3I2CH

Crystal structure of anti-il-23 antibody cnto4088
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVQLVQSGGGLVQPKGSLKLSCAASGFNFNTYAMHWVRQAPGKGLEWIGRIRSKSHNYATDYADPVKDRFTISRDDSQGLLYLLMNNLKTEDTAMYYCMREGIYGSFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CNTO4088 LIGHT CHAIN
publication title Noncanonical conformation of CDR L1 in the anti-IL-23 antibody CNTO4088.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH01
4LU5H 1CR9L 1L7TL 3A67H 1F58L 2P4AB 4YDJB 4P2YA 5F8QC 1MELA 4LLMA 3S97C 4M7LT 3WFCH 1IEAB 4FNLL 2WUCL 4XPHH 4F80A 1DEEB 3SDAB 5E0QA 4F37F 1YN6B 5AAWA 1IGTB 2CLRB 2ADGB 4JRYA 4QRUA 1EZVX 1BX2B 3GGWA 1WAAA 4HG4J 5CINH 2DOCA 1DZBA 1QLEL 4QOKA 3WIHH 5ICYA 3BP6A 3EGSA 1LDPH 4JFHD 4P2QD 1OP3K 3W0WE 4OF3A 4WWKA 4Y5VB 3CIQA 3RWDB 1IAIL 1Y6NR 4UU9A 2BVPA 4R26L 4XAKD 1UM4L 1BMGA 2XA8L 1WITA 3S36L 4FXKB 5KSBE 2QADB 4KDTC 4MHHG 1RK0B 4IOFC 3QXAA 1I3RA 3UJTH 1P84J 5IK3A 1MI5D 2C7UB 2AGJH 2XN9E 1U91A 4PJFB 4DQOL 1EMTL 4Z7VA 5FO9A 3BPCB 1KCRH 1B6UA 4X6CF 4MA3B 5JW3H 3U7WL 3V0VA 4DGVH 1MRDL 1FAIH 2D3VA 3NPZB 3F6LA 5I8KL 1CGVA 1A9BB 5FK9A 2OYPA 5FB8B 1KIRA 2DBJA 2DLFH 1VGEL 5E2VL 4IM8A 4UMGA 2A1WL 4S11A 3NZHH 4JFEA 4X80H 4K3DH 4WW1A 4DAGL 1FZOB 1P7QA 4BFIB 4K2UL 2HVKB 3EYSL 3UPRB 3IFLH 4WCYL 3RY6C 4HZLA 4EVNA 3O9WA 3RA7L 1G7MB 2WP3T 4KTEL 1AI1H 1HQ4B 2NY2B 5C07D 3T0VA 2W60A 4RGNE 4UOW1 2ZSVA 1IGFL 3CDGB 3PV6A 4XNUH 5L9DH 4MB5A 3GSUB 5C9KA 2R2HA 3ALPA 4OKVB 5I19L 3KPQA 3MCKB 1FVCB 1KNOB 2F8XC 4HS3B 5C0RH 2BK8A 5TFSL 1K6QH 4TTDC 1RJYA 3B8YA 1EAPB 3NTCL 1ORSB 1FFOA 2P8MA 3DTXA 4MQ7A 1CF8L 4PJ9D 3E3QE 1WZMA 5E56A 5E8NA 1RZKC 2VR4A 3QUXD 3BW9A 4JN1H 1QR4A 1U41A 5KS9A 4Z7UB 3FN0L 3OXRB 4MQSB 5K93A 4G8GA 5CSBA 2QQQA 1VHPA 3TIEA 3NFPB 2H2PC 5J11C 3ULUH 5J4MA 5L2KA 5J3HD 2EXWD 3QIBC 1U8MB 5HDBE 3PUCA 5IIEB 1IT9H 2Z8SA 3I6LD 2YPLE 4I3SH 2BNRA 4JG1L 4P4KA 4RISH 3VFRB 3PL6A 3NIDF 1T03H 1SHMA 2FDBP 2JCCB 4RSVA 5F9OL 3CAFA 1KLGB 3VCLB 4XTRD 4NYLB 2XXCB 2K7PA 3VI3F 2GFBA 1UWEL 1WICA 1FO0A 3P9LB 2VJXA 4PJAB 3SDCA 3BYTA 4P2OB 3RVTD 4B53A 4ONFH 2VMFA 1EPFA 4PJEF 5FKPB 3VE0A 3OQ3B 4Z9KB 4E42B 2NXYB 3AVEA 3P4MA 4YDKH 4U49A 1GZQA 5GS2D 3MLZH 3QXUA 4HCRL 2EE2A 5HI5D 5A3IC 3OR7B 1BZ9A 3IF1A 5AD0B 3WJJC 1CLZH 1GH7A 4I77L 4U33A 4E0RA 5BOPA 5JXEC 1UB5A 1MCRA 4YHYC 2PYED 1UM5H 4N5UA 2X7LB 1BOGB 1A22B 4EN3D 2FJGA 5CKGA 1PLGH 4JO4H 4U3CA 1F4YH 2Z93B 2F53D 4M5ZH 1PSKH 2VDLH 1QSEA 5CJ8A 3KPRB 5D1ZD 5D1XD 1T1WB 1ZA6B 4YGVB 1AGBA 4OF8A 1VENA 3T8XB 2FATH 4PIRF 4ETQB 4FTVA 3D25B 5E8EB 5INDB 1OB1A 3FAWA 5I16B 4K7FA 5CSZB 3MLVL 3O0RH 2NZIA 4FMKA 4IOIA 1LILA 2GTWA 1SYSB 4HPYL 5DLML 4FXLA 2QLVB 4ODXA 4ISVA 1YPZB 3QQ3B 2EE3A 1A9EA 4L8SB 4EI6B 4YHOH 5IMLA 5AWNL 1INQB 2CRIA 3QR2A 4GQPH 4KUCF 4YFLF 5DT1L 4EI5B 4JY4A 3QNYA 3BEWB 1MAML 1X5LA 4J3OC 4D0BB 5DHVA 1RZFL 3FN9A 3GIVA 4ELMB 1JWUB 4YXHL 2IMNA 1OPGH 4HX1A 2VN7A 5ACZA 4M7KL 5HHXL 2HRLA 2CUHA 2VDQL 3Q48A 4PJ5E 5K9QI 5D9SB 2IAMB 4U1IB 3UTTB 5FUOL 4BSWB 4NNXB 2Y07L 3IJYB 2B5IC 4PLJD 2DJSA 3BJLA 4FABL 4L4VA 3IDYC 4F7PA 1D5MA 4YPJA 5C0BB 4PG2A 3QUZB 3HAEA 2UUDH 1DQLH 4YXLL 3BKCL 3O8XB 3P4OB 2OJEB 5BQ7A 4JG0H 4JQIH 1N6QH 1PD6A 1A4KA 5DEZA 4KDVA 5DJDB 5E8OA 1ITCA 5E4IA 5F96H 5I6XC 2WNGA 2VL5B 3A67L 3E0GA 4HLJA 3TESA 5F7KC 3WS6C 5ESAA 5DUPL 3VXNA 4Q58C 1LO4H 3REVB 1A8JH 1MCCA 3PGCA 3VXRB 2VLLA 4WTZG 4JQVA 2QKIA 1OVZA 4XVUC 4Y19A 3QDGE 1ZE3C 3F7YB 5F89A 4AG4H 4WW2C 4NUGH 3ARZA 1R24A 1H0DB 4NZUH 3ZDYE 2EEDA 1S9VA 5C0AA 3IETB 5DQDH 3LKOA 1E4WL 3MGTA 3HLAB 4NJAH 4PJHB 5GGQH 1RI8A 1N5AA 3N85L 2HP4A 4M9OA 1IAII 5K9OB 2WWKT 5A16A 2BOBB 3N1MC 4KJPC 5HVHC 4K8RL 1FGVH 1BGXL 2YD4A 1EFXA 3GMRA 2AVGA 1RIUH 3GMPB 3R06B 5FM4A 1G7QB 4MS8C 2R2EA 3ULUF 1NAMH 2YSSB 3U9PL 4IHOA 2VXTL 1U93A 1SVZA 3OKEA 4K3DL 4LLVB 5MENA 2P8PA 2ZUQB 3HZKB 2X4PA 2HWZH 5SWZA 2JB6B 4Y16D 1AXSB 1F13A 1CICA 1OW0A 4ZUVA 5IV2B 5FHAL 4HUVA 3V4PL 5DGRA 4OLUL 3IDGA 2GT9A 4NNPH 5HDQL 3FRUA 2CMRH 5FM8A 4F7TB 1QEWA 1SJXA 5ITBL 2OL3H 2MHAB 3WKMH 3UROR 4OZGE 1YMMA 3ZT6A 4H20L 5J56B 3X3FL 3JBG7 2J12B 5EPMB 2GY7B 4CMHC 4Y1AA 2M8XA 1U0QA 3NN8A 3RVUD 5KSUA 1BFSA 4QXWA 1FDLL 4X4YA 3QI9C 4I8DA 3IJSB 3L3DB 4M7JL 5HHPB 4NKMA 1I85C 2Z31B 2Q86B 4KROD 1FJ1B 4L3EB 3F65A 3ULSB 3OV6A 3SJVB 2HTKC 2IG2L 1V7MH 5D5ME 2C3GA 1NKOA 1VFAA 3HZMA 5ISZB 2GY5A 4G7VH 4O51B 4AZ8A 5I30L 2FZ3A 5IMMA 1NBYB 2RFXB 3ARBA 4HF5H 4JFFD 5CMAB 3VXOA 1T03L 5CUSH 1K3ZA 4YXKL 1J1XL 3MNWB 5DJ0A 2O26U 1G7HA 5BW7A 1QACA 4TUOB 3G6JB 3VFWB 1I8IB 1KTLB 4POZD 4X9HA 2JTDA 2Q8AH 1MJJA 2OP4L 3V52L 1AP2B 5HHMD 3V6BR 5KSVB 1HOCA 1VSCA 4GBXD 2YS4A 4Y4KA 4XX1G 3RTQC 3HE6A 4LLUB 5K59E 5HYIA 3SGKA 4U1JB 4PYGA 1BFOA 3J8F7 4W4NA 2ZSWB 2CIIB 4JKPH 4OSUH 4RFNB 4KRPC 2VDOH 2AI0H 5DMJB 4YH6A 3B2UD 1VACB 1FNGB 5E24E 4NQEB 1NLDL 2CDEA 5F7WC 4X6DB 2Y5TA 4HIHA 4P2QB 4PTTA 4JO4L 3LZFL 5T33L 4MD5B 3SO5A 5JZ7D 3HE7D 3HNTL 3VRJA 4QHMB 4QCIB 4RMWA 4N0YH 3IVKA 3QCUH 1BFTA 4ZAKC 3AFLA 2C3VB 3P2TA 5HGGS 4KXZI 5IKCA 1MWAB 3L95B 4JHAL 4D0CB 2HMIC 3GSNA 2IALB 2FATL 5HGHB 3DRTB 2AK4B 1BF2A 3VGHA 1MFCL 1MI5B 5F9JB 2VERN 5FEBA 