 1GA2A 3ARZA 3UC0H 1AGBB 2R1YA 3GI9H 4Q58C 3I75A 4HC1A 4FX5A 4IK6A 2WKOA 2B08A 4NQCD 4QNPF 3VFPA 4AQAB 3N9GL 5C0EB 4W6YB 2DDQL 4UBDC 5D7KD 3CAFA 1KXQA 3EGSA 4IBSA 1D9KA 3WFHA 4MA1B 3MV9A 5TFSL 4F33A 1KSRA 2ZXQA 3VH8G 4OSUH 5E8PB 3GMNA 1XAKA 4CU8A 4JO3H 1UQSB 3RBSA 4EVNB 5AL8A 1XF2B 3WMQA 2Y3AA 4L4JA 5BO1H 5TF0A 4XPFH 3KJ6L 1DQKA 1A6UH 3FAXA 3GMMB 2D03H 3T3PE 3IU4L 3ARDD 3HPLA 1T03H 2BWQA 5DSCB 1V7MH 2VW6A 3DUHA 2Y06L 4HBQA 2MKLC 4TL5A 4HIEB 3L3IA 2YGVA 1SJVA 2YAMA 1SJHB 4XPGL 5I1HH 2BX5A 3QDJD 5CLYA 4OGZA 2C4FU 1E4KA 5D55A 1S78C 5DJDA 3QDHA 3C6SA 5KSVB 1QRNE 3IU3B 1J8HD 4L23A 4DEUA 4B9FA 4LSSL 4PS4H 5GS0L 4D9QE 3I6LD 4G6JL 3D8MA 4PJGB 5H94B 1FORL 3UZVB 1DO6A 4PBVC 4EDWL 4AQOA 2COVD 4NUMA 1F18A 3VFOA 2ZKYA 3MKKA 4B60A 1BBDH 1OAQH 3QEHB 3MLTA 2YAQA 5E99H 4TUKL 1ECYA 3VXOA 1RHHB 4KDWA 4OJAA 5H8DA 1MFCH 4UB0H 3D3VE 2PKDA 1CO1A 2C1PA 3VFVA 4Y16B 4NIYE 3IKCA 3IS0X 3K8LA 4IS6B 4CMHB 2VC2L 2KDYA 4NI3A 5EU6E 1FFOB 4MMXB 3H3KA 4XPAH 3DGGB 4KI5C 5DJCA 2BCKA 3TN0C 3CHXA 3TP4A 2AGJH 4YBLB 2F2HA 1S7UB 2P46B 3OXSB 1N5YL 3ULVL 3QB7C 5G4OA 5KBNC 3B7TA 3L3KA 3VWJD 5IIEA 2BC4A 3QDME 4MJ6A 2H3XC 3PP4L 4K3EH 1MHCB 5CIPB 4YSSA 1NICA 2P7TB 3LX9A 4LCYA 5ADPL 1WICA 3MZTA 3MOBL 2A6DB 1DDHA 4PWIA 2Z8RA 4FG0A 3RNQA 1MCOH 2JJWA 1E2WA 3QEGH 4NJ9L 5J4MA 4E9RA 3M7OA 2F19L 1J0KA 5GGUA 4B5ZA 1KELL 5HI5C 3KEHA 1TZIA 4HD9A 2J72A 3AREB 4NKQB 2XN0A 1NBYA 4Y7OC 32C2B 1MY5A 5ETUB 3VXME 5JIIA 3F00A 1DVFD 4AZ8B 1INQB 1OSPH 1QI5A 5D1QC 3AQXA 3E9UA 1FV1A 1M05B 1TVHA 5CWSB 2YPLD 1ZGLB 1G1OA 3C87A 2E6QA 3NABL 1TTUA 43CAB 5I6XC 3INUL 3MJ7A 4JDEA 4H25B 1HH9B 2OW6A 1YY9C 2AJYL 4XVSL 4LHUG 3NCJH 4MRBA 4IEFB 4JQIH 4RISH 5E6ID 5IB3A 1RK1A 5LDSA 1KIRB 1Z3RA 3MRGA 2BK8A 5DMKB 1G7JB 4LL9A 5LWYL 2NYYC 1Z9NA 2AJZA 5DLML 4KX7A 5BRZA 4WSGA 5SWZD 1AGDB 5L4FA 4P5SA 5EO9B 1JF1A 1JPGA 2D3NA 12E8H 2WYHA 3CCHA 2G3MA 3BOVA 3F5WA 4LVNC 2PR9A 5DJYA 1GPOH 3OHXC 4JFWA 4P59L 4D9LL 2EKJA 2PABA 5EU4B 3QQ9D 1JK9A 4L37B 5I19H 2MCAA 1KFGA 5L2KE 3FZUD 2NRDA 4X7EC 2AQRA 4NXKA 4JO4H 3FTXA 2X4OB 4J12A 2VR9A 1RIUL 1ET8A 5K1JA 5LGYA 2ZCLL 2YKKA 3TZVA 4BQ8A 2W88A 1YY8B 2HFTA 3QO1B 4RGNB 3CIQA 5I8EB 2W9LA 1G5AA 3SKNB 4LSQL 1JPST 2IWGA 3GT6A 2P24B 2VLLB 5BMFL 2W07A 1GGIL 5H35B 5HYEA 4HGMA 1AE6L 4HW6A 3H1ZA 3C5ZA 3QAZC 4PP1D 5E6YA 4BGDA 5F21B 4Y5VB 4WEEA 3WDIA 1XGYH 4M1DL 4IKIA 4J39A 1SEQL 3TYGL 3EGXA 1UT9A 5LDUA 2DOCA 1X5MA 2XZAH 5LAXB 1P1ZA 2IWEA 4UF7C 1FFQA 2ICWB 4U1NB 2VH5H 4X8XA 1XGPA 2F8XC 4HU8A 4NO2B 5KZCB 1GZQB 1KLUA 1RURH 5IJKC 4YDNA 2YR3A 1WZ1L 3OV6A 2P48B 2JQAA 4ODSH 2F61A 4TTGA 3U1PA 3PHSA 4XNQB 3FO9A 4P9ML 3VVVA 3RIAF 1BJMA 4JFPA 4BZ2A 1PFCA 3HPJA 4N9OB 4TS6A 5IESL 3QRGH 1QUPA 2V9QA 5H4YA 3S3JA 1J7VR 1KBPA 2IANE 4OTXL 4E42B 3O2DH 4NAJA 2D2CC 2EZ0D 2MJWA 2VDLH 5JW5A 1D2OA 4K3JH 1BGXL 4ERSL 1TTGA 1YYML 2B1HL 2F7RA 1MRFL 3ZT5A 3BD5A 2AI0H 4TOYH 1CVSC 5AOLA 2GY5A 1X7SA 2J6EH 4X4ZA 5F7AA 1FL3B 4WWPA 5ERWA 5GS1A 2DEXX 2YZ8A 1YNKH 1DQQA 4Z7VA 2JV6A 1UWFA 2F74A 3KL3A 3RWIA 3SDCC 2BWIA 2ZUXA 2BSRB 1JXGA 2IADA 2DY2A 2NY0B 4NQEB 3CLWA 5KSBA 1WZKA 1JZJA 1QFPA 3ULSB 2L4OA 1TZ8A 1RJLA 2QADD 4RSVA 2WJ5A 1X5ZA 1HINL 2RAMA 4WJKB 3E2HB 2XN9E 1NGPL 2BIOA 3L2MA 4TSBH 6PAZA 3RTQC 3U36A 5MP6L 1LK3L 4NIKB 4QRUA 2GHZA 2YUXA 4FNPA 5FXCH 3HN3A 3O4OC 2ZPKH 4G7YH 4L1HA 4MKTA 2JWYA 1MI5E 2RALA 1KCBA 1AJ7L 3FQWB 3FC8A 5FECA 4MMZC 4AXWA 2H1XA 2YFOA 5I5MA 3JTSB 4NKOA 3IM1A 3MLVL 3P54A 3L3OA 4FZEH 1RZGB 4NUGH 1SMDA 1CLZH 1SOQA 3ZT7A 1T1XA 2X44D 3BGAA 5EO0B 1BXUA 5LGJA 1KPRB 2DTML 2LVEA 1D5ZB 4LLMA 2XC8A 4MA3B 5BXFB 3SYCA 1XD1A 4XP1L 1JV2A 1WIOA 3LD8B 5F8QC 3RA7H 3VH8A 2VDPH 2Y07H 1PSKH 2KBGA 3VXRD 4ACTA 1R3LB 4FNRA 3RI5K 3RWCA 4CSPA 1BVZA 3WUWB 3P0VL 2A83B 2NUTB 3RWHB 4WNQB 3FHQA 3M45A 3N85H 1ZWIB 1IGML 1CICB 4FQIH 3PL6A 1KG0B 4DFIA 4IBUA 4ZYKB 1K4CB 1NSNH 4E9QA 1BVLB 4P8QA 1P84J 2EDOA 4BFKA 4GLRI 3T4YB 1UADC 3WKPA 1KF9B 4NBXB 2XWJA 4GG6E 3PHQB 2FO4A 4AG4H 3SQOL 2D3LA 3AU1A 2YEZA 4UM8A 3LY6A 1W0WB 1DBKH 2H26A 4LCWE 3SDXA 2Z31C 4F8NA 1WBZA 1TEGA 4UM9D 3W2DH 5AAMC 4YHYB 2XKUA 2XN2A 5EG6C 4L9LC 4NPYB 2X3BA 4YXKL 1Z5YD 3FOLB 4OCWH 3ZTJG 3O8XA 3OX8A 2R0KL 2VERN 4NO0B 4CU6A 4HOXA 4GG6F 4H5SB 5JOEA 3J7HA 1GGCH 3HAEG 5TK2A 2RCSL 2VZ1A 3GSQB 4OF3A 4OV5A 2NNAB 2FL5A 5SV4A 4DOHE 2A5UA 1C5CH 2VERA 4E0RB 2OULB 5DHVA 3S37X 1JWSB 1D2PA 2VLJA 4X98B 1OF2A 5IROC 1JV5B 1J0IA 1A7OL 2CM6A 2J4WH 3EYQD 1RULH 2IBGA 3S36L 1G9ML 4A7TA 3KH3A 1U8KB 1YJDL 5D7LD 3IGUA 2CZNA 2AV1B 5AEAA 2KLRA 2CLZA 1JZ3A 3T4AC 5D7EA 5I1CH 2RGSA 4YXHL 9PCYA 1BDYA 4XN2A 3GUTB 3UP6A 1I8MA 1BMWA 5D7JA 