3I2CH

Crystal structure of anti-il-23 antibody cnto4088
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVQLVQSGGGLVQPKGSLKLSCAASGFNFNTYAMHWVRQAPGKGLEWIGRIRSKSHNYATDYADPVKDRFTISRDDSQGLLYLLMNNLKTEDTAMYYCMREGIYGSFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncanonical conformation of CDR L1 in the anti-IL-23 antibody CNTO4088.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CNTO4088 LIGHT CHAIN
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH01
2CUMA 2MMXA 4DUWA 1NFDF 2D7OA 5EH1A 1QO3A 1AGCA 2A83A 1WQVT 1MOEA 4D9LL 1PY9A 1AXSA 4G6FD 3DRTB 3QXDA 5ELIA 4N0RA 4RQQB 1U3HC 2Q76A 5DVKA 1QR1B 5ADOH 3BP6A 1S9XB 5HVFB 4AENB 3PWLB 4PRPB 4IOSD 4WUUA 5DWUH 5IQ7L 1OPGH 2DWDA 3UTSB 4FQJH 4XMLL 3VFRB 5I1AA 5F96L 4RWYL 5F1NB 4OIIL 1TIUA 3GMPA 4U1KA 4NRXB 1KN2L 5FAAA 2VC2H 5GZND 3WFEL 4FQQA 4TTDC 3BJ91 3H7LA 4FQHA 1ZA6A 3VH8A 2NY2B 4NNPL 4P57B 4NQEE 2MHAB 4NBYB 3PUCA 1JV5B 1S9WB 1BEYL 1LHZA 3VMNA 4Y19B 4JDTL 3MYZA 1M6OB 1MHHA 5DJCB 1LDPH 2J12B 4HZAA 4K3DL 5DMIH 1F4XL 2Z31A 3WN5A 2GT9B 1ITBB 2XA8L 4OCRL 3SDXB 1G6RA 2X1PA 3QCVL 1CDIA 5B39G 1YPZE 4MHHI 3ZHDA 5CWSB 1KBGH 1HZHH 2HP4A 1U8IA 3BRGC 4KK5D 4CN1A 5IGXL 1F4XH 5F97E 4K3DH 4XTRC 5CLTA 4Y2DA 5FYLD 4PTUA 1BREA 1DN0A 4QYOB 3ARBD 2XN9B 3QDJD 1U3HA 4LAQL 3CFDB 1Q1JL 5T3XD 4YBQD 1BAFH 1ZEAL 4OBRA 1A7QL 4LLDA 3LKSB 1PDKA 1FZKB 1IL1B 3C6LC 1BGXL 3WKML 1SBSL 5HHNA 5F96H 5BO1L 4L29B 4AG4L 1FFOA 3N0PB 5IQ7H 1RJYA 4GKSA 1JNHA 4O9HH 4MJ4A 4PJDE 3ARPA 2XNAA 1PAMA 4TQEL 4NZRH 2HT2D 2E7MA 1HEZA 3G5ZB 4LQ1A 2HFEB 4HIJA 2R0ZL 3GO1H 1IBGH 4Z5RB 3NCCB 5KG9B 1P4BH 4R4BB 4ZXBC 4HK3N 4HUUB 3T0ED 1NEZG 2F53B 2GTWA 4PD4K 4FTVB 3STZA 3R1GL 5DMYA 4XP5L 4F9PA 3ORJA 3BVNB 4F7MB 2X1QA 5JXEC 3UAJD 1WICA 1SYSA 1AHWA 1RSFA 1JGVH 4PGBB 1OTTC 3OJDB 1FH5H 3CJJA 3PDOB 2NY3C 4PP1C 2WSKA 4XNMB 4W6WB 5SWZB 4OI7A 2VXVH 1CK0H 4GT7A 1P1ZA 1KLGA 5I15L 5KSVA 3MRFA 3VFPB 1EHXA 4NQEB 2LTQC 1A6ZB 1JPTH 5TDPA 3GFUA 4CNIA 2Y4SA 5D1ZC 5LGHH 4Y19E 4ZOAA 4AM0B 1I7RB 5HI3D 1INDH 4WU5B 4UIMB 5EUOE 2NW3B 1NJ9B 3MUJA 4PGBA 2NNAA 4HIHB 4UT6H 3EFDL 1RUAH 3NCBB 4YHYB 2LABA 1E6JL 3MFFB 3P73A 4JKPL 2OS7A 5IFJA 3S34H 4KK5C 1IBGL 4LDLB 5E1AB 5HHMD 4L3CA 3RVTD 4LNVA 5D7KD 3C5ZA 2YD8A 2V7NA 2XTJE 2F53A 2GTWB 3VD5A 1EVTC 5DRNB 4ZTOL 1MAMH 3I75B 4G6AC 4NO0A 4U6XB 2YR3A 4M6AA 2CK0H 3ZKQD 1NH6A 4F3FA 4O9HL 4S2SA 3S37L 1REIA 4RFOH 1A4JA 4KRPD 3OGOE 1J86A 3FQTB 3JV5A 4WTZG 5F6HJ 3H3PL 3LKQA 4QRQA 3SO5A 5I19H 2W9LA 5EN2A 1J8HA 3ULVL 2EC8A 4GXVL 1DLFH 4KZDL 1H15B 5FKAB 3UPRA 4GQPH 5DSCB 4Y5VA 1A6PA 3FO1B 1NCAL 1EUTA 2XTLA 2C7UB 3ARTA 4M6NH 2CKBH 3U4BL 4QXUH 4ZD3H 1MHCB 5ICZA 1OTUC 2ADFH 4APQA 2Y36H 3DURA 1VACB 1PBYA 2OTWB 3H3KA 1KIRA 1T7XA 2AXGB 5I1HH 5FO9A 3QDMA 1TCRA 4K9EL 2VLRE 1QFUL 2ICEA 1ZHBB 4U05A 5IB2B 5BS0D 3UP1A 2DQJL 4GG6E 5I30H 4MCZA 3D2UB 2FNBA 1FN4B 5IBTH 5C08D 3SKNB 2VXUH 5FO9B 3KPOB 1IAIL 4H1LG 5EWIL 1LWRA 4GG8A 5EN2B 3DVIA 5EUKA 5AAWA 4JDVB 2E8YA 3JWDC 3BP7A 3FOMB 4URTB 2HG5A 5FYKL 4S0TD 4QXTA 1G7IA 1FORL 1IGYA 4LFHG 4ZO7A 4F7EA 3L5XL 4PGDA 4AIZA 1KB5L 2BNQD 4U1LB 5GS0C 3U6RA 5IMMA 4D8PB 2BY2A 1CWVA 2ADIA 5JORB 4Z76A 5F3HA 1ZANH 4XNXH 1A3LH 3PV6A 4XNUH 4M7ZB 1YEEH 3OJ2C 5C0AD 3DYPA 3MR9A 2OTPA 4UT9L 1IT9L 2I60L 2E9WA 4JEGB 4OB5L 2NW3A 1BZ9B 12E8L 3IU4H 5K9KA 3CVIH 1I9RH 4Z7UB 3IFPA 5C86A 3JVGA 1BBDH 1JGUH 1G7IB 1YZZA 5BMFH 2A6DA 3IJYA 4J8RB 1BBJB 1T2QH 4M7JH 4LHQB 3CZJA 1MHPH 4ELKB 1HHGB 3HUJA 4RGND 1TFHA 5JW4Q 2ZNXA 4PJFA 1RHFA 3WXWL 4GLRH 5DJ0B 1RV6X 1M71B 5TDOA 3ROLA 4LDEB 3FONA 1SHMA 2I9LA 1IGCH 3BE1L 3C5JA 3HMXL 1E0OB 5C0CD 4EUPH 1U3ZA 5C0CA 3D6GA 4KRNA 4FABL 1JJUA 3KYMA 3Q5OA 2WLYA 1ZLSH 3O4LA 2OJEA 5DVLA 2HMID 4PJEB 5JUEH 1F90H 1VFOA 5MEND 5DEGA 1KXVC 4QHUA 3KAAA 3ZMRA 1XF4A 3BH8A 1QSED 2HLAB 1S7SB 4Y5XB 1W72B 5K9JH 5FF6A 1U41A 5I8OH 4I3SL 3QEGL 5SX4H 2W07A 4FMKA 5L2KB 2PXYA 4G8FB 1NCUA 1RIVH 3EO9H 4U1GC 3ZZ1A 4KKAC 2K3TA 1IL1A 3OV6A 4S1QL 5I1DA 1Z9SA 4PGEA 4IIQA 4PJDF 3WO4C 2AK4B 4P48A 2ORBH 1OQOA 2FX7L 3GMQA 4N68A 3LN9A 5BQ7A 5D7IB 4NKMA 4PJ9A 4XNYL 1ACYL 4HAGA 1WISA 3C08H 5ESVB 5C0RH 3BKYL 5HYJE 1JNLL 4FZEH 1IQWL 2BSRA 1YYMH 3FAWA 3MOAL 4LRNL 4CU8A 3S5LG 1VESA 2I5YL 5IIEA 3TV3L 3TZVA 1AGEB 3UTTD 5BV7B 1H3GA 3MGTB 1DUYA 4EI6B 2VLKE 5KN5B 4L4TE 2CIKB 2OTUA 4M7KL 3GSWB 3IFNH 4YE4H 5I75B 2M2DA 1EO8H 1AKJA 4MA7H 3GJFB 4KMTH 4V2BA 1MCIA 4J12A 5I2IA 2GSGB 3A67H 5CUSH 4LCCB 1XF5B 3SDDD 3NFPA 5JOPE 3VGAC 3C8KB 5DRZA 1DANT 2P48B 4G8EB 2OL3L 3MV9B 4KY1L 3ZTJH 2HAZA 3UTSA 4ZG1A 4RIRB 1JF1A 3C08L 4I18B 1KC5L 3L3HB 1HQRA 4WUUD 2VLRB 4D94A 2D4DA 4ZYKA 4RQQA 1QR1A 3W5NA 3P40A 5GSVB 4Y16D 4F2MB 1MCWM 2YN3A 1AGCB 3QP3A 5ALBH 4IEFB 4TYUA 1YJDC 1N6VA 5FDYA 2ICES 5EU4A 2ESVD 4QRPE 2ESVA 3L3HA 3FO0H 2O93L 2QQNH 5FYJD 3JV4A 3VFUA 4A6YA 2XY1A 1U8NB 5MERB 5C9JA 3QYCA 3HAEH 3PGCB 1BQLH 1AXSB 1F42A 1LO5B 2JJWA 3Q2CA 2AV7A 2NX5E 1U93B 2FJFB 2FIKB 5L8JB 3X13A 3B2VL 1CFVH 2GSGA 4HUWB 4P5MB 4PJEA 3R0NA 4JN2B 3TBTB 1A6AB 3T1FA 5ANMA 2X44D 3LKSA 5ALCL 4NP4H 1ZT7B 4A2MA 1C5CL 1VHPA 5GSRB 5EZLB 3KYNB 5E6YA 1Z0MA 5TF0A 5IF0A 2VLJD 2BOCB 4BH7A 