4FQQA 2F54A 3E6FB 2PCPA 3MRHA 3HHRB 4N90D 3S35H 3EYUH 5EA0H 3RX5A 3ETBF 4TNWK 2Z4QB 3PDDA 5GJTH 5ICZB 5J0BA 3RPKA 4WO4D 4RFEA 3ARWA 4QNPF 5HY9B 2GJ6E 4ELKB 3TBTA 2D9CA 4Z7WB 2NTFA 1PFCA 1ZWIB 4AM0A 4NN6C 4OM1L 5KVMC 1ZLVK 1IM9A 3LN4B 2IQAA 1NL0H 1NGWB 1H3GA 3CUPA 3FFCD 1DLHA 1NCAH 4LSTL 4MLSA 5C07B 3DUSA 5C0ND 1BBJA 3GI8L 4LKCA 4D9QE 3PABB 1N0LA 1LP9A 3GSXB 4P3DB 3ZKMD 3G04A 5DEFB 1DBBL 4G9DB 4K3GA 2UVEA 3PWLA 1CDIA 2D7QA 3G5ZB 3VD7A 4KMTH 5I73B 3P9MA 2I27N 5GSRA 5IMOA 2K9UA 5BRZD 3S5LG 3C60A 4PJ9B 3QUXB 1L6ZA 4PRPE 1AC6A 5IBLC 3V5KB 5L8LB 1DEEA 1SBSL 3DURB 2H26B 3SDAA 4XPGH 1WTLA 1YN6A 5DMKB 5LQBH 2X9XA 4HZAA 2CLRA 1SY6A 2GI7A 1HYSD 3DV4B 2EEAA 1GSMA 1ADQH 5KAQF 1ROWA 3OAZK 4PGEA 2DQTL 4BM7A 4BZ2H 1L7IL 3BN9D 2HJKB 2DD8L 1T3FB 3L3HB 1BEYH 4NQTA 4ZFGH 1G9NH 4N1HB 3HZVA 4GKSB 1A6VL 3NFSL 4GOSA 4ZOBA 1NFDF 1S3KL 1A7RH 2CXGA 1KTRL 3NMEA 3D0VB 1A14L 4KV5F 4NO2B 4FQXC 5FDWB 1KEML 4ODTL 3MXVH 1MRFL 2DKUA 2WBJD 1KACB 4FXKA 2VZUA 3N9GH 2YMXH 3G9VA 1B9ZA 1N5YH 2PR4L 1WZLA 4OCYH 5GJSH 4MA3A 4NJAL 4D3CH 3KLAB 1H5BB 5FB8A 1AXIB 3RGVD 3GZKA 4OQTA 3NABH 1IGCH 1PEWA 3VD4A 3DYPA 3M07A 2PYEB 5B4MD 1QRKA 1E6OL 1CLYL 4LCWA 1U3HC 4Z7QE 3HTLX 1LO3L 4M43H 3PWUB 3TN0A 2HVKA 4EN3B 4EZMA 5DI8A 1KCLA 4Y4FD 5IVXB 3THML 4LSQL 4Z7OE 3FO1B 5TDOA 4WU7B 1XCTB 4GMTH 1HQ4A 5K9QG 5D1ZB 1S7UB 5MERB 5CCKL 3CDGA 5D1XB 2VAAB 3B9KC 1DL7L 3OKDA 3BEVB 1BIIB 3ESVF 4HFWB 4M6NH 4F7EB 2AJSL 5EU7C 3QCVL 2OJZH 1FVCA 1RK1B 8CGTA 4NCDA 5CEZE 1MOEA 3ARSA 3VFNB 1ORSA 1MCJA 4NZRL 4WHYG 3BXNA 1CXEA 4AK1A 3U2SB 1J0JA 2VQUA 4YHMH 5A2FA 4JPKH 3O6KH 3MYJB 1CDGA 1MQ8A 4U1SB 1U8LB 4Z7UA 4XMPH 1M05B 1ZANH 5JIIA 5L2JB 2BRQA 2G75A 3U0WL 1JYWA 1SVCP 2JJUA 2OQJB 1U9KA 4I3RL 4HIJB 4BZYA 4RBPH 3VFRA 4G43B 2XWTB 5I76A 3GSWA 3GBLA 3S96B 1EBAA 1Q38A 3K1DA 3KPOB 1HZHL 1I8LA 4QRPE 3VCLA 4UAOB 1KPVB 1TLKA 3MRIB 1BZ7A 2FGWH 4HKZA 4P23C 1A0QH 1PVHA 2F5AL 1C08B 2NY4D 5E6IA 3U46A 3AAZB 3P9LA 5AZ2H 5KG9A 1AR2A 4PJAA 4PJ7F 5JHDE 1J88A 4KZEL 5IQ7L 2YWZA 1G0YR 5GGUA 4P5TC 3VXSE 1BM3L 5CUSL 4UV4H 5FKPA 4NNYB 1FNAA 3B2VL 5T1DL 3SQBA 1G9MC 5HHNB 4Q9QH 5LCVL 3VFSA 3BQUD 2ZUUA 3S4SA 4PY7A 5LKNA 1PZUB 3FQRB 3QH3B 5AZEL 5E5RB 5D6DA 3ORJA 2Q8AL 3QDAA 5AD0A 3BIBX 2RBLA 5HYFA 4RIRB 5H94B 3DIFA 5TDNA 4RWHA 4X6CE 4M6OL 3BRDA 3RWJB 1B6DA 3SDXB 2HFEA 4GJTB 4XPTH 4NM8H 2KQNA 5ALBH 4LHUG 4MXWL 2IBBA 5EO0B 1JPSH 3LH2H 1EERB 2AKRB 2BNQA 2KKQA 3BDYH 2BJML 1B2WH 1T7ZA 5HPMB 1OAYL 1FNLA 4YGVA 1NCBH 3ARDA 5IW6B 3WKNA 4HJ0D 3MA7B 2J3SA 4NFBA 3UTPE 4WI2A 4PREB 4XPAH 1CFNB 5I16A 3OZ9H 5CSZA 3ILQD 5I1DA 5I1KL 2EIBA 2VRAA 4N68A 1SYSA 3G5YB 1G6RA 3F5WB 4YPGB 3T1WA 3OGOE 1TMCB 1N59A 4UIMB 4L8SA 4EI6A 1QFWH 1N64H 1MCOH 2XQBH 2UYLB 2WUBH 4NSKB 4A6YL 4AJ0A 1W0WB 3OPZL 2FEDD 3BEWA 3S35L 2HJFA 5ECJE 1ZKAA 2XI9A 1QPXA 1IEBB 4R7NA 4TOYH 5FYKL 3GJFK 1JWUA 1WFUA 4OM0L 4TRPH 1B0GA 2CDFB 2BDNH 5CFHA 5E2UL 1QBBA 1WIPA 2FB4L 4OCXL 5D9SA 5F1NA 1F8TH 4IIQA 4U1IA 4XP6H 3SKNA 3UTTA 3BMWA 4BSWA 1LDSA 3NIDE 15C8H 3ULVD 4NNXA 3D0LB 3EYFA 3MRQA 1NL0L 2IPTH 1D9KD 4RGMC 4Y16B 3VI3E 4NC2B 2Y6SD 1KCUL 2HN7B 1FO0H 5EC2A 3O8XA 4IRJC 1AQDB 1A6TA 1HEZA 3MBXH 2QADC 4XGZB 4GFTB 4LLWB 4G3YL 1F2QA 3BISA 4PJEE 2UY6A 4APQA 1HHKA 3CXHK 4RNRB 1DBJL 4KMTL 4ZG1A 2V5SA 1SEQH 3ZE2F 2VL5A 3K8MA 2WANA 4CDHA 5DRZA 3WUWG 4LHUD 3REVA 3QPXL 3RIFK 2NXZD 1RFDL 1CE1H 1X3DA 4KROB 5FO8B 1I9JH 3WBDA 4DKEL 5FGBC 5E8PA 3VD9A 3DRQB 2DQIL 2EH7H 5TH2B 4S0TD 1AO7E 2VZOA 5DD0H 1CVRA 1JGUL 4JFFB 1H0DA 4I4WA 1PY9A 3JUYA 4DN4L 5C6TL 2VXUH 4L4JA 5E5MA 3IETA 4YO0B 4NQCE 4L1DA 5I18H 4PJHA 4M62H 4OGXH 1W72B 3DVNB 4YIQB 1NEUA 3TFKC 4R0LB 3HUJA 1I8KB 5K9OA 2DICA 1Z0NA 4FQ2L 5HHMB 4KK8D 1FG2B 1NCWL 4GBXB 2PF6A 3CJJA 1JFQH 3G9AB 2W65B 2A9ML 2YZ1A 3H6JA 4OCYL 3TNNB 2SEBB 12E8L 4OZHF 4WI8A 5H35B 1T1YA 3R06A 4KMLB 4S1RH 4MA1C 4DEPC 3NABL 4JKKA 3RWHB 2YSSA 1FVDB 5TQ0H 3PHQB 4X99B 4JN2B 5I71B 1FC2D 4HDIB 4OFYA 5EU7E 4IMKC 2FO4B 4G6JL 1RJZB 3TJHD 4G7YH 3PF2A 5TGBA 3V7MA 2HAZA 1KIUA 4IRSD 2JB6A 2IQ9H 1TVBB 3WHXB 2GIYA 1LEIB 3MRNB 4GAJL 4Z78A 5E5UB 1OP3H 4Q0XH 2X41A 3QXTA 1NGXA 3MLTB 2HA1A 1JNNL 5HHOD 5EZIL 4P2OC 4WV1B 1YY8B 4HV8B 5IFAH 3TPUA 2YZ8A 3DETC 3PDOA 1Q0XH 2OJZL 4F7TA 3MMEB 1UACL 1FL6A 5JLZB 2MHAA 4OZFA 5DJZA 4ZS7L 1QBML 2NXYC 3MOBL 3SKOB 4PLOB 1IQWL 1JE6A 2H9GA 1D5ZA 5DC4B 3LPWA 5EPMA 4Y2OA 1IC5L 4GO6B 2QSCH 3OJDB 4WO4B 4ALAH 1DUYB 3P0GB 4Z7VF 5HHPA 4YFEA 2VWEC 2Z31A 2Q86A 3ZKND 3ULSA 1X5IA 3HB3C 4XNQA 3WO3B 4DGYH 5IHUL 5TE4L 3QRGH 3MACH 5ISZA 3C6LD 1CD8A 4GAFB 2HG5B 5CMAA 1U6AH 2DBLL 3FFCB 2OR8A 2Y25A 3LV3B 2XQYG 5JO5B 5BZDA 1QLFA 1OSPL 5FYLD 2O5ZH 3QXDB 1VB9A 1A3RH 2VLME 3VFWA 1KTLA 1SM3L 1JUFA 1K5NA 2FX8H 2MKWA 1OD9A 2APVA 5KSVA 5BRZB 4OZ4A 4H88H 5BZWA 5IQ9A 1S9YB 2E9JA 3OKOA 3KJ4B 4XI5D 2EYSB 1QZ1A 4KVNL 1MH5B 2ITCB 3R1GL 1ZTXL 2X89D 2DQDL 5D7LE 4EI5C 2B1AL 1VACA 1FNGA 1J1PL 1D6VL 4H8WC 5F7EH 3D85D 3OWEA 3GJFA 4NQEA 4EBQH 5KS9F 1T22B 2DKMA 4X6DA 3ULUE 4LVNB 4R97B 4P2QA 5D72H 3S3JA 1JZ8A 3MV7D 3X14B 4X7FC 5F71A 4QHMA 4WU5B 4KQ3H 4CVXA 2FIKB 4XPFL 1JPSL 1WWWX 1X5YA 4PJIB 5GRUH 2IAMC 4YEFA 