5FYLE 4OVUA 4N5EC 4ZMVA 4CAGA 2HT3D 3GDCA 3WNLA 3RIKA 5I17A 4AYDC 1FE8H 5GGSY 5E24E 5E2UL 1CU4H 3H55A 3SD5A 1P53A 1ASOA 1EBAA 2MPAH 4POUB 1G7LA 2ZXBA 3VXTA 1I9IH 3PJSA 5K9KB 1XX9C 2JK5A 1TTAA 2CAKA 4S10A 3UJJL 3BDYH 5IEHB 2EINB 4HEMA 4L3ED 3RWDB 2CMRL 3C60B 4EKJA 3HA0A 1F3DJ 5E8EA 1C16A 1FLTX 4QLRA 1T1WB 3T0EE 3QUMB 3UTTE 3W11C 1U0QA 1T66D 1DLFH 4FFVD 3TV3H 2IAMC 2Y36H 3WEXA 3K8KA 4WNSA 3WU1A 4ODUB 3U7YL 3VXNB 3CBKB 4DKFL 4FMFA 3H3PH 2YBRB 3CFJA 5FUOH 4JFYA 3CN0A 1F3RB 3GSRA 1P69B 4IIZA 3WJJC 4Z95H 1DVSA 3H9SE 3SKJL 1FHNA 1MAJA 5DZAA 2ZUVA 4IIQA 1F86A 1E4JA 4LRIC 4X5WA 1C12A 1O7SA 4AEHL 2PYEB 3P2DA 2Z34A 2NXYB 2RJMA 4MA8L 1IAIM 1Q1JL 3BN3B 4N8VG 6CGTA 5F9AC 5ANMA 4K7PY 5KOVC 3VD5A 4LFHG 3TVMD 4L4TA 4FP8H 3X3GL 4YC2B 5FPIA 1K3IA 4A2EA 2H2SD 1XGRB 5BVJA 5C0IA 1MAML 1Q1PA 5FV2A 1AXSB 4FC3E 4X5PA 2QDVA 3HFFA 3B9KA 4U1KA 4QUOA 4XWOC 4JG1H 1AP2A 1KTLB 3KVPA 4DZ8A 2ZG1A 3N04A 3ARDB 4L1LA 3MRFB 2FX8H 3AMLA 4P99A 5I6KA 1KC5L 3QNYA 3EBGA 3PNWB 4KTEH 4D0BB 5FW6A 3RL1A 4KQ4H 5I74B 4HLJA 1KIUB 2BDNL 1CGXA 3QDJB 3PWLA 1LEKA 2R0LL 3PAYA 4J3BA 1RJCA 3KLAB 2KLSA 5L7XH 5DUMH 4RFEB 2PPCA 4OZHB 1I8IB 3NCWA 3TX4A 1UB6B 4F2ME 2EDFA 2BHYA 4QR7A 3TBSA 4GKLA 2RFXB 5DWUL 2EUVA 1AD0A 4EN3B 1E8YA 2GC4C 4NZ8A 1EVTC 2AVFA 4JGNA 1YA5A 4HZAA 1F58L 2VXTL 3UOAB 2X42A 5D1ZD 4G42B 2CM5A 3LB6D 1U2YA 2LU3A 4JFEA 1OTTD 3AXLB 2P5ED 1TO5A 5FO7A 4P5TB 3MJ6A 2WLHA 4JHAL 2YJLA 2GCYB 1A47A 3EBIA 1PIFA 2JJTA 3PUCA 3L2LA 3VFMB 4WI3A 3V4VL 3LXAA 1TR7A 2JELH 1R6VA 4NP4L 4PJ8B 5DFVC 2JKSA 4XOCA 5F6HJ 3DV6A 3IDIA 4PTUB 1ZLDA 4UTAH 4I2XE 3FT2A 2V2WA 4PY8J 4Y4FA 4DGYL 3PQYB 3T8XA 3TH3T 5JPNB 2WQSA 3NIFF 4JVWA 4XP6H 3Q1SL 4X5XA 2XCMC 1GZPA 3BIKA 1N0XL 2NNXA 3EO0B 4UU9B 4HT1H 3V4PA 4IRSC 4M7LH 4WFEE 4JY5H 3JWNG 1JHTB 2HH0L 4OD1L 4YZWA 4BUGA 4D8PB 1KTRL 5I0YA 4LEBA 5HHMD 3SY6A 2VDOB 3C09C 4XPTL 4APXA 2JI1A 1L9SA 3FRPB 3QW9A 1IEBB 4KMTH 4KHXL 4MJIE 4L8CA 4KKZA 3AGVA 2VN7A 3ABZA 4LSRH 3ECBB 5ACZB 3SGKA 5K59E 1KJVA 5JOFB 4C8XA 4HIIB 1CDBA 2BY0A 4HS6A 4PGJA 3L7FA 1OD9A 1HILA 5I75C 1BYOA 5KSUA 5I66B 5M95B 1IE5A 2O5ZL 1AVAA 5K59F 1SYSB 1ZGLP 3ZK0A 3ATBA 3SD2A 5HI3C 3GBMH 5GSRB 2Y9RT 4AV0A 4M48H 3OKMA 3MBXL 3U9UA 5IJDC 4PRAB 3HG3A 3RGHA 5IVXA 3GSOA 4G43A 5F7DA 4PB9H 5CILH 4HETA 3S98A 3C5JB 2DMCA 1CUOA 2CO6B 1IO4C 1SVBA 1R5WA 3IGKA 1SYVA 1J1PH 3GTNA 2ZG3A 3BSZH 4ZPTA 4QGTA 4LKXA 1JNHA 2VDMB 3IFOB 3ROOA 3BQUD 4KDVA 3NCEB 3MUJA 3ESUF 4M5ZL 4FNLL 2GJZA 3IFPB 4U1JB 3H0TB 4X6FB 1L9TA 1S4IA 4LQ1A 5AW6B 1E9PB 4MCNA 4KX9A 1UTDA 5C0EA 1GYWA 3MO1A 4A6YH 4GRWE 4G8GB 1NGYB 1Q9WA 3E38A 1MCNA 1HAUA 1UENA 3QYNA 4D7BA 2NNRA 3F85A 3GYRA 3HEIB 4ZS7L 5HD8C 3FUFA 4PSRA 4EVNA 3OSVA 1O5DT 1QG3A 4G6MH 4XZ4A 1T7VA 4GRWF 2F1BA 5DRNB 1JGLL 1ZOXA 3TONA 2I07B 3HG5A 1EERB 1DBJH 1X9UA 2ERJC 3JTBA 3MJWA 3HAEA 5I8CB 3GMMA 3O6KH 4NQXA 1WG3A 3S3SA 2ODIA 1LYQA 4I18C 1T7WA 2NY4B 1VZIA 1BFTA 3GXUB 5DSCA 1DJYA 1W6WA 1M6OB 3ES6B 2BNRB 3GSWA 2XV3A 3DX3A 1DBMH 3DO3A 4P5KB 1BECA 1SJMA 3SIKA 5HHQB 1IGYB 1SJHA 1S3RA 1FCCA 3ULVE 3ALPA 5EOTA 2VMCA 2V2XB 4PJ9A 5CSZB 2VXVL 3IU3A 3VFGL 2P8PB 1G87A 3RX5A 3TH2T 3B8SA 3ZMEA 4GMTL 5H94A 4K5MA 3VXSE 4GKOA 1OD7A 4TLTA 4IHOB 3ULVF 1WEJH 5MEPB 3AZUA 5HJGA 4B7IA 1V54B 4IOIB 4AGOA 2NQCA 3LOWA 3QCTH 3FU8A 4LCIL 2DIEA 4NERA 1MKFA 3TJEL 3DIFB 3ECQA 4RFOL 3GIZH 1VFMA 1TEYA 5C0AD 4WEBH 2QGEA 3LIUA 3EOTL 2FWOB 4IS6A 3AABA 4IRZL 4H8WC 4X80H 2TRHA 4OU3A 1TSHA 1ZY9A 3L3JB 1UM6L 1FFOA 4KXCA 4MMXA 1WGOA 3NIDB 1NMAH 1VJSA 3QZBA 1MY7A 1S7UA 3I3EA 4PV8A 1GHFL 1EJ8A 1INDH 2UWEA 4K2UL 4ODWB 4B3VA 1QVOB 4YPGB 1XIWB 2WUBL 2HRLA 3QDAA 5F0JB 1XZ0A 1L0PA 1U8JB 1A6AB 1FAIH 2CBQA 4H8WH 5CZXD 2P7TA 3QUXD 1FNGA 4ZT1A 5A2KH 3MV9E 2EDLA 2KPNA 2A6DA 4H0IA 2G75A 4HWBL 4J3SA 5F0LB 3ATEA 5JHLH 1E40A 2BRRH 2P1YA 3QDGA 1FYHB 1T2XA 1KLFB 2ZSVB 2WLMA 1LWRA 2OI9C 3CBRA 1EDYA 2DWXA 3LQAL 4QXGH 3CFKB 4UYQA 4K0OA 1QSEE 1Z66A 3TNMB 3BHBB 1IGIH 2YRLA 4KKAD 5A16B 3IDXH 1A14L 4MX7B 5F1NB 5C09A 3MA9H 3OR6B 4K3GA 2ZAIA 3FB6B 1MCKA 4LXFA 1C5DB 1OEZW 2YEQA 1FVCA 4P2OA 4QRQA 4AZ8A 1INQA 2A6JA 5I0DA 3SJVD 1BIHA 4L3CB 5CWSA 2ZOWA 5GGTL 5CJOH 3UO1L 1MCFA 2B5IB 3BP6B 1UZ8B 3UTZB 43CAA 4KZDH 4IJ3C 3WCYA 2DM7A 2WXNA 4XWGL 5LBSL 1T1YB 1KIRA 5DMKA 2Z35B 4QLWA 5F71A 4MCZA 5GZNC 4P5MA 1AGDA 5IBUG 5DVOA 5EO9A 5DMGC 1WFNA 2CHZA 4NWTH 2OXGB 4N90D 2Q1EA 2GTZB 1JTPA 1S3KH 3OKEB 5EFIB 3ZMRA 4JL2A 1XBDA 1JERA 2X1XR 1EEUA 5EU4A 4L37A 3PV6B 4MDIA 5GRUH 4UM9B 3MI6A 4CA4A 4U2ZA 4J8RB 2H3KA 1KCSL 2F1EA 1TOXA 4YVUA 2H1PL 4GQ9L 4R3SA 3CLFH 3ZKMC 1FJ1B 4JRYB 1AG0A 1YY8A 2ZXAA 3FU3A 5C6WH 