4X7DC 4QYOA 4F7TB 2EXWC 4ZPTB 1AFVH 3IJSB 5I1IH 5I74C 3QHFH 3VXNA 1F11A 4NZTL 4WNQB 4P23D 3IDMB 4ZPTA 4LSSL 4YDLC 2IGFH 1U8OB 3OAUL 3KLAB 5HY9B 2FL5A 5JMOC 3QUMH 5IVXF 3BDYH 3O3AA 4LSUH 4TVPL 3VGHA 1MFBH 3OKDB 4JFPA 1Y6MR 5EBMA 1FE8H 3TYGH 3QNYB 1MHEA 1MJ8H 4L8DB 5L2JA 1JBJA 1EZVX 1I85A 1LK2A 3SKOB 2ESVB 3BFOA 3OJMB 1HQ4B 4G8GD 1C7SA 2FGZA 4JJ5B 2PKDA 3EJYD 3VXRA 5MP6H 4YC2B 3BGFC 3BT2H 5D1ZB 4KUZH 3BMWA 1E4KC 3WNOA 4MDIA 3BWUC 3SJVB 2D7QA 4HIIA 2VQUA 4MAYD 1CXHA 5A43C 5HHNB 1EAPB 2XG4A 2BY1A 4Y5YC 3DX8B 5C09E 2ZOKA 1CU4H 1PKOA 1X4ZA 2PXYD 5HYQA 1JFQH 3D39D 3IDXH 2WWMC 2C3HA 4E0RA 4KROD 2QR0B 4P4RA 4TSCH 4IDJH 5J11B 4M62L 3GSRB 1DBAH 1FGNL 1QLRA 4OIAA 4C83A 1DTUA 1HXMB 2J8HA 2PCPB 3MJGX 3IDNA 3PNWA 5CLWA 5FOBA 3T65B 4PB9H 3QUYC 4JO1L 1TVDA 3D5OF 3V4PH 3CFIC 3MLXL 4G6MH 1MJJA 1XF3B 2D2OA 4TSBL 1MAJA 2RCSL 4HXAL 4HWUA 3B3IB 2I27N 3C5ZD 3WDIA 1AGEA 3O81A 3OXSB 3L7FB 2W0FB 1S9VB 1I75A 2B1AL 3K0WA 3WXVL 2DKSA 1QA9B 5DDHB 1TJIH 1LE9A 5J9PA 2JCCF 3MRKB 4QCIA 3DSFH 3DX9B 3C6SA 2IG2H 5DLMH 5FHAH 5C0DB 1XGUA 1KB9J 2WUBL 4GXUM 5LAXA 1ZTXL 3F5WA 1DLHB 2AI0L 4K7PX 2XT1B 2BY3A 5K9OB 3HE7A 2ZKHL 4OQTL 2AP2A 3IKCA 5EU6B 1ZS8A 5IVZA 5IVXB 5B3NA 4JE4B 1EAPA 2JB6A 4KJYB 2B20A 3O6FA 1WSST 1RZGA 3FT3A 4XVJL 3T0DA 2LVCA 5GJTH 5HHVL 1UJ3B 4E42A 3FOMA 3O41A 1HQ4A 2A6KA 3WLWC 1OT2A 3S4SB 3S36X 2AXJA 1RMFH 4DVBB 1YN7B 1SVZA 4MXVE 5HGDA 2Q6WA 5BV7H 4MAUH 3O2DA 1CR9L 1UQSB 4OZFG 2P7TA 4YNYB 5IW1A 4OM1L 4UT6L 1GOFA 4GBXA 4FG6D 4S10A 1VKXA 4QF1A 3QRGL 3ECBA 3MRMB 5DEGB 1DCLA 2ZSWA 2XTJD 3HI5L 1DUZB 4C56A 1VFAB 1FVDB 1F4WH 4AIXA 5HHOB 1MVUA 3ARBB 5GHWL 4Q9CA 2XWJB 5ICZB 4FTVD 4GO6B 5FO8B 3L95B 1JGVL 5DC0A 1IAKB 1FGVH 3T1FB 5DT1H 3RZCD 1GJIA 4PTTA 2WBJB 1YPZA 5HHXH 4ZFZA 1FP5A 3PDOA 3MRDB 1UT9A 5K59F 4LSQL 1HHGA 3HUJB 1DVFA 1U92B 5E94B 1T20B 3H0TB 3MR9B 4QRQB 1S5HA 5IUSA 4GSDL 2N7AA 2P8PA 2VR5A 3D0VA 4NO2B 4NQDD 5EZJB 5D71H 1OW0A 5FEBA 3EO9L 2WIMA 1CR9H 2YA1A 4YBHA 5J0BA 1DQMH 3MROB 2VDPH 5C92A 1U8QB 1I8LA 1FIEA 3MNVA 5HYQB 4NUGL 4PRHD 3E6FB 1DQQB 1N6QH 3LDBB 2P8PB 4H88L 4MNGA 1F3DJ 1XT5A 1OCWH 1N2RB 1I8KB 5L88H 4HKXB 4KHXH 2Q3AA 2X4TB 4D8PA 5JPNB 1XCQA 3HC4L 3LN5B 2Z4QB 1LD9B 5B21A 3NZ8B 3MV7E 3RA7L 4XPFL 5JQHC 1WAAA 2UZXB 1EZVY 5EU3B 4X5LA 3RFZC 1IKFL 1NGPL 2G75A 4GS7B 2GFBB 4L8SA 3NFSH 2CSPA 4HXBL 1UVQA 2DLIA 3RL2A 3KLHC 1OAUH 3RUGB 2WUBH 5J06A 3LCYA 4DUXA 3RWCA 1QFHA 3ZDXE 5DHYA 1WZKA 4P99A 2DL2A 2AEPH 5MENA 1RULL 3WXVH 3BPOC 4WTXA 3MV9D 1BEYH 3KPLB 1MRDH 4I0KA 1I9RL 5EUOB 1YMMD 4P59H 3RJDA 1PKQA 1C5BH 4LNRB 3V6FA 4PGJA 2NX5B 2V6HA 4HULB 4K7FA 4MZ2A 4HUXB 3F65A 2BMKA 2PYEA 3KPRA 1A9BA 5FA3B 4XNZB 4KXZI 4RWYH 3ETBF 5JIHA 5EU5B 3P0VL 3P77B 4LIQE 4ZMAT 4LVHC 5I71B 2EXYC 4NOBA 1OD9A 1L7IH 3QNZA 4KQ3H 1L9NA 4ORZC 3ZKNC 1GH7A 4WENB 1S8DB 2F5AL 3FB7B 4GMSH 1DEEB 4WU7B 3PWUB 3SCMC 1KT2A 4MXQC 4C56E 2X4TA 1OAYH 4AZ8A 2H41A 1CU4L 2BX5A 2HLAA 3WBDA 4RAUA 4NQUA 4MDJB 1OL0A 2VSDA 4DTGH 2F53D 1C08B 2GCYB 4OZHB 2HRPH 1IAIH 5EWIH 1IGTA 2V5RA 4CVZB 1P4LB 3LSOA 1KTLB 2O5YL 1IZJA 2VXUL 4S2SB 1OD7A 5E8OB 1F13A 3A0OA 1HH6B 4KKNA 3I6LD 1KCVH 5GRYA 2C3XA 3BPLB 5L2JB 4HEME 4NO2A 5D7JC 4WI6A 3GSNA 4X5XB 5E7FA 2Z31B 1MFBL 1T21A 4HUMB 4R4ND 1MVFA 35C8L 1FNEB 4E9LA 3PGDB 1RHHB 3SPVB 3LZFH 5IHZA 5K9QG 2OSLA 5CBEA 4JM4L 3BW9B 3LHPH 5IT2H 1IEHA 2H2PD 3GMNB 4J4PD 4EDWL 3ARDA 4PJHF 2I24N 1C12B 3C2AH 2YS4A 3CMGA 2EDWA 5HYJA 2NW2A 1D6VL 3Q5YA 1S9YA 3V6OC 4DW2L 1X4XA 2YD3A 4DGIL 1NC2B 2H8PA 4ZOBA 1I3VA 5CJ5A 4UV4H 4Z7VE 4GOSA 4ZXBA 3UJTH 1CVSC 2VLKD 1CQKA 3OAZH 3CX2A 3FN0H 4PJ9B 4TULH 3SE9H 4OCYH 3FZUD 4R7DB 3ZL4L 4O2EA 4K2UH 3BYTA 5GZOC 3HZMB 5C0BD 2XY2A 1NC4D 2YD6A 4N90E 5ITBL 4NGHH 3QQ9C 3PE9A 2K1MA 3SCMB 1A6UH 2AJVH 1UC6A 5FKPB 3I9GH 5E56A 3MRLB 1IAIM 4L4VB 5FF6B 5IESH 5EZOL 2V2TA 1FCGA 1K4DA 2DB8A 5HVWA 2C4XA 4LU5H 1CD0A 2LFGA 5LGHL 4JFEA 5JW3L 5E6IB 3OXRA 4I4WA 1K5NA 4HK3J 4NQSA 4UB0L 5D72H 3W9DA 3BKCL 2NY4D 1T04B 1MHHB 4HH9B 4MMZC 2L4OA 2HLFD 2BK8A 2LQRA 4Y5YA 2BFVL 5J12C 1HWHB 4EEEA 1ETZB 3MRKA 5HVHB 1YEFH 4R2GC 3MBXL 1HOCB 3QUYB 3FO2B 5I1GL 2K7PA 4LLQA 2D3VA 3CMOL 3UTPE 4U1HA 4Y4FD 3HPJB 3C6LD 1J0YA 1KJ2L 4R26H 1LO5A 5IG7A 2E7BA 4JZNB 1PZ5B 3MSPA 5T3ZE 3QDGE 1KCSL 3WFHB 1FFPA 2WP3T 3GZKA 1FNFA 2DQHL 2ITCA 1LP9E 1NL0L 1HH6A 3DUHA 3FTGB 1JGLH 5BZDB 3U46A 2PW2B 5E2UL 4FS0A 4FQHB 3EHBD 1I8IA 2AEWA 4NT6B 1ND0B 5C8JB 3QFJD 3GMOB 3ZKXC 3QUZB 4XHJD 2EYRB 3MUHL 5F9AC 1ND0A 3BGFB 5C8JA 1H8NA 1UG9A 3BPOB 2P24A 1HXYA 2VLJE 4N0UA 2MFNA 4EI5A 2VYRE 2FX7H 2GHWB 4OZGA 2AJ3A 1A7QH 2DI7A 2FRGP 2BNRE 4LSRH 5HGGS 4Y1AE 1SQ2N 1BECA 3EJZC 4EKXA 3DARA 4OLEA 4EXPX 4QRRA 1NEZB 1RAMA 3C8KA 1DVFB 3CVHL 1T2JA 3KGRA 4XC3H 1U8MA 5A2FA 2NY1B 3LRGA 5T3ZH 1UB5B 2YOCA 5HYFA 2AXFA 3V52L 4AH2A 3JTTA 4J2XA 2UVEA 2VDQL 5E4IA 4Q9QL 4BK4A 3GGWB 2AAVA 3AMKA 1TTFA 3FL7A 3B6SA 4P2QE 3TGXA 5C2UB 4NZDA 4LLMB 1U8OA 2VH5H 4G3YL 5C7XH 4R4FH 3CD4A 1ZXQA 1GGCL 3RP1A 2NQCA 3T4AA 3CVHA 4YH6A 4QT5B 4EN3C 4GAGH 2EYSA 5CGMA 3EO1A 2QSCH 5ICXB 1BM3H 4BZYA 2VXTH 1K4CB 3UJJH 5D2LE 4QRUA 4ETQA 3SE8H 4GRLD 4LEXL 5CIPB 4FG6C 5IF0B 