3I2CH

Crystal structure of anti-il-23 antibody cnto4088
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVQLVQSGGGLVQPKGSLKLSCAASGFNFNTYAMHWVRQAPGKGLEWIGRIRSKSHNYATDYADPVKDRFTISRDDSQGLLYLLMNNLKTEDTAMYYCMREGIYGSFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO4088 LIGHT CHAIN
publication title Noncanonical conformation of CDR L1 in the anti-IL-23 antibody CNTO4088.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH01
4L3ED 1DEEA 4QGTA 3VD4A 1WV7T 1U41A 1F13A 3T0EE 4Q7DA 3SJVA 3VXRE 4LLWA 2P8MA 2QEJA 2GT9B 4YHZL 3HPJB 1R3KA 1QSEB 4IMKA 3FN0H 1HHGA 1W72H 3AMKA 3LB6C 4X80H 1G7LB 2BNRD 5JOFA 2JJUA 2PYED 3M1BB 1IAKA 2FRGP 1NAMA 4YE4L 4NJ9H 4JFQB 4F7TA 5E9DD 2D0FA 3F8UB 3AY4C 5DJ8B 3I50L 3T4AB 4XNYL 2F5AH 1RZKL 3DX6B 3HLAB 2JJVA 3MMEA 5HHMD 4XCCL 2CK2A 2FX9H 1B0GB 4PRBA 5EZJB 1S5HB 2BK8A 3DHMA 4KPHH 1HHJA 1S78D 4F33B 3WN5B 1D6VL 3QXAA 5EBMB 1FORH 3FOMB 3MFGB 3NABL 3KPRE 4C56B 2DLHA 3NZHL 5DJXA 2AK4B 3FO0L 5L7XH 3MBXL 5I1AB 2E9IA 3D3VD 3I02B 1XIWD 2B4CH 5D1ZD 1KC5L 1GH7A 5EU4B 1DEDA 2HH0L 5T3XL 1Q8MA 4O9HH 2NY0D 3MLWH 2ATPB 3IDGB 2QSCL 4LBEB 5I18H 4YO0B 4AZ8A 3FHAA 4LPWA 1SMAA 1U8QA 1V7ML 1Q1JL 1FCCA 1J18A 2JLLA 2VSDA 4IOIB 1G7IA 2OBGA 4P5MA 4ZO7A 4JM4H 4CAGA 1IAOB 4ZSOE 3EW3B 1CDHA 5CHNA 3SDXB 2HP4A 2VXVL 5ICXB 3RUGA 4E41E 1C5BL 4U7MA 1HQRA 3RAJL 2N7BA 1YNTB 2PCPB 1IEAA 2B5IB 3GSRA 3LRGA 1C16A 4EUPG 2GCYA 4KKBD 1WAAA 2WBJB 3DWTA 4LSRH 4KROB 5FGCB 3VXUB 3FL7A 1CFVL 1P2CA 1OWWA 2J12B 3QDJD 2ZNWA 3BGFC 3QEHA 4UQ3A 4K7PH 1LEKB 3CFKB 3V4UL 5BS0E 4NPYA 4NT6B 3N1MC 5ITBH 4OSUH 2E6JA 1KCKA 3VJ6B 1MCWW 1N5YL 3KG5A 4PTUA 5KAQF 1MCFA 5FF6B 4GG8B 3MV8A 1JPSL 1R24B 1CDCA 4U33A 2UYLB 1QRKA 1FNHA 4BH8B 3UPCA 5I1CH 3W0WB 3QUML 3MNWB 1XZ0B 1PG7H 4F2MB 4OCYH 1IVLA 3C2SA 1OAYL 4JCMA 3SE9H 3BP5B 4ZUTA 1ZWIB 1LO3H 2WK2A 5E6IA 4UTAL 2CIKB 1MCRA 5LKNA 2FATL 3C6SB 4GKNB 3MACL 5EO1A 1AIFA 2YKLH 3V95A 4N5UA 5CZVL 1FFPA 3JUZA 4O02L 1M7XA 2N7AA 3V0WL 1S8DA 5JXED 1NMAH 2AJVL 3NA9H 2PR4H 4PJAB 1FZOB 3ARXA 5MP6H 5FDWB 4LF3B 3TO4D 3BIAX 2AEPH 3GBNL 3B9DA 2Z8RA 4NHUA 1LE5B 5C7XH 4DVBB 1A7RH 5FK9A 2A6JA 3U2SB 4JFFA 2IALB 1DN0B 3OF6A 4ZUUA 3TYGL 3X17A 3LY6A 5DQJA 1KTKE 4D9RD 4XC3L 4Y5VB 5FOBA 1DBBL 2Y36H 4AT6B 4XWGL 1WFUA 4DN3L 1RK0A 4NZUH 4OT1L 2YMXL 2BDNL 2E7CA 1S7SB 2W9LA 2X05A 5CILH 2X41A 1KENH 1HHHB 5TF1L 1JTPA 4KWUA 3KR3L 4F37K 4DUXA 1ZT1A 1VGEL 2VE6B 4Y8DC 4Z7VB 3TZVB 4Z78B 1Q9KB 3ZDZF 1PZ5A 3N9GL 5M94B 1KULA 3FRPG 1M6OB 1WUNT 4R7NA 4TNWF 4YHLH 4DTGL 4M7JH 1PQZA 4U1GB 3ZDZE 3VXOB 1YN6B 4S11A 4JFOB 1ERNA 1MH5B 1OAQH 1EIBA 3WKNA 4ALAL 4JFZH 1P7HL 3DV6B 3D2UA 2UWEF 3DRQA 4HS6A 2F54D 3ZE0F 1E27A 35C8L 1OPGL 4GW1A 1CFNB 2A74B 1FH5L 4KQ4H 2GAZA 2UWEE 5IIEB 3ZE0E 3T77A 3F7VB 1JHKL 3THMH 3GSQB 3S8WA 4AIZB 2DQFA 4V2BA 2PN5A 1MCOL 3U36B 1IT9L 4PTTA 4UV7L 2Z0BA 1XMWA 3QNZA 5ADOH 3QPXL 2CK0H 4GKZB 4GW4A 1O5DT 2IPKA 4DOHB 1T0MA 4N8CL 5KOVC 2Q7NA 4R96B 4RISL 3NBNA 2F53B 1CGSL 2D4FA 4H8WL 5T1MA 5I6XC 5J12B 4JGMA 1FYTE 3G04B 4G6AD 5IROA 1TZHA 4XP4L 4K23L 1MAML 2PXYD 4X4YA 3L5JA 5DMGC 2ED8A 4QY8A 5J06A 5JDSA 4WV1C 5CEYA 1OTTC 3Q5YA 5GGTA 3GSXA 2Z92A 1VKXA 1UENA 1X6NA 2UUDK 3BVNB 3E0GA 5F1KC 1LQSR 1E4KC 1FE8L 1QSEE 3V6FB 2EDBA 4RX4D 2NZ9D 3TBTA 4X6CB 3VGEA 3IJYB 4QRQA 1MWAA 4RWHA 1P5UA 1OQOA 2VLKD 3GMMB 3SDAC 4LCUA 4M62H 4Y16A 3QUYB 3RVXD 4ZUVA 1D7FA 4JHZA 2R2HB 3GK8L 4HZLA 1F4WL 4NUJB 3ARQA 3QULB 4XZUA 2GJ6D 3RWDA 1DL7L 2CLZB 2X5PA 4GS7B 2P48B 4M3KB 2F58L 4Y5XB 3MV7A 3MLTA 1RJLA 1AHWA 2FHFA 1ZGLP 3MJGX 4AEFA 1TDQA 2DDQH 4HFWB 5F72S 2HVKB 3P9MB 4J4PA 2EDRA 4LIQH 1SEQH 4X6DA 3H9HB 4C56E 1H15A 5C0JA 1C5CL 1J0IA 3OR6B 3FQWA 4XAKE 4OZHA 4L1DA 2FJFB 4KFZC 1I7ZA 4X83A 1QTYT 3V6ZB 4LOUD 1VEMA 5DF0A 1XH3A 3I9GL 1LO2H 2E7BA 5B8CB 1BF2A 3W39A 4M43L 2DKSA 4WDIB 2GSGA 4FFWC 1YEEH 4HIHB 2XY1A 4Q6IC 4WEMB 1JRHI 1PJ9A 4PS4H 2VERN 3FN9A 3INUH 4GBXD 4JANA 2NY3D 2Q20A 3EYFB 2YA1A 1IQDB 4LSPH 2CXKA 4UV4H 1TQCC 1IC7L 2EIBA 2LAAA 3SDXF 4HK0B 1JGUL 3PDOA 3D39A 3U7WL 2NCMA 4FQLL 3WNNA 4Q74A 3OJVC 3SDXE 3V6OA 1P7KB 3RWGA 4OFYA 3QO0B 4MAYB 5D1XA 1OW0A 4EN3A 4P5KA 4S1RL 3IDUA 1U8NB 4NKIL 1HDMB 3VXUE 5FGCE 2YK1L 1U8LA 1WWBX 1GGCL 5TE4L 2AABL 2E7LA 4I0PB 3BH9B 1WTGT 1QR1A 1JF1A 5F70A 5IB4A 1EXUA 1AD9B 5DJYA 1MIMH 2R2BA 3MRIB 4PFEA 5JR1L 5KSUA 2IWGA 2A1WH 3S5LG 2LE9A 3AVEA 3ELAT 3BKJL 5D5MA 1QYGL 4L3AA 4N9OB 1NUNB 1SY6A 4DK3A 3ROLA 2XXMB 3P4MA 1ZA6A 2A0LC 4TNVK 1QLRB 2XFXB 4DZBA 1S78C 2HWZL 1BLNA 1KJMA 3W0WE 2E6PA 2KH2B 4N8VB 3O4OB 5CJQL 5I30L 4XPTH 5EU3B 4UDUA 3KPQB 5E99H 5ESAA 1I3GH 1CLCA 4L8CB 3EUUA 3OZ9H 4PJAF 2COQA 2NY0C 5IEHA 5I16B 1ED3A 1EO8H 5EORL 2GSIA 4PJAE 4H25A 1AO7E 1KPUA 4G8FA 5HPMA 2IBGA 4JVUA 2X4TA 3BJ91 3GSUA 1B0RA 5F7DA 1I7TB 1WC7A 1BFSA 1S9XA 1MHCB 1UJTA 4JDVA 2XICA 3Q6GL 4Z95H 1C5DA 5FYKD 1OGAD 5D96B 2CGRH 2VDOL 1T22A 3EYVA 5DHXB 1VFBA 4K9EH 1G6RB 3W11D 1S9KC 2GY7B 1NFKA 1UM6L 1Q72L 3V2AR 4XC1H 2BHYA 1E4WL 4Y7MA 4H1LA 4Z7VF 1I1FB 4JN2A 3DYPA 5ITFB 4ORZC 2Q76A 3KLSA 4S0SD 2G2RA 4Z7VE 1DUYB 1CQKA 2OP4H 3RGHA 1JPTL 2X4SB 4OI9A 3WNKA 1OT2A 1Q9WA 4PGCA 4YC2B 5KVDH 