4GRLC 3EXLA 4ZAKD 3RFRA 1OPOA 3NQIA 1T5XB 5GRJL 3SKNA 2X4UA 2BSDA 2HJLB 4CJ1A 3TEYA 3FQUA 2P24A 2QKIA 5DD0L 1OPGH 2DBLL 2A4ZA 3JUZA 2X1OA 3GSNL 2KQNA 3HMXL 4BQCA 2ED7A 1CLOH 1KULA 3QCVL 5GJTL 2OCJA 1OALA 4XTRC 1VESA 5DJ8B 4X0KB 4OT1H 1GCFA 4WSKA 3MRKB 4PJHF 3LZOA 2B1OA 2ZXDA 1F2QA 4YSRA 3SYOA 3B9AA 3R1GL 3ZR5A 1KV3A 1IM3A 2ICWA 3NH7L 4U1NA 2WXRA 4N68A 1U21A 2H7WA 2OXHB 3NJNA 1GZQA 3MJ8A 4K9JA 1JHKL 3TV8A 3GWJA 2QV4A 1G0XA 2Q2EB 3LH2H 2C7FA 4KPHH 1AO7B 1JZGA 1HHKA 4XNQA 3HE6D 2X0UA 1HI6A 4M7JH 1TMCB 4YDLB 3GO1L 2CDEB 5ACMA 2YGPA 4WCYL 2OP4H 4E42A 1NEUA 1XGTA 4FJZA 5I1DB 4RMQA 3ALXA 3KWWB 4JM2D 4ONHB 4TNGA 3D18A 1URZA 3ECWA 4HFUL 1ETZB 4K7PH 5BRZE 2VB5A 1AQ8A 5FYLH 4XBEL 3O0LA 5F6IC 1MCHA 4UIMA 4TLUA 3KPOB 5TE4H 1J18A 2F7IA 1B4LA 4TUOB 2F08A 1OCCB 2DMKA 1SM3L 3DUSB 3K6IA 3V6OE 2FRGP 2BSRA 5A2LH 4HMEA 2BM3A 2XNAB 2ICWJ 5K9JH 3LAFA 4NQEA 3T0EC 4NI6A 1W72B 1UC6A 2ZJSH 1K6QH 1IGJA 5BVPH 3FFCD 2FECL 3ULSA 3UTSD 1G1YA 2BOCB 1QKZL 5FUZH 1FZOB 4ELKB 3BX7C 1XSJA 2E9JA 5E4EB 3CZKA 5ITBH 3BUQA 4DP7X 5IUSA 3BPOC 4JCWA 1KXTB 3S8WA 1U4FA 1DHKA 1I1AD 4QKXB 2WTRB 3ABKB 5DC4B 5ENWB 1NDMB 5DK2B 2VLKD 3MLSL 5JQ6H 4FCAA 1G7QB 3VO0A 4H2CA 4DP4X 4WFGD 4DERA 3QFDA 4RAUA 5LUMA 3MLZL 4NO5B 1ZJAA 2AXHA 2OW7A 1VEPA 2VITB 3BVNB 3OPUA 3AJ7A 1PZ5A 1GW6A 1RZGA 4FI7A 5E56A 3O2WL 1DANT 4GY4A 5SX4H 3V8OA 3WV0A 4HXBL 1KPRA 2PTUA 2BSCA 3QUYD 4MA3A 5BXFA 1A25A 3S3CB 5I1EH 3IGAB 2CRIA 3LPFA 4P2QD 3WUWA 1R4XA 1GOHA 1LP9B 1EMTH 2A83A 3VD1A 3RWHA 4WNQA 1FVEB 5AENA 4QAMB 3SE3C 3SDDB 2JXMB 3BFWA 2R0WL 4XO8A 4HPHA 3QSKB 5F96H 2ZCHH 5LJYH 1KG0A 2E0PA 4L3FA 1K4CA 1PQZB 3SKUD 1MIEL 3ZTCC 4FQ1H 1NCNA 3MAWA 3T4YA 1YECH 4AW7A 3O2VH 3D39D 2P28B 1RAMA 2IOOA 1CGSL 1TJHL 3PHQA 4JDZB 1EVUA 1COBA 4JZNA 1GTFA 1W0WA 2R69L 1MW2A 4ZJ9A 3HNVL 1PD0A 1F02I 4E9WA 4Z78B 2N4IA 2F5BL 4HJIA 3IF1A 3REVB 2HN7A 3DROA 2KPWA 5IQLA 3PWPA 2CLRB 3S35X 3GK8H 1UD6A 2CH8A 1NMBL 4M6MH 3WMSA 5KG9B 2ESVB 4H5SA 1FSKB 1KJ2L 3ILQC 1QATA 1QACA 5L0QC 3GLZA 4QOKD 4N0YL 1BF2A 2DQHL 3OAUH 3EJJX 2BIQA 3BEVA 2G5RA 3HRZC 3NFPA 5CN2A 2A74C 5CU9A 1U6AL 2LAGB 4CKQA 5D93B 4E0RA 1T0NA 3ZKXC 1JWSA 2PP7A 3CFDB 1S7WA 3KE0A 3U4EB 5KSBE 1JV5A 2ATKB 1DQDL 5EO1B 1YNLH 4TQEL 2HT4C 4MZIA 1OAZL 5BS0B 5M7QA 3ARVA 1U8KA 5ALCH 1ZLSH 1JGVL 5E1AA 2ICEB 4QYOB 1N8ZB 1FDLH 2WMPA 3IPBA 4JMXA 1PX8A 4Q7DA 4E9SA 2CJTA 5IHUL 5KSBF 1CLYH 1JVOA 4I0PC 4NN7C 2IWKA 3GUTA 3D1MC 2X4SA 2R1XA 3VJ6B 3UTOA 1AHWC 2V6HA 5KTEH 5I1KH 4P3DA 5HHMB 4WZ9A 3I85A 4OGYL 4M7KH 1ADWA 2EDDA 2J44A 1NFIA 4OLUH 3W1ZA 4AV5A 5LLIC 1QQDB 2RQEA 3OGCB 2QVTA 5K9KA 2K4AA 1YEEH 3QI9B 5IB2B 1UOVA 2DS4A 2R4SL 3LS4L 3FB5A 3VI4A 2W9EL 2WIMA 1HQRA 2WXMA 3C60A 3RWDA 4PJ5E 2YAFA 4WI0B 4HUWA 5CM1A 4QRTB 3RU8H 1QFUH 4ELME 3V0EA 3RZWA 3CH1A 3DJTA 1T1WA 4F2FA 4XMKL 5AAWC 3QUMA 4RZKA 4N2FA 3ARFD 2YA1A 4AGQA 4FA7B 5J12C 4BH7A 2DQCH 1AZUA 3QRLA 4O9HH 4PW9A 3IAGC 5FHAH 2AXWA 3VXNA 4ELMF 3TWCH 4WI5A 4F1SA 2CNYA 4KQ3H 4V1DD 2BY3A 4GG8B 3P3YA 3WFEL 3NSDA 2NQ3A 4UBDD 2LU5A 2PCXA 1QBBA 2R2CA 2YAOA 2P5WD 2NNFA 2V7NB 1BD2E 4JBSA 2P80D 4PJDE 1JWUB 3EH5B 3N9GH 5FWQA 2FNWA 5AVXB 5EDSA 3S8GB 2DDQH 3UYRL 3QIUD 5TFSH 1T6WA 3EJYD 1CGYA 1UKTA 5E9AA 4B50A 5JIMA 5J3HC 4NQCA 1XMWA 3PDOA 1O9VA 2G2PA 2VLJE 4LHQB 4PJDF 5C9KA 4P46B 5HVFB 3VAEA 1U3NA 2YD3A 3GD1C 2PN5A 2BW4A 2HKFH 2Z0UA 2XT1B 3RUGB 4KNTA 1QWHA 2YC1B 3PUUA 5DRWB 3IJ9A 3KJ6H 4ETQB 4G83A 4PWGA 5M94B 3D2UB 3IU4H 2ISDA 1AXSA 5GS0C 1CQYA 1U3HB 1NGWB 3VFTB 1S78D 3MRHB 2C4XA 2Y06H 4Q74A 3NJXA 1KTLA 3QUZB 3FU0A 1EZSA 3D33A 4GNKB 4IU3A 5H37G 4BM7A 3ARDA 4XPGH 1IBFA 4JJOA 4Q4EA 3IAQA 2C9UA 2ALAA 2DF3A 4ENEC 1L0XA 1O7DE 2HCZX 3HVNA 3W39B 4OZGE 1H3PL 4Y4KC 1LEIB 3PNWA 1EXHA 3OD3A 4D0BA 1VEMA 4LSSH 4GRWH 2BFGA 4A38A 5GS0H 1KIUA 4G6JH 3QDJA 1FORH 4FXTA 4EDWH 1GCYA 3TYFA 4OKVB 4ZMPA 1I8IA 3EDFA 3PG2A 1J8HA 3O11A 4OZGF 5CJ5A 4XN4A 3F3HA 4TUKH 1T89A 1UD8A 4KI5D 3ULVC 2YSSA 4CGTA 3OWEA 3N0AA 3NBNA 1IE4A 3KPLB 5AKSA 4G6FD 3GMRB 4PBWD 2DQJH 2GIMA 2KMWA 2VC2H 3DIVA 4WW1B 5GGRA 1PY4A 1Q38A 2OMZB 4G42A 3DVIA 3KM1A 4JO1L 2DYPD 5DJZA 2Y7NA 4P5TA 1XF4B 1JE6A 3EHBD 3EF4A 2GCYA 4BFOA 2DEYX 1UB5B 2XPGB 2WD0A 3AMKA 3ULVH 1OM3L 2Y7QB 3SBQA 3P0GB 3VSTA 1Q0XL 5LCVL 4F7TA 1ID5I 1TFHA 2GABA 3PP4H 4YH6A 1FG9C 1DUYB 1PZBA 4PTUA 4Y4HB 1ZT4A 2J73A 4L8SB 1JFQL 4MDJB 4MAYB 5ID1B 1PF3A 5ADPH 3EDKA 5HI5D 3AS0A 1E4XL 3MOBH 1WF5A 3EOAB 3F84A 5EZIL 3LS5L 3JSSA 4LP5A 3VWJA 4Z7QB 2OQJB 5JPNA 3AY2A 2YK1L 4ZOBA 4NJ9H 3EO0A 4UU9A 4ATTA 5JZ7C 2QPDB 3DHPA 3ARGB 5DJ0B 5ANME 5CNHA 1JHTA 2F19H 2O5YL 4TL4A 3KWUA 1HDMB 1A64A 1KELH 