3I2CH

Crystal structure of anti-il-23 antibody cnto4088
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVQLVQSGGGLVQPKGSLKLSCAASGFNFNTYAMHWVRQAPGKGLEWIGRIRSKSHNYATDYADPVKDRFTISRDDSQGLLYLLMNNLKTEDTAMYYCMREGIYGSFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO4088 LIGHT CHAIN
publication title Noncanonical conformation of CDR L1 in the anti-IL-23 antibody CNTO4088.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH01
3MMEA 5I2IB 3MMEB 2FHCA 2YD6A 2IG2H 5DEZA 3NACL 3JSSA 4H20H 4NNPH 1CLCA 1DBJH 1X6LA 4D0CA 5J1AB 4D0CB 2A6JA 4L29A 4X5WA 4CVWA 2A6JB 4L29B 4H0IA 4DW2H 4HLZH 3DGGA 3DGGB 4QGTA 4BZ2L 1P2CA 1Q1JL 2GUOA 2GUOB 4HGMA 2X7LA 2A9ML 4G9DA 3ZYZA 5I1GL 4G9DB 5EB9A 4NQEA 1JUFA 5IKCB 1F42A 2X9YA 3GK8L 4NZUL 4PJHE 4P49A 2BX5A 4U6VH 4HFWA 3NTCL 4HFWB 1VERA 2QSCH 2ORBL 1R3IH 3ARFC 1QPPA 1T4KA 3BT2L 5DT1L 1G0DA 1XF1A 2W0PA 1QFOA 2QQLL 3CXHK 1UT9A 1QBLL 4JCLA 1FNGA 1D9KA 5C09D 1D9KB 5FO7A 5FO7B 2MCPH 2V5TA 1V3KA 4FHBD 4HD9A 4Z8FH 3C2AL 4KJQC 4Z7OE 5L6YH 3BKML 1GOFA 2CDGA 1U2HA 1KB9K 2CDGB 1TVDA 1MJJA 5DMIH 1MJJB 4AMKH 4XP4L 3MROA 3MROB 1TVHA 1TVHB 4BJLA 3ILQD 4G3YL 4WCYL 4JQIL 4R9HA 3VWJD 2YUZA 5TH2B 4BFIB 4NO5A 1EVUA 1G7MA 1I1FA 1G7MB 4M7JL 1I1FB 3UTPD 2Z0BA 1IZKA 4YO0A 2A0LC 4W4NA 3SDXE 4YO0B 3SKJL 3FZUD 4LSSL 4HUUA 4LF3A 3IJYB 4HUUB 4LF3B 4RGOL 2X6MA 5I19H 3N85L 4YDIL 4OCSL 5DUPL 2CLRA 5FEBA 2CLRB 3CSBA 3TYGL 4BKLB 4DK6A 3VD9A 5EOQL 3T65B 1X5IA 1ZVSA 1ZVSB 3OKYA 4WEBH 1QA9A 1QA9B 4MA7H 1QTYT 1YMME 3RKDC 1RULH 1YPZA 4U6YB 1YPZB 2W65B 4XMPL 5F9OH 2GAZA 3U7AA 4KZDH 2GAZB 4JM2C 4G43A 4G43B 4OF8A 5IFHL 2F19H 3RU8H 1VENA 3EOTL 5ACZB 3QO0A 3V7AG 1X7QA 1BIHA 1X7QB 3IS1X 2HT4D 3ESUF 4ZMAT 4L4TD 5JW4N 5E8EB 1QZ1A 5JOFA 1SQ2N 5JOFB 3RA7H 4PJGB 1D5MA 4ELKA 1D5MB 4ELKB 3QQ4A 3QQ4B 1UM6H 1GZQA 2GY5A 2VE6A 1GZQB 2VE6B 3O8XD 3PWUA 1FO0L 1GSMA 3PWUB 3KXFE 4UT9H 4U3HA 4JHWH 2YBRA 4YHNB 2YBRB 1T1XA 5EC2B 1FCGA 3MV9E 3VU2A 2GW5A 3OKMA 2EYRB 3OKMB 5E56A 2DIBA 2IBGA 3P9LA 2HRPL 5FYJD 3MGOA 5HYJD 3MGOB 4EDXA 4EDXB 1LO4L 1NSNL 4MGXA 5B38B 2QQNL 1Z3GH 4B7IA 3RVUD 4NWTL 3K2UH 4L4VD 4KJQD 3UPAA 1OTUD 3NOIA 4FZ8L 1OWWA 4JR9L 1DBKL 3NCBB 4OJFL 3BRGC 3MYZA 3MNWB 4RISL 3QP3A 4POZC 1G9EA 5ELIA 4HC1H 3VD4A 3UZVB 4PGDA 1TDQA 1JYNA 2W9LA 4TQEL 2DTML 4WHYH 2CPCA 5C2BL 2AQ1A 1H8NA 3QA3A 5E2WH 3H9HA 3IGAA 3H9HB 3IGAB 2A0LD 1DQDL 4JPWL 3S96A 3SKUD 4KHTL 3TN0D 4HXBH 4GRLA 2B2XH 4TULL 4GRLB 3HG1A 3IDYB 3OGCB 4KV5F 2P42B 1QYGL 3RFZC 2UWEE 4IRJA 2C4FU 2YD1A 1XCQA 1MCNA 3D3VD 1XCQB 5GGVH 3B9DA 2R2EA 1GOHA 2R2EB 2O5XH 4YDLC 1NCWH 3RAJH 3E6HB 4S0TD 1RURH 3ESVF 1WCBA 2UUDH 1WCBB 3RKDD 3BKYH 5K9QI 5EUOA 5EUOB 4XAKD 4X9FA 3KHQA 5F7FA 4YDVA 1F8TH 4YDVB 4DAGL 5KW9L 3OXRB 1I8KA 1I8KB 3GSVA 3GSVB 5F7EH 5H8DA 2C3XA 2E9IA 3O11A 4JO3L 3AM8C 3O11B 4C56A 1KTLB 3L5JA 1HHGB 4C56B 3WS6C 3HC4H 3QQNA 2DYPB 1OAYL 3S7GA 3Q5TA 5IHBA 3QI9D 5FDWB 2VDNL 2DM3A 3WFDH 3V6ZA 1PG7X 4U05A 2VIRA 2VIRB 3H2WA 5JIKA 1I3RA 3F7VB 1Z9LA 4YHOH 1I3RB 4U0RB 3IDIA 3IDIB 3ARBC 3UJIH 2XI9A 2EH7L 1FJ1B 4HH8A 3GUTA 4W81A 3GUTB 2FJHA 5DVNA 5FUCC 3KAAA 2FJHB 4PJIF 3D18A 2Q1EA 4XPFL 4Y1AA 1VDGA 3B5TA 4LVNB 2OSLA 25C8L 3ULSB 4NM8H 1RUAH 3VWKD 1LNUB 2EDHA 3K80A 1B6DA 1OOAA 2CKBA 3O4LE 5BV7B 2CKBB 4PJGF 2A6DA 5F96H 2OJEA 2A6DB 2YD5A 2OJEB 1QFHA 1XFPA 4YZFE 1F02I 2NMSA 1LK2A 1LK2B 2A1WH 3MLZH 3P4NA 3P4NB 1S9VA 1DZBA 1S9VB 4XNXH 3SE9H 5FYLL 4NQCB 2EH8H 1V8HA 2EE2A 5FFLA 4WHTB 2C4XA 1KYOK 3RY5A 4KTEH 4KJPD 1MFBH 4G6KH 5I1EH 4TNWF 3GKZA 3H42L 1F45A 2FGWH 3WFBL 1HH6A 1HH6B 1CFVL 2YXMA 4RQQB 4OGAC 3GB7A 4M43H 3GB7B 3DETC 4W68A 1S7QA 4OIAA 1S7QB 4W4OA 3LKRB 1A3RL 4JLRA 8FABA 4JLRB 8FABB 2WQ8A 4M3JA 1N0XH 3ARED 4D9QE 4ZTOH 2WINA 3QR2A 2WINB 2HH0L 2A9NH 1GYAA 3HTLX 2AV1A 4CGTA 2AV1B 1AC6A 1I85A 1TCMA 4RFEA 2L7UA 4RFEB 3U83A 1T2QH 1EA9C 2V2XA 2V2XB 4RGMB 1E6OH 4YXKL 3QUML 1BZ9A 3ARGB 3NACH 1BZ9B 1AGBA 1AGBB 5JIPA 4U1SA 5C07A 4ETYA 1Z9SA 4RMRA 4U1SB 1BP3B 5C07B 4DEPB 5KJRH 2D7OA 1FVDA 1FVDB 1R3LA 2C3VA 2C3VB 5EN2B 2P44B 3QNYA 5I1GH 3QNYB 1I1AC 1F4WL 1FLRL 2P24A 1A3QA 4Y2DD 3GK8H 2W59A 4GXUN 2MCG1 1YJDL 1WT5A 2BSRA 2BSRB 4UUJA 2ORBH 3MRFA 4UUJB 3MRFB 3VI3F 4ZXBC 3DGCR 2GJJA 1ZK9A 2QQLH 5HVWA 5I1CL 2NXZC 2X44D 1GGYA 2VNCA 1GVIA 4Q0XH 4CMHC 2YRPA 5SWSE 2NQCA 3LOWA 2NY2C 4G9FE 1TZGL 2Z8RA 4AQOA 5T1MA 5T1MB 2VN7A 2EICA 5JQHC 5DURD 4L5FH 2EC9U 5CINH 5E5RB 5GS2D 2OBGA 4XP4H 3PWLA 1II4E 3PWLB 3IU3B 4M7ZC 4L8SA 4L8SB 3HFMH 4YNYA 4G3YH 2CIIB 3WLWD 2DLEA 5KSUB 1A9EA 1YEGH 1A9EB 5KANG 4MA1B 3ZT7A 1JP5A 2FBJL 1K2DA 2W0FA 2W0FB 4FTVA 4FTVB 2DICA 5DEGB 3SKJH 3VDBA 4LLAA 3RWDA 4Z7NE 4LSSH 3RWDB 3CFCH 5SWZE 1BZQK 4RGOH 4FZEL 2DWEA 4YDIH 3MSPA 4GG6A 4OCSH 3ZSTA 4EZMA 4GG6B 3QCUH 5IJKA 4JFDD 4N9OB 4OFIA 3IFOA 3WXVL 3VXSD 3TYGH 4NJAL 4OGAD 4L9LC 4MB5A 1FG9C 3DETD 4O2EA 1P5UA 1WWWX 4O2EB 1QRND 1OGAE 2FEEI 3QEQA 3QEQB 4LPXA 3CH1B 2D03L 4E9LA 1A64A 4LK4A 1JTTA 1S7WA 3MJGX 1IC7L 1S7WB 4GUPA 3V6OE 4GUPB 5CD3A 4XMPH 5CD3B 5SX4H 5GHWL 4TN9A 5JDSA 5BV7L 2CKBL 5JDSB 5IFHH 1AXSA 1I8LC 1UZ6E 5ITBL 1TNNA 2DI7A 3NGBB 3B6SA 2H2PC 2WAHA 1CLZL 