3I2CH

Crystal structure of anti-il-23 antibody cnto4088
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVQLVQSGGGLVQPKGSLKLSCAASGFNFNTYAMHWVRQAPGKGLEWIGRIRSKSHNYATDYADPVKDRFTISRDDSQGLLYLLMNNLKTEDTAMYYCMREGIYGSFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncanonical conformation of CDR L1 in the anti-IL-23 antibody CNTO4088.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CNTO4088 LIGHT CHAIN
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i2cH01
4OCSH 4HUWA 4YIQA 1BREA 1D6VL 1QKZH 5C0AB 5T33L 2VQ1A 1Q38A 1FHGA 4WHDA 4JG1H 2R0ZH 2FECI 4MQXC 1FC1A 3S4SA 2ARJQ 5C0EA 2Y6SC 4AT6A 3MLSL 1G7LA 3DXAE 4OFKA 3PDOB 3U0TA 2HJLA 5D2NC 2P44B 5KTEL 3VDCA 5D1XB 5CSZB 5CGYC 4FMFA 2UY7A 4FOMA 2VDKH 4KQ4H 4RAVB 4QRPA 1CGVA 4O02H 5CEZE 1RZGA 4MNQA 5L8KB 5EORH 4XAWL 1VERA 1BVZA 3BGMA 3PV6B 2FEEL 4IRSA 5DLML 4P99A 1IFHH 2H2PC 1FJ1A 1NFDF 2C3VB 1W72A 2VZTA 4ZUVA 2I9LB 2WMPA 4FQCH 4YBQD 4HUVA 1NLBH 5JPMA 5T1KB 2D7PA 5T3XE 3KVQA 4X7TB 2C26A 2EC9U 2IPTL 2YXFA 3KLDA 3QSKB 3HZYB 4O2CB 4EDXB 5IB4B 2EH8L 1QR1B 4LCIH 2DJSA 2X4SA 3WUWG 2WUCH 1R3IL 2AJSL 2A73B 4MA8L 5FYKL 1C12A 3FN9A 4NC2B 2K1MA 1IGYB 4JPWL 1CDUA 3LB6D 1FZMA 4QEGA 4RFOL 1KGCD 5JMOC 3KS0H 1T1ZB 1NKOA 3SKNA 4IMLA 3TJEL 4MXQD 3OB0K 5GGTH 4KKLC 4MA3B 4ZO7A 3PP4L 5DQ9B 5HPMA 2NY0D 3O8XA 5H2BA 5IK3A 1AJ7L 2HG5B 3BGFB 1KTDA 4FFYL 4Y16C 4PRPD 4PJHA 1A1MA 4E42A 1FE8H 4X98A 1U8HB 1WEJL 2X7LB 3HNVH 1KJVB 5H37H 1EHLL 3VRIA 3VCLB 2FGZA 1WWAX 2DI9A 4G9DA 5I1GH 4M7JH 4Z78B 2ATKA 4JFQA 2JK5B 3CFCH 1UH2A 4WI7A 3GJFB 2ERJC 1CE6B 4D8PB 5GZOC 1MLBA 4WUUD 1HINL 4Z77A 3O8XC 2IH1B 2N56A 1JYXA 3NGBB 1JHTB 1UQSA 3FO9A 4RFEB 4WHYH 5TFSH 4AIZB 2VE6B 1PSKL 3PWNB 3GZKA 2XKSA 5E56A 3DXAD 3D0VB 2Q86A 1HOCB 1HI6A 4NO2B 4UT6H 1TTGA 4LHJB 3WFCH 3T4AA 4QHUA 4PV8B 4JRYE 1F6AB 5DUBB 4LLUB 1CQKA 4OBSA 3BP5B 2DQFA 4Y2OA 5IWLA 4Z7VE 4R0LC 1RULL 1SEBA 4ACPA 4DN3L 2R1WA 3RAJH 4Y1AD 2BVPA 4ZXBA 2BVOA 4X6DF 4L4VA 1S7WA 4NKMA 4HWEL 4JFZH 5F97E 1K2DB 3KPPB 4YXLH 3CD4A 4Z76A 1JZ7A 4EBQL 2Q8BL 1RUKH 3SJVE 2AAVA 4LGSB 4LCWE 2AJUH 2ZOLB 4Z0BH 5T1LB 4JPIB 2RFXB 1HCVA 1NCDL 4NZUH 5LKNA 4MMXC 1OPGL 4LSRL 4PUBH 5C0CD 3ALPA 2PYFA 3EHBD 1PKOA 3S98A 2LVEA 2X4OB 4LLWA 1Y6KR 3C5JA 3WIFA 1I85A 5CP3H 3BVNA 3QDMA 1T7YA 3OPZL 4PYGA 1INQA 2VLLA 3O3DB 3EJZC 1UKQA 3VXQA 4BSVB 1PLGL 2V5MA 2FNBA 4GKOA 4PRAB 2PXYB 1CGWA 5F7LB 1S3KL 4NHCH 2F19H 5E8NB 1RFDL 1RJZA 4HMEA 2ERJB 3WN5B 3SDYL 5JOPE 1E6JH 1D9KC 3MSPA 1BMGA 1KENL 2ZCHH 4HWBA 4WW2C 3RWHB 5KSVA 1M6OA 3MJ9H 1T7WA 2PW2A 1IAMA 2DYPA 3MLZL 5CP7A 2G75A 4HKJA 5T5NG 4XNXH 2BSRA 4LARL 5TE7L 2WQ8A 3MFFA 1AR2A 5BV7C 3LN4A 3WL9A 2JJUA 3T0WA 1OVZA 3QCVH 4ZOCA 5AD0A 3KLSA 3EW3B 4LL9A 1T1YA 2B1AL 4Y4HB 3MV7E 3MLTB 4ZD3L 1NGWA 3CNKA 2AEQH 5DRXA 4NT6A 5E6ZA 2WANA 5HGBA 4OKDA 3LRSA 4U05A 4TUJB 5EZJB 3V8OA 1ZT7B 4GG8A 1NCBH 2J12B 3NCYP 5T1DL 1ZVHA 2E27H 4LSSH 4FQXD 2EKSA 2SEBA 5F7HA 5E8DL 3EOTL 1KELL 2DQEH 4JPKH 5FA4A 3VXTA 5DFTA 2DLFL 2ATPA 1N59B 2VR9A 3GMPB 1S5HB 2ZUQC 4K7FB 4NO0A 5JPNB 3RUGB 1KLGB 1MCJA 4TSCH 2HJKA 2XXCB 4GW4B 3TN0B 2A77H 5IFHL 1I3UA 1B0WA 3V7AE 5F7FA 4XH2A 4OZGA 3BGFC 4GRLA 1MUJB 1MJUL 5CCKH 4YHPB 5JTWA 1P2CA 4WTWA 1FE8L 2H2SC 5FUOH 4YDJB 1DN2A 2ITCB 5GRYA 2VDLH 2IH3A 4MSWA 3ZE1E 5JLZB 4JFPB 4K2UL 2X4SB 2YC1A 4Z8FH 4XCNA 1OGAB 4NP4H 5FHAH 1FIGL 1WGOA 3U9PL 3G5YA 5D7JC 1O0VA 1Q0XH 3S88H 1XGUA 4J3XA 2IPUK 4NM8H 4U4BA 3T2QA 3D39A 4AZ8A 4KWUA 4JZJB 3WHE1 1IAKB 3OPZH 4FABH 2F9BT 5LVEA 5TF1H 1R3JA 1B6UA 1T7XA 2CLZB 3V4UL 2H26B 1J1XL 4ZAKC 4PJHB 1HIML 1BZ7A 2R39A 1JNHB 5GGSB 3V6OC 5DD0L 5EU4B 2DQJH 4CVWA 2YD8A 1LDPH 1YECH 1YDPA 4NHCL 5GRZA 1AFVH 5BO1H 4Z78A 3SDAB 4AL8H 5MP6L 3HNSH 4OJFH 3MBXL 5D70L 1AKJD 3LS5L 1Z6JT 2AJUL 3K8MA 4I2XB 4OD3L 2DWDA 3BQUD 1RUPL 3CX2A 4MXVE 1BAFL 5FO9A 3FO9B 1YEDA 3BPCB 2UZYB 4ELKB 3PWNA 2APTA 4N0FB 3JTTB 2DLTA 4GAFB 4KI1A 2VLKB 5JW4M 2IPUG 3O9WA 4X9HA 3FQWA 1T7VA 1PBYA 3GMQB 4L3CB 2W60B 1F2QA 3R1GL 5MEPB 1AI1H 5IR1B 1QBBA 2DJ4A 3L3DA 4L4VB 2X89A 5J56B 5DHVB 2X70A 1EUUA 1HYSD 4X9FA 4PJ5D 4LPXA 1VACA 4HIHA 1AE6L 4Z7NE 3MYJB 1XF3A 2G5RA 2HP4A 3LPGA 4M3JA 1ORQB 2L0DA 4IIQC 3JBG7 3H9YA 4OUOA 5L7XL 3L5JA 4PJCE 2OSLA 4MQ7A 4P59L 2CIIB 5IKCB 5E94B 3IDYB 4FFWC 2AJZB 1CF8H 2AV7B 5MHSE 4KVNH 4LLWB 3ZLQC 5F89B 3TESA 3IAGC 4UTAH 3HZVB 2VTFA 3IDXH 4LKCB 2ICCA 5HPOA 3PHSA 3W82A 3ECBB 4U1IB 5E2VH 1WBZB 3KPTA 4FQQA 3TLRA 2G2RB 3U1SL 4RGMB 5C09D 1CG9B 5LXGL 1XZ0A 3TO4D 5F8QC 4OV6F 2DB8A 4NQDB 4PJXF 4ENEC 4PGJA 4OLWL 4Z7WA 5KVDH 4EUPB 4Q9RH 4CJ0A 4FQXC 1OWWA 4RRPG 3BDXA 1MREH 4G8FA 3SE9L 5GGVY 5ILTH 4GXUN 4M43L 3KDMA 4M1CD 4N0UB 5INCB 5IJKC 1NUNB 2I27N 1OD7A 4KTEH 1WTLA 4W6WB 1WSST 4JFEA 3HR6A 4ODTL 2OR9L 4LLDB 3W2DH 4PJ9B 4HUKB 1T1YB 1FL5A 3MPCA 3O6LH 4XC1H 5C0DB 2GCYA 3IDJA 4NNYB 4CMHC 1NCWL 1F5WA 4OB5H 2GAZA 5CCKL 1YECL 4X80H 2I26N 4UQ3B 4YDIL 1ZANH 1ZHKB 5MP6H 3C9NB 1F02I 2DD8L 1LO2L 3FO0L 4OGAC 2FR4B 2Y6SD 1WFUA 5IB2A 3QUMH 4LSUH 3F65A 5DJ2B 1CD1A 5DGRA 5AAWA 4MVBC 4P9MH 4OCXL 3OKLB 3MLWH 5FDWA 3MO1B 1T83C 3OKMB 