4BRVA 5D1QD 3D2TA 1YMHA 1A4BA 1VIWA 3LNEA 3LHPL 3FRPA 2W0KA 2VCOA 3CSYB 1J05A 3L48A 1DVTA 1YY9D 1I4FB 1A7PL 1W0VB 3QG6B 1SMAA 3CZNA 4RIRB 3S5LG 4F27A 1I8LA 4EXPX 3NABH 4F7KA 1BWWA 1I3GL 1IIIA 2NYYD 1X5KA 1AC6A 5HYJD 3INUH 2QBWA 1DVFA 1QFWI 2AJYH 1PAMA 4HC1H 4XVSH 1ZA6A 5I66A 3VGBA 2E59A 5I16B 3QORC 4XCNB 3R7QA 3Q48A 5B38A 2YPLA 1SYSA 4ZMOA 1AS8A 3K2MC 5LWYH 5GSRA 5DLMH 3A6OA 4PJCB 5EF2A 4OJFL 5E6IA 3DDGA 4PRAA 3FONB 1P9MA 2XETA 3C5JA 3DX7B 3QEQB 3KGRA 1ORSA 5SWZA 1CDYA 2CO6A 2KERA 5KS9A 2R2EB 2WNKA 1RZQA 4D9LH 4O2EB 3BPNC 4ZSOA 2CIIB 5C08E 1M57B 2EEFA 1NGQL 1CFQB 3MBED 4XNXL 5I18L 5EIVA 3IFOA 1XR8B 4HSQA 4AC4A 1H6FA 4YDMA 4ZDHB 3T65B 5DURD 1BZOA 4RRPG 1J5HA 3Q06A 1WGVA 3K46A 4HUNB 3BCDA 3IFPA 4CBPA 4U1JA 3FMGL 1RIUH 3H0TA 1I1FB 2LU7A 2ZCLH 1S7TB 3EFFB 4FXLA 4X6FA 4ZOEA 3MRPB 2QFRA 1KCVL 3TNNB 4GI6A 5HI4D 2A9DA 1NGYA 4M02A 4N9GA 1PX3A 4LSQH 4QT5B 3MGOA 5BMFH 1ZSDB 4ZMLA 3FCSB 4RMTA 1AE6H 2G3XA 2AJVH 5JIDA 5K9OA 3B2VL 5DRNA 5EBGA 4GUQA 4UQ3B 1P4UA 4M93B 1WAAA 4YLBA 2I07A 1JD9A 4M1DH 2MQCA 2Q8BL 1SEQH 3TYGH 2UV3A 5E6UB 3VYPA 1T22B 2E9WA 3QUGA 4G8IA 1F0LA 1FRGL 2HTKC 5D7IA 1M6OA 2BNRA 3CVIH 5AW0B 2NYZA 3FPYA 5EZPA 3PABB 5CO1A 2EC8A 2X70B 1U8CB 1REIA 4P5KA 1WZ1H 4X42A 4KNQA 2VR8A 2Y6SC 4N8CL 1PKOA 4Q56A 1HNFA 2V2XA 2OBGA 1JTOA 2KDGA 1UJ3A 4LOUC 5CSZA 5IESH 1FVDA 4OTXH 5E4OA 4Z7WB 5IB1B 3VQ1C 3RX7A 2R2BA 3GM8A 3FO0L 4ERSH 1YYMH 2O5XL 3H42H 3HBPA 2B1HH 3U6XS 5MEPA 1MRFH 2BW5A 3W0WD 4JDTL 4KUCF 1ZPUA 1OB1A 3BPLC 2V4LA 3H9HA 2DQGL 3SDCD 3DIFA 4FTVD 4JM2B 1VENA 1BPVA 2Q8AL 5IVXE 5B8CB 2SEBA 5IEKB 4R7DB 3IETB 1BQRA 1TYJA 1FA4A 5F1KC 4Z7NB 3AGWA 4CDHA 3QJFB 1DL7H 4AQ1A 2B20A 4TQIA 2NSQA 3FUIA 4RFNC 3NFNB 4Q9CA 2YGNA 2OTWB 4ODWA 1P7KB 5LG1A 3DMMB 1QVOA 3B2UC 3LN4B 3NG5A 1HINH 3QG7L 3VRIB 5BRPA 1E43A 1NGPH 2Y5TB 2WOBA 5EU7E 5IW6B 3K72B 1LK3H 4X6CE 3VFUB 3CE1A 2GFBB 1J12A 4I0CC 1T7YA 3L95B 3V6OC 3K6DA 3CLEL 1NPUA 2FECI 1H5BC 4Q97A 4RMVA 4X6CF 4HGKC 2ZSVA 4L2LA 1IT9H 3MLVH 4ODBD 4PQXA 3VXUD 1I3UA 4HJ0D 3L08A 3N44B 2NY7H 3K1DA 4U0QB 4W4OC 2O1AA 3BHBA 5EIQA 1E67A 5D2NB 3ISYA 2FATL 3TZVC 1MFVA 5F1NA 4JQXA 3OR6A 3ZE0F 3EYOB 3H4FA 5F70A 3RWFB 4X6EB 5IQOA 3QWOB 4XP1H 2ZP8A 2OSYA 1KBGL 3PHOA 1MCIA 4ZO7A 1B0GB 1ZHBB 1OAUL 3P0VH 3QNXB 4L3CA 2QR0A 4YHML 3ZE1E 2VGLM 3DHUA 3A0OA 3BP6A 3UTZA 1IGMH 1OP5K 2ED8A 1I1CA 3VXRA 4R9HA 5C8JA 4V33A 1IZJA 1WC7A 1Z5HA 3NIGB 3CXDL 4IGBC 1EFQA 4IBZA 5DT1L 4JFZL 3RBGA 4BELD 5AW1B 2LLGA 1BX2B 1MFBL 5ESAA 2DMGA 3Q5TA 4OZFB 4OZIB 5ECJE 4U1HB 2OXGA 5HPMB 3GXFA 4E5XG 1U3ZA 3D39B 2ITDA 2CIKB 2BP0A 3OKEA 4JB9L 2JLPA 2CKBB 3BPCB 4ODTL 5EFIA 4YXKH 1VLXA 4XMXA 1G9MC 1UGKA 2VL4A 1YJDC 4KKBD 5KVDL 5IROD 2PYFB 1K5WA 1M7IA 3PV6A 4K07A 4Y9BA 2PF6A 5C0GA 2RCSH 4UM9A 2VZ3A 1CS6A 5IJVA 4J8RA 1KDIA 1M2VA 1FH5H 1TQUA 3H2PA 2CO1A 3A4DA 3QR1A 4M7ZB 4ZX5A 1A7OH 1B0WA 3M86A 2FJSA 4QOKB 4CVXA 2UWEE 3S36H 1KOAA 1G9MH 1YJDH 2HJLA 2WWMC 3U79A 3ZZ1A 1LNUB 1G84A 1EEYA 5E8NA 3ZGIA 4L8DB 2H32B 2ICWI 3FT3B 4CVWA 4EXKA 3IRPX 4XOBA 3KNBA 4AYID 4YXHH 1X9QA 2P3YA 2UWEF 3HI6L 3ISWA 4BGLA 5HDRA 4EE2A 3A22A 5DJ8A 2FB4L 1PCXA 3D25B 4FL4B 3MRKA 4KOCA 3FCTB 3BC9A 4H1LB 2DWDB 1QUNA 3EGDA 1VGKB 3MGTB 3QDGE 3MOAH 4FZ8L 5EB9A 2A6KA 4C4KT 4KJPD 4JREC 3UBXB 4HKZB 1JGDB 3MRJB 5E2UH 4JNXA 5JR1L 5C09E 3U30C 3CTTA 4MJ4A 4GIAA 5IQ9A 3LRSB 1H3WM 1AANA 2Q6WA 4ALAL 2VN6A 3M17B 3W11D 3UJJH 3EDJA 2ZTBA 2IAMD 2CMRH 2CDEA 1R3HA 1VAHA 5IVZA 2VQTA 4LLWB 1L3NA 1CE1L 4ONHA 3NDYE 4NUJA 4NJAL 5DU7A 4L3EA 1Y18B 4TNEA 1KYAA 3DJ9A 1OQOA 1ETZA 2KZBA 2DLEA 3U7YH 4G1MB 4DKFH 1EUTA 3S5LA 3ERXA 4LLVB 4N2BA 2B4CL 5IFHL 3TTYA 4A68A 2YRZA 2DQIL 3CIAA 2GJRA 3DUSA 5I0VA 5ESVA 4MJJA 5JORB 1M3IA 1KBWA 4XO4A 5E9DB 3VWKB 5E8OB 4K94L 3SKJH 5A2CA 7FABL 3FXIC 2LHAA 5TTRA 1W72A 4OIBA 3GS0A 4LNVA 3GSUA 5FHBL 4FQ2H 3L4WA 1BXAA 1QD0A 3I9GL 4AEHH 3GJFH 1FZOA 3AG1B 4JPVL 5FM8A 3RGVD 4MA8H 2IQAA 1AAJA 1Q1JH 4Q4IA 2D7TL 2HPTA 4N0FB 5CD3B 2I5YL 1TTBA 4JCMA 4FABL 1M7UA 4XWOD 5ENWA 3D34A 5DK2A 2AK4D 5FGCE 5I6LA 1QBAA 3X3GH 3REWA 3KPRE 1OLZA 1MAMH 3HHSB 3CX5K 4ZMYA 2VITA 3TVMA 1KB5L 1RQ5A 3BVNA 3KPSD 4ZFZB 4AQEA 4KXDA 4DIXA 5T5FL 2EEXA 1SHMA 1EXGA 4WDIA 4ZTEA 4Z7OB 2J5LC 4ZZFA 1UZGA 4AT6B 1FC1A 3QT2A 4WO0A 3VG0L 4BK5C 1ED3B 5DHMC 4X8CA 3IGAA 4G3YL 1OP3H 5BZXA 4GSQA 1JZ6A 3UPAA 1GW0A 2FWUA 1E6OL 1LP9A 1RXLA 4B9GA 2BDNH 1FVEA 2X10A 2R0LH 2NW2B 3AWGA 2JXMA 4U1GB 2MMXA 4NNYB 4D0CB 2DBJA 3VA6A 4K5NA 2JSFA 2Y69B 1PQZA 5D7JC 5FA3B 3JWNE 1I9RH 5DWUH 4D9QD 4TF4A 1UKSA 2LTQB 3FUKA 1BOGB 1YPZB 4CC0A 4PRPE 3DOSA 1G7HB 1CGTA 2ADFH 4JDZA 4JANB 1OP4A 