1IMHC 1XR9A 3J7HA 2PTTA 5KJRH 5F88B 1BVLB 4GXVH 12E8L 4JREC 5DVMA 5HVHB 3X13B 3IVKB 1I1AB 4NFBA 4ZPVB 5H35A 1G7JA 1CFQA 5D2NC 4QRTB 4OGZA 43C9B 5TDNB 5HHVL 3MRQA 1UM4H 1KFAH 5FO8B 1GVIA 2VOTA 4PJDB 3BQUA 3C87A 3IJHB 3B2VL 1J87A 4MCZA 4MJIB 3U0WH 4ISVB 2J3SA 1KEML 2QR0B 4DW2H 5JXEC 1REIA 2I26N 3EYOA 4FQCH 5HYJB 3GDBA 4G43B 3TBWA 4WFFE 4FXGA 3TO4C 2WQRA 4MNQB 1GGTA 2R39A 5IF0B 2F53E 3AS0A 3IFLH 4HS8H 4YWGL 1KV3A 4Y4FB 3S4SA 3I6GB 3WIHH 3SE8H 3HAEG 2I9LA 5F7WC 4HWUA 3MRRA 1NGPL 1EHLL 5HYFA 4JO1H 3SJVB 4O4YL 3TPKA 4ZS7H 1CTOA 3ARBB 3O0RL 4G8GA 4PIRF 5K33A 1JNNL 2O5ZH 5JHDD 4UILL 3T65A 3K2UL 3O3EB 1K8DA 2BHZA 2APVA 1CG9A 4OBRA 4JKPL 1RMFL 3B9KB 5GRVL 5KSAB 4X6CF 1FNSL 5ALBH 1AGFA 1P84J 4BQ6A 3MRJA 4YXKL 4Q9RL 4MDJB 1NAMB 1GC1H 1JNLL 1HK6A 2ZSWB 4O5LL 4TSAL 3UYPA 3U4EA 4FZ8H 2X9YA 3IFNH 5IV2B 4PRBB 1OP5H 3HG1A 4R90L 1CS6A 5HHNA 4FQIH 3RDTB 1WLHA 3TCLA 1FLRH 5F3BA 2XG4A 1LD9B 2ADIB 2EO1A 3DNKA 4GG6A 4IMLB 2VXSH 5JIIA 5BMFH 1N5AA 2AI0H 4UT7L 1T5XA 1S7TA 4KMLB 3N85L 4KUCD 2FH6A 4MSWA 4LARH 1FG2A 4B7IA 3QUZC 5FYKH 4L4TD 4Z0BL 4OQTL 4G6AC 1U8QB 3C60A 2J88L 1MFEH 1QBLL 3RTQD 3AXLA 2PXYC 3MXVL 4HJGA 2YSSB 2VLJA 6FABL 4L9LC 3PF2A 5D8JL 3WE6A 5CHNB 1OD9A 1KN2L 3ULVD 1GXEA 1HQRB 3BKMH 2Z35A 3RKPA 2R15A 1IEAB 4DKEL 5H2BA 4HK3N 1G9EA 3GSRB 3CK0L 3N0PB 4X7TA 5L88H 4K9EC 1CD9B 2IG2L 4R4FL 3V9FA 4UQ3B 2GTZB 1H8OA 4XWOD 3RVXC 2WANA 3O6LL 3I6LE 1AGDA 5GSRA 4GRLD 2APWA 4U1LB 4EI5A 4HUUB 4RGND 4WHYG 1YPZA 4PTUB 5SWZA 5T1DH 2XWBA 1GJIA 1OSPH 2YR3A 3Q48A 1P4BH 1QLEH 2NTSP 3DSFH 4JPIA 3JBG7 5JNYB 2BZDA 3T08A 4HGMA 4M93B 4ZXBC 2OS7A 3MJ6A 5C71A 4XH2B 1NCBL 5ACMA 3F12B 4ZUTB 5KANG 1F4YH 3DROA 1KT2A 3O6FB 3QUKA 3GJFK 2F5BH 3PP4L 3ESVF 4F7PA 5DA4A 1LDSA 1VFAB 3RVUC 3RFZC 2LU7A 4OZFA 5EO1B 5T5FL 3SHSA 2DIBA 4LOUC 2D31A 3OWEA 4P3CH 1AI1L 2YUZA 3WEXB 3O2DA 2X89D 4MXVF 3BUYA 2ITDA 1PLGL 4OCRH 5J6GA 1RIHH 5DRWA 4XAWH 3P9WB 3REVB 2V7NB 2WAHA 2NY3C 1EA9C 4MAUL 3RIFK 4HGKC 5C8JA 3I75B 4AQ1B 1CU4H 1CLYH 3LAFA 1X4ZA 2IQAA 3C8DA 4NZRL 5BW7A 5EUOE 1HEZA 3KLDA 4TN9A 3Q5OA 1PAMA 1XGPB 5EZIL 2RB8A 4R4BA 4G6ML 4N90E 3SEPA 5JPNB 2B8OT 1H0DA 3T1WA 3VFMA 5DUML 2W0PA 1OB1A 1HSAA 4HCRL 4KZEH 1U8HA 3VGHA 3BKCL 4FQPA 5HYSG 5SV4A 1ZLUK 2VLLA 3X12A 1AQDA 4OLYH 5GS1A 3VG9C 4EOWL 5I76B 2FX7H 1KTRL 1ZLSH 3GIZH 3CU7A 1C7SA 2R0LL 3J8F7 3UZQA 5HHQB 5EOCH 1PQZB 4ZD3L 3Q0HA 1IM3A 1GC1C 1XR8A 4L1HA 3GBML 1KLUB 4JFDD 2HYMA 1F90H 2P5EB 3P0VL 4LU5H 4NN6B 3VFSA 3NFPA 1HI6A 1AKJB 4GW1B 1KG0B 4QHLA 1A0QH 2XY2A 5F44A 4RAVA 3KJ4C 4OGXH 5FB8A 4G7VL 2X4PA 3QXUA 1MEXL 4LLYB 4PJDF 3HHRB 5I9QC 4PJDE 3RL2B 5T1LD 2DD8H 2OQJA 4MJIE 2KUTA 1IL1B 3VXPA 1T3FA 4XP5H 2HJKB 4HXBL 2IPKB 1Z0MA 5E2TL 1CDBA 1QRNA 2VDRL 3QR2A 2H1PL 4MNQE 1UYWL 3TN0A 3RPIB 3O8XD 2F19H 3FB7A 3OR7A 4DVRL 4PJHB 2ATKA 1R3LA 3ULVH 1SM3L 3SKUD 5E2WH 4UNTA 1ORSB 3C9NB 4PJFB 5ISZA 3PDGA 5JDSB 1BP3B 3WDIA 2YPKA 4NZJA 3W11C 1VKXB 2Z92B 1R3JB 3QIWA 4LEOA 1FL3A 4ODUA 2GK2A 4PG2C 4NYLA 5DK3A 4JFXB 2BMKA 3T09A 1CGUA 4U1NA 4LCWD 4G9FD 3U6RA 4A6YA 4YEFA 1FFNB 5I74B 4PJGB 3BW9A 2VLMD 3K80A 4LCUB 3FTGA 2EH7L 4ZUVB 5I8KL 2VDNH 3LOWA 5IVOA 5MEPB 3HZMB 3V5HB 5AD0A 4U6HA 5HD8D 5IESL 3GGWA 5BVJA 3M17B 3KYMB 1YDPA 3QXWA 3L6FB 4WO4A 4X6FA 1FVEB 1FV1A 3QZWA 2DQJH 2X42A 4MWFA 4XPFL 4YDKH 2W9DH 3IDYB 2ICWJ 4H20L 1WBZA 2GIYA 1NCCL 1AHWB 1RJLB 5EULV 4NQXB 4M7KH 1DFBH 3B5TA 4NQCA 4M7ZC 4I18A 4P2OA 4XRCA 3LVEA 4XCFL 4X9BA 5IB2B 2J4WH 1I7RB 4PG9A 4ONGL 5T3ZE 3GI9H 3FQWB 5FO9A 5TDOA 4RCAA 1I7ZB 4P2RA 3WIIL 1JZ4A 1AGCB 5FYJE 4DQOL 3OKDA 4LCCA 1IZJA 2W07A 3O4LD 4Y1AD 3LDBB 3TH2T 1E4XI 1KYOK 1CI5A 1HXYA 3MCLH 1L0QA 5FUCE 3L5IA 5CGMA 1A3RL 5CJ5A 4W4NA 5D7IA 1OP3H 4ENED 4ELKB 5JO5B 5BZDA 2D7OA 3RUGF 3PDOB 3D39B 4PLKD 1CYGA 2ORBH 1HWHB 1YJDH 1B88A 1G7HA 5D7SH 4RBPK 5C0AD 3PWLA 4XGZA 3HE7D 2OTUB 2ZG2A 4NKMB 3MRGB 1U8LB 4ZOCA 2QL1A 1U8PB 4NFCA 3OSKA 3N1QC 4DGVH 2XOTA 1DVFB 1FQ9C 1DQDL 2R2BB 3F58L 1NLBH 4TTDD 4XCNB 3LCYA 4KKNA 3WD5L 1Z5LA 4NC2B 4U0RB 1T66D 3O45A 4HX1B 2H6PB 4PB9L 3IFOB 2XTJD 5KG9B 5K9QI 3T2OA 1JFQH 4WFGE 3KS0H 2J6EH 3C08H 1X4XA 5F7UA 5DFTA 2AJXL 5ID1B 1ZA6B 4MA1B 3G08B 4G8EA 1XF4B 1X5KA 3RIAK 2A83B 3OB8A 2MCPL 3DBXA 5TFSL 1AGEA 3RZWA 4K3HA 4WU5A 3IGAA 3BO8B 4KY1H 4NQEA 1A6WH 3IDNB 1EFQA 3N06B 5D9SA 4EIGB 4WFED 2MQ0A 4I0CC 4YBQC 3TLRA 2HG5A 3ZL4H 2FEEI 5JHLL 1K6QL 4K71C 4YR6B 2HRLA 3VGFA 2OM5A 2VL5A 4YFEA 5B39A 5IGXL 5C2UB 5IEHB 4AENA 1ED3B 3HNVH 2Y4SA 3MOBL 4MA8L 1DQJA 4WUKL 5D4QA 4WW2A 5TE7H 3GSVA 4LLVA 4OCMC 4F9LA 5GS0D 1C08B 1K2DB 2XPGB 2GI7A 1JZ8A 3RTQC 1B0RB 5F7DB 5C09A 1EFXA 2ARJQ 4N0YH 1W0WB 4N1CA 5D72H 4WNQA 5A3ID 1N3NB 4ELMA 32C2A 3IDXL 2VR9A 4QTHA 3ULVC 3IU4L 5D7JB 2ZUYA 4ODSH 4HKJB 3GHBL 2JB5H 1IGIL 3SDDC 3QWOB 4O2EB 4ZOAA 3UO1L 4H1LB 1P53A 5E08H 3LEXB 4ZQKB 1FRGL 4XWOC 1FGVL 1KACB 3OKLA 1Z0NA 3H3BC 4YH6A 3VXMB 5HVGB 3IJSB 3KYOB 4GRLC 4MB4A 3QDHA 1QLFB 4FFVC 4RRPA 4IDJH 4KVNH 3S37L 5DMYA 2AQ3A 2P5WD 5DD1L 1EMTL 2VDMH 4HWNA 4PJIA 5BRZA 4Q9QL 3GEWB 2P5EE 3T4YA 1FFQA 4TVPD 5EB9A 3DUHA 3VE0A 2L4OA 2OJEB 1E6OH 1RZ7H 4F7EA 4UI2A 4U1MB 1G7JB 