1LQSR 3HAEH 1Q0XL 1L9MA 1KLGA 1BM3H 5ESQB 4OFYA 4QRUB 1QBLH 3DI3B 1KIQA 4LF3B 1CS6A 5GS2H 2W0LA 2XV6B 3CH1A 2GI7A 3H7BA 3OX8A 2XWTB 5GSRB 3U4EB 1BPVA 3MXVH 2CK2A 5DURD 4U1JB 4P23A 1HHGA 3F62A 3ULSB 2H1PL 2X40A 1CTNA 1S9YA 2HJLB 4I8DA 3UTTD 4JG1L 2YUWA 4MSWB 2W65A 5JLZA 4AH2B 3D3VA 4MXWH 4OQTH 1H8NA 1NJ9A 5GS1A 3V6OE 2IAMD 5F93C 2VXQL 4LAQH 3B5HA 4KK8C 1UM5L 2VWEC 2YPLE 3OKEA 3BGMB 4S1RH 2MFNA 1XMWA 4QOKA 1GGUA 4P5KA 4X5WA 2P7TA 1IAKA 4YHYC 1NGYA 1KTLA 4CVXB 5FHBL 5JXEC 3ZKMC 3H9HB 1NGXA 4BZYA 3R1GH 3ROOB 3H3BC 5D7SH 4KI5F 1JGUL 3FJTA 1OWRM 3K4DA 4JVWA 2BMKB 4PRIA 3LKNB 2E7CA 2VDOH 1UVQB 3CUPA 4C83B 1RZKL 4HCRL 3C08L 3ESUF 1N7ML 4B50A 1V7NH 3QUMA 3ZYIA 1MCQA 3FQUB 3WJJC 2KQNA 1I1YB 1CFNB 3MNZB 5DJCA 1J8HD 1NL0L 2V5RA 1WZKA 2WQRA 4X7CC 5CJOH 1AGFB 3SJVD 3HCVA 4YBHA 5CJQL 5BVPH 4X83A 3RJDA 4YUEL 3L9RA 1YEKL 1KOAA 4P46A 2FLBT 4G8GB 2Z31C 4L8DB 3HAEA 3PWUA 1A9EB 5KSAD 1RZIA 1PKQB 4X98B 4OFDA 4WV1B 2DDQH 4UBDC 4GW5B 5I1LA 1SEQL 3GKZA 4Q58C 5I1IH 2H2PD 3CAFA 1C5DA 1NUDA 3K4ZA 2EZ0D 5CINH 4CN1A 1N6VA 2EDBA 3ES6B 4YGVA 3ARGB 3RPIB 5HYQB 1XGPB 4K7PX 3ZMRA 2IH1A 1J1PH 4OLWH 5KVDL 2HKFL 3QO0B 4LVNC 1GHFH 3WFBL 1T2XA 1ZE3C 5C0NC 1WIUA 1PX3A 2ESVE 4N1EA 5FYJH 2EEBA 2Q86B 5JZ7C 3V7MA 4HT1L 3T4AB 4CL7A 4ZOEA 1QOKA 3CJJA 4X9BA 1PSKH 4MNHA 2Z8RA 3O0RH 5JOPD 3I3DA 1YNKH 2FJFA 4JHWH 4YHZH 5HDLA 1U9KA 2HTLC 1A7QH 5ETUA 5DSCB 5ALCL 3MGTA 3WO3B 5HDQH 2AQ3A 1NGZA 3CFIC 4M1GL 4WI4A 1ZHNB 2BHUA 1D5ZA 1WZ1L 3PJSB 1EK3A 5SWQB 3ARED 3B2VH 5E4EC 4W70A 5HPMB 1GH7A 3ARSA 5D7LA 2ZOLA 2NY5L 4NRXA 1KTDB 4QTIL 2X4NA 5DS8B 3GSVA 4QRQA 2A74A 5I66A 4LGPB 3IKCA 4JG0H 1KXQE 2QV2A 5T5NF 1CL7L 2FHCA 3KNBB 1TJGH 3OHXA 3HPJA 3OJVC 3GSXB 5C0FA 4WI2A 3EO0A 2FZ3A 2XZQH 3C5JB 1MCEA 1PDKA 2P5EA 3L3KA 4XMLH 2VLLB 3LB6C 3DYOA 3O3DA 1WF5A 2ADGA 5E08L 2EDEA 4JM2B 1UCBL 1NAML 2VDRH 3MMEB 5DUML 4H8WC 5B8CA 5IVXF 2Z35A 4LEXH 1TVBB 5A43C 2VXTH 4OD2A 2GCYB 1MRCH 4YH6A 3MRRB 1R3LB 4B53A 3OXSB 3JTSA 2NY3B 4S1DD 5T5FL 3QZWA 3MRJA 5HHNB 3EYFA 1XGRA 1D5MB 4P2QD 3IRPX 1RV6X 3QAZC 1P4IL 2R0LL 1S9XB 4FS0A 4Q7DA 3VFOB 1F97A 5E6IA 2L7JA 2EIDA 4K3DH 4GRWE 5TE4L 4MA7H 1NDGA 4FQ1L 5E4EB 1EUTA 3GSWB 1K4DA 5E8PB 3MFFB 5E1AA 5IMOB 4ODHL 5LGKA 4FG6D 3LEYH 1VPOH 3RZWA 1TZIB 2YPKA 4DZBA 5F7UA 3D6GA 2F5AH 3O6FC 1P5VA 5I1HH 1DLFL 4Z7VF 3H9SD 2E9BA 3QXWA 5E6IC 3K74B 4PP2B 3NPSC 4X4MA 3WNNA 3U6RA 1ZGLA 1L6ZA 3RP1A 25C8L 3KPLA 4JO1L 1MQ8A 1AHWA 4U3CA 5J6GB 5GS0D 5FXCH 3IFPB 3C6LB 3RGVD 4JO4L 1GGCH 4OZ4B 5F1NA 3RX5A 3VFWA 4WJ5B 4DOHE 3TBSB 2APBA 1YY8A 4NRYA 4GRLC 1KCVL 4MJ6A 3LN9A 3K8LA 4RFNB 2HA1A 4DW2H 1IBGL 1R5VB 2VOTA 3O6FD 4OZFB 1PX4A 4LPYA 5FO7B 4U1SA 3S3JA 3BWAB 3EOTH 5K9QG 4X5WB 3QUXA 3QJFA 4I0CC 3SGEI 5J12B 3IFLL 3X11A 3FT4B 1I3GL 1OP3K 2BNQA 4EI5B 1WITA 5DWUH 4YXHL 3PQYB 3CLFH 4ESKA 1FZOA 3DETD 3QXVA 2X1WL 4LFHD 4DQOL 1W72B 5AG9A 2DLIA 1A14H 3C8DA 1E6OH 3W9DB 5FA3A 5TH2B 2IBGA 3WDIA 5HVHB 3DX8B 1FH5H 3WLBA 1MJUH 2YRZA 4IRJC 2R15A 4YEEA 3VWJA 4D0CA 1XR8B 2YZ8A 4HUXA 1I7ZB 2IALA 2ADIB 4WW1B 2X1QA 1LEKB 3O2DL 3QPQC 5T1MB 3S4SB 1FDLH 3AMKA 3E6FB 3G6AA 3U30C 4N0RA 5JIIA 4P46B 2IAND 3ZKXB 3VD5A 4I0PC 3UXFA 1VEPA 3HAEB 3SKNB 3EYVB 3DMMD 1UCBH 4X5LA 4NKQB 3BESR 5JIKA 1RZIB 4CN6A 4PJCB 4Y5XC 4APQB 3IU3A 3F7QA 2ORBL 2FYYA 4ZS6C 5JW5B 2OTUB 5C08E 4GXUM 1KJVA 3GI9L 2NNAA 1OY3B 4UT7L 3WXVH 5CGMA 5CEXA 4JKWA 3DBXB 1HDMA 4POZD 1P4IH 2EEDA 3PDOA 3BKYL 2RHEA 1XF4A 3GRWL 4LSQL 3SKMB 4F9LA 4L3EB 1EAPB 5EIIB 1ZWIB 1ADQA 3H2WA 3ZSTA 4WUKL 4KQ3H 2QLVB 1HWGB 1EVTC 1WCBB 1O7VA 5J6HB 1HHKB 5ADPH 4XCEA 2AEWA 3P4NA 2VDKL 3GSNL 1LE5B 1ZTXH 2NY6B 2OXGA 5E2UH 1CN4A 5HYIA 3ARFA 2A73A 4U1LB 1JTTA 3RL2A 3D39B 2BK8A 3PJSA 4R8WH 1JBJA 43CAB 4LLYB 5C9KA 1F4HA 5EBMB 5DI8A 2W9EH 3U83A 4XVTH 1II4E 1IGCL 2V2XA 2X4NB 5DS8A 4R7DA 5JPMB 3LZFH 3AS2A 3U36B 3HE6D 1IKFH 3E8UH 1MCWM 3HZYA 4O2CA 4EDXA 2HRLA 1G1CA 1VKXA 3KG5A 4P23C 4UILL 1U6AH 3C60B 4EUPH 1MCPL 1OCWH 5F89A 2CJUL 1HYRC 3MACL 3TP4A 3VFVA 1TDQA 3GSUA 1FZMB 2X4OA 4N0FA 1BQLH 1I3RB 2E8ZA 4PJEF 1UC6A 4FQIL 5J7CC 3TCLA 4WGWB 2BNRB 4PJXA 3TH3T 1J8KA 1MCSA 1EMTL 4NC1E 4WWID 4WWKD 2VLRE 2J5LB 2X41A 5IK3B 2VABA 3WCYA 1M7XA 3GJEB 3UTZA 4GLRI 4WVRA 5CIPB 2HT3D 4E42B 3F7VB 5DMJB 4EZMA 1AGBA 2OMNA 1OAXL 1SEBB 2YA0A 5DD6B 3ZE0E 3I50H 2BVPB 5FM5M 3O9WC 2BDNL 3DO3A 2FECL 1A8JH 4JDVB 1TZGL 1N8ZB 1NFIA 3AROA 1ED3B 1KJ2A 4NQSA 2FH8A 1GGBL 4G7YH 3FB5A 4ZQKB 1Z3GH 2BSRB 4KK8D 5ALBH 4ZTPH 3DLQR 5T1LA 1I3GH 2FBJL 1A7BA 2ESVB 4U6HB 4AENA 3TBWB 3VXRD 2JKXA 2BY0A 5I74C 1OAYL 1EA9C 2ORBH 4OF5A 1GZPB 3KWWA 1RULH 4GAYA 5CZVH 1KG0A 4PRBB 1A6ZA 4QHMA 4UT7H 4NKMB 2ZKHH 3WIFB 4KK5C 3M8OL 4PB9L 5LBSH 5GHWH 2EDTA 4KROB 1IVLA 5IEHB 2ZJSL 2E7BA 1CXHA 4WDIB 5J1SC 4RRPA 3K80A 1KTRL 4LQFL 5FA4B 3BZ4B 1BJ1J 3I2CL 3EIFA 3ZYZA 4I1NB 4GG6E 4Q6IC 1SJHB 2OJZL 4ZFZA 5SX4H 3RDTD 4YHOH 3VWKB 4AG4L 3ILPB 4H1LA 5EU6B 2UUDH 2GFBA 2NCMA 3OKNA 5CP7B 4OV5B 3DARA 1WK0A 2HT3C 2W9DH 3DX8A 4XP1L 4OZIE 1KEML 4TVPD 2CRYA 2ITCA 4MAYD 3W0WD 4RISL 3G6JA 1ACYL 3UJTL 4JKKA 3WXWH 1GRWA 