1W2KT 3FH5A 2G60L 1F58H 2VXTH 4LCUA 2X6VA 1JK8B 4Z78A 1KLGB 5DFVD 2C3GA 1ZV9A 2GITA 1E28B 4NC2B 3REVA 3TN0B 3OAZH 4JHAH 2EYTA 1ZS2A 4NLHA 4AJWA 5EZLB 3QXDA 4LSDA 5KSAC 5D1ZA 3A6CL 4YDVB 3V55A 3V4VH 2DYPB 2P5EA 4M29A 2Q3AA 3S2CA 1X4XA 2OL3L 1OARL 3OZKA 4EI0A 3CFDA 3U4EA 4DGYH 4E9VA 2ATKA 25C8L 1PX4A 4QRAA 1SHXA 4XP4L 5EO1A 3ETBJ 2FJGA 1ZXKA 4ZQKB 3LZNA 1N0XH 3TPKA 2AQ3A 2ICEA 1N8ZA 1TYEB 2GHWB 3HZ3A 1KGJA 2HKAA 3AT0A 2HH0H 4OD1H 2VXUL 3ZU8A 3OMNB 3MRQB 4XGZA 4O5LL 3VJ6A 5KYWB 4XPTH 5B1KA 1R75A 1WBXA 3MCYA 4IIQC 4KHXH 4X5QA 1L9QA 5IP4A 5BOPA 5D1QB 5HHOB 3MRLB 4ZUSB 1HC1A 3OMIB 2IBBA 4GS7C 2VN4A 5I6XB 5HI3D 4GBXD 4J3OG 1JAEA 1QQDA 3SPIA 3KLLA 4C59B 2BSED 3OGCA 2YQGA 3I02A 3UDWA 4KO6A 4UZUA 5IB2A 2O5ZH 1PD6A 1WZMA 4JFTA 2NYKA 3UGUA 5JNYB 3LPOA 2G5UA 2VM9A 1WCQA 3OLGA 3QHZL 3MBXH 4YSCA 3KG5A 5EBLA 4FI6A 4CW1B 2BNUB 2ITCB 3DETC 4LVNB 3LMJL 4MBOA 4NQDE 3SYPA 3FQ1A 2HLAB 3OHXB 3ASOB 1GGYA 2EIEA 4TNFA 4GG8A 4IK7A 1G7PB 3SPVA 5FFLA 5CSBA 2GI7A 4M5ZH 4FNLH 3VNYA 1ZVSA 3PWPE 2I60L 5F9JA 1HJBC 1UWXH 1FZMB 1JWUA 3B37A 4G5ZL 3BQUA 1OT4A 4XXDA 2VDQL 5T3ZL 2FT6A 2Q5BA 5DQ9A 2X1PA 4NS0A 3IFNL 4Y1SA 3AG2B 3MVSA 3RJQB 5JHAA 3G5VA 1JIBA 2IH3A 2ZWZA 4NB7A 3VDAA 4MXVF 3QAZB 4ZNEA 1IKOP 4P46A 4ZS7H 5JHDB 1J8RA 2O6PA 3U1QA 3LKQA 1BXXA 2BS71 1BQLL 2E7DA 1MG2C 1NOFA 3K0WA 3VU1A 2X38A 1OANA 4PIRF 2YC1A 5DRWA 5FDWB 1DN0B 2XZZA 4QRBA 4UZGA 4W9EC 3DKHA 3DX8B 5C0CB 5JXEA 3D2UA 1FIGL 3GS4A 4JN1L 5DFWH 5INDB 4R8WL 4YHIB 3MRHA 1IX2A 5J9PA 2WSDA 5ADOL 3NPSC 1R46A 4WEMB 4DPAX 1M9WA 4ZX4A 1ZMYA 2Q2LA 2DH3A 4XHJD 4KVPA 3CFNA 4Y2DC 4P3CL 3VE0A 1T4KB 3GMPA 4GAFB 1LEIA 4U1IB 3ZKSD 2PPDA 1AIFA 2P49B 2VXVH 5FO9B 3VFGH 4Q6KA 3SDAC 4X2UA 3MACL 2CGRL 3BSGA 3TGXA 2VABA 4GMTH 5AYUL 3T08A 1MN4A 2K7QA 3H6JA 4MD0B 2WQUA 1VGEL 2B3IA 4OKVA 3VI4E 2X4RB 3MV01 2IFGA 3WL9A 2JJSC 1RPKA 4R4NC 5FA4B 2IAND 4LCIH 3TJEH 4PAZA 4RFOH 3FK3A 2XA3A 3QPXL 4IOFD 4YQXL 3EOTH 3KPLA 2F5AL 4IRZH 3GMRA 1I7ZB 4PJFF 1DFXA 1KIQA 4W9DC 4WW1A 4F3FA 4FTVB 4G11A 1UM6H 4PR5B 4AEIL 2DM3A 1XF4A 1BBJB 1UD2A 2GJ6E 4JLRA 1IBYA 4O2FB 4XB8A 4Y89A 5C0AA 5EIIA 1CC3A 4QD2E 4O02A 1GHFH 1YVLA 4JHZA 4K2UH 2Z4QA 4JVUA 5AW5B 5B3JE 1FPTL 3LQAC 3RTQB 2AZUA 4KMQA 1U95A 1DUYA 4BKLA 4L8SA 1HXMA 4PRNB 3BAKA 1ADQL 4KUZL 4XHQA 1PKQB 3SE6A 3EOAA 4DP8X 2CA4A 2OQJA 2VDPB 3D0LB 4NQCE 4FKHA 7PCYA 4Y19B 5B3JF 4FI8A 4MMZB 4B3EA 2CXKA 3QUXA 1DLHB 3BVWA 1TTRA 4CC4C 2YAHA 2OMWB 1BG9A 2YUWA 3SEPA 3HLKA 3CXHK 1I1YB 3LZLA 5A43C 3X3FH 1HDMA 3LQAH 1YHPA 4APQC 1OZUA 5DQDH 4X6DF 1MI5D 2CCWA 1A14H 3KR3L 3ORJA 5EU7C 4R0LC 1MW1A 5SV3A 1Z0NA 2XQYK 3HE7D 1I4FA 4S0TD 5D8JL 3FQNA 3QG6A 4NSKB 4Y5XA 2AP2A 3TASA 3HG1E 3HZVB 1KWGA 2BSSB 1TZAA 5GGTH 2MCG1 4JY6B 3UO1H 5GZND 3RWJB 5F2FA 4EN2A 4YGVA 1K5NB 5HVWA 4OB5L 3KDMB 3SJVA 3SGEI 1J1OL 4R5VA 5DRZA 5T3XD 2HYMA 2CUMA 4GQPH 1NL0L 5INCA 4QI3A 4DP0X 3A67L 2Y3NA 1G4RA 4GQQA 5L8LB 1XBRA 1J8HE 3NSJA 2V2TB 2Z31B 3I6LE 3EUDA 4JFQA 3L45A 4PMFA 3FONA 1BZEA 4L9LB 3QEQA 3ZTJH 3O6FC 5KOMC 3JV4B 5EEWA 3NZUA 3SE9L 2R2EA 4KX8A 4QRFA 4O2EA 1M9SA 3HAEH 4PJ9C 3MUY1 1CFQA 2FX9L 1LO0L 4BSJA 1HIMH 2CXGA 5DRXB 4ZDHA 3T65A 1R1CA 4Z77A 2BVYA 1KCSH 1HHGB 2H1PH 4GQ9H 4XNBA 4N3TA 1BYPA 1OAKL 1S9YB 2X4QB 3T1FB 3QFJD 2Q7YB 2ZONA 3IMTA 3MRPA 2V8LA 3T3ME 3Q05A 3TNNA 5L6YL 3Q8AA 1U36A 4ABWA 5GRJH 5EF1A 5AVQB 1QFWM 4QT5A 4WHDA 1NC2B 5DD0H 3SE8L 3ZDZB 1D5MB 2DBLH 3T4AB 3FCSA 3VYNA 4AZUA 4JFVA 1IQWL 2IOIA 3GSNH 2PLTA 3DJZA 1UXWA 3HMXH 4ZAKA 3T3MF 2AXGB 3HJEA 2K7PA 3QCVH 1OAYH 2J8UA 3KMDA 2VL5A 3DO4A 4IMKA 2FBJH 5DWPA 5GJTH 3K5RA 1DQLH 1IGCL 1NUGA 2V8MA 1AI1L 4FNTA 3NP3A 3ZMNA 3R1GH 1T22A 1QASA 2HFFA 1GXEA 3NH7H 3PGDB 1B2WL 2R2HA 1JDDA 3PABA 4JAMA 1K3ZA 1I75A 2X70A 5FYLD 1F00I 1U8CA 1JHKH 2OX5B 3D48R 2OYLA 3VXQA 3OZLA 1IMHC 2A9AA 1Q94B 1IKNC 4PI2A 4YE4L 4TSCL 4WCYH 4CUCA 5BOZG 1N64L 2N3JA 4JEGB 3HE6A 3MV7D 4UYPA 3IMRA 4OFVA 1AG6A 1JN6A 1NAML 3LN5A 3QNZB 2CHXA 2ZWYA 2YPLE 1WT5A 1D3CA 1E4WL 2IAMB 1BMZA 3HB3B 3BDXA 4HFUH 4ZMZA 4RGOL 4UQIM 1J9TA 2EXYD 4MA7L 1MHHB 3EJSA 4JM2A 4P2OC 2HFEB 4BK8A 1N5AB 2VAAA 4JFXB 3IXTB 2ZX9A 4XBEH 4HWEL 4R7DA 1RH8A 3IETA 3ROLB 3MRDB 1SM3H 3CPUA 3OSKA 4PGBA 5SWZE 3UP1A 1G1CA 2DYSB 5FB8A 5KS9E 4HBCL 5CF3A 3LPWA 3QJFA 3STZA 1SY6L 4FXGA 4ZSOE 5HGAB 2PTTB 4PGZA 3NFNA 3P9LB 4QHMB 1H6UA 4BK4A 1M56B 3UG4A 1NM4A 2AXJA 1CFNB 2MQGA 4OM1L 1QKZH 4HIHB 3FTGB 2IBZY 4XVUC 3VRIA 1TLKA 2BLFA 1YAZA 3FFCA 3VFUA 2VDNL 1FYTD 3UTSA 2GFBA 3A6BL 3WTWA 1PZ2A 3IWUA 3PRZA 4TRPL 3RHWF 4N6QA 4PS3A 2QELA 4L0ZA 1ANUA 5D6DC 4AYGA 3B5GA 3MLZH 1E8XA 2IC2A 1I1AA 4FLSA 1IVTA 