4WTWA 3PGFH 1CFQB 3MV9B 1ZHLB 1TQBB 2Z31C 2DKMA 3BEWB 3I3DA 5A16A 3DIFA 2VZ3A 1EJ6A 5I1IL 3GSNA 3VD7A 2BNUA 2ZCLL 2M26A 3L3GB 2DLTA 2ZUTA 3BQUB 4OFKA 3H9ZA 4FA8A 1HXMB 5GGSA 3UC0L 4I4WA 2GUOB 3EO0A 1F3RB 5GJTL 4XI5C 2VXTH 1MFDL 5IJKA 3O81A 3MUJA 4FXGB 1NKRA 5K59E 1A6PA 1PKQB 5HGAB 4PJ5A 2H8PA 3HB3D 4FS0A 1NBYA 4N8PA 2XA3A 4AG4L 4PJHE 3IAQA 4PJFF 1VCAA 4D2NA 4X7EC 1NAML 4X7FC 2OL3B 4XPBH 4APQD 3QCUL 4PY8I 3B6SA 5EA0H 2P45B 4PJFE 1J1PH 5IP4A 3VXNA 3T65B 3WFEL 1P1ZB 3BD3A 3N1PC 1JTTA 1LK2A 1AY1L 1K8DB 3HE6A 4G6JL 3WS3B 4OTXL 5DDHA 3S4SG 3TM6A 1I7UA 5AYUH 3MO1B 1RUKL 1YJDC 2A73B 4PJGF 2HJFA 2PNDA 1RZGA 3F6LA 3VFOB 3FQNB 2DTMH 1P9MC 4PJGE 4LSSH 4OCSH 3ARTA 4EBQH 3Q6FA 2ZJSL 1ZKAA 2IGFH 5E2UL 2P1YA 4HKBB 4PRHA 1J5OH 4RIRA 5T3ZL 1P84K 3UAJD 5C08D 43CAB 1IE5A 1E6JL 3NCMA 2CXGA 4I48B 1QSFB 5EC2B 4JJ5A 4G3YH 3QDME 4ZTOL 4R0LA 2UZIH 3L5HA 1JMZA 5CD3A 1MJJA 2C3VB 2WWKO 1NJ9A 4U1HA 1WEJH 1RUAH 3AREC 4WHTB 1H3XA 4A2MA 15C8L 5F97E 4UBDD 4HXAL 3PL6D 4UU9A 5HHMB 5I73B 1EBAA 1YQVL 5FKPB 1JGEA 2ZKHH 1VHPA 1I8MB 1T5WA 5J4MA 4JHBA 4K3DL 2ESVD 1T5XB 2MPAH 2XRAL 4UAOB 3MRCA 3TNMB 3ZE1F 3BDXA 1JIBA 4V1DD 5DRNB 3UBXG 5F1NA 1QNZL 1H3WM 3ZE1E 4JE4B 4MSWB 4M6NH 1Z9SA 5T3XD 1FVDA 4G5ZL 4PJ9C 3MC0A 4N1HB 4PD4K 3O8XC 2HKFL 1XIWB 3OKMA 3RWHB 5D1ZB 3CSPA 4YIQA 1CIUA 5IUSA 3IDMA 3SGDI 3AXLB 1NL0H 5F9OH 5DFWH 3LIZH 2YPVL 5CKGA 4J3VA 4XPAL 3WE6B 4OD2A 1BD2E 1ZSDB 4QT5B 4WI7A 4DGIH 1J86A 2Z35B 5H2BB 1C7TA 5I8CB 2CLVA 4UIKL 3WL9A 1TETL 1GAFL 3QP3A 3OPZH 4QHUB 4NN5C 3FQRA 4H5SB 2HT4D 3O11A 5GISL 5IBUB 2YC1B 1GGIH 5KOMC 1FZMB 4TVPH 1U42A 5FA3A 1AGDB 3WS6A 4FQXA 3EGSA 1KB5B 3GMNA 4GRMA 1OTSD 2FR4A 3MLXH 2XWBB 1JZ5A 4C55A 5AUMB 3FMGH 1G0YR 1X5JA 1C12B 3LKPB 3MRFA 1LO5B 2HKHL 3WHXB 5CBAA 4OD1H 2IPUK 4OJFH 3VU2A 1JV5B 3HAEH 4BKLB 5MERB 3O3DA 1GYAA 4G42B 4S1DC 3DROB 3O3AB 1Z6JT 3QUKB 1MFBL 5IVXA 3UPAA 2P7TA 1F3JB 4F7PB 4NQSB 5CUSL 1YEFL 3MCKB 3OG6B 5SWSA 3BUYB 1NANI 5I8OL 5DQ9B 3ET9F 4QF1B 4OCWL 2FWOA 2VQUA 4W68A 1DBAL 5DRWB 5HI4D 5J6GB 2OTWB 1RUPL 4PREB 3FJTA 3BAEL 4HDIA 5GZND 4OAWA 1BBJB 1IGJA 4MCYA 3QB7C 2K7QA 5C0BB 5IM7A 2WZPD 2X9XA 5BZWB 4ENEC 1ZVSB 3GM0A 2DM7A 5EU6D 5EO9B 3MODH 2IQAB 3VXQA 2AK1L 3LKQA 2CLRA 4PLKC 3OGCB 4PRDB 4X99B 4YHZH 3LN5A 4P5TB 1W8NA 5GRJH 4HJJL 3SKMB 1OP9A 4R4BB 4KI5D 3O6KL 4HKXB 1H0DB 3QISA 1J11A 5DLML 4NHCL 1OB1B 1HSAB 1U8HB 3HE7C 1UCBL 1C1EL 1MCEA 3X12B 4UNVA 1I1YB 5GS1B 4IDLA 3U30B 4NM4H 4JQXC 3ARGD 4NKDB 1UWEH 1DQMH 4OLVH 5IK3B 2X1XR 4PR5A 4TTDC 2CKBH 4TPRH 3VXME 4CU6A 1A7QL 4ZTPH 1RZKH 3AY4A 3C6LD 1XR8B 5K9KB 4R7DA 2XTJC 4XCCH 3RNKA 2APBA 1KCUL 3KJ6L 3FRUA 5H37G 5CIPB 5A43C 3EAKA 3KLHD 1OAZL 4RFOL 4BFIA 5DMIL 4KJQC 4QHLB 5DJAA 4R3SB 4XMPH 2DYPB 5FB8B 3NABH 4P99A 2X4PB 4J8RA 3GI8L 3MV9E 2H41A 1J8HB 3ARDB 3NZHH 3WMSA 4Z77A 4KK9D 5FA4B 1ACYL 3MBXH 3UTSA 3FT4A 3IXTA 4GMTL 5I1EL 1TJIH 1UXSA 1KC5H 2AVGA 5FOJA 3MNZA 3TGXA 3QJHA 5T3XH 1U8KB 4QOKD 1V05A 2ICWA 3V7AG 5DEZA 1HZHL 3T0ED 1F8TH 2QSCH 2EDTA 2O5YH 5GGTL 2C7UA 1QRNB 1PKQE 4Z8FH 3ZLQC 2UY6A 3QXDA 5C6WH 4L8SC 1J0JA 3VFGH 4DKFL 2PTVA 5EH1A 1YEDA 2MQ3A 1DBKL 1UB6A 4L29B 5ISZB 4WHYH 1C5BH 1U2CA 2X70A 2AJSH 4Z6AT 3QDGD 2V17H 5FAAA 3H7BB 2HT3D 4LCYB 3VCLB 4Z7UA 3VWJB 4LEOB 4ODUB 1YA5A 4NYLB 1B2WL 4AYFA 4D3CH 3MYZA 3LPGA 1C8PA 3VW3L 1NDMA 2NXYD 1I3RB 2DQTH 1KCSH 2HFFB 3FB8A 4OCXH 2YA0A 5DMKB 1LDPL 4ZO9A 1WCBA 3H6JA 4P46D 2AKRA 4KRPD 4BZYA 4U6HB 4Z5RA 5BOPA 1NEZB 5BVJB 3MREA 2BNRE 2R1XA 3KPRD 4WO4B 3QZWB 5MHSD 1QSFE 5E9DE 4NC1E 3JTTB 2B39A 4Q9CA 2Q3AA 3G5XA 2VKXA 1OAYH 2XN9A 1MREH 1YMMA 5HHOD 4UTBL 5E70A 4BA8A 4I18B 2H32A 5HHME 1F4XH 1NCAH 3CDFA 4U1IA 1RURL 4O51A 5CZVH 1RUQH 3HI1B 2VJXA 4QCIA 5FO9B 4WUUD 4U3XA 3ZT6A 2W92A 4NNXA 2AJVH 5IQ7L 2W65B 3BUTA 4JZJB 1Q0YH 3D85D 3OKDB 1CCZA 5BV7C 5JW5A 4LGRB 4UQ2B 1YY8B 5IMMA 1NGQL 4FNLL 3HB3C 4RA3A 1Y0LA 3D3VE 1Y18B 2FHCA 4R8WL 4JGUA 3TYGH 3BH8A 4XC3H 2VDPL 2X4OA 4APQC 4OT1H 4U2YA 4HC1H 2YMXH 1MCDA 3D0VA 3OJDA 1QFUL 4GBXB 1F58L 2NY1D 1D5XB 5IMOA 4RAUB 1KIPA 4JFYA 1KJVA 1SY6L 2EDHA 5IOPA 3LKRA 1NFIB 3KR3H 2X4UA 1BREA 1VGEH 4PRPA 5TH2B 1A7OH 4FHBD 2V2TA 2YXFA 3JWDL 2XKNB 4WHCA 1MQ8A 1XCQB 3CH1B 1IAIM 2YD1A 5IG7A 1W72A 4DTGH 1BM3H 2Y25A 2FEDD 1TCMA 1QKZH 3O45B 3UAJC 4EDXB 2G5BB 5HI3D 4JG0L 3QDJE 35C8H 3DO3A 1RZKC 2CDFA 4PJ8B 1BIHA 4JY5H 4G8EB 1BVZA 1TPXB 3DBXB 4UBDC 5IT2L 1KOAA 3PL6C 1IGMH 5KVFL 3G6JB 4J3WA 1MCOH 1IT9H 4NQDA 3NPZB 4LP4A 4UV7H 2IADA 5JW4N 4Z76B 5I1LB 1F42A 4KMTH 4JHAL 4YGVB 5C6PB 2VL5B 1NGYA 5DJDA 4AENB 5KW9L 1YYLL 4YK4B 1RZJH 4RISH 1UJ3B 5GGSY 4PLJD 2EIEA 1CGSH 4F3FA 4X7DC 4WW2B 4LLVB 1LHZA 4YDLB 4XP4H 4CRPA 5C09B 3ECBB 5C0BE 2FD6L 4D9QE 1MAMH 5DK2A 2VH5L 2DQCH 2FLRT 1U95A 4X8JA 1AR1C 5B39G 5J1SC 2NY6D 2VUOA 2PO6D 3ARZA 4NIKB 1R3HA 1VGKA 32C2B 1EO5A 5TQ0H 3LEYL 4QTHB 4WV1A 4DAGL 1A4JB 4ZNEE 2OCFD 1OAXH 4HMCA 5IR1A 4NKOB 1GZQA 1E4KA 4D9RE 4C54A 2VISA 1MF2L 1FNGB 4FXKA 2HT4C 5C07D 3P4NA 3EYQD 4CVZA 1BFOB 3BRFA 1VDGA 5EN2B 4G6FD 1TJGH 3GK8H 3PQYA 3SDAA 4CNIB 5EZOL 3BPOC 3SDCB 5CD5D 5F21B 3MR9B 4MJ4A 3K4ZA 3T4YB 1I3VA 3LMJL 4H0GA 