3VWKB 4FQJL 4TPRL 3TO4D 2F54B 5HGDB 5GS1A 5DJZB 5E2VH 3ZDYF 5BMFL 5L2KD 2ATPA 4PRAB 4PJIF 4G7YH 4WO4D 1HSAA 3DHMA 4X7EC 3ULVC 4B7LA 4DOHB 2VL5B 4C59B 3CCHB 2ID5A 5EOCH 3A6CH 2ZG1A 5DZNA 1X3DA 3MRHA 3N9GH 3C60D 4QRRB 4YDIL 4IIQC 4D0DA 3P0YH 2RAMA 1G6RL 4O4YH 4YGVA 1GGTA 1ZANL 3N1GC 2JLLA 3L5IA 5JHLL 4I0PD 2ZSVA 2V17H 4WV1A 2XQBL 5TFSL 4KDWA 5F7DB 3CSBA 2VLJB 1UCBL 4LVEA 4JHWH 3OHXB 3QUXD 3L7EA 5J9PB 5C71A 2PETA 3PDDA 3T0XA 1KG0B 2YSSB 3HNVH 3RKDC 1T20A 4DKFL 5SX4I 1MFDL 3NN8A 5A3ID 1FZJA 4PJHB 4OD1H 2R4RH 3STLB 4PYHA 1PG7H 3G5YB 1JE6A 2NXYC 3B9DA 1E4XI 4U2YA 4U6VH 4D3CL 1HN1A 3HRZA 1GZPB 4OFDA 3IAQA 3VW3H 2ICEB 5IB2A 4KAQH 2YSSA 1NUFA 4RFEA 2IBBA 4JN1L 3ARBA 1VGEH 1CBVL 4WO4B 5GQBA 1NGWB 2FB4L 3RY5A 1YC7A 4XVTL 3ZLQC 3CDFA 2XWTB 5C0CE 1J1OH 3U7YL 5EPMA 1TZHA 3UTQA 4A6YH 4FQXB 3GB7B 1NFDB 3EYOB 1RFDL 4KK8D 3U4BH 1KB5A 4ZTPL 2UY7A 2XZZA 4JFFA 1EFXA 3ROOA 5E08L 5EO1A 3PWVA 1OAXL 2F8VA 4AIZB 3SJVA 3QG6B 4GW1B 5ABDE 2FZ3B 3ULVH 2X4OA 1J05B 4IS6B 2P5WB 2XXCB 5IB4B 1S7WB 3D3VE 1MIEH 5C09B 2PW2A 5GGRB 1X5HA 1CXFA 5C6TH 3S35H 3B8SA 4HQQL 4ZTPH 3ARGB 3SKOA 2H26B 3DX6B 5CEYA 2ADJA 2P44B 3NIDF 4YXHL 3NCEB 2NY5L 2V7HB 1QKZL 5DMGD 2Z8VC 1G9EA 3T4YA 2ZNWA 5IBUG 1KB5B 2GY7B 4DKEL 1A1MB 1R5WB 3PHQB 4M6MH 1J87A 1H3PH 1OARL 1S7RA 1C16A 7FABL 5T3XE 5H35A 3IS1X 4ZNEA 2UVFA 1BJMA 1TCRB 2QQKL 4X0KB 5J1SC 3RVUD 4PGZA 4OTXH 5DK3A 5F9WC 2AKRB 4WFGE 1IFHH 2KBGA 2CKBB 1INDL 4I3RH 2YC1A 1VCAA 5ENWA 2R2EB 2EE6A 1EEZA 4I0PA 4NQEA 1NANI 3QJHB 4KTEH 5J4MA 3JTTB 2YMXL 1AQKL 5IW3A 5D1QC 4ETYA 4LK4A 3RGHA 4R0LA 3EYQC 3G5YA 5CGYD 2E7HA 5IQ9A 2BNUA 4PD4J 3KPNA 4JHWL 5HHOD 2YD1A 4PBVC 4PYGA 5T5NF 1F00I 2JJVA 1RUQH 4O00A 5CZKA 4LEOA 1AGBA 1G9NC 3WEXB 2YZ1A 2Y5TB 4D0CA 2C26A 3TIDB 1MI5D 4GBXC 4FXKB 3RWHB 3ULUL 2DN7A 4J3VA 4NQTA 4JFDA 1J5OH 4CN4A 2A74B 3MREB 5IMLB 1PD6A 3TJEL 2BRRL 3VXMB 3GSOB 3MRIA 2WUCH 2Y5TA 1X5AA 1I8IB 4HLZH 4M5YL 2F8XC 4PJXA 1WZ1H 4YEFA 2VLRA 4XVUD 3SE3C 1A14H 3WSQH 5TQ0L 4Y19D 5FB8A 3U7WH 3PQYA 4H20L 1YDPB 4HWBL 2NY7L 4ZFZB 4R0LB 2HT3C 1IVLA 4NWUL 4NO5A 3D3VB 5L0QC 3WKMH 1IM9D 1MCPH 1ED3A 4XBGA 5SWQB 4KJQD 4KVCL 1QRNB 5F9OH 1ZHNB 1F6AB 3LQAC 3ZTNH 2R1XA 1ZEAH 2BERA 3DXAB 3WEXA 3N1FC 5HHOA 4ZDHB 3BIKA 2VH5L 2HT2C 1JHLL 3KPNB 3T2PA 4X7SH 1E4XL 2UV3A 3FT4B 3HR5B 3QDJB 3U0WL 3MLWL 3FB5A 2DJSA 4XNQA 2YWYA 5H2BB 1WFNA 1D5XB 4OAWB 4M6OH 3FRPA 5IMOA 2Y9RT 3WHE1 3EOBA 4X6EA 1YN6A 1XGQB 4PJ7F 1WC7B 2A73B 5JXED 3W2DL 1NBZB 4MQSB 3QEQE 3VFMB 3TN0C 2Y1VA 1UYWL 4PRHB 3MRGB 4DZ8B 5E99L 5DR5L 2R1WB 5BQ7B 3MLVL 4G7VL 1S7RB 2OXHA 4PR5B 4DN3L 1R3HB 4G6FB 4IS6A 4MXWH 4OQ1A 1UENA 1P7HL 1YNLH 1AQDA 1B2WL 4JLRB 4FFZL 1UH3A 3G6JB 4TSAH 4LGPB 4NN5C 2W9EH 5F7EH 4CVUA 5A2IH 2OCFD 3CLFL 1NUGA 1ONQA 3T0EB 4HWBA 2QL1A 4OFYA 2CUHA 1RUKH 2VZUA 4XCCL 1UZ8B 5GGUB 3VFNA 3DV4A 1BLNA 3HC3L 1W72H 4JY6A 5BRZE 1R5VA 3MV8B 5I8KH 4D9LH 2GK0B 3INUL 1K6QL 2VABB 3MV7B 2FDBP 1JZ8A 1WJ3A 3G08B 3GUTA 2NZ9D 4BFEA 4Y8DC 5T1DL 1M7IA 2H3NA 4NYLA 4UQ3B 1NGYA 2LTQB 3TIDA 3FO9B 1UWXH 2WIIA 3L3KB 2GJZA 4WFEE 4R3SA 3H9ZA 1EEYA 2HJFA 4OD3L 4X6CA 5FV1L 4MJID 4XPTH 1SBBA 2ED8A 4S1DC 3WFCL 3HCVB 1CE1L 2W1NA 1MF2H 1G7JA 4NQCA 1HOCA 5INCA 3I50L 3TT1H 5I2IB 5J7CC 3OZ9L 4EDXA 3ZTJG 4XMPL 3OKEB 3T2OA 4ODHH 2CKBA 3QQNA 3MRQB 3EO0B 4NHCL 3EJYC 2DJ4A 4WUUB 2XA3A 4GW4B 4Q0XH 4CN6A 4Q6IC 2AABH 5IESL 1OGTA 2AK1H 3AS2A 1A47A 5EO9B 4RDQG 2WBKA 4BSVB 2E7CA 5KTEL 4WUKL 3TA3C 5DFWH 1A3RL 4EVNA 5TE4L 4QRRD 4GAJH 1B0WA 3MRIB 4NPYB 3S97C 2NXYB 5D1ZA 2DQIH 2D7TL 4HLJA 2Q8AH 2MNUA 1LNUB 2NY6B 2A0LD 3F12B 1QPXA 1W8NA 5FKPA 1ZT4B 4PG9A 4CVWA 1R3LB 2Q20A 2ZSVB 4O58L 4IIQB 1WBZA 4FFVC 2NLJA 3MJ6A 4XP4L 3T2NL 4LCUA 1R3LA 2ARJB 4EIZC 1N8ZB 4ODVH 4LHUG 2VZOA 1YQVL 4F9LC 2OI9B 1XGYL 5DRWB 2BC4B 1SEQL 5AG8A 3FT3B 4CJ0A 5HJ3B 5TDNA 1JMXA 4I3GA 3LY6A 3L5WA 5T3ZD 5C0BB 4RMQA 1OAKH 4U1SB 3GJFK 2G9HB 1G7LB 4B7IA 4K23H 4JM4H 3W0WE 5L7XH 2JJTA 1ZHLB 3G5XB 2FGWH 4JGMA 3UZQA 2A2QT 2YPLB 3QXUA 4JB9H 4PJGA 3R06B 4L8CA 2V2WA 4AH2B 3KJ6H 2E27L 4RA3A 1N0XH 4FTVE 4JRWA 2PO6A 5H37H 1PEWA 3IYLW 4NDMA 5L8LB 4YFLF 1LK3H 1MH5B 4XC1L 4S1DD 1TNNA 1CVRA 3TVMB 2Q3ZA 4MA8L 4PJEF 5I9QC 4WEMB 5T3XH 4BM7A 5DJCA 5F7WC 3JWOC 5JPNA 5E5MB 5GS0H 4MJ5A 4P2OC 4K8RH 3QDJE 3QULA 2GJJA 2HRPL 3FCTA 4RCAA 5E8PB 4NQDE 2R0LL 1S7WA 3V4VL 4FQQB 2P8MB 4PIRF 2MCPH 1PVHA 5T1LD 3CX5J 3AY4A 2PCPA 4IRSB 3WKNA 1RZGB 5DEZA 3QHZH 4BQCA 1R5VB 5TPWL 4YDKH 3D9AH 3KG5A 5IVXA 3M17B 1U95A 2AV1B 5KZCB 3SDAB 2HMIC 5BVPH 4L4VE 4GKOA 5F89A 4YBLC 2CLVA 3OKEA 4M5ZL 4W6YB 4Z0BL 2EECA 4M9OA 4KJPD 5HHPA 1A9EA 2MOVA 1YEIL 4X8JB 1KNOA 2MQCA 4KK6C 4RGNB 3GMLB 5GRJH 1LVEA 5CZVH 2HT4C 4XP1L 4UNTA 1R3JB 2J8OA 3HLAA 4F57L 5DK0A 1UM4H 3HNTH 5AD0B 4EXKA 3AMLA 5JXAL 2DLGA 5IJVA 1MJJB 4PJDB 1KPUA 1KTKE 4YIQA 1FHGA 3LH2H 3TFKC 5BJTB 2R2HB 3CXDL 4HXBH 4R96A 3NFSL 1KFAL 3PL6D 4XWOC 3WIIL 3I02B 2Y72A 3K2UH 2DJUA 4OFPA 1NC2D 2PNDA 2PW1B 2OQJA 2XKNB 1Q9LA 3ZYJA 2Q6WB 4E0RB 4TNVF 1T22A 1WIPA 3X3GH 2VZ3A 2BNQB 3V6OE 2JJTC 4KKBD 1JL8A 1ZT4A 4JY5L 3NCJL 4MB5A 4PG9B 4XBEL 5CGYC 2FYYB 5D2NE 1A1NB 5IROC 1WTGT 4JO3L 