3B6SB 4X83A 3V8OA 4BQ9A 3B83A 2XY1A 3SPVA 5J56B 2OR9H 3SPVB 1SY6L 3MOQA 3UXFA 1KENH 2F54E 4R7DA 4R7DB 2K9UA 4N5UA 4PGCA 5GGVY 4PGCB 1NGQH 5D96C 3BRDA 5DO2D 4EI5D 2PW1A 3QPQC 2AERT 2PW1B 1Q0YL 3QO1A 2PYEE 5TGBA 3SCMB 3QO1B 5TGBB 4P46D 1FO0H 2QEJA 1F4YL 2E6PA 2VC2L 3VGAB 4LLWA 4LLWB 2VXQL 5F7HA 2HRLA 1KB9J 4ALAL 4B53A 4NN7B 2E6QA 4X6CF 4WHCA 4JZJC 1BVZA 1UKTA 1LO4H 3FFCE 3LQAC 4G7VL 4BK4A 1I9JL 2QQNH 3L5WB 1MIML 4I48B 4GRMA 1QHOA 4QOKE 4YC2C 3QXTA 1DVFA 1DVFB 4PJAA 4PJAB 1NBQA 1HHKB 4UI2A 5JXAL 3RVWC 4FZ8H 5E2UH 4X6DA 2EE6A 5GRJL 3WKML 4X6DB 1DBKH 5MENA 3VFVA 5MENB 3D48R 3VFVB 2UUDK 5JHDD 5KSVB 1F3JA 1F3JB 1W72H 4WO4A 4WO4B 3DUHA 5L8JB 1SJHA 3ZDYE 1J0KA 1SJHB 4IRSA 3J7HA 4IRSB 2Q8AH 5IBLD 5D1ZD 3LPFA 2PXYB 2UZYB 5C2BH 1YEJL 2WLZA 3ZHDA 2X5PA 5BO1L 1NAKL 3HKFA 4JPWH 1ED3B 1EUUA 1S7RA 1NFDE 5D6DA 1DANU 5DC9B 3DX7A 3RVTC 3DX7B 4AIXA 1FIGH 2P8PA 2P8PB 3W39A 4HGWB 3W39B 3ECBA 4L4JA 1AQKL 3ECBB 3DMMC 3I02A 4RA0C 3MJ7A 1S5HA 2VXVL 1S5HB 4OBSA 3PWPE 1XH3A 2X4TB 4FQXC 1XH3B 3FQXA 4MHHI 1YEIL 4KK8D 3O3AA 2Y06L 4P2QA 2WUCL 4P2QB 4URTB 2IWGA 4XP6H 5D5ME 4LEXL 1NLBL 5B39G 3N50A 4NCDA 2NZ9C 5FA4A 3RIAF 4JRXD 5FA4B 5KW9H 4ZSOE 2EIZA 3VXUA 5F3HA 3VXUB 5F3HB 5LXGH 1QSEE 2ZSVA 2ZSVB 4HBQA 4D2NA 2FHBA 4RA3A 2DI8A 3MUZ1 4WTXA 5E1HB 5HI4D 2VZ3A 4J4PD 5KVEL 3PV7A 4WI4A 2YK1H 4PJ5A 4PJ5B 1RZFL 1OAYH 2ZG1A 3CXDH 3SO3C 1CXEA 4XP1L 2VDNH 5AZEL 4Q6IC 5GS3A 1K6QL 4GMTH 2GY7B 5FYJU 5BMFL 3QPQD 1G7LA 5J57B 1G7LB 3VXPA 4NQSA 3BH9A 3EO1A 4NQSB 3BH9B 3EO1B 2HLFC 4XRCA 3RPIA 4XRCB 3RPIB 2H41A 2R1XA 3T4AA 2R1XB 3T4AB 2CK0L 4XI5C 3JVGC 4XP9H 5K93A 4OQTH 3EYFA 3EYFB 2JE8A 4PPTA 5IW3A 1HILA 1HILB 3O45A 5I1HL 2QKIA 2QKIB 3AB0C 4QEGA 3QFJD 1S7TB 4QRRB 2OR7A 1NCCH 1Q94A 1Q94B 5T3ZL 3LQZA 1HQ4A 3LQZB 1HQ4B 3RVWD 5TJWK 5JTWA 1S5IH 4ODWA 3BGFB 2XWJA 2XWJB 2NY4D 3LDBC 2VITB 4KJYA 4KJYB 4M6AA 5FAAA 3CFBA 4ZAKD 3CFBB 5BZDA 3H9ZA 5BZDB 5C7XL 2A74A 2WW8A 2A74B 5K59E 5AG8A 4M7LL 1A6UH 3BGMA 3EIFA 3RL2A 3BGMB 3RL2B 1ZA6A 2HH0H 1ZA6B 3MRCA 1KCSL 3BKCL 1G1CA 3MRCB 1PX4A 3WJLA 3L3KA 3V6OC 3L3KB 3MRJA 1DDHA 1DDHB 5J13C 4YXKH 3QUMH 3W82A 3ORJA 1KLGA 3ZKXB 1KLGB 1HIML 4HAFA 1G6RA 1G6RB 3S36X 3I3BA 2DL2A 5IT2L 4RAVA 4RAVB 5T1DL 4I0CC 1MRDL 5I1IL 5D72H 1KSRA 2AXHA 3IVKA 3IVKB 4YEEA 5GRUL 2YS4A 4Q74A 5MP6H 1A22B 4GRWF 2CGRL 3KJ4B 4PJEE 1G7PA 1IAIH 1G7PB 3QDGD 4HKJA 5FUZH 4HKJB 2APWA 4LARL 4W70A 4LGSB 3E3QC 3OZ9L 4E41A 4OSUH 3R1GH 4E41B 1N4XH 5DJCA 1YN7A 1ES0A 2DIJA 1CFBA 1ES0B 2MQCA 2H45A 1M7IA 1M7IB 3FT2A 4MNGE 4AIZA 1PYWA 4AIZB 1PYWB 1FV1A 1TXKA 1NC4D 3BD3A 5I1CH 4AY0A 5F7NC 3WDHA 2R0WH 3CFKA 3CFKB 3U9PH 5ADOL 3QUYA 3QUYB 3LEYL 2R2HB 3V7MA 12E8H 2R9HC 2VR9A 1TZGH 2AJUH 4MD5B 4DVRH 4FNLL 5IMMA 3O4OB 5IMMB 3ZTNH 1CTNA 1KYOJ 4NJ9L 1AKJD 4MQTB 2IBZY 1E4WH 3RHWF 4OBRA 3GMMA 3GMMB 4HBCH 1I8IA 1J1PL 3EOYG 1I8IB 4ODSH 1WEJL 1T3FA 1T3FB 3RWJA 3G5VA 2FBJH 2V5MA 2HJFA 3G5VB 3GBMH 3PGFL 2HJFB 3DX9A 4FFVC 3DX9B 3MBEC 5C6WH 4TUKL 4D3CL 3IDMA 3IDMB 5DD5L 5SX4I 3C6SA 3PQYE 3C6SB 4G8GD 4H0GA 5HVHC 1MELA 3F7PC 1ZHKA 1ZHKB 4R26L 3VFOA 1H15B 4XWGH 4JKLA 3O6LH 5F9JA 5F9JB 1J8HA 4P2OA 2D03H 1J8HB 5DJ2A 3ZDXE 5DJ2B 1UM4L 3BN3B 3V4VH 1IC7H 1OD7A 3RRQA 4F7CA 3TO2A 3TO2B 2VLJD 3AROA 3S4SG 5GHWH 5ITBH 4HHAA 5T1LA 4HHAB 3NAAH 5T1LB 1T20A 3IDJA 1OSZA 1CFNA 1T20B 1MLCA 3IDJB 1CFNB 4M5YL 1BOGA 1BOGB 4PD4K 1EDQA 1SY6H 5EU5A 4PJDF 4LVHB 4ONHA 5EU5B 4KI5C 4ONHB 2C9AA 3FCTA 3FCTB 1NMCB 1U8PA 1R0AL 1JMXA 1U8PB 4J23A 2K7QA 3MLYH 4WNQA 3MJ8A 4WNQB 3MJ8B 3CZFA 3VG9C 4NUGH 3CZFB 4W6XB 4U3XA 4NC2B 1WQVT 2FO1A 1Q0YH 1CDHA 2Z93A 1QUNA 2Z93B 3HUJF 3OKDB 3NIGF 5JPMA 5JPMB 3BZEA 3BZEB 1B0WA 4YR6A 3O0RL 2VC2H 4YR6B 2VXQH 2VN4A 3BI9X 5KSBE 2Z91A 2E7HA 1VGEH 3F7YA 5GSRA 5GSRB 5E95B 1P6AB 1OTTD 5HYEA 3PDGA 4G7VH 3RZCA 2WIMA 1WAAA 4G6MH 5E9DE 3C5ZA 1I9JH 3ARSA 2V6HA 1G6RL 3TZVD 1BGXH 1EAJA 4PLOB 3VW3L 4QRPE 5JXAH 1ZS8A 1JWMA 1ZS8B 1JWMB 4PBXA 3CLEH 5GRJH 4ZUUA 3SGKA 4GBXA 4QWWD 4UILL 4GBXB 3LD8B 4Z7VB 1QO3A 5HHNA 4XBGA 5HHNB 1OARH 5MEOB 4XBGB 3UTZA 1T5XA 3QULA 3UTZB 3QULB 2J8OA 3PV6A 3LQMA 3PV6B 5AZ2L 4KKLD 4I0PA 4I0PB 3CSYA 4YFDB 3CSYB 2IPTH 2MKLC 5K9QG 4PLJD 3H7BA 4FFVD 3H7BB 1NAKH 4PTTA 2NY5L 1CD0A 4PTTB 4XPBH 1MCQA 2XQBL 1ZLSH 1LDPL 3GMNA 3MCLL 3P30L 3GMNB 4OT1L 5CZVH 1FFQA 4QTIH 2MKWA 5D1XD 2FB4L 1YA5A 5HHOA 3GJEA 3ULUF 5HHOB 4JG0L 5CJOH 3V9FA 3LB6C 4U31A 2HFGL 4JRYE 2IAND 3VD3A 3DO7A 2X1QA 4XPAL 5EZIH 4Z7WF 3DO7B 2WUCH 3KPMA 4P4KD 2J6EA 4TUJA 1IMHC 4TUJB 4PJ8C 1NLBH 3ULUL 3UDWA 3ISWA 3OX8A 5KVMC 4PUBL 4NIKB 2AEPH 3BEWA 3LV3B 3BEWB 5HTSA 3EYQD 2Y36H 1YECL 3DLQR 4PLKD 1BFOA 1BFOB 2A6KA 2A6KB 5EOCL 5HHVH 1TQCB 4XHJD 5KSAD 2ZUXA 5AAMA 1FYHB 1GOGA 1RZFH 4KI5D 4XB7A 2DQIH 2J8UF 5DJXA 1JHTA 4XP1H 5DJXB 5CJ5A 2BP3A 4XAKE 3RIFF 4MJ2A 4DFHA 3BO8A 3RX7A 5IQ9A 5BMFH 5I73C 3H3KA 1L6XA 5JZ7C 2WP3T 4NNXA 5E08H 4NNXB 4PJ7F 4FQJH 4WTZA 3VXME 3EGSA 1RZJL 5B22A 1U8OA 3EGSB 1U8OB 3PHQA 5HYQA 3PHQB 5HYQB 1MNUL 5FCSH 4OD3L 1ADQA 5LCVH 4P2YA 3E1F1 3FO1A 3FO1B 1UC6A 2R0ZL 3QDJE 4EUPH 4OLUH 4ZDHA 4ZDHB 3ULVC 4YK4B 3ROLB 4HLZG 5DFTA 4YUEL 