3MU3A

Crystal structure of chicken md-1 complexed with lipid iva
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
b'EWPTHTVCKEENLEIYYKSCDPQQDFAFSIDRCSDVTTHTFDIRAAMVLRQSIKELYAKVDLIINGKTVLSYSETLCGPGLSKLIFCGKKKGEHLYYEGPITLGIKEIPQRDYTITARLTNEDRATVACADFTVKNYLDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein MD-1
molecule tags Immune system
source organism Gallus gallus
publication title Crystal structure of soluble MD-1 and its interaction with lipid IVa.
pubmed doi rcsb
total genus 30
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3mu3A00
3RG1C 1NEPA 3ULAB 3MU3A 3VQ2C 3M7OA 3WEBA 3FXIC 5IJBC 2E56A 5KWYC 1WRFA 5IJDC 2Z65C 1KTJA 3MTXA 3VQ1C 3B2DC 3WEAA 3T6QC 2HKAA 4G8AC 5IJCC 1A9VA 2F08A 1AHMA 2Z64C 1AHKA 2E59A 1XWVA
chains in the Genus database with same CATH superfamily
3VYPA 3EF7A 3UTSA 1UB6A 4WI7A 5AQ0A 2DQIH 2KL6A 2IVFC 4MCMA 4WWOA 4JO1H 4UV4L 5F7BA 1L0XA 5LGHL 3EO1B 3OKYA 2F5AL 1XSJA 3GJEB 2IPKA 4E36A 2X6BA 3TNMB 5LQBH 2KH2B 3MNZA 1WFMA 3X13A 2EXTA 4CU7A 5DMYA 3LKQB 3PQYB 5C0EA 3MUGA 1UKTA 4Z3GA 5LUMA 3H42H 3N9GH 3FMGL 1T21A 3EYSH 3S2AA 3PJNA 2R15A 2XTSA 1AR1C 4BQBA 3A21A 3CCHA 4BZ2L 2AEQH 1EJ6A 3QPXH 3GRWH 4I2XA 3STZA 1OGTB 1AP2A 2GUOB 1S78D 2FJGA 3LNHA 1WBXB 4PJBE 5H2BB 1XR9A 2NXYD 4GW1B 4UTCA 2NQ3A 3VGAB 4F37K 4P5RA 1SBSH 1NAMA 1S7TB 2YMOA 2X7LB 3SGKA 4E42B 4EN3B 2WXQA 1JMXA 4NAQA 2ZONA 1J9QA 1T2JA 3GIZH 1NEUA 4WFED 3M07A 3G6JA 5DXWA 5CZRA 1RULH 2R2EB 3GMMB 1OALA 2WBJB 3TCLA 5I6NA 5C2UB 3N5AA 5MHSD 4Z23A 5B38A 5CF3A 5IREA 1CR9L 1MFDL 5A2KH 1PLAA 2IADB 5B7MA 2DQ6A 4F1SA 5E2WH 3F6LA 4FLQA 3MLXL 2XLLA 3F58H 1PG7W 2X9ZA 3JTBA 1J05A 4PJIA 4DP0X 1T03L 2C4FT 1H8OA 3WUWG 1S9YB 1MFMA 5DZJA 3VMOA 3FUIA 4L1SA 3Q3GA 4W70A 4GSDL 3Q1SH 1ETB1 5AZ2H 1B2WH 3S3PA 1E42A 5AAWC 4AIEA 2QQNH 3CFMA 5KW9H 1BX2A 1NSNL 4HLJA 4Z95L 1OTTD 1A7QL 5CNHA 2I9LA 4Y8AA 4M1DL 2DD8H 4BKTC 2PPEA 4IOSA 4YZFE 3QUZD 3SE4A 3OKKA 4JQXA 5E8EA 3DTXA 1A02N 1YYML 4XCYB 1A9VA 4PRNB 4XP1H 4Z7WF 2BCKA 2E76C 3RWEB 1YAZA 5F0MB 1LD9A 1CUOA 1YEIH 1O9VA 2DH2A 4CVWA 2GJZB 1ZWIB 3RPIA 1IQDA 4MJIE 5IMKB 3ABKB 4K9EH 1FV1B 1X6LA 2FECI 2QADB 4ACTA 2QR0B 3WV0A 4OZFA 1HN1A 3L48A 1NCHA 4X5WA 3SY6A 3EAKA 1NIEA 4RMRA 1TMQA 4BH7A 1T83A 1RVFL 1AVAA 3FU5A 4N6RA 2X4TB 1MCCA 2OMXA 2AGJH 5F89A 2V2TA 3HBGA 4BKLA 1PG7L 4NQED 1FUNA 2YUXA 1A14L 3TIDA 4OI8A 2BFVH 1EEUA 5D1QA 1QFWL 3N1PC 4JJ5A 5EOCJ 4YQXL 5JIKA 2DDQH 1F2XK 5FWRA 1LHZA 2B59A 3HNVL 4R26H 2WINA 4DVRH 2CHDA 3T4AA 2V33A 4Z7UE 4NOBA 4I85A 1MEXL 4PRAA 3MLYL 5D5ME 3UZQA 1E4KA 4G83A 1XH3B 3ZZLA 2IAMA 3ZE0B 1WGOA 4JFFB 4AZ8B 4Y4HC 3TCXA 1OF0A 2Y06L 1QNIA 4HCGA 4LLWA 4XPHL 2YKLH 5HDQL 3FULA 4DGYL 1SXBA 2LLGA 3S4SB 3KPRD 5E9AA 1TZGL 1MREL 4E2OA 3P4MA 4I4WA 4X8JA 2VMEA 2XBDA 4LIQH 4GRWE 4HA1A 5FOBA 5CJXA 15C8L 4ORGA 5HYJA 3NFNA 3LQAH 3VWKC 1YQ2A 4JGUA 4OZFG 4JO3L 1G6VK 2E6PA 4OF7A 4XVOA 1WA1X 1IFRA 2BH0A 4WFEE 4M6MH 1CE1H 2Z4TA 5IUCA 1JGIA 1HE7A 1W72L 5BV7H 5I28A 4DP7X 4JFDE 2IH3B 3KXFA 1FNEB 4AGPA 1TFHA 4YHML 4AIOA 1RZGB 3DVGA 4XMTA 3BWUF 1NGXB 4MD0B 2AXHA 4ADIA 3CN4A 2BC4A 4DP9X 4EI0A 4ZFOA 4LHUD 2OS7A 3HE7D 5CMAB 3U4BH 4YSEA 1CCZA 5KSAB 1YEHH 3JV5A 3VX1A 1T1ZB 2E7MA 1R3IH 1ZANH 3BWZA 4J3TA 1CGUA 4H4NA 1EVUA 3P3TA 2Q2EB 3PWPB 1N18A 4HJ0D 1W0WB 4UQDA 2YD4A 3ZTEA 1HZHL 1N64L 2CLRA 1FCGA 1EX0A 4PH8A 5KYXB 4J39A 3CZNA 4E5XG 4ALAH 1FZKA 3ZUCA 5JLZB 1OGSA 3GSVB 2WP3O 3CFDA 1EZUA 4NC1C 4JKPH 4OJYA 4JZOA 4A2GA 5ILTH 1BVNP 1I1CA 4OIFA 3WE6B 4QAMB 2V2WB 2AJYL 4EJ1C 2MKWA 1DQML 2F15A 1NFIA 1KYUA 1FL5B 4KXZI 2Y7LA 2BNQE 5ESAB 4BZ1H 2CM6A 3KVPA 3VRIB 4RWYL 4HT1L 1T1WA 2HG5B 3P4OA 4FHJA 2ICEA 3FO9B 4UQ9A 4ERSL 2PCFA 3EH3B 3MLWH 3QDME 2OQJA 4OJDH 1MJUH 2OMWA 2NY3B 2D7PA 1F4YL 1NIAA 3JWOH 1MCJA 2P48B 3NAAL 1S7QB 1J1OH 2A6JB 2WXLA 1U8PA 4TM9A 2WYHA 4QRPA 4WY7L 3NIDB 4PJ7F 3ZDXF 2ZOKA 3BZFB 3VO0A 3TTYA 4X4YB 4UBDC 1HH9A 4HIEB 2ZNWA 5D72L 1AAJA 3G6AA 4NQDB 2Y72A 2R0LH 3ZKND 4F9LC 1XGTB 3QCTH 3AABA 3EDKA 4F7PA 5F1IB 1P6FA 1S9WA 5CEZD 5TH2B 1COBA 4X4KA 2G0KA 4XXDB 1M7DA 4HX1A 1I9IH 3BPNC 3BKJL 3BW9B 4R6UA 4JM2D 1HKFA 4G7YL 4NCC1 3SGKC 2FGZA 2FJGB 2CKBA 3RI5F 1A1OA 1VACB 5F6HI 2DYRB 3C8KA 1OT4A 2YA2A 4KFMA 5JDSA 2DB8A 1O5PA 4MJHA 1R5VA 2MMXA 5FM5O 1I9IL 2NLJA 4UT7L 4Z7WA 3DHJA 4F8TA 3CFIC 2DV6A 3FOMA 3F7PC 3FONB 3F65A 4X6BB 4W9KC 3ZLQC 2OKMA 4XOAA 3RZCD 2VZSA 3JUZA 3F8UB 1ORSB 4JZJC 2XNAA 4O2EB 1IAII 2XG4B 3IWVA 4OLEA 4D94A 2YJLA 4WHTA 2F7IA 2FR4A 2FJFA 3GJFA 1RZIA 3I9AA 4FQXB 3T3PB 1CFMA 4EBQL 5DJZB 4ZUWA 1XTMA 4GSRA 3C9NA 5EORL 3GHBL 3UACA 3KPOA 5TDNA 4KXZH 4RRPA 3T0DA 2V5SA 4RISL 2F58L 3SKMB 5L0QB 2ZKXA 3VQLA 1QG3A 4AGLA 4TSCL 1V05A 4MCYA 5E6SB 5D1QE 1JV2B 4NCC2 3T04D 4KI5C 3X11A 3CSPA 1JFQL 1A5FH 2DLFL 2NY7H 4XGZA 2C9QA 2HT3D 4WU7A 1H5BB 2A6KA 4NQCD 2VLJA 4Y2DD 4GSXA 3ZQWA 4FTVB 2MQ3A 3O4LB 1MLBB 2KLRA 3L08A 1KTLA 2CK0H 4A66A 5DR5L 4HC1A 3C60B 3ZDYB 3WELA 1BD2A 2B20A 4Y4FD 1PG7X 3L1GA 2I5YH 1FAIL 2N01B 4ZW3A 4NNYB 4PRNA 4Q52A 3AC0A 2C34A 4NRXA 5K39A 4WUKL 1HCYA 1MW2A 4F7MB 5SWSA 1CL7L 3V0VB 1XVSA 2ESVA 1D7CA 1AGBA 4M5YL 1M6OB 1A21A 4FXGC 3V6BR 1FL5A 