2C3VA 4JFXB 5T3ZD 2WBJB 4JFQB 4D0CA 3ECBB 1X4YA 1MHPL 4EUPG 4CNIA 2IALA 1NMCB 3BP5B 3DRTA 2AK4A 4XPAL 3QUZC 1HI6B 2Y23A 1ZHKB 3E6FA 3NCYS 4TNVK 2E7HA 1XZ0A 1ZSDA 4PGZA 4XNMB 1RZGB 4HIIB 1ZVYA 3R8QA 3MUGA 2VLJA 1UG9A 4ZPVB 4CVZA 1RSFA 5ICZA 2V7NA 1PW3A 2F9BT 3GRWA 4NWTH 1QO3B 2OTUB 3HG1D 1EX0A 3GMQB 4RRPA 3FQXB 3FRPG 4PJGA 4G6FB 1YEHL 1UC6A 3K46A 3OJMB 3O3DA 3QDMD 1W0VB 5DTFB 1H3XA 4OFVA 4Y4FB 6CGTA 2JIXD 1CZ8L 4JZOB 4MAYD 4M61B 3LVEA 1LO0L 2P7TB 4KK9D 4P48A 2DQCL 4HGMA 3PABA 4P3DA 2A6KB 4KKBC 2NCMA 1IAKB 5EBMA 1U8HB 3G5ZA 5I2IB 5IB2A 2VUYA 3S5LB 1TTUA 2XKSA 1G7LB 1S5HB 1KN4L 2IBZY 1JTTA 2ATPA 1KENH 5DMIL 1WBXB 3S37L 5DYOA 3WUZA 4OUOA 2X1OA 3FB7B 3B9VA 3V5KA 1WJ3A 1H3VA 3ARPA 3DX7A 2BY3A 1PDKA 2H26A 3HI1B 5DEGA 5C1MB 3S9DB 5D2NA 4JR9H 1FN4B 4JVWA 4R8WL 4QY8A 3DV4A 3JSSA 2NZ9C 2AEPH 2AK1H 2V9QA 3FZUD 4J3VA 3SEPA 1EZVY 5F88B 3L3HA 4K3EH 4UIKH 3STLB 2AJZA 4OCRH 1H3TA 2C4XA 1F3DJ 2NY4B 1CD0A 5L88L 5FDWA 2R56L 4ORGB 2K7QA 1XGQB 3QNZB 4ZFOL 1ZEAH 1IGJB 4F3FB 2P49B 1HILB 2Q3ZA 3BE1L 1Z9MA 4OCLC 2XKNA 2J4WH 3R0MA 5F7UA 3SCMA 4U3HA 4JB9L 4BQ6A 1OSZB 2P5WD 4XVSL 4EJ1C 5D7IB 1RHHB 1YEKL 3BQUB 4TPRH 4R4NC 3ZE0F 2XY2A 3KLAA 2M26A 5CWSB 3CXDH 4ESKA 4U4BA 1YQVH 5ID1A 1HE7A 4PJ8D 4JREB 1P84K 1QRND 4AL8L 5C09A 1K4DA 3ZT7A 4G9FD 5T3XH 1WC7B 5GRVK 3GBML 4EN3A 3RNQB 2DI9A 4LRIC 4KDWA 4PRBB 4R7DA 4QNPE 5LAXB 4TQEH 4F9PA 1UA6H 4NBYB 4G6KL 4U1HA 5DHYA 2C4FT 2A83B 5D1ZA 1S7UA 5DD3H 5MERA 5D1XA 2W07A 2YXMA 3BEVA 1BIIA 4HFWA 4F7EA 4LEOB 3LKNB 2VLRE 3DSFL 1QSZA 4YHLL 1RK1A 5GGVY 4NZJA 4HAGA 1JF5A 2IPUK 4GG6A 1KPRA 3ZHLA 1FYTD 1JPGB 5AEAA 4NIKB 2NY3D 2ICWI 5HYEA 1LWRA 1QLRB 1ZVSA 4I48B 2BSSB 4S1SH 1MY7A 4QHKJ 4U1SA 1U8LA 1OF2B 5DD5H 4WRLA 2AQ3A 2VWEE 3QUYC 3ZTNL 2E27H 1MIML 1QSFA 2O5YL 4N8CL 4NO0D 3PQYA 5HGDB 2JELL 4X7TA 3VGDA 3U48A 1OGAE 1A7QH 2DYPD 2ZG1A 4KJYB 4MAUL 1V7NH 1LEGA 3D9AL 4HIJA 1FFPB 2XWTA 4LQFH 3S96A 1UJTA 1YNTB 1HCFX 3Q3GB 3MLSH 1SY6H 3KPRE 3MRIA 4NHCH 5FV2A 4QYOB 4N0RA 5FIEA 3TC9A 4DZBB 3EOTL 3REWB 3AAZA 3MACL 1KG0B 1TQCC 3GHEH 2I60L 2NLJB 4JGUA 4W6YB 1QNZL 1P2CA 1D9KB 3U7AA 1FNSH 3ZTJG 3VJ6A 1GGYA 5BV7C 1NFDE 3FMGH 5SV3A 4QHUB 2ARJB 4KV5E 4DUWA 1P4BL 3LKRB 2ESVA 5IJKA 4PRHE 4WTWA 3MRDB 4M9PA 2NY1D 5E9DE 5HHNA 4HEPG 4BH8B 3QH3A 1P4IL 1HIML 2Z0BA 3OHXA 3L7FB 3MLYL 35C8L 2OSLB 2N1KA 3BDBA 4YX2H 4GW4A 3TP4A 1B4JH 4RIRA 2ATKB 5H94A 3IKKA 4U1MA 3EYQC 3V5HA 1NC2D 3VMOA 5IT2L 3D5OF 2AJ3A 3RWJA 5L7XH 1DBAH 4KTDL 1J9CT 2V17H 2ITDA 3AY4C 4LHUB 2IH1B 4F15B 4GAGL 3G5XA 3BHBA 1QD0A 2NXZB 3V8CA 3A6OA 2JB5L 4N5EC 5EO0A 1GPOH 4S1QH 5FF6A 2AKRA 1FZMA 3R4DA 1XMWA 3TO4D 5HPMA 2O5XH 1VFBB 2APBA 2XZQL 5C0BE 4UILH 2L7JA 1F90H 2XN9D 3I9GL 4PREA 5BMFL 4DTGL 3SE4A 1CFNA 1FSKB 1IM3B 1X6LA 3UDWC 3ZYZA 2H6PB 1CTNA 4LGRB 1GC1H 2Z8VC 4Y5YC 3OMZA 1XGUB 5J1SC 4EDWH 1AIFA 2BERA 4NN5C 4ZFZB 5I73C 3OG4B 4NSKA 4PTUA 5IW1B 1W0WA 1U8KB 2PTVA 4FQPA 4PJ9C 1K85A 3UO1L 1MFDL 3ELAT 2H3NB 2CPCA 5JR1H 4FQJH 3FQNB 4KKLC 1TTFA 1Q72H 4MNGB 1MCDA 5J3HC 4RGND 3K8LA 1CD1A 2NYYD 4K9EC 5IHLB 1A1OB 5TF1H 2FX7L 4RMSA 3WL9A 2A0LD 4O9HH 1QHPA 5CGMA 4IRSB 2DL2A 1UB6B 4WHCA 2ADIB 5C0FB 4PJ7E 2HN7A 3JVGC 5HHOB 4O5LL 4HUKB 4MD0B 3RDTD 32C2B 5KSAD 4XGZA 1QVOB 4LLWA 1S9WB 2CKBL 2HJLB 1RUKH 1T66D 3MV9D 3QIUA 5GGVH 4RNRA 3TCXA 1HKLH 5EZLB 3HR6A 2YPLD 7CGTA 5LXGL 2I07B 1REIA 3O9WC 3QFJA 4XCFH 3WUWB 1H5BC 5B22A 1K8DB 1VDGA 4YWGL 3VXTA 5IB4B 2LAGB 4K7PL 4HSQA 3P0YL 3O3UN 4M48L 3RKDD 4UDUA 4BQCA 3DRQA 1DFBH 1JK8B 4RMVA 4JFFA 4XNYH 5GGRB 5IWLA 4S1DD 5AG8A 3E6HB 4IJ3B 3WD5H 1ZLVH 1U36A 2NR6D 2GHWB 3SGDI 4X8JA 4Q2ZA 2XRAL 3B9EA 3EDDA 4M7LL 1VPOH 3L3KB 3BN3B 4KAQL 5AUMB 4FQCH 1XH3B 1W72A 3DMMA 3BPNC 4P59H 1N26A 2Y7QA 3LEYH 4NKIH 4RMUA 3ZSSA 4DFHA 3IFNH 2YA2A 1FG2A 1GGUA 4ZUWA 4GBXA 1G9ML 5C6PB 5I0ZA 4O58H 2IH3A 1G6RH 2W65A 3T04D 4Z8FH 1HHGB 1VKXB 3GSNL 1O5DT 5MP6L 2E6PA 3AU1B 3TNNA 1T21B 5EWIH 5FGRA 1KCKA 1KPUB 5HBBA 4N0CD 5CD3B 2AJYH 4L9LB 3RWHA 4OLWH 3IDNB 7FABH 4LPUA 3H3BC 3SDCC 3PHQA 4X99A 5F9WB 5HYJA 4ENED 3D85B 4JE4B 4HDIA 1X5ZA 1RJZA 4JFDE 3CFCH 4XRCB 4XVJH 3B4NA 1MEXL 3MV7B 2ZCLL 3S6CA 3FO0H 4UBDD 1TVBA 4P9HL 4UAOC 3OAZH 3PWVA 1LEIA 4Z18A 3NACH 4UT6H 4L8CB 4W6XB 2V5YA 4OLYH 2DQFB 3KPLB 2IGFL 5HGBB 2DMBA 4PLJC 4A2LA 4WV1A 4HV8A 4I0PD 3RUGB 2HH0H 3DROA 3LRHA 3S7GA 3DHMA 4HQQH 4KY1H 5JLZA 1LE9B 1OAUL 4PBVC 1FFQA 2XPGB 3SKOA 2AS5M 1XGRA 2ZCKH 2XZCL 2YRZA 4R2GC 4ZNEA 3QIWD 4LSVL 2JF1A 4HULB 2QHLA 4K3JL 1DQJB 4CJ1A 4WO4A 3HG1B 4IMLA 1DUYA 3WFHA 2X4SB 4PJ5D 3MRFA 3JTSA 3ZE2E 1A6UH 2R0ZH 1JF6A 1FZJA 2YUWA 5DSCA 3SDDD 1JGLL 1T80A 1JHKL 1F00I 3QDMB 3DX9B 1A7QL 3GSOB 4JDVB 4LLQA 3I6KB 4OFKA 5AYQA 2VSCA 3Q5TA 1ACYL 4GKNB 4R96A 1JHTA 3ILPB 1FBIL 4MAYB 3OSKA 1K2DB 4JQXA 4CBPA 5BVJA 1Q9WB 1SY6L 3IU3B 3SE9L 2EH8L 5HI3D 3LV3A 2MOVA 5D7IF 1CU4L 2EDEA 4KK6C 3GHEL 1DQQA 4OT1L 1WUNT 2P45B 1MI5E 1CFSB 2X4TA 1DVFD 4H1LG 5IGXH 3QB7C 1CXFA 4KRMB 4LVEA 1AGDB 4ZSOE 5BRZA 3IFPB 1IC4H 1F4AA 5D4QA 3F12B 5IFHH 1Y18B 2CO7B 2EYSA 3HPLB 4GXUN 2R29H 1AQKL 1KLUB 5FHBH 3GMOA 4KZDL 2CO6B 4LDEB 4I1NB 4Y5XB 4UTBH 1JF1B 5DVNA 