2F19L 2GITB 4WHYG 1Q72H 3OKDB 4WU7B 4LP4A 2XTJC 2EE6A 1MVUA 1X4ZA 4HWZA 4TOYL 3DPBA 4LSQH 3H3PH 3BIKB 5HXMA 1PY4A 2X4TB 4TUJA 2JJTA 4BH8A 1YMME 3OV6A 5D6CB 5IJVA 5I6XB 3HKFA 4NFCA 2OK0L 3MV8A 4ZPTB 3SE4A 1RK0B 2J1KA 4UB0H 3MO1A 5FKAA 2VUYA 4QRPE 1UWGH 2EIZA 5CZXC 3RIFK 5HDBE 4KV5E 1UM6H 4X6CE 1N5AB 5CHNB 2R29L 3VI4F 3WDHA 1S5HA 2HH0H 4U0QB 4DTGL 5FGCE 2B1AH 5TDOB 3PWPA 4YNYA 4XP9H 2CH8A 3OGCA 4OUUB 5HGBB 2OI9C 2GK2A 1CFNA 4WEMB 2I07B 1DR9A 5DJ0B 2OL3A 1ROWA 4O4YL 1TZGH 3JTTA 3DECA 2JELL 2GIYA 3DX9A 3MNVA 3RDTC 1J12A 2VLKA 3FRUA 2R69L 1NL0H 5FM8A 2IMNA 1LE9B 1UACH 4QT5B 4TYUA 4JN2A 1ZLSH 4G5ZH 3ZE2F 1KUMA 3DRTA 4N0YL 1ND0A 1GIGL 3HI6L 2D31A 4DCQA 1GOHA 5JUEL 1DBAL 1EO7A 4GRWB 4LLYA 1EO8L 4L4TB 5DHVA 1NGYB 2CO6B 3RI5F 3VH8B 1IGIL 2ARWA 5C2BH 4MAUL 2DN7A 3IETA 5C0BE 4A6YL 1T5XB 4J1UB 4JY6B 4FFZH 4BQ9A 1P6FA 4OT1L 2H32H 4PJIA 1I7RB 3DSNA 3QRGH 1U2HA 1MAMH 2HFFB 4L9DA 5EG6C 5FUOL 3V6FB 1NEUA 1J0IA 3QWOA 4KK6C 3WUWA 1F6FB 1BIHA 3LN5B 3X13B 1MJ8L 4LHQB 5IFJB 1YDPB 1N4XL 1AD9B 3QHZH 1KLFA 2P8MB 4Z0XB 5C3TA 1WZMA 5BQ7B 4LPUA 5I18H 3KLAB 4YHOL 4XPHH 2BNUA 3BZFB 3PUCA 2E6PA 3TV3H 1J0HA 2QSCL 1ORSB 3GGWA 3IDNA 2FBJH 4K7PH 4UT9L 4JM2C 4GUPA 2V7NA 4XX1E 2IADB 3UTZB 2ZNWA 1MHCB 5E2WH 4C57C 4QRRB 2CMRL 5CZVL 3LPFA 5SWZB 2DJUA 1FFNA 2W60A 1YEJL 5JXED 3O2WL 5CBAA 5IT2H 3KPSE 4PRHE 2NW3A 5DJAA 5GGQH 3ES6A 4YGVB 5LGJB 1AXSA 4HKZB 5F6IB 2JK5A 4OI8A 3BPOC 4UINL 3NIGF 2XY1A 3S6CA 2VLJB 3SDDB 3HMXA 4R3SA 5B8CB 1D7FA 3V4VL 3QUZA 5K59F 4HH9B 2VE6A 3TBWA 1RHHA 4N9GB 3I75B 4IOFC 4G6KH 5HBBA 1PFCA 4XCCH 4S10A 2EDXA 3EZJB 1F6AA 1J0KA 2R1XA 4Y4FB 5IR1A 4LHUG 3NZHH 5L2KD 5KVFH 2VLRD 3C6SB 4BELD 1KB5L 4M03A 1ZSDA 3DV6B 4RMRA 5AUMB 1C1EL 1OAQL 3RL1B 5FGCB 5D7JD 4IMKC 1F4XH 3GSWA 4RMVA 4I77H 3QQ3B 3IDGB 3SKUD 2VIRB 1RMFL 4R2GD 3FB7A 4MD0A 2E7MA 4WV1C 5GGVL 2AEPL 3Q6FB 4HK3J 4NDMA 4PTTA 2IBZY 2N1KA 4LU5L 3SE8H 5ESQA 2QQLH 1LP9F 4MA8H 3IJHB 1OAUH 2AJZA 3ULUF 2Z91A 3H7BB 4YXKL 4UZGA 4D9QE 2P5WE 32C2B 3GB7B 3BXNA 2EIBA 3LQZA 4ZXBD 4I5BB 1BWWA 3W9EA 5LWYH 3DURB 5EO9B 2GJJA 4ZS6D 3A6BH 4X6EA 3QZWB 3E6HA 5IF0B 3DTXB 4IRJD 2ZUVA 1UB6B 2APVA 1XF5B 2Z8WC 5E8NA 3IVKB 2JB5H 3LQAC 1MCDA 1BX2A 1D5IL 4GXVH 1VEMA 4JFHD 5E2JA 1ZHKA 3M1BB 3SO5A 4KKBD 1HINH 1KIPB 5D71H 5IJVB 4OGZA 1VFOA 2BVTA 4GSDL 3VGDA 1HKFA 4MD4A 1J11A 2EXWC 1KCSL 4NC0B 5I76B 4JFYA 5HYEA 4ODTH 4LLDA 2HFGH 3G5VB 3U2SB 4U7MA 3LN4B 1FG9C 2ZUXA 3LIZL 1SJXA 3PWPB 4YNYB 5AD0B 1M05A 1KIRB 3E1F1 2Y23A 4JHZA 3HUJB 3CH1B 2W1NA 1K9TA 1VHPA 2YRPA 3HRPA 5CP3A 2ZCLH 2NY2C 2DICA 1JWMA 1LK3H 3O3EB 4HS6A 3S7GA 4RQQA 4HULB 1LEGB 4PY7A 1MJ8H 1FV1B 3S37H 5J0BA 3TO2B 3VWJD 1QQDA 1U8OB 3FQRB 4U1NB 1MJ7L 2XN9B 4APQA 3O4LA 3GI8L 5F7DB 1OT2A 3PE9A 1LO3L 3PWUB 2CKBH 2Q20A 4JQXA 1KSRA 3TV3L 5BS0A 3SGEH 3SKJH 3UMTA 1IILE 4U6VH 5CBEA 5FYLH 3I9GH 5DUPH 4W4OA 2H8PA 4U1JA 3SCMA 5ESAB 2VZVA 3SBWC 3VI3E 1S7TB 3BUYA 2CMRH 5GS0C 1HXMB 1KB5H 1HHJA 1RPQA 5CILL 1C1EH 1OAQH 2EDHA 5T3XH 1UWXK 3EYUL 2CKBB 4X9IA 1CWVA 3V79C 4NZJA 2BRRL 4B7LA 5C07B 1AD9A 3MRLA 3NPSB 2Y5EA 2VN7A 1KNOA 1RIHH 4W4OC 2ADIA 2YD9A 1SY6L 4HWBH 4M48L 3KPOA 4QRSA 5IMMB 4X6DB 4MDJB 3GO1H 4U1LA 1IFHL 4K71C 3SDCC 1NUGA 2XNAA 3RU8L 2XTLA 5ADOH 4WI9A 3F12A 3VFUB 3HE7A 4FZEL 1EHXA 1XIWA 2FJHB 5JHLH 2LV4A 3KJ6H 2A0LD 1ZKAA 4OD1L 4XPAL 1MEXH 3K0WA 4J7RA 2JTDA 4R7DB 3RA7L 1BFTA 3EFFB 3TPKA 3IFOB 1JPTH 3U36A 1N5YL 2CD0A 3ARFD 1VB9A 5EUOE 3RIAF 1FO0L 5KVEH 4H0GA 1BOGA 4L3AA 2D7QA 3KPRD 3TZVB 2NW2A 1DJSA 5CLTA 2JB5L 3AS3A 4I77L 3QWRD 3KYKL 5JHDB 1KTKE 3L6FA 4C58B 4HK3N 4LMQE 4PREA 1MELA 4UILH 1I3RA 5AYUH 1CGUA 1D9KD 5AZEL 3ARWA 5TJWK 3U9UA 1A6WL 2F8XC 1IEBB 1FPTH 5CJOL 5IW6A 1Q0YH 2QQQA 5CD5C 3PP3H 1KPVA 2Z93A 1MIML 4QYOA 5KN5A 5FECB 4KUZL 2YSSB 2OR7A 4TSCL 4K23L 1J1OL 2FJFB 3EYFB 5EZIL 2RB8A 3VFMB 1TPXB 4P4KD 2P5ED 1UCTA 1DBBH 1LGVA 5TQ0L 2HLAA 3KYOB 2BHZA 4JCLA 4ONGH 5C09E 1UB5A 4WW2F 2V5YA 2VXSH 1ZHNA 2D03L 3Q6GL 4F2MB 1R6VA 5J06A 1M71B 4K2UH 3BQUA 1CD0A 4Z7UE 1CVSC 1OW0A 4MS8C 2NTFB 4NQEB 3CPLB 5CEZH 1K6QH 3BT2H 3LMJL 3KNBA 1YEEH 5ALBL 3TWCH 2MKWA 5T3ZH 3SKJL 3TBTB 1GYAA 2AV1B 2YS4A 5GRJH 2G60L 3GB7A 5C0GA 1EJOL 5ALCH 4Y4KA 4JFDA 5ESVA 3KPLB 3UTSE 3N50A 3C6LC 3RX8A 2X9YA 4RX4D 1MIEL 3IDIB 4ZO6A 5E6ID 5B39B 1WTGT 3VXUA 1IGFL 5IF0A 1NC4D 3UP1A 5C0ND 1FG2B 3GSVB 3F7VA 1NDMB 1FL3A 2E8YA 5HHNA 5T1LD 3EDFA 2AERT 1XGRB 4HF5L 1A9BA 5JXAH 1NH6A 3C5ZD 1TJGL 1UWXH 2X05A 4XPGH 5CEYA 1JFQH 3MBED 3K2UH 3OWEA 5HHMD 4HIJB 4DKDC 1ED3A 4EI5C 1SJEA 2FRGP 3JWOC 1UXWA 2ADGB 4O02L 2XA3A 5CAYB 3G6JF 3OKYA 4XAWH 4N1CA 2VDRL 5JOFB 4DVRL 3S9DB 5IHZA 1ACZA 3PL6C 3JXAA 4AQ1B 3VI4E 4OF0A 1CICB 2PXYD 5AYQA 3EUUA 4V2CB 3I6LD 1A2YB 4RISH 5FAAA 1ZGLB 1IE5A 1JWMB 4JDTH 1OQXA 5JNYB 1OLZA 4QXUL 3IKKA 1WVZA 1Q9KB 3N06B 5E2TH 4PJCF 5KS9E 5EZLA 3B9KA 5E9DA 4LCIL 3SQBA 4YHYB 4PGZA 3T09A 2ARJA 1KPUB 2DAVA 1MRFH 3UC0H 1ZLVH 5ERWA 1FNEA 3RU8H 4JREB 2QTEA 3MA9H 1NPUA 3SGKC 3E2HB 1TJIL 1KCRH 5TDOA 4JAMB 5IESL 3G9AB 1S7SA 4MHHG 2ICWB 4U31A 3BN9D 4Z7WF 3M45A 3OTTA 2GFBB 