1NC4D 3QIUB 5JQ6L 3HNTH 3SGEI 1HKFA 1K9TA 3ZTJH 4GSDL 2BNQB 1MFAL 1GHFL 1IKNC 4FMFA 1J8HE 4Y2DC 2BNUB 3FONB 2OR8A 3CVHH 1FYTD 2FECL 3R1GL 4ZFFB 3LSOA 5E24E 5C0CD 1IAIL 1CR9L 1BVKB 1IFHL 5KN5A 3EO0B 5SV3A 2YUWA 4M43H 1TTFA 3L5WA 5HI4C 3TVMB 3TJEL 2FX8L 3QFJA 1QRNE 1JBJA 2K3TA 4PJ5B 2PW2A 2H8PB 4Q6IA 5E6ZA 3CZJA 2RBLA 3WO3B 3ULUF 1UXWA 4L4JA 4ZFGL 5IHUL 4PRAB 4L3EA 1X5ZA 1H3PH 1JGUH 1UB5B 4CN1A 4XCEA 3ULUE 4CMHB 3HZVB 2ZSVB 4FQLH 2IMMA 4HJ0D 3RY5A 5GRWA 1CD1A 5JMOC 4MA7L 4KI5C 5FCUL 2W60A 1LK2B 4I3RH 2CUMA 1JUFA 2B0SH 2HJLB 5DEFB 5LJYH 4LVNB 3TYFB 1FO0B 4O2FA 5DDHB 1CFBA 5JLZA 1I7UB 5ERWA 4NKIH 3UJIL 2WINA 3CSGA 2YK1H 2MWCA 3UPRB 3V52H 3L9RB 5HBBA 2PYEA 2BCKA 2WBKA 1EGJL 2HJFB 4EIZC 2A2QT 3ARGC 1XGTB 5DJZB 3S34H 5CWSB 4HFUL 3EO1A 4YHPA 4YHNA 2XZQH 5JR1H 1R5WB 3Q6FB 4M00A 3C6LC 4XHJD 2D7QA 5FGRA 3PHOA 3BKJH 5EU7E 2NLJB 1QYGH 5KBNC 5D93C 4Y4KD 1D3CA 3KLHC 4C56D 5L9DL 2AK4D 4J1UA 4ZAKC 1D9KB 1DBJL 1MJJB 3L3KB 5CD3B 5ICYA 5IKCB 1NJ9B 1TVBA 4U1HB 4XAKD 2O61A 3MJ8B 2C1PB 3NCYS 1CXKA 2BOCA 1MNUH 4HPYL 4KK9C 5J1AA 2DKUA 5I30H 4DKDC 1MPAL 3MRNA 4HG4J 1ZANL 5CJOL 5E8NA 2W0FA 2JTDA 3SE4C 2CMRH 1HYRC 4L8BB 4UOW0 5ANMA 3NAAL 4OD3H 1CDIA 4JLRB 3MRCB 3F5WB 4FTVD 1INEL 4PJ7B 5FO7A 2NXZC 2JELL 2KKQA 3T0EC 1NSNL 4HH8A 2AGJH 2IPUG 3BSZL 3DX7B 1CBVH 1FVDB 1X6LA 3HMXH 4LSVL 1X5LA 2XA8L 4DK6A 4RMUA 5C9KA 4YIQB 4PGZA 1I85C 4ACPA 1LEIA 5JW4Q 3H42L 1HKLL 3DVIA 4GT7A 3BKYH 4QHKI 5LWYL 1XF5B 4I13B 3VXUD 4JPKH 2WBJD 3VMNA 4KROD 2VDOH 2DLFH 1I9RL 3GUTB 2D2OA 1G1CA 1HQ4A 4U6XB 2QADC 2EEBA 2F8OA 2V6HA 1EVUA 2GHWB 1KB5L 3GRWH 4M61B 5HJ3A 1FAIL 3KVQA 5T1KA 1KJ2B 1NCNA 1E4WH 2CLVB 3T04D 5LGHL 4K7FA 4XNUL 2NXYC 4Z7NE 2WP3T 3CUPA 5EOCJ 2F9BT 5BJTB 1S7QB 3L3DB 3S37X 5ENWA 1T20B 1WCQA 5JPMA 3MLZL 4JO2L 3LQAL 4KRPC 2F8VA 1T6VN 4LRNL 3W0WD 4TYUA 3MRHA 3KPLA 3FQTA 4FQXB 3JV0A 4P2YA 3VGAB 1Z9MA 4H26B 12E8H 1XGUB 1IEBB 1QHPA 3S96A 4QRSB 3STZB 4S10A 4OIBA 4YHIA 3O2DL 4S0TD 4JDTL 4P57A 5D1QB 1L7TL 1CLOL 1JWMA 3G6JF 4NO5B 1MUJA 4C4KT 3RZCC 4CADB 1PFCA 5HHVH 3STLA 3G6JE 3O3DB 5D2NA 3K7UA 4P23C 4DZ8B 4I3SH 2FIKA 3UJJH 5JXAL 4RDQF 2P7TB 1UWXK 1MVUB 4N0CD 2EXYC 3RWFB 5B38B 3MRKB 2ARWA 3RX8A 1WIOA 1S7UB 3BP4A 5SWSB 5JXEA 1IRAY 3CX5J 4WW2F 1A9BB 1BGXL 3VXSB 1CFSA 1NQBA 3JXAA 3TO4A 4HDIB 3MJ7A 4OAWB 2DM2A 3DGGA 4D8PB 4ETYA 1CE6A 2DQHH 4M6OL 5C09E 1A22B 1EHLH 1AP2A 5GZOD 2DQEL 4M48H 4KHXL 3O0RH 1MFNA 1JNNH 1P4LB 3LKQB 3CFIC 2EDYA 3A67L 3K2UH 4UILH 4XPGL 1IC5H 2UZYB 1P7QA 5DD5L 3C5ZB 2N4IA 1RPQA 2BVYA 2NY1C 4KTYA 4S2SA 1RMFH 2ADFH 5I0ZA 1FNSH 2OI9C 1ZOXA 3FB5A 5GJSH 4OIAA 3IETB 5MENB 1N6UA 1QG3A 1OGAE 2AXHA 1JNLH 1S7XA 1O7SA 1KBGL 3VI4F 1H5BC 1YNLH 1CICC 4NN7C 3VI4E 1R0AH 4YZFF 3DYMA 3X3FL 4LLMB 3DXAA 5LQBL 4HK3J 3FQXA 5HI3C 1IGYA 2F54A 3ZTNL 5C0FB 1OT1A 3GO1H 4U7KA 2OZ4H 2YRZA 3GJFH 1OHQA 4J8RB 4TULL 4DCQB 2BNQE 5DVLA 3W9EB 5CGYD 5J1TC 4WFFD 3UTSB 1W2KT 4UT7H 4M8VA 3W5NA 3IXTB 4R6UA 3WFBH 1UXSB 1HH9B 1U8IA 2QQLL 2NMSA 1BJMA 2AXGA 4JFED 4LASL 1FNEA 3QJHB 2Y72A 4XXDB 3NACL 3QQ9D 3E6FA 4KJYA 4U1JB 1RHFA 2LABA 4PLJC 4DGYL 2I9TA 4ORGA 4QO1A 1CZ8H 1MCPL 2YPLA 2VDLL 3WLWD 5DRXB 4OQTH 3IRPX 3TF7C 3QUZA 1DDHA 5L6YL 5F3HB 4CUCA 4C83A 3WLBA 4NNPL 1DLFL 3QFDA 6FABH 4A6YL 2NY6C 2PO6C 2PXYA 5J13B 4NO2A 3EJZD 1KN2H 4L9LA 4MNGB 3U4BH 4ZUSA 3PWPB 1SBSL 1DQTA 3WDHA 3P11H 2BY1A 3O41B 4G80A 4HIEB 4LHUG 3CK0H 3EYSL 3V4PH 2CH8A 4AY0A 1XCTB 1JWSA 3EHBD 3I3BA 4TQEL 2HT2D 2UZXB 4LQ1A 2QQKL 3CZFA 3FB8B 3O6LH 5HGHA 2VLKA 4G9DA 1TXKA 3KS0J 5CD5C 5LBSL 1JHTB 3U46A 1WBYA 4HWBH 3I6KB 3TNNB 1RU9L 1BJ8A 2LU3A 1UG9A 2BVEA 1G9ML 1SJVA 2GJ6A 1AQKH 4U4BA 4XNZC 1TVHA 1YNKL 2RGSA 4KK5D 3QO1B 3A6OA 4RMRA 5ICZA 1UWGH 4LKCB 3G5XB 5T5NG 5E8OA 3RA7L 3WFCH 1NCBH 2FYYA 3TO2A 1N64L 2DM3A 3BGAA 2UY7A 3Q2CA 2W38A 4ZXBA 1KIUA 5F7HA 1DLHA 3PP4H 3DVNB 4P2QD 3GSOA 5ILTL 1B0WA 3NGBC 5AZ2L 3SY0A 4PJ7F 4QCIB 4UDTA 1AI1H 3RVTD 4NNXB 4LVOC 3E2HB 4Y19D 1PLGH 4PJ7E 2VAAA 2IANB 4WU7A 5IWLC 1GIGH 3G9VA 2NNAB 1AC0A 4WW1B 3CFDA 2FO1A 1TTGA 5DD6A 1L7IL 3VRLF 2X4QA 1BQLL 4HD9A 1RIVL 3VRLE 2JCCE 4OLZL 1BZQK 3FT2A 4NZRH 1U2HA 1KCRL 5HDBF 4X7CC 3UZEA 5AZEL 1NC2D 4B7LA 1OD7A 3WIHA 4G6MH 5C6TH 3U7YH 4AEEA 3OJDB 4I0PD 5HDBE 4L4TE 1AXTL 2UV3A 5DUMH 4D0CA 3OG4B 5IMOB 3O2WH 4JFYB 4OLXL 4BFBD 2O93L 5IOPB 5TE6L 4OKVA 1QPPA 3KNBA 2HFEB 4HUKB 1YC7A 1ZVYA 3MUY1 4QYOB 4EOWH 2VQ1A 2VITB 3SPVA 2R0LH 1F2XK 2OJZH 4XHJC 5D2LB 4ZD3H 1M7IA 2X7LA 5C0AB 4ZFOA 1XF3B 3WN5C 3P0VH 2WUBL 1MLCB 2VZ1A 3FFDB 4F15B 2EH8H 2VSCA 1U91A 1BZ9B 4HT1H 2YBRA 1OTUC 5CMAA 1QP1A 2DQUL 3MLVL 5CAYB 2J8UB 4OZGA 3MRBA 4L5FL 3KDMA 4RGNE 3QG6A 3ZKNC 3UTQA 2D03H 2FH8A 4NQDB 3AB0B 1ZVHA 4PRNA 5EPMB 5IFJA 3PABA 1U3HB 2NW2B 3BXNB 1NBVL 4OLWL 3DTXA 2AJYL 3BZFB 4HXBH 1A9EB 1WTLA 1A2YB 5E2TH 2W0LA 5HHXL 1OARH 4WI9A 5C0ND 5SWSE 2QJDA 3QEGH 5K9JL 2XQBL 4YHYB 1CD0A 1LWRA 4F3FB 4QRRA 1BQHA 4JY6A 3QH3B 3OTTA 3VXSE 2WM0A 1A3LL 2V5YA 1PDKA 1SM3H 1OSZA 3WNOA 1IGCH 1A6VL 4KKLC 3RBGA 2WBJC 4KROC 3VFTB 2A6DB 1R3HB 5DWUH 4RBPH 2VXQL 1IKFL 1LGVA 1N2RA 1ACZA 1U0QA 2ED7A 3PGCA 1GGUA 9CGTA 3PWJA 4YHOH 4PG2A 