4LKCB 1FNGB 2YAFA 3GSXA 3MUGB 4ZO9A 3CFNA 1ZPUA 2VDOB 4LHUA 5ERWA 2J43A 3FQ2A 3AFLA 1WJ3A 2H26B 1G7MA 3FTGA 3D3VB 4Y16D 1YEGH 3JVGC 3DJZA 1QKZH 3QR1A 2YGVA 2J5LC 5BV7L 4X6EA 3HG2A 1ZA3A 4YXKH 4IW4C 3BP6B 3ZDXB 1X6NA 1QTPA 3AJ7A 3WTXA 4J4PD 5AYUH 3PXJA 3TVMD 4UOZA 1NGPH 5C0CD 5CP3A 2VXUH 4HFUL 1KXQE 1W8NA 2DYSB 2G0LA 5DHDA 2B5IC 4K3DH 4Z77A 2ZF9A 4AGOA 3B2PA 4A7TA 4N1CA 4XHJC 4M43H 2XYBA 4J3BA 3RZWA 4H7VA 3LKPA 5DRZA 4Y19A 1DBAL 3QT2A 2YPLA 1I9EA 1I85A 3FB7B 3L4TA 4X83A 3BW9A 1OVZA 2ZYHA 1II4E 2W81C 4QMEA 2EEXA 1O6VA 1YUKB 4CADB 1AQHA 3ILPB 3HMWL 2BVQB 4ZXBC 4K8RL 3QWRD 5E8NA 1BZ9B 2X05A 4NZ8A 3BVDB 5E0FA 5GJSH 3QW9A 2EVJA 1ZHNB 3UC0L 3EYUL 1BQLH 2KYIA 1F4HA 1CFBA 2EDKA 1QUNA 1HCFX 4HIEA 2WBJC 3R06B 1SMDA 3RBGA 2ZIDA 2FQFA 4N26A 1EANA 4QCIB 1E4KC 3ESMA 2FATL 3QUXD 4F15C 3WJMA 3PPSA 1EDQA 3ARGD 4R90L 5LBSH 2ZICA 2B14A 1U8JA 3DHPA 4BCXA 2YSSB 3GHEH 3C5JA 4NO2A 4H2CA 1I8UA 1I7UB 3L4CA 5F1NB 3SDDD 3T4YA 5J13C 4JJ5B 1H3UA 4P2OC 4F7TA 4NJAL 3GIVA 1HAUA 4JKWA 4WI9A 5CD5C 4MMXB 2N4IA 1DN2A 2LABA 4HD9A 5T3ZL 1ZGLP 2VW4A 1LO4H 1KCRH 4CGUB 1KCKA 3AUVA 5KS9B 1XCTA 2CO4A 1UA7A 3VFPB 3BKCH 3HC0B 3N55A 3UTPE 2H45A 4XBPA 2AGJL 2Q7NA 4LPUA 4LCIH 3VE0B 1RJZB 3E80A 3MV9A 1UM5H 4HJSA 1E40A 1NEZG 1PZ2A 2GJRA 3A5VA 3WIHH 1KTRL 2Z6FA 4Y4FA 4HZAA 1OZTG 3GGWA 2GHZA 3PABA 4U6XA 1YG9A 3FB6A 2MCPL 4F8PA 5HPMA 4KKBD 4YHOL 5BOPA 5EZLB 3B2VL 3L13A 4MAYB 3CVBA 2HRHA 4HUXA 3LPWA 4PV9A 1BM3L 1VAHA 2O5YH 2VXVL 4PM1A 4NIYE 3VCLA 4L9LB 1MW0A 1NLBL 5DEGB 2GVYA 5BS0B 1O7DE 3NP3A 1RUAL 4QDGA 4PJEF 2PTTA 4MCZB 3P11L 3GSNH 3BYYA 5LBGA 4S1DD 2LQRA 4HLEA 1YMMA 5EU4A 3ZGHA 3AW5A 4X50A 3CZLA 4KMTH 3B1UA 4NLAA 1T6BX 3A22A 3HCVB 3VGAC 4I4WB 3JZ7A 4C56B 4P5TC 4DFIA 2QFRA 5GGVH 4ELME 1EGJH 2CGZA 3ZE2F 3GBLA 2NY6C 4K5OA 3QFJD 2F8IA 2A9NL 2ARJB 4X80H 3RFZA 4R84A 1KJ2H 4WVRA 4BDVA 5BRPA 1NGWA 4J6RL 3GLZA 4LKXB 4U1JA 4UQIM 3VE0A 5DWUL 2K4AA 3N43B 4LL1A 5GS0L 1HAWA 3MA9H 3ATBA 3SE9L 3QCVL 3HLAB 4XNXH 3OZ9L 5TQ2L 4B60A 3EYSL 3Q6FA 2FEEL 4H1LA 3D0VB 4FLSA 2QSVA 2XWCA 3WHXB 1MFCL 3EH1A 3D52A 1INQB 2NNXA 1E8ZA 3MBED 4U1HB 2BXYA 4ANUA 5E8DH 2FO8A 2Q8BL 4P05A 1I3UA 3DV6B 3KH3A 4MMZB 4ZW6A 3VCLB 1EEZA 4D0DA 2J6EH 2Q20A 5LVEA 2ZOUA 3HE6A 2ZWKA 4H1LG 4YGAB 1WHPA 2ZXBA 5BZXA 1NDTA 2AJ3A 4QYOA 4G59C 2RACA 2V3DA 3QQ3A 1I1FA 4GBXA 3CDGB 4MNHA 4AYFB 4XVTH 2FEJA 2C3WA 4K3EL 4MNQB 5F8RC 2H2PC 3NCJH 2WN2A 3ZJAA 43CAB 1QYGL 4DESA 1JF6A 4K3GA 1T04B 2IAMB 1P4LA 1GZPA 4A38A 1DUYA 2YGQA 1BZ9A 2PCPB 3ATDA 4G6FD 4GRLA 5AZUA 3KS0J 3UBXG 1KLUB 1NCNA 3GSOA 1IGTB 5TK2A 5D72H 2TSBA 4U7MA 3II2A 1CGSH 1E5CA 3F7RA 1SMAA 4L2LA 4U1NA 5T1DL 3V6OA 5HHNB 3INOA 1KOAA 3DX4A 2BS8A 5BVPH 4AQEB 3LQZA 5IJVB 4HU8A 2JSFA 3OSKA 4BUQA 2WOBA 1CI3M 3BGMB 3MZTA 3FQYA 4JM4L 1WH0A 5KANG 2DL2A 2W95A 4Y19D 3SDCC 1E4XH 5JHBA 3S37L 2H26A 3V5KB 1A6VH 4MXQD 2Q7YA 3N1GC 2OR8A 3IDNA 3K5RA 3L4WA 4YE4L 5CJOL 5F1NA 3FUNA 3OAWA 1K2DB 4ONFH 3L7FA 1JSYA 1RURL 2XZCL 5IG7A 5DCCA 2R4SH 3MLWL 2P5PA 5C07B 3JTSB 4X7FC 5T3ZE 1JRHI 5ISZE 2FL5A 4ELDA 4RVBA 3CNKA 2X6CA 4OZHA 4W9LC 1F1AA 1JWMB 1KJ3L 2VC2L 5EF2A 2GAZA 4XWGH 2E9BA 4F58L 1BM7A 4WW2F 3WHE1 3J2PA 3M6DA 4B9CA 2DMCA 4H25B 4GAFB 4GEIA 5F97E 4D8OA 5TGBB 3VGBA 3S48A 3VDBA 2JKXA 5T3ZH 2FX9L 1RLBA 5IKCA 3K6NA 2AQQA 1JXDA 3MPCA 4OZ4A 1KSRA 2IGLA 5AB9A 5CEYB 2Q9OA 1UQSA 3NSDA 3AAZB 3QQ9D 3SCMA 4JHAL 5JHDB 2NZ9D 2OZ4L 3SKMA 3UZVA 4V1DB 3TBYB 3ATAA 1GSMA 5E94B 3WENA 4YXLH 1NCBH 1I8KB 1I1AC 4FKEA 2DQGL 5D7IF 4NX0A 3KLLA 1GAFL 1U42A 2PYEA 1J0JA 2JTDA 5C0BB 1JUFB 3ZOAA 4JY6B 3J27A 2WLJA 3GDBA 4LIQL 3L7EA 4U3SA 4JPKH 1I85C 1J8HA 1WE5A 4LK4A 1CICC 4NZUL 3Q2LA 1NIFA 5AVYB 1TETH 1Q90A 5A7BA 1E4XI 1GPOL 1PD1A 2MPAL 5C0GB 2BNUB 2PPCA 2WKLA 5CKGA 3CFJA 1IAIL 4X9YA 3RLSA 1YEWA 4N8CH 2A9AA 1IZJA 3B9KA 2G2RA 4A2FA 3S8GB 5IJKC 3DUUA 5HDWA 3HS9A 1BQLL 1EFQA 2DYPA 5CINL 5DD6B 3VGFA 2WLHA 1NIBA 3K72B 1IC5L 4WENB 3WNNA 2W0FB 1SNRA 1KBWA 4HFWB 4LOUD 5D2LE 2YPLB 4HKJB 5LBSL 2C7UA 1BSIA 1K4CA 2QTVA 4JRXD 1QQDB 4MQTB 3H2WA 5IJBC 3J07A 4OGAD 3TNMA 3L1OH 5DJZA 2VYRE 4FQ2L 4S1QL 1DE4A 4P9MH 5GZOA 5I0WA 4HEME 4Y4KB 1VEMA 4BH8B 2BWIA 3EFOB 1KLGA 2BOCB 5F7EL 4H20L 3T3MF 2ZPKL 1KACB 4M56A 3FN0L 1RZ8A 3EXJA 4PJ7A 2VZVA 2UZYB 1KUMA 4O02H 2GC4C 4IOSD 4JDZA 4PRPB 4PJ8B 3VVVA 1D7DA 3ZE2E 3IMVA 3QEUB 2GJ6B 2HH0H 3ESNA 3QUXC 3HTLX 4L4TA 1YJDH 3LKOA 3QRGH 4OGYH 4YBHA 2FT6A 4LEXH 2XQBH 2ISDA 3U7WH 5BVPL 1UYWH 3KEHA 1CXEA 2V5RA 1IBHA 1G7JA 5GGUA 3US9A 3D0AA 3KNBB 3MRQA 2R2HB 1I7ZA 3ILPA 5IBTL 3TONA 5FECA 5J7CC 4G80B 4N0UE 3BIAX 2WWMC 1OTTC 3GTVA 2C3VB 5DJ2A 4XI5C 4NO3B 5ICXB 1W15A 3HR6A 2OTUA 4DVRL 1EXUB 5I30L 4OCXL 2R4SL 1C16B 4X6DF 3CPLA 2ZUQC 3VXSA 2EYSA 1BPVA 1HQ4B 3BPLC 4ZO7A 2K45A 3ERXA 5B22A 2H6OA 4U1SB 2BERA 1ZLUH 3FTUA 3PHQA 4A67A 1OPGL 4XODA 4EUPH 4TQ8A 4AT6A 5BCAA 5JLZA 1GIGL 5FV2A 3FZUD 3DXAA 3SDXF 1NCWL 4HGWA 1YC8A 3ALXA 3ASOB 1I4FB 4MNGA 5EU7C 1T7VA 3B9EA 3ESOA 2DQIL 1MCSA 3M1BA 2AQ3A 3LKRB 1CXIA 4TQHA 4D9LH 3D87B 1NWOA 2ILLA 1MWAA 5DZOA 2ZUTA 5EN3A 1B9KA 3VB8A 5E6RB 5KVEE 5EUKB 4DO4A 6TAAA 2E7DA 4WTWA 1AGDA 5I71B 1LL1A 2HTKC 3UJIH 