2ZJSL 2B8OT 2P5EE 4IOFD 5EOTB 4OZHE 3L3IA 4XP9L 2YD5A 2AQ1A 1DBAL 1IBGL 3VXME 2DTMH 4LPXA 2YPKB 4OQTL 3AGVA 2BOCB 3NIFF 3M8OL 1KB5H 4M1DL 4XMLH 4X6EA 4AEHH 4OV6F 2FIKA 3CSYB 5DQ9B 1DANT 1NGYA 4JFXA 5EZOL 5E95B 4GW5A 1EEQA 1E6JH 2O5XL 4JFQA 4EUPB 2G5BB 4JRYE 3K7UA 3SKMB 3CFDB 3OB0H 3BP5A 3BWAB 3D48R 1HI6A 3O4OB 4TVPH 5EOCL 4FFVD 1ZHKA 2P5WB 1CD9B 1A1NA 2VE6A 1OARL 5TPWH 4XNMA 5BJTB 3BT2L 3CSBA 1RZGA 1M7DA 4HIIA 1F3JB 3DI2B 4ZUTB 4RZCB 4LLAA 5ILTL 4Q97A 1GOFA 4QXUL 3RU8L 2RHEA 1E28B 1U8IB 1IFHH 4PJ8B 1WZ1L 4OZFH 2R1WA 1QO3A 1QRNB 2IADB 2OTUA 3WJLA 1RAMA 4DUVA 1TJHL 4XBEH 3DUUB 3GMQA 1WGOA 1S7WA 4M8QB 1KCSL 4G9FB 6FABL 1H9VA 1ZHBB 3G6AA 3ULVF 1ES0B 1W0VA 4JGJA 5DTFA 2PW1A 4Z7VE 4Y4FA 4RMRA 2ARWA 4QWWC 4TNWF 1YMHB 1XIWD 4JZOA 1BBDH 3AMLA 4KROC 4M61A 5CBEB 2QQLL 2H45A 4BA8A 2COQA 5T1LD 5BS0E 4AIZA 3BPOB 1KGCE 2P7TA 1WCBB 3IDIB 5BO1L 5GS1B 2A6KA 3SGEI 5F70A 1PG7H 4AEEA 4UDTA 4DUXA 5I2IA 1CDUA 3UTSA 2MPAL 1MCHA 1FYTB 4PJCB 2NY3B 3CK0H 1G7LA 2ADFH 4NO5B 3LS5H 4FQIL 4N0FB 4JM4L 3NAAH 4JM2F 4POZC 1RMFL 1ETZB 4F8QA 3EYVB 3FB7A 3U0TA 1N7MH 3BSZL 4XBPB 4R0LC 2BCKA 2WK2A 4WDIB 3HI1A 3QO0B 5GGTH 3NGBB 1T0MA 2E7MA 2KPNA 3VGAB 2BRRL 5C0IB 4NO0B 1FZKB 1JWMA 4YBQC 4HIXL 5DRNB 4AMKL 4YE4H 4LMQE 2DYPB 4NRZB 3CPLB 4OJFH 1WT5C 4QGTA 2F53E 5C92A 3RL1B 4LCIH 3JWOH 4Z5RB 3STLA 1MCIA 3H9HA 3D1MC 1DP0A 5KS9E 3GJFH 1ULVA 1LD9A 1XF2B 5GGSB 1XGQA 3QNZA 5JXED 1EO8H 4LASH 1RZJC 3GFUA 5KBNC 3MO1A 1N2RB 5EZJA 4RQQB 3HE7C 4PD4J 5F7YC 2Q1EA 3WCYA 1PBYA 1TZGH 4P46C 2F15A 1T0NB 1X4ZA 2KL6A 1RHHA 2M2DA 1QP1A 2PETA 4AEIL 1AGFB 3BZ4B 5KOVC 2X4QB 1U3JA 4HIEA 2BMKA 5CWSA 3I85A 4P59L 2E3VA 1FC1A 3QG6B 2C5DC 4OBSA 5HHQA 3BD3A 4OD1L 1Q9KA 4BUHA 2P8LA 1NC2B 5GIRB 2ZKHH 1YYML 2CQVA 2QR0B 1WC7A 3W0WB 4HUXB 4X6FB 2YKLH 1XFPA 3O6FA 4KJWD 4LGSB 4ERSL 1LNUB 5IR1A 1JGEB 3RNQA 3GRWH 5JHLL 2Q7YB 4JRXE 3W5NA 2R8SH 1FRGH 4O4YL 4PRBA 2DMKA 5GRYA 2GTZA 4MNHB 4LRNL 4XMKH 2Y36L 3MLRL 4J7RA 5JQ6H 5JOFA 3EHBC 3OL2A 2A83A 4H8WL 5KSBB 1J1OH 1PJ9A 5J7CC 4J1UB 1J8HE 1UKSA 1KC5L 2EEBA 3DVGA 1KUMA 5B8CA 3CFCL 3QJHA 1I9IL 1VGKB 2MMXA 1S9KC 2X9YA 1EVTC 1MFNA 2DF3A 3LKNA 2G60H 4LEOA 2XN9B 2YWYA 3T0ED 2VKXA 2C9AA 2O61A 2PYFB 4UT6L 2FLBT 1JPGA 1JPTH 2EC8A 3SGKC 1QTYT 4OGYH 5JQHC 4OV5B 1BQSA 4U6YA 2BSSA 3C6SA 2FH6A 4BZ1L 2H32H 1OF2A 4HT1H 2ZCHL 1OTTC 4DWHA 4KY1L 3V0WL 3BAEH 4R90H 3KYKL 4X7SL 4S2SB 5HGDA 5JNYB 2YD1A 3KJ4C 1T6WA 3INUH 4JJ5B 4NN7B 5FGCE 2XKUA 4KUZH 4RGNB 1O0VA 2OS7A 4DGIH 3ZZ1A 4D9QD 1UJ3C 4Y7MA 5KVFL 4HJJH 2VDMH 4QYOA 4G6MH 3QEQE 3MX0A 1KTDB 3BN9C 2NLJA 3LKPB 2OM5A 2W92A 4ODWB 1WTGT 4MCZA 5DJ6B 4QHUA 4HD9A 3TV3L 5D2LF 1DUZA 3QAZC 1DLFL 1MREL 1VADB 3UBXG 4PRPD 1Z9SA 4BH8A 5EN2B 2E8ZA 1OM3L 3RDTB 5KSAB 4XB7A 3D18B 3FQTB 1U8NB 3MV9B 4DK3A 1V8HA 2OSLA 1V05A 2DAVA 5LBSH 1AXTH 1FQ9C 2YPLB 1MCKA 3WHE1 4L4VE 3ZE0E 2EZ0C 2FR4A 3MUHL 4P5KB 4MWFB 5EU6D 1CGSL 5HHVH 5IFHL 4XPBH 2B1HL 4E9LA 4GRWH 3RGVC 3UJJL 5EUOA 2IH1A 3ET9F 3ZDZF 5B4MC 2X1QA 3QHFH 2A74B 4U1KB 4MNQD 2ZUVA 1HH9A 2DTML 4KJPD 5GHWH 1FV1B 5DK0B 1ZS8B 5IBTL 4OTXL 3C60C 4X5XB 5H2BB 3QQNA 3T2QA 4MS8D 4NHUB 5IW3A 2EDTA 1YC7A 4L4TE 2H6PA 3RNKB 1OAXH 3GK8H 2MWCA 1ACZA 2PO6C 4Y19E 3WNLA 1QSVA 1F11A 5IW1A 2BZDA 2Q76B 1PGRB 1Q0YH 3GIZL 5F9AC 3S88H 5C0AE 2R4SL 4GG8A 2G9HA 3B3IB 1AFVH 2D0HA 3P4NB 1ZVHA 2EKSA 5CGYD 1NSNL 2WLYA 1OY3B 1HXMB 1MJUH 5FYJH 1M71A 4L3AA 4OKDA 3IXAB 5CEZD 4IRSA 4U0RB 5JMOC 3H9SD 5E6ZA 1RQ5A 1FORL 1UB6A 4JO3H 3WNPA 3LQAL 4N9OB 4F57L 4H0IA 3AM8A 4MD0A 4HHAB 4AT6B 3MBEC 3OKLB 4I0PB 4XH2B 2HJLA 5HHME 5C8JB 1EHLH 5MENE 2HTKD 1ERNA 3BH8B 4WFEE 2XWBB 4MJ2A 1T2QH 2EDOA 4Z77B 1RUQL 1BZQK 1GZPA 2OZ4L 3BQUC 3QIWB 5KN5B 1J0KA 3BZEB 1FCGA 5KOMC 3WUWA 2G2RB 3N1FC 4PGBB 3KLDA 4QRPD 4LKXB 2EDNA 3F7PC 4YDVB 2EIZA 4JREC 5HJ3A 5EU4B 1FCCA 4J8RB 4PJ5B 5IB4A 2YK1H 4NZTL 3SDDB 1TQBB 3WFDL 1KCVL 5JHDD 2VZTA 3B5TA 4DVRL 4ODVL 4NDMB 4CDGC 4YE4L 2B0SH 4QXTB 1HHHB 3VXSD 4TSAH 5ADOH 2D7TH 3IDMB 3KPNA 5ERWB 1AKJD 3BIKA 3EOBB 1YMME 3D69B 3MLWL 4LCIL 1MPAL 5EU5A 1EHAA 1HN1A 2V6HA 3E6HA 3KYMB 5FKAA 2GUOA 4KRPD 3LMJH 1FH5L 5I66A 4M02A 3L3KA 4HUWB 5AUMA 4ODHH 3TA3A 4E5XB 1DVFB 3ALWA 4Y0GA 3UXFA 2D7MA 2J88H 4QHNA 1CQYA 4W81A 3WFEL 4R3SA 5TDPB 1MWAL 4WEUD 1HHGA 4WEBH 1EH9A 3S34L 1C5CL 1T21A 3U7YL 4UNVA 2CH8A 5CJXA 4YDIL 4ZAKD 4XP4L 5IP4A 2W9DH 2X89A 4O02H 3IDNA 3KHOA 4X5WA 4LNRB 2O93L 4ZXBD 1DE4B 4M5YH 3ZKXC 3D85A 3P0VL 3O2WH 3MRPA 3WE6B 5IROA 3K74B 1UKQA 2YKLL 3UTPD 2OMBA 3VWKC 4BK5A 5ITFB 3BESR 3MV7A 4UINH 43C9A 4JY5H 2XV6B 5JQ6L 4PJCF 4HWZB 1P53A 4L8CA 3H7LA 2X70B 3QCTH 1J1OL 5IESL 5ADPL 5D6DC 3ULVC 2WQRA 3MV11 1GGCH 1UKTA 1PKQA 1ITBB 4F2MA 2AABH 1D9KC 4XCCL 3QFDA 3QA3A 4GSDH 1A47A 3MFGB 3KNBB 2GK2A 3IKCA 5GS0D 2Y6SC 1NQBA 1T0PB 2CIKA 1LE9A 5JTWA 2XPGA 3MRLB 2NW3B 3EAKA 2DLEA 1BAFL 4F7CB 5F7DA 3LPFA 1DQJA 1CGYA 4Z76A 5BVPH 2VDRH 4OAWB 2R23B 4ZO7A 4FXGB 3T3PF 1BWMA 4HT1L 3HS0A 4HK3J 2VXQL 2ZZUT 3IGAB 3LHPL 4JM2C 3ARDC 3DX9A 5E4EC 1U95B 4JDVA 4QRSB 4GRWF 1WZKA 4QRTB 4GKNA 2FL5B 1F3DH 5J12C 4MAYA 4XP5L 5KTEL 5DJ2B 5ETUA 5D1QD 1Q9WA 4LVHC 5T1LB 