5L8KB 4MWFA 4YHKH 4RGMB 3NPSC 1GAFL 1ZLVH 1HILA 3NA9L 5FM4A 4GBXD 3O3DA 1G1YA 4CMHB 3OR7A 4Z95H 1MHEB 5IEKA 3O3EA 2IALA 3VG9B 3OPZH 1ZGLA 3EGSA 1WC7A 5HI5D 3C60B 2YPVL 3UPCA 2A9NH 3DROA 4J3TA 2NY0C 4Y4HA 4AEHH 1L6XA 4N0YL 2XTJB 4UIKH 1AGBB 2AXHA 3GBNH 4OUOA 4R96B 2R4SH 5DC4B 5DJXA 3CAFA 1V7ML 4YXKH 4WO4C 3MFGB 4D9QD 4PBWD 4MD4A 1KTDA 4JPIB 2HKHL 2CIIB 2X4QA 3K2UL 4XCFH 3D69A 1F4WL 1ZGLM 1QRNA 4XVUC 3UX9B 3H9SD 4NKIH 3T3MF 4YHMH 4LCCA 1QEWA 5D2LB 3L3GA 5L6YH 1A2YA 1JPSL 1Z9LA 1VFAA 3HCVA 3HN3A 4OM1H 1QD0A 5DD6B 1GYAA 3EZ8A 4L1DA 5J13B 4U1JA 2VZTA 3GSWA 43CAA 3MBEC 1ZLVK 2BCKA 1QSFB 2H9GA 1JK8A 5IW1B 3RWGB 2BY0A 3MQIA 5DHVA 1UQSA 1BFTA 4JFEB 5E8OA 5H94A 5EU7C 2OR9H 4NHUB 2BSRB 2JJSA 3DX6A 3I85A 4WEBH 5IKCB 3NH7L 5SWZE 1FG2A 2DYPB 3UZEA 1C5DA 4FFWC 3QUMB 4OZHA 3ARFD 2WM0A 1E28B 3KJ4B 1WFUA 3TP4A 1T4KA 1EH9A 5E9DB 3TN0D 5D2NB 2BNUB 3IDUA 5DMKB 2P4AB 2UZIH 1HDMA 4ODUA 1PKQB 3O4LD 1BWWA 1NCTA 4Z7VF 2VE6A 4R4NC 1XF2A 4IHOA 1CXKA 4I2XA 1TJIL 2BVQA 1P7QD 5K33A 1IEAB 1RIUL 3BH9B 3D87B 1ZT1B 1QYGH 1IGIL 1KIRB 3CFBA 4LCYB 3DLQR 5FUCC 4YZFE 4PLOB 3LEYL 3BH9A 5D2LA 2RCSH 4M1CD 4M43H 1RJCA 4PJXE 1W0YT 3GEWB 5EIIB 1NCBH 4LCIL 4LPVA 2WQRA 1DSFH 5D4QA 3O45B 1K8IA 4P5TD 5MI0B 1IM9A 5KSAB 1FL3B 5D93B 6CGTA 1S5IL 4JFED 5FB8B 1FZJB 4OLVH 3BIKB 1DBAL 1FGNH 3VGGA 5FUZH 1NFDE 5MEOA 2Y23A 4YUEL 1EO5A 3GMRB 1V8HA 1ZHNA 3W0WB 4RBPK 2LVEA 3GSOA 2AW2A 2HKFH 1E27B 4QXGL 5D93C 4OSUL 1O7SA 2P49B 4ODVL 2YRPA 2R0KH 5CHNA 3RVUC 4U6XA 4Z0XB 3MGAA 4XPBL 2X7LA 5AAMA 4Y5XA 1JK8B 4Y4FA 5EU7E 2AJYH 4AEEA 4AYFA 4D2NA 3CSYB 1M7XA 3QXWA 4PRPE 3RDTD 4D0CB 3V95A 2Z91B 4YXLH 1FO0L 1FFQA 4C58B 5TE6H 4MDJA 5IHUL 4OLYL 3L6FB 1I8LC 3NGBC 1GC1C 2WMPA 4Y1AD 5B39A 1A2YB 5CHNB 1LP9F 1DFBH 4XP9L 3V9FA 5F8RC 1JNNL 3QUML 2DQUL 2P5EE 4QO1A 2IAND 3QWOB 1HI6B 2HLFC 2EE9A 5GGTA 1XGPA 1IGFH 4LCWA 5CIPH 1G7PB 3IXAB 4YWGH 3KVQA 2OZ4L 1L6ZA 3D69B 4HC1A 3UC0H 2XRAL 3BQUC 3IXTB 3JXAA 4LLYA 3IGAB 4HW6A 4U1NA 3REVA 5F93C 4GKNA 3B2UC 3D18A 1IM9B 1B9ZA 2EDLA 1WEJL 4PJ7B 4QT5A 5JPMA 1X5YA 2DQCH 5JW5A 4NFDA 4NP4L 3MACL 4M03A 1ORSA 4TNWF 3TZVB 4XPHH 3WN5C 2DBLH 1EGJH 4LPXA 4MNQA 3ZDXF 3LRSA 4QKXB 3G08A 3DUUA 4HIXL 2AKRA 4P2YA 3UTZA 1AO7D 4WI2A 3RWCB 5F1IB 3MV8A 2WANA 1KN4L 3OSKA 1H8OA 4RBPH 3QG7L 4N0CC 4L8BA 5HJ3A 2HRLA 3WIFB 2QQNL 1JHTA 5JZ7C 5HVGB 3SDCA 3VRLE 2VUYA 1KACB 3TT3L 4FXLA 3C5SB 1VB9A 4LVOB 5I8KL 5JDSA 4KVNL 1KPVA 2DMBA 2PXYB 4G8FA 2ICCA 4PLJC 5IHLB 4ERSL 1CDHA 1ACZA 4U1IA 1DBJL 1FDLL 2IANB 1CFSB 4P23A 1P2CB 2R2CA 3P77A 3NIGE 2X42A 3MV9E 4EJ1C 1KC5H 2NY2D 4FFZH 4W4OC 3QUZA 1RZKH 4PTUB 5DJDB 1N4XH 1BOGA 4P2OD 3GSXB 4HS8L 1H3XA 4WO4A 4AL8L 5F7HA 2KQNA 2W0FA 1KJVB 4KPHH 4Z7WA 3TIEB 2OXGA 3KXFD 4KHTL 5E5MA 2NY4B 4KI5C 5DC9B 4RIRA 4YBQC 1XIWB 1PZ5A 4OCWL 1P53A 2BVYA 4OLWL 2VERN 3VWJA 3ULVD 2DQDH 2MHAA 2B0SH 3Q6GH 3MA9L 2AK4E 2V5YA 4Q9RH 3QWRA 2LU4A 1ZHKB 5C07B 2DBJA 2Q8BH 1G9NL 1SJEA 4ZPVB 4WI9A 1T04A 2P45B 3EFFB 5J13C 3M8OL 1FNHA 3SDAA 5GS0D 5C0RL 1WAAF 4NKDA 2VDOH 4RGOH 5DD5L 1DE4B 5L9DH 1Q9WB 3GHEL 2AGJH 3BIBX 2EZ0C 1A0QL 3DWTA 4ZO6A 3U7WL 3I2CL 1T03H 1QLEH 1WIUA 4YNYA 4N0FB 3HFML 3P11L 4M93B 3PV7A 4HHAB 3QEGH 3FCTB 3ZSTA 2DQEH 3NMEA 1RU9H 3WUWG 1YEHH 4JKLA 4S11A 5FYLE 3D3VD 4O51B 4S1SH 3EOYG 1YUHB 4TN9A 1RVFH 2QSVA 4DGVH 1KPVB 2GTZA 2NXYD 2VDMH 5JUEL 4JDVA 2YD9A 5FYKD 5IWLA 4HGKC 5F3BA 3VWJD 3RY6C 4Q97A 3TPKA 3FFDA 4RGNC 4FABH 5IQ9B 2VL5A 4M1GH 1INEL 3T4AB 4MCZB 2V2WB 1VGKA 5DEFA 4XCEB 1IKNC 1P1ZB 1I1FB 2AJSL 2V5SA 1YNTB 5EB9A 1V3MA 5GS2H 2VSCA 4HJJH 4X9GA 4JREC 1ORSB 4Q9BA 4GRMB 4MQ7B 1MI5A 1VACA 2OTWA 4ZUVB 4LPYA 5ICXA 2YN5A 1CFQB 4TUKH 2YA2A 3HC0A 5C0AA 1XCTA 5E1HB 1WWAX 1FNSH 1PSKH 4FQ2L 3IJSA 4AEIL 4N0UE 1JWMB 1U93A 4NNXA 2EDJA 1A6VL 2FBJL 4TOYH 1NC4A 2NXZC 4KXZH 2QQKH 2BVPB 1NMBH 4Z5RA 1CG9B 2A9ML 2QBWA 1NGXB 5MEPA 4N8VA 2A6DB 3IJYB 4J8RA 7FABH 5J11C 4DVBA 1KLFA 1KJ3L 3GSNH 3OKKA 1S9WA 3GMLA 4ORGB 4JDZA 1BIIA 4XNXL 3DGGA 1MI5E 5B38B 4YHYC 1BD2E 1CGYA 3D85B 1CLOL 2UWEB 3RI5F 5DURB 5CILL 2FZ3A 5IB5B 4DN4H 1F4YH 1Y18A 2DDQL 3ABZA 3GJEA 4PJXB 3BEWA 2NTFB 3QUXA 4PRNB 3I75A 1BX2A 4YFLI 2O5ZL 4OZGB 4I77H 2XZCH 4Q6YA 4MD5A 4WW2B 4EUPB 1NBQA 4PJGE 4FQXA 2ZUSA 4K3JH 1MIML 1N59B 4XWGL 3BQUA 4K94L 4IRSA 4ODSH 4IMKA 3WFBH 1J0ZA 5ESAB 1ZLUK 1VFMA 5FHBL 3RWJA 4RISL 3RNQA 3VU2A 3FO2A 3QAZB 1LE9B 1E4KA 3BZFB 2ZUVA 3LKRA 3BP7B 4UINL 3BD3A 1I9EA 5EULV 1P7QA 2CRIA 1MCDA 3TO2A 3LQMA 4YEEA 2DQJH 3IDYC 4TUJA 3T3PF 3HPLB 3RHWF 2HFFB 5KVDH 4O2FB 5IV2A 5E2TL 4AEFA 1D3CA 4UT7L 1A21A 2VWEE 2MTPA 4LLWA 5DFTA 1XF3A 3HPLA 2EC9U 5I1HL 2SEBB 3Q6FB 4Y19A 3RNKA 4MNHB 3OMZA 2DTSA 3RQ3A 1AGFB 1H0DB 1NKOA 3LV3B 4OZFB 3VRIA 5EZIL 1Z3GH 3RWFB 5FDWA 4HMEA 4IBLT 4K94H 4JFZH 5E5RB 1GHFH 1NCAH 1T89C 3PHSA 4KQ4L 1DLFL 4M1CC 4IOIA 4ZOCA 4KZDH 3LS4H 5IEKB 2AK4A 2IQ9L 5I19L 2IEPA 3T4YB 2H1PH 3NFNB 4MSWA 1OAZH 4KK6D 4TVPD 4AQOA 1VEMA 4X6DE 4UBDC 3BUYA 5CMAB 1H15A 4ZODA 3WHXB 4L3EE 5HDBF 4IJ3B 3MRHB 4RFOL 5TH2A 2VLKA 2W60A 1EMTL 4F15B 4GH7B 5F71A 1JYNA 5IB4A 1KXTB 1AXTL 4WI8A 2G60L 4W6XB 3Q1SH 1T1ZB 4NCDA 1K8DB 3AAZA 3D39A 