1WITA 1KNOB 2VLKA 2DWSA 2H6OA 4IDJH 3PJLA 1WAEA 1S7RA 1DEEB 3O2WH 4WUUD 3P9MA 3WKML 5D2NA 5KVDE 4HXBH 1NFDF 4NNXB 3EYOA 2NZ9D 3E6HB 5K9QI 3RWFA 4L8BA 2BERA 5D7IE 1ZS8A 3QWOA 4ZW6A 4GUOA 2AQSA 4GI9A 5D2LA 2FIKB 1B0GA 3N1QC 1ZHBA 2QKIC 3NUKA 1PPIA 3STBA 3GXIA 4UT7L 1B9KA 2PO6C 3T3PB 4DGWC 4AVIA 2DWTA 3QUYA 4UT9A 1ZVHA 5LN8A 5D7IF 2VJ8A 1KUMA 1YDPB 2IMNA 2MNWA 5E08L 4DTGH 2B59B 5F3HB 4XVTL 1MIEH 5IZ7A 3HKZA 5JUEL 1RI8A 1AD9B 3MMEA 2PCYA 5CXPA 1CGSH 1ZTXL 2E4FA 3NESA 4XN5A 1QRNB 1NTDA 2DTSA 2GSIA 4OZIA 3ILQD 2R69H 3RDTC 3ARBC 3HNVH 5HPMA 4FQXB 1NBVL 3D39A 1SEBB 2CIKA 2F5BH 1K8IB 5KVEL 3CWGA 1ZGLM 4U1MB 3QIBD 1NMBH 2WLIB 1KJ2H 1RK0A 4NQVA 3OJVC 2OLDA 3GINA 3JWNC 4N0YH 1MCQA 2A0LC 2DQHH 1FLRL 3OF6D 2G9HB 3D3VB 2WV3A 3OKDB 4R97B 1U6AH 2CQVA 1KY7A 2QLVB 5AW8B 3BVTA 4I0PD 1ZHKA 2HLFC 4X0NA 1DQDH 4QOKA 4TQEH 5EU6B 1OAZH 3AAZB 1TVDA 1TFPA 5G5DB 1HJCA 4N86A 4PGDB 1LNUA 1EJOL 4IRSB 5EOQL 2EXTA 5TQ0L 3OTTA 4OLXL 3JWNH 1P6WA 1TQTA 4Z5RB 2H32A 5IHUH 2MTPA 3UBHA 4XCEB 4WHTA 4MJ2A 2XU9A 3ZUCA 4LLUA 1VCAA 3CVHL 1BQ5A 2DICA 3QDMB 2BHUA 3C09B 4HCFA 5EU3B 3MRIB 5DMYA 3FCTA 2E7LA 4H1LA 1A9BB 1RJYB 3MGTA 5F89B 4ZTOL 5A2AA 4N2MA 4RNRB 4OGYH 2ENQA 3UBXA 4HKZA 5CU5A 3MRJA 2B16A 4OQTA 2DI8A 4FXKA 5L8JB 3MRNA 4RAHA 5I75B 3GZOA 4QRPD 5DQJB 3DX0A 4WO4C 3DGCR 4F15C 2W9EH 1KYOK 3VXMB 4X6BA 5FYKL 3LHAA 2GJJA 1O6SA 3LPGA 1H8OA 1H9DA 1MRDL 2XG5A 4LLWA 3CQQA 1T20A 3VXRE 4XMKH 4WHYG 1H3GA 4OJEH 4M43L 4K7PX 1MEXL 5A40E 1P4BL 3WDHA 3N50A 4I87A 4A6YB 1B4RA 2BPBA 1NZRA 2FVNA 4G1MA 4J7RA 1QI4A 2VQ1A 4EIBA 2NNCA 2VXSL 3WFEH 3ARFA 1DQVA 3RP1A 3MRRA 1M1XB 5JHBA 2N59A 1UFUA 2XX1A 3QH3B 5J3HD 3Q6GL 1LE5B 3OWRA 1QR1B 5JORA 2EP6A 5E9DA 4V1DA 2C34A 1HHHA 3HZKA 1PLCA 2NTFB 1OGSA 3UYRH 2GSGB 1E7UA 4J4PC 3X17A 4AJYV 3OQRA 5CR1A 2P80A 3DDFA 3L4UA 5BV7L 2D8KA 5L2KB 5CS7A 1GS8A 4F7PB 5I1LB 3HJ0A 5GS0D 1IAOA 2EXWC 5DHEA 2H0EA 3BRDA 3M7FB 2KKQA 3IDMA 4I18B 1AXTL 2AEQL 3NTCL 4ZZKA 4Q9QL 5D7LE 4WFHE 4Y4KD 3KHQA 2H45A 1CGVA 5CCGE 4AT6A 2RR3A 1WJ3A 2D7MA 1UASA 3EW3B 3HC4H 1W16A 5IMMA 4J5VA 1IV8A 1H3PH 4G6AC 3LKRB 4U6XB 2NSXA 4QHNB 1A5FL 1LDPL 4GW1A 3VRLE 3MREA 3OKNB 4N2EA 2NW2A 2BZDA 4IOSA 3ULVD 4P9HL 4NNYA 4D0CA 1CFTB 3US0A 2DQMA 3B4NA 2EYRB 3VQLA 4BFNA 4X9YA 3WTTA 1BOGA 1YPZA 2EDKA 5G4MA 3VRLF 3TCLB 3DX6B 3P4MB 3N1MC 4AYBA 5D1ZI 1CGUA 4HIXL 1X5HA 4L3EE 4AM0B 1CI3M 1I8KA 1KTCA 2IANB 3D87B 3P4NB 4HKJA 3COOA 3GXDA 4ZUUB 4YWGL 4JO1H 2NZ1A 3HLAB 4PREB 2VR3A 1E28A 3QC5X 4RA0C 4Z8FL 4LAQL 4LSUL 5HYFA 3A3YB 4KKLC 3BP4A 3RIAK 3NACL 1OM3H 1NCHA 2DYPA 2JKJA 2M26A 3HC3L 4CRPA 2ZAGA 4FFZL 2DWYA 1Q0XH 3Q6FA 3GGWB 5FYJU 5HGDA 5LCVH 4N1EA 4R7NA 1TEFA 4DH2A 3H2WA 1JFQH 4HWNA 1E4XH 3FUNA 3LS5H 5EZIH 4ZQKA 4FG6C 2YK1H 5FGSA 3LKPB 3GXTA 1RZ8B 4FA6A 1OKEA 1M7DB 1BZ7A 3DPDA 2OI9B 2O5YH 3KPMB 3KWTA 3MGAA 4UQCA 2EDYA 3X1NA 1JZEA 3L5XL 3ZVVA 3X11A 1YEIL 3IGFA 3O4LD 4JQIA 2XN9B 4F8TA 5KYWA 3MOQA 1VZHA 1KFAL 2W1NA 1U8QA 1KEML 3LHPH 4ZW5A 4JFDE 4NFDA 3WGVB 1C08B 1P6AB 3MA7B 5D1QA 1A7PH 4GKSB 3MRLA 1MI5B 3H7BB 4ESKA 3QORD 1QSED 4TQPA 4ZUSA 3FUDA 4E41D 3V0FA 2BP3A 1I3GH 3QVAA 4IJ3B 2FJHB 4HYTB 1A7BA 3D69B 3V7AG 1BIIB 4NQTA 4FQLH 4TULL 4HH8A 2D7QA 1RLBA 2EIBA 4KKNA 2J88L 5D96B 4HKXB 1KXHA 5JLZB 3MNWB 1KN4L 2CDGA 5JNYA 1U2HA 4MQXC 4B97A 1F4AA 2KI6A 3GZQA 5GGSB 4OJFH 4N87A 3NP4A 4CW1A 2BNUA 2ITCA 2DIBA 4NHCL 3KGUA 4YX2L 5IVNA 2BVTA 2HLAA 3OHXA 3UEQA 2FHBA 5CP3H 2QSCL 1Q9OB 5KJRL 1DSWA 4EI5D 3DO7A 4XNXH 1JL8A 2JKLA 5I18H 1YYLL 4HKBB 5EBMB 2PR4L 2JCCA 1KGWA 3EZ8A 4GG6B 1NEPA 5BUGA 1YC7A 1CIDA 2EXSA 4LCWB 2W95A 2CWRA 2R39A 4GRLB 3HS0C 1FZMA 1KCVH 3ZSTA 1IUZA 2X87A 4HJGB 4NZDA 4BQBA 4AIOA 1JPTL 1U4EA 1WWBX 1NUDA 5TE6L 2P5EE 4AWJC 4Q0XL 4S0HA 3INOA 1CFSA 3OR7A 4K3DL 4JX0A 1E2ZA 1Z0MA 4Q89A 1EA9C 5JHDA 4DOHB 4ZFFA 4QY8A 3FU7B 4OW6A 4RWHA 4JG9A 2GI0A 2Q8BH 5FDWA 2EEDA 1PGRB 4QMEA 1ZLWH 4ABQA 2YGQA 2J55A 3DX8A 4N22A 4NKDB 5INDA 2KH2B 3CC1A 4OUUA 3IVKB 1FRGH 4PJ6A 1FGNL 2JH2A 4P49A 5CJ8A 3LNFA 4LEOB 4HJ1A 2VISA 2BMKB 1ZIAA 2J6EA 2EVIA 3TCTA 4N8CH 3VWJC 1T4KA 2NY3C 4U1IA 1DANU 1NIBA 3B83A 5DJAB 1VERA 2XWXA 4IBQA 4UWQB 5JW4R 3FO0H 4MD0A 2Q76A 2GKIA 2O5XH 4QWWC 3OB8A 3Q0HA 4JDTH 2X4RA 4V11A 4WTWA 2EDMA 2Y23A 5B1AB 4Q9RL 1TJGL 2DQGH 3IDGB 2WUCL 3U0WH 3CHSA 1A1OB 4YLQT 3C8DA 4GINA 4W93A 3W0WA 3S4SB 3QJXA 1TIUA 2Q8AH 1B3IA 1I8LC 4RMUA 2JQZA 2FZ3B 3SDCA 2Y7LA 3B2UD 4FTVA 3B9EA 2XVGA 1DVFC 4J3XA 4PR5A 5JPMB 3T0EB 1BBJA 4MNHB 2EO9A 2UZXB 1YQVL 3UTTB 1QBML 4BSVB 2E7HA 5T8IA 3K71A 4EDXA 4HV8B 4JS7A 5IMOB 1EZLA 1XSKA 4JKPL 3WJLC 1CDIA 5F3BA 2WZPD 1S9VA 5JIHA 5CZVL 