5IBLD 4TSCL 2CLVA 3JV6B 5J11B 1AD9B 1OD7A 4G8EB 4UNUA 1R3IL 1MLCB 3RWEB 4HGWB 5INCA 4WY7H 4HJGB 4LDOB 1OAZH 5D70H 1JGVL 4OZGB 3SQOH 1AGDA 2X4RB 4TUJB 3CFBB 2RCSL 3FB8B 4JEGB 4UZGA 3TBSB 3F12A 3HPLA 4YJZL 4GG6F 1KLUA 1G1CA 3HCVB 3IT8D 4FQXD 3A6BL 4KHXH 2E9IA 5D5MB 3SPVB 1CFTB 2NY7H 5I8CB 1JBJA 1AO7D 1NCDH 1NUGA 2Q20A 1DSFH 3I2CL 1J05B 3AMKA 4DKFH 3BX7C 3UTZA 5C7XL 2Z92B 2YPKA 2NX5A 4WNQB 3CGTA 4EIGB 4IBLT 1YNKH 4M1GL 4NQCD 1YDPB 1PZ5B 3KG5A 4LCCC 1N8ZB 4MA8L 3Q6FB 3CSYA 1HQRB 2WWMC 1MNUH 4EUPA 5JUEL 5C08E 3T77A 1YN7B 3IAQA 2DWDB 3CFDA 1U3HD 5CSGA 1NUNB 2QQKH 5F97E 3T4YB 3VXUE 1TETL 2P5WA 5I1CL 5ESQB 3Q1SL 2ICWB 1Q9LB 4NWUH 1F3JA 2AEQL 3HMWL 2DL9A 4KUCD 2B4CH 3LN5B 5FA4A 3H42H 1U8IA 4NKDA 4I2XA 2IADA 2F5BL 3FRPA 3B9KD 5I8OL 2GW5A 3DUUA 3I84A 4PB9L 3VDCA 4M8QA 4E41E 5IVZB 3VG0H 1ES0A 4TNVF 3O45A 1TZHB 2VLKA 3TBWA 2L7UA 1HSAA 1YMHA 1HHJA 1S7XB 3NCJH 5CBEA 3TVMD 2J1KA 3LQMA 4JZJA 1MJUL 2VDPH 1FVEA 4FQLH 1WCBA 3IDIA 1KT2B 3C6LC 3IXTA 3C9NA 4I18A 1KJ2H 4HC1A 4BYHA 1KJ3H 3HMXL 4LCWE 1MFBL 3T0EB 1IVLA 3DO7A 2ERJC 2B2XL 3DUHA 4IJ3C 5D7IE 4HEME 5FA3B 2YC1B 3HRZB 1T7VA 5DVMA 4NO5A 5T1MB 4MMXC 4MMZC 5JIPA 5I1JH 1I8MA 4PUBL 2A9NH 1B3JA 1VERA 4L8DA 1F42A 2HT4C 4U1GC 1A5FL 4K07A 5DZOA 1UCBL 3QDJE 4NO0A 2B5IB 2GK0B 5KVEH 5DRNA 3P9WB 4P5TD 3X3GH 2DYPA 2UWEA 2AEIT 3LAFA 3IFOB 2NNAB 1AGEB 3WNOA 3RL1A 4L9LC 4Z5RA 3AS3A 1J5OL 2YEZB 4OCSL 2VAJA 5D7SH 5F9WC 1S8DB 5GGSA 4MXQC 4Y2DC 3NIFE 5I6XB 1INDH 2YD6A 1UENA 3I50H 1GYAA 4OFIA 2DQHH 1N2RA 4RQQA 2W0KA 1A2YB 4MSWA 2YUVA 2IANA 4WUKL 3BJ91 1T0NA 4PRPB 1EHNA 3VWJA 4YHKL 3CD4A 2XY1A 3TZVA 1BP3B 3FL7A 1A7NH 4RCAA 3BFOA 3SOBH 4CW1B 3T65B 5JPNB 5D7LD 1INEL 3TIDB 2V5RA 4WW2B 3DX8A 1T2XA 1MCFA 1MJ7H 1NC2A 5DRXB 2VABA 3HPJB 4FQ1L 3ULUD 2QR0A 5EU6B 4LSPL 3W0WA 4X6FA 4JANB 4WEBL 1JGEA 1R3JB 4FP8H 2GITA 4MNHA 1CE6B 5I1IL 5LWYL 3ULVE 4JHZA 4MNQB 4HPOH 4NT6B 5IHZA 4HKBA 4PB0H 3EFDH 3ARGD 1VGKA 3FOMB 3HC3L 5HVHB 4LIQH 5AYUH 4UINL 3TGXA 4XC1L 3RVXC 4YDLB 2PYFA 3MFFB 2JJSC 1YEGL 3EO1A 5SWQB 3JWOC 4H0HB 2BNQE 4GSDL 5I1GL 2X4UB 2ZP0T 4OB5L 3ME0A 4UT7H 1KIPB 3VFMB 5F6HJ 4QXGL 1YEEL 3PGFH 1LK3H 4IDLA 5JNYA 1UM6L 1CFQB 1MHEB 2V7HB 1Z9OA 4OCWL 4JJ5A 5EORL 2WINA 4IRJD 4Y5XC 4ZDHB 2ZG2A 5E1AB 2DLTA 4MXVF 1I7ZA 2VXVH 4MJIE 4Q6IA 1KTDA 3FZUC 1NFIB 2XACC 4UQ3A 3LKPA 3VFVB 2R0WH 3L6FB 4X7DC 5EUKA 4HWBA 4B7IA 2Y9RT 2FWOA 5DJ6A 4CMHB 4MDJB 2Z35A 5CLTA 2R0LH 3UBXB 1BPVA 4W4OA 1PG7W 5HVWA 3QI9B 5EN2A 3VG9C 5HDOA 2I9LB 3I75B 2I24N 3D18A 4O2EB 4N1EA 2DQGH 5C9JA 3GSQA 5IB1B 1QFWM 4ZPTA 1RV6X 3KPTA 4PP2B 3FT2B 5GRJH 4XCEB 3MRBB 4QRRE 4CGTA 2A38A 3BPLC 3UZEA 1MIEH 4MWFA 1I7RB 1W72L 3DWTA 1T5WB 4MNGE 4PJ8C 4QRPB 4GRLA 4CN1A 4PJXF 4PRAA 5AG9A 3SDYH 3S98A 5DK2B 4C83B 3W5MA 4KQ4H 5KAQG 1JNJA 5JHDB 4YAQA 1G7PB 1UXWA 4U1KA 3TFKD 4OLZL 3VXSB 5K9KB 4Q7DA 1DSFL 2XA3A 1AKJB 3O6LL 3R8BB 3CVIH 1L0YA 3HKFA 1FV1A 1N4XL 5F44A 4GAYB 5HHOE 1HDMA 3SBWA 1EUTA 3JWDH 5M95B 1A7OL 2YD3A 5H2BA 4KRPB 2N7BA 3FB5B 3U1SL 1PQZB 5DUBA 5CHNB 1J0YA 3UTQB 4RWYL 1RZJL 4BSVA 5HYQB 4P2RE 1NMAL 5GS1C 3ZMRA 4X6CB 2ED7A 3VGFA 3QQ9C 2I9TB 2DWEA 2Z8RA 1YYLL 5TF0A 1Q94B 1Z3GH 3NA9L 4OGAD 2UZIL 1T4KB 4ZAKB 4F7MB 3MRCA 3FT4A 1R3HA 1KN2H 3O41B 2MCPL 3DETD 4ZXBB 3BYYA 4CRPA 2VLRD 4JGMA 3IXAA 5EH1A 1CR9H 1L7TH 1F58H 4PV8B 3RWIB 2DS4A 3SCMC 4YR6B 3MODL 4FNLH 2WUCH 5IEHB 3NCJL 3U36B 4N1CA 4FQLL 5GZNC 2BVQB 3ARFC 4GH7B 4HHAA 4AT6A 2Y1VA 3V6FB 3QNXA 4I0PA 2AXGA 4G5ZL 4XH2A 1HH6B 3HB3D 5D2LE 1YJDL 2VDKL 4C58B 5D71L 1QLEH 4NN6B 2GCYB 3DV6A 2NY1C 1OGAD 4ZUSB 3QIWA 1ODAA 5KN5A 5DFWH 2C1PB 2G2RA 1IAIH 4PGBA 4TVPE 4GRMB 4BELD 4R26H 1UM4H 2XA8H 1OHQA 3FJTA 4J8RA 4PJ5A 3FCTA 5KVEL 4R4BA 1Y0LB 5E8DL 4XVTL 3UMTA 1C16B 4NDMA 1LO5A 4QXTA 1SEBA 4DQOH 1EMTH 3ZDZE 4LHJB 3U7WH 1XF5A 4PRHD 5D1QB 4G8FB 5E9DD 1I3GL 5I8KH 1HWGB 3V7AE 5CP7B 3FB6B 4M4RA 3TO4C 3MJ9A 1VGEH 5E2VH 3RUGE 5D7KE 2A1WH 4KKCC 4YNYB 3CDYA 5F3HB 3WS3A 4E5XA 4DAGH 1AY1L 4JKMA 4LPTA 4K2UH 1SJEB 3EYSH 4WCYH 3C8DA 3DVIA 3CLFL 3RA7H 3KGRA 3MOAL 1RIVL 5C3LD 1HNFA 1KJVB 1NC4D 4KTEH 2V5MA 3HG1E 4OIBA 2N56A 1IGFH 1I1YB 4PGCB 5GXBB 4FQXB 1UXSB 4JO1L 4ZD3H 2KDGA 5DA0B 2YHGA 4KDTA 3QDGA 3MRMB 1MJ7L 3VRIA 3P73B 4AENA 2DQJH 4N0UB 5TFSH 1RZ8B 1AO7B 5I74C 1A02N 5I8EA 3NTCH 1CF8H 4J2XA 4A6YA 3NFNA 4NN7C 4OUUB 5DUML 4NQCB 2HFTA 3U82B 1V3KA 3BGAA 1FLRH 3FN0H 2X70A 3AS0A 4HPOL 3CFIC 3PHSA 3B5GA 2C3HA 4PGDB 4HXAH 2QV2A 4XNXL 4RA0C 1RZ7L 2GJZB 5J6GA 5T1KD 3ZYOA 1UYWL 1U3HB 3CX5J 1UFUA 3KNBA 5DFTA 4JG1H 1YEFL 3RY6A 3LPGA 1UWGL 3MRLA 3KJ6L 2UZYB 1J0IA 3D2UD 5F9OH 3VD5A 4B41A 3RDTC 5KSAC 5CILL 4D9RE 2V2XB 1XF4B 3WXVL 3RPIB 1UWEH 4OAWA 1MF2L 3V6ZA 4CU7A 3PP3H 1UQSB 2CSPA 3L3GB 4FXGA 3B9KB 3LKSB 1QFHA 4JCLA 3VDAA 1ZA3A 4I9WE 1NAKL 2EICA 3IGAA 1TDQA 4KKBD 2X6MA 1U95A 5A2IH 4QRSA 5EIIA 2AXHA 2ADJB 3OX8B 3SE4C 1F2XK 4QRTA 1EEYB 2FL5A 4PRID 4HCRH 5DJ2A 3TVMB 2VLJE 3LSOB 5KW9L 3JV6A 4U1LB 1B0RB 1AD9A 4G8EA 5I1EH 1MLCA 3B43A 3QIBA 4H1LA 2EO1A 5CZXC 4HGWA 4UUJA 3FHQA 3JWNC 4OZIB 4S1DC 4OZGA 4FZEL 3VXQB 2WM0A 1AH1A 2R0LL 4TUJA 1ZT1B 3CFBA 4KXZH 3EO0A 3FB8A 4X9GA 