4CW1A 5MENE 3VWKD 3VI3F 3CFBA 4Y2OA 4X5XA 3RVVD 3VI3E 1I1AD 4L4VA 3H9YA 4MYWB 2XTLA 3SCMB 4QXWA 3QNYB 5JZ7C 5DO2D 5JTWA 1FLTX 3GSNL 3ILPB 4JB9L 3M07A 1AGBA 1ZS8A 3MA7B 4OBSA 3UMTA 4MQ7B 3V5DB 4H20H 1NCCH 3TT3L 3WXVH 3RI5K 1IM9D 4MJID 3CFCH 4JPWL 2AV1A 3G5YA 2N56A 1X3DA 4AL8L 5H94A 2P49B 4KTEL 5HYJD 3UTTD 4IIQA 4WTXA 5ESVB 4WFHE 5EOQH 5ESQB 1Q9LA 4Y4FD 1S9YB 4M1CD 5KN5B 2AJUL 1JPFB 2B2XL 3LKNA 4Y5VC 5GGRA 3RHWF 3SJVD 2APFA 1OAUL 4JVPA 2PW2B 4Q6IB 4ETQB 2E27H 3KXFB 2HMIC 3S35L 5GZOC 1VACB 2ZG1A 3B9KD 3QXVA 4HQQH 1A21A 4GAGL 3EOAA 4UUJA 1CD1B 4FQHA 5T33L 4MVBD 2VR4A 4MNGE 3TZVC 5JHDA 1F2QA 3PWPE 3MGOB 1QFWM 1DQQB 3G6DL 3CLEH 5B21A 4NRYA 1II4E 4OM0H 4WWKC 5I1KH 1X7QA 4U1GC 3TJHC 3TESA 3IRZA 4U6VL 1KLGB 2C1OB 3BHBB 2YA2A 1JYVA 2VLRB 1LE9A 4OLUL 1G7MA 1F4AA 5E00B 1IGTB 5DJ6B 1EJOL 4CMMB 1MRFH 4TVSa 4OCNC 2RJMA 1V7NH 3RDTD 1I1RA 4N1EA 5C0GA 3QI9A 1UT9A 4NRZA 3DMMC 3RGVB 5CINL 5BO1H 2KZWA 2R4RL 2AJXH 2FJHA 4B50A 2G9HA 4KRNA 4R4NC 1PD6A 4XTRC 3P77B 4YQXH 1H8SA 4J1UB 4L3CA 5T3ZD 3OQ3B 4YDIL 4HHAA 3ZDXE 2VLME 1AH1A 1WFOA 1A6ZA 4M8QA 2FBJL 3BOVA 3SDYL 2P47B 4P9HH 2I60H 5CGYC 1RVFL 5J1AB 4HF5L 4ODWA 1W0VA 4WEBL 3MRNB 1BZ7A 4JG1L 3MA9H 1K4DA 3HN3A 3LHPL 5J12C 4GQPH 3T3MF 5GGUA 5IGXH 2DIJA 3QQ9C 4BSWB 1E28A 1U93B 4P4KB 3S97C 1ETZA 2H2PD 4MA8H 3WSQL 4WUKH 2SEBB 3T3ME 2IANE 1G6RH 4PJXE 4NOBA 4HG4K 4Y4HC 5CP3H 4IOFD 4U2ZA 1MHPL 2ESVB 4MA3B 5KANI 1KJ2L 1YEIH 2ZG3A 3T8XA 2CO7B 3RTQA 2OLDA 3DX9A 3JUYA 1BEYL 3PP3H 4MD0B 3MROB 3O4LE 1HQ4B 3V8OA 1RD6A 4LDEB 4JRXB 4RMVA 4W81A 5IFAL 5BVPL 1SYVB 3TV3L 3CVIH 3V5KB 5JDJA 3ZDYF 5LAXB 3QUYC 5HJ3B 3EHBC 4ODHL 4UT6H 4OZ4A 4PGJA 2HT2C 1BFVH 3SDDA 3UO1H 1B90A 1EO7A 3ZDYE 2EYRA 4K7FB 5FKAA 3LKOA 1RSFA 3HR5A 4KUZL 5AG8A 5E2VL 4AEHL 3QSKB 3D0LA 2BFVL 4GS7C 5ALCH 4LL9A 5JPMB 1N8ZA 4F9PC 2I5YH 1HCVA 2YWYA 5D2LE 4LPVA 4GRLA 3RX5A 5C0AE 2VXUL 1EMTH 2V5TA 4QXTA 3K8LA 4Q9QH 3S96B 3WUWB 2VB5A 4KK5C 4K3EL 3O6FD 3WJJA 5EOTA 4YLQT 4YHIB 4KXZI 4HGWB 2J8UF 3LN4B 3QIBB 2AV7B 5TDPA 5FEBA 5DHYB 2VMFA 3QAZB 1OGTB 1QFWL 3TC9A 2J8UE 5B22A 2Z31A 3NZ8B 2ZCLH 4KGJA 2OK0H 3EDJA 4TUOA 3SBWC 4PV9B 4PJEA 5EC1A 3UC0H 4LEXH 3RVTC 4BM7A 1JGVL 2HLAB 1A8JH 1U6AH 5KTEL 2BSRA 3LRHA 2X89A 5HGDA 1EAJA 2JF1A 3NN8B 3OF6D 3QQ4B 3U1SL 1T7WA 5FGBA 1YZZA 3MJ7B 2CIIB 2DLGA 2EC9T 3NMEA 4AG4H 3W5MA 1CE6B 3SKNA 1TNNA 4MAYC 3GKWL 1D5MB 3OMZA 2IAMB 1KCVH 3QCUH 5EUKA 1LK3L 5IHZA 2X40A 4F57L 3HMWL 4WY7H 1AY1H 4I0PC 2Z93A 4NUGL 4M03A 4I9WD 3ZSSA 1BWMA 4OTXH 4ZUWB 2A6IA 5CZXD 4PJBB 5F93C 4EJ1C 3FB5B 1RUKH 5FM5O 4KTDL 2ZP0T 2EIZB 5CSZA 5F9JA 4CL7A 4TSBL 4OZIE 1WIUA 2P5ED 2APXA 1S7XB 2DWEA 4XCYB 5C70A 3UYRL 5AWNL 2ZJSH 4M5ZH 1D5IL 5E2UH 2H2SC 5DTFB 2JIXB 4MDIB 5T3ZH 1CDUA 1I8LC 3P3YA 1LEGB 3DXAB 4X4ME 3O4OC 1E6JH 1ZTXH 5IW1B 4JFDA 4FZEL 5E1AB 4ZTOH 5FYJH 4OKDA 1GOFA 3BIKA 1NLDH 4MX7B 3DUSA 1QVOB 3GMQA 2ZCKL 2FO4B 4HXAH 4HIIA 2GQHA 2ICCA 4XT1C 1K8IA 1MCHA 3AREA 3LPWA 3QQ3B 2YD5A 1YQVH 3NA4A 4FQJL 3LH2L 2P5WE 3H3PL 4ZDHB 4OUUA 2R69L 2XRAH 5F7MC 3EO9H 1U8IB 3QBTB 2CSPA 1FBIL 4P9HC 2JJTC 5T1LA 3PGDA 1O0VA 5I1HH 4YHKL 2R0WH 2BXYA 1QNZH 4WJ5A 3E6FB 4KJYB 3IB4A 1ZA3B 5F7KC 3MQIA 5B4MD 5D96C 3IKCA 1N26A 4G5ZH 2KQNA 3UTZA 5TGBA 3EOBA 5LCVH 5E8PB 2EDQA 4PJ9A 1DDHB 4JR9H 4NRXA 4H0HB 3DX8A 3WLBB 3KXFE 3QFDB 3WFHB 3CDGA 2PUQT 4LCIH 4XPAH 5EWIL 1Q0XL 1T1ZB 5C0DA 5INCB 1A5FL 1A6AA 1DANU 2AJ3B 1I75A 4W6XB 3L95B 1FZJA 4G80B 1WQVT 2ARJA 4UB0L 5C0IB 1T83A 4UIKH 4YAQA 3QEQA 1HHIA 2NTFB 1UKTA 4YC2C 1JNHA 3PV7A 3D9AH 2CRMA 5GISH 3CZFB 4LCWA 4G9FA 2AEQL 2VLRE 4ZNCD 1BFTA 3QDGB 4JRYB 5HVHC 1WJ3A 2H9GB 4OF7A 4YDJB 1I1AC 2JJWA 5MEQA 3HUJA 1Z3GL 3BWAA 2X2YA 3MRPA 4EKXA 3OKEB 1I8KA 2Y7QA 1KLFA 5ADPL 4HUNB 2GTWB 4PGEB 3FOLA 1I9JL 1CL7H 4P46B 4RQQA 1FAKT 5E8OB 1MI5B 1JZ7A 1ZLVK 1MHHA 2FYYB 1AE6L 5EFIA 3TO2B 2Y6SC 2FSEA 5DS8B 1CIDA 2MHAA 2F8XC 3N1FC 1YEFH 4UDTB 1K5NA 3OHXB 3MOQA 4M1CC 5HHPB 5INDA 5IW6A 5I8OH 3ROOB 5I71B 4WU7B 4OCWH 5FUZL 1RUPH 3KPPB 5FYKU 3ARBC 3BAEH 3GSWA 3NIFF 2W91A 4Y1AA 3D39D 5DD6B 1HSBA 2X4QB 3BESR 5I75B 5F96L 1GGBH 2ESVE 4WUUB 4OI7A 3NIFE 3QQNA 5DD0H 1T0NA 3PWNA 5ABDE 2K1MA 5KSAC 3B9KC 5AG9A 2AK1H 4EN3D 2V7HB 1V3LA 1G9NH 1Q94A 4F7CA 2Z91A 3IU3B 3FN0L 3CPLA 4JAMB 2O5XL 1W72L 4MVBC 1YEHH 4PRIB 5CBEB 4MD5A 1ITBB 3MLRH 3RWIA 4JRXE 3V0VA 4MNHB 1BAFH 5DLMH 4NHCH 4UT9L 4X8XA 3P4OB 1BOGB 1E4XL 4NJ9L 1DVFD 1NH6A 1PBYA 1C1EH 5GIRB 1FNLA 2WIIA 3HE7A 2P43B 1WGOA 1WFNA 3TFKD 3DUUB 2F5AL 2VQ1B 5DA0B 1BX2A 2HLFC 5K9OA 3SPVB 3RDTC 5FYLE 5EZLA 2OMBA 4JQXA 2DOCA 3T1FB 1HN1A 2X7LB 4N9GB 2ITCB 4N0UA 3WNPA 3KPNA 3KJ6H 1CXHA 1J10A 4WHDA 2VDQH 2QKIA 1QA9B 4JKKA 1NGZA 4RFOH 2C4FT 3CXHK 1FORL 5E5MB 4J6RL 5JW3H 3BYTA 1ZT4B 3HTLX 1QFPA 4JQVC 1JZ6A 1A4KB 4JPVH 1R6VA 2BVPA 4OZGB 2V2XA 1INQA 3GI8H 1NUFA 2B4CL 4M5YH 3UTQB 2QQNH 5F1IA 1KJ3H 1HHKB 3KAAA 4M02A 1JGDA 4HH9B 4U49A 3VGGA 1KN4H 4O9HL 1MJ7L 1EEZA 1VEPA 5FUCC 1BECA 3MLWL 2VC2H 4GOSA 2W9EH 3BZ4A 4QHMA 3QUXC 1FZKA 1UZ6F 3SN6N 2H2PC 3GMPA 2EZ0D 3WO4C 1T04B 2V5MA 3HZKA 4IOFC 3DO7B 4QRRB 1BQHB 1W0YT 4JY6B 5HDQH 5KS9E 4JFPB 4JM4L 4XNXL 