2FJGB 2MHAA 4HKBA 4HKBB 4PRPA 4PRPB 1CGWA 3IETA 3UEZA 4MNHA 3K1KC 3IETB 3QUXC 4MNHB 1JNLL 2XTJE 4X7EC 1ULVA 1AGEA 3I75A 1CFTA 2EECA 1CFTB 3I75B 3P11L 1EEYA 3UBXA 3L5XH 3ZDZE 1EEYB 3UBXB 4ODUB 4JCMA 4CNIA 1Q9OB 2W9DL 4KC3B 4CNIB 5I9QB 3QRGL 1ZVYA 5BJTA 5BJTB 1M05B 4R2GD 2PW2A 1P7QB 2PW2B 4FABL 4JEGB 4PJ9A 1S3KL 4PJ9B 1SHMA 5GGUA 5GS1C 5GGUB 1FSKC 3U46A 4F8QA 3U46B 4QXTA 1KCSH 4QXTB 3BKCH 5I71B 2BY1A 5DMJB 1F4HA 5T1KA 5GGTA 5T1KB 2HLAA 2HLAB 3BE1H 4M1GL 4WU5A 4WU5B 4Z7VF 1XAUA 4P2RA 1NBZA 4P2RB 1NBZB 2IAMD 1IAII 4U6TA 4NO3B 3LB6D 3S5LA 4JKWA 3S5LB 5JLZA 1HIMH 5JLZB 5KTEL 2BNRE 5F1OB 1AXTL 1G0XA 2EZ0C 4PY7B 1MRDH 2O5YL 5I1IH 5E6IA 1TENA 5E6IB 1RI8A 2PO6D 6FABH 4PJ8D 1HSAB 1LE5A 1LE5B 2F74A 1ZT7A 2F74B 1C1EL 1ZT7B 1VPOL 3HS0A 3HS0B 4KAQH 1L7IL 1U3HD 2VL5A 4LARH 5F44A 2VL5B 3CLFL 4XVJH 3DNKA 1MFCL 5HD8D 4P9ML 3T0ED 1KIUA 4Y5VA 4GRWH 3DARA 3RGVA 4I9WD 2NX5D 3RGVB 3MRIA 3WNOA 3MRIB 3O6FA 1GPOH 1K5NA 3O6FB 1CXIA 1K5NB 3VJ6A 5K9JL 4O2FA 3WFCL 4L3CB 2O26U 4EN3D 4GXUM 4PS4L 3MOBL 2CIKB 4X98A 1KGCD 5E5MA 5E5MB 3TJEH 1I7ZA 5AWNH 5JR1L 1I7ZB 2VDPH 2N4IA 3TT3H 2CXKA 3ARDC 4EEEA 2J6EL 3ILPA 4FNLH 3ILPB 1M71A 1M71B 2EDQA 2FATL 3JTTB 4NJ9H 3FAWA 3BESR 3V6BR 1MF2H 5J06A 3ARTA 2DD8L 2D7TL 2V17L 1AR1C 5C0CA 1NCBL 4OD2A 4OD2B 5DDHA 1T5WA 5DDHB 1WEJH 4XXDA 5IVXF 3SE4A 3BW9A 4XXDB 3BW9B 3MCG1 2AABL 5EA0L 4GO6B 1FVCA 1FVCB 3GEWB 3MO1A 4WEUD 3MO1B 1IGMH 4D3CH 5D70L 1IGIL 5ABDE 4Y4KD 3QAZB 4G5ZL 1DFBH 4MJIE 4DKFH 3U7YL 5HHQB 1X9QA 2E7CA 4PV9A 4YHYB 3WNLA 4UIMA 3W9DA 5IGXL 4UIMB 3W9DB 2YPVL 1IKNA 5FECA 1UJ3C 5FECB 3UJTH 5GQBA 1ADQL 2X41A 4WW2A 3RWCA 4WW2B 3RWCB 4XPGH 5DJDA 4XHQA 5JO5A 5DJDB 3L3DA 1UENA 5JO5B 3L3DB 4X5LA 2PETA 1AI1L 3HHRB 2OTWA 2AGJL 4RGNB 2OTWB 1QKZH 1LEGA 3JWDL 3SJVE 2AV7A 2AV7B 1QR1B 4KVNL 4YXHL 4XCFH 2ED7A 4LCWD 3NN8A 3U0WH 3NN8B 3RWEA 1F4XL 3RWEB 2JJVA 2VUYA 4M5YH 3PP3H 3WE6A 1BBDH 3WE6B 2PN5A 4P0DA 4CN6A 4HK3N 1WZMA 4PB9L 1TTUA 1EHLL 2O5ZH 4GAJH 5JW3L 4BA8A 1X5ZA 3HC3L 5C0AE 4MZ2A 3FOMA 3HI1A 5BS0D 2I07A 3S3JA 1HKFA 3AMLA 4JY5H 5IG7A 1SVCP 5IG7B 1H8SA 1MFEL 2P5WD 3IAPA 4BFEA 3GSNA 3GSNB 3GGWA 4GQ9L 5GGTL 3GGWB 1WBZB 2F9BT 5I0ZA 3MLUL 4V1DE 2YHGA 2R1WB 4QHMA 5D7LB 4QHMB 2K1MA 2P45B 5A2JH 5IB5A 5IB5B 4JPKL 1KLUA 4OB5H 3S6CA 4RNRA 4RNRB 5HI5C 4UILH 4P9HL 5D71L 5L2KE 3ABZA 1DSFL 4S1RL 4UQ3B 3ARWA 2XTJC 4MXVE 4PP2A 5ICXA 4PP2B 3G04A 5ICXB 3G04B 5E4EB 3ZKSD 4NQED 4PIRF 4TTDC 2VZUA 2BVTA 1HYSD 1CF8L 2XT1B 4M93C 5T3XL 2OP4L 1ZWIA 1ZWIB 1Q72H 4F58H 1LDPH 3RIAK 3P30H 3QWRA 1FNFA 2QADB 4S1SL 1JF1A 1JF1B 3B8YA 2BY3A 3SEPA 3LPWA 4APQC 5IWLA 3K8MA 4MNQE 3VRLF 1CGVA 4HCRH 1JV5B 3PE9A 5DC4B 1D9KD 1H3UA 4C83A 4C83B 4G6FB 2NY1B 2HFGH 5HYFA 2ZCHL 5DFWH 2EDFA 2J8HA 4PD4J 2B39A 5E70A 3OWEA 3AMKA 2DF3A 1FYTA 2CR6A 3ULUH 4HWZA 4HWZB 3UAJC 2PYFA 3T09A 2E7LC 1WBXA 1QVOA 1FFNB 1WBXB 1QVOB 4F57L 3OTTA 1FORL 3A0OA 1PSKH 3L1OH 1DUYB 1F6FB 3LRSA 1NANI 3LRSB 1WZLA 2EIDA 4L1DA 2I9TA 2HTLD 4X7SL 2I9TB 2D9CA 4H25A 4H25B 4XH2A 1DTUA 4NCC2 1NMAH 5C86A 3CDFA 3B2VL 2BRRL 3TJHC 4YHLL 4K3JL 4L8BA 1UVQA 1AE6L 1UVQB 3WJJC 4PRHA 4PRHB 2P5EE 4IRJC 5DD0L 3OAZH 1K8IA 1TLKA 4M5ZL 3KPSE 2IC2A 2L4OA 1JYVA 5I8CB 2QQKH 3G6AA 1MNUH 1VEOA 2CK2A 2R4SH 4UV7H 4XTRC 4HS8L 3TM6A 3MX0A 4BFGA 4N0FB 5DD1H 2B5IB 5GGSA 5GGSB 3RVVC 3RDTA 3RDTB 4PJCE 5DVOA 5CEZE 3B9KC 1NDMA 3EDFA 4QRSA 1T89C 1N2RA 4QRSB 2VAJA 3WN5B 1N2RB 5D1QC 3RUGE 4YUEH 3MZTA 1UXWB 5H37G 4NKQB 1X4ZA 1RK1A 1RK1B 1MIEH 2HFEA 3ZE0F 2HFEB 4M6NL 2NCMA 4O51B 5C3TA 5HI5D 5FYLD 1NLDL 4OZHB 1T2JA 5K9KB 3MODL 4U3CA 4XAWL 2W9DH 1JHKL 5HYSB 2PR4H 5DRWA 5DRWB 1TPXB 4X7DC 3U6RA 3U6RB 1PDKA 4IS6A 4IS6B 1H5BA 5ICZA 1H5BB 3IB4A 5ICZB 4FABH 1S3KH 1F90L 2DM4A 3RNQA 1M7DB 2LAAA 3RNQB 5L0QB 3G6JA 3GSNL 3G6JB 4JDVA 3W2DH 2V2TA 4JDVB 4JQXA 3QSKB 3OG4B 4E0RA 1LO0L 4E0RB 1QSFE 5DF0A 5F1IA 1EX0A 2AJXH 4RDQF 1KEGL 2CUIA 3W11C 3P4OB 1L0XA 3NCCB 2JJUA 4WTZG 3T0WA 2J12B 1J11A 5J11C 1BOYA 4PRNA 4PRNB 4ODTL 4PJBF 1C1EH 2ZJSH 3RVXD 1EGJL 3JWOL 2DLFH 1VPOH 2D31A 4GMSH 2D31B 1EHNA 1L7IH 2XQYK 3CLFH 2BNQA 5J12B 1FC1A 1RZ7H 4P23A 4P9MH 3BXNA 3MXVL 3BXNB 5D2LF 4KJWC 5EZOH 2NYYC 5JOPD 4GRLD 1YNTA 4Z0BH 1YNTB 4AQ1B 5H35A 3HG1D 5H35B 3WSQL 2DAVA 3K8KA 3KR3H 1VADA 4QLRA 1CVSC 1VADB 2W38A 4LOUD 1I3VA 3FQWA 3HC0A 3FQWB 3HC0B 4IRJD 35C8L 3MOBH 1KIQA 4PBVC 4KMTH 3V5HA 1A8JH 3V5HB 4WFGD 2B0SH 4XVUD 5FM8A 3GMRA 4GW1A 4LBEA 3GMRB 5DI8A 4LBEB 5DI8B 4XTRD 3UYRL 2CLVA 2CLVB 4JKKA 1XF2B 4Z77A 1R5WA 4Z77B 3RVVD 1R5WB 4UNTA 4HUKB 2GJ6E 2V17H 3FAXA 1NCBH 5KG9A 3PL6C 5KG9B 4TPRL 3V2AR 4LLUA 4LLUB 5CP3H 2AABH 3OR7A 1T21A 3OR7B 1T21B 3HCVB 1CIDA 3PP3K 4QRQA 4WV1B 1L9MA 4C56D 1NUFA 1N5AA 3MV01 5D70H 2IFFL 4U1HA 4U1HB 4CW1A 4OZGA 1A6TA 4OZGB 1N5YH 2R8SH 5DVKA 4JFFE 5I1KL 4G5ZH 1KJ3H 2W1NA 2OI9C 4Y4HA 5MI0B 3MYJA 1NKOA 4Y4HB 1JYWA 3MYJB 2LU7A 5IGXH 2MPAL 3BOVA 3PHOB 2YPVH 4YHML 2XZAL 4OGYH 5C1MB 3A6CL 3BPLC 2VAAA 2VAAB 1ADQH 2GSGA 2GSGB 1YYLH 1BEYH 4F2MA 5KAQG 4F2MB 4Y1AD 1GGBH 3JWDH 5DK0A 2XTLA 3RTQA 3OQ3B 3RTQB 4NC1C 4OZHF 4NQDE 1MI5A 4IJ3C 5DJ0A 4YXHH 1MI5B 4PYGA 4IDLA 