3BPOB 2WO2B 5FK9B 3QG7H 5E6IC 2ZE0A 4PRNA 5TJWK 1ZSHA 2IDSA 3IPEA 1E5ZA 4S1SH 1PKQA 1RZJL 3CLEH 3H9SB 4TXVB 3D0LA 4TNWF 2OM5A 4MMZA 4ZNEE 1DLHA 4AENB 2IGFL 5EEUA 1N0LB 2NCEA 2ED9A 1I1YA 5I82A 4BCYA 1FIEA 3NJJA 5EOQH 4XB7A 1ZK9A 5LB1A 3IDJB 3QQ9C 2FATH 3WTXA 3SOBL 3OC8A 2O6FA 2QPUA 2TSBA 3WUZA 5IFAL 3VXUA 1DDTA 1A2YB 2ATAA 4R26L 5AOMA 5EWIH 1KBGH 4NC1C 5IK3B 3EOYG 1IC1A 2XBDA 4NSKA 4XE0A 4CILA 2EEAA 3CXHJ 5AVVB 1OAUH 4A7VA 4IGBD 1DJIA 1T4WA 2NLJA 1MRCL 4OKDA 3NDZE 4OBRA 3RWJA 3V10A 4N2IA 3SY0B 4NRXB 4FQCH 3VCLB 1KCRL 2B1AL 1J5DA 3N43F 4PJAA 5ID0A 3VFRB 3MXWL 4U3HA 4G82A 4MTMA 3FQTB 3CDZA 3CXDH 1L5GB 4PP1C 5HJBA 5DT1H 4JFZH 2OYKA 3HG2A 1MFBH 2COQA 4C4KO 5T1DL 5FS5A 2Z31A 4DKTA 2W59A 5AOIA 4X5LA 5AAMA 1EZVY 5I6OA 1RJZB 1OT2A 4P23C 3RL2B 5F88B 3JV4A 4ODTH 1KB9K 2A73B 5FOJA 3E3QE 5DEZA 4F2MB 3FQRB 4DK6A 5KVDH 1UJ3C 3ENEA 5FOBB 2I69A 4DHLA 1JVKA 2WWMD 2Y6TE 2IQ9H 3ZKXB 3H9ZA 5C0AE 1ZE3C 5IROA 2X4QA 3T1FA 2Q7YA 4B9JA 2YS4A 2P44B 4OLWL 2WXHA 5C2UB 5IHHA 3LNHA 1CL7L 1KCLA 2HFGL 3VSQA 3AFLA 2EZ0C 3DBSA 4YFLI 4JO5A 3EAKA 2MEJB 2A9CA 3EF7A 1D5MA 1MVYA 4OD2B 5AYQA 4I0PB 1INEL 1YEHL 4NN7B 4X7DC 3TWYA 1NLBL 2BOBB 3WJMB 1PCSA 2AXGA 1MZZA 4F8PA 1A3QA 1E6JL 1ZE3H 2D7NA 3HI6H 5DDHA 1UWGL 1AHWB 1MCBA 3OM3B 2FB4H 1VFBB 3HZYB 1VPOL 4LPXA 4ALAC 1D5IL 5BNXD 4HIPA 4YSUA 4FZ8H 2DLHA 5IOPB 2DN7A 3ZBMA 4Z0XB 1FG2A 3PGDA 3OKYA 5JR1H 1THCA 2EDWA 4H88L 4WKZB 3V6ZA 2OX5A 3AW5A 5TPWL 5D4QA 4PRDB 5E1QA 1A7RL 3TESA 4DN4L 4Z3IA 1Q94A 1H6EA 1WS8A 4ALAH 3VFWA 2V9RA 3WO4B 4NAQA 1JI1A 4GAGL 4YHOH 3SGDI 2WVVB 4MJIB 4Z6AT 1UH4A 2B4CC 1EHNA 1I7TB 2F7OA 4U0RC 2C1OA 2YHGA 1CE1H 3SJVE 2R8SL 3ABGA 4DP1X 3QNZA 4Y2NA 3LNIA 4NJAH 3ME0A 3EOBB 5SWSD 4Y1AE 2IAMA 4K94C 5BJTA 4PJ5D 5ES4B 2BJML 2XWZA 1MHHA 4PW3A 4MJ5A 5LNDA 1EV2E 1N5AA 2M83A 2DEWX 3IRCA 4KI1A 4JG0L 1M6UA 4JFXA 2B4CH 3C2AL 4PWEA 1BJ1H 3C6LD 3ROLA 2DQIH 3WJJA 3MRDA 4FQQA 3D4ZA 3F04A 1S7SB 3FT0A 3IDNB 4WJG3 4K94H 7FABH 4YHPB 4GSUA 2H4EA 1FL6A 4LSTL 3P9LA 1T5WA 5FHBH 1NC4D 2GK2A 3I9GH 4B9CA 3VFSA 3PXLA 5B4MC 4HIHA 3OL2A 1DYZA 3FTGA 4XX1G 5G55A 3LQMA 4LIQL 1MJ7L 2D7TH 1HZHL 2VWEE 1SRDA 2I5YH 3CC5B 1SN5A 2P45B 4FABH 4Z3HA 1YMME 4AGNA 2BVOB 2IV9A 3K6SB 2WXJA 4NO3B 4PP2B 1SLVA 2WGXA 3RGVA 2UY7B 4JR9L 4PJBA 1S5IL 3H3BC 4GRWB 2J8UE 4OBSA 2AK4A 1KNOA 2X09A 5H37H 5KVEE 5T5FH 2L04A 1WRFA 1DEEA 3GKZA 5KBMA 5GRZA 1QLRA 3GC3A 2XIBA 2DQ6A 1HEHC 3VG0H 3E6HA 1TQWA 3KPSA 4M1GH 4OIIL 2XG4B 4G3YH 4TYUA 4NNPL 1UXLA 5I71C 1Z5LB 1XB8A 1E6OH 4GSDH 4HUMB 1LQSR 2VC2B 3L3GB 4NC0B 5DS2A 3VXPB 2VDOL 1YDPA 3E80A 3MR9B 2QV2A 2KHAA 4JO2L 3DVFA 3VDCA 1Q0EA 1QW9A 5HY9A 2R15A 2XFXA 2I32A 4NLAA 3SCMC 5ICYB 2IOMA 1AD9A 3B3BA 3T6XA 2G60H 2ZUUA 4UTAA 1S46A 2OCFD 3VXSB 2X3AA 1K8IA 2HT3C 1XDTT 2MCMA 5I9QC 4LZKA 4JM4L 1BF5A 3B2DC 4U1MA 4F58L 2WLIA 1BMGA 3L5JA 2WIIB 5DTFA 4HK0B 1GTNA 1IM9D 1NJ9B 1ETJA 3BAYA 3A6CH 2ZOKB 3FU9A 4C83B 3OKDA 3D3VA 2OL3H 1DQTA 3WLWC 1OARH 3O9WD 2DKUA 3MROB 3IE4A 3QFGA 1EHXA 2C3VB 4NPJA 4J3OF 4P48A 25C8H 3SPJA 2BVEA 4HX1A 3AAZA 4JDVA 4LHUD 4JRLA 1XEUA 4TVUA 1BQHB 1QW8A 3FB8A 3II2A 1KTJA 2VDML 4QCIA 4Z5RA 3H54A 5HXMA 3FFCE 3UBXI 3UTSE 4XCEA 2VXUH 5IWLC 2W60B 2Y1YA 3JTTB 4R90L 1XO8A 4DPBX 1F11B 4UINL 3SE4A 3QDMA 4O5LH 5CCJA 3CQPA 5JW3L 3MRIA 5IVOA 4F33B 3P2TA 4AOFA 3GSXB 3MV9B 5F89A 2RBLA 2VLKE 3T0BA 1HSBA 4GP4B 4UTCA 4WFGE 3EH4B 3DXAE 1OIOA 4U7SA 3BZDA 1MCSA 3NZHH 2EE0A 1P7QD 2O6CA 3QP3A 4G1EB 1P4LA 4B96A 5D2LE 3QORB 1QSEB 5DQJA 3DETD 1L3WA 3O0RL 4PBDA 3BSZA 4GBXA 2ORBL 2BSEA 2YMOA 4KWUA 1E3ZA 3TVMC 3QHZH 1MCRA 3S48A 4P2QE 3CFUA 4YMPA 1AOHA 4JCLA 5KANI 1RUPL 1P0SE 3BD4A 3LMJH 3KLKA 4IMLA 4GO8A 4TSAL 5C2BL 3FF7A 4A6YA 3TPUB 4KJWD 5DJDB 1KYOJ 3BPNB 1TCMA 3C6SB 1WIUA 3MBWA 1MCEA 4TLSA 1DQJB 1EX0A 1UATA 4M6NL 3NEEA 1HXKA 1T2QL 2BNQD 1YNTA 3QH3A 4LCCC 3BKCL 5A6IA 3KM2A 2JQMA 1QR1A 1LE5A 3MLTB 5KYUA 5C08D 2HT2D 1QLFB 4G5ZH 3BLPX 3VXOB 2VDQH 1U8MB 4Y5YC 4K5PA 2GSGA 1N2RA 3IFNH 4AUJA 1J9CT 2JB6B 3WXVH 2HWZL 1PG7X 1TTFA 3VFVB 1FNEB 4FRWA 3U2JA 4GAJL 5L2KA 5GSVA 3GBDA 4Z7IA 3G5YB 1XB3A 1BQLH 3T8VA 2C9XA 2LW3A 5DJCB 3LZRA 4XBGB 3BD3A 3LRLA 3FSWA 3MLWL 4J3TA 3GTTA 4YDKL 4PM1A 4I18A 3BSHA 1FIGH 4JN1H 5D1ZC 4LOFA 3LB6C 5E2TL 4Y2DD 3EJCA 3BGMB 4MJ6B 4GOSA 4PJHB 5ADOH 3BJ91 5GRVK 3UEZA 1H3VA 4OFIA 2D0FA 2G5BA 3VD7A 1DDHB 2D31B 3RNQB 4C54A 4P3CH 4U6XA 1U8LA 1M71B 5TQ2H 2VE6A 3JZYA 4OD3L 4R4ND 1F6LL 1KN2L 3MACH 4OIAA 3FNKA 5GGUB 3OKNA 5AYUH 4AV4A 3KLHC 3BQVA 2B0SL 1VGEH 4JGJA 4LDEB 1JI2A 2NY1C 2VJ0A 3WENA 1CDJA 4KUCD 3BPLB 5CMAB 3EO1B 2EYRA 2FGZA 1CXKA 2BS8A 3NZ8A 2YO3A 