4P2RD 3QG7H 3LD8C 4AMKL 2AK4E 2P8LA 3MV7B 4OGXL 1FO0B 3EYQC 1DEEA 4BUHA 4FQXB 1RUML 1FN4A 3L95A 1AXTL 4TUOB 3VXUE 2AXGB 1ES0A 4DK3A 1OQOA 3R06B 4QGYA 4IHOB 3LMJH 3UTSA 1HHHB 3MRKB 1N0XH 3T0EC 1LEKA 5DA0B 4IMKA 5E8OA 4HXAH 3TN0D 3PGDA 1P69B 1IAOB 1ZT1B 2ADFH 3DGGA 3KPQA 4M7LT 4TVSa 5K9JH 4OQTA 2FH6A 4Y5VB 5IHUH 1VEOA 3DIFB 4ONFL 1QFUH 4JQVC 4ALAL 1SMAA 3O6FA 5E03A 3H9HA 3D2UA 3WJLC 3LRGA 2J2ZA 4Q0XH 4Z7UA 2XFXA 5DR5H 5A1AA 3VXPA 2AXHA 2PYED 3HI5L 1Z9LA 5E1HB 5ANMA 5DVOA 1ZLUH 4OZIA 2ZG2A 1BBJA 5BJTA 5BQ7A 1LO0H 5DD5L 2IBBA 3ZTNL 1LHZA 2BNUB 35C8H 5F8RC 2C7UA 4YAQB 3INUH 3VGAC 3I6LE 1P53A 3X3FL 1JYWA 2O5ZH 3BPOB 4FQ2L 3STBA 2KDGA 5FEBA 3WMSA 4D3CL 4EEEA 4TRPH 4XPHL 4JGMA 1A02N 4ZUWA 4BUGA 4GG6A 4JHAL 4LOUD 3TJHD 4JGJA 2F5BH 3CFEA 3ULVL 4H5SA 2B5IC 4LCUB 3TBYA 1A9EA 3ULUL 4GKSA 4OJFL 1QRNE 3P4MA 3S34L 1B90A 1YMHB 4LSVL 1MI5B 3T65A 4XCFL 1N64H 4B7IA 5LGJA 1Y18A 2EC9T 5L6YL 1P7QA 1YEJH 3T0ED 4TQEL 3H6JA 5F9OL 3REVA 3QEUB 5DI8B 5EUOA 2IGFH 2O5YL 1EX0A 4OTXH 5DFVD 4WI6A 3VG9C 2ZCHL 2DQHH 3X13A 3PIQB 3DO7B 4N9GA 5DLMH 1VFAA 2GY7B 3O3AB 5GJTH 3NH7H 2HKHH 2GUOB 3S35H 4D2NA 4QXTA 5GXBB 3QDJB 3QRFM 2GHWB 4KKBC 1P6AB 2Y7QA 5JA8B 1CLYH 1RURL 3TH2T 3NACL 1RU9H 2I9TB 3I85A 1SM3L 3IDIA 4MQTB 3DV6A 1ADQL 3F7YA 4GUPB 1HQ4B 2V7NB 3IS0X 3TGXA 3AAZB 2AP2A 1MCNA 2CO7B 3MRMB 1IQDA 4U49A 3FO1A 4HMDA 2UY6A 4XWOD 3PDGA 5ICZA 4JY5L 1IKFL 4RGOL 2VLRA 1CFVL 3RWIA 4XHQA 4PLOB 4Y5YA 2XZAH 2X10A 3AU1A 2Z91B 1OCWL 1I1AD 4WHTB 2VDQH 3VRJB 3GSXA 2P46B 3OXRA 2VWEE 3VFVB 2ED7A 1XCTB 3EO0B 2YK1L 4XPBH 2OTPA 1N8ZA 1NFIB 3U0PB 4NJAL 3GSQB 3QIBC 5GGTA 1IM3A 3E0GA 3GHBL 4ONFH 4KDWA 2XQBH 2ZOKA 3RTQC 1MHHB 4JRXD 3GHEH 3RDTA 1DE4B 1W8OA 2FATL 3O2DA 3OXSA 4LVEA 5I1IL 2VYRE 5CJXA 2WUBL 1JMXA 1IM9A 3GSOB 1A6ZB 2A6KA 1EERB 3P9MB 1W0VB 3JV6B 4HKXA 3EDDA 5EZLB 4EQ2A 3WNOA 3JUYA 3RX7A 3OJDA 3G08A 3KYMB 3BEVA 5HJ3A 2NXYC 5IB5B 2ZUYA 4XC1L 5D7IB 3D9AH 4HUWB 1V3MA 3X14A 4X6CB 2EIZB 5D72L 2R23A 4RMUA 5C8JB 3H8NA 4JPVL 5MEQA 4PD4J 5DTFA 4ZFZB 3ZL4L 2PCPB 3A0OA 1LO2H 1A6AB 2LU4A 3GIVB 3HLAB 2DTSA 3FO0H 4KKCD 4D9LH 2ADJA 3U6RB 1H0DB 5EU6A 4LCYA 5LQBH 3HZKA 5EU5A 2DIBA 4PB9H 4N9OB 1YEIL 3VGHA 5KZCD 4QRTB 2D7NA 3UTPD 5IEHA 1KB5A 3KXFB 1UJ3A 1BHGA 3GM8A 1QQDB 4DAGL 3QDAA 3G6JB 5F7DA 1H3XA 1EZVX 3MV8D 4QHLB 2DKSA 4OD3H 5IVXA 1EEZA 1HWHB 3BP4A 3EDEA 2O5ZL 1EFQA 3HC3H 3MRQA 5DC9B 2P5WA 3SDDC 4L8BB 4MCYB 3D48R 4Z95H 4F7CB 2HRPL 5TF0A 3P40A 3WFHB 4KDVA 5CKGA 3UTTB 3OJMB 3NCJH 4UDTA 5AAMA 4DGVL 2Z31B 3W81A 2VB5A 3MLRH 1PD6A 4G8IB 3I6KB 3WLWC 2LAGB 1WLHA 4MXVF 1QPPA 5DRNB 5IB3A 3THML 15C8L 2UV3A 4MNQD 5BS0D 1A7PH 3WFDH 4Y89A 1WBYB 4R4ND 1HN1A 5CD3A 4PY7B 3QI9D 4TUKL 5D96B 4NM4L 5J3HD 1I1FA 4C59B 2YN3A 5EZOH 2ICEB 2FEDD 3MNVB 4ZD3H 5I1JH 1J0YA 2IADA 2Q7NA 1DLFH 1OHQA 4GKSB 3HC0A 3DX6A 4EN3B 3IDXL 1H3VA 1FFNB 2WM0A 3B8SA 5CBAB 5HHME 3MUHL 2CPCA 4XP9L 4EIZC 1NSNH 5IQ7L 3CSYA 4E41B 1I85C 4JPKL 1MI5E 4X4ZA 4ZUVB 5F88B 2K3TA 5HGAA 1T04B 5ENWB 5ITFA 4X4ME 4X7TA 3V6FA 5IHBA 2Q3AA 4R97B 2XTJB 1NFDB 5F1IB 4P5TA 3MLYL 5LAXB 2IAMC 5HY9B 1FPTL 2DDQL 4G8GE 1HH6A 4MQSB 5JORB 5IMMA 3IFLH 4J3UA 3ZKNC 1C5BH 3B2UD 3M17A 3B4NA 3VFMA 4WW2A 5KSAB 2YWYA 2YUVA 4YE4L 1D9KA 3OKOA 3EHBC 3IF1A 3VFSB 3ZE0F 4AM0B 3L3IA 4JJHA 2VDNH 3TNMA 1T1ZA 2EEAA 4L8SC 2FJHA 2MCG1 2R1YB 2YBRA 4DGIL 4FRWA 3T77A 3O2VL 4Z8FL 3ARGD 5H2BB 5HI5C 3U9PH 2DTMH 3GBLA 2AI0L 3QNYB 5LGHH 3WUWB 1MRDL 5I1EH 1DVFD 4PGCA 3NIGE 5C0BA 3FOLB 1PYWA 3SGDI 1NCDH 1U41A 4P9ML 3WHXA 1OTUC 4KUCD 1AXSB 3OAZK 1OPGH 2E7HA 1FYHB 2P5EE 3ZDXE 2P8PB 3LH2H 4P2OA 4XBGB 1HKLH 1RY7B 2GSIB 4YFDB 2R56H 1MPAH 5C0JA 1H3TA 1FVEB 1T89C 4LVHB 1FORL 1IC1A 1DLHB 3NIFE 1HILA 1OB1B 3DURA 2O5XH 3NCJL 5EO9A 2EXWD 2I5YH 3VMPA 2X1XR 5D7LE 1VA9A 2QADB 4WFHD 5J13C 2ITDA 3QQNA 3S5LA 2WIIA 2ZP0T 1H5BA 5F6HJ 3DVNB 4PRDB 3SN6N 3N85H 4LEXL 2YD6A 1K5NB 1WWCA 2BCKA 3FCTB 3QUZB 1OM3H 1NAMA 4X7SL 1MWAB 4XTRD 1E28B 1IAII 4DKEH 2DQTL 3TZVC 1KEGL 2PCPA 5KJRL 2ESVA 4XNQA 4AENB 1QSFB 1A2YA 5EBLB 4F33B 3ARBB 4KI5E 4NT6B 2XY2A 4JFDB 4W4NA 3Q0HA 4X6FA 4ZS7H 5TE4H 2EH8H 3VXQB 3GMOB 4GAGL 4XBPB 1NSNL 5IQ7H 4P59H 1VENA 4X0KB 3B9KB 5B39A 3G6DH 3LEYL 3W9EB 2GK0A 1CF8L 4FFVC 4XNZB 2F5AL 2UVEA 4WDIA 4PGBA 1CFSA 4U6XB 2BY3A 2MJWA 2DM3A 1T22B 3BZ4A 4JAMA 3ZKMD 4EOWH 5IQ9A 1PQZB 2J8UF 1CGSH 5A2IH 4R26L 2JE8A 5ACZA 2IBZX 1JWUB 5C6PB 3VWKA 3FT3B 3VW3L 1TTFA 4OLXH 3RWCA 1U3HD 3DYPA 4OZFG 1A6TB 1Y6NR 4HS3B 3VG0L 2NY3C 3EO9H 2NY5C 3RGVB 4X6DE 4OV5A 4KV5F 3IJSA 2X1PA 1ZHLB 2B7DT 2IANE 4LK4A 4M61A 4YIQB 5BV7L 4I0KA 4AMKH 1ES0B 3IXTA 1OAXH 5K33A 3L3HB 1BX2B 4M5YH 1F3RB 1GHFL 3WFBH 1O5DT 4K9EL 1ULVA 2LABA 3PGDB 5L88L 4YGAB 2NYYD 4YHNA 4RQQB 2HVKA 1QRKA 3NBNA 4LIQE 3SDXE 3HE7B 3BX7C 3OR7B 5BVJB 5LJYH 3PQYD 2VLME 1CDHA 4UTBL 4KZDH 5I76A 1RK0A 2PF6A 2XFXB 2GTWA 3JWDC 4HBQA 4O2FA 2Q8BH 3QO1A 2MPAH 3O6KL 3AB0C 1L6XA 4DOHB 4JY4B 4U1HB 2VQ1B 3QUML 3X12A 1J1XH 3F8UB 1BOGB 3P30H 4MB3A 1S7RB 4HCRA 4WENB 3R0NA 5DD0H 1V3LA 3FTGB 1BFOB 4Q9QH 4PJEB 4QTIH 3B3IB 1LEGA 2L4OA 2I9LA 3WFEL 