3BZ4B 1XR8A 1XR8B 2XA3A 2H1PL 1ZLVH 4KRPB 3CVHB 5FF6A 4P4RA 1BECA 5FF6B 5JORA 4PB9H 5JORB 4PRIA 4PRIB 1HWGB 2D7PA 5D6CA 5D6CB 5C92A 4KKAD 3HC3H 5JXEC 3JWNC 3MV8A 1U8KA 2J5LC 1U8KB 1BD2A 1PGRB 3MV8B 4WUUA 1BD2B 4WUUB 1AIFB 5DVLA 4O9HL 1MWAH 1RSFA 2X10A 3CFEA 3QZWA 3CFEB 2ADFL 3QZWB 2EEDA 3ZE2E 1M7XA 4ETQA 4ETQB 2FX7L 1MFEH 3GKWL 3O6KH 1ZHLB 4IOFD 1F11A 1F11B 1I3UA 4GQ9H 4UINL 1JGEA 2NXYC 4JFXA 1JGEB 4R96A 4JFXB 4R96B 2DOCA 5LAXA 5LAXB 2DQUL 4LL9A 3MFFA 3MFFB 3SGDH 4JPKH 2O61A 2O61B 1F3DH 5C07D 2DKSA 1KB5A 1KB5B 3NIDE 4NQXA 1GGIH 4LCUA 5F3BA 2C1OA 2RB8A 5J4MA 4OD1L 2C1OB 5F3BB 1ORQA 5ID1B 1PG7L 1ORQB 2RR3A 4S1RH 2E27H 3O2DA 1NH6A 3VWJB 2RHEA 3C6LC 4UOW1 1FAIL 4PP1C 2Y7QA 4MB3A 5FGCB 3QBTB 4YDKH 5IFAL 1T1ZA 4NSKA 3VFRB 2IQAA 4NSKB 2IQAB 3OL2A 5T3XH 2OS7A 2GK2A 4Y19E 1CGUA 3WNNA 3GHEH 4S1SH 3TBSA 3TBSB 2VSCA 4YAQA 4YAQB 1F13A 3TGXA 4PRAA 4PRAB 4Q58C 5FGRA 5EPMA 4S10A 3O6ML 3ZL4H 3IFLH 3OAZK 5JPNA 3WXWL 2ZCHH 3DX6A 5JPNB 3DX6B 1FNSL 4YDJA 5GGRY 2I26N 2XIDA 4HIHB 4U1JA 3ZO0A 3DXAE 3RIFK 1KXTB 4KXZH 5MHSD 1E4KC 1FC2D 4OZFA 4OZFB 4H1LH 4N1CA 2LU4A 1AO7A 1FORH 2JCCA 1AO7B 2JCCB 4NKIL 3TV3L 1IEBA 1IEBB 4KZEL 2APXA 5F89A 3K3QA 5F89B 5CS7A 3LH2L 4PRBA 4FTVD 4XMLL 1ZT4A 3NCYP 4PRBB 5EUKA 1ZT4B 4B41A 1T22A 1T22B 1OB1A 1OB1B 1XGPB 2ED8A 3B2VH 5D6DC 4ZUWA 4K3JH 4ZUWB 3ARQA 1JRHH 1AE6H 4XNQA 3VD7A 3NFPA 5DD0H 4HIJA 4HIJB 4JFHD 4M5ZH 2ICES 5E6ZA 5EIIA 5EIIB 1AGCA 4P3DA 1DN0A 4P3DB 3QEQD 3P4LA 5TF1H 4IDJL 3U1SL 4HS8H 3ARFA 3OXSA 3TCLB 3ARFB 1LHZA 3OXSB 3QIUC 2GT9B 1JZ3A 5FM5M 4LPTA 3I3DA 2ICWI 2Q76A 5E03A 3UMTA 3DOSA 1T6WA 4L3AA 1Z9OA 3CD4A 2Z92A 4LASL 2Z92B 4CKVX 2NY3C 3O9WC 3CVHL 5GIRA 3BAEL 4JN1L 5GIRB 1BM3L 5T3ZD 4S1QH 4M6NH 4KKCD 5FO8A 5FO8B 4K3HA 4OLXH 4K2UL 1OPGL 2UVFA 5JIHA 1TQBC 1WWCA 3B9AA 4XAWH 2OMNA 3VXRA 3VXRB 4Q9RL 1NFKA 1I9IL 3FT4B 3HI6H 3QQ9D 2YPLE 3OHXB 3GSUB 5CUSL 4UDTA 1X5FA 4UDTB 3PWVA 2VXUL 3PWVB 1BBJB 2LQRA 5F93C 1EMTH 1MEXL 3FB5A 3FB5B 4DZBA 4P5MA 1C5DA 4DZBB 4P5MB 1C5DB 4RCAA 4UTBL 5IBUB 3RBGA 4K55A 4D9LH 3FO0L 4I2XB 4LIQH 2RFXB 3F12B 1YQVL 4ZS6D 3DYMA 4JO1L 1DVFD 5I30H 1KB5L 1YEDA 3MLXH 4R0LA 1YEDB 4N90D 5DGRA 1V7NH 3E2HC 3KLHC 5MEND 2QHRH 4ODTH 4D94A 4JM2A 3MV7A 4JM2B 1EGJH 5DZNA 3RWIA 5BVPL 3RWIB 4WO4D 2HWZL 3N06B 3B5GA 2ERJC 1ACYH 4IRSD 1U8QB 2NTFA 4DUVA 2NTFB 1RVFL 4KY1L 4MDJB 5CJXC 2XN9A 2XN9B 3MLSL 3H6JA 3Q1SL 5KS9A 4M6MH 3FN9A 5KS9B 4J6RH 1CICC 4WW1A 3BQUC 2AJSH 4WW1B 3WJLC 4JO4L 3SDAA 4FFWC 1MLBA 1MLBB 1C8PA 2A77H 4K94C 35C8H 3Q2CA 2JKXA 4TVPL 2ILLA 1G7QA 1G7QB 4DOHB 4LSQL 2CJUL 1R6VA 4OLEA 5D7JA 1NC2A 1NC2B 4K7FB 2EDOA 4P2QD 4BH7A 5F7LB 2UZIL 4BH7B 1RV6X 5IB2B 1X5KA 1SJEA 1RUQH 1SJEB 1XGUA 2AKRA 2AKRB 5GS0H 5ISZE 4M4RA 3P40A 2X4UA 3VXUD 5J0BA 2X4UB 3GO1H 4PGBB 2H3NA 2H3NB 4X4ZA 1K3ZA 5DFVC 1ZLVK 2DDQL 2BVPA 4PJ5D 3P0YH 4XXCC 1QLRA 4Y8AA 1QLRB 2M2DA 4R6UA 4XNUL 1GGUA 1FQ9C 5I1KH 4KK5D 4OF3A 2AQ2A 3LKPA 2VL4A 1B4RA 3LKPB 4NC0B 1RJYA 2XZQL 1RJYB 2BY2A 2XZAH 5H94A 3TFKD 5FYKH 3BUYA 3BUYB 3FMGL 5FYJL 4ENED 1XCTA 4HKZA 1XCTB 4HKZB 1S9KC 2IALB 3SY0A 3SY0B 1OLZA 4MXWL 3PP4L 1RIVL 1TMCB 5C08A 5C08B 1S8DA 3MGAA 1S8DB 5I18H 2AXFB 1RIUH 4YDLB 4P57A 2NY0C 4P57B 2H1PH 1RY7B 2FECI 1FDLL 1ZA3A 1ZA3B 3QDME 3NZHH 4R97C 1BIIA 1BWMA 2CUMA 4JDZA 4JDZB 4XWOD 1EK3A 1MHHA 2H26B 1MHHB 3SE3C 4KPHL 2H2SC 4YHZL 3RI5F 1NCAL 4S0SD 1JE6A 2DJUA 3NCMA 4IEFB 4U2YA 4R4BA 3SGDI 3HZYB 3AM8A 2ADFH 3WS6A 5B8CC 4PJHA 2FX7H 4S1DC 4P2OC 4WHDA 5DMGD 5B3NA 1MFDL 1PY9A 4OV5A 4RFNC 3ARBA 3ARBB 2B20A 3KPRE 1C08A 1FNEA 1FNEB 2ICWA 5KVFL 3KGRA 4UV4H 2UY7A 2R1YA 3BMWA 1IGFH 1PG7H 2YWZA 5D4QA 5MEPA 1AY1L 5MEPB 4NT6A 4NT6B 1L0QA 5IFAH 3NA9L 4JB9H 3MLPA 5FUOH 2EKJA 3D25A 1DBMH 4E41D 2Z8SA 4ACPA 1LQSR 5HHME 4ZO9A 3SDXA 1YMHA 2APTA 3SDXB 1RD6A 3KJ6H 5DRXA 4KXZI 5DRXB 1ZLUH 1HXYA 1HXYB 4JJ5A 5J3HD 4JJ5B 1R3HA 3VXSA 3WKNA 3VXSB 4U49A 3VA2C 2XWTA 3MLWL 3RZCC 2XWTB 4HAGA 3C5ZC 4JE4B 3QUYD 1G7HA 1G7HB 3WXWH 4MD0B 4XCCH 2R4RH 1FNSH 1FL5A 3FN3A 4N1HB 1XGQA 2L7JA 3BIAX 1XGQB 4ELMF 1YMMA 3NABL 3SGKC 5IEKA 5IEKB 2ZUQC 5T5FH 4Z7QF 3LKQA 2Q87A 3V52L 3LKQB 1JRHI 5CGYC 1GCFA 4WEMB 4NM4L 5C6PB 1W0WA 1W0WB 4YQXL 4HW6A 7FABH 3HAEA 5FK9A 5FK9B 4DK3A 4KZEH 4LKCA 4LKCB 2PNDA 4TTGA 4OF6A 5IQ7H 4KMQA 4Q2ZA 1CG9A 1CG9B 4KV5E 3C8HA 2VZTA 5CILH 1L4IA 2H2SD 3LSOA 1B6UA 3F6IA 3LSOB 1I1AA 1Y18A 1I1AB 1Y18B 4EI5B 2WUBH 5I76B 5GSVA 5I1LA 2VB5A 4WFEE 5DJ8A 1KT2B 5DJ8B 3U7WL 1XGYL 3MRDA 4X7TB 3MRKB 1UACL 3N1MC 3NMEA 3QJFA 4LLQA 3QJFB 4LLQB 4S1DD 1J8HD 4P2OD 2R29L 2V5SA 1OL0A 3QDHA 3MV9A 1A6WH 4ZXBA 4ZXBB 3MV9B 1B2WL 3BDXA 4WFHD 1T80A 1URLA 5ALBL 4YBLC 5E0QA 5M95B 2NXZB 2MWCA 4CJ0A 4LASH 5T1LD 4CMHB 3WIHA 4XVTL 3KNBA 5IHZA 1IVLA 3IDXH 3KNBB 2F5AL 5IHZB 3HE7C 1CGTA 2NY2B 3CVHH 3WO4C 3BAEH 4X4ME 1OTSD 4CVZB 1IL1A 2V5YA 1IL1B 1H3PL 1JZ2A 2ZSWA 4YBHA 2ZSWB 4K2UH 1OPGH 4M7ZB 5LKNA 2H8PA 3AS3A 4NGHL 4HPOL 3PWJA 3PWJB 1KBGL 4F7EA 4F7EB 1I9IH 4RMTA 3D9AL 4GXVL 2IGFH 1FN4A 1FN4B 5CUSH 2GQHA 3GM8A 1OY3B 4PG2C 4PJIE 2VYRE 2XACC 3UX9B 1KPRA 1KPRB 1MEXH 1YNLL 2CRYA 4KUCD 4M1DL 5HGBA 1OD9A 4ZUVA 5E2TL 