4L29B 2FECL 5DD1H 2IFFL 3IAPA 4P23B 3HI6L 3U4BL 2N4IA 3MCLL 1IC7H 4MLIA 2HVJB 4G9FE 5E00B 5GRJL 5KVDL 4P5TB 1NCUA 3SPVA 3P30L 1JZ5A 1CFTA 5TE7L 1GGBL 5I8CA 3SN6N 4PR5B 1BHGA 3MLVH 5HI4C 4HKJA 3RWCA 4HPYH 5DLMH 1F4XL 3UYRL 1JTPA 1C12B 3UPAA 5F1IB 5IEKA 3O3BB 3Q6FA 5IHBA 4J3UA 5JXEA 4XAWL 5IJVA 5DD6B 3SGJC 3QIUC 5DT1H 4J4PD 5D2NE 2ZUSA 4HH8A 2OK0L 4UBDC 1FYTE 2DWDA 4PJCE 4PLKC 4U6HB 3T4YA 3JV0A 3FTGB 1RZFH 3PHOB 2ICWA 1Q9LA 3ZSTA 4DJMA 4YXHH 5I1AB 4M7KH 3W39B 5HHXH 3LS4L 1DEDA 1QPPA 2VDQH 4QRQB 3LN5A 4YHIB 5D7LB 2JKXA 4F37K 5FUOH 2DDQL 1YEIL 3KXFD 4N8VG 1WK0A 3BD5A 1C5BL 3VXPB 2Y07H 5L0QC 5EO9B 1K8IB 4FABH 1A6ZB 4JFDD 2DN7A 4V1DA 4EOWL 2VZSA 3T3PE 1WCQA 3BKCH 5CZKA 3IAGC 1CFVL 5GS3A 2DQEL 2QBWA 2DM4A 1A6PA 4MJ5B 4D8PB 1S7XA 1XGTB 3SDDC 4FZ8L 2JJTC 1OAKL 4GRWE 3QUYD 4LFHG 3SY0B 4FQHB 3ARGB 5EUOF 4KI5F 4Y4HD 4JKLA 3IS0X 1NGPL 1BVKA 3ZT5A 3S3PA 2QEJA 3CH8A 5FA3A 5DUPH 5HI3C 3HRZA 1XR9B 1CXIA 5T1MA 3ULVL 5FGSA 4YUEH 4C57C 1DVFC 5MEPA 3G6DL 5SX4I 4YQXL 4QTHA 4OI8A 1JV5B 3C5ZD 2GJ6A 1NCTA 1OTSD 4LQ1A 1FL5A 1LHZA 1OCWL 2D2OA 4I0CC 4RGMB 3PJSA 3V4VL 3N1PC 3BP7B 3B6SB 1OAQL 2WBKA 4GG6E 2XNAA 3F7QA 4TSBH 5AAMA 3IFOA 1E4WH 2NNAA 4IRJB 3NH7L 3O2VL 1QR1A 2IMMA 3KPSE 4XP1L 4P3CL 3UC0L 3I02A 3N85H 2R2BB 3UAJD 5ANMA 5JPMB 3C2AL 5C0CA 1ZT4B 3QEGL 1QSFE 1A6WH 3EYQD 3EJJX 4K8RH 3DGGB 3WO4C 3PQYE 1BGXH 1U8JA 4FN0A 3B5HA 2D7PA 3K3QA 1DQDL 1P69B 1S7RA 2YRPA 5FYJE 3DARA 2DKSA 2C3XA 2D7NA 4X6BA 1DQTA 2LAAA 2EXYC 1KJMA 3U79A 3FOLB 3U9PH 4DN3L 4EUPH 2VXTH 3QULA 1D5IL 2VH5L 4DZ8A 3AREC 1BJ1H 3CVHL 4N5ED 4CW1A 3LEXA 3T65A 3TIDA 1YNLL 4FFVC 2P5ED 4NQXB 1EEUA 5DRXA 1MCBA 2ZUWA 2QHRL 4JPVL 3VXMD 4PRNB 3SE3A 2AERT 2BSED 5FHAH 2HRPH 4P2CG 1T2JA 3V4PH 4OLUH 2XG4A 2CDGA 5HDQH 3D6GA 1R3JA 3QWRA 4JLRB 4ZD3L 1T04A 3MC0A 1JNHB 3C5SA 5ITBH 2DQJL 2HFFB 3C09B 4ZTPL 4AQ1B 1M4KA 2RJMA 2JLLA 4LFHD 5HGAB 4WWID 1N3NB 2VR5A 3D39A 1KBGL 4JRYD 1CLOL 4XXDB 3HA0A 4HS8L 3IDJA 4H20H 3X3FH 4QOKD 1XIWC 1FLRL 3MFFA 1FDLH 5ICXB 4MA1B 4DEPB 4BH7B 4M7JH 4MGXA 4XWGL 4KKLD 3MV9E 4HXAL 5SWQA 3GNML 4NKOB 2IG2H 1BJMA 2QSQA 4XCNB 4Q9BA 3WN5C 4DW2L 1G7IA 3VFMA 5EULV 5I30H 1I1RA 4BK4A 3UTOA 1ZMYA 3QG7L 4YXKH 1J1XH 1CFQA 2KZ1B 1IGML 4OF5A 2V7HA 5I0DA 1TCRB 3RJDA 3V95A 2R2CA 2W9EL 3L5IA 4NCC1 1TPXB 2IFGA 4ZDHA 1TVHA 5BS0D 3T09A 1KGCD 1KF9B 2BVOB 5JORB 1JWSA 1IGYA 3GSVB 2OP4H 3V52H 3MLUH 1PKOA 2VLRB 4RX4A 5FFLA 1PY4A 5DJ8B 3RVWC 1NFIA 4LLDB 3VFVA 1VEMA 3G5VA 3L6FA 8FABA 4G8IA 2XT1B 3O9WD 2PUQT 3WLWC 4OGZA 3UBXA 2BSTA 3QI9A 5F1OB 1I85A 5I1EL 2E7LC 4O2EA 2X5PA 4X9BA 3T2OA 5CJ5A 4FG6C 1NLDH 3VFOA 4H26B 3MNZA 1R5VA 4ZFOA 3RZCC 1OGAB 5FYLL 4XCEA 3MRBA 3LZFH 5T33H 5EG6C 3HNTH 1G0DA 3MPCA 1S9XA 3OAUL 2HLFC 4K94L 5DD1L 1W8NA 4LSUL 5GPRA 1IC7L 2EECA 3PP4L 4JHAH 4ZODA 5DK2A 4XC3L 4G8GD 3MCG1 2FECI 3HR5B 4URTB 3RX7A 1NAMB 1G7PA 5L2KD 1MFCH 4KJWC 5K9KA 4M00A 4Z0XA 3AXLB 3IU4H 3TH4T 3QO1B 1NFDB 1ORQA 2BNRD 3MJ8B 5DHXB 4P4KD 4PRHB 3RTQA 2HT2D 3PL6D 5DS8B 5E9DB 1H3PL 4OIIL 2PN5A 3FB5A 1H15B 1PQZA 5CHNA 1CDYA 5HVFB 2D31B 3SDCD 3PWJA 3T0EC 4X6CA 4DOHE 2P42B 2V2WB 3GO1L 4OM1H 1S7TB 1NBQA 3Q5YA 1AHWB 1IZKA 2R69L 5T3ZL 2R39A 2OL3B 3NCBB 4D9LL 5CKAA 1Q94A 1NC4B 3BP4B 5DRWB 2A73B 3JXAA 5EDXA 4JRXD 4LSTH 2BSRA 4LBEA 4HKXB 4TN9A 3CFKB 3GI8H 1T4KA 4ZAKA 3U9UA 3MGOB 3O41A 1DBBH 2Y5EA 1J8HD 1QBLL 4NC1C 5L8JB 4UB0L 5MEQA 1F4HA 5FYJU 5J1AB 1NGZB 3MJ7B 5BXFB 4YBLC 1MCNA 4OZIF 2C1OB 5CD5C 4ZQKB 4MXVE 3RWIA 3TNMB 4R2GD 3T1FA 3MYZA 5EBGA 1JVKA 3TWCL 3U36A 1SBSH 1P4LB 3L7EB 3ZTJH 3UYOD 3V6FA 5HYJE 1HH6A 4X4XB 2DQTH 1WBZA 1L7IH 2BHUA 3ZL4L 2DD8H 5GISL 1CGUA 4J23A 2VYRE 3D2UB 3O6FC 5HPOA 4RAVB 4YUEL 4N8PA 2ZOLB 1A6VH 1AE6H 3NFSH 5GSVB 2VITB 1S3KH 3L3OA 1D5BB 1A14H 4ZUUB 4GRMA 2VC2L 1KEMH 4KPHL 4ODTH 1MRFH 1T5XA 5CBAB 4KK6D 3QEHA 3QEQD 4LSRL 3JWDC 4AQOA 3C08H 5JW4N 1I1FA 1C16A 1DDHA 4PJXE 4XCYB 1I4FB 4WTXA 4C59B 2PR4H 4TSBL 2FYYA 5CP3A 3DNKA 1IRAY 4KRNA 1HINH 4PJ7B 1HCVA 5EFIB 4JPIB 4U7KA 4UT9L 3VGEA 4M3KB 2NW2A 4PJEA 1A6WL 4I3GA 3UEZA 1E6OH 1CLYH 4YNYA 5F3HA 43CAB 1LO3H 1YUHB 1J7VR 4YDLC 4L4VD 2NTSP 3THMH 1ONQB 3O2DA 4LSQH 1BQHG 1QA9B 1I3VA 1M7IA 4NPYB 3LEVL 3RWGB 1MCPL 2VKWA 1X5XA 4PJBA 5D7JC 2FEEL 1I1YA 5CCKH 1DL7H 4FQXA 3KR3L 1JPFB 1UXSA 1S7SA 1KELL 2AV1B 2AJSH 3HC4L 1GRWA 1IILE 2HKHL 3QCVH 3UPCA 3MRMA 3P73A 5L6YL 1T6VN 2CR3A 1AO7A 3ESUF 3TBYA 3FQWB 1QKZL 2HRPL 4NZRH 5MHSE 3CLEL 3QZWG 5HYSA 2HT3C 1A64A 1VFMA 5CGYC 4NQCA 4YHNA 1D7FA 1KEGL 3KWWB 1SJHA 4PGJA 1I1AA 2UWEF 3S3SA 4L4TD 4X98A 3U0WH 5ID0B 3KYOB 1TFHA 3HC0B 2R0KL 1RVFL 4NRYA 4Y19D 1UADC 2GJZA 4NM4L 5IB5A 4I3RH 4PJDA 2Q3AA 1I9RL 1N0XL 4UQ2A 3EZJB 5C0AD 2ZNWA 2DJUA 4QWWD 1HZHH 4XZUB 5DURD 4KI5C 4WI7A 4HC1L 5J9PB 2V2XA 1XF4A 2F5AH 3RPIA 2P48B 3KXFB 1GGTA 3L3GA 4UTAL 3B9KA 4KZEH 5IQ7H 3JTTB 2EIEA 1NDGA 3CMOL 1JZ7A 1MVFA 1BM3H 3FN3A 2CKBA 4JFDB 2X4OB 3FO2B 1IKFL 4MD4B 4M7ZC 3B2VH 5T1DH 4B50A 4NRXA 2ADJA 1EFXD 5LCVH 5J13B 2D03L 3WIHA 5AZEH 4P4RB 2CK2A 4XXCC 3K2UL 3MLUL 3P40A 3LSOA 3JZ7A 3QUYB 4U1LA 4Y4HB 1TENA 4M6OH 2AJUL 5MEND 4LEXL 4JZNB 4MA7L 4YBQD 3IDXL 1GIGL 