1J18A 2EO1A 4R90H 2RQ8A 5GGRY 2PW1A 3BI9X 3P3YA 3RTQA 4M02A 2W9DL 3ZYIA 4F2MA 3BH8B 1EAJA 3RDTC 1U8LB 4NC2B 4WHCA 1NCNA 4X6FB 1OGTB 4MNHA 3F58H 1EEUA 1T89A 1L7TL 3H3BC 4WFED 4TTDD 3EDEA 1BF8A 2YD2A 2A77H 4XP6L 2VNCA 3B4NA 1RZIA 1XGPB 4MB3A 3RVXC 2R56H 4P3WA 5I76A 1MCJA 2EDHA 5BV7C 3PP4H 5DD3H 5CEZL 4UUJA 3OB0K 1Q72L 1TETL 2IH1A 3W82A 5EOTB 3BQUB 2JELL 1MJ7H 5DD0H 3BZ4A 5LCVH 3N1PC 1RU9L 5A2KH 3U6RB 1RY7B 1ODAA 2FX9H 2Z93A 2HH0L 2Q7YA 4X80H 1HSBA 1K8DA 2ZWLT 3AAZB 5B38G 1IC5L 1IAMA 3LSOB 5CCKH 3VD9A 1DVFD 2EC9T 3OAYK 4G43A 4IMLB 2Z92A 5GIRA 2CGRL 2VR4A 2HWZH 2OJZH 5GGUA 3VFNB 1CD9B 2CGRH 5F3HB 1AP2A 3B83A 2H6PA 4RGOL 4YC2C 8FABB 4HJGB 1KIQB 3LKOA 4JRYD 4HUXA 4ACPA 3F7QA 4CKVX 5I16B 2Z8WC 5I71C 5LQBH 2IBZY 3WMSA 3ROOB 3V0VA 3THML 3PWUA 1N64H 1G0DA 2G2RA 2GJ6D 4DAGL 3L9RA 4PJ5E 4LLQB 4KDTA 3ARFB 5I8CB 3GRWA 3H9SB 4G80A 3P30L 4RX4A 3HMXA 4BZ1L 5EBLA 4HWEH 4K71B 3PWJA 4ZXBD 3T0EC 1A3QA 5DGRA 3WL9B 4PJGB 1CD8A 2DKMA 1CLZH 3O4LB 1MCBA 2R9HD 3QCVH 3RUGA 1KCKA 2HFTA 4LHUA 4ESKA 3LRSB 3LPFA 3MLSH 1JMZA 5C07D 3SOBH 3VFTB 5HYSA 4GAYA 2IH3B 3V7AE 3K81A 4HFWA 4P2RE 1K9TA 4PRPD 3FFCE 3AY4C 4J6RH 3DNKA 2D31B 4JM2C 4NC1C 3QJFB 5M94B 1CF8H 3AREB 4ZNCD 4OZIA 3FQUA 2J8UF 1YEKL 3J7HA 3ESUF 4UB0H 3AFLA 3QEUA 4I9WE 3MRLA 4XMLH 2BNRA 1G6VK 4G8IA 3MCLH 4CBPA 4C55A 1G7PA 3IXAA 2BHUA 3L9RB 4M8QB 3MV01 1JN6B 3B8YA 5EZOH 3S37X 3KPQA 4R7NA 1WFOA 1RURL 2AJVL 2MQ3A 3KDMB 5D8JL 5EORL 2E8ZA 1ZSDA 1F8TL 3WFDH 3KYKL 4K2UL 2FIRT 1I7ZA 1KN4H 1LP9B 4JFQA 4HIIB 5TQ2H 4DGYL 5KSBA 4X7CC 3ZKSD 1IZKA 3CX5K 1FNLA 2BVEA 4XHJC 1DP0A 1QO3B 3ZHLA 4LSPH 1RJZB 4UQ2B 5F44A 3G6JF 3H7BA 3ELAT 3U46B 4MD0B 3ULSA 3ARDB 1PLGH 1HHIB 3RDTB 3GI8L 4YHZL 3PIQA 4JZOA 3BDBA 2DIAA 2IQ9H 3UTTA 2DQCL 5DJ0A 4U4BA 3EJZD 3VWKA 1T1XA 3HPJA 3GSVB 3VWJC 5AZEH 2FD6L 3RZWA 3QCTH 3IT8D 1NJ9A 1OGAD 3MLUL 2VRAA 2XRAH 4ONHA 5DUPL 1OTUD 4PY8J 1LEKB 2UUDH 1OP3H 1NGYB 4QXWA 3OHXA 1RZ7L 3K80A 2H2SC 5DQDH 1A7NL 4POZC 3V7AG 3MNZA 4XP9H 4P4RB 2WZPD 5HSFA 1BZ9A 2B2XL 1AIFB 1X9QA 3ZE2E 5TE6L 4JM2D 5GGSB 1P9MA 4EN3D 3RTQD 3CSPA 3KXFE 5AUMB 3BXNB 3EYSH 1NLBL 4U1IB 5KVFH 4XPBH 4L9LB 3HI6L 3AXLA 4GKZA 4HJ0C 4M93C 2GTZB 1U8JA 2JB6B 5H8DA 5LBSL 3NFNA 1LO3L 1KELL 1AXIB 3V7MA 5I1EH 4OF3A 1MRFL 3GMRA 3ZO0A 1D5ZB 4WJ5A 2P24B 1K3ZA 1G9MC 2J5LB 2BNRD 4OLUH 3TYFA 4MNQB 4M4PA 5BZDA 5J6HA 32C2A 5CWSA 4XB7A 3IKCB 5IVZB 25C8H 1YEJL 2EYTA 1FL6B 3TFKD 4I0PC 3LEVH 3WFHA 3WN5B 3QZWB 5BS0A 1NMBL 1TZHB 3BJLA 4XWOD 4Z7VB 1JF6A 1Q9KB 4P59L 3SO3C 3UTQB 2YD4A 4G5ZL 2P1YA 3IJHA 5BZWB 1ZHKA 4UDTB 3MRRA 3U79A 4KRPB 5KSAD 4QHNB 5JA9A 3RWFA 3DURB 4IJ3C 3S88H 1A02N 3K1KC 3DV6B 3MLSL 5MHSD 2FHFA 3BUTA 4JQXC 1QBBA 1R3IL 1XAUA 4IM8A 5FECB 1LDSA 5A3IC 4YR6A 1VFBB 1JGDA 5GZNC 1H5BA 2MWCA 3B3IA 15C8H 1BWMA 1YEGL 4BZ1H 2QR0A 1RZ8B 2GJZB 2NY2C 4KTDL 1T6WA 5FYKE 1FZOA 4GRWF 4WW2A 4EUPA 1OF2B 2WV3A 3H42H 3LKRB 2GEEA 3BZFA 4M1GL 4OCXH 4PV8A 5EIQA 1I4FA 4IRSD 4LVNC 3RNQB 1ZWIB 1I3GL 3FQTA 3OB0H 2ATKA 5FGSA 1Q38A 3BIAX 2V2TB 4PJCA 5E0QA 4APQD 1JWSB 3U48A 4OD2B 4ORGA 4MS8D 1M05A 4HC1H 1RZFH 2F8OA 1WZLA 4HIJB 1URLA 4LSDA 1OM3H 3PWPA 5T1KA 4QLRA 3MRCB 1KJ2A 1IEBB 5I0ZA 3BZEB 1RZ8A 5KW9H 2XWBA 4J1UB 1U8JB 4U6YB 3Q5TA 3ZDYE 1DN2A 2IFFH 2X2YA 3MFFA 3ULVF 1W2KT 3U1SH 2GAZB 1BF2A 1DBMH 1U92A 2FHBA 5I1JL 1JPSH 4GKSB 4JPVH 1T03L 1FL3A 3BZDA 1IARB 2V9QA 5DRXA 4YHML 5GGSA 1Z9MA 2IMNA 5L9DL 4UDUA 3M45A 4ZS7H 4ODXB 5CP3A 1LMKA 2X9YA 3PP4L 2E9JA 1KTDB 4YK4B 1F3RB 3LDBC 1B6DA 3N85H 1WV7T 4DK3A 3GBNL 3SKUD 2XYCA 3LV3A 4OZFA 1WBYA 3MNWA 2J1KA 5ID0A 4F7TA 1MCWW 3B9KC 3X17A 3TBSA 2XPGB 1MRCH 4M3KB 3SDXA 3GDBA 1LE5B 4HIEB 1ZGLB 3PP3H 4O2FA 3SDDC 3U82B 1T1ZA 4Y4KB 4HFUL 1FAIL 5DZOA 1Q0YL 4ONFL 5DUML 2W0KA 5D7JA 2GI7A 4JVPA 3QO0B 4HKJB 5CD3A 3SDCC 3EYQD 3VH8B 4MAUL 1SMAA 3O11B 2NMSA 4N0FA 3ZE0E 1I7UA 4CVZA 1T0MA 2F58L 1T83A 3ET9F 4JHAL 4JRXA 1SYVB 2B1HH 3O6FB 5B3JE 3DMMA 1A7RH 1YUHA 3IAGC 4ZUTB 5IBUB 3W81A 3FOLB 3BKMH 3FQRB 1JRHL 1LEGB 3D85D 5A2LH 2WQ8A 4NO3A 3VXUB 4DKAA 1QHOA 5C0CB 1NCWL 4H1LH 1JNJA 1AI1L 1H5BB 3HA0A 1H3TA 2P8MA 4XXCA 3BGMB 3VXME 3QG7H 1FC2D 3CXDH 2GIYA 3D1MC 3HE6A 2J6EA 3FB8A 1GHFL 5D1QB 3SGEI 2W0LA 2J88L 1Z3GL 1OW0C 4JFXA 3RPIB 2CQVA 2JK5A 1U8KB 1I9IL 4JO2H 4PTTB 5EUOA 4F57H 3E1F1 5C2BH 2XOTA 4BJLA 3QJHA 3ARED 5JOPD 1JWMA 3IDIB 5EG6C 2VDNH 4D0BB 1QRNE 4M1DH 1N5YL 1WEJH 4X8JA 5IK3A 2CDGA 1IAOB 2EIBA 2IBGA 3QXTA 4L9LC 4N8CL 3CZFA 3EOAB 4ZFOL 3VWKD 4M3JA 1IGTB 2J88H 5F1OB 2R9HC 4MYWB 4N1CA 3ZDZE 3TBWB 4Z8FH 1IEAA 1YNKH 4UINH 5D6CA 5D2NC 5BVPL 1BFVH 2NCMA 3JV6B 4P23C 1SJVA 3JWDH 1KYOK 3O3EB 4X98B 3P4OA 1OAQL 4JR9L 2O61B 1HDMB 4UTBH 1UFUA 1Y18B 1Q94B 4WU7A 1JFQL 3OF6D 4HJGA 2MCPL 3HNSL 3VE0A 4OLYH 1GGYA 5F1SA 4NRZA 4WFFE 4B50A 4U7KA 3EDDA 5AUMA 4BQBA 4QRSA 1FO0H 4OKDA 5E9DD 2BHZA 2DDQH 2P42B 2PTTB 1N6UA 3TH2T 4M48L 4OIBA 1S78D 1QACA 4Q6IB 4QTHA 5FCUL 1D9KD 1A7PH 4HWZA 1VERA 1D9KA 1MCSA 3MNZB 1X5ZA 3AM8A 5IFHL 2C3GA 3QIBA 1KCUL 5LG1A 2B5IB 4AMKH 4W4NA 4JAMA 4MJIB 3FB5B 1GSMA 3BHBA 4JQVA 4LSUL 4RZCA 1YA5A 5EOTA 5EDXA 4ELKA 4OLVL 1JF5A 1BQHA 1JYXA 4LOUC 5EA0H 