4LNVA 4UTBH 4ZUVB 4LSRL 4KMLB 4PY8I 5CGTA 2EDYA 2FWOA 4L9LA 2FWOB 4PJGE 4L9LB 3RZCD 2UWEA 2UWEB 3MRBA 2EDLA 3MRBB 3C5ZD 1DQML 5DXWA 3SDDC 3DTXA 3ZYJA 3DTXB 1KCVH 3UO1L 1KB5H 3RKPA 5B4MC 1A6VL 3WLBA 1R24B 3WLBB 5BW7A 2XQYG 4GBXD 5DD3L 32C2A 4O02L 1I8LA 1BX2B 2ICWJ 2VDRH 2CQVA 3SDYH 4I0PD 3MNVA 3MNVB 1HSBB 3MLSH 3GSQB 4FFZH 1SYSA 1KG0A 1KG0B 1CL7L 1MRFH 1YY9C 5D96B 3NIFF 3CFIC 4ZD3L 3WFEL 4F15C 2IH3A 2IH3B 5HHOD 3TBTA 1MCOL 3M07A 3OBAA 5DEFA 5DQ9A 5DEFB 5DQ9B 2CJUH 4OM0H 3QXWA 4OZIF 5JHLL 4HJJL 4JZJB 2UZIH 3GMQA 1U6AH 2FL5A 2FL5B 1G9MC 3O4LA 5IBUG 1QFUL 1OHQA 2XA8L 4OCYL 1RZKL 4YC2B 4ONFL 1EJOL 4C54A 4XMKH 1WIUA 1DBAH 1HK6A 3TBWA 1J9CT 2VDLL 3TBWB 3OF6A 3VI3E 4KRNA 4Y5VC 2BK8A 4XNUH 3OKNB 4D0BA 4YBQD 4D0BB 5E8DL 2XNAB 1B0RA 3TO4C 1B0RB 1C12A 1P6FA 2XZQH 3UYPA 3DHMA 3HZVA 3HZVB 2EDNA 5FKAB 1CD1A 1ONQA 3A6BH 1CD1B 4N0CD 1I3GL 1ONQB 4OGXL 3FMGH 5FYJH 2VLRE 2CMRH 3N9GH 5F7DA 5F7DB 2MSPA 4TRPH 4MXWH 3PP4H 1RIVH 3DMMA 3DMMB 3WIHL 3OG6B 3H9SE 2WBJC 1FDLH 4FQXA 1KPUB 4FQXB 4L9DA 4XB8A 3SE4C 1IQWH 4R4NC 5C0EB 1FZOB 4LLYB 4QGYA 3BPCA 3BPCB 1UA6L 4PRPD 5DHYA 5DUBA 2VDQL 3CSPA 4KPHH 2HG5A 4YHZH 4LAQH 2HG5B 4K23L 3FQUA 1GH7A 1JF5A 3FQUB 1BFSA 3H3BC 1KEMH 2X1XR 2OTUB 2R0KL 2YEZA 2YEZB 4HGKC 4ZYKA 1MH5A 4ZYKB 1MH5B 1TJGL 4JZOB 3HNSL 4PJ9D 3SO3B 3BZFA 3BZFB 3ZKNC 4M7KL 4Q6IA 4Q6IB 4D9RD 2AI0H 1V7MH 1MFDH 2ZUWA 4NQCE 1KCLA 3U0PA 1ZLUK 5T1KD 3U0PB 5FM5O 4LEOA 1HCFX 3KYAA 4LEOB 4O4YH 2D2OA 4P2RD 5HDLA 3BP4A 1MPAL 3BP4B 4WGVB 5KVFH 3JVGA 1LO3L 5SWSA 1Y0LA 5SWSB 5HDBF 2R56H 1H3TA 1CGSH 4G9FA 2QSQA 4G9FB 5CSZB 3WIFA 4PTUA 5GRYA 3WIFB 4PTUB 5E6ID 4CU7A 4HG4K 1T7XA 5BQ7A 3LVEA 3AB0B 5BQ7B 3PUCA 1LGVA 2ZCKH 1AY1H 5FDYA 1PAMA 3Q48A 4MJ6A 5E1AA 2VLKA 4MJ6B 4C57C 1IGJA 2VLKB 1IGJB 3BDYL 5IM7B 3DECA 5FHAL 3RUGF 1DQQA 2B4CC 1EERB 1CIUA 5T3XD 4MJ4A 2B1AL 3RGVD 4X6CE 3C60A 5SWZA 1E4XL 3LDBB 1UKQA 3O6FD 5SWZB 3IU4L 4G8GB 1JZ8A 1N64H 4KVCL 3QEGH 1KULA 1AGFA 4U6XB 1AGFB 3ZLQC 4YE4H 3L3IB 3RWGA 3T0BA 5DMKA 3RWGB 5ESAB 5DMKB 2YD3A 1CWVA 4JZNB 1OGAA 1A7QL 2Z8VC 1F3DJ 2WQRA 4P99A 4YHKL 3NABH 2HKFH 3DVNA 3V6OA 5JMRA 3DVNB 1OAUL 1NGXA 1P4LB 1NGXB 4OCMC 2BXZA 1TTGA 2FX9L 2IH1A 5DHVH 5J13B 2IH1B 5IV2B 1ZE3C 4OFYA 3MGTB 1OCWL 4XPTH 5E2VL 5C0CD 2IPKB 5F1NA 4JVPA 3REVA 5F1NB 3REVB 4QNPF 1IGCL 4KKBD 1VESA 2P7TA 3GNML 2F54A 2F54B 4XCNA 3CK0H 4UAOC 3QHZL 2UYLA 2UYLB 2ZCLL 1QLFA 1QLFB 2ZUTA 2PYEA 2QV2A 2PYEB 4LLDA 5JMOC 4LLDB 1KLFA 3S36H 1HINL 3VGBA 5T5NG 5IK3B 3VFGL 3ETBF 5C0ND 1ETZA 1ETZB 1MJ8L 5ALBH 4RGND 1T04B 2IPUG 5ESVA 5ESVB 4LCIL 4G6AC 4YHPA 3VFNB 1KIRA 4CAGA 4YHPB 3W5MA 1KIRB 4L3EE 3GJFH 4X9GA 1WGOA 4R90H 4QOKA 4QOKB 1UCBH 3EJJX 4YXLL 5EU6E 1H3PH 4TSCL 4NBYB 3V4PL 1S9YB 2BVOB 3VXNA 1JBJA 3VXNB 4CRPA 2AJYL 2QTEA 4NGHH 4L8CB 4FG6D 4F37F 3D9AH 2HJLA 2XZCL 4Y2OA 3ET9F 3MBEA 3FO9A 3MBEB 5J7CC 3FO9B 4MWFA 3RBSA 3HAEG 4GKOA 3MLRH 4HFUH 5SX5H 2AXGA 2AXGB 1NFDA 4Z7UB 2MFNA 2UY6A 1GC1H 1A47A 4RMSA 3K2MC 5HVHB 3GRWA 1QNZL 3FHAA 3H8NA 3PJSB 2F58L 2X9WA 4NP4H 2DIAA 5KVGL 2WMPA 1R5VA 1R5VB 5CBAA 3UO1H 5CBAB 1A14H 1A6VH 5I1AA 5GS2H 3U36A 1CVRA 5TDNA 5TDNB 4BZ1L 4DJMA 4JFPA 3B4NA 4JFPB 1GAFL 5D5MA 5D5MB 4TSBL 3RNKB 1OSPL 5IEHA 1JYXA 4HUXB 4ZSOA 4ZSOB 1JN6A 1QSEA 1JN6B 5MEQA 5MEQB 4DKEH 5IVZA 2DQFA 5I6XC 2ZNXA 2DQFB 1A7NL 4CN4A 1WZKA 2WP3O 2QADD 3QWRD 5KZCB 2FDBP 3VG9B 4JQXC 1P5VA 1KACB 3WFEH 3S88L 1DBBL 2HYMA 1DEEB 4X99A 3O2VL 4X99B 1RMFL 2K3TA 5IIEA 1VFAA 1J10A 2OM5A 4X6EB 1VFAB 5IIEB 3L3GA 4G6FD 2NY1D 3L3GB 3KPOB 2XG5A 2Q3AA 4N5EC 4KDWA 5C0IA 2E8ZA 5C0IB 4WWKC 2NY6C 5JHLH 3E6FA 3E6FB 3QHFL 1FYTD 3F58L 1Z0NA 1AH1A 4GRWE 4HDIA 4QRTA 4QRTB 4OCNC 3SKOA 1XF5B 4PY8J 4PGJA 1QOKA 3SKOB 2ICEB 1PFCA 4OCYH 1RZKH 1KN4L 2V9RA 4PLNC 3MUGA 3MUGB 1UYWL 5D7IF 3ARGC 5DZLA 4P23C 2HMID 3WO3B 3ME0A 2E7MA 2X89A 3D85A 3PG2A 3D85B 3IXTB 1ZGLM 2I5YL 4PRDB 4PRHD 3X12A 5E8DH 2WIIA 2WIIB 4HZAA 1FL6A 1YQ2A 2C1PB 4H5SA 3GMOB 1I3GH 3MRNB 4OGXH 2DLHA 3UTSE 3RI5K 1I7UB 3LKNA 2QQQA 3LKNB 1O7SA 2DMKA 4LAJH 3ROOA 3ROOB 5I1JH 2KPNA 1L7TL 3GZKA 4KROC 3RDTD 1OAZL 3WIHH 2X70A 1BFTA 2X70B 3GI9L 4WU7A 4WU7B 5BXFA 5SWQA 5BXFB 3LKSB 4YPJA 3CU1A 2JJSA 1LWRA 1WC7A 1WC7B 3A6OA 4PJ8B 4PJFF 2VDQH 4IRZH 3QXAA 3QXAB 4I4WA 2IBBA 4I4WB 1E28A 3ELAT 2X4OA 2ED9A 2HJKA 4K23H 2HJKB 1IC4L 4NKDA 4NKDB 4Z7UF 3TBVA 3TBVB 2R0KH 4WI5A 5ESQA 4QRRE 1S7SB 4PJEA 5ESQB 3TBYA 5EORL 4YWGL 4WI3A 1RUPL 1TJGH 3W5NA 3DVIA 2MQ0A 3L9RA 4BSWA 1VFUA 3DHJA 3L9RB 4BSWB 3CPLA 1WF5A 5JUEH 3CPLB 1SBSH 2HVKB 4CU6A 4M7KH 4JFQA 4JFQB 4OLZL 4MNGA 4MNGB 3GRWL 4NFDA 1BJ1J 5I73B 2C3HA 1JWSA 1JWSB 5DLML 4Y7MA 2VZ1A 3LHPL 1JFQL 2ZKHL 3A67L 1KV3A 2FSEA 2IMMA 4UB0L 1LO3H 1A0QL 4N5ED 4PJDE 2ZWLT 2OCFD 4I3RL 1X6NA 1I4FA 3RPKA 4KI5F 3T0AA 4F7TA 1INEL 2W0LA 1T7YA 4M6OH 3HUJE 1C16A 3NIGE 2W91A 1C16B 4CADA 3T8XA 3X3GL 4JAMB 3T8XB 5E2JA 2BNQD 2X4NA 4FQ2L 2X4NB 3DV6A 4NQTA 4K71C 2IBZX 1FL3A 4P23D 1FL3B 2APVA 3QUXA 5E8PA 3QUXB 5IR1A 4JKPH 5IR1B 4WY7L 5AEAA 4P5TC 4TSAH 1FRGL 1IAKA 2B1AH 3GFUA 1IAKB 3IU4H 1RJZA 4J3TA 5KVDL 1A6ZB 1RJZB 2VDML 3PQYA 3ZE1F 4KVCH 4HUWA 4HUWB 