3WMPA 3IF1B 5I1EH 1NCBL 3CX5J 3GO1H 3EJUA 3WMSA 1XAKA 4PVBA 3FF7A 3UTSD 4BBWA 1BIIA 3GMOA 3FMGH 4PGJA 1NOFA 3FU3A 3GZOA 5I0YA 2LVCA 3BPCA 5GS2D 3MO1B 3MV9E 2CO6A 3N3EA 4U4BA 3O0RL 3SDXE 2HZHA 5T33L 2XIBA 4LVEA 4NKOB 1OOWA 4NT6A 5J11C 4O2EA 1AD0B 5MEQB 1TJGH 5T1JA 2BC4B 4LO9A 3UFIA 4AQ1C 2P5WB 1UFUA 4DETA 1AKPA 4YHKL 2WSPA 3JBG7 2R29A 1IAKA 3H55A 5BNXD 2YD3A 3RAJH 3LRSA 4UAOC 1IB5A 2GKIA 3W56A 2VDRB 2XN0A 3VXPB 5E9DA 4I18C 5TE4L 4UT6H 2CLRB 4EIUA 4LRNH 5J1TC 3QDMD 4KO7A 1Z7JA 2XWDA 4IOIB 4YDJB 1AD9B 4L1DA 4WKXA 1AANA 4YO0B 2F53E 3DK0A 2B16A 2I69A 4Z7VE 5GZNC 4QT5A 4X4YA 3MX0A 3QORB 5TQ2H 2ZJSH 3HS0B 4PGBA 4RMBA 3A4EA 2APFA 2Y69B 1TZIB 4HIXH 4OIAA 5IR1B 3FN3A 1TNMA 5SWZB 4POZD 1IJNA 2Z92B 4YXHH 4JFFA 4U7SA 1IGCH 3AQDA 3KPNB 4WJ5A 5AWNL 4KH9A 4F2MA 3IF1A 4P4KA 2O5YL 2VXVH 1YECH 4FC3E 4OUOA 5D6CA 4OLUL 4APQB 5JOPD 4OZIE 4NXKA 3H9ZA 3ZHNA 1UASA 4X5XA 4HAGA 4A6YA 1CD1B 3GRWL 2CNZA 2CSPA 4KKRA 4ZTPH 1BD2E 1KIPA 5JPNB 1HEZA 1MI5E 3UO1H 1C9SA 1UKSA 3P3RA 2CMRH 4HD5A 1HH6B 3DBXA 1UQSB 1IVTA 5CEYA 1PSKH 4TUJA 2F54A 2I32A 3H9SA 2JKWA 1MN4A 1JERA 2DEXX 2VSKB 3IEAA 3KDPB 5IT2L 5I76A 1HL9A 4IK7A 5E23A 3VJ6A 3MTRA 1F86A 3GO1L 2O6FA 4LIQE 1T2QH 3DROA 5MEOA 1SN5A 4BWTA 4R97B 2H47C 3QDGB 5EUOE 3X1FA 4KVNH 2P5WD 3C60C 3HG1A 1M7DB 2QSQA 5K5YA 4RWYH 3T0VA 1U95B 4HWUA 5DJ6A 2H3XC 5DHEA 3RTQA 4JFXB 3PP4L 1CE6A 4UTAL 4P3WA 3AXLB 3QG7L 4OLYL 3TIDB 4XBGB 1AXIB 1ZT4A 3W57A 4TUOB 1RUMH 4ALAC 5I26A 4QRSB 3LOWA 1MG2C 1TQVA 3QUHA 4R5TA 2YPKA 3I6LD 3EJSA 4ZPVA 4L8SC 1KDJA 1BEXA 1K85A 2IGFH 4YHLH 4MA1C 5AZEL 4ERSH 2Y9RT 3N50A 3LMJH 3FUMA 2V2WA 3TN0C 4R4NC 3RU8L 3VGEA 3DPBB 2XU9A 1MIMH 3MXWH 1U8LA 3IRCA 2FNBA 4JFZL 2EIEA 5DHYA 4CU8A 2GB2A 3QDJE 3O45B 1T1WB 2HG5A 4OR1A 3S4SA 3U6XA 1QEWA 3BH9A 4WHDA 4QI3A 4M1DH 2YZ1A 2CE6A 3RBSA 1HNGA 4R4BA 3UTPD 1KCSH 3I74A 2IWGA 4JPVL 4KZ0A 3V9EA 2BIMA 1A4BA 3M1BB 3OJMB 2A0LD 2XKUA 4FQQB 2EJ1A 5EO9B 4M8VA 1H15B 4HBCH 2D3LA 4E9SA 4NBZB 4UNVA 2H7WA 4JPWH 1BOYA 1QMUA 4W6WB 3SJVD 3DX3A 5HI5D 1F8TL 2H1PH 3P69A 1XH3A 5F3BB 1HSBA 1MRDH 3DIDA 4PJEA 3RTQB 3QI9B 3VUAA 1IRAY 2BS71 2VITA 4L9DA 4Z7OE 1C7TA 2CRIA 2YGNA 5HJDA 3H3PL 1G7QA 4ZO8A 3T4AC 5FHAL 1SJXA 2J8UE 2GG1A 3FW6A 4GINA 3KPRA 5TF1H 4CMMB 1I3GL 1A6UL 3SYOA 3EDFA 1QLRA 4GEJA 5FA4A 1HX0A 1RY7B 4JG9A 2CBPA 2V37A 2YQ3A 3DYOA 3ZKXB 3QIUA 2YXFA 2CA3A 3AMKA 4NI6A 3CMOL 2NDGA 2Z31A 2C3HA 4S1QH 1GAFH 4RNRB 3I6SA 5AAPA 1XWVA 2PO6A 5ECJE 1ASOA 3ULVL 4U1IA 1XXDC 2M26A 5TTRA 3UIYA 3ZDYF 4DEPC 1L5GB 5FUOH 2WTRB 4WWKB 1K5NA 4XPHH 3H42L 3N9GL 1CD1A 2HA1A 4CJ0A 1JUFA 1OLZA 1Z5HA 3TBBA 4GUCA 1PJWA 4KUCF 3EBGA 3D06A 1LMKA 1DQJA 4KJQC 2X4PA 3ESUF 3HIZA 3FT3B 4IQHA 4UUJB 5EIQA 5C9KA 2F61A 1UCBL 1VKXA 4BKLB 1AZRA 2BOBA 5D1XE 1Z0NA 3CZEA 1IC1A 4Y4KA 3GXDA 1B0WA 4A7VA 1H19A 1ECZA 3NABL 4F9PC 3U36B 4GI8A 4JHAH 3U7AA 5BXFB 4GUPA 3RILA 2IOIA 1NC4A 2XACC 3DJSA 4K9JA 3CU7A 2CCVA 4K15A 5EA0L 5EZIL 3IETA 3WNPA 3KYMA 2EIZB 5DURB 4AH2A 5GGSY 1NAMB 1S7TA 1XMEB 25C8H 1BG1A 1H8NA 4PCSA 1K8DA 3ZYOA 4HZLB 1UJ3C 3ECUA 1BLIA 2D9QB 2VQTA 4FFZL 5C0AB 3QG7H 5AG8A 4F7EB 4HJEA 4NQCB 2YZ8A 5L8LB 2WXFA 4OZIA 4Y2OB 3C6LB 1MKFA 1WTGT 4CW1A 3MKGA 2W80C 3NTCL 4NBXB 3Q9QA 4PI0A 3BXNB 4YEEA 1C7SA 2MCG1 1UD5A 3ZQXA 1M4KA 2UWEF 4R3SA 1G9MH 4OTXH 4W81A 4U1GC 1DFXA 4ZODA 4UF7C 5E99L 1PEWA 2NW2A 1EERB 1DDHA 2VH5H 4FHBD 2VMJA 2CUMA 3R7RA 1TEYA 4JS7A 4PR5A 4OCYH 3WKQA 5E6ID 4Q0XH 3VW3H 4ES9A 3HZVA 4PWFA 4XH2A 4XVTL 1MFNA 4RDQG 3DHUA 1QX1A 1LP9F 1LE9B 1U93B 1I1AD 2CXGA 1H6UA 2NY1D 1F4YH 4KRMB 3SSGA 3AMLA 3L3IB 4IRSB 5J5EA 3HI6H 1KGXA 3N6YA 1WWCA 3QC5X 4G9DA 4JQIL 4ABWA 1JBJA 1ZE3C 4JJOA 3TBVA 4YK4C 5HYSB 2JXMB 1AG0A 1TQBC 2QGEA 3TWYA 4PP2B 2Y5EA 2Q8BH 4H5SA 4E68A 4PS8A 3BH8A 5FM5M 3ULVD 1ET5A 1SHMA 2F74B 3IDIA 1SM3H 2D0GA 3I84A 3PFQA 4KY1H 4EEEA 4PSRA 3IGLA 3E9UA 1CMOA 2RBLA 2WIIA 1EVTC 5H8DA 3N04A 2HTKD 4M62H 3HA0A 3S0PA 4NN5B 1FNLA 1ETZA 2O6EA 3FTSA 3GJEA 4GG6A 4CW1B 4Y2NA 1K6QH 2ZYIA 4GKSB 2O6CA 3IJSB 2C7UB 1NKRA 2EINB 5DT1L 1BBDL 1QWHA 1DJWA 1INDL 3O3DB 4NQDD 1G7PB 4KRPC 5EUOA 4HXAL 3AG2B 3LB6D 1ILUA 5GGVL 4HKXB 4PGEB 4OLWL 3MRDA 3GZKA 5ICYB 4PMFA 3BP5A 1LEGA 4RDQF 4KI5E 1H9VA 3TBWA 4J3OG 3WD5L 1NFKA 4J7RA 3AADB 2UWEA 2AQSA 1BAGA 1HWHB 3DO7A 4JN2B 1DQKA 1JF5A 2VQ4A 1U91A 2X1WL 4NUJB 4PG9A 4KRPB 3K8KA 4Y16C 4B0MM 2A73B 4JKLA 1MJ8H 3MGTA 1WBZB 2BOBB 2F68X 2NY2C 2PP9A 3L1FA 4CILA 1HQRB 3R19A 1J86A 4JO3H 1F18A 2DQTH 2XBZA 1AR1B 3BH8B 5AW7B 4OH2A 1PNCA 3T09A 4ONGH 3QA3B 1TVBB 2J1XA 3BFOA 4GO8A 3SJVA 4EZMA 4DUXA 1CBVL 2MNWA 1NLBH 1T1XA 4G42A 3QNXA 2VSMB 4ZMNA 5JW4R 4HK3N 4S2SB 1D6VL 4IMKC 5TGBA 4BV1A 4Y88A 2RALA 3TYGL 1ZRUA 1QFWM 4O00A 1BFVH 3FOMB 1M2OA 1A47A 5AW6B 3Q06A 1QASA 2X4OB 4Z7QF 5GRVL 5EEUA 2CUAA 4I3GA 4TSAL 3GSOB 1ZTXE 5JHMA 3UTZA 3ZYJA 4WGWB 3BSHA 4TVPH 1BMGA 1OP9A 1CU4L 2HFFA 5IOPB 3D18B 3ARUA 1QBMH 2JKIS 4UWQB 1JOIA 1FGNH 1KNOA 4XX1G 1HXYB 2XZAH 3IXTB 3TNNA 1NEZB 1G7IB 3OQ3B 4GT0A 1YY9C 1E28A 1B4JH 2NT0A 4PR5B 3QI9A 5KEZA 2OFQA 4F2MB 1TQUA 3VI3F 4D7BA 2L7JA 3KPMA 4X7TA 4Y7MA 4OJFL 4WAFA 2J71A 3DHMA 2EKSA 2WQRA 5IG7B 2XWJB 3FYIB 2IBGA 