5D7JD 1U8OB 5DMJB 1OM3L 4PBXA 3KPOA 5J7CC 4LLAA 1JMXA 2R56L 3F6IA 5AYQA 4MQTB 1UVQA 4L8SA 3B3IB 3FFCB 5DR5L 4PJBF 3MYJA 5SWQA 1F11A 1N2RB 3HS0A 3VXMD 1XAUA 4PJBE 1RIUH 3PGCB 4HLZG 5ITBL 5J9PA 1JWUB 2R1WB 4OUOA 4HMEA 3AROA 5KVEL 2W59A 2IC2A 5BXFA 2DIAA 4V2CB 3ES6A 5ECJE 1NGWB 3PIQA 1YECL 3PDDA 1U8JB 4M93C 1LO4H 3MV9D 3VFWA 1ITCA 1UQSB 2BOBA 3QCVH 5C07B 3ZYIA 1AGBB 3BMVA 4GLRH 4OCYL 3O6FC 1IAII 2BJMH 3BQUD 1I8IB 1P4IH 3KPTA 4G6FB 5DZNA 1NDGA 4UTBH 4BUHA 1F02I 1ND0A 2YKLL 5F89A 2MOVA 5H94B 5DFVC 1OVZA 1NMAL 4LSQL 3NA9L 1BJ1H 3VD5A 2PR4L 3FQUA 4IIQB 5MP6L 5I17A 1S9WA 5IQ7H 3HFML 3RKDD 3HAEA 3SKOB 4BK4A 2AEPL 2X4NB 4X5WB 4U1KB 5IB5B 3OAZH 5L2KA 4OCLC 3LKNB 4GMSL 5DUBA 1NGQH 4Q6YA 3WKML 4HIJB 1JI1A 3HC0A 3VRJB 2Y36L 1JZ2A 4R8WH 4M9PA 5KSBB 4NZUL 2RFXA 2VDPH 1IBGH 3T0DA 4K94H 4AH2B 4YDVA 1OF2A 5CILL 4Y88A 4APQA 4YFDB 5DHVB 1KENL 4FQHB 4G7YH 1QFUH 1ZGLA 3BEVB 2P24B 4M7LL 4AJ0A 5CZXC 1G9NC 1EHXA 3OB0H 1YMHA 1XGQB 2OSLB 4QRUA 3FO2A 1RZ8B 5A2IH 5LXGL 3B9EA 4YHLL 4M7JL 4NN6C 2NYYD 1FN4A 3QPQD 4MD4B 3RWEB 1OAQL 4E9LA 3QDGE 4JRYE 1XF1A 1FL5B 3HG1D 1QSFD 1YN7B 3OKKB 3R06A 2V9RA 4JFZL 4R9HA 4XP6L 2H3NA 1NCUA 3MZTA 5C0GB 3B9VA 3EFFA 3QI9B 3AU1A 2L7JA 4IM8A 2QSQA 4JG0H 2Q86A 3RU8L 1MRCH 5C08A 2FJHB 3QT2A 3THML 2CKBA 4L3CB 1QO3B 3VD3A 1A6ZB 4NNYA 5IT2H 4E5XA 2A9NH 4FP8L 3QHZL 5ADOL 2ED9A 2DRUA 3G6AA 3K46A 1MI5E 1T7YA 3PL6A 4Y4KB 3TA3A 1PEWA 2VIRB 3DOSA 3NVQA 3OX8B 3MTRA 5MHSE 2CDGB 3ZKXB 3D69B 1Q9OB 4MJ6B 5GGUB 3IF1A 1EK3A 5IROC 4V1DA 3BT2H 3PHSA 3CFJA 1ETZB 5HHOE 3LQZA 1JNJA 2VLJD 3SO3B 3IDJA 1ZXQA 2WV3A 5EIQA 2FD6H 4RMQA 2Z4QA 2XWTA 4XP9H 4H1LH 4WUUE 4FTVB 1ONQA 1B4JH 1HINH 4IS6B 2VH5H 3ARWA 2Q87A 3H0TA 1CT8A 4EUPB 2JJSA 3DX9B 4POZD 1GPOH 4I2XB 5FYLL 3MCG1 4F58H 3R8QA 4DAGH 4PRIE 5I74C 4XNQB 5F7NC 1FL6A 4GAYA 2Y06L 3L3HA 1UKQA 1M71B 1LP9B 3E6HB 4OZ4B 5D6CA 3HRZB 4EI5D 3PNWA 5A2FA 4YFLI 3LKOB 4XVSH 4IRZH 5ACZB 2XNAB 4YGAB 1GZPA 1RULH 3IDYC 3NFNB 3EDKA 4RAHA 4OFDA 5EZOH 3SE3C 5BQ7B 1U58B 2E7HA 3IXAA 1L0XA 3LMJH 2DDQL 5JQ6H 5EOTB 4CDHA 4LIQL 1SEQL 4OZGF 5SX5H 1L6ZA 1KIRB 1XEDA 1CLZL 2IMNA 4EZMA 1G7QB 1WBXA 4OZGE 3VFPA 1SJEB 2Z31B 3HC3L 2FHBA 5JUEL 1MHEA 1IKNA 3LDBC 3MLPA 4GXUM 4Y2DA 2P42B 3RPKA 4PJEB 3R1GH 5EO0A 2R1YA 3RBSA 2OL3H 1YEEL 1IFHH 1N59B 3KPMA 5C0BD 1FSKB 1FVCA 4PS4L 5GRUH 4D9QD 3KPSB 3M8OH 3L3OA 2OR9H 1MIEL 3INUL 1T2QL 1KF9B 3DI2B 4LSPL 3DYOA 2CUHA 4U6YA 3QXTA 3S35X 1F6AA 4P5TD 5SX4H 2NY2B 4ZFGH 1MAKA 3SKNB 2FB4H 4PYHA 5HYSA 4CJ0A 3MJ9L 4PJCA 5EU6A 1H3TA 1RHHA 1KTDB 5IHZB 4UNUA 5FCUH 3JV6B 4LDOB 4HUWA 4K94C 1L6XA 3FFCE 3DURA 3NH7H 3PXJA 3H8NA 5F6IB 2A6IB 1DVFC 2V2WB 1MLBA 4HC1A 4U0RC 4G8IB 3TFKC 1EGJH 2DI7A 2IH1B 4MHHG 1KB9J 4HFUH 4PGDA 3ARGA 2FJGB 2E9BA 1FHGA 1FG9C 3MRLA 3BD5A 4ODBD 3Q3GA 4MMXC 3C6LA 3RWJB 2DYPD 1R5VB 5D7LB 1J8HD 3ARDD 5C07E 3CXDL 3QJFB 3QHFH 4XPTL 3GMQB 4ZAKA 4HPOH 5E99L 4NC0B 4Z7WA 3AREB 1MPAH 2G75B 1ZANH 4WCYH 1UWXH 1S7RA 4XNMA 2ERJB 3X11B 2I07A 4OUUB 1ZHBB 3T3PF 4JJHA 1QRND 1EO8L 1FC2D 1PYWB 3SE4A 3TN0D 3T3PE 1NSNH 5FHAL 3VMOA 4U3HA 2EZ0C 3ZHKA 1U92A 5HGBB 1FFOA 2EYSA 3VA6A 3T0EA 3ULUD 2XKSA 4HEPG 1CDJA 3IKCB 4X4XB 3VXRA 5LGJA 1BQSA 3UTZB 3WXWH 2EDXA 5KSBF 5ISZD 4UIMB 3LV3B 4JFEB 4ONHB 4WIQA 5D7JC 4ZFZA 4PJ9B 3ETBF 5KSBE 4WI8A 4MXQD 2M2DA 5C0CE 3VWJD 3QIWD 1I85A 3OGOE 1JPGB 3D18A 2Q6WA 3WIFA 3L3IA 1FIEA 3JTSB 5C0DB 3NPSB 2C5DC 3MRMB 4JY4A 4HS3B 3BPLB 3BE1H 1RJYA 4OV6F 1KB5H 1QR4A 4DEPC 5F9AC 5C3LD 1FAIH 1FCGA 5D7KE 3L7FA 3QEQB 4I1NB 5LGHH 4JZNB 3CFEB 3ARSA 1ADQL 3EFDL 1DUZA 1XGYH 2DI9A 1XF2A 4W70A 4HWEL 4BZ1H 1MY7A 5ID0A 25C8H 1RQ5A 4FMKA 4WO4D 5KJRL 3O9WA 4JO2H 3LQAH 4K55A 3VFNA 2EKSA 1V3MA 1KUMA 3RNQB 1PY9A 3HUJB 3X14A 5C0EB 1ZHNA 5LVEA 1N6QL 5IEKA 4P2OD 3KPRA 2F74B 4IRSA 1MY5A 2FDBP 3BQUC 4JDTH 1L7TH 2M8XA 2YD6A 1KPVB 3EOTH 1UM4L 2Y07H 4R97B 4AM0A 5DK0A 3EZ8A 2BC4B 2X4RB 4JDZB 2XWJA 3U0WL 3RZCA 3ME0A 2EDFA 2FSEB 4NQVB 4OM1H 2IFFL 5JXAH 3TIDB 4P23A 2MHAB 1KYOJ 5F7YC 3OKOB 1AXSA 1RZIA 2AK4E 3RKDC 3REWB 1RUMH 2Y1VA 1S5IL 3ALWA 3D85A 4I5BA 5E94A 3P40A 3RP1A 3WIHL 3V6BR 4E0RA 3QDAA 4P2QB 3GSWB 4ZSOA 3CVHA 5DEGA 3GNMH 2OX5A 1NBZA 4JO1L 1UA6H 4P3DA 4E41A 4ZYKA 5EBWA 3FT3A 2O5ZL 2C3XA 2DQEH 4Y19B 4FTVE 3U0TA 3FO1A 1NGXA 5IMKB 1Q94B 3A67H 4LLDB 4F7CB 2DS4A 2Z91B 2QLVB 4XPGH 4N0RA 2G60H 4LSUL 4I2XE 1UZ8B 4MD5B 3JV4B 3HCVA 1LP9F 3V0VB 1J1OH 5BS0A 5EU5A 4CJ1A 3RWCA 1GC1L 5CIPH 1LP9E 1ZLWK 2V9TA 3S5LB 1J1XH 2HN7B 3C8KA 4UMGA 3GKZA 5FECA 3JWOH 2NYYC 3QPQC 3W9DA 4TRPL 1NC2B 2XZCL 3LD8B 1J9CT 3K81A 1KBGH 1KIQA 2YEZB 4HUXB 3IFNL 5JIHA 3SGKC 4NC1C 5K9OB 5IVZA 4PJ8D 4OB5L 1H5BA 3G5VA 5D70L 4FQIL 3W2DL 1CICA 3LZFH 3KPNB 2ADGB 5DUPH 5I73C 2BVQB 4ZO8A 3CMOH 2GITB 4AEIL 4QRPB 3GHEL 1A6TB 4NDMA 5FXCH 2B1HL 5IMLA 3FHQA 4JKWA 3TIEB 2VXSL 4UAOC 4ZPTB 5BMFL 4HBCH 2AI0L 2BVPB 4ZOBA 1A1MA 1SJHA 1EX0A 5DQDH 4KRLB 5A40E 1DJSA 4PJEF 1EEZB 2R23A 4LASH 4CU8A 1IZKA 3NIDF 3ULUH 1YUHB 4ODXA 1XIWC 3CU1A 4LARL 5D1ZC 1DE4A 4QHMB 1DN2A 3NIDE 2FZ3A 1FZKB 5C09D 1EFXD 1G6VK 4DGYH 4RGOL 5MI0B 3KPSE 3K3QA 1MFEL 2PYFA 3BZDA 4L8DA 5EBLA 2XZZA 