2YA1A 4NN6C 2LE9A 1A7BA 1K8DB 1VEPA 3Q6GH 5TPWH 4BQCA 5GS1B 1J86A 5TDPA 1FSKB 4JGJA 5TDPB 2AS5M 3HMXL 4PBWD 4MSWB 3ARUA 3VG0H 3RX8A 1OAUH 3P9MA 3P9MB 3JXAA 1ZEAL 4UT7L 5D2NE 2DQHH 3KYNA 3KYNB 1OCWH 2B8OT 2V7NA 5E2VH 2V7NB 5DR5L 2YN3A 4I77L 4CN1A 2FX8L 5L7XL 4FMFA 3GJFK 1IGCH 1OP9A 2VZOA 1JPGA 1DQLL 1CCZA 4Y4FA 3GNMH 1FFPA 4NHCH 5B3JF 1FFPB 3TPUB 4EKXA 4MQXC 1KPVA 3P0VH 1KPVB 4ZNCD 3ULUE 3U0TA 4H88L 2I9LA 2ZCLH 2EXWD 2JELH 2I9LB 2E9WA 3U0TB 4OLWH 4Y4HD 3P77A 3VMNA 1CBVL 1VGKA 3CMOH 4RIRA 1U3ZA 4RIRB 4Z7WE 2DS4A 2RGSA 3VFGH 5HSFA 4N0YL 5KSBA 4HG4J 4OCWL 5SX5K 5TE7H 1MJ8H 4NNYA 4NNYB 1IILE 3ZTJH 2RAMA 3FN0H 3ES6A 2BHYA 3RTQD 2N56A 1VHPA 1MI5D 3NCJL 3CFJA 5E9DA 3QXDA 5E9DB 3EZJB 3QXDB 3ARDA 4X5WB 1NEZA 3ARDB 4KRPD 3LPGA 4QRPA 2Y5TA 4QRPB 1FH5L 2J8UE 2Y5TB 4TSCH 1J8HE 1UB6A 1UM5L 3VXOA 1UB6B 4PRID 3S37H 1P2CB 4XPHL 4X9IA 1MCRA 1WV7T 3CVIL 3Q0HA 2X7LB 1A5FH 3MV8D 1BD2D 4MVBD 4WUUD 4PJ7E 4NQEB 1JUFB 1PEZA 4KWUA 4MA8L 2EC8A 2EYSA 2EYSB 2XKUA 1EAPA 1EAPB 2Q8BH 3TYFA 5CCKH 3TYFB 1NMBH 3MJ9A 1DQTA 4G42A 1T4KB 4G42B 4FFYL 4JGMA 2DQTL 2NR6C 1LMKA 2EDKA 1FNGB 3IKKA 2J2ZA 3I6GA 3GI8L 2AK1H 5ID0A 1UJ3A 3MLVH 2OJZL 1UJ3B 5EC1A 5EC1B 5GJTH 3NPSC 1BQHA 1J1XL 4JRYA 1BQHB 4JRYB 1IGYA 3G6DH 3X14A 3X14B 1JPTL 4BZ1H 1FNLA 3UJJL 5FHBL 4UTAL 4W6YB 2WWKT 3SGJC 3T2NH 3ULVL 4C58B 1Q9WA 1Q9WB 2OK0H 5CEXA 1KC5H 2KQMA 2DMCA 1OVZA 4N1EA 3WD5L 1ACZA 4BFBD 4NO5B 1NL0L 4Y8DC 2P43B 4JFEE 4DN4L 3P73A 1EFXA 2GIYA 5D7KE 3P73B 2R39A 4MZ3A 2DQDL 3LN4A 3ZT5A 1EFQA 2GCYA 3V6FA 2GCYB 1DN2A 2WLYA 1AD9A 1N0LA 3DURA 1AD9B 3DURB 4F7PA 4HWBA 4F7PB 4LGRB 1DBBH 1SMOA 4Z7VE 3HA0A 1UH3A 4P3CL 2K7PA 1RMFH 4ODVL 2FD6L 4HS3A 4TVPD 4HEME 4HS3B 3VXMA 3VXMB 2BMKA 2BMKB 4OCXH 5CZXD 2OZ4A 1VACA 1VACB 4R0LC 3UP1A 4OTXL 4HULB 5EWIL 3F58H 1RZGA 1RZGB 1U42A 5CAYB 3QDJA 3QDJB 2XICA 1TZHA 1KN4H 1AO7D 1TZHB 4X9HA 4P2CG 4DQOL 1U8JA 2EDXA 3QO0B 4AT6A 4Q9QH 3QCTH 4J12A 1CLYH 5AYQA 4KK9C 4WI6A 2BCKA 3I85A 4XBEH 2XTJB 3SDAC 1NBYA 1H3VA 2JF1A 4M93B 4QTHA 1T1XB 2RQ8A 4PYHA 2DQCL 4XCEA 4XCEB 4RWHA 5B39A 1O0VA 5B39B 4LQFL 5D7JC 3ARFD 1RU9H 3UTTE 5J6HA 2Q86A 1F6AA 4APQA 3P9LB 1CE1L 1F6AB 1FPTL 3FB6A 4APQB 2QL1A 1L7TH 3FB6B 3ARZA 5BRZE 2WWMC 4JO2L 1T7VA 5LGHL 4HEPG 2ITDA 3MRHA 2ITDB 1AR2A 3MRHB 5LGJA 3MBXL 5D2NC 5LGJB 5IVXE 3NPZB 3SBWC 1HZHL 3R0MA 3VFSA 4HMDA 2BNRA 4O5LH 3VFSB 3WUZA 1KCRL 2BNRB 4DGIL 5IJVA 1XGRA 3BSZH 5IESH 1CR9L 4I13B 1JGVH 3MJ6A 4GW4A 2E7LA 4GW4B 1E4JA 1WICA 1IC4H 1H0DA 1H0DB 4JFZH 3KLAA 3KLAB 3VXRD 5EORH 3ULUC 3FRUA 3FRUB 3HN3A 4NRZA 4PGDB 1F4AA 5BCAA 4NRZB 1IT9H 1HHIA 3UTQA 3UTQB 1HHIB 3QA3B 1J0IA 3C09C 4HF5H 3S96B 1K4DA 4OLZH 1K4DB 3HG1B 3SN6N 1VA9A 4KHXL 3WJJA 1EHAA 4NBZB 2H32H 3LHPH 4IRJB 4PREA 4PREB 1MAJA 3A67H 2VQTA 3KYMA 3KYMB 1WCQA 3IDUA 5C8JA 5C8JB 3QYCA 3LEVL 1RAMA 1IM3A 1IM3B 1BAFL 1MHPH 2XY2A 3TVMC 3ARPA 4JDTH 4I3RH 5A3IC 1MCKA 1BHGA 4KGJA 4V2CB 1NAMH 4JM2D 5E4IA 3MV7D 1IGTA 1IGTB 3B9KA 3B9KB 1INEH 1RK0A 5TFSL 1CDJA 1RK0B 5D9SA 1T89A 4Z95H 5D9SB 5D1QA 4J3SA 2JB5H 5D1QB 3X3GH 1RUKL 4U7SA 2YMXL 1JGUL 4FQ2H 4GKZA 3D39E 4GKZB 3D6GA 5L8KB 2XN9D 5C9KA 1BVLA 1BVLB 3HI5L 4WY7H 1FRGH 4CVXA 4CVXB 3IAGC 3V6ZB 4I3SL 5KVDH 1MRCL 1YPZF 3SDAD 4R8WL 3EFDH 5CJ8A 4MJIA 3UTOA 2FYYA 4MJIB 1A7PL 2FYYB 1W8NA 1R3KA 2HT2C 1R3KB 3L6FA 3L6FB 3F6LA 4P48A 4YGVA 4YGVB 1BVKA 1BVKB 3HMXH 3D18B 4G7YL 3CH8A 2JJTC 3VH8G 5D7JD 1QFWH 1NC2D 2HKHL 4Y1AB 3OAUL 5T3XE 3T0DA 1SMAA 2OSLB 2ADJA 2ADJB 4FQIL 4ZQKA 4U7KA 3SJVA 1G6VK 4Y16C 1N6QH 4HH9A 3FRPA 3C87A 4NQVA 5L7XH 4NQVB 2EDRA 1D5BA 2EO1A 4HMEA 1D5BB 3F7QA 5TE4L 4FQ1L 3LS4H 1HXMA 2FIRT 1HXMB 5J11B 1PLGL 1JK8A 1JK8B 2F53E 2OL3A 3V0WL 2OL3B 3OV6A 2AEQL 4ERSH 4JHZA 3VRLE 1TTFA 1XGTA 2VOTA 1XGTB 4POZD 5C0AA 1MFAL 1N8ZA 1N8ZB 1TNMA 3EOBA 3OPZH 2BSSA 4DKDC 2BSSB 4KQ3L 4EVNA 4A6YA 5JQ6H 4EVNB 4A6YB 2BFVL 2VDOL 3SDCC 3WDJA 5FCUL 2J7LA 4RWYL 3OB0H 4JPVL 4N0YH 1U3YA 2FGZA 4IHOA 4F37K 4IHOB 1SM3L 3D2UA 3O2WH 1V3LA 3OJMB 5HHPA 5C08D 4V1DA 5HHPB 3NCJH 4V1DB 5I75C 1K4CA 2AJZA 2AJZB 1MY7A 4JHAL 1B3JA 2YZ8A 2Q20A 3SE8L 5CJQL 1D6VL 1A9BA 1R3LB 1ODAA 4BZ2H 1G7JA 1G7JB 3RGHA 1Q1JH 4EXPX 5L2KA 2A9MH 4F9LA 3VA6A 5J9PA 3PL6A 2P24B 4BM7A 3PL6B 2OQJA 4JQVC 2OQJB 1UEYA 4NZUH 1TETL 4K8RC 4RX4A 3CU7A 3Q6FA 3Q6FB 3V0VA 3NTCH 3V0VB 4Z76A 2V9TA 3B2UC 3S4SA 3S4SB 3REWA 1JTOA 2B1HL 4HS6A 3REWB 5DT1H 3BT2H 4LPUA 5C9JA 2DQTH 1WFTA 2OI9B 1QBLH 5EUOF 1WZ1L 4G8FA 4MNQA 1MREL 4G8FB 4MNQB 3ARBD 3GI8H 5EIVA 1X5HA 2ZNWA 3C2AH 3OKKA 1QRKA 3BPLB 2YKLL 1OM3L 3OB8A 3ZE0E 3BKMH 2MOVA 4PB0L 1U95A 4F33A 1U95B 3TH2T 1ZTXL 1JCKA 1T0PB 3D0VA 7CGTA 3D0VB 3UJJH 1CDIA 4FQLL 4GKSA 4GKSB 4YNYB 4IJ3B 4WCYH 4JQIH 3RL1A 3RL1B 3T0XA 1JZ6A 1CS6A 3PXHA 4LNRA 3DI3B 4LNRB 3LCYA 5D7LE 4M7JH 1K2DB 4DN4H 2DQDH 4LIQE 4KFZC 1X5AA 1S78C 2Q6WA 3TA3C 3OKEA 2Q6WB 1NEZG 3OKEB 5JXEA 1Z2KA 2DWEB 3N85H 2J5LB 5DUPH 3IFOB 3RY6C 4WFFD 2Y4SA 5M94B 2P5EA 4EOWL 2P5EB 2KL6A 5EOQH 4LSDA 4ODVH 2FD6H 1EPFA 3KPSA 4MAYC 3KPSB 4JFYA 3DVGA 4JFYB 3DVGB 3ZHLA 5CD5C 4PJBE 5EWIH 3BJLA 1EIBA 1YMMD 5BW7C 9CGTA 2NXYB 1FGVL 5F8RC 2EEBA 1AXSB 