3T2OA 4RAUA 4HK0A 4N5UA 4Y16D 4M6AA 3ULVD 4WW2B 4QWWD 2FL5A 1KV3A 1RVFL 1U8QB 1WFTA 5EDXA 3IDMA 5IBUG 5DD1H 5D7KE 2VR5A 2V5SA 5I15H 3I9GL 3PGCB 4RAHA 3O9WD 1MRCL 1QSZA 3PHQA 4UI2A 1IKNC 5T1KA 3BN9C 4LPVA 5FUCE 3EFDL 3O8XB 1VFAB 3O3AA 5H8DA 3VXMD 3BKML 2PR4H 4O58L 5E2UL 1MFCH 4LBEA 5DHVH 3I3BA 4C54A 4PB0H 1R24A 3TZVA 2EIEA 4JLRA 4I0PB 4JFQB 3K46A 2UWEB 1R3IH 1P1ZB 2AJSH 3TYFB 1OM3L 3L7EA 4R90L 5ISZE 1DUZA 5ESVB 5F9WC 1CE1H 2AEQL 3HHRB 1E0OB 4OLXL 3S37X 4ZOAA 3I6GA 4K3JH 3BPNC 4KXZH 1QFPA 1RZ8B 4GW1B 5HI3D 4CVUA 1MHCA 2W38A 4ODXA 3HZMB 2V6HA 4KK9C 3HE6B 3MZGB 4WCYL 2EE2A 5HTSA 1H5BB 5FGBC 4GMTL 4Q9RL 3BHBB 3MRPB 4OKVB 1RJLA 3QYCA 4PRDA 2EECA 3I84A 1QLEH 1Y6MR 4POZC 4RDQG 5L88H 2R69H 2XA8L 2AK1H 4AIZA 5C6WH 3QFJA 5GRWA 5F21B 2F8VA 1V5JA 4M93B 4NN6B 4XX1G 1SEQH 4MQ7B 1CGSL 1VCAA 4JPIA 4MAYC 4JFFA 1AKJA 2CK0H 4M6NL 4RMQA 1QR1A 1F4YL 4G9FD 4WWKB 3ARBA 4KDTC 1GIGH 3RWFA 2AV7A 1KACB 2DI7A 2VDLL 5GQBA 4ZFOA 5I0ZA 5HHOD 1W2KT 2FATH 3BN3B 1J05B 5JXEA 4U1IA 2OZ4A 4KAQH 5AEAA 4PS4H 4EDWH 2XPGB 2X9XA 1JV5A 4XPFL 2EDYA 1TZHA 5I16A 3LHPL 4R7NB 2PTTA 4DK6A 2D03H 2XRAH 2DD8H 4NZRH 4YHZL 3HRZA 3CVHB 4X4YB 1JP5A 4O51B 1G6RL 4LIQL 5F1KC 1HCFX 3NCEB 4WWKC 4Y5VC 4Y2DA 4NZUL 2FEEI 2XICA 5DRZA 5IQ9B 4OIIL 4F37F 5MEQB 1KIQB 4LF3A 1WZ1H 2FIKB 2IEPA 3W5NA 1G84A 1XCQA 5ISZB 4IEFB 3KDMB 3M8OH 2BNQE 3GJFA 1FL6B 2DMCA 2HMID 4K7PL 2W0FB 3RWJB 3U0PA 3LAFA 1SJEB 1KBGL 4JJ5A 4BFIB 4LDEB 2VJXA 5DHYA 4JO3L 1N6QL 4HJ0C 2FB4L 2DQUH 4RMWA 4P3CH 1FG2A 4GFTB 3L3HA 2Y07H 4ENED 4OZHF 3ZSSA 1TFHA 5E08H 1J7VR 5F6IC 3CDFA 2OS7A 4ZAKA 3VDAA 5JXAL 4LAQL 2FO4B 4HBCH 3KHOA 5AZ2L 1AXIB 3CSPA 1NEZG 3RHWF 5EC1A 5EU6D 5EPMB 5HGHB 3L3OA 3CH8A 5I8CA 1QFWH 1KPUA 3D2UB 4OSUH 3QWQB 2RFXA 1A7RL 3LKSA 4PRIB 4ONHB 3QEQD 2V2TB 1CD8A 3U2SA 1QFHA 4DJMA 2V9TA 3QIBD 3BJ91 2AGJH 3SEPA 3GMNA 2WNGA 1IGCH 1NC2B 4P5MB 5A2JH 5DJCB 1RZKH 3RY4A 2QBWA 4X8JA 3L5HA 2OK0H 3VFRA 2OR8A 2A6DA 2SEBB 4HJ0D 5GS1B 1OSPL 3P11L 4P9HH 1UM6L 5CSZA 2E6QA 4QHLA 4ETYA 3SE8L 4JFFE 4KK6D 2FL5B 1J0ZA 3WN5A 5CJQH 2WIMA 4ERSH 2RIKA 4M8QA 2V17L 1LDSA 4P5TC 2C4XA 1B0RA 4IJ3C 4PLJD 1HHHA 3HC4H 3MOBL 4W6XB 2A6JA 4WTZA 5E9DD 4J8RB 2RR3A 4KKCC 2VC2L 5I1DA 3SCMB 5CMAA 1FJ1B 1J9CT 3QEUA 3FHAA 2OMBA 1FZJB 3MV7A 4L9LA 2GSGA 3QB7C 3D25B 1H8SA 3MLVL 4HUVB 3BDBA 4U3HA 5DEGB 4JFPA 1A3QA 4P4RA 4MNHB 5GISH 1A4KB 2HFEB 5FB8B 5KSAA 1IEAA 2UWEA 4MCZB 3TT3L 1JJUA 1S7VB 4XXCC 5IVZA 5FUCC 1U3YA 2AK1L 1I1YA 1YJDC 4XHJC 5CD3B 1BFVH 5JA9A 5DJ6A 2C7UB 4PJ8D 1G0YR 1DQDH 1T6WA 4U1GC 2D9QB 2EDKA 3WSQL 2ED9A 1FRGH 5HDBF 4Q2ZA 1XIWB 1QFUL 4XVSL 4ALAH 5HDQL 3NIFF 5ACLA 3KR3L 3WS6C 3WNLA 1FAKT 5GZND 4TNWF 4IDLA 4LSUL 4U2ZA 1HIMH 4ZODA 1LP9B 5SWSE 3QDHA 4PGCB 4AEIL 4GW5A 4PS4L 4EDWL 3HPJB 2NY2B 2XZCL 4ZUSB 1U8HA 3TF7C 4OGYH 4E41A 5I1EL 2QSCH 1R3HB 4NN7C 2V5TA 5EO0A 4Z5RB 1L0YA 2HVJB 4D8PA 5ITFB 3QA3B 1IGML 3U7WL 4O2EB 3TFKD 4YO0B 2FJGB 1D5XB 3LEXB 2AXFA 4XNMA 1NAMH 1YMMD 2R56L 2EE3A 5GGRY 2Z4QA 3HAEG 5F7MC 2R0KL 4QRRD 3B9AA 1PG7W 1AI1L 2IC2A 4P2OD 3SJVA 5DHXB 1K3ZA 2AGJL 4GQ9L 1U8LB 1VACB 4FQLL 1TZHB 2BVOB 3O11B 1ZK9A 4KQ3L 4OF6A 3WJLA 4DKFH 4HIXL 3R8BB 3V4VH 1M7IA 1QUNA 2R4RL 3AFLA 3QWRA 4DGYH 5J11B 5IMOA 3FCTA 4PRIE 4MJ5B 4Z7VA 3LEVL 4HLZH 1OSPH 3P11H 5IROA 4NHUA 3N85L 3CU7A 2FIKA 3CPLA 3GO1L 2MKLC 4FQJL 3VE0B 1YPZB 5CJBA 4OI9A 5SX4I 3H42L 3SDXA 1G6RA 2W9EL 3OB8A 4KVNL 2VITB 5IMKA 3UZVB 4X6FB 3L3KB 4LRNH 3WIHA 4JRXE 3V6ZA 4P3DA 3CFDA 4QOKE 4H8WH 2OP4L 5DYOB 5L2KB 2N7BA 4XPAH 4HCRH 1NCBL 2YPLA 1YY8B 4QNPF 4RZCB 2VXUL 5GGVH 3IDYC 3V6OA 1KYOK 1R5VA 4PJHE 4PGBB 1FO0H 4N90D 3SOBH 4I4WB 4S1SH 5MEPA 1MHEA 3MLVH 4WEBL 4Y5XA 5GGRB 4EUPA 3MRIB 4JY5H 3ZT6A 3WNKA 1BQLL 3GNML 3UBXI 4OCNC 4G43B 4PTUB 1P9MC 3OXRB 4HGKC 4N8VA 1QO3B 5EPMA 5HGHA 1CFQB 1UYWL 3MYJA 2KBGA 4XB8A 1JNNL 1UXSA 1UG9A 4FXLA 1TJHL 1CZ8L 4AEFA 1UXWB 4G5ZL 3LKSB 1TIUA 3CDCA 3N1PC 4YXHH 5JDSB 3X14B 4OI7A 1P4LB 3VG0H 2PETA 3KR3H 4XCYA 4NQVB 2BDNH 1AGEB 2JIXB 1DQML 1XEDA 5DTFB 1K8DA 1NC2A 4N0CD 3HB3C 1HYSC 4FNLH 5T1MA 1A6AA 3CZFB 3FQTA 5GSVA 2XZCH 2IFFH 3QUXD 3WKML 4TSBH 1Z3GL 1KJMB 1PG7L 5GS0H 2VKXA 4PGDB 1CD1B 2WBKA 4I18B 2B4CH 1WCQA 5IB5A 1D6VH 1IC7H 4OZFA 1YEFL 2W59A 2F53B 2NY1C 4GRMA 3VGEA 3CVHL 1EH9A 4JR9H 5I71B 3T4YB 3NTCL 4L8BA 1HHGB 3IXAA 2NXYB 5CMAB 2K9UA 3B3IA 1S9KC 3QIUC 3VRLE 4RWHA 2K7QA 2A6IA 3D69B 4DKFL 4YHPA 3GKWH 1CIUA 4I48B 1MJ7H 4AH2A 2JCCE 5B39G 3UAJD 1Q9LB 3ARVA 3LKOA 5B21A 4OGYL 3LKNA 1G7HB 3VWJB 4D0CB 4CU6A 5DUMH 1DBKL 3CGTA 2CRIA 4R96B 1S7VA 2YC1B 1DUYB 2NPLX 5DRNA 1CCZA 1D5BA 1V8HA 1JFQL 5DD3H 5ADPL 3RL2B 4IHOA 3EDJA 1U95A 1NGPL 3ZHLA 3ARYA 5BW7C 3MODL 1XGUB 1I9RL 1UKSA 4F8TA 3GM0A 2AJ3B 2H6PB 5CWSA 5T3XL 3MRDA 4XT1C 2I24N 4PJCA 2UZIL 2Z31A 2DLGA 4F57H 4GS7C 3ZE2E 4PRNA 3C60A 2DQGH 5C07D 4ODHH 5CEXB 1C16A 3EO1A 4X7FC 2R4RH 2DI8A 2A9NL 3DBXA 4G8EB 2C3GA 15C8H 2RQ8A 1LEIA 1HHIA 1OGTB 5DJXB 4Y4FC 4HPOL 4WI5A 4FTVB 4UTAL 1UWGL 4E0RB 3KJ6L 1U6AL 1V7MH 1S8DA 2FLRT 1EEYA 5EH1A 4OZGF 4PR5A 3HCVB 2BJMH 1YQ2A 4DTGH 1TJHH 3O6ML 