3TCLA 3P4MA 1FV1B 3LXCA 3QPXH 4BDVA 4AQ8C 4YQXH 1IAKB 1MIMH 2XOTA 4AM0A 1CE6A 5B39A 2IANA 1MFUA 2CO3A 2FLMA 5CJXC 4JDEB 4ZUUA 5J6HA 3HLAA 4J27A 4L0YA 4AEIH 4KTDL 4M56A 4RFNB 3ULAB 2KLTA 1DQML 4Q9BA 5JHLA 2AJZB 1MZYA 3QJVB 3ATFA 1JF1B 4GJTB 1ZA3A 3GGWA 3OPZL 4V1DE 1Y0LB 1FPTH 3CCHB 4HS8L 2PXYD 4NFCA 3F5WB 3LKSA 4PRHD 5DJYB 2P5WE 2FWSA 1ADQH 4KUZH 1XCQA 1JCKA 1LGVA 2GUYA 4APQD 2B7DT 4BBWA 1Y7VA 5E70A 3QE5A 1JK9B 1JWMA 1ACYL 3LKPA 1H5BB 4P4KD 2Z8WC 4WWOA 1RZ8A 2CK0L 4JPKL 4XRCB 4YHNB 1Y6MR 1PL3A 3OAWA 3KPMA 4A39A 5I5IA 1DBBL 4ZOCA 3R18A 5C92A 3P77A 3TZVB 1EO5A 1DP0A 2XN9A 3CFTA 3WIFB 5DZ9A 1DJXA 3KR3H 4LPWA 5D8JH 3MA7A 2WYZA 2W07B 1MI5A 3C5XA 1LL1A 3ESMA 1O9WA 3IDYB 3CUPA 4F8LA 2IMMA 3VGAC 3SGJC 1PNCA 2J6WA 4BSWB 3HE7A 3O3BB 2X3CA 3ML8A 1D7BA 1BIIA 2VMDA 2LABA 4IGBB 4R4FL 2J20A 4YBHA 5EA0L 4HKXA 3QXVA 5GZNA 1NL0H 3R7RA 4WTZA 4EOWL 3BGFB 4M4RB 3U6RB 3A67H 1XGPB 5GGSA 3D09A 5GPRA 1OE3A 4I8DA 2B2XL 2R29L 1J0JA 1CBVL 5I1AB 2VZSA 3FO9B 1HFUA 3SE9H 1S7XB 4JFPB 3HPJB 5DHXB 2OCCB 2FX9H 4B95C 2P26A 1LO0H 3ZL2A 1RERA 1PNDA 5JW5B 5EBMA 3LKOB 2NXZC 3CDFA 4GG6A 4LEXL 1UWEL 1OAKH 4Z3GA 4LCWA 5BUPA 5KVFL 1NCTA 3W56A 3RI5F 4BWWA 2I9LA 3K5SA 4C57C 2GY7B 4RGMB 5L6YH 4GMSL 5ERWB 4AM0Q 1HU8A 1P2CB 3SE8H 4BQ9A 3E3QC 4XE5B 1IQWH 2ZYIA 1DQQB 2WXOA 1T83A 2WTPA 1UOKA 4LLQA 4K9EC 5IHLB 3GEWB 3QJOA 2XI9A 1AI1H 5D7HA 5KSBB 3CHPA 4IRJC 4UQBA 3OAYH 4O58L 1M53A 1EO8L 1JRHL 5D4IA 4HAGA 5CFAA 5EEYA 2CCVA 3SO3C 4L5FL 3TF4A 3IVKA 1YEJL 1PMYA 1B2WH 2D7OA 3CGTA 3U30B 4P2RD 1A4KB 4QRUB 4K9EH 4YR6A 1U93B 2BMKA 2VYRE 4ZFGL 1B0RB 2OMTB 4O02H 3VI3E 3D50A 1UA7A 4YE4H 4AXWB 4TSCH 4NKOB 2WZAA 4FNUA 5DJAA 1N64H 3L3OB 5DFAA 2WQAA 2C3XA 2QT6A 3MC0A 4LO9A 1XTLA 3PIQB 1T1XB 4MS6A 1HX0A 1NAMH 4EUPG 1PLGL 5LGJB 1E4WH 3VI3F 5HYJE 3SZKC 4RGOH 4LLMB 4ZFOA 4XN1A 2DM4A 3BWUF 4MA7H 1UD4A 1JV2B 4LFHD 5JO5B 1AR1D 3MV7A 3VH8B 1P84K 1E5CA 1M1SA 1G0DA 2XTSA 3GJFB 4Y5XC 3MHZA 3RWCB 3S4SA 4ECNA 4HWEH 4PJ5B 4AVJA 2QPEB 2ZQKA 2ZUYA 1WV7T 1P4IH 1U42A 4ZBJA 4DVRL 2FZ3A 4ELMB 1IVLA 1TVBA 3ILEA 2H2PD 4HBCH 4KRPC 2AQPA 1Z9PA 1TMQA 2CUIA 5GGQL 4XVUD 1SY6H 4MNHA 2UZXA 3B7SA 2NY2C 2Q9OA 1J0ZA 3UXFA 2P4AB 4XCFL 2JCCE 1TKWB 4X4KA 4OM1H 4LSVL 3AU1B 2W38A 2XBZA 4ZW3A 3JWDL 2H26B 1CG9A 4OZFG 4U6VL 1WBZB 1EXUB 3OKKA 2I9TB 1NC4B 2X4PA 2VDNH 3KXFD 4N1CA 1BD2B 1QTSA 1QP1A 1WA1X 3A6BH 4Z1PA 3AM8A 2AS5M 3GJFK 3O8XB 3EUUA 3H9SA 3OX8B 2A38A 3PPSA 4TRPH 1ORQA 3GPEA 4K15A 4PJDB 1IBZA 3TA3D 4NT6B 3UACA 4AENA 1N0LA 1FC2D 1FYTA 4OV5B 3X1BA 4EF3A 1CDHA 4PYGA 3EYFA 4GUPA 4MQTB 2J5LB 4ONGL 2VLJB 4GSXA 5T3XL 3WKMH 1OF2B 3ZDXE 2PO6D 3ABLB 3KPRD 1KBVA 2VWEC 1KENL 4PVLA 4QIRA 2M8XA 4KU1A 2APVA 2EDHA 4FGMA 4PCYA 1ZHNB 4OFKA 3KYMA 4FG4A 2HTLC 2WZ6A 3FTYA 3QJTB 4XXWA 3ZDXF 4UT7H 3SE3A 2WWKT 1SN0A 4N0RA 5DEJA 3NN8B 4XNDA 1I8MB 1OP3K 4NRXA 4UNIA 4I1RA 3VCLA 5E08H 4LPYA 5D7JB 3SBPA 5EEVA 2LVCA 1FZJB 3I74A 4I7ZC 3I2CL 4XVTH 2GAZA 3FQTA 5JUEH 1L5GA 1KXVC 3D07A 5EPMB 4OFQA 1A9EA 5I17B 3FDWA 2HKHL 4OCMC 4OZGB 1ZTXH 5GGVH 3IJHA 2PCPB 3MQIA 4PLOB 1OGAE 1OAXL 2HVKA 2OPCA 3RZCD 1G7LB 1SXAA 1NBVH 2A0LD 2LLLA 2Y4SA 3PJSB 2H0JA 3RL2A 3VXTB 5KVEH 3IN2A 2A73A 1U58A 4N2GA 5C6PB 1GY2A 3W0WE 1SXCA 3UAFA 3FQRA 5KSAB 3C75A 4AX3A 4F9LC 5E8EB 1I7RA 5FOBA 3DTXB 3ZX1A 3HRZA 2VR5A 5CGYD 1J8KA 2A74A 3OAZK 4OCLC 3FTZA 4HUXB 4MQ7B 3HE6C 5ICXB 1CN4A 4YAQB 3AQDA 4PYHA 1ZAGA 1QRKA 3WEXB 1IM9B 1KB9J 4NQUA 5JOPD 3UPRB 2LV4A 5L4MA 3OF6A 3CHRA 4YDZA 3ZTEA 1SN2A 4FTDA 1EJOH 2FUTA 2Z91B 5TQ0H 4JFYB 2ICCA 1A6TA 4CADB 4I0PA 1N3NB 4ZXBD 2X2IA 4J3OC 3WJMA 2WCPA 2XWDA 4LHUB 1AHWA 3CVHH 1VFBA 3EYUL 3HZYA 4IIQB 1CI5A 5DVPA 5CCKL 4FFWD 5TDOA 1USZA 1C12B 5TE7L 4ZTOH 3SGDH 5CLZA 5IOPA 5J5EA 2ZUQC 3CFBB 3RVTD 4WO4D 4GS7B 4HUKB 4J3OH 5AZEL 3MRMA 5ANMB 2A6IB 3LIZL 1BEYL 4PRDA 3VXUE 4XMLL 1R34A 3RY6C 4OZHF 1YCSA 2DQUL 5BPPA 5BVJB 5C0IB 1R3KA 4RETB 5FYKH 1FFPA 3WD5L 1PY9A 1I7TA 1KPUB 1DJZA 5DJ2B 2FQFA 1AP2B 1MRDH 1CTOA 4M5SA 5AAWA 4PJAE 5DGQA 3ZRSA 1RVFL 4M43H 3QAQA 4HWUA 1AQDB 1P4BH 3I6KA 2CALA 4ZMWA 4UQAA 2MKWA 4XC3H 2ZWKA 3QNYB 2R0ZL 3T0VA 2CPUA 2VXSH 4LHJB 3RL1B 1LEKB 4K5OA 5BV7C 1MNUL 2YXFA 3PWLB 5GJSL 4NQDD 4IBVA 1ILSA 5JDSB 1X5FA 3QUYC 1HAWA 5EOCL 2VAJA 2CK2A 2LFGA 3CN1A 3Q6GH 4XN8A 5D70L 3IDNA 4LLYA 3KH4A 4DVBA 4YHPA 2UXGA 3I9PA 2BNQB 2EXWD 1EPFA 4TVPL 2AAAA 1NWPA 1WFMA 1UWXK 4N0UE 5E5MA 2WANA 5C08B 4DF9A 5BV7H 2VZVA 4MXWL 3VNZA 1ERNA 3V7MA 3B8YA 2CJUH 1BVKB 4YL4A 3LKNA 2BVOA 5J89A 3K6SA 4PP2A 4NM4L 3VTAA 3PV7A 1MOEA 2DLIA 3WAJA 1WAPA 1AXTH 2AEQH 3NTCH 4KKPA 4L3AA 4WK4B 5I5JA 5HDLA 4DEPB 3M8OL