1QSZA 2EXYD 4HIJB 3FFCD 2BM3A 5D2NE 5HI3C 4FADA 2Z31C 1YQVL 1NH6A 4CN6A 1BVNT 1IX2A 3SKJH 3FL7A 1UWGH 4YHNA 2R27A 4JPKL 4AVHA 5I8OH 4HV8B 4U7KA 3HN5A 1NGQH 3VFVA 3IGFA 4P2QA 3CWGA 2WWNA 5EBLA 2VLKB 5CD5D 3P4OB 1T3FB 2HH0L 5KS9A 3MLVH 2XWZA 4RSVA 4TPRH 9CGTA 2FK9A 1VENA 2CIKB 4XO8A 1K5NB 5BQ7B 4JRLA 4WO4A 3DPBA 1G43A 1K4DB 2XXCB 2PETA 2WV3A 4XN8A 3RIAK 4EN2A 5AKTA 4TSBL 1LE9A 2X4PB 1SHSA 3D0LB 4TNVF 4X8CA 3TZVC 4JKPL 3BH9B 1NGYB 3ZDWA 4YSCA 1SQ2N 2A38A 1GZQB 3PGFL 2C3XA 4LEXL 1ZLDA 3WN5A 5DYOB 3H3BC 4ODXA 3G6DH 2VLJD 3CJJA 4YZWA 5HVGB 1QFUL 3AU1A 5CM1A 3NCEB 2WQVA 1EQWA 4FXKC 2RR3A 4MD4A 3KPPA 5D9SB 3VD7A 4ZSOB 2WUBL 4PY8I 1UZGA 3CDGA 3JSSA 4MNHB 1V7NH 4JFQB 3QUKA 4Z3FA 4XO9A 4F7CA 5FYKL 1HSBB 3S97C 4L4VB 1MZZA 4X6FB 1GHFL 5JOEA 4B9PA 3U25A 2HJLA 2EDQA 3C6EA 1LK2A 1PD6A 4M9OA 4P04A 3VI4E 3ZIYA 4HZLA 4LL9A 4Y5XB 3NJKA 2OXHB 5EB9A 4ZFZA 4FFZA 4XCEA 3PABB 4U6XB 1G1OA 2VNCA 3ZKXC 2IMMA 3V2AR 1TUPA 3ZHFA 4JQXC 3RWCA 3BDYH 3M45A 3P54A 4K7FA 3MBWB 5CILL 4Z1PA 4PTTA 4GG6E 5HHNA 5DSCB 2W0LA 4MMXC 4FTDA 4Y4KC 4AEEA 2ZXQA 2R1XB 5GZOC 1EFXA 3UAJA 1H15A 3PXHA 3HG5A 3TJEH 3VRIA 1LYQA 4R8WH 5IMLB 4YSRA 2R51A 2R69L 5K33A 1YN7A 1GA2A 1W8OA 2Z35B 2DMGA 3UPCA 4L0ZA 2MJWA 4B9YA 4FQXD 1FGVH 1U8OA 1E9QB 4LLDB 4L37B 5IHWA 4XB8A 2VDLH 4OV5B 4J1UA 1AHKA 2FYYA 5CCJA 1S8DB 1FZKB 1UWEL 2WINB 2YSSA 2JF1A 3FU6A 1AHWC 2RMNA 3QDJD 4Y1TA 2CLZB 2NY0B 3WO3B 5KBLA 4R5XA 3H0TB 5IEHB 1MIEL 5T1KD 3DOHA 1DBJH 3AXLA 3BZ4B 3OHXA 1A14H 3VRJA 5JDJA 4YBLC 5MENE 2W60B 3QRFM 2J44A 1BIHA 1HL5A 5K59F 3RWHB 4RETB 4POYA 1IQWH 4TTDC 1WAEA 4YFLI 5ISZA 3V6OE 2Z9TA 1S46A 2DIAA 3FO0H 1CICB 3EIFA 3MOQA 3ZDZB 4KK5C 5JXAH 4LBAA 2F58H 2UY6B 1TZHB 1IIIA 4PS4L 3AXHA 3IGKA 1A3RH 4Z3TA 2MFNA 1U6AL 1NFDA 1RJZA 3UH8A 3P4NB 5MHSE 3T1FB 3UMTA 4ELMF 3HR5A 5FA3A 1TZAA 4X4ME 3RIAF 1H3WM 2IOOA 1FE8L 1F11B 5FKAA 4G11A 2EVHA 2H0JA 3RUGA 1CXHA 1CDYA 1YEDA 4DKAA 4K5PA 2W0PA 3WE1A 3GRGA 4IDJH 5CO1A 5E6IB 4FP8H 4R0LA 3CBKB 1H8SA 1EJ8A 2R0ZL 4PJEE 1MSPA 1SXSA 3VTTA 1F3DJ 1RZIB 4LOEA 4Q2ZB 1W6WA 5GS1B 4ZUTB 1E43A 4Y9FA 3JTTA 1SFDA 3O3BB 2EACA 5IHHA 3U4KA 2GTZB 2BP8B 3LN4A 4HHAA 5T3XH 3B3BA 1JIBA 5DFWH 1EAJA 3V4VL 5D2NC 5BZWA 3S37H 2OCFD 5EOTA 1NCJA 3D5OF 1UM6L 4P3CL 5JOPE 1X5ZA 4JN1H 2E9IA 4I3SH 1JZIA 4JFEB 3Q1EA 3T0AA 3WXVH 3EZJB 3FAWA 1YMHB 2W1NA 3SPIA 4Z6AT 3V4VH 2JKRM 4EI6B 5AW1B 3WNKA 4ECNA 1A6TB 1QACA 3ZSSA 1J9RA 4X5WB 5DRWA 2B08A 4TOYH 3QUML 1INEL 3QIWA 3QPQD 5F7KC 4HKJA 4B27A 3ULSB 4EIGB 1KB5B 1XR8B 3Q8AA 5D7KD 4LEOB 1OAYL 4FJ6A 4TYUA 2IPUG 1JV2A 3HKZA 4P4KD 3F12B 3TN0D 3ZTNL 4XN7A 4XZUA 3U0PB 3FH5A 3DROB 4JQVA 2F19L 2P26A 5CWSA 1R0AL 3QS3A 1A1MB 2BW5A 3G6AB 3ETBJ 3SKUD 5DJXA 5JZ7D 2K0RA 4WEUD 3ZTNH 4C4KO 2PR4L 2AAAA 3TP4A 4NO2B 5BRZB 1DBKL 5EH1A 3EBAA 5CJBA 5JPMC 3G5XA 1A64A 5DVLA 4RGOH 4NKMA 2E3VA 3BQUD 4J6RH 4UZUA 2YOCA 1BQ5A 3DO3A 4BFJA 1ZIAA 4DEPB 2CLZA 4XRCB 1SY6L 4L9LC 5A40E 1E2VA 1MI5A 5HHVH 5L2KE 1ZK5A 2Q87A 4QGTA 1UENA 5IJCC 3E7JA 3AWGA 1DVFC 1JHTB 2EECA 3L9RB 1ID5I 2OSYA 3C09C 3ZKQD 1NGZB 1NANH 1GGUA 1YDPA 1GHFH 2R0KL 4U31A 3O6KH 4MA1B 5T1LD 1AXSA 2WB1A 1OP5H 5FYJE 2MOQA 4KROD 1ORQB 2WSKA 3VA6A 3LEYL 2X6VA 3VXSB 1QAWA 1MCKA 2PYEB 5I66B 1UGKA 3ZZ1A 4FG6C 2XXFA 3T1FA 2Q76A 4NSKA 4NQVA 1HK6A 4DZBB 4GQPH 4JZJA 1KXTA 3TASA 2EP6A 6FABL 4XN2A 4FFYA 4G8IB 3NGBC 2J73A 2ALWA 1AR1D 4U0RC 4MJ5A 1IEAA 4UDTA 1QHQA 4MNGB 3T08A 1KXHA 3LPFA 2X2UA 3HKFA 1SYVA 3JWNH 4DGYH 2BIQA 2A6JA 5ISZD 1FO0L 1NQBA 2XDHA 3O0RH 4O58L 4XPBH 4ZAKA 2X4NA 5EFIB 2WGXA 5G55A 1HCVA 3TBTA 4NM4H 5FYJD 3WIHL 2GCYA 3DXAE 4NNPH 2X12A 2LGNA 1H5BA 1CICA 1N68A 4KJQD 5I6XB 4JFQA 1CDBA 5D5MB 1QVOA 1O5DT 4JAMA 2GJ6A 4YHPA 3DX7B 3W9EB 4UM9A 4IS6A 1MDAA 1LEKA 2Z91A 4JG0L 4LEBA 1UXSA 4PJ9A 4M6NH 4PWGA 5B1JC 4XNMA 4FGMA 3EYVB 4Y9EA 3LPGA 4GMTL 1X5MA 3MFFA 1BBJB 3GSUB 3QARA 1JD7A 5DD1L 5IQLA 5CN3A 3V0VA 2YMXL 3APNA 3H3PH 5CXPA 1MJJB 2WJ5A 5I17B 1P53A 5JORA 1DEEA 2AXGA 1GMIA 1THAA 3UZVB 3X1NA 1TQSA 4XNUH 2DRUA 2DWSA 1J7VR 1OQXA 2C9AA 3P9MA 4QKTA 4DKFL 1F6AA 3ZKMC 2YKLL 4PS3A 3I6GB 4M48L 5F93C 4ODUA 3TPUB 3ARTA 1TTFA 1OK0A 2IJ0C 4FX5A 2UZIH 3F7QA 3VXME 3WNJA 1DVTA 3TEWA 4L05A 4H1LH 3BKML 5I6MA 1AKJA 4YK4B 3ZE0F 2XA8L 1TTBA 3NCYS 2X40A 1X9LA 2BPBA 4P2RE 3AZUA 3BDYL 5ENWA 5F7FA 1QWUA 4XMUA 2Z4QA 1KGWA 2ZX6A 3MLXH 4JX0A 2D03L 2J8OA 2YN5A 2ZSVB 1KTJA 4FNLH 1NC2B 3WAKA 1IAOA 3MRIB 4X5QA 4LVNC 4M6OH 3ARBC 5EOCH 3OG4B 3DX8B 5C70A 3V52L 4HBCL 3EOTH 1FYTA 2R7EA 4M02A 2EXSA 3WFCH 2AV7B 4ZZKA 4WHTB 3QJRB 3P2BA 4F8QA 3R0MA 2ZXDA 4XPAH 2VL5B 2J4WL 4K0OA 2VUOA 5EZLA 1MH5A 3VFRA 4G6JL 4Q0XL 4HGKC 3VYOA 4PW3A 1U8QB 1Z0MA 5BZDB 5HHVL 4ZMOA 3MV8E 4ZX4A 1IGFH 2QZQA 4K8RH 4R0LB 1AG6A 4K23L 1FC1A 1MAJA 4I87A 1UD8A 5E4EB 2XZQH 4ZUTA 3RGVA 4LEEA 1P6AB 2AK1H 4PPTA 2B59B 1YPZB 5IW3A 4P99A 4J6IA 5DO2C 5D2NA 2HJLB 3SBWC 3VQ2C 4FFWD 3LMJL 3UZEA 4PWEA 2VRQA 1ZHKA 3DARA 2BJMH 4KUZH 3MRPB 3JV4A 1GL4B 4FA7B 1I1FB 1L3NA 2KLSA 1T03H 4OCLC 35C8L 4GJTB 1E3FA 5HHOB 3MC0A 3OJDB 4WU5B 4FTVD 4LDEB 4AEHH 4H25A 1YJDC 3OB8A 2LV4A 3CK0L 3TF4A 4TQEL 1JK8B 2J5LB 2J72A 4ZW8A 3RVTC 3RZCB 1JGVL 