1NDMB 4H25B 4M4PA 2UUDK 4WFED 4LF3A 4LPYA 4OCNC 3VXQA 5DJYB 5C0EB 5EOQL 5J57B 4EDXA 1ZT1A 4MXWH 3DJ9A 4WJ5B 4L29A 4OF6A 2Q6WB 2NY5L 4P23A 4O2CA 2BJMH 1ZLSH 3C5ZB 1TQCB 1OAYH 2HVJA 4N9GB 5E00A 3KPMA 3C5JB 2HLAB 4P5TA 4FFYL 4R4FL 3SHSA 5BV7B 2GJJA 4PR5A 3QWOB 1YMMD 5I1KH 1RU9L 4P46D 3X13A 3OAYK 1CS6A 3M1BA 3HZYB 4NO3B 3HI5L 1C12A 4JDTL 4LNVA 4X0KB 3I6GB 1I7UA 1U58A 3U0PA 4ZXBC 3ZKQD 1J12A 4F9LC 1CXKA 4RAUB 2EYRA 5DD6A 4A6YH 4I5BB 3T0EE 3IU4L 2A77L 3OPZH 4K3HA 5LGJB 2DI8A 4ZSOB 1BQLL 4L5FL 4EIZC 3LOWA 4LOUD 2RR3A 5CJOL 5FYKH 3PHOA 4OM0H 1CIUA 3RP1A 5I1AA 3EO9L 3VI4F 1DBKL 4QRQA 5E2UH 1OGTB 2VIRA 3EHBD 4H5SB 2FB4H 4N8VB 4OCXH 3VU2A 5D7LA 5GS0C 4MCYB 5EU3A 2X2YA 4RAHA 3JV4A 3CFJB 4NBXB 2P5EB 3VXPA 1X5AA 3DX6A 4OZHB 3KYAA 5EO9A 4NC1E 1JJUA 3W9DA 1A6ZA 3VXMB 1FNHA 2YUXA 4JFOA 1KCUH 3HE6D 4LLMB 5DC9B 1ZGLA 5ENWA 4MJ5A 4D8PA 2KH2B 3ZDXF 4G3YH 1KTKE 1CG9B 5F1KC 5JW5A 5I17A 5ALCH 4Y5YB 4JRYB 1OTTD 4NN5B 4QRUB 3SY0A 1DBJH 4FQHA 3GGWB 5H37H 4GXVL 1T1ZA 4K55A 1DBML 4YDJA 3BP6B 3EGSB 3IB4A 5D1QC 1IEAA 2BXZA 4NOFA 1RD6A 1ZLUH 3WIIL 1CL7L 3QPXH 4B5EA 5CJXC 1RFDH 1IGTA 4H1LH 3T0XA 4UU9B 5KVGL 2ADGA 2JJWA 4HWBL 4DKEH 1BX2A 4RMTA 4HH9B 2DQIH 3P11L 3QXAB 1I3RB 4ORZC 3W2DL 5EU6E 1JGUH 2AJXL 5IK3B 1U91B 4Y5VA 4HUNB 4Z7VB 2AXJA 3DXAE 1F6FB 4DN4H 3BP7A 5C6TH 2Y06L 3B6SA 1AE6L 4OFPA 3RWDA 5T3XD 5DVLA 3V0VB 4MQTB 5BS0B 5FK9B 4MNQE 3STZB 5E08L 1RK0A 2R2BA 3C08L 1D6EB 2ICCA 4FQ2H 2VN4A 2C7UA 5A2LH 4CVUA 4WW1B 1L6XA 1NCWH 4PJFA 3T2NH 3BPCA 2A9MH 4EVNB 2EZ0D 4KU1A 1HINL 1IM9D 3O9WB 2J8UF 12E8H 1B0WA 2YA0A 3RVVC 3ZE1F 1BFVL 1A9BA 2B39A 3FOLA 3NCFB 2ZSVB 3LIZL 4IDJL 4S10A 1FLTX 4KRLB 3PV6B 5JOPE 4CU6A 1FZOA 4BFIA 4IRZL 4G6JH 3PWPE 3UPRA 3TH2T 4R6UA 4B0MM 1JP5A 4LARL 3SO3B 5DR5L 1FFOB 1IARB 1G7MA 2F53B 4BFEA 1RZIB 4PRNA 4GAJH 3B8SA 2OR9H 3C60D 5JDJA 4J3SA 1JNNH 1LEKB 5EZIH 4JLRA 5KS9B 1T89C 3GSUA 4G8GB 1P9MA 4OKVA 1E4XL 3MCKA 3TIEB 1N6VA 3BPNB 1KNOA 4HS3A 5L2KB 1OLLA 1UACH 2FEEI 2FGZA 1IE5A 2PO6D 5HGAA 1N3NA 5C08D 4J6RL 3H9SE 4ZS7H 1EAPA 4XXDA 1QBMH 3MOBH 4LK4A 4LHQB 4HGKC 1IQWH 3VXUD 4P4KB 2W1NA 3MUZ1 3PL6B 5BOZG 3TVMC 1IC5H 3OXRA 5EUOE 5ICXA 4KI5E 4HBQA 4BH7A 3NFPA 5E99L 5CJBA 2GFBB 2Q8BL 5E2TL 1FO0B 3RIAF 1U8MA 5F7HA 3SDCB 3ISWA 5IHUH 5IIEA 1MFEL 5TE4H 4G42B 4IMKA 4XCNA 4P57B 1NMBL 4E41D 4TYUA 3VE0B 2JCCA 2DBLH 1WF5A 1KLGA 2XOTA 3DYOA 3Q6GL 4JRXB 4NYLA 1JI1A 1NANI 4K8RC 3MOQA 5B21A 1FPTL 3S4SG 1OSPH 1BZ9B 1JIBA 1W0YT 4P2OA 5F93C 1SM3H 3MBED 5JORA 1J8HB 3MRRB 3C8KB 2VLRA 2R9HD 4NQDE 2LVCA 4LCWD 4HUMB 5DC0A 1EBPA 4B7LA 4E42A 2H8PB 4KGLA 3TN0D 1YQ2A 1C5DB 4R2GB 3OR6B 2FJGB 1UZ8B 4KVNH 3I3BA 3OR7A 2BVEA 3R1GH 3SE8L 3GI9L 1ZTXH 2DQDH 1CBVL 2B1AH 5DQJB 3RY5A 1J1PH 2X1WL 1D6VH 3QDJD 2X7LA 1BOGA 1VEPA 1JHLL 1EK3A 1MRCL 3AS2A 4LPCA 4HS6B 1OGAA 3MJ9L 4FFZL 2BFVL 4K7FB 2Z93A 4IOIB 3NPSB 4WI4A 1HXYB 5FGCB 4XPFH 4KJQC 1Z2KA 1EIBA 4ISVB 1ED3B 3KPRA 1ZLSL 1T1WA 2RGSA 2XXMB 3EYOB 3QEQB 3GUTB 1ZA6A 1U8QB 1MHPH 3GB7B 4FS0A 3HR5A 3T8XA 3ULUC 4ETQA 4I18C 2V2TB 3QNYB 3D25A 5E8EA 5INDA 1XGYL 1U2HA 4CN6A 3K4DA 3V2AR 4PRHA 1IEHA 1T7XA 3STBA 5DS8A 5E9DA 1YPZA 3QQ3A 3BRGC 5ACZB 2W0LA 1INQA 3ARGC 1H15A 5E6ID 4EI5A 4RFOH 1YEHH 2ORBL 1RJCA 2V2WA 4L4VB 1GAFH 1S7TA 1D5MB 4D0BA 3MRGB 2Z9TA 4Z0BL 3CXHJ 3O6ML 4CN4A 4OD2B 3VWKD 1CZ8H 4ELMA 5DRWA 2A73A 4OLXL 1LO0H 4NUJB 3QQ4B 4ZOCA 5IFJB 2DQCH 1Q1JL 2BVTA 2IAMA 2FBJL 1TNNA 3BZFB 1A4KB 3IJYA 1CI5A 3NZ8B 5E8OB 5C0GB 3A6CL 5JXAL 5C0BA 1EJOL 1UH2A 3QUZA 3WNKA 2CUIA 1T1XB 4KWUA 1KN4H 5DMIH 5ESAB 3P4OA 2C1OA 2OJEA 3S37H 3VFTB 4ZQKA 1BVLB 3OJVC 3TNMA 3D3VE 3BH9B 1FGNL 3PGCB 1QFUL 4L4TB 5ALCL 3TZVC 2VLLB 5DJDA 5DJXB 1WWCA 1P4LA 4PS4H 3L7EA 1NBZB 2BNQD 4Y19B 4R8WH 5F89B 2XZAL 1RZKL 1JNLL 4X4XA 2H1PL 4JM2D 3ARDD 1R24B 1FIGL 3SGDH 2MTPA 1S9VB 5C0AB 4ZO6A 5FUCC 3LKOB 3AROA 1OOAA 3VXRA 3MGTB 3OF6A 3U6RB 5L88H 1D5BA 2R56H 2VO5A 1N5AB 4CVWA 3F7YA 1CL7I 3ARRA 5CBAA 1TJIL 3BE1H 4N0UE 1PKQE 2R1YB 4F33B 4OBRA 3V4UL 4MJID 5A16B 5E6YA 3ARTA 2EDRA 4JB9H 4XVSH 1EFXB 1NKRA 3GMRB 1YEKH 1U92B 1JRHL 1KB9K 3HLAA 4PJ7A 2UVFA 5EFIA 2Y4SA 4JPIA 1PYWB 2R2EB 4X4ME 3ROOB 3C09C 4IHOB 1FE8L 5B3JF 1EA9C 2HFGL 3OKEB 4AL8H 1RHFA 2UY7A 4LSSH 2D4DA 5MENB 2BOBA 2P8PB 3T2NL 3UTTD 3T0AA 5JW4M 1JCKA 3IRPX 3GBMH 43CAA 5T5NF 1D3CA 1BQHB 3GMPA 4QRRD 1ONQA 1WEJL 1QA9A 1G7QA 1K9TA 3GEWB 4V2BA 4ZUVB 1C8PA 4HUVB 3RWGA 1YECL 4G6KH 1P5UA 5KJRL 4LLVA 4IS6B 4ZMAT 2F8VA 3RAJL 2WWMD 1QEWB 5E2JA 5DHVH 2BXYA 3HZKA 4APQD 1R5WB 3DSFH 3MLXL 4YHLH 4K23L 4OZFG 1EV2E 3HE7B 1AXSA 3NCMA 5FDYA 2YOCA 3FQWA 1YMMB 3QZWB 4OGAC 5IV2A 1WAAF 2OR9L 4P46B 2FIRT 2VUOA 1QHOA 3GHBH 3GMNB 3CH1B 1TPXC 1BWWA 2Q7NA 5B39G 2IWGA 5KSUB 3QRFM 2L0DA 4X4YB 3V7AG 3KWWA 4NKMB 3GJEB 4QF1B 3HAEH 4K7PY 1NGQL 3F8UB 3ZTNH 4P2RD 1MIMH 2O5YH 4N8CH 4OZIE 5HD8C 4NJ9H 2I5YH 1E4XI 3SKJH 2JELH 4EXKA 1VFAB 3HZMB 3IS1X 4QTIL 2FZ3B 2ZPKL 5IMMB 4MAUH 3D9AH 5TQ2L 4LRIA 3MA9L 4LL9A 5DJ0B 3IJSA 3L3DA 4X4ZA 1G7HB 4NP4L 1IAOB 1NBVH 1NEZG 4TULL 4A2MA 1FJ1A 4L3EA 5DDHB 5J9PA 4LAJH 2X1XR 4LP5A 2ICES 3EOTH 3SJVA 1KYOK 2I60H 1MJJB 4O51A 1QNZH 