1MCFA 3G9VA 2AERT 1W0VA 3QQ3B 3QHFL 1MEXH 3VFSB 5EA0L 4M7ZC 5E03A 4UTAH 4XCNA 1KEGL 1UWEH 3FRUA 2XICA 3V5DB 2V9RA 2G2RB 5AZ2H 3OKNA 1ROWA 3QDMD 2DL9A 1A4KA 3O0RH 1ADQA 4PFEA 5CSGA 1UH4A 4S0SD 4CVXB 3GMMA 2BSTB 3WLBA 5I18L 4O02L 2MKWA 2APXA 4BK5A 4QRPB 1B0RB 5BVJA 1CI5A 2WIIB 3ECBB 3L3KA 2GJ6E 2A6IB 4M48H 1DQQA 3OAYH 5IFAL 4PPTA 2JF1A 4JKKA 1HHIA 3RDTA 1JTTA 5IMMB 1A4JB 1AGDA 1KJVA 3KWWA 4XMKL 4HHAA 2A74A 2VDML 2YEZA 1NDMA 4WWKD 2IF7A 1IQDA 2P5WD 2UZIL 2DQIL 2VLLB 1PKQE 5TF1H 3V0AC 3UBXI 3GMOA 5C09D 4ELMA 2VR9A 1WCBB 1KLUB 4JFQB 4JR9H 1II4E 1AC6A 1EERB 3LB6D 2BNRB 5DUBB 5CINL 5HBBA 1E6OH 5ACZB 2VO5A 3ZKXB 3JTSB 1H3UA 1X6LA 2OR9L 4WWID 3QDHA 3U30C 1BD2A 4NQDA 1HSAB 3UCRA 1MH5A 1M7DA 3K74B 3WD5H 1D5BA 1ZVYA 2YXFA 1HIML 4YX2H 3WFCH 4C54A 4FFYL 1CGXA 2Y5EA 3ZKMD 5C2BL 2BOBA 4OD3H 3CDCA 4X0KA 1BQUA 4XGZB 5D5MB 3VXNB 1EHNA 2LV4A 4X99A 2QQLL 4DQOL 5D2LF 3PF2A 2UY6A 4LBEB 5DD1L 4NM8H 1A7OH 1GIGH 4Y2DC 3DYOA 3LRHA 3LAFA 4MQXD 5H2BA 4TRPL 3IFNL 4YE4L 2HFGL 5CZXC 2DLFL 4OJFL 3X14A 5A2JH 5MENB 4JFXB 2FX8H 2EZ0D 4LHUB 4FRWA 3HG1D 4Q6IA 4YHIA 5BXFA 3REVB 2NY1C 1H3WM 2FECL 4UILH 3QDGB 4JN2A 4YDLB 1KB9K 1UB5A 3SGEH 1CFSA 1K85A 1UJ3A 4E42B 4AL8H 1G7MB 4JO4L 4N0YH 4CW1A 4NRXA 3QWOA 1NBYB 3DUSB 5ISZD 4FQIL 4AIOA 3S8WA 5HVHC 5IMKA 3JTSA 4K8RC 1U58B 1I1AD 1PQZB 5C0IB 1DR9A 1CE6B 5ILTH 1QFWL 3VFUB 4EOWH 1CL7H 1MFNA 2WWKO 5JQ6H 4PJBE 4BQ6A 3C5ZB 3BP6B 1XF4B 3FMGH 3ARBC 1S7XB 1NAMB 4RFNB 3WV0A 3G5VA 4P2OB 5EPMB 5JW4M 2EYRA 1FFNB 5DUMH 3MODH 3CFCH 1VEPA 4KTYA 1T1YA 2UWEA 2IADA 4RAVA 1MCHA 3EYSL 1HSBB 3QIUB 2DLFH 5HI4C 4U7MA 1U8IB 3RJQB 1F90L 4WFHD 4P3CL 4CL7A 1GIGL 3HI1B 4NNYA 2CMRL 4OAWA 5HYSG 5FYJH 4L3CB 4O5LH 4OCNC 1MCCA 3SGDI 4XNMA 1S3KH 4ZAKB 2W92A 4JZNA 3RWDA 4LF3A 4MD4B 2R69H 5INDB 3IRZA 5D1XA 4PJAB 3NFPB 4X9IA 4X6CB 4CMHC 5ESQB 4P57A 4PY8I 2PO6B 3DYMA 4FOMA 1KFAH 4JZJB 5D96C 5DUPH 3TBYB 3P2TA 4V2CB 1R3KA 1QLFB 3L3OA 4Y4HB 3JWNC 1UWGL 1NMCC 2F9BT 5CJOL 2NPLX 3MGOB 1CT8A 4HEPG 4NWTH 5IP4A 2OI9C 2FO1A 5CZVL 3REWB 4MQXC 5E6IA 1ITCA 2DQUH 1W0WA 1JGEA 1U6AL 1OVZA 5E2WH 5GJSH 1CFTA 2P46B 4LARL 4Z7WE 1SYVA 2IANE 1NBVH 2A83B 4H25B 2BRRH 4NZUH 3DROB 3M1BB 3AC0A 4U6YA 4DWHA 4JRYB 3ARZA 5D96B 1GGBL 3BP4A 3OKKB 3ARDD 2UUDK 4LLUA 4ZSOA 2R23A 1F8TH 4KJQC 5CD5D 3QNXB 2GJ6B 1TVHB 5F9DC 3H42L 2F54A 4WGVB 4F33A 3QBTB 1MCOH 4YO0B 5CEXB 1TLKA 1F3DH 3QHZL 3VE0B 1QSVA 3TCLB 4K3GA 1UM5L 2K9UA 5HTSA 4KRLB 3I02A 4G6AD 5FYKH 3VRIB 3RIAF 3HC0B 2X4RA 1Y0LB 3U2SA 4JFFB 1R0AL 2FJHB 4LVHB 5BJTA 3CH1A 3VG9C 3WIHL 4Z7WF 1OT1A 2LU7A 3CLEH 3HE7B 3C6LA 3HUJE 1MCRA 5IOPA 2OQJB 3DSNA 5C0DA 4YR6B 5DQ9A 5E8EB 4ISVB 1NCBL 2ZCKH 4Y7MA 5CAYB 3WE6B 2PXYC 4YDVB 3VD7A 4P5MA 3RU8H 3TC9A 3LN4B 2F5BH 1A7BA 1UEMA 1J0JA 3UXFA 3TBVA 4AMKL 4CUCA 3P4MB 1YMMB 3KJ6L 4O2CA 2R15A 4PJAF 4JPKH 3IJHB 4JB9L 2NY5H 1AR1C 2V7HA 4OV6F 3S7GA 4U0RB 5EC2B 5DK0B 5I66A 4UU9A 1CGSH 2ERJB 1VENA 2RFXA 3NN8B 3S5LB 2V9TA 5DJXB 4KZEL 3OG6B 4R0LC 5DVNA 1PX4A 3TZVC 4U6TA 1MRFH 3OKYA 1B90A 2PO6C 3GSXA 1UXSB 4P2QA 3MOBL 3SBWC 3WS3A 5GRVK 4RDQF 4ZUSA 3C60A 1OAXH 1NAMA 3PV6B 5DJ6B 3IDYB 3VXRD 4MNQD 2JTDA 1RK1B 3NH7H 3ULVE 1FCCA 3JWDL 1IC4L 3ARQA 3O3BB 4OT1H 1YECH 4P2CG 1UEYA 1F97A 2UWEF 4GKZB 4ZTOH 3BYYA 4FNLL 4NZUL 2VKXA 5CD5C 5FECA 4NNXB 5DFVC 3CGTA 1A1NA 1MFEL 2M8XA 1ZV5A 5E8PA 1CD1B 3O6KH 4WW2C 1HHHA 5DQDL 3S34L 2EDBA 3QHTC 1U8PB 4KK9C 2UYLA 1J1PH 2GITB 2P47B 3EFDH 1B0GA 3VDCA 1Q72H 1MAKA 1I9IH 1TETH 4JO2L 2VIRB 4NWTL 4NHCH 5MEPB 1CIUA 3VI3E 4OZIE 4ETQB 4G6KL 3NABL 5DJ8B 1G0XA 3W39B 1B6UA 1ZHBA 5LWYL 4XP6H 3I50H 5IM7B 4P9MH 3BVNA 3RAJL 5F9WB 1MFAH 5SV4A 4YHZH 1CE1H 3RTQB 1UH2A 3FFCD 4LOUD 4HBQA 4NQXB 4APQB 4Z9KB 1YY8A 5TFSH 1IE5A 1NFIA 3GJFH 2Q86A 4KKLD 1F6AA 4XP5H 3A6BL 2R2BA 2GITA 4FFVD 3NACH 4OZHE 4I9WD 3PGFL 3QT2A 4A2LA 1UA6L 4JCLA 3P0YL 1M4KA 2B1HL 1IGMH 2VLKB 1DL7H 2DMCA 3FFDB 5A40E 3ARGC 1X5LA 2ZUTA 1ZKAA 3INUH 1MQ8A 2ZOLB 3MODL 3ULUE 3QG6A 3RVWD 4Y4KD 1EMTH 2APFA 3PGCA 4G9FB 3EHBC 5J6GB 1KJ2B 1GAFH 4XPAH 1XEDA 2QKIB 5SX5K 3MCLL 1QRND 3F7YB 2YEZB 2J4WH 2ZUXA 4AG4H 4XBEH 1SBSH 1B2WH 3C6SB 3U9UA 1B4JL 3D0LA 3DPBA 4LKXA 2F74A 4LLVA 1IAOA 4P9ML 4RSVA 5I1LB 2JCCA 4ZUUA 3WJLC 2EH8H 3HRZB 3ARYA 4JFZL 4G42A 3V6ZA 3VA2C 5KSAA 4HDIA 3GI9L 4PUBL 2WK2A 1CLZL 5TDPB 5J3HC 4U1GB 4B41A 4LHUD 4H1LA 3VCLA 5DD1H 3IAPA 3WS6A 4ZUUB 3O6KL 4MAYC 2X4SA 5T3ZL 3MLWH 2NY5C 1G7JB 4PS4H 3ZYOA 5E2TH 3FQNB 1LDPL 3GUTB 1P4IL 3CVHH 4WGWB 3U9UB 1AKJB 4KROC 3MRNB 4NNPH 3O6FD 1KEMH 3VXUA 2DWDB 3BN9D 2IANA 4ZFOA 1F58H 4JANA 2HTLC 1KENL 1PQZA 4XWGH 3TNNB 1MIMH 4OGXL 4AY0A 4BFGA 2XN9E 3QUZD 1NEUA 2IC2A 1WFTA 1I3GH 3QUKA 3TH4T 3A6OA 1I9JL 1N7ML 4Y2DD 5E2UH 3QH3B 4RMVA 3GMQB 1FG2B 2DYPA 4IMLA 5KSUB 1FJ1A 4LVOC 1GGIH 1GGUA 4N9GB 3DUUB 4K7FB 3BEVA 4F7PA 4LL9A 4C57C 4I13B 5C3TA 2FL5B 2EDEA 3DVNA 1R3IH 4GAYB 5HGAB 3GK8L 1D5XA 4WIQA 3UTTE 3WIFA 1XF1A 1CCZA 5C6WH 2D7NA 4UI2A 3RU8L 3MC0A 5F7YC 1EIBA 5HD8D 5I18H 4XC1H 2GSIB 2YBRB 3PWJB 3PWNB 1C1EL 4ZDHA 3RTQC 3BKCH 1EJOH 4L3ED 1YN6B 3PG2A 1L7TH 3LOWA 2E27H 4OZGF 3RKDD 1YEDA 25C8L 4NQSB 1R0AH 1KEGH 1T6VN 