4R4ND 5FV1L 4WHYH 2GI7A 5I16B 1BXVA 3GGWB 1A7OH 1I9RL 5FFLA 1XF4A 2VAAB 1WITA 3BJLA 3KL0A 4PJXA 3CTTA 2FB4H 1EEYB 3T3PE 4X6DB 4H2AA 4JB9H 1XCWA 3ILQD 1CDGA 4N24A 3Q3GB 3LDBB 5ALBH 2J7LA 1Y0LB 5EO9A 1QA9A 3S34H 1S7XA 1SJMA 1R3HB 4GW5B 3I6KB 4RGNC 3ZRFC 4E0RB 2OA9A 4PP1C 5E8OA 4FEIA 5E6IA 4B9GA 2WQAA 2HX7A 1XF5A 3O2VL 3ROLA 3CC1A 3UGEA 4DNLA 3VNZA 3P3YA 3EDEA 2YD7A 1Z5LB 4RZCB 1S4IA 1VFUA 4OLVL 3WMQA 3VFUA 3EYQC 4UTBH 3WTTA 1IM3D 2J57A 5I1GH 3O4LE 1JNNH 3P11H 4G7VH 4AW7A 4LVHB 3OL2A 4IDJL 3E38A 3NFPA 3ZDYE 1QRNA 5GRJL 3ARZA 4U1NB 4ZI8A 2ARJA 3AQYA 5DJAA 3U4EB 3WNIA 3WNLA 3RFZB 3N44B 1SLUA 1IEHA 3ZGIA 1KGCE 3NJHA 1UA6L 3RL2A 1OD9A 4ZNCD 2Y7MA 2FX8L 2GSGB 4XCEB 5TFSH 3VFNA 1E9OA 1X3DA 3NDZE 5EG6C 1H3VA 3G6JB 4HETA 1R3KA 1UA6H 1WZKA 3F7KA 3N2JA 3QCUH 3ZKSD 5FOBB 2DY2A 4OU3A 2FIRT 1KIUB 2PKDA 5DMIH 3QPKA 1C08A 3HZYB 5LBSA 4P5SA 2YRZA 1Q0XL 1U8CB 1D5MA 1DQDL 2OTWA 1S7SB 5I15L 4RAHA 4D9LL 4P3DA 1SRDA 4XCCL 5IM7A 2Q2LA 1SEBA 3NG5A 4H8QA 1KNOB 1LP9B 1S7RB 5BO1H 5HHPA 1MPAH 5J57B 2Z35A 3KZ8A 4LF3A 4DAGL 3FF8A 2VW6A 4G8GA 3SGDI 3HE6B 1T7YA 3T4YB 4N0YH 3VXRE 4YVNA 4PP2A 3ZDXE 4UB0L 3BP7A 4XNQB 3SPVB 4GNKB 4BA8A 3DWTA 3NTCH 3UEQA 1Z5LA 1BQUA 3GJFH 1BX2B 3UAFA 3IYLW 3UP6A 3QXDA 1M57B 1JGLH 4YAQB 3PWLA 4FFZH 5FIEA 3O8XB 4H8HA 2DWYA 4HG4K 5I30H 1MXGA 1QOKA 2Z65C 2MHAB 1F56A 3PWUA 2F2HA 1DR9A 3QNYB 1MWAH 3DYMA 2Y6TE 3ULUL 4L3EA 1H3GA 5JMOC 2HFTA 1G9NH 4HV8A 4QHUB 5C0ND 1XGQB 3C08H 3UAJD 4F8LA 1VESA 1TJIH 4E9TA 3BAXA 3PWPD 1ZWIA 5E8NB 1QFPA 2GJZA 4LGRB 4MYWB 3BX7C 1DVFD 3BXNA 1ZGLA 2CBQA 3M1OA 1LM8V 3GJFB 1NM9A 35C8H 1BLNB 3O6FC 3D9AL 3TVMC 5DGRA 3NIGF 3O41A 5EEVA 3V8CA 2NW2B 3HAEH 2JELL 5C9JA 5D7LE 1QRND 4QHNB 3UDWA 2YC1B 4RAVB 4WRLA 1XF4B 4RWHA 2YHGA 4QCIA 4XBEL 5LAXB 3I6GA 4AQZA 4AMXA 1DQQB 4TUKL 4YDKH 3W5MA 2X89D 1SJEA 1NMBL 3QPQC 2HRPH 3RY6A 3RWDA 3TC9A 4KZDL 1A7RH 3CHPA 3VD3A 4AG4L 3CVHB 3HMWH 2G4EA 3UJTH 4R96B 2ZTBA 5DFTA 5ID1B 2VC2B 2EYTB 1TKWB 4PJFA 1Y6MR 2QMJA 1I75A 1S7WB 4GIAA 5ENWB 3MRFA 2R1YB 2JQMA 4GW4A 4N2NA 1YNKH 4NUPA 2E46A 3OKEA 5HDRA 4XVJL 3JWOC 1J8HE 1R24A 1Q0XH 3PIQA 4PTUA 3UJTL 2AV1B 2IH8A 4UIMB 2AXFA 1BZEA 1A9EB 1BJ8A 2R59A 4YUEL 5KS9E 2HKAA 4NUGL 3BE1H 1BYOA 3DI2B 1AZVA 2A4EA 3OM3B 3TPKA 4UT9L 1I8AA 1U21A 5DA0B 3WYRA 2HT4D 3EF4A 5IWLA 2F18A 3BIKA 3O6LL 4XX1E 2ED6A 5EU7E 1NCTA 2Q3ZA 4OF8A 3KJ6L 4M7LL 2CDEA 4PMEA 4P2QD 3WLWC 2NXZB 2X0VA 3KH4A 4NO0D 2J1KA 4PLKD 5E5UB 4H44C 1SYVB 3DGGA 2D0FA 1CGVA 3DGCR 1AZUA 3C8HA 4AK1A 3PWNA 2HTLD 1EXGA 3EGDB 4B7LA 2WO4A 2UXVA 3PXLA 1F2QA 1A1MA 3TV3L 3VGGA 2Y6SC 2HVKB 4A37A 4LFHG 3KLAB 4LSSH 2R4RH 1DANU 2ZX9A 4QOKB 3R1GH 5EF0A 1AIFB 3RVUD 1HHGA 4S0TD 5DK3A 2WZAA 3UGXA 2VITB 5E1AA 4RIRB 4N28A 3HHRB 1WLHA 3LRLA 4LOFA 2Y7SA 2P8LA 2VLRB 5LDUA 4AL8C 2JI3A 5FHBH 5C0AA 1CU4H 4NO3A 4OSUH 4ELMB 4G43B 3I2CL 4WQOA 2FEEI 2VQ1A 3S88H 3BRDA 1QP1A 1OCCB 1XB3A 4TNVK 4TSAH 2Y1YA 4Y2DA 2PW1B 5H37H 1MLBA 3F6JA 3F84A 5I0DA 3A6BH 4OZFH 2CGYA 3LN5B 1TJXA 2RFXA 3L5HA 2F74A 3IDIB 3QDJA 3T3ME 2CIIA 1N59A 1I8MB 1CG9B 2BNQD 2F7RA 1TR7A 2IAMC 1OSZB 2PCFB 2DJMA 1IBFA 3FQUB 5BW7A 1OM3L 5D7JC 2BVPA 3ZBMA 5FYKH 5ABZA 5JQHC 1S7QA 4ZZFA 5BMFH 1CTNA 1VLXA 1E5YA 3CXDL 4HIHB 1T66C 4BXSV 1OB0A 2NNCA 2Z34A 4GAYA 3KXFD 4UUJA 5D2LF 4HEPA 2XVBA 4LKCA 2TSAA 5T5FH 2DLIA 2AITA 1RP9A 2HT3C 4OD2A 3BSZL 1QFHA 1FA4A 1KTKE 2NNAA 3X3FH 5J6HA 5E1QA 4K5NA 3TEXA 4OZGA 3ZX1A 3IJ8A 3O4LA 4RMSA 4NQXA 4DUWA 4G6ML 3UO1L 1DTUA 2VLMD 1WFNA 4LLYA 2GCYB 1E3ZA 4QKXB 4MNQE 3P0GB 1FNSL 3L3KA 1SVCP 4NNYA 4ZXBD 2K4WA 4YX2L 1IUZA 4ENEC 5KWYC 1J0IA 1EHNA 4ZPVB 3VWJD 2JKSA 5DJDB 4QT5B 3MRRB 3NPSC 4NJ9L 1CLCA 3RB7A 3WIAA 4DKTA 1YPZF 1RKRA 2VR3A 3N42B 4JFFD 1KENL 1PZ5A 3TA4D 4QO1A 3NJVA 1GS8A 1BVOA 1NAKH 3KL3A 5I8KL 1BJ1J 5EIIB 2OJZH 3FQXA 5IF0A 2A1WL 5EF1A 5J56B 3OZKA 2X1OA 3QIUD 4JHZA 2FO4A 2XG4A 1ORSA 1NFIB 4ZFOB 4N9GA 3OGOE 4R83A 3K2IA 1FL3B 4NM8L 2EDTA 1BP3B 3L7EB 3LTVA 2VDKB 3KPOB 2CRYA 4HWBL 4OKVB 4RX4A 5DJ8B 5TDNB 1S8DA 4OCRH 2NTFA 4JHWH 1BA9A 2OW7A 4LT7A 4JFOB 3HZVB 3FJTA 4QF1A 1XCQB 1WVZA 5E1HB 1JZ4A 3HC4L 3BT0A 2W8CA 3AU1B 4HK3J 3RG1C 1HU8A 1CL7H 3SDDC 3PCYA 4WTXA 3NN8B 5ID0B 1KTDA 1OB1B 4LNVA 1QA9B 2OCCB 3PHSA 4Q2ZA 3T8MA 5JO5B 2XXGA 1UZ8B 2EDYA 1DBBH 5E7FA 3BQVA 4D9RD 2V8LA 1ASPA 4FULA 1B9ZA 1GYCA 2P80A 1MHPL 4AC4A 1DLHB 3DX6A 2BP8A 5JPMB 4N86A 3F05A 2OJ1A 6FABH 2Y5QA 4NAMA 3OPUA 3RFRA 1HI6B 4XTRC 5KSBA 2XZQL 4H26B 2VOTA 2DLTA 2ZSWA 3FPXA 4FNRA 2GY7B 3WHE0 5KVGL 1N8ZB 2JJVA 1SMOA 4Z7WE 1QLFA 1LLAA 5DHMC 5IVXF 3P02A 3WFBL 2VERA 4NERA 1IC7L 2NX5A 4MDJA 5I19L 1U3HA 5IQ7L 3HI5L 4NXSA 4QOKD 1IC4H 1PMYA 3BN9D 2QKIA 3S5LA 4UT9H 5JHDE 3W0WD 1ZDSA 2I07B 1NPJA 2GFBB 1RK0B 3WO4B 2X2YA 1JYVA 2WLKA 3KLSA 4ZBJA 3OAYK 3C5ZD 3A6CL 3KPSB 5EV7A 2PW2A 1R47A 1DJGA 2DQCL 3D08A 1CE6B 3KGTA 3CZFB 3CFCH 1G6RH 2P5EA 4D9QE 5AAMC 4ODSH 1IFGA 1OB1A 1MCQA 3TT1L 1BAWA 2XPYA 4UCFA 4TNEA 4U6YB 2OMBA 3LH2H 5DJCA 2Z92A 3MV11 1RQ5A 3DLQR 5SWZA 4DSYA 1GCFA 4NUQA 4OJEH 4RX4D 1LDPH 5EBLB 2ZCZA 5IWLC 1K6QL 4QXGH 3I02A 3MRKA 1CG9A 4JPSA 3O2VH 4Z7IA 3IXAB 3RVWD 4JQVC 2ROXA 3PAUA 5SWSE 2IANB 