4NO2A 1J8KA 1XIWC 4PJCA 2HT3C 1C7SA 4JVWA 4PJCB 1C7TA 4G80A 3EOTH 4G80B 3V5KA 3TNMA 1U2CA 3TNMB 4K3DL 3T08A 2R23A 4P59L 4NZRL 5D2LE 1X44A 2R23B 5IHUL 2Z31A 1BQHG 2YD4A 5I17A 5I17B 1F6LL 3CXHJ 5CIPH 1I1AD 3C6LA 3EJYC 3C6LB 2W92A 3DUSA 1HEZA 3DUSB 5J6GA 3QIWA 1HEZB 2VLME 5J6GB 4K8RD 4K07A 4A6YL 4LPVA 5EU7E 1ZGLA 5HGDA 1DLFL 4EBQL 4IOIA 5HGDB 1ZGLB 4IOIB 5F21B 4M00A 1YYML 2IQ9L 4ZXBD 3MV9D 5GZOC 2X4PA 2X4PB 2HRPH 1FPTH 2I60L 1JTPA 3W9EA 3W9EB 1PBYA 1NSNH 5LGHH 3MACL 2NXZD 4U7MA 1KIPA 1U36A 4NWTH 4PRHE 2FEDC 1QSFA 5D8JL 1QSFB 4GRMB 1WSST 5AG9A 2NY2D 1EHXA 1SVZA 2LAGB 2XZZA 1KCRH 4JR9H 5DZOA 4DGIH 1ERNA 1KJ2A 4OJFH 4AJ0A 1KJ2B 1Q0XL 2GHWB 5ERWA 4M03A 5ERWB 1E4KA 5FYKE 4RISH 3NA4A 4C55A 3WFZA 4HJ0C 5HPMA 5HPMB 1ZKAA 1JMZA 2M8XA 1KFAL 3T2OA 1YEEL 4N8VA 4TQEH 2DTMH 3VMPA 3AS1A 4C4KO 4WVRA 3GSOA 3SQBA 3GSOB 1IM9A 1DQDH 1IM9B 2A73A 4KHTH 4NUJA 2A73B 1S78D 4NUJB 4TULH 1S7RB 4KHXH 2Z8WC 1QYGH 2QR0A 1NGYA 2KDGA 2QR0B 3BD4A 1NGYB 4LCCC 4MLSA 4OZHE 2BVYA 4LRIC 2AW2A 1IAIM 3L3HA 3L3HB 3STBA 3I02B 4FMKA 3MJ7B 5F9WC 1QP1A 3FQXB 1MCJA 2MQ3A 3QIUA 4NBXB 3QIUB 3O3AB 2CUHA 4JY4A 4JY4B 4RBPH 5ILTL 3QUZC 4DAGH 5TFSH 1NGWA 3MRGA 2GEEA 3MRGB 2EIZB 4RRPA 2HT3D 2H2PD 4GG6F 2GJ6A 3PGCA 4AG4L 2GJ6B 2NY3B 4I3GA 3O9WA 1YN6A 2YMXH 3O9WB 4JO3H 1GIGL 1GXEA 3ZMRA 1BQLL 4AENA 4AENB 1QFWI 1IRAY 1FFRA 3LZFL 1TQBB 2YOCA 1MRCH 4WI9A 3INUL 4JFFA 1D5IL 1JHLL 3VXPB 3QEUA 4N9GA 4BK5A 5C6TL 3QEUB 3L7FA 4ZNEE 3L7FB 2EH7H 1A7RL 2IF7A 1UEMA 3IDNA 4PGZA 1S7UA 5EIQA 3AU1A 3IRZA 4XPFH 2HKHH 1FBIL 3OB0K 1D5XA 2L0DA 1D5XB 2ZUVA 1VCAA 3I9GL 25C8H 3O45B 2CDFA 3EHBC 3FQRA 2CDFB 3FQRB 5CEZL 2J4WL 4NQDA 4NQDB 3O4LD 4UIKL 2AK4E 4XP5L 4CJ1A 3NH7L 4FQ1H 5FYLH 3X13A 2Y07L 3X13B 3E2HB 1PLGH 1QBBA 3C5SA 4J3VA 3C5SB 3OF6D 4YX2L 4ODWB 2AEQH 3C60C 4CU8A 2X05A 3H42H 2BJML 3VI4F 4NFBA 3WFBH 1CFVH 3V5DA 1MFAH 4TYUA 2ERJB 4OQ1A 1IJ9A 1XR9A 1XR9B 1A3RH 5CJXA 2G75A 4KQ3H 2G75B 2BVEA 5F9AC 2X9XA 2VDOH 4H26A 4H26B 2G2RA 2G2RB 4DUWA 2ESVE 2C26A 2C3WA 4JPVH 1V3JA 4D9QD 1CICA 4PJAF 1CICB 1YC8A 3BQUA 3BQUB 1U92A 4X6DF 4OZGE 3RVTD 3STZA 1UH4A 3MRJB 3AAZA 5HDQL 3AAZB 5EOTA 3LIZL 5EOTB 3DMMD 4QRUA 1MJ7L 4QRUB 1DL7L 1MQKL 3KYKL 4QXGL 2MJWA 4FQXD 4JM4L 1HKLL 3SE8H 5CJQH 3C9NA 3C9NB 1KJ2L 1LD9A 1LD9B 3T77A 3T77B 2YD9A 3EYUL 3I50L 5ETUA 5TE6L 2WBWB 2NZ9D 4R4FL 1F4WH 1FLRH 4KTDL 3GMPA 1CE6A 3GMPB 3QNXA 3RP1A 3QNXB 3DROA 1YJDH 3DROB 5GS0C 3AY4A 3VGDA 3IS0X 3FRPG 5ITFA 5DJCB 4XXCA 1YN7B 4H20L 4NNPL 5EU7C 5ITFB 4PJXA 2B1HH 4PJXB 3S35X 4Y19A 3FT2B 1PEWA 2BDNL 1FV1B 2EDDA 2VXSL 4AEFA 5DYOA 5DYOB 2HLFD 4WUUE 3O3UN 4OZ4A 4OZ4B 1M1SA 4HIIA 2HVJA 2YKLH 4HIIB 2COQA 2HVJB 4XI5D 1OM3H 5ECJE 5SWSD 4HC1A 4G9FD 1INDL 1MY5A 3O3EA 2N1KA 3O3EB 3DXAA 3DXAB 4FQLH 4UQ2A 3VE0A 4UQ2B 1JI2A 1MSPA 5ALCL 3VDAA 2VLKD 3HE6A 5C09E 2NY0B 4PR5A 4PR5B 3THML 3T1WA 2X4QA 2X4QB 3HRZA 3HRZB 3RWJB 3I6KA 3I6KB 4R97B 4ZOEA 2MCPL 2DKUA 2YRLA 4HIEA 4OUOA 4HIEB 1MJUL 1WVZA 3SE3A 4FZEH 5INDA 1HYRC 3C60D 3DRQA 3DRQB 2NY7L 4YGAB 5SWZD 1S9WA 1S9WB 3WXVH 3OSKA 4NJAH 5DD6A 4AMKL 2F8OA 4YFLF 4FQQA 4UMGA 5GRVL 4FQQB 2BVUA 3VFOB 5B8CA 5B8CB 3S3PA 4P2OB 1FZKA 1OGAD 1D7FA 1FZKB 3R4DA 3UTPE 2CXGA 2EDWA 5J89A 4F7CB 4YIQA 1FZMA 4YIQB 1FZMB 1EVTC 4ZODA 4JANA 1KJMA 5ENWA 4JANB 5ENWB 5BV7H 2CKBH 5FM4A 4RFNB 1L9NA 4OFYD 1OSZB 1CLZH 1MLCB 4OIBA 3TEUA 4K3GA 2Y6SC 3ALWA 2DJ4A 2PCPA 1BMGA 2PCPB 4K3DH 5FV1L 4NZRH 4NKOA 5F7WC 4NKOB 1D5ZA 4KK6C 1D5ZB 3KWWA 1YEKL 2F54D 3K4ZA 3IT8D 1G1YA 5KANI 4GQPH 1RULL 1ZHBA 1ZHBB 5IUSA 3B3IA 3BISA 3B3IB 5F9OL 4KZDL 4Z9KB 3BH8A 4BELD 1F4YH 5JW4M 1WJ3A 2PYED 2YPLA 2YPLB 1DLFH 2F19L 3CX5K 4EBQH 1AQDA 3RU8L 1OGTA 1KTKE 1OGTB 2Z91B 2FEEL 2CO7B 4ALAH 2N7AA 5HGGS 3F7YB 5GZNC 3QB7C 4L4TE 2GITA 1P69B 2GITB 3QQ3A 2R0LL 4K94L 3QQ3B 3SQOL 2FLBT 1XT5A 4UBDC 3RZCB 3C5ZB 3MOAL 4HPYL 1MIMH 1SEQL 2ZOLA 5D8JH 2ZOLB 3BIKA 2DN7A 1OT1A 1UM6L 2R9HD 5CHNA 5CHNB 2ENSA 4QOKD 4X7FC 1WUNT 4OKDA 3WKMH 4UU9A 4ZUUB 4JHWL 4UU9B 1Q0XH 2ZUQB 4I8DA 4ZO6A 2FNBA 1QO3B 1TJIL 2ATPA 1IAOA 4PJXF 5FYJE 1T5XB 2DJSA 1T83C 4RBPK 3FOLA 5HYJE 3FOLB 2I25N 4HUNB 1JGLL 1CXFA 1HNFA 1KFAH 3WNMA 2G60L 4L4VE 4YFEA 1DEDA 1YEJH 1OP3H 3P2TA 1Z3GL 3MBED 5BO1H 3K2UL 3EDJA 3JV4A 5HI3C 4FQHA 1P1ZA 4FQHB 2RIKA 1U9KA 1A4KA 1P7KA 4EXKA 1P7KB 1P9MC 1AQKH 3GJEB 3IYLW 3G9VA 1ORSA 1ORSB 2VXVH 4FA8A 1BJMA 4LU5L 1YEIH 4HC1L 2JJSC 4LDOB 2Y06H 3KPMB 1C5CL 4EIZC 4LEXH 4YBLB 5E2WL 4UZGA 5ILTH 1F2XK 3WEXA 3OX8B 3WEXB 3E8UL 2B2XL 1AJ7L 5ISZA 5ISZB 4XCYA 3HE7A 1DLHA 43C9A 3D3VE 3HE7B 1DLHB 43C9B 3WO4B 3QIBC 1LK3L 1QSED 4H8WC 4I2XE 4LVOC 5KVEH 1GIGH 4ZFOA 5GGVL 4ZFOB 3CZJA 5FA3A 1BQLH 1QPXA 4J3WA 2DMBA 2O5XL 3RAJL 1QSVA 1H3GA 4KK6D 1JHTB 4ONOA 5AZEH 3U4BL 1RURL 5KZCD 1K6QH 5EO9A 5EO9B 3BKYL 3BO8B 2EXYC 5IQ9B 5CSBA 1F8TL 3SKMA 2D9QB 4PG2A 3SKMB 2CK0H 2VISA 3MREA 3MREB 1NCDL 1U0QA 4N8VG 1FBIH 3JV0A 1LE9A 5GZND 3I9GH 5E7BA 5I1HH 3HC4L 1CFSA 4X7CC 1CFSB 5ICYA 3K4AA 1LEIA 5ICYB 1MOEA 3WFDL 2VKWA 2F8VA 3SDDA 3SDDB 1SJVA 5T3ZH 3TF7C 4UIKH 1A2YA 1O5DT 2FBOJ 5F7KC 1A2YB 4YHOL 3R06A 3R06B 2MHAB 4DOHE 3QDMA 2Y07H 4CL7A 