4G8GA 1FVEA 2YKLL 3BKCH 3P2TA 1K8IA 2LFGA 4NWTL 4WHCA 1MCFA 3QCUL 4XBEL 3EOAB 3ARFB 3VXMA 1FNGA 4OFVA 4OLZH 1LO4L 2J6EH 5I9QC 2ICWJ 1RZFL 4J3WA 3W39B 4BM7A 1MI5A 2LU3A 4NFBA 5MEND 1FZKB 2Y4SA 3KPRB 3ZKXC 5J8OA 1R5IB 4JDVA 4OIAA 4I18C 3WKMH 5DZNA 3JUZA 5D1XC 3WEXA 4LEOA 5FDYA 3ROOA 5C71A 5JHDD 3BUTA 2PNDA 5FYKD 4O5LH 3C8HA 3QFJB 3KJ4C 1EDQA 4DFHA 5L8JB 5CIPH 4XGZA 4P5TB 1L7TH 3CUPB 3MLYH 4P0DA 4XNQB 1RIVL 3V6ZB 3QG6B 4YE4H 1J05A 3H7LA 4LGRB 2NY4C 2P5EB 1U58B 5KSBE 3GJFH 2XKUA 1DEDA 3T8XB 3Q2CA 5TDNB 4JFFD 4PGEA 2C3WA 2F54D 1TVBA 4OCXH 2EDQA 5I18L 2NY5H 3KGRA 4QRQB 5KSBF 2ZCLL 2IFFL 3TWCL 3HR5A 4NQED 2FEDC 2VO5A 4NZDA 1DBKH 4TTGA 4P48A 3VXRE 3BRDA 4OM0H 1QO3A 5D2NA 4OZGE 3S5LB 4F7PA 5H94B 3VRJA 3HMXH 3OKNB 2E7LC 3KYNA 4L5FL 3UTOA 1JGDA 1JN6A 1MPAL 5T3ZD 1S3KH 2Z35B 4HZLA 2ZCKH 1JGVH 5IVXE 4M02A 4HX1B 3T0DA 3QBTB 4MXWL 4OQTL 3ULUH 3TA3B 1AGEA 2JIXA 1OSZA 1JTOA 4XP1H 1NFDE 5DC0A 4IRSC 1CLCA 1HZHH 4JDZB 4LLMB 4PP2A 1N6QH 1H9VA 4RGNB 3MRGA 4MNGA 4UQ3A 3EOBB 5E5MB 4O9HL 1MVFA 5EBWA 4Q9CA 1GSMA 4NQTA 4HPOH 4LSPH 5DMKA 2AJYH 2NY4D 1HSAB 1KB9J 3MBEB 4ZPTA 5FGSA 5C0RH 5HHMB 3MUZ1 5BOPA 5IBLD 5BZDA 5DVNA 3NH7L 2BJML 1TZIA 2YPKB 2D7MA 1E28A 3HG1D 1ZHBB 3T3PE 2QSQA 4X7SH 3RKPA 4KMTH 2ZG3A 5I1HL 1QFWL 4RGNC 4NC1C 1QSFA 3BWAA 5HI5D 4ETQB 3L5WB 3PF2A 1CICD 3X11B 4GQPH 5JO5B 2JJSC 3RWJA 4EI5A 5HHQA 1JPTL 1T89A 4I13B 2ADJB 4JM2A 1KCLA 1CLOH 4Z9KB 4XBPA 3QIWD 1XF1A 4O00A 1EEUA 1N26A 2QQNH 6FABL 3G6DL 4A2LA 2X44D 1T1XA 3L3GB 2YD3A 1N6UA 4DWHA 4R96A 4YZFF 3T0VA 3TH4T 4O4YH 2XZAL 3ZDXF 4EKXA 5KS9F 1V7ML 2FBOJ 1EEQA 4HG4K 3ISWA 3K4AA 3JV4A 3DJ9A 3QDME 4MA1B 3ZDYF 3SO3C 1UZ6E 3CFBA 2YD1A 5DRWB 4BH8B 1KLUA 5FV2A 4NCC1 3VXOA 4XP5L 2P7TB 4KMQA 3X3GH 1KTLB 1T83A 3L3OB 1IQWL 4CVXA 5HYJB 5I8CB 2HFFA 4P2RE 3PHQB 3IJSB 3B5TA 2WINA 3WFHA 2XWBB 3UTTA 4UOJA 2GTWB 3EOYG 2EDNA 2UWEF 4LCWA 2DL2A 4C55A 1ONQA 3B6SB 2EYSB 2EXYD 4GKZB 4S1QH 1IAIL 1CK0L 3PWJB 3P0YL 1FAIH 1H15B 3QUMB 4K9EH 4PR5B 5D1QC 4YHNB 1QKZL 1K6QL 4S1DC 4KTDH 1BFVL 3ZT5A 2FGWH 4TVPL 3QUKA 4EJ1C 5JW4Q 3L9RB 1R0AL 3FOMA 3WSQH 2HFTA 2DKUA 2J5LC 3BP6B 3N1MC 3G5ZA 4X4XA 4JY4A 4U1HA 4KKLD 2FIRT 2OTUA 5DEZA 5EBGA 4OAWA 4GMSL 2PYEB 4QNPE 3MCG1 3HPLA 1KPRB 4HKZA 3WUZA 1AO7B 4FXKA 4LEOB 4OFIA 1JYVA 4I3SH 2V2WB 1MNUH 1WWWX 4DAGH 1BQHG 4PJ8A 1T0MA 1TVHB 5GGQL 1QRNA 4GO6B 4LASH 5DA4A 4AIXA 4HF5H 4RAUB 2APWA 5ENWA 4CGTA 2R2HB 3P3YA 4R2GC 4M4PA 1X5ZA 4FQHB 3MRCA 4LSVH 5GGSY 2M26A 1LE5A 4QKXB 5DXWA 1TENA 4LVOC 3D0LB 4HW6A 5I74B 2CXKA 3UEZA 4PRPB 2DWEA 2QHRL 3VFPA 1CXIA 3S36X 3ZKSD 3QXDA 1FSKC 1DUZB 4P46C 3SGKA 5ANME 5HD8C 1JE6A 1JZ6A 4FQPA 4DGVH 2O61B 4GKNB 4LHUB 2A9ML 5TQ2L 2QQNL 6FABH 2VABB 3MRNA 4G6AD 1QSED 3E8UL 2A74B 3BIBX 2C3HA 4FZEH 5D1QD 3T1WA 5K9KA 3S3SA 1VFUA 1P84K 1GOFA 1RU9L 2PUQT 4M1CC 1ZLWK 1A4JB 3P77B 5H37G 2L7UA 3RA7H 5KVGL 3TIEA 4JZOA 2FZ3B 5KSUA 1NCAL 3TYGL 1ETZB 5HHOA 5D8JL 3DHMA 3LQZB 1JVKA 1SMOA 4YXKH 3QDJE 2X42A 1BBDL 3UYOD 4LSTL 4PJ5E 2AXFB 5C0JB 4UU9B 4C4KT 1DLHA 2Q87A 1UB6A 4YK4B 1TCMA 3JWDH 1EGJA 1BD2E 1CLOL 2AK4A 3ALXA 5GRUH 4DN4L 3A6BL 1D5MA 5KG9B 3I50L 1ZS8B 3LV3A 1CXKA 1JF6A 1T66C 4GXVL 4RGNE 4BSJA 1QLEL 2BOBA 2PTTB 4IDJH 5JUEH 1I9IL 5E95B 3LS4H 2F54E 5IM7B 1GGBH 5IGXL 2XXMB 3MJGX 4WI8A 1E6OL 1NAKL 2J8OA 2DS4A 1P4LA 3C2AL 4JCMA 1F90H 1VKXB 1R0AH 1BEYH 4PBWD 3RIAK 3W0WA 3VJ6A 3EYOA 5E9DE 1G6RB 1OAYH 1G7QA 3MJ8A 3LIZH 3QXTA 1F8TL 1KG0B 1AIFB 4PRBA 3WIIL 3FFDB 4Z0BL 5DR5L 3PWVA 4PLKC 4B41A 4J3VA 5LGHL 3BRFA 4PP1D 3LHPH 3VFWB 3D9AL 2LTQB 4NZRL 2QJDA 3E6HB 1AGDA 4I4WA 3P0YH 1MSPA 1WQVT 3OR6A 1MFAL 2G60H 3C5SB 2QKIB 3TT1L 5CFHA 2FD6L 4CKVX 5E8EA 3OKDA 1XGQB 3QEQA 1I9JH 4WFFE 1CDCA 1X3DA 4K71B 3UZQA 3QUZC 2H8PB 3WXVL 3JWNC 1GPOH 4NIKB 1MLCB 4Y4HD 3JWOH 3RTQB 5FYLL 5JR1L 3HFML 4ODBD 4ORGB 3D1MC 4JO3H 1KEMH 4LLAA 4Z18A 2R2EA 3SE3A 5C0AA 1N64L 1TXKA 2Y25A 4FHBD 1X5GA 1A6PA 3WLBB 3MUGA 2C9AA 3LKPA 2GITA 4JVUA 2NY7H 2YUZA 1DUYA 1T66D 4YHKH 2ZUQB 3KPOB 5KANG 1W0YT 1MFDL 3UBXB 1IGTB 4JFDE 5D1ZB 5DJ6B 3MUY1 4LRIA 3U48A 2CSPA 5D7SL 2HKHL 2Q7YB 3MX0A 3NMEA 4M6ML 5FYKE 3DX9B 5LCVH 1OW0C 3FRUB 3O4LB 5GGUB 3RUGE 4XMKL 2F15A 1KEGH 3F58H 4OSUL 4NYLB 4UNUA 1S9WB 3NACH 3S4SG 2WV3A 3UPCA 4B5EA 5MENE 5IIEA 2NW2B 1TPXC 3QQ9C 1BP3B 3OGCB 4OUUA 5ESAA 2NNAB 5HHPA 2AEPH 1OGAD 1HHJB 1QVOB 4OCRH 1T5XA 1S8DB 3HUJE 4J1UA 4RFNC 3ZKQD 4KHTL 3H3KA 5B3JF 5IW6B 4PJFB 1I9IH 2W91A 4HJGB 3VWJC 1LE9A 2VDQL 1KN4H 4P4RB 2CLRB 4MDJA 4K9EC 5FB8A 3QIUD 3D87B 4M8QB 2P8MA 2DWEB 1Z9MA 3QJHA 4Z0XA 3MJ7B 4KKNA 1GC1C 4N0YH 4I2XE 2CDGA 3VD4A 4HHAB 3SDAD 3RZCD 5EA0L 3C8KA 1CVRA 1PJ9A 4FN0A 4QRPD 4L8CB 3T2NH 4CMHB 4M6OL 5DQDH 4PY8I 4V1DD 5GIRB 43C9A 2IG2L 3BQUB 4M7LH 4K3GA 5I8EA 3QEGL 1NQBA 4LNVA 4PRNB 5D9SA 2VLKD 2JJSA 4G9DB 1MFAH 1OF2A 5K9JL 2AKRA 5C0EB 3CFJA 4FTVA 1QLFA 1MLBB 3MGOA 4Q0XL 4CAGA 4YC2B 4M5ZH 2Y72A 4NUJB 2DQJL 2QHLA 1AR1D 3VXUB 4JFHE 2H41A 4JN1L 2BSSB 4O2EA 3BH9A 3HFMH 1A7NL 1KN2L 1RHHB 5TE6L 5D7JA 1UA6H 5F6HI 3CDYA 3ARFC 4KGLA 4C56A 3P30L 3DRTB 1A9BB 2IQ9L 1EHNA 