2GK2A 3BPOB 2ZWYA 2HG0A 2OXHA 3WSQH 4UIKL 4AJWA 1JNNL 5IB2B 1QSFA 1MAMH 4YIQB 3FSAA 4PLJC 5EO1A 7TAAA 5FF6B 3VD2A 2Y23A 1G9MC 2Z7YA 4QHKJ 1CS6A 5I76B 1MHHB 1UM6H 4P3CH 4A2EA 5KSAC 2OMXB 5F89B 4HJTA 2V2TB 1PAZA 2A83B 3FK3A 5DLLA 2Y0SA 1E6JH 3M1CA 4OF5A 4X5LA 4PRID 3X12A 3LXCA 1H0DB 4BUGA 2COQA 4DGIL 2ZXEB 2OK0H 3DIFB 3QEQA 2J55A 5IMMB 2J6WA 3FOLA 4HULB 2GJ6E 1OAJA 1BVKB 3H7BA 3LNFA 5ADPH 1NAML 3TT3H 1BD2D 4QTIH 5E2TL 2ZKWA 1TENA 4MJ2A 1M05B 5PCYA 5F9OH 2DTML 4OV6F 2YD6A 3JWDH 1L0PA 4I2XE 5CP7A 1OPOA 2QQQA 4PGZA 3KPRE 4JHVA 1UZ6F 2J8UA 3C6SA 5E6ZA 4OB5H 3T65B 2GTQA 1FAKT 1G94A 1I1YB 4V2CB 5EU3A 2EYRB 5F1OB 4AZUA 1IKOP 3PP3K 3BZ4A 4HSAC 4PWHA 5J3HD 4Z9KB 4GQQA 4NT6B 1UG9A 3UPAA 4OZHE 1U8MA 4GKNA 4I1NB 4N6QA 1S5HB 4Y2DB 1ZAGA 4U1KB 2AK1L 2B39A 2PP7A 3HC4H 3T6ZA 4FAAB 5T3XE 1PNDA 1AE6H 2WY3B 4GXUN 3V7AE 4KXAA 3JWDC 3MRGB 4PJGF 2WO3B 3FT4A 3SQOL 3T3PF 1LEIB 4XC1L 1SJHB 2Z8WC 4HDIB 3EJQA 4WO4B 2MQGA 3NGBB 2VR4A 4YIQA 1JDDA 3TXAA 3VXPA 1N8ZA 5AAWA 5JNYB 4G8GE 2YA0A 3RVXD 2MTPA 1CGWA 5JW5A 2HN7B 3EOTL 1GOHA 1FYHB 4E9LA 1KCVH 3B2UD 3WOVA 2ODIA 4NZRL 3S5YA 3ZU8A 3SD2A 2Y7OA 5T1KA 5B38G 4N6RB 3UAAA 1DL7L 3OX8A 2CR6A 1MREH 4ZUUA 1HSAA 4OY9A 2MQ0A 2A9NH 2F9BT 2DQHL 2DQFA 1CGTA 1JGEB 3P0YH 4K7PH 3KCWA 4DW2L 3RGHA 2OL3H 3B8SA 5D7JA 4ODHH 3OWRA 4G6AC 4TPRL 2AXWA 5I82A 3PU7A 2HMIC 4ZDHA 4AKPA 1ZS8A 4NO0A 4K73A 3BKJH 3AWFA 2V2XB 3RVVC 5LQBL 1XH2A 2V17H 3E8UL 4AZ8A 3EGSA 4F5CA 4PFEA 3NFSL 4I48A 1BZDA 2BFVL 3MLZH 1GJWA 4JANA 1F90H 1ED3A 3QS2A 4MDRA 5I23A 3CIAA 2RCSL 4KI5F 2ADFL 2HFEB 2NUTB 4QTIL 3ARPA 2EUWA 4JY5H 2A4CA 3DOSB 2CKBH 3FO2B 5J1AB 3VFGL 1JZJA 3FTYA 3UTQA 2J1YA 4OFYD 4LRIA 1S7VA 3QUZA 5FHAH 1DJZA 2XKSA 1CYXA 3LRKA 4ZQKA 5F3HB 4QRFA 2DMBA 1PKQB 2DWEB 1DVUA 1T1YA 3MCLL 3AAZA 4FS0A 4A7GA 5JHDA 5FUZH 2HWZL 3BO8B 3OKOA 2IFGA 1MNUH 3LNEA 1S9YA 3SPGA 2E8ZA 5HYSA 1QW8A 4L48A 4N90D 4PJ8A 4PI2A 5GIRA 4FA8A 3O3AA 5C8JB 3VH8A 3TTSA 2F53B 2G75B 5KUKA 4R4FH 1RFDH 4PB0H 4Z7VB 5ID1A 2OULB 5CWSB 3LV3A 2OZ4H 1OK8A 4KKLC 1UATA 5ACZB 3LEVL 2CMRL 1R19A 4PYGA 4E9YA 4OZGB 3HE7B 2W38A 1XQ4A 4YH6A 3GEWB 4NUJA 3FUJA 2R2HA 1E8YA 3BZDA 4AJ0A 3CLWA 3DTXB 5AB2A 3IS1X 1MPAL 1OGTA 2Y4SA 3QDAA 4ZOAA 1GZHA 1WT5C 4GKSA 1IZKA 1JWUA 5TD4A 3EHBC 5AEAA 2G3XA 2VDOH 4HKXA 1FVDA 1EAPA 1WS8A 4BSVA 3LQZB 2JKLA 2FX7L 2CQVA 3GI9L 1IGMH 4J3OC 1K4DA 3FCTA 1WICA 2X1PA 3S96B 3DSFL 3LHPH 5GGQL 5T5NG 1S7VB 2PABA 5K9QI 2N0MA 3P30H 3IJ9A 2EDBA 4W9ZA 1CI5A 2IPUK 3REVB 3KDMB 1NBZA 5K9JH 1KT2B 2YAEA 4K9EC 1E5AA 5DC2A 4JFDA 1MW1A 1WFUA 3ZKMD 1NJ9B 4UTBA 3H54A 1X5AA 3V0WH 3O3BA 1YNTB 3PV7A 2VDQB 5LG1A 3U2SB 3LNGA 1IAIM 5ESVB 4WDIA 2JB6B 4FHKA 2AEIT 4J5VA 4MAUH 4FYRA 4HUWA 2Q3XA 2OXGB 2IQAB 4IRZH 4GBXD 2CO2A 1TOXA 1E0OB 4Y16B 4KRLB 5L2JB 1FLTX 2EEFA 4L4TD 4HFWA 3LEXA 2W9EH 4Z7QB 4MNQA 3KM1A 4RMVA 2W92A 5I16A 4HOXA 3VI3A 4YDMA 4WY7H 1SYSA 2ZX7A 3ECVA 3L6FB 3EFFB 3JT0A 1FP5A 4F15B 4NQEA 5A6MA 2AJXH 3CU1A 4MWFA 1DVFA 4EN3C 1IBDA 3RWJA 3DX1A 4HJJH 1ND0B 4XBEH 2VUKA 1UOWA 3IN0A 4A6YH 5H37A 1AJ7L 4AM0A 3FB6B 2NCEA 2JV6A 1SQMA 5IBTH 3GMRB 3IJEA 5IHUL 3C6LA 1OARL 3PF2A 1KCUH 5DQDH 3FYEB 4HJJL 3TIEB 3T0EB 4MA7H 2J2ZA 1OLLA 5GRUL 1S6NA 1D6EA 5L8KB 2EH7L 3LSOB 1XGYH 3KCPA 4YSTA 3FCGA 4PGCB 3GBEA 1AGCA 4WDIB 1KZQA 1M3JA 4WLCA 1TKWA 4HUCA 4Y9BA 4DP1X 4Z7OB 1GKEA 1M7IB 5CU9A 3M7OA 1X5KA 1E6OL 3SJVE 4U0QB 4X98B 2J8UB 3DV4B 2AV1A 1IGTA 1FVCB 5C0DA 3NRQA 3CG8A 3RYMA 4QXTB 5AD0A 1N0XL 1FO0B 2DQUL 1INEH 2QPDB 5DD6A 5DD3H 2DLFH 4AQEA 3W37A 2EO7A 2X4SB 3VWJC 1T4WA 4LCWE 4XCNB 2WBWB 4YGVA 1EGJA 3BUTA 2PO6B 1U3JA 5I9QB 5KW9L 1S7SA 1PU0A 1FYTB 2R7EB 2Z8RA 4Y5XA 5AB1A 4X4XB 2XQBL 4JFPA 5DZLA 2X42A 5LXGL 3VACA 1DJXA 4JCWA 2CHXA 3QWOB 5B4MD 3EBIA 3Q43A 3ARVA 5D7LD 2K7QA 1XIWA 3WFCL 2ZOKB 2ITFA 5DZNA 5CCHE 1OCRB 2F0CA 3HG1B 2H5UA 5GZND 1UD3A 1UOVA 1E9PB 3HAEG 2SEBB 1U6AH 1MHHA 2ZP9A 3PWLB 3WY2A 1NDMB 3IFOA 3FQRB 1UCTA 3SE3A 3QXAB 1U41A 1T0NA 3S88L 1HHKB 3TESA 2VDOL 3GI8L 1AGFA 3QI9C 3VFUB 4KDTC 3PAYA 4N85A 3NPSB 3DV4A 4J3OF 5EU5A 2Y07L 4MZ3A 1YAIA 2VDMB 1P4LB 1QRNB 2UZIL 4Y0GA 2VL5A 4L1LA 5I1AB 2HRLA 2ZKMX 3MNVA 1FNAA 4BINA 2R23A 4NKOA 1ZS8B 5HDOA 1WA0X 4I0PC 3UG5A 5C0AE 3Q5OA 3FU9A 4R26L 4HFUH 1MUJA 2ZKHH 1SJVA 2E9WA 4APQA 4IOFC 2I9TA 2WVVA 3UBXI 1IGYA 1DZBA 1JVLA 1JGDA 2KZ1B 4JGNA 3HW7A 1FFQA 4ICXA 4PD4K 3REWB 4XP9H 4P9HC 1IV8A 3X12B 3RVWC 1ZT7B 4L1BA 2P24B 1E2WA 4O4YL 4ZUVA 3OLGA 5IHZB 3QRGL 4OGYL 4CNIA 5LGJA 2Q7YB 3MREA 5IFAH 2JJSC 2R2CA 4PJ5A 1AQKL 2YXVA 3VXTB 2I27N 1TEGA 5IB4A 1U2HA 3ESPA 4MCZA 3RKPA 4HPHA 2AEOA 3F6IA 3FHQA 4FXGA 1GC1C 2ZP0T 3BHBA 3B2UC 4AKOA 3HVNA 5SX4H 1L6PA 4OW6A 3U30C 4OQTA 1YHPA 1HXYA 5HSFA 4FE9A 4LSRH 1TPXC 5KSAD 4H40A 1AMXA 3ZXAC 4JPVH 4YAQA 3NFSH 4U6HB 2WCSA 3IPEA 3QXDB 4PJ9D 3TL5A 5LXGH 3RWIA 2NSQA 2Z4QB 1KIQB 5DJ6B 3B9VA 3RL1A 4XP6H 2X28A 4R97C 4UM8A 4AMKH 2WUBH 5C86A 2VRKA 3QQNA 4LRIC 3FT1A 4PB9H 2QQKH 3AQZA 1EO5A 4BQCA 1JS4A 1ZANL 4ODBD 4KZDH 1ICTA 1EEYA 5AVRB 5EBMB 2ZUXA 5JYMA 2H6PB 5CLWA 2XWBA 2CRZA 2W94A 2FHCA 2X0WA 5HDBE 3N41B 3VFPA 1SF3A 3IGAB 4HS6B 4HUMB 1ILSA 4LMQI 3QPXL 5KYWB 3TA3C 5C0BD 