4Q9RL 3F7RA 1NBYA 2RFXA 4JFDA 4C56E 1JZ6A 1HOCB 2X4OA 3FO2A 4MD4A 2QJDA 3MNWA 1P4BH 3K8KA 3HE6B 4AH2B 1BFOB 3CX2A 4DKAA 1BQUA 4WUUE 2OZ4A 1DR9A 3MUY1 4TUOA 3G6JA 1I8IA 1NLBL 4GS7C 1P4IH 1HIMH 4P4RA 3MLYH 35C8H 1AP2A 3QUYA 4I2XE 2HT4D 1JZ3A 3OTTA 4LGPB 3BGMB 5CP3H 4GQ9L 4OFYD 5IT2H 2AEWA 1G1YA 2CDEB 4H25A 1SBBA 2Y5TB 4LLUA 4KTDH 4U1JA 4PTTB 5DMYA 5DJYA 5C0EA 2R1XB 3BD4A 4GAGH 2ZSWA 2CIIA 3IVKB 1H3WM 1A7BA 1FL3B 2JB5H 4TVPD 1UJ3B 2Q6WA 1MLBB 5IKCB 2M1KA 3UCRA 3MTRA 4RGOL 4MXQD 2XZQH 4N9GA 4OD3L 4Y2DD 1AHWC 2R4RL 2Z91B 4FRWA 2FD6H 3I9GH 4NCC2 4FQQB 3EJYC 5BMFH 5I1HL 4DTGH 4MD5A 2PCPB 3MRHB 1CDBA 4M8VA 1IGIL 4QCIA 5DVOA 3QAZB 2K3TA 4MQXC 4UV7L 4LVOC 1MWAA 4X0KA 3I6GA 3L95A 2J8HA 5GRXG 1E4KC 1NCCL 5D7KD 5HGHA 2OX5A 4RRPG 1MI5A 5F9JA 3C2SA 3AUVA 3TBTB 1S7QB 3MJGX 2NTFB 3CU7A 4WEMB 3QUMB 3V8OA 1S5IL 1IM9B 2CKNA 3UO1H 4ZSOA 2ENSA 1MFDH 2UWEE 2Z4QA 3EJZD 4U7MA 3TT3L 3AY4A 3CUPB 3RGVB 3RX8A 5KANI 4JHWL 1BD2E 4LKCB 4MYWB 4RFOL 5HY9A 4HWEL 3SGEH 5IB3B 4H5SA 4M93C 4N8VA 4QHKI 4ELKA 3G04B 3NCCB 2FX7H 4MCYA 4Z7WA 1ZWIA 3CFJA 2P5EA 2AW2A 1GAFL 4OZHA 1GCFA 3M17B 3LN4A 3PWLB 2RQ8A 3GMLB 3KS0H 1NGWA 2CLZB 3VXMA 1DANU 5IMOB 3RI5K 2N7AA 3C60B 3RVXD 5C07A 3GMMB 2IANE 4L3CB 3F58L 4YZFF 4O5LH 2QQNL 3UDWA 3GSXA 5DEFA 4G9DA 2CKBH 3VFGL 1LQSR 1CG9A 2CJUL 4Y5YA 2PO6B 5C08B 1YZZA 4GLRI 1G9EA 4JPWL 4PV9B 3DYMA 2FX9L 1CTOA 5LXGH 4NQED 2F19L 4PGEB 3VXUB 3GKWL 4PJ9A 3QUXA 1O7SA 1V3MA 1X4XA 5FUCE 4JO2L 3DURA 4YWGH 3HZVB 4D9RD 4PS4L 2CK0L 4K7PH 3P0YH 5DMKA 3BKYL 4ONOA 5CEZL 1WBYB 4M48H 4PY8J 4JVPA 1BECA 3OJ2C 4HH9A 4QHLB 4I9WD 4E41B 2HJKA 1P7KB 1T3FA 2AK4D 1RULL 2LQRA 4ONGL 4KHTL 3O4LE 5MEOB 4GKSA 1R5IB 3D0VA 2A6DB 3DBXB 5I15L 3JVGA 2XRAH 4NO2A 5EC1B 4M7LH 4HG4K 3GBNL 2VLJD 4KAQH 5BS0A 2GAZB 1MQKL 5HGBA 1JZ4A 1WWBX 3MBEB 3WFBL 1LVEA 3IJHB 4XBGB 3STZA 4Y89A 2NY0D 2B7DT 4OFDA 1D6EA 4F58L 3JV5A 4UNTA 4LCWB 3MQIA 2VQ1B 1G9MH 3TN0B 1OT2A 5DI8B 3GSNH 1FG9C 5MP6H 5TDOB 5SWSE 4QKXB 3V6OC 1NJ9B 4WGWB 1H5BA 5CJQL 5DWUL 5D96C 1JRHI 4J4PC 1RUML 3GDBA 4LSSL 3W11C 2PYEA 4XWOC 3CCHB 1MVUB 1J10A 3OKDB 1EGJL 4U1NB 3QDJB 5JOEA 5JIHA 5IMKB 3PWUA 5F6IC 4X9IA 1MEXH 5IVXA 3FO1A 2ZCLH 4WU7A 3VI4E 1XCTA 1KFAL 2F53A 3BXNB 4P9HH 1RZIA 4CJ0A 2DQUL 2D0GA 3HNVL 2IGFH 4HLZG 2VAAA 1LEKA 3DO3A 1CLCA 4L8BB 4YC2B 3VW3L 2G75B 3TJEL 1OAUH 3QQ9D 3VFNA 2E7CA 4PP1D 1DQML 1Y6KR 2ZUTA 3GHBL 4WFHD 3U2SA 5J13C 3ZDXE 2XZCH 2E5EA 1P6AB 4LSVH 3GSWB 5I76B 3MYJA 4OLVL 4NGHL 4K3JH 2YN5A 5D8JL 3QHZL 2B20A 1QYGL 1M05A 3EOAB 1G9NC 1BZ7B 4HKZB 5L2JA 4TUKL 3HNSL 5E6IB 4Y4HC 2DLGA 3U46B 4Z7NF 1JGLH 4NJ9L 5KG9B 2OI9C 2I5YL 1A3LL 3SKJL 1JHKH 2OQJA 4AY0A 3ZKXB 5GGUB 4G42A 5CEXB 4HFUL 4P57A 5E7BA 1ACYH 4G43A 9CGTA 3MZTA 3X12B 3VWKB 1FBIH 1A3QA 3HMXA 3KPOA 3SCMD 4JRXA 1NBVL 1KPVA 2VXSL 3SE9H 5IVNA 3VFSB 2EH8H 3S4SB 2ZWLT 4PY7B 1CU4H 5GS0L 1C08A 3C5ZC 3L3JB 1L9NA 1OTSC 5GZND 4OT1H 3ARFD 1QUNA 5HDLA 1AGCB 3C8HA 1J8HA 2PXYC 3MRRA 5E2WL 3DIFB 5TDNB 3C8KA 4PJBF 5TE6L 3TT1L 1C1EH 4YLQT 5C09D 1R3LB 4NNYA 5CZVL 4X7EC 2H8PA 2HFEB 1C5DA 5K9JL 5FCUL 3OR6A 3FQRA 1EJ6A 1UZ8A 2V9RA 3UAJC 5LGHL 3GSRB 5I9QC 1AQKH 4KZDH 4HK3N 3PNWB 2VISB 2BNQB 5DQJA 2ZJSH 1OTUC 2AJVL 2J8UE 4MJ6B 4JM2B 4XP9H 3ARDB 3ZE1E 4GW1B 5E4EB 1IBGH 3SDXA 4OQTH 4HS6A 5IVOA 5J8OA 3HRPA 3M8OH 5J12B 5I1DB 1P7HL 1F5WA 4M1DH 1HXYA 5M7QA 4LVHB 3UZQA 4PJDF 1G6RB 3KPSD 4G6AD 1RUAL 1ED3A 5EZOH 1N59B 1TZIB 3EYOA 3O2DL 3QEQA 3GUTA 3L1OH 1U8QA 3UJIL 4KKCD 4MJIB 3GB7A 5IW6A 3CVHB 3MA7A 2NQCA 1R0AL 1QSFD 1GHFL 2FD6L 2V2TA 3EDEA 5F21B 3PQYD 1MJ8L 2HJFB 5EOCH 1ZAGA 4Y88A 1GJIA 1OARH 5FYJD 4ZYKB 4R7NB 3BT2H 3G5YA 1YEJL 3F5WA 5ILTH 4YPGA 4QXUH 1QG3A 3RU8H 4U31A 4UIMA 1DCLA 1WZ1H 1C7SA 1B0GB 1YC8A 1CK0L 3HFML 2P47B 1TJHH 2UYLA 5F1NB 2YN3A 4IIQB 3SKNB 5A43C 1KCSH 1V3LA 6FABH 3EYFB 5DVKA 4WWKC 3MRQB 1IEBA 3V5DB 4QRRB 3MRGA 4P99A 2GSIB 1F6AB 4OD2A 4WFGE 3BKJL 1LO2L 5EC2B 2ESVD 5C70A 2CDFA 2QQLH 1DTUA 4LCCB 1A6TB 1HEZB 4NUJA 3QQ4A 1RUPL 5IFJA 1IAIM 4HUUB 4UOJA 5BO1H 3D0LA 3O3AB 3BZFA 4APQB 1HHKB 3NZ8A 1JI2A 2QSTA 4Y16A 5C0GA 5FO7B 1Z6JT 5DK3A 3T0BA 2MPAH 4PRIE 1IMHC 4LU5L 2J5LC 1T1XA 3LB6C 5SX5K 4FQIH 5DRZB 1ZLWK 3WFCL 4JM4H 1AQDA 3VFTA 4XPHL 1BVLA 1RMFH 3MXWH 3BH9A 3BSZH 3OAYH 2LU3A 4L4TA 2E7BA 2VR9A 4P2RB 5DJXA 2BRRH 2CXKA 1NBZA 4HIXH 2XTJC 5E8PB 5CINL 3BZDA 5DF0A 4AMKH 3WIHL 4X83A 1LDPL 4FHBD 4I4WB 3SE3C 5E5MB 3H0TB 4IEFB 4WTZA 1FFNB 5FO8A 4MB3A 3U6RA 4PRDB 5FYKE 2MCG1 4ODSH 5TH2A 2IPUG 3C6LB 2R1YA 3HUJB 3UJTL 4F33A 3SO3C 2BHZA 5CZXD 2AGJL 1JGDB 1ND0B 2ERJB 4WI6A 1KCRL 3QSKB 3UBXI 4YO0A 3K0WA 5JW3L 1U92A 4AEIH 3V6OE 4DGVL 1T1YB 4MJ4A 1FAIL 5A2KH 1HSBB 2DLFL 1PYWA 1X5HA 3DVNA 4YIQA 2EO9A 2ZUXA 3ROOA 4ZTOH 1KB5B 4R0LA 1I8KA 2NY6C 2EIDA 3NZHL 4U1GB 4OD1H 4X80L 1PG7X 3O11B 2C3WA 2FHCA 2P44B 5D2LB 4L1HA 1YYMH 1LP9F 3IFLL 4P4KC 2HT2C 3PL6C 5TGBB 4ERSH 1CYGA 2SEBA 5H35A 1BQHA 5JHLH 1X5GA 1WT5A 5HI4D 1OT1A 4O4YH 4Z78B 5MI0C 5KANG 4LRNH 1AI1L 2W59A 2Y36H 3MLRH 1FVDA 3KXFE 2D9QB 1NGXB 5CS7A 4H8WH 4XNUL 4JN2A 5L9DL 4IS6A 3TPUB 1KC5H 3PDOB 2FO4A 4X8XA 4Y2DB 1I9IH 1YY9C 3QIUD 5C0RL 1FL6B