4ZFGL 2CDFA 1YNLH 1CLZL 4DCQB 1DVFB 3RWGA 2LTQC 5I2IB 1LD9A 3GI8H 4B0MM 3LV3B 4RBPH 4PJEE 1OARH 1I7UA 2VLMD 4JY6A 4W68A 1FQ9C 4WTZG 1FGNH 2VRAA 3GMMB 4NSKA 5DMYA 1UXSB 4E9LA 1BFSA 4OCSL 1IGMH 3RVVC 4EUPG 5BS0E 3QQ3A 2W9DL 2IF7A 1YEHL 3O4LE 1MCBA 5F7WC 2WP3O 2WWKO 1OSZB 3QULA 3Q6FA 1ACYH 1NCTA 5DK0B 3SDCB 1LO5A 2MQCA 4H26A 4TN9A 12E8H 3RWFB 3KLAA 4BZ1L 4NQDD 2HJFA 4TOYH 1RI8A 4K55A 3G9VA 3C6SA 5L7XH 1SY6H 3ZKND 2YD7A 1ZSDB 5AUMA 3RY5A 5GJTL 4PJGE 4XVUC 4JGUA 3VXNB 3ULVE 4EI6B 4G6ML 4GBXA 5SWZE 2PKDA 1MFCL 3SGJA 1NLDL 5KJRH 1JGEB 5I9QB 1GC1L 4PJBB 2D4DA 2R29H 4KJQC 1NMCB 3IGAA 1VFBB 3PP4H 2QQLL 3MREA 1KFAL 3LSOA 5I19H 1V05A 2DF3A 1G7JA 4LLQB 1KIPA 1BQHB 4P2CG 5BXFA 1KF9B 3UPRA 5KANI 5I73C 2VLJA 4FQCL 5DGQA 2VZSA 4ORGA 3EGSA 1AH1A 4CBPA 3MLPA 5HGGS 3UJIH 3WLWD 5DQDL 4RZCA 2X4PB 3B9KD 3L95B 3HE7C 1Q9LA 3LKOB 5C07E 4LKXA 2Y36L 3V4PH 5TFSL 5GGRA 4M43H 4MJID 5ID1A 5DRXB 2W07A 2DQCL 4MDIA 4MNGB 2FHBA 3MRKA 3AREC 4MX7A 4RFOH 3WFCL 2OQJB 5EBWB 5DWUL 2Y9RT 4G43A 1U93B 4L4TE 3REWA 4DQOH 3DNKA 2QQKH 2AS5M 2XA8H 1J1OH 2D9CA 5FK9B 4JANA 2BXZA 1JNNH 4G6FB 5CWSB 3IDGA 1U3HB 1C5BL 4K8RH 1S9WA 1JRHL 1ZHBA 4JE4B 1QHOA 3MV9E 4K7FA 4ZSOE 3VXPB 4NQVA 5J57B 3IJHA 1A3LH 4L1DA 3O2DH 3O2VH 2IAMB 3LKRB 5HHQB 1GOGA 3ILQD 5JHDE 3HI5H 4KMLB 3KAAA 4LSRH 3U0TB 3K1KC 5DJDA 3ARRA 1ZV5A 3VFRB 2PXYA 3QH3B 5DJ0A 3TIDB 2A6DB 4KJQD 1EJOH 4FXGA 3HE7D 2BXYA 5EOQH 3X3FH 1MHPH 3FOMB 2YUXA 5EOCJ 4XPTL 1XF5A 5EO1B 3FFCB 5TPWH 4BKLA 1E27B 4KU1A 1D6EB 4XMPH 4JFZL 4JKMA 5B38B 3ULVH 5E00A 3RGVC 2P49B 4FP8L 3JV5A 4EBQH 3LOWA 5SWSD 2V2WA 2OTWA 3QIBA 4CADA 1R5IA 4J8RA 4NUGL 3MV01 3KPSA 5I1DB 3G5VA 3EFFA 1J8HB 4L29A 1TITA 3H0TB 5DVMA 4ZNEA 3MLZH 3EYSL 5LG1A 3QWOB 1KYOJ 1XR9B 2V9QA 4GRLD 1NLDH 2DBJA 5J1AA 1A5FH 1QLFB 3DUSA 4MJIE 4MCZA 4IOSD 1J5OH 1QRND 2OYPA 3L5XL 4PREB 5F7NC 4DKEL 4N0CC 1R3KA 3MLRL 1NBYA 4JDTL 3JVGC 4MS8D 12E8L 1FYTA 5BZWA 1DANU 1ADQH 1C5CH 4BJLA 3X17A 2PO6B 5L0QC 2B39A 1RZGB 4ZFFA 1MCPH 1MCWW 4TUKH 2BVQB 1VGEL 3VXMB 3VCLA 2NZ9C 2X70B 2KQMA 3HPLB 4PJIE 3EO1B 2VZUA 3W39A 1UZ6F 1MUJA 5C6TH 5IG7A 4YPGB 1YEKH 1LEIB 4MQXD 1H8OA 1ZT4A 4K3EL 1WC7B 2JJVA 4ODVL 5D2NB 1KJ3H 1XGYH 4XNXL 1G7IB 5EO0B 1AQDA 1UQSB 4RFEA 1YN7A 2RCSH 5EWIH 3S5LG 1E4WL 5EFIA 1BF8A 2AJVH 1N2RB 4X6BB 2CIIA 4J6RH 3BKCL 4LOUC 4OZHB 5BRZD 3TJHC 5D8JH 1JK8B 1MY5A 2YHGA 4NKDB 5DUBA 5IKCA 1RZKC 1KNOB 2VLKE 3TA3A 2DQFB 3WD5H 4HIIB 3MOBH 1C7SA 3OKKB 5C2UB 2PW1B 2XNAB 5JOEA 1JF5A 4Y4FA 3H9SE 2HLAB 3KYOA 1CL7I 3VFUA 4Y4KB 1EV2E 4ZFOL 1HQ4A 1H3UA 5AWNH 4NO3A 3V4PL 4IMLB 5HHVL 3BO8A 3KYMA 3PWPE 4S0SD 1CG9A 4FG6C 1A6VH 2WW8A 4WY7H 3T0AA 1M71A 2Q3ZA 1UZ8B 2ZUTA 3T0XA 1T4KB 3GIZL 2HYMA 4X6CA 5IBTL 3HMWH 1MF2H 3FMGH 1MHPL 2A0LC 2QSVA 1S78C 2BNRE 2MHAB 3V4UH 2R9HD 3MV8E 1JNJA 3WNMA 3RQ3A 5H35B 5BOZG 3O3BB 1UEYA 2NY3D 3FB8A 1F90L 1YEDB 1YMMA 3BPCA 4HKBB 4K8RL 4KZDL 1CE6A 4F7EB 3RKDD 4JPVH 1BJMA 5HHOB 3AC0A 4P2QB 1MRDH 3QXUA 1ERNA 3CFDB 5TDNA 1G0DA 4OLEA 1OLLA 3FZUC 5JOFA 1XFPA 5FECA 4MLIA 3CMOH 3G6JE 1BZ9A 2HLFD 3WN5C 4NN7B 1IAIM 2XG4A 3UCRA 3AM8A 4Y8AA 1AY1L 4GSDH 3V5HA 1BQUA 4DEPC 3H9SB 4OM0L 9CGTA 1SVZA 3PNWB 2CR3A 3SY0A 5ISZD 1IZJA 1Q9KA 3K2UL 1ZGLP 4LP5A 2BY1A 4L4JA 3DOSA 2V7HA 1OAKL 4W81A 5HGDA 3SE4C 4XMPL 1B9ZA 1VSCA 2NTFA 5GJSH 4OF8A 3EZ8A 1DVFC 1WFOA 4EN3C 3PWLB 1OP5K 3T1FB 2IAMA 3V5KB 3MLTA 3LVEA 1P7HL 4OTXL 2DYPD 3MRGB 3MZTA 5EUKB 2WUCL 2HTLD 5DZOA 5JQ6L 1IEHA 1H3PH 1NEZB 3UTQB 3FQTB 5GSVB 1UJTA 2AEIT 4UB0L 3BKMH 4BSVA 1KJ3L 1A22B 1A7PL 3WFDL 1RURH 5FGRA 5D7KD 2DOCA 1ZVYA 1FO0A 1MEXL 1MRFL 1Y0LB 2AQ2A 3FFCA 3U30B 3VXTB 1RJYB 1E27A 1PEZA 25C8H 4JO1H 4KRLB 1MFBL 2MOVA 3GMPA 3J8F7 4I9WD 4FFYH 4R90H 2JF1A 5IIEB 3QEQB 3CXHK 3BKJH 1MH5B 2DM4A 5KVEL 2BOCA 2ICWA 4LRNL 3JV4B 1IC5H 4FMKA 4DUXA 4N0UA 5INCA 4G80A 3JZ7A 5CUSH 2JJWA 5TGBA 5L0QB 1JZ4A 3T4YA 1AGCA 5K93A 5B38G 1DQQA 2UYLA 5HYJA 4PG2A 5AYUL 3HG1A 3SE9H 1NGQH 3ZZ1A 3QISA 2BMKA 4EIGB 3KHQA 4PFEA 5D5MB 4WY7L 3L3GA 2IANB 4PBVC 3LKPB 4KTEL 2VAAB 2V17H 4KUZH 5IB3B 3DMMB 1G7HA 3K3QA 5FCSH 4PJXE 5ANMB 2W0PA 3A6OA 3NFSH 4HUUA 1E4WH 3C60C 4NWUH 3MNZA 1A0QL 1GAFL 3D3VD 5BMFH 3P9LA 4FFZL 3TNMB 5I30L 4ONGL 4OLYL 1UWEH 4JZJA 5A2FA 5E9DB 3UJJH 3X3GL 5F9WB 5GIRA 5GGUA 3RVUD 1DCLA 1FLRH 3SCMD 1YNTA 1E4JA 4N8CH 4Z7UB 2P5WD 1FDLL 1MJJA 5GISL 1OT1A 4XP6H 3BFOA 1MCRA 4L3ED 3UO1L 4HC1L 1YPZF 3MRNB 2I60L 3BPLB 3SDAA 3OGOE 1FFOA 1QLRA 5IWLC 4PUBL 4OCYH 2XRAL 1PG7H 5GS0L 4UTBH 1WT5A 4G8EA 2NY6D 3EKCA 4LVOB 4LPWA 4PJ8B 4YDLC 2H32B 2VZ1A 4ZG1A 2DQDL 4HIEA 4D3CH 4DN3H 1B4JL 1JK8A 3DO7A 4ZPVB 1XIWD 1NCWH 1HKLL 1HH6B 2A83B 5DT1L 3SO3B 5DEFA 2IWGA 4PG9A 4QHUB 1CXLA 4UV7H 3QJHB 3VI3F 1A7NH 4LQ1A 3HS0A 2Y7QB 1E6JL 4M7ZB 1QSEA 5DJYA 4UINH 2FX8L 1I8LA 3C60D 1S7WB 4HS8H 1E4KC 4S1RL 4TQEH 3AVEA 4ZO8A 2R2BB 5C08A 4F2MA 3QNYA 2CLZA 5EUOB 5I66B 1I1CA 2X4UA 2C4FU 3MC0A 4FFVD 4QXGL 3OAUL 1T0PB 3QT2A 3TBVA 4G3YH 3MFGB 1NCUA 3UDWC 4KHXL 4JKPH 5DD3L 1P4BH 2B2XH 3HTLX 3T0EA 1YMMB 4HKBA 5KVFL 4PIRF 5IMLA 4D0BA 2PYFB 4KK5D 2VDOL 4YDKH 8FABA 1PAMA 