1RZKC 1J0ZA 2AJVL 4P46C 3FCSA 1A9BA 3BT2L 4KK8C 5CCKL 5L88L 1A8ZA 1EEZB 3GRBA 1BECA 2FQDA 3TU6A 3LKOB 3AS3A 5HPMB 3T6XA 2BVPB 5GGTL 5E5RB 4M7KH 4QAWA 2FH6A 2E59A 3QUYA 3FT0A 4Y1AB 2FUQA 5J8OA 4MXVF 3VXQB 5F1SA 1GR7A 5C09D 1CLVA 1D5XA 1L9SA 5EOCL 5IOKA 1WBYB 3IMWA 4YHIA 1A2YA 5IHLB 4JAMB 1EHAA 3ARDD 4O2CA 1BV8A 3RVTD 4PJCE 1TQBB 4N5ED 5L2JA 2ZP8A 5DQJA 5E8EB 2KPNA 3DO4A 4L3EE 4Y19B 2Q6WA 1SUJA 2XZZA 4JM2B 2X6AA 5D6DC 2MCMA 3S5ZA 5I74C 4B9ZA 2DH3A 2EH8L 1FL6A 5D7SH 3SE8H 4TKWA 3MRRA 1BBJA 2E4FA 2ENQA 3WI9A 2DMKA 4OBSA 3CSYB 1OAUH 3BD3A 3L3OB 5L7XL 2IGTA 3P2DA 2BRRL 1HZHH 4WGKA 1P7KA 2DQCH 4LLVA 5JORB 2Z93A 2PXYD 2OQJB 1I3GH 1IBZA 3MQIA 1L9NA 4LPYA 2C4XA 4TF4A 1O6SB 3U83A 2C26A 3NQKA 4WNJA 4ACPA 3F7LA 1L9RA 1JJUA 1T0PB 5IBLD 1CURA 1P5UB 5LHDA 5B3JF 2X4RA 2WYIA 1GGCL 4FI7A 1FL3A 4PJ7B 1I1RA 1VFBB 4IBTA 1RZPA 1AGEA 2X53A 4JCLA 1A1NB 3MCYA 3ECWA 5B1BB 1AGDB 4GQ9H 2DW5A 4F2ME 3LH8A 1I7RB 3HPJA 1JPGA 4PJ5D 2D7OA 2A74C 4J8RB 3GMNB 1DO5A 3DOIA 4O51A 4GH7B 5E08H 3VD1A 2AVGA 2HRPL 3OJ2C 1X44A 3OKEB 5CJQL 1YMHA 1FL6B 3ZK0A 2R2BA 2DIEA 4G7YH 4Z78B 3B7UX 4DCQA 5C0IA 3LKPB 3INUL 4UINL 4XMWA 5TQ0H 1KXTB 1Q9KA 2XETA 3QXWA 5FO7A 2EO1A 4G71B 4KXCA 1JYXA 2ATKB 2OMYA 4G9FB 4R9HA 3VXMD 4KTDL 1VEOA 2EYSB 1RURH 2WLIB 3PV6B 1DQQA 1ROWA 1CZ8H 4YDLC 5D4QA 4LEOA 1AOZA 1P5VA 2Y1VA 3EUUA 2AJSH 3CLFH 4ZT1A 5AOMA 2DM4A 3MRLB 2WAQA 4HIHA 4ABUA 1MCFA 3MNZB 3X13B 2FLRT 5BQDA 5KYWA 4QY8A 3NZHH 4LVOB 5E6YA 4PJ5E 5CFAA 5JW4Q 5D5MA 2ZWSA 1U58A 3BP4A 1XMWA 4YSOA 5DVPA 1BQHB 1AC0A 3GBDA 4CSZA 4WKZA 3IDNB 3FB5B 1P9MA 3QZNA 2H9GA 1PGRB 3QZWG 3MROA 5MP6H 1KFGA 5KZCB 3NZHL 5CKAA 4EKXA 4CADA 4H8WC 3H9YA 4QRBA 4S11A 4XVUC 1A0QL 3X3GL 1JNHA 5DHVB 3MV7A 1T7ZA 1A25A 2MQCA 5DHXB 3KWVA 3RTQC 4A1RA 4IRJD 2R39A 4XOEA 4F80A 1DUZB 1FYTD 1SDAB 2F7OA 4WF7A 5C71A 4PUBH 2VR8A 1HYSD 1S78C 4FZEH 4NLHA 4OCRL 5JW3L 5DEFB 3QEHA 1JFHA 5D1QD 1MELA 1ZJAA 3ECBA 2P5WA 2E7CA 3HG1D 1ACXA 3H2QA 1ZEAL 3HB3B 3MA7B 3QXUA 3QUYB 2VSCA 3MHZA 3QG6B 1N12A 4DQAA 1ZCRA 2PPAA 1CK0L 2HKFL 2IIJA 1AHWB 3K81A 3V6OC 1QLEH 5IVOA 1U8OB 4KMLB 5CZKA 1HESA 1D9KC 4L5FH 4XPGH 5CUSH 5AVXB 5GRJH 1I3VA 1EAQA 1NCCL 1GGIH 3SQOH 3B6SB 3X2QB 3LPPA 5CCKH 2H2SC 4CMHC 1T66D 3LRGA 3HFFA 3NP4A 4Z3EA 4WJKB 4ZMWA 3QCVH 4BZYA 4ZX6A 5BMFL 5DJXB 1EBPA 3MRCA 4WFHD 3DECA 4N5UA 3MLZL 4YHZL 3PWPA 1NM4A 2IG2L 2JCCE 2EICA 1Z6JT 5DDHB 2AQ2A 4LHUG 1O75A 3QJFB 5TDOA 2WNXA 4CC4A 5CP7B 3S34L 1NANI 3WKPA 1HOEA 2IH1B 1TJHL 3CBJB 3NCBB 4P2QB 5EU6E 4NN6B 4KRPD 4WEEA 4WSJA 1VGKB 3S36H 1UTDA 1MQKH 1ZOXA 5IB5A 4Q74A 5I1DA 4BDVB 1IMHC 1FV1A 2EZ0C 1UWXH 3GXUB 4N8CL 2YAPA 4XZUB 3U0PA 1FBIH 3VDCA 1P4BL 3K8MA 3MAWA 5I1HH 4HWZB 2OTWB 2GFBA 1ZTXL 2MPAH 1L0QA 3WFDL 2XVKA 4WI4A 1C5DB 2DM3A 4HXBL 4LSRL 2YQGA 3SKJL 3CVHH 1NBCA 2L3BA 1NKOA 1OT1A 1UOKA 2DIBA 4LF3B 3IDJB 1YMMB 4G8GD 3L5JA 3LXBA 4IJ3C 4J3SA 5ICZB 2VGLM 4RBPH 4FQLH 1AFVH 3BEWB 1LO2H 1QFOA 3L7FB 4J3OD 3CX2A 1N7ML 5H2BA 1MAKA 2W65B 2ENPA 2YMXH 4DN4L 4JM0A 2O5XL 1MLCA 3TGXA 4PRAB 4XP9L 1ZEAH 1MUJB 4L4TB 4QXTA 4FQ2H 3CLFL 1LGVA 1B6DA 1FFOB 3D69B 1C5CH 2X4OA 2X3CA 3DX0A 1WD8A 1UADC 3U6RB 4MZRA 2DBJA 2KMWA 1A1OB 2A9MH 4HH9A 4OCSL 3D2TA 4K7FB 5ADOH 2KZKA 1G6RB 4HUUB 2PPFA 5KVDH 4BH8A 3H9HB 1BVLA 1A7QH 2YRBA 3ME0A 2DTMH 4ZFQA 4NC1E 4OFDA 1DFBH 3QUXA 3ULSA 1MVUA 1QTSA 5EBMA 3H56A 4JFED 4AYID 2EDLA 5E94A 1RZGA 3DVGB 5F0JB 5IBUG 4HVBA 1KB9K 1O7DC 1Z2KA 3QO1A 1FC2D 4KKAC 5D93B 3ZYIA 1G9NC 2AKRA 3J8F7 4JFDD 3VB9A 1XHHA 4JCMA 5J6GB 1P5UC 2FQEA 4JNXA 4N2HA 2IC2A 3MODH 1CD9B 3MBEC 4JN2A 3DO7B 1XF2A 1MFDH 1ZT1A 1CIUA 1ZV9A 3RWIB 4G8EB 1IC4L 3MV7D 2X0UA 4CN4A 4Z76B 2OV0A 2NUPA 3FQWB 1ZLWK 5IEHA 2NYYC 3BLKA 1QABA 1XF1A 2VB5A 4FYQA 5JW3H 2BNUA 4XAWL 3MRPA 3AT0A 2BCKB 4UQ3A 4W9GC 1UD4A 4PJBB 2ZD0A 1I7TB 4MD5A 4ZFGH 1ZGLM 2ZCKL 1CXFA 5D4JA 5L2KB 4GIOA 2FQGA 4ZMQA 4LXFA 4M1GL 1U8KB 2H8PA 4GKLA 3WIIH 3QNXB 4S1RL 4LAJH 4D0BA 5AVTB 3BGMA 3QNYA 1WS7A 2YD5A 1PLCA 3FQNA 3QH3A 3TH3T 4OQ1A 2WIIB 4BCZA 3ISRA 1HL8A 3VXSE 4LCWD 5AYUL 3T2LA 1XGQA 4WTQA 2E9GA 1M56B 2EH7H 5DYOA 7CGTA 5LAPA 3GMRA 2DBLL 1HOCA 3GLAA 2QKIC 1PAMA 1RUKL 1UACH 4M3JA 3M17B 4HGMA 5T1MA 4DP6X 4NKDB 2R1XA 4KKCC 4D0CB 4F9LA 3L3IA 1HNFA 1MWAB 1YA5A 2D0HA 1DBMH 2Y1ZA 1N70A 1CFSA 1YEFL 3U1SL 4MNGE 1XO8A 4X0KB 5C6TH 4QHKI 3SDCD 1RIVH 2ZNXA 1E28B 1X5HA 1YN6B 2LTQC 3C2SA 4PRHD 4YHYB 2COVD 2ENJA 2GAZB 3O6FB 1LWRA 4HK0B 1XGUA 3QQ3B 2VUYA 2UXFA 5GGVY 2FX7H 1URLA 3BAEH 5HGAA 2UWEB 1ACYH 1MCIA 1PTZA 4N68A 4ZMZA 1CB4A 1ZV2A 3RDTC 4UINH 5TQ0L 4WWKC 3GFUA 1R33A 2YBGA 4PREA 4UT6L 4EUPB 4WI6A 3APDA 2XQ0A 3D51A 2YXMA 2JB6A 4CBPA 4PG2A 1N10A 3HRZA 4JFVA 1FZJA 3MUHL 3E3QE 1ZJBA 1G7PA 1N0LA 3ARDC 4NQQA 4Y16A 5C0CB 1R3JB 1W80A 2AK4B 2HJKA 2E8YA 3A4FA 4LRNL 4PV8B 3CHOA 3I3EA 4ZG1A 1BXAA 4JM2C 5HHOA 1SVBA 2CIKA 4MJIB 3MJ9L 2L7QA 4D2NA 3NYKA 3BP5B 3QEHB 4YSDA 3L6FA 3OBAA 3CZSA 4IBLT 5HDQH 2DTSA 2DQUH 1JHKL 5LN8A 4ZQKB 2DWXA 4QRPE 4P9HL 4ZFGL 1D9KA 3QP3A 3HMXL 1RK1B 2NNRA 3EYFB 4ODUB 3LX9A 5AVZB 4KDVA 3BIBX 3FTZA 4P46D 1TYEB 3O6ML 1E67A 1F58L 4HU2A 4P2OB 3QXAA 1A66A 3FRPB 3V0AC 2NSMA 1FIGL 3FB8B 