1MEXL 3UDWC 2FR4A 1EJOL 2JB5H 4GRLB 4RMSA 2PYEE 3KPRE 2E7LC 1RUMH 2F19L 1I8KA 3OGCB 1AD0A 3SDDA 1FNEA 1XH3B 2R1YA 4L4VA 4HF5H 4U3CA 3CUPA 1HYSD 2GQHA 1TZIA 3QUMA 4LLVB 5DJYB 3Q1SL 2VN4A 4FQPA 3GMPB 4BFBD 3S36L 5I74B 3ESVF 4OCYL 5FUOL 1A7PL 1ZK9A 4TNVK 4KV5E 2I25N 4QRPD 3T2NH 3T09A 4MLIA 2HJKB 2E3VA 3UROR 4XAWH 1HNFA 2Z91A 3DRTA 3Q3GA 4POUB 3QUZC 4LGRB 4XB8A 4UOJA 2GY5A 1JWUA 2C1OA 3OGCA 5E8NB 2R29H 3SDDB 4Z78B 3L1OH 3KDMA 4HPOL 4L29A 4UTBL 1A4KB 4UBDD 4AM0A 2AGJL 2Z31D 2FECI 1T0NB 2ZG3A 3MO1A 4Z6AT 1KENH 1XFPA 3LHPL 5EIIA 5BRZB 2ERJC 2GUOB 4FZ8H 4G8IB 3WUZA 5IROA 2VLMD 2HTKC 4YDVA 4RMWA 5DMGC 3X3FH 1U9KA 1CDJA 3BP5B 3MRRB 2C1PB 3IDMA 2D0HA 4QHKI 1EEYB 1P4IH 2HJFB 3TT1L 2A73A 2A6JA 2YPLE 3QQ4B 2EYSB 4NQVB 4HCRH 4V1DD 3TVMD 1G9MH 1BPVA 4JN1H 4IRSC 2F53E 5FYJL 2EIZA 1OSPH 2AJUH 2RGSA 3V5HA 2OMNA 2EYTB 3FT2A 2BXYA 1OOAA 1K5NB 3HI1A 5C0EB 2ZUUA 2RB8A 3KPMB 3MRJB 3FT4A 1BVKB 3HR5A 3BD4A 3GBLA 5LJYH 4RISH 3BEVB 3E2HB 2IADB 4RAVB 2A1WL 1CGTA 3HE7C 3ZT7A 3KLDA 4DKFH 4Y89A 1M1SA 5JDJA 3O6ML 1CD1A 1RPQA 3EYFB 1I7TB 2DRUA 1UB6B 1NLDH 2YWZA 3STBA 1N4XL 2AV7B 1U91A 1UCBH 3HTLX 4QY8A 1IM3A 5I1AB 3SDAD 1RZJL 4OUUA 2J4WL 2V17L 3C5SA 1RUKL 3ILPB 5CILH 4A6YB 2Z0BA 3DRQA 1T1WA 4ZSOE 1AR1D 1QBAA 1T5XB 5C07E 1RZJH 1QOKA 1JGEB 4YPGA 3H8NA 4KVNH 4YHLH 4E5XB 1Q9LB 1KGCD 2AJXL 4X4YB 4PJCB 4KUCD 3V5KB 3CFJB 2CLRB 2A9MH 2BZDA 5A1AA 4PV8B 3ES6B 5HYJB 1UKQA 5JLZB 1AGFA 4I1NB 5LGKA 1JIBA 3NZHL 2Z8RA 2ITCB 1UYWH 4MJ5B 4ONFH 3PJSB 2CK2A 1KPUB 4U3XA 4BYHA 5C0JA 3A6BH 3D0VB 1NGXA 4P4KB 3HZYB 5DYOA 3NCYP 1JCKA 1B0RA 4P5TC 4RRPG 5GRUH 3RPIA 5BVJB 1PZUB 4P46C 1TCMA 4OFIA 1X4YA 1MRCL 4LPCA 5C0BE 4FFYH 2BDNL 3CNKA 1NGWA 1GOHA 5C0AB 2GUOA 1P5VA 1E4XH 1BQHG 1D6EA 1M7DB 4PREA 3MMEB 1YYLL 4NOFA 3TA3B 4JFOA 3X3FL 1QPPA 2YC1B 2XV6B 2YPKA 4YZFF 3UZVB 5B4MD 3E6HA 3FAXA 3VRJA 4OM0L 1XCQB 4MD5B 4YWGL 3GRWH 3CK0L 5L88L 2XTJC 4GFTB 5E4EB 1N3NA 4X6DA 4AENA 5DJ2A 1SYSB 2X40A 1XR8B 5J56B 5KSBB 2NTFA 1QSEA 1AJ7H 5HI5C 1JHKL 2KKQA 3AB0B 4GQ9L 4JM2F 3TYFB 2NY0D 3IKKA 4QWWC 5IB5A 4MJ2A 4OF7A 2YUXA 1CE6A 5EFIB 4NM4L 2F15A 2AJZB 4JDZB 4KKLC 3DTXB 4JQVC 4L8DA 2ITDA 2IWGA 1M05B 3G9AB 1X5KA 1AJ7L 4ODTH 1ZVSB 2XNAB 3R8BB 1U3JA 3JWOL 4UNVA 1JYWA 1YC8A 4O02H 3UTOA 1F5WA 1W72A 2BP3A 4BZ2L 5D6DA 5HYIA 3WNLA 1R5IB 1RJYB 3TJHC 3SGJC 3BMVA 2VZVA 4QNPF 1TPXC 2FYYA 1UZ6F 5I6XB 1TQCC 2J3SA 1DDHB 4YDJB 1HINL 4PJCF 3GM0A 1YYLH 4TTGA 4PRBA 4BKLB 4POYA 3MA9H 1FZOB 1W0VB 4RGMC 3CFDA 3F5WB 1BFSA 5DHXB 15C8L 3HLAB 1X5GA 1OLZA 5GRUL 1BFOB 4WV1C 1MHCA 4JAMB 4JFHE 4MJIA 3IDIA 5F70A 3VXSB 1C1EH 4L4TB 2JJUA 2L7JA 4OFVA 2VE6B 4R90L 1MWAL 1U8KA 2Y06H 3IFLH 4ODUB 1HCFX 5FCUH 1U42A 2WNGA 5CEYB 3MRCA 1KJMA 4U31A 4GMTL 2AJXH 4YHLL 1OTSC 4D9RE 4P46A 1BVLB 1F2QA 3LS5L 1UJTA 4FA8A 4YXHH 3U4EB 5D6DC 2X4OB 1JPGA 2NYYC 4OLUL 1FVCA 3L3DA 4U1KB 5LXGH 2D7MA 5T1KD 3OF6A 4WV1B 3RWEB 4CMMB 3JUYA 2X9XA 4I18A 3U4AA 5DJAB 1NFDA 3EYOA 3WNKA 3QUXB 1A1OB 3TO4B 5E1AA 1CDCA 3CSGA 43CAB 1J9CT 4Z8FL 3G6DH 4TULL 3SE9L 3MV7D 3MUY1 3VGEA 1WBXB 5L2KE 4N8CH 1QUNA 1RFDH 1DVFC 5T33L 5F9JA 2B1AH 2R1WA 1YPZB 1AHWC 1DEDA 4WW1A 4XPHL 2X70A 5AWNL 1J1OL 1KJMB 1NAMH 3TESA 1YJDH 5EOQH 5TGBA 1QHPA 2VMFA 3L95A 1E4WL 4QOKB 4HCRL 4PS4L 4PJCE 4F80A 3EOBB 5CEZD 2FSEB 3VW3L 3OAZK 1RZ7H 2AEIT 4EDWH 9CGTA 1CFBA 3U9PH 2QHLA 2H32A 4Z7QF 3KPPA 2C1PA 3STZB 4LAJH 5C0GA 4HBCH 1MFDH 2OYPA 3P9WB 35C8H 2EH8L 3HB3D 1A8JH 3GKWH 4G80B 3X12B 1YY9C 3EDKA 1JRHH 3VD4A 3MXWL 1J0HA 3QI9A 1HEZB 3KPSD 3SEPA 3KYOB 3D3VA 4Y0GA 4P3CH 1HILB 3G6JA 4XAWL 4ZFGH 2VTFA 5F9JB 3FFCB 4NRZB 4ZQKB 4C56D 1WIOA 2QHRL 3L3JA 1CLOH 5ISZE 4XPAL 2JIXB 3TH3T 3BWAB 4MNGB 2OL3B 3IB4A 3S36H 3P4OB 4JFEE 5A16A 1MJ8L 4NCC2 1CL7L 1NDGA 1NFKA 2VDRH 2BSSB 4JHBA 1DL7L 1NDMB 2HYMA 4HH8A 1T0PB 1XGTA 3SJVE 3OAUH 1TPXB 1E27A 5C0GB 3NACL 2YUWA 1K2DA 3X3GL 1LQSR 4IMKC 3OKLA 4KQ3L 3BPLC 1I3RB 3SE4A 3RIFF 2P5EB 4OI9A 3CUPB 1H0DA 2ICWB 3H0TA 1XH3A 4LEXH 4WI7A 1WTLA 2RFXB 1H8SA 3DVGB 2NXZD 4MAYB 4OZIB 4ENEC 1BBJA 2R1XB 2OBGA 1I1CA 4UV7L 1QBLH 3ALWA 2EDXA 3PJSA 5C0JB 5I17B 5EUOF 4HFWB 1GXEA 3R8QA 4UQ3A 4ZOEA 2MJWA 1RIUH 3EDFA 2QQLH 4KI5E 4DQOH 4G9DA 4HGMA 1GZQA 4DFHA 2PR4H 4KRMB 4NSKA 3U36A 2AVGA 3MUGB 2FLBT 2IFFL 3DX7A 4OZ4B 3TLRA 3O6LH 1L0XA 5FUCE 4EI6A 2HA1A 4K8RD 1IKNA 3VJ6A 5MERA 1YEIH 3QCUH 1XR9B 3WD5L 5B3JF 5CP3H 3VXMD 3NA4A 1VADB 3VXMA 3N06B 1NCDL 1Y0LA 5HI4D 3V0VB 5JR1L 1JZ3A 1I9JH 1N7MH 5D2NA 1GOGA 4HGWA 2Q1EA 2DIJA 3GSUB 1CICD 4F37K 2XACC 5HHQB 2VQTA 3VRLF 1BJ1H 4JY6B 4QRSB 1BVLA 5TH2B 4KI5F 5DD5H 4L4JA 3OTTA 3WS6C 1TDQA 5B8CA 1EJ6A 3ARXA 2R0LH 3KPMA 4PLKD 2HH0H 2PYED 3KPRD 4GJTB 2Q8BL 1NL0H 4J3XA 1TXKA 3DO7B 5C08A 2G5BB 5IW6A 4Q9RL 2CH8A 4PR5A 5J1AA 3V6OA 2OK0L 1KULA 3Q6GL 4KDVA 1RQ5A 4Q7DA 4KMTL 3UPAA 4DOHE 3GJFA 5DQ9B 4JPKL 1EO8L 4MA7L 5C0NC 5BOZG 1RIHL 4HH9A 1LK3L 3KYNA 2CIKA 3I3BA 3BISA 3OXSA 5DT1L 1BJ1J 1CLYH 1KOAA 3U0TB 1G7LA 5EU3A 3MO1B 2FJHA 4JFYB 1OP9A 1JZ5A 2IMMA 3LPWA 2NZ9C 3QQ4A 4NQVA 4HS8H 1HHKB 2NZIA 5TDNB 3CLEL 5DA0B 1AH1A 4U33A 3MRBA 3TO2B 1T83C 5GRXG 5D7IA 2N56A 1IEBA 2IQAB 3OKLB 2ZUQB 