4FQQB 2ZUQB 1SEBB 1T7VA 1JL8A 3MOAH 3BDYL 4NNPH 1DLFH 3DV4B 3QG7H 4POZC 2C3GA 1J0YA 3HMXA 1Z2KA 1T1YA 5F71A 5K9QG 3UEZA 3V0AC 3T2NH 1GOHA 1EUUA 3UTPD 1FJ1B 4NWTH 3PJSB 1F11B 5GSVB 5EG6C 3TBYB 3ARFB 4TQEH 4ODVL 3TPUA 1HH6A 1QSVA 4KKBC 4RNRA 2QQKH 4NSKA 2Z8SA 3SDCD 2QSTA 2D4DA 3QEUA 4XBPB 5A1AA 3GRWA 4WVRA 3VD9A 1RJZA 5I8EA 5BXFB 1OSPL 3ES6B 4QWWD 1NCDH 4HKZB 3BPCA 3QIUD 4CVXA 2NR6D 2UWEA 3PIQB 1P4BL 1RU9H 4E42A 5KSVA 1G9MH 2CDEA 3LQAC 4KH2A 2BNQD 1V5JA 4RZCB 3GJEB 3VWKB 5D7LE 1PVHA 3IDIB 1NC4A 5CJXC 1CVRA 1F4YL 2CO6B 2F5BL 3STBA 1NDGB 2Q8AL 4HEME 1ND0B 4QHNA 3CX2A 1FP5A 4P3CL 2K9UA 4KGLA 4LLQA 2DL2A 3LKSA 5AZ2H 3TVMD 3VFUB 3FQUB 4IRJB 4WGWB 5DD3L 4NCC1 1RIHL 1IM9B 3DVGB 4PJ5D 4XAWL 3MBEB 5E0QA 1FYTA 3HAEB 1M05A 2NW3A 5CEXB 2OYPA 3IFPB 5IWLA 3K2MC 5FGSA 3UTTB 4KDVA 4DOHE 1CU4L 1CLYL 4P5TC 5KVMC 2JB6B 1RIVH 4JFEE 3VXTB 5L2JB 3HE6D 4OLZH 2Q7YA 3HPJA 1KCRH 5D71H 1QSEA 4YDVB 1DEEB 1OF2B 2ENYA 4JM2A 4CN4A 4LLWB 2P8MB 1A7NL 3U30C 1AXTH 3T0VA 3M1BA 4OLYL 2WLYA 4OLXH 1JRHH 2FX7L 5CEZE 1ZLSL 3GIZL 1OCWL 3FO2B 1R3KB 3B2UD 5DJ8A 3QEQE 1HHGB 4TNWK 3T4AA 5EOCL 3HLAA 4OF0A 5JOFB 1NCWL 4X6CE 1IAKB 3H9SA 1B0GA 4LU5L 5I0DA 3C09B 4F7TB 5EZJA 1S5HA 1D9KD 2H3NB 2VQTA 1JGLH 3JWOC 3HUJF 3EFFB 2WUBH 4KDTC 1KTLA 1A0QL 4XP1H 3ARDC 3WN5A 3MMEB 4W6YB 4C58B 3FOMA 4ERSL 2CKBB 1PX3A 2DQUH 4P59H 3MLVH 5I1AA 4Y5YC 2OR7A 1HHJB 4E5XB 3I02A 4JO3H 3UBXA 4XMKL 5EU4A 3K74B 2AW2A 2DD8L 4BFGA 3QXAB 3TA3B 3IDGA 5DJXB 4LBEA 4OLWH 2OZ4A 4YO0A 4PD4J 2AJYH 3GMRA 3GJFA 2DAVA 1T2XA 3A6BH 3IF1B 3K4AA 2F19L 3ULUC 1QOKA 4FQ2H 4IOIA 4HLZH 2QHLA 5F1OB 4P2QE 2Q8BH 1IAOA 5E2WL 5FIEA 3EYUL 4KRMB 5DI8A 3SDXA 4GW5A 5ICXA 3BP7A 1RFDH 1ZK9A 3VWJC 1YNTA 4ONOA 4Y19E 1G7IB 4OQTA 4K8RL 3PXHA 4P5MB 3VXUA 2WBJA 1K85A 2QBWA 3OJ2C 2VXQH 1IKFH 3MV01 3RUGB 1FL6B 3L3HB 1LEKA 2VAJA 3CFKA 5KZCB 4NT6A 3UROR 3OXRA 5EU7C 4EEEA 1CGWA 5C3TA 1C16B 3KHQA 2GCYB 4FQXD 2NZ9C 5GS3A 3NTCH 3PNWB 5GRVK 2VDNL 3GBLA 1P2CB 5FF6A 4GG8A 1QFWI 3QEHB 1R24A 2D7PA 3KYNA 2DL9A 3K1DA 4NPYB 4X5LA 1S7VA 5D1QD 4BH8A 1YY9D 3W0WA 1LVEA 1U36A 2W9DL 3MNWA 2AQ2A 1XZ0A 4JB9H 3H2WA 4F2MA 1INDL 1IILE 3KGRA 3EBAA 2CR6A 4I18C 3BPOB 1JPST 2ILLA 3MV8B 4M7KL 3BP5A 3L5XH 2EIDA 4QRPE 4Q0XL 1ZWIA 1G9MC 2R4SL 2CIKA 4JPWH 2J4WL 4HWBA 2OMNA 3C6SA 4GKNA 4HUVA 1WBXB 2AQ1A 4JZJC 5SWSD 1ZHKA 3EIFA 1A6UH 4PJAA 1FZOA 4QTIH 1AO7A 3UTOA 5E6IB 3VXSD 5FDWA 4LF3A 2DMKA 2A6KA 2WSKA 5LG1A 1AIFB 2AJUH 3MCLL 1FFPB 2YOCA 2XACC 1LE5A 4LPYA 3AUVA 1Y6KR 1S8DB 2IALA 1DN0A 5HPOA 2CKNA 4BQCA 1OAUH 1FO0H 4Y5VA 1OY3B 4MXVE 4AT6A 5JIKA 3C5ZD 1AJ7L 5TQ2L 4GBXC 5GGQL 1OAKH 3S35H 4MXWL 1FDLH 4NHUB 1S7SA 5GRZA 5FK9B 2A6JB 3JV5A 4YEEA 4POUB 4LAQH 2J1KA 4JFFB 5HYSB 1BHGA 1D6EA 5HGGS 4GAGH 5GGVL 4ZUUB 1UH3A 2EDLA 5T33H 5JOPE 5DQJB 5MEND 2VKWA 5FOBB 3MUGA 1HHHA 1BPVA 3LB6D 1BQUA 1RK0B 3P9LA 4GQ9L 2VE6A 3TZVA 4Z7VA 2A77H 4Z78A 1Q9KA 4UOJA 1M6OA 3MLYH 4U6VH 3U79A 3CNKA 4DGVL 4WWKA 3C8HA 3VXOA 2FGWL 1NLBL 4JFOA 3ZSTA 1MH5A 5I19H 2ICWI 1MVFA 4RMWA 5E7FA 4KQ3H 1ZT1B 3QCTL 2NY5L 3DV6A 4PJ8C 1PZ5B 1T4KA 1JCKA 4U6TA 1TPXC 1CFNA 2A74A 4R7NB 5IFHL 5CINH 2D0HA 3F7VA 4C59B 3DMMA 5CJBA 2Y9RT 1KB9K 2EYTA 3SQOH 4AIZA 3D2UB 4YDIH 3UTSD 5J8OA 3DRQB 4HS6B 3U36A 1E27B 4WFHD 2YUVA 4LGPB 1J05A 2GAZB 1RVFH 3T77B 3CH8A 4GKZA 4WEBH 4YK4C 4JG1H 1UJ3C 3MPCA 3S7GA 3LHPH 2DQFB 3DGCR 2ENSA 4YJZL 4WW2C 4PTTB 3B9AA 1WT5C 1AD0A 2F53A 3QNZB 4YDLC 2BX5A 3MNVA 1JF6A 2ZCHL 3G04A 2EYSB 3B4NA 3BWUC 2NXZB 4GW4B 4BQ9A 1VB9A 4NZTL 1MHPH 5HYJE 1T0MB 5D6DC 3UTTE 5CEZL 1KJ2H 2R29H 1PY4A 4Y4HA 3PWPD 4XBEH 5T1MB 3B5HA 1TZHB 3CC5A 5HYQA 3B8YA 3W81A 3BX7C 4ODSL 4X4YB 2JB5L 3V6FA 1DBMH 5IFAH 4I8DA 1T2JA 5JQHC 4JY4B 3SJVE 4QY8B 3TV3H 1MCKA 3IJYA 3RL1A 4AK1A 5IVNA 2QADB 5CEYB 3GSXB 2MCG1 4RMTA 3GMMA 2HA1A 4RFNB 3QUYA 5L0QB 5CCKH 3SDCC 2R2HA 1WWCA 4MB5A 3TBTB 1DTUA 4AEHH 3QULA 4IDJL 5ID0B 2VDML 1U3JA 3O9WB 4QRQB 4NP4H 1CGXA 3QIUC 1MWAB 1MJ8L 2CLZA 3QRGL 2W0KA 4Y16B 2VXUH 2BY2A 2AJZA 5E4EB 4F9PA 1E6OL 1RZ7L 3HI6H 3L7EA 4HZLB 4HFWA 2DF3A 3PGFL 5IEKB 3P9MA 4XZUB 4K3EH 3MXWH 4GKSA 4IRSB 3RWDB 2BSED 1VPOH 3OR6A 3MV7B 3MLTB 1HE7A 2P44B 3V6ZA 2C4XA 2IAND 3TVMC 2IQ9H 4P23B 4A2LA 4X6DB 1JGVH 4Y8AA 3SBWA 1H15B 1RZIB 5C0JB 5KTEH 1EAPA 4OF6A 3ABZA 4OZHB 2R0ZH 2YRLA 3EYFA 5E94B 1NAKH 1IQDA 1XH3B 4CMHC 1DSFL 3W39B 1BF8A 4ZSOB 3CVHB 5DEGB 4HK0A 1T89A 2GSGB 4MZ2A 1LMKA 1UC6A 4XPBL 4E41B 3X3GH 4OV5A 5EBWB 3ZTJG 1D5ZA 1J1PL 3GKWH 4LVNC 4JANB 3PWVA 5B3NA 2E6QA 1P6AB 1P7KA 4POYA 4MLIA 3QO0A 4MAYA 5J6HA 3O6ML 3ARUA 1BWWA 4QXUL 2DBJA 2KPNA 3V79C 4HAGA 1U8NA 1HDMA 4D0DA 1V3JA 1JI2A 1YEJH 3RUGE 2YS4A 1AFVL 5I1GH 2QQQA 3RWGB 1SVCP 5D1XB 4KTDH 1WAAF 1AD9A 2DTML 3U4AA 4LSSL 4EN3B 4EBQL 4P5KB 3MRIA 5FECB 2IGFL 3WHE0 3DJ9A 1WAAE 1T6WA 4F37F 1J5OL 3UYRH 5AWNH 1QR1B 1KEGL 2RCSH 1D9KC 1JF1B 2YD2A 5IB4B 1EXUB 1QLRA 2XFXA 2YZ1A 1ZGLM 5DJYB 2UZIL 4KDWA 2CD0A 5KSUB 1CICB 4FZEH 1WEJL 1I8LA 2IEPA 4N8VA 2VZOA 4YX2H 5D5MB 1DQLL 2ADJA 3SOBL 4NQDD 2HFGH 3MV8E 3ROLB 8FABA 3P4MB 1ZLVH 2ZCKH 5KAQG 2ZKHL 1U3HD 4DZBB 1BJ1J 1SQ2N 1BLNB 4L8CA 1KJMB 2XYCA 2NY4B 4FQJH 