4WTZA 3R7QA 4KK9C 2VDNH 5C2BL 1AJ7H 4OGZA 5IP4A 4E0RA 4P2RB 3NAAH 1T2QL 4MJJA 1U58B 1SYSB 1AGCB 3PNWB 4JFFE 4IHBA 4DK6A 4X9BA 3VWKD 5E1IA 3MRIA 3HI5H 2IAAC 4YHYC 2YQBA 3C6LC 4L5FE 1GGBL 2P8LB 1PFOA 4PJXB 3N44F 3W2DL 1WIOA 2ESVB 5AOZA 1ZLSH 4NDMA 4XNZB 1FFPA 4G7QB 2X4SA 1FSKC 2ZCKH 4FQHB 4FXKA 4L8DA 4XXWA 3TJHD 4DTGH 1ML0A 3IDYC 1ITCA 4K3JH 2RH0A 1MCPH 2QMKA 4K94L 1P7QB 3PUCA 1N6VA 4W9EC 5CLYA 5DEFA 1NBZB 5ICYA 2FHBA 3KDMA 1S9WB 2WVSA 3EO1A 3GSQA 3SGDH 4C56D 1IGJB 2QQKL 3BPOC 1OY3B 1KC5L 2A9BA 4YZFF 4MYPA 4GS7C 4FABH 2Q5BA 1KY7A 2CNYA 4N90E 4BFOA 2QELA 3FS9A 4ZD3H 3EGXB 1FH2A 5HJ3A 4XOCA 3HZMB 4EI5A 4NM8H 5A16B 1AKJD 5F7DB 3EGSB 4UI2A 1QHOA 4KKZA 5TDPB 3FQNB 5KVGE 1DJYA 3MLTB 1QEWB 4KK6D 4AXWB 2BVYA 2ED9A 4TMPA 2NY5L 4D3CH 1WBXA 1D2PA 1N4XL 1VA9A 4APXB 1WWBX 4UV7L 1DP0A 7PAZA 4FP8L 2Z7ZA 4N2FA 4N2CA 5TPWL 4YUEH 1L9TA 4PRHB 1SEBB 1U4FA 2C7FA 4Z95H 4BWWA 4UYQA 1FGVL 1OZUA 1AHWA 4NFDA 2WLIA 2P8MA 3PV6A 4X6DE 5SX5H 4PRBA 3R06A 2WZ0A 4EXPX 2BLFA 2E0PA 3UJIL 2G9HB 2RHEA 4MAYD 2ZUWA 4JE4B 3MRMA 4NHUB 2A6KB 3POHA 2Q76B 4NQDE 2D9CA 1JD9A 1KJ2A 1ZSDB 3Q5TA 1LMIA 4HHGA 5EC2A 2ZE0A 5F7EH 4F7PB 3D4YA 2E5EA 1VKXB 4WZ9A 5CBEB 3MROB 3DMMC 1CDUA 4FLHA 5E70A 3LQAL 4LE8A 4XNUL 3BGAA 3F5WA 3L9RA 3SE4C 5F9DC 1MDTA 3HNTH 2E75C 5D70H 3U36A 4BA0A 2BSDA 5LXVA 1LNUB 5HDBF 4L4VD 2J6EL 2GTWB 1S7UA 3E1F1 4PV1C 4MHHI 1BFTA 4FCHA 5ALCL 4N2DA 4C83A 1UXWA 4GQZA 5HYJB 4AV4A 3GSXB 3OKLA 5CBAB 1XH1A 3QH3B 2JCCA 3G6JE 3OKDB 3O45A 4BEIA 4GRLB 1ZVSB 4UB0H 5FWQA 4EE2A 2DD8L 2W07A 3IFPA 3EYVA 3SHSA 1BFOA 3AB0B 3N1QC 3Q0HA 1SOSA 3BESR 3VRLF 5GS0H 4LSUL 5A2LH 4FA6A 1YECL 5DO8A 1LP9E 1T4KB 3G5ZB 4XWGL 4GBXB 4F37F 3VXRB 5I73B 1Z9MA 3ZO0A 3D48R 3H7BB 3KE0A 5ECGA 2YD2A 5JIDA 2G75A 2GPZA 3K2UH 4JE0A 1W6LA 3O9WB 2XN9D 4XNYL 3RE0A 1FN4A 3TFKC 3Q48A 4PRDA 4M4RB 3B9KD 2MNJB 4HS3A 4ZS6D 2ORBL 4EIBA 5JPNA 4YL9A 4LDLB 5K9OA 3ARDA 3FU7A 1XF3B 2EDRA 1JHTA 4HIIB 3O11B 5BZWB 5AVQB 3DURB 2V7NA 3DK2A 4KTYA 4ONFL 5K93A 1TTAA 4ANXA 5ESAA 4C8XA 2PYFA 2ICWB 3GXTA 4DUVA 3K6SA 3IJ7A 5SWSD 1P4IL 1JGDB 1YEFH 3BAJA 3D4GA 5DZ9A 1IGYB 3U1SH 4C47A 3SOBL 4XVUD 2B7DT 4Q6IB 5BVJA 4K94C 1DQIA 1YNKL 2A6IB 3JV0A 4Y5VA 1OCWH 3G08B 4PIBA 4JW3A 1OTUD 5DJ8A 2P44B 2YLKA 3D3VE 2YEVB 3UYPA 5DZVA 1FFNB 4U6YA 1X4ZA 3GZQA 2V5MA 2WTPA 4GBXC 2XWTB 3S3JA 2H0PA 2BS9A 1OCWL 2A74B 5HTSA 2CJUH 1JPTH 2F53D 1TTGA 2BX5A 5KYUA 1CVRA 2WXPA 5I0ZA 3MU3A 2P45B 1Z3RA 2FJSA 4JB9L 4L1HA 5GGTA 4JM2A 4Y9CA 4GUPB 2GQHA 4UILH 1DLHA 3DX6B 2CKBB 4YOKA 4IIQC 4O9HH 2F5AH 5E03A 3WNMA 1A6TA 2P7TB 4H8PA 2VERN 3DVNB 4EBQH 5G5DA 1BF5A 1R75A 2NYYD 2R83A 1PQZB 3ULUC 2XFXA 3BH4A 1AIZA 2OYKA 1MCOL 1AZZC 4MJID 4YWGL 5FF6A 4X6CB 3K6SB 1D5BA 3TM6A 4PJAE 4FQQA 4XB3A 2GITA 2P8PB 4TUJB 1RZJL 4JDEB 3NCWA 3UTSE 4HISA 3OKMB 5JA9A 5FO8B 1WD9A 3QJZA 4ODHL 3SKNA 4I13B 4NQXB 1ROCA 2X4TA 1KBGL 4LLAA 3V5HB 3AUWB 1TCRB 1CBVH 1GH7A 5HYQA 1EZVX 1OAZL 1AZNA 1P84J 3S4SG 3A6CH 3KLQA 2YSTA 3OXRA 3CXHK 4QXWA 5AVWB 4KH2A 5B1KA 3SDCB 1KV7A 4KK5D 2IBZX 1Q4NX 3K1KC 5GSVA 5I15H 4G42B 1XL6A 4UTAA 3ZTCC 3UERA 2BO0A 2HYMA 3BVTA 4RCAA 1B90A 5DK0B 4ICWA 5AKRA 5K1JA 1IKFH 4KC3B 1LK2B 1NC2A 2D7TL 1GXEA 2G3MA 2FSDA 4CVZA 5E4IA 2B4CL 4QJ3B 4U6HA 1GGCH 2AP2A 2CDFB 3P4LA 1PQZA 3BQUB 4IDLA 1PD0A 4B0MB 2PW1A 3SKOA 1NFDE 3MO1A 1T0MB 3V9FA 4JY4A 1JGUL 2ZWZA 2AS5M 4GXVL 1DVSA 3C6LD 4H26A 4WUUE 3FO0L 5CZVL 1EGJL 5F71A 1U8HB 2OR7A 2AJYH 3ABGA 3H85A 3L3DB 5ICXA 3MREB 3FSOA 3VXRA 2NXZC 3KXFB 4M5ZH 4LPCA 3KPTA 4FL4C 3LNIA 5B1JA 1RD6A 1V8HA 3D39A 3TJHC 4L4JA 1L3WA 3BGFB 2XIDA 1FAIH 4PJHE 5DZPA 3UIZA 1I8LC 1GW6A 3BCDA 3LPOA 3WJJC 2IDTA 3UBGA 2YUZA 5BS0E 2WKGA 3DJ9A 1J8RA 4N2IA 2VLME 1WEJL 4AV0A 3VD0A 3U82B 5FW6A 4G5ZL 2GIMA 3E8VA 1AS7A 4AQ8A 3KD4A 4HGWB 3FCBA 3N40F 1AQMA 4Y4HB 2EVIA 1VFAB 4DGIH 3F5WB 4BE6A 1UXSB 3BT2H 5TPWH 3KHQA 5F96H 2WQ8A 4Y7OC 2AXFB 4PJGE 1OP5K 1GIGH 4YN3A 4M7KL 4KK9D 1OV8A 1C16A 5D55A 3CSGA 4ENZA 5HHMB 1Y1UA 2YUVA 3GSNB 3QDMA 2OM5A 3ZDZF 4CC1A 5HGBA 4OZIF 5EU6A 3MJ9A 2VISA 1GGIL 4YXLL 1U3NA 3D2UD 4KK6C 3P3UA 3PJSA 4NM4L 2XY1A 2B0SH 2W07B 1L9MA 4RMUA 2RA1A 3B3IB 5KG9A 1HXMA 5BJTA 3L95B 3N0PB 3CFEA 3F7YA 4OB5L 3W9DA 1RJYA 3T5WA 3V5DB 3BE1L 4PRHA 1N64H 3TA3A 4RMTA 3EH5B 4CNIB 1KB5H 1V27A 1JVKA 2FD6L 3ARGA 4FMFA 5B3JE 4QF1B 1CDHA 5I6OA 2QHRH 3DRTB 5JQ6H 3RPBA 5EUKA 3QEUA 3HE7A 2F1BA 5GS1C 2H4EA 3A4AA 5DD3L 3FZUC 1JP5A 1VCAA 2O5ZH 4KJWD 3WN6A 1S3KL 2IGFL 4HWEL 4XT1C 2H9GB 4HHWA 2E7LC 2P5EE 1U8IA 1B88A 2N7SA 4UOW1 3NZ8A 3EYUH 4M61B 3ZPDA 4OVVA 1I53A 5CJOH 3T8XB 4XN5A 3F62A 2RD0A 3MX0B 3UAJC 4Z0XA 1ZLWH 3D09A 3CGTA 3O4OB 3NH7L 4MQ7B 1T89C 1W0VB 4ODTL 3ARDB 3FU7B 2BIHA 2EC9U 4LESA 4P5KB 1BQHG 4FEMA 4YHNB 1P7KB 1CT8B 6PAZA 4L5FL 1XGYL 3G5VA 3GMQA 3N06B 3ARFD 3QZWB 3RP1A 3RX5A 4Z7WB 3BKMH 5EDSA 2ITEA 1IL1B 1FPTH 3RTQD 1T3FA 1TLKA 2ZAHA 3B2MA 3KM2A 1OGAE 4ELKA 2XFGB 4RAVA 2DQEL 3DJRA 5DA4A 3MRMB 1W72A 1RZKH 1ZVHA 4FXKB 4JG0H 1J1PH 1MFEH 2CGRL 2D03H 4L8DB 4U1SA 4MWFB 1B4RA 4L3ED 3Q5YA 4KAQH 5IQMA 2JLPA 3KPSE 2A7BA 4P3DB 2JJUA 5CINH 3GM8A 1BJ1H 2ZAIA 3FN9A 5FKAB 3QEQD 4BYHA 3MRHA 3VSQA 2VDMH 3U4AA