4HWNA 3PDOA 2Y5EA 4AIOA 1AGEB 1WTGT 5C2UB 2X89D 3D85D 3DYOA 4KUCF 1IBGL 1F2QA 2DQJL 2JLLA 4NM8L 5C7XH 1WAAF 4DZ8A 3ILQC 2NLJA 3KPPA 4DZ8B 2NLJB 3KPPB 4RRPG 4M7LH 4ORGA 4ORGB 1EZVX 2EDTA 4E5XA 5F96L 5CSGA 3F8UB 4ELME 1H9VA 4GS7C 3JUZA 2A1WL 3MLZL 4Z7QE 3BP6A 2JB6A 3V95A 2JB6B 4XNXL 3SE9L 4FOMA 5HDQH 5EULV 4F15B 4BZYA 1F00I 4M9OA 2EH8L 5FGSA 4KTEL 3EYVA 1MFBL 3EYVB 4JGUA 3KPRA 3KPRB 1MQKH 3J8F7 3U2SA 4JM4H 5IT2H 3GIZL 1HKLH 3U2SB 43CAA 5T1DH 3VFMA 1IFHL 1U8MA 43CAB 3VFMB 1U8MB 3WNKA 1FO0A 3EYUH 1XZ0A 1IE5A 1N0XL 3I50H 1XZ0B 5TE6H 4Y4FC 5GRUH 4ZTOL 5D7SL 1VKXA 3EYOA 4N0RA 1VKXB 5DJAA 5DJAB 2HFFA 2A9NL 2HFFB 2CGRH 1DANT 3H0TA 1LP9A 3H0TB 4KTDH 1LP9B 1NJ9A 1DQJA 1NJ9B 2R2BA 2XRAL 1T2QL 2R2BB 1UB5A 5D93C 1E6OL 3OZ9H 4Y5VB 5J1AA 5KJRL 3QJHA 1B88A 3QJHB 5HHMB 2BDNH 3VJ6B 2VXSH 5INCA 2HT4C 5INCB 4O2FB 2EXYD 2EKSA 1PZUB 2EKSB 5JZ7D 4PFEA 3TO4A 3BWUC 3TO4B 3DO3A 5ADOH 4X98B 2HN7A 3LEYH 2HN7B 1W72A 2Z35A 1W72B 2Z35B 5IKCA 2BHZA 2KUTA 3O8XC 1JPSL 5EZLA 1INDH 1HOCA 4YPGA 5EZLB 1HOCB 1A6AA 4YPGB 1A6AB 2OX5A 4ORZC 5ALCH 1J1PH 3ULVD 5C0CB 4B50A 5JA9A 2WBJA 5IB1A 1T5WB 3PHSA 2WBJB 3THMH 5IB1B 3QPXL 4ZFOL 3PGFH 4Q0XL 3RVUC 4TUKH 5FUCE 2NW3A 1CQYA 2NW3B 3QUXD 1MJUH 4JRWA 5DD5H 1OTUC 2NY7H 4AM0A 4AM0B 3PQYD 5A16A 4L5FL 5CINL 5A16B 2R2CA 5GRWA 4R26H 4PV9B 3HFML 4X9BA 3WCYA 1G9NL 1RQ5A 1WTLA 1UM4H 1CGXA 5TH2A 1YEGL 2AXJA 1EXUA 4BFIA 1EXUB 3WL9A 2XG4A 3WL9B 1ND0A 1ND0B 1WFNA 1LEGB 4LGPB 3TN0C 3CFCL 3IJYA 4JFDE 4N8CL 3VXSE 4WFFE 3QCUL 3C08L 1YC7A 3BGAA 1QRNE 5F8QC 4BKLA 4X4MA 2EZ0D 2DQGL 2EIBA 3T65A 1OLLA 3TC9A 4LSPL 4OFDA 2DLIA 4N68A 1R0AH 4OLVL 4Y4FD 5C0BA 1YEKH 3NIFE 4NZDA 5C0BB 4OQTA 4U6YA 2W65A 3T3MF 3FOMB 4WHYG 3HI1B 2I07B 4LQ1A 1B4JL 3AXLA 1LO2L 3AXLB 3O0RH 1QACA 4PJIA 1OP3K 3VFUA 4PJIB 3VFUB 4OZIE 1N6UA 5ACZA 4MDIA 4MDIB 4M62L 4K94H 2OR9L 2R0LH 3SQOH 5E8EA 1KENL 3QI9C 5DTFA 4PJGA 3MOAH 5DTFB 4HPYH 3SOBL 3WNPA 1SEQH 2VZVA 5E9DD 1G6RH 4Z6AT 1NGQL 1LP9F 2CKNA 3VW3H 1KLUB 3X11A 4ONGL 3X11B 2CRIA 3ARDD 1JZ4A 3B5HA 4QRPD 5KAQF 4YHNA 3KDMA 5EC2A 5B21A 3KDMB 1I1CA 3VFTA 3VFTB 2EYRA 1TJIH 1ZSDA 1G9ML 1ZSDB 4IMKA 1JGLH 1AR1D 5AZ2H 4GT7A 1IAMA 4MHHG 1MFNA 3WHE1 1CT8A 1Z9MA 5E5UB 1CT8B 3VWKC 3ARXA 3T3PF 2G60H 3IXAA 2C3GA 3IXAB 1W8OA 3QUMA 5B38A 3QUMB 3LN5A 1TFHA 3LN5B 3GMLA 3GMLB 2NY5H 4KGLA 2XQBH 4LDLB 3MCLH 4OT1H 4UAOB 5GRZA 5E2UL 5JHDE 2AP2A 1X5XA 2FB4H 3EO9L 5EZJA 5EZJB 4DVBA 4DVBB 5CBEA 5CBEB 1KCUL 1GGCL 4JG0H 3MNWA 4KJPC 4U2ZA 1W72L 3Q5OA 3QUKA 3QUKB 2ARJA 2ARJB 4LRNL 5EBWA 5EBWB 2WV3A 1JJUA 1UKSA 3DX8A 4LU5H 3DX8B 4UDUA 4JRYD 4UDUB 1IEAA 2Q8AL 4XPAH 1IEAB 3S3SA 1C5CH 4GH7B 1FYTB 3AREC 3CFDA 4PUBH 3CFDB 4HZLA 3E8UH 4HZLB 2PYFB 1AJ7H 1YECH 3OGCA 1RHFA 1ZVHA 2XKSA 3FTGA 5EOCH 3FTGB 1LK3H 2DWDA 1FIGL 4POYA 1MQ8A 2DWDB 2IFGA 4X5XA 4X5XB 3CX5J 5CLTA 4XVSL 1EFXD 2Z9TA 3E6HA 3U4BH 4XH2B 3ZKMC 2VABA 4WW2F 4LPCA 2VABB 3ZYOA 4XT1C 4L8BB 4OAWA 4XP6L 4OAWB 4AYFA 4JRXE 1K8IB 1CXKA 3OXRA 1RZJH 1U58A 5HDBE 1U58B 4K7PX 1HN1A 5LXGL 3G6AB 3VXMD 3TP4A 3V8CA 4OD3H 1NCDH 4Y2DC 4ODBD 1KTLA 2VLRA 1HHGA 3BRFA 1A02N 2VLRB 2M26A 2YK1L 3UYOD 2DYPA 5C0GA 5C0GB 2YD8A 2R0ZH 3CXDL 5FDWA 3GBNL 1NDMB 1F3RB 3QDJD 5FYKU 5L2JA 1AFVL 4GMTL 5L2JB 3F7VA 2KBGA 3H9SA 1GC1C 3H9SB 2XYCA 1FJ1A 1JNLH 5DSCA 5DSCB 2ADGA 4XP9L 3B9EA 3P11H 2ADGB 4OQTL 5E8OA 2XOTA 5E8OB 2XTJD 1IBGH 5LGKA 1J0YA 3FL7A 3QFJE 3QRGH 4TTDD 3ULSA 2DQJH 1LNUA 3SGEH 4AZ8A 3LY6A 2B4CL 3WLWC 5I6XB 1NCCL 2BHUA 5EBLA 4EIGB 5EBLB 5EO0A 5EO0B 4MCYA 5JNYA 4MCYB 2V2TB 5JNYB 2P49B 4APQD 1SY6A 4NQCA 4M1GH 1S5IL 3U79A 4WHTA 2EYTA 2YD7A 3PNWA 3STLA 2EYTB 1TITA 3PNWB 4K9EC 3STLB 2W0KA 4M8QA 4E42A 4M8QB 4E42B 5ACLA 5F1IB 5KTEH 5CWSA 5CWSB 4RQQA 1AXTH 4QNPE 3GIZH 4WWKA 5F6HI 4WWKB 1CDYA 1IFHH 2BNRD 2O5YH 2NY6B 3LKRA 2BSED 2VQUA 4XX1E 3UAJD 5D7SH 1A6UL 4ODHL 1VSCA 3WHE0 4LHQB 4QHUA 4QHUB 2D3VA 3O3DA 3O3DB 2HA1A 4IIQC 2XRAH 3KPNA 3KPNB 3LMJL 2BNQB 2WNGA 3TNNA 3ARGA 3TNNB 1MFCH 3NFSL 4P23B 1ZV5A 1UFUA 2WSKA 4MCZA 3T0VA 4MCZB 1RZKC 3ZKMD 5LVEA 3TJHD 4XNZC 4X6CA 1FP5A 4X6CB 3VGEA 5K9JH 3WFCH 3RX5A 5H37H 5D72L 2V9QA 4PS4H 5EN2A 1Z0MA 5J1SC 1KIQB 4KU1A 4O58L 3QDGE 5MP6L 1CDBA 5JR1H 5GRVK 5DO2C 4EI5C 2P8MA 2ZZUT 1OWRM 2P8MB 5AYUL 2VR5A 1CDUA 1IAIL 1EEUA 4GW1B 5FUZL 4P46C 2J6EH 2GFBA 1JPSH 2GFBB 1DR9A 2FATH 4U1GC 4Z0XA 2J3SA 3R1GL 4OSUL 4Z0XB 5HYIA 1N4XL 4KROB 1AHWC 4P5KA 2OXHA 4P5KB 3HLAA 1EUTA 3B9KD 3HLAB 2DD8H 2D7TH 4F9LC 4GW5A 4GW5B 5FGBC 5D1QD 2D4FA 3QPXH 4ZOCA 3WUWG 5EA0H 3QDAA 2R0WL 4QRQB 3U9PL 1N5AB 3LRHA 4CW1B 2RBLA 4QO1A 4DFIA 1A6TB 12E8L 1IGIH 5DHXB 4YFLI 2AJUL 4DVRL 3U7YH 3ZTNL 3IU3A 1K3IA 1NUDA 4MJID 1E4WL 1TVBA 1TVBB 2VLKE 1NKRA 2CIIA 3IFPA 4HBCL 1G9NH 3IFPB 2QSVA 5KSUA 3DV4A 3DV4B 2FO4A 1OP5H 2FO4B 4ODSL 5M7QA 1J05A 3MRMA 5IBLC 1PX3A 1J05B 3MRMB 4WI2A 5D1ZC 3AFLA 1HWHB 3GBML 1AI1H 1GRWA 2AGJH 5DEGA 5DK0B 3BPNC 4HQQL 1YZZA 1Y6NR 4KVNH 4N8CH 5DJ0B 4G8GE 3SJVD 2PTVA 1F4XH 3G9AB 1U8HA 3C08H 1U8HB 3S34L 2EE9A 3AS0A 4L3EA 4L3EB 2DQGH 3W11D 4P4RB 4N0UE 4XWGL 3VXQA 4BQ8A 3O6LL 3VXQB 5EU6A 1EHLH 4FP8L 5EU6B 4LSPH 3BX7C 2F8XC