3LH2H 3H3PH 4H0IA 1V3KA 5I16A 2B20A 1ULVA 1FBIH 4UDUB 4S1QH 3U48A 5ESAB 5C92A 3L3JA 1PEZA 4LSDA 1TLKA 2JJTA 1MSPA 2R2CA 5F9DC 3TWCL 3BGMA 1MHCA 3EJJX 4W6WB 5EUOA 3D6GA 4X6BA 1NL0L 2GSIB 4CDGC 4H25B 5F9OL 1KPUB 4G8FB 3EJYD 5HPMB 3VG0L 3LIZL 1BBDH 2X4TB 3GSUB 4XX1E 2X6MA 3S88L 1G6RA 1WC7B 5CFHA 1S9XB 4KK6D 5CP3A 4JDVB 4JFFE 1VESA 2RHEA 1C5DB 4LQFH 4M4PA 4AMKL 5ITFA 3OPZL 1T22B 3EYVB 1WZMA 1VFBB 1DUYA 2EDEA 3SCMD 3TPUB 1GGIL 1HH6B 2X4SA 4FQXC 5FV1L 3WS6C 1CDGA 3VGAC 2D3VA 2AEQH 3VH8G 5ACLA 4JN2B 5F88A 1NCTA 1BVLA 2WUCL 2Q76B 4I9WE 5GXBB 2G2RB 2HFTA 5D1QC 3X13A 4DFIA 1YY9C 3IVKA 1I1AA 4ZPVA 1LO0H 2DJSA 3L1OH 4RGNC 4E42B 1Q9WB 4PGCB 1FGNL 1XR9B 4OD1L 4QRTA 2YWZA 2PTTB 5TDNA 4OJFL 1SBBA 1K4CA 5FO8A 5F9WB 1I9JH 1WVZA 4PJDA 3IJHA 3MLSL 2WBWB 5H35B 4MJIA 1N0XH 1AE6H 4NQUA 2QR0A 5C86A 4PV8A 5C2BL 3NFSH 3MRQB 2UVEA 1EERB 1UGNA 3B83A 4MNQA 1B6DA 1IAMA 4LNVA 4MCZB 2CUIA 3I6GA 3KXFD 4KZDL 3EYOB 3CDYA 3TBWB 3CIQA 5F96H 3MODL 1IGFH 3ARBA 3C5ZC 4M1DH 3O3EA 3P73A 3HNSH 2Q7YB 3S4SB 5GRJL 5E7BA 2I9LB 3MRRB 4NGHH 5KSAA 3B9KA 2O5XH 4JM2B 4R2GB 3TP4A 2VLRD 4G8GB 4JKLA 2LVCA 4M4RA 4UT9H 1E4XH 4MDJA 2X10A 3PP3K 2WWMD 1TVDA 2ZSWA 2X1QA 4J12A 4NM4L 1CG9B 1UWEL 1VADA 1DQML 4OLVL 1IC4L 1AGFB 2CKBL 2R0KH 2YD7A 4TPRL 4ZTPL 3RGVD 5C1MB 4OIIL 4X6EA 4HUMB 3V8CA 4X98A 3MLUH 4RMSA 1H9VA 5FHBH 3H9SB 3MRJB 5IV2A 2RQ8A 3QYCA 3RDTA 3U4EB 3BZEA 2A0LD 4YXLL 3BPNC 1KTLB 1LD9A 4XMPL 2ADIA 3V7MA 4FQ1L 4FABH 4IMLA 2QSVA 4J6RH 3C2AL 2DQDL 3HG1B 2QHRL 4TNVF 5HHNB 3TCLB 3SGJC 4JQVA 1TJIL 3UBXB 4XPHH 3MV7E 5F3BB 1HYSD 4P4KD 1MJ7H 4X6DF 5CGTA 4GG6B 1F8TL 3HI5L 1N5AB 2IH3A 4OZHF 4X6DE 2O5YL 4N0FA 3GMRB 1S7TB 3GJFB 2EDKA 4TOYH 1OLLA 1EDQA 4Z8FL 4LHQB 4OZHE 5GS0H 1CK0L 2XV6B 3QUXA 4X4ZA 3P0YH 5J13C 3CAFA 2YSSA 3VFGL 4XNXH 2D9CA 4XHQA 1FG2B 1OM3H 5DI8B 4JRXD 2V9QA 3D48R 4UZGA 4GW5B 2R56H 3BP7B 2AJSL 3C60B 2V17L 1WICA 4LAJH 5T1KD 4X9HA 1WIPA 1G1YA 3UXFA 1CXLA 1NMBL 3HC4H 4HJGB 3T0XA 2VLJB 4JQIL 5DR5H 4D3CL 3D39E 1S3KH 1F3DH 3OAYH 5FYLD 1I3UA 2GTZA 4PP1D 4JN1H 2DQTL 1KCSL 1MCSA 3V6OE 3OXRB 4OCXL 4NM8L 3TT1L 5GGVY 4U1LA 4HUUA 2ICES 4X7TB 5KVEH 5CSGA 3KYNB 4X7SH 1S7VB 1YECH 3QIBD 4KI1A 3OL2A 5GSRB 4EI5B 5HD8C 5JNYA 3E1F1 5D5MF 2A9ML 1YPZB 5SWZB 4BSVA 1MREL 5IBTH 1IC1A 4MMZC 4XH2A 5D5ME 3F12A 4KVCL 3ZHLA 3O6FA 1F4XL 4JPIB 1NCAL 3Q5TA 1VFAA 4HUVB 3E2HC 1RUQL 5DGRA 2CRZA 3WEXA 4KHTL 1ZHKB 4NCDA 2XZAH 4LSQH 3A6CH 2WP3O 1Q0YL 4O00A 5I15H 1AO7B 1TJHH 4XB8A 1KT2B 4JVWA 3HFMH 3REVA 2A6KB 2V7NA 5BV7H 3AGVA 4OZFB 3QA3A 3S36L 1FNAA 2D31B 4TUKH 4GMSH 1I9IL 3I75A 2FLBT 2IAMD 2ITDB 1JZ3A 4FFYH 3WKMH 3KYAA 4Q9BA 4I77H 1UACH 3MRDA 2RAMA 1P7QD 5DC4B 3KYKH 2VZTA 1CF8L 4HC1L 1HIMH 1XGPA 5JPNA 4S1SL 4JCLA 4C4KO 5C8JB 1D6EB 1HEZB 3MUGB 4M7LH 4ONFL 3P9LB 1RI8A 5I76A 3E3QE 1A7OL 3KHOA 1A1OA 3MUZ1 3VFMB 5LXGH 3MGTA 5HHQA 4WWKB 2JIXD 1BM3L 2VLLB 5AEAA 3DXAD 4F15C 1AQDB 1EEQA 1KLUA 2P5EA 4YE4H 1QKZL 4UOW1 4XP6H 1T4KB 1J0ZA 1Q38A 3I50H 1AKJA 4BK5A 4XNYH 1KG0A 4JY5L 3UJTL 1T66C 1IM3B 3RU8H 4QGYA 1YC8A 3ZYJA 4PLNC 3DMMB 1IGML 3AB0C 4OGYL 4LLYA 3IKKA 2EYTB 5E6YA 3VFSB 3NFPB 1HI6B 1U3HC 1CXEA 4FP8H 3QHZH 4EQ3A 5E1HB 3RL2A 4CKVX 1J05B 5BOZG 1D6VH 2ZOLA 4RAVB 3SO5A 4KMTL 1IL1A 2HJKA 4MJ5A 4YHYC 3FO0H 2B4CC 2YPLD 1RZJL 1AD0B 4GXUN 1SMOA 2HH0H 3QUZD 3MNVB 3RPIA 2OQJB 4CVWA 4PJHA 3VXPB 3EDFA 1T3FB 3QWQB 4LRIC 2J5LB 3EJYC 1ORSA 3C9NA 2DQCL 3CLFL 4PJFA 5CP7A 4Y4HB 5GS0C 5L8LB 1V7MH 3TN0B 1B3JA 1Q1JH 2Y5EA 4LHUA 5J11B 5TQ0L 3FB7B 3OR7B 4R26L 3ZYZA 1R3JA 2ATKB 3CC5B 4KK6C 5HYQB 1R3LB 4NBXB 5FYLH 4JM2F 4IJ3B 4JFXA 1OAXL 5A3IC 1MWAL 2VXVH 2P8PA 5DZLA 5FCSH 3RL1B 2Y06H 4G8GE 4JRYD 5ELIA 3RAJH 3LQMA 2YPKB 1Y6NR 1FFNA 4PJGA 3SCMC 4P4RA 3QIWB 2J2ZA 1FL3B 2J8OA 5L8KB 1CFVH 3SGDH 2BMKB 5MEPA 3HZMA 1TJGL 2KBGA 3M45A 3V5HA 4U1NB 3BI9X 2ZUSA 4MJ2A 5E8EA 2DJUA 3U6RB 3M17A 3KYMA 4A6YB 2ZPKL 3V4UH 1WFTA 3L6FA 3QDMA 1FVEA 2BHUA 3H9SE 4XVTL 3BW9B 2NX5A 3PHQA 3FTGB 2AJZB 2AERT 2VYRE 1EVTC 3TBVA 1N5YH 1RZFL 1MI5D 5AD0B 3SE3A 3L7EB 3HNTL 3T0WA 3OJMB 4NQXA 3GGWB 1JPSH 5JW4M 4AQOA 1YDPB 4ZXBD 4GKSB 4X6FB 1FV1B 1WSST 3D87B 5IB2A 3AS3A 1CLZH 4MWFB 1I7RA 3HG1E 2H26A 4WTZG 3QUMH 4KV5F 1JTOA 1WBZB 3RVUD 3HC3H 4GG6F 3CVHL 4J7RA 4KV5E 5JUEH 4YBLB 1AGCA 4NQCB 1QBAA 4P2OB 4XRCB 4UTAH 4GG6E 1YQ2A 2FATH 1KSRA 4PG9B 3MACH 1EAPB 4O02H 1TZGL 5TDOB 1MIEH 3V0WH 1T2QH 4P2RB 3T0BA 2FL5A 4BUGA 1CGVA 4LCCB 4ELKA 3DARA 5J57B 5JO5A 1H3PL 1QBML 4PRID 3GBNH 1HXYB 1HWGB 1BD2A 4OV5B 1D5ZB 1N7ML 4QXGL 7CGTA 5D7IB 3PWVB 3RIFF 2DQGL 2C9AA 3MJ9H 4I3RL 5J6HB 2B0SL 1PZUB 4O58L 1VERA 1DBBH 1H3GA 4XWGH 4DN3H 5BZDB 1NANH 2VLJE 2OTUA 4D0DB 4NKMA 3MRGA 4PGBA 2BDNH 1MOEA 3V52L 1U8PA 2WWMC 4LFHD 4K2UL 3S34L 4XVJL 1DVFA 1G7HB 3PWLB 4XGZB 2XZQL 3VDBA 5TF1H 4XCNA 3RGVC 1MCIA 2GKIA 4HX1A 2H6PA 3IFOA 5KG9A 3N9GH 1CVSC 2DTSA 5ID1A 3F7QA 4F8TA 3G08A 1XF4A 2A83A 1YPZF 1Z5LB 5IHBA 4ALAH 3BO8A 4NO0A 3CXDH 2ADJB 1YPZE 5SWZE 1MNUL 3IDNA 1OPGH 1HILA 4DUWA 8FABB 4U3CA 1FH5H 2V5RA 2E8YA 2VWEE 2CMRL 4YR6A 3LPFA 1HYSC 1AGEB 1JHKH 3MZGB 4OD3L 4P4KC 3IGAB 4WU5B 4KAQL 4NQEB 4N8VG 2P4AB