2I9TB 1U8NA 5D70H 3MJ8B 3CDYA 2W9DH 1LO3H 1UM5H 4DCQB 5DO2D 3E3QE 3NOIA 3DTXA 3NA9H 3QQ9D 4L1HA 4WY7L 5IFHH 4P49A 3UO1H 3HI6H 2OP4L 5HD8C 2XG5A 4Z78A 2QHRH 4NGHL 3S96B 1BOYA 1XR9A 4NPYA 4L8SC 4Z7UE 4OZGE 2IQAA 4E41A 1LP9A 2BXZA 5ID1B 3BKJH 1BIHA 4QRPA 4Y16C 3P73B 1QTYT 3MXWH 3QIUD 2WW8A 1OSZB 3HNSH 4HIXH 3SKMB 3QDME 4UV4L 5D1QD 3EO0A 3MCG1 4GAJL 5IMKB 4LVNB 5C6PB 1X7QA 5E2WL 1KT2B 5GJSL 3TA3A 3O8XA 1VFBA 1Y6KR 5JO5A 4DCQA 4MNGE 2E5EA 3QEHA 2BVOB 2PTVA 3O2VL 3WIHA 1QZ1A 1LE5A 1ZTXH 2XIDA 3QDGA 5D7LE 2CJUH 5EUKB 3PGDA 1FZMA 1JPFB 1WCQA 3RX5A 4LF3B 5DI8B 1BVKA 3VFWA 3MV8D 3O2VH 4JKWA 5BRZD 3QO1A 4FTVA 2B7DT 4GBXB 1BBDL 2SEBA 3HG1A 5JTWA 5KS9B 5J6HB 4PRIA 5MHSE 4PP1D 3H7BB 5KG9A 2R39A 2A6JB 2V2XA 2VIRA 4WHTB 1ZLWK 4PJFF 4GAFB 1PG7W 4XCEA 3V4PL 4F9PC 3EIFA 4ODWB 3G5VB 1KXQE 3BKJL 2HT3D 3IDGA 4Y16A 5FYJU 1I7ZB 3CFEA 2EDOA 2AJYL 5J1AB 3I6KA 3WFDL 3GSUA 2O5YH 5DFVD 3K3QA 4EQ3A 4H0IA 4WCYL 2OP4H 4ODSL 5D8JH 3CXHJ 1Q94A 1BD2B 5KAQF 3AS3A 5F89B 1VDGA 2RR3A 4IDJL 4K3JL 2ICWJ 1L9MA 3L5XH 3IDXL 4R7NB 1MUJA 1U95B 2YD7A 1UB6A 3BKML 1QFWH 5ILTL 3EYFA 4YPJA 3O41B 1N0LA 2QADC 5C0FA 1AD9A 1UWXK 5CBAB 1YEKH 1DQLH 1ZWIA 4YHNB 4F3FB 3MLVH 2Y06L 3IFLL 4G7VH 4RFEB 4JY4B 1Q9WA 5E7BA 3ISWA 3HE7D 2I9LB 4QOKD 2CUIA 1QFUH 4U3HA 1FAIH 2GW5A 4M43L 4OI8A 2WWMD 4HUKB 2CDEB 3PABA 3W2DH 1N0XL 2FX8L 2APBA 4FQLH 5FGRA 2FBJH 4TOYL 1WT5A 4AEIH 1J0IA 3QUYA 4Q74A 1QA9A 1HH9A 1YPZF 3P30H 1KNOB 5L7XL 1RJLB 4CNIB 3OKNB 5ESAA 4DAGH 3CXHK 1V5JA 1CXIA 1H3VA 3RVWC 2B5IC 3K8MA 5D1XC 2KPNA 4I5BB 4N5ED 4KMLB 1LEGA 4ZS7L 2C1OB 5E8NA 3C60C 1BX2B 3ZKMC 4YDJA 1MQKL 3JWOH 1MCOL 4KUCF 5L0QB 2IAMC 4H20H 4HWBH 3CSYA 3WO4B 1VKXB 1FVCB 3L3DB 4JPVL 5I1JH 4RFNC 5IHBA 3MLYL 3VXRB 1G7HB 1IQDB 4UZGA 1OP3K 4NN5B 4NM4H 2Z93B 4P46B 4NN7B 4N0CD 2BSSA 2BJMH 4WWKA 4F7EB 1DBBL 2VUOA 4LLUB 4ZSOB 3U0PA 2QKIA 1CXEA 4NUGH 4Y4KA 1DBBH 4HC1L 4WUKH 5EBMB 1DQML 4Y1AB 3QEUB 4M7LH 2AABL 4GG8B 3MLYH 3JV0A 2PR4L 5JNYA 5B4MC 3T0VA 2ARWA 3DETC 5JIPA 1Q9OA 2R2BB 5GGVY 5I1CH 2QSTA 3RY6A 3X12A 4WFGD 1T80A 2W59A 3MJ7B 3TA3D 3GGWA 3RVTC 1RUPL 4ODXA 3QDMB 1G9NH 4QWWD 3HG1B 4YXKL 4EDXB 5SWSE 1CFNA 2R69L 2HN7A 1D6EB 1S3KL 5IVXE 2EXYD 3MYJB 2CMRH 1JUFA 1FIGH 2PTUA 5EC1B 4I0CC 3MPCA 4HUUA 5EBWA 3PQYE 1O7VA 5FCSH 5D7LB 3D39B 4LP4A 4QGTA 3SCMA 4QOKA 2FEDD 5J89A 1K6QH 2RIKA 1I1AB 1HI6A 2H26A 3RZCC 2CR6A 1M7IB 3LKQB 4N5EC 4TQEH 5K9KB 4F7CB 5HHQA 1HNGA 1R24A 5JHDE 1KTLA 1J05A 1JNLH 3ARWA 1T7YA 2EE2A 4UMGA 4BFIA 3RX7A 3MCKA 1N59A 3DV4B 2O61A 5H94B 4BSVA 1BGXH 3BD5A 3FQRA 2WLZA 1ZSDB 1QSFA 3LS4L 4H26B 3SGKC 4ZUTA 3ARUA 3MLZH 5D7JD 3O6MH 1ZAGA 3GJEB 3NBNA 5E08H 3LQZA 4Y88A 3TT3H 4WCYH 2IH1B 3MMEA 3TNMA 2EDFA 4PJ7E 3GMNA 5KSAC 4YJZL 4U0RC 3W0WA 3FHAA 1EK3A 3QIWC 4OJFH 4PJ8D 3VGFA 4PJIB 4XVSL 3BDXA 4XVTH 5I66B 4DFIA 2CRMA 2VDKL 1E4WH 4XX1G 4HSQA 1TNMA 4X6EB 1EGJL 5EOQL 4NUJA 4R2GB 4MA1C 5HGBB 3VFTA 2FH6A 4FZ8L 4GW5A 2JCCB 4K55A 4LLAA 1BQSA 2ED9A 1PG7L 3FKUS 1AKJD 4TSBH 3JZ7A 4KVCH 3WFEH 3QCTL 3VI3F 3AB0C 4JO1H 3SY0B 3G6DL 4YPGB 4WDIB 1UZ8A 1TJGL 5CJXC 4RAUB 2R29L 1TVBB 1A14L 3C8DA 3TM6A 5FXCH 4OKVB 5EO0B 1S9XA 4NN6C 1IJ9A 3JSSA 4M5YH 2YHGA 1RD6A 4JLRA 3M1BA 2FJFA 2HJLB 2H32H 1AP2B 4YHPA 2ZPKH 3CFEB 5CJQH 2P5WE 4F15C 1XGRA 3RIFK 5EU5A 1A7RL 3GIZH 4P9HL 2EDKA 5EO0A 1FVEB 4GMTH 4PJ8B 3S35X 4NQCE 5E6IC 1T5WB 3W11C 2X7LB 3BT2L 4PGCB 3PXHA 3UO1L 3SGJA 4RWHA 2NY4C 2HTKD 1A6VH 2FO4B 4WY7H 4X5WA 1RUML 1Z6JT 3T08A 1Q0YH 1R3KB 5DO2C 2A6IA 5D70L 1LGVA 5BW7C 1MWAA 3O0RL 4WNQA 4TUKL 4HX1B 2C3WA 1CFQA 4FMFA 3MUGA 5DJ2B 3QIUC 4KTEL 5GISL 3TWCL 4KKBC 2OJEB 4JZJC 3G04B 4L4TD 1BM3L 4J3WA 3QIWD 4PJ8C 1JRHI 2FGWL 5GSRA 3MV9A 3O45A 1QEWB 1SJEB 1ZT7A 2FLRT 4J6RL 3AM8C 1M6OA 2EE3A 5BRZA 5C07A 5CGTA 4OTXL 3FRUB 5SV3A 4WEUD 3TBYA 1INEH 4WW1B 1U3HD 4PJHE 3QWQB 4NIKB 1H3PL 1OARH 3O4LE 3ALXA 2VDQH 5KVMC 1SEQH 4WI4A 3L6FA 4KK9D 2C3VB 1JWUB 4MXVF 2VAJA 3GBML 1T21B 1RVFL 3HG1E 4F7MA 1C08A 2LU3A 2DM3A 4XCYB 4OV5B 5T1KB 1K3IA 1XF2B 1H5BC 1YEHL 4O58H 2DQEL 3S35L 3OR6A 1HXYB 1IM3B 4N9OB 1QFOA 5E8DH 1ES0A 2D7TH 2Q8AL 4AK1A 4QHMA 4QXTB 3MJ8A 1RZFL 4P5TB 3VMPA 1JHKH 1O0VA 3IF1A 4S1RH 2PYFB 3QULB 4OM0H 1BFVL 1HHKA 5IB1A 2QEJA 2X89A 2BVPA 5JDSB 4PBXA 4XTRD 4KH2A 4JFYA 3IS0X 4KKCD 3FB7A 1MAML 1U91B 5GRWA 3OZ9H 3QFDA 4P9HC 5D9SB 3RGVA 2IJ0C 3ZE1E 4PP2A 4E41E 3MBEA 3QXVA 3RUGF 2B0SL 3QPQD 2V5MA 2QADD 3IDGB 4D3CH 4KFZC 3FN9A 4Y5YB 3GI9H 4PUBH 4CRPA 4DEPB 1Q9KA 2VDLH 4U6HB 2OTUB 3A67L 1CDYA 1D7FA 3O2DL 4J3OC 2J2ZA 2R56L 2BFVH 4J23A 5D7IE 3WJJC 3OXRB 5I15H 2EIZB 1LEKA 4HT1H 4LLWB 4JREB 4U1SA 3RPKA 4HUNB 4Y5VB 5DI8A 3O8XD 1HHJB 2CIIA 4HAFA 3MRPA 1J12A 4MGXA 4JFDE 5DRWA 4YBLB 3ARGA 3RHWK 1JV5A 4RX4D 1AI1H 3QI9C 4LGSB 2I5YH 2VQ1B 2A6KB 3NVQA 5ANME 3ZE0F 2ARJA 1WCBA 2X4NA 2ZJSL 4LU5L 1IQWH 3MZTA 1NUDA 5FGBA 3WCYA 3FQWB 1ERNA 3VFVA 1CYGA 5F7UA 4MA3A 1HXMA 4HS6B 3QPXH 3DI2B 2Y07L 3O2WL 4WWKB 1Z0NA 4TSAL 1TMCB 1J8KA 1CLCA 3HZVA 3I9GL 2X1OA 5SWSB 5IJKA 3GO1L 5EFIA 1AGDB 5DRNA 1WZMA 4OLXH 4H25A 1BZQK 3HAEA 2BCKB 3RBSA 1CZ8L 4LKCB 2NY3D 3V0WH 1S7XA 4MQTB 3FN0L 4ELMB 5I8OL 4G7YL