3LZFL 2VL5A 3ZYJA 1A7RH 4ELKA 4PRPE 1X5FA 2XT1B 4X5XB 1SM3H 5SX5K 4CDGC 4Y19B 4PJBE 3OF6D 2KKQA 4M3KB 4ZUWB 4R6UA 1PKQA 1MQKH 3DVGA 3BAEL 5IB1B 1CFSB 1LMKA 2DQEL 2DQGL 4MLSA 5F7EH 2J8UA 4PJGB 1A1MB 3ME0A 2DLFH 3O81A 1N0LA 3NABH 3OG4B 1HNGA 4ZNCD 3V5HB 3MREB 1TJIH 4ZMAT 2ESVD 3LSOB 3ARGA 2ATKB 5TE7H 1P7QB 4HEPG 4ELMF 1GCFA 2BFVL 3RWHA 5KSVB 4U6TA 1K5NA 4OLYH 1JGUH 3RBSA 5I19L 2G75B 5CINL 5IM7A 3IDUA 1VGKB 5F70A 4YBLC 1T2QH 4HUNB 4IOIB 1HSBB 3LKQA 1SHMA 3IXTB 3ARGC 4BSWA 1NBQA 2VZOA 4NBZB 3RWDA 4KRPD 5L9DH 4HFUH 1RZ7L 2GAZB 3TVMC 2I60H 2KL6A 4NGHL 1G7QB 2J88H 3HLAA 5D71L 1FP5A 3C6LA 2ZPKH 4H88L 4LKCA 3P9MA 3O0RL 1EXUA 4GG8B 4O5LL 5FK9A 4FQQB 1Q9WA 1YEGL 3AAZA 5BVJA 5I71C 3VWKD 2P45B 3BIAX 3QDGB 4FABL 2A77L 5TF1L 4IOFD 4M1GH 1AGDB 1BJ8A 2AK4D 1QNZL 1WWBX 4KJYA 1DQMH 5I30H 3HE6C 3OG6B 4Y5YB 5LBSL 4FNLL 3W0WB 1XGQA 1FNSL 2AI0H 3EJYC 1ZLVK 3K81A 5DK3A 1G9MC 3Q1SH 3QUYD 4UIMA 1DQQB 2X09A 4OZGB 3VFNB 1A6TA 1JNLL 2WBJB 4HS3A 4HPYL 3MJ9A 2YPVL 2GYSA 5DJDB 5I75C 3CLEL 2IPKB 5D5MA 4YBLB 1A47A 3DV4A 3QI9A 4LKXB 4OCYL 3V52H 5EOTA 3S88L 2IH3B 1DEEB 3IFNL 5K9QI 5EO1A 1EEZB 1RJZB 2BY2A 4POUB 5FYLD 1BIIB 5L2JB 4HWUA 1KBGH 1WICA 1I8IB 2OQJA 3CFKB 3NTCH 1QYGH 5B38A 1MCIA 2O5XL 3QFDA 3KLHC 2I5YL 1G7MB 2FB4H 1SQ2N 2OTWB 1C7TA 3VXOB 4OCLC 3PL6B 4F9PA 1YNTB 4JRYD 1CXFA 4Q97A 3HNSL 2ICEA 5D7IA 2JB6B 4R0LA 43C9B 2DM7A 2UUDK 1EIBA 1CDBA 4NQEE 3WS3B 1MCOH 4QOKD 4ZXBC 2IQAB 3MUGB 1QLRB 3KXFE 1PY9A 2EYTB 1IARB 4HS8L 1TTUA 1KULA 2NY7L 1NGPH 3EFDH 5ADOL 4JLRB 3BGAA 1IGTA 4H20H 4P23B 2PR4L 4O58H 3TYFA 3KPSD 3ZT7A 5C0IA 2AJYL 8CGTA 3QIUA 5JHLL 3OAUH 3FAWA 2CUIA 4XXDB 2Q6WA 5C0AD 1KB5B 3KXFA 4QGTA 4NUJA 4L4TD 4W6YB 1CDGA 1NJ9B 1GGYA 4ZS7L 4XVJH 4DVBB 1RZ8A 4XCEB 3OL2A 5EZOL 1ZLWH 3H42H 4PPTA 1QR4A 3CX5J 5FO7A 3HC0B 2VERN 3O45B 4D0DA 3QJFB 2ATPB 2BERA 4C56B 1X5KA 5L9DL 2DQIH 4JEGB 1C5CL 3GSNA 3PQYA 3LD8B 3MV11 4LPCA 1EBAA 5EIVA 4JQVA 4AQOA 1XGPA 3C8KB 1UACL 5FA3B 4X8XA 1FFPA 3FQXB 4FTVD 4ONOA 1Q0YL 5ID0B 2BX5A 3L5IA 3MRFB 4NO0D 4WNQA 4K7PY 5EULV 1J86A 4HJGA 1JWSA 5D5ME 1KN4L 1ZGLM 2AJVL 4Y19E 1QNZH 3QULB 3DUSB 2CLRA 4Z7UF 4HZAA 1OTUD 5I1KL 5E7FA 5DSCA 4QHKI 1CT8B 1MAML 5SWZD 3E6FA 3VFSA 5BV7H 2LU7A 5FUZH 4IRZH 1WEJH 1JPSL 1EHLH 1A64A 5MERB 1I4FB 2P42B 1FCCA 4KRPC 4F58L 3EYVA 4N68A 3STLB 1CDYA 2A1WL 1MCLA 1X5LA 2P47B 4AEEA 5IB1A 2G2RA 4NGHH 4M7LL 4NRXB 3IS1X 3QFJD 5JW5A 2ZPKL 4H88H 4Y2DB 4S1QL 3CXHJ 2AKRB 3UZEA 4IJ3B 5E0QA 1BJ1H 5GRJL 3RWIB 1HH9A 3CFJB 4WFED 5C0FB 4NPYA 1BD2D 1CICC 2CIKB 2WIIB 4PJAE 2C4FT 1G7IA 1CYGA 2NY0B 3MGOB 4KTDL 4Y4FD 4XWGL 5ICYA 4Y5YC 4JZOB 4NKIL 2EDLA 3EGSB 3QXAA 5IEKB 2AVGA 2ILLA 1I8KA 3P4NB 3S8WA 4JFFB 4OZHA 5D7JB 1NBVL 2F54B 5EUOF 1ZXQA 1ZAGA 1MCOL 3D3VE 5KBNC 1GZPA 3KWWB 4WUUB 1K85A 1KCKA 4OM1H 4WO4C 1DVFA 3L3DB 1U8KA 5GZOD 3MLWL 3IRZA 2FO4A 2HJFB 3ESVF 3UYRH 3DXAB 2BSTB 2DIJA 5KAQG 4UIKH 1U3JA 2X4RB 5EU7C 5C7XH 1D5ZB 1OARL 2XKNA 2V2XB 4M9OA 4NN5B 1MWAL 1RAMA 3VXNA 2ZCKL 4JANB 3HRZB 1T4KA 5DDHB 5DJZB 1ORQA 1PKQE 4Y1AB 4DZBB 5FO8B 2YEZB 1LWRA 1YEHH 4LCCA 5F9DC 4U6XA 4BH7A 1JGEA 3KYAA 3GI9H 4XVTL 5KSAC 4FQLH 2QHRH 1PYWB 1PQZA 3FL7A 3MUJA 4IRJB 3TCXA 4F7EA 1G7JB 1IRAY 4HH8A 3MJ8B 5DJ8A 3N1GC 3TCLB 2ZUSA 5JDJA 4RCAA 5F1NB 3QEHA 4QY8A 2NLJA 5BRZE 4AEHH 1H3PL 5C0CB 4P4KC 2WZPD 2NY1D 4DFIA 4M61B 5FOJA 4PJDB 1JYNA 3GBML 1JL8A 5HSFA 2NXZB 4JFEE 2YOCA 3IGAB 3QFDB 3BP4B 1YY9C 3OAYH 4MX7B 1JI2A 2MSPA 4H1LH 3G04B 3O6MH 3PWPD 4OFYD 4XVJL 5TGBB 5ACZB 5MI0B 4ERSL 2GKIA 1OL0A 1FZOB 3VGFA 2CUMA 3BJLA 1F4WH 1JHLH 2HLFC 4PJ7A 3QCUH 4XBEH 5FKAB 4F7CA 1R5WB 2BCKB 2NX5D 3EO9L 1IL1A 3WO4C 3GNMH 3SCMC 4Z7WE 3D18B 4TNVK 3PWLA 4L1HA 4C4KO 2Y36H 3QHFH 4LDLB 1X5XA 4Y16A 2HAZA 5EOCH 4A6YB 3LKRA 1A1NB 1DBJH 3BE1L 4I9WE 4ODUB 1AHWB 4M6NH 1G9ML 3OZ9H 1NUFA 1W72H 1GVIA 4QCIB 1L7TL 2CLVA 4UBDD 3VD3A 3MRHA 2MQ0A 4YWGH 3V7AG 1R3KB 4D9QD 1FNLA 2Q76A 1U8IB 1U3HA 4TNVF 4YFEA 3FONB 5HYJD 3O41B 4AY0A 4KAQL 5GHWL 1DTUA 3OKMA 1FYTB 2GQHA 5FOBA 5E24E 1LK3L 4NYLA 3DVFA 4NBXB 4JG0L 1BVLB 1FCGA 2HKFH 1F45A 1PVHA 1OD9A 2A6JB 35C8L 5KS9B 2FX7L 4KC3B 2O26U 4XZUB 2ED8A 5ITBL 2XWTA 5IFAL 4HC1H 1HDMB 1BFOA 1C5DB 1U3HC 4Q6YA 4M62H 3ZTJG 1YC7A 3FRPA 4ZTPL 4Z7QF 4WNQB 3QH3A 4NQXA 3TIDA 4YC2C 3WFEH 1EHAA 4FXGB 1U2CA 1JWSB 1FSKB 3NFNA 1LP9E 3ARQA 2E9IA 3KJ4B 4X6BA 4XAKD 2FD6H 3DMMA 2Z4QB 4RDQF 4U2YA 4NQCE 2Q1EA 3U7WH 1SBBA 5HYJE 5T33H 1YJDH 2IALB 3OKEB 2ENSA 1B4JH 2W92A 4IS6B 1JF1A 4PG2C 4I0PA 4NNPH 5CILH 5DQJB 3STZB 5ETUB 2GEEA 2NYYC 1ZA6A 1S78D 4HGMA 5F3HA 3FN0H 3MLSH 4Q2ZB 2PXYC 3H3PL 5FF6B 4TSAH 2YD4A 4G6JH 1JGLL 1N5AA 5CHNA 4NHUB 5C0CE 1J8HE 2OJZH 1I75A 2MNUA 3A67H 5C7XL 3ROLA 1MFDH 2BVQA 2VH5L 4PJAF 3R8QA 5DJAB 5J89A 2D0FA 5D2LB 1TLKA 5H35A 5C08D 3D39E 3FB8B 2NR6C 2H32A 2YPLB 5LCVL 1MY7A 2VISB 3IU4L 1YYMH 2GSIA 4RGMC 4BQ8A 4FZ8L 1CR9H 4JN2B 3I75A 4XNMB 2A83A 2A9NH 3MLUL 3MV9B 2R0LH 5DK2A 1Z0MA 4OD2B 3NA9L 4ZSOB 2Q8AH 2YMXL 1IGJA 4XXCA 4JFXA 4ZFFB 2BC4B 1AGBB 3IAQA 3BZEB 4ELMA 2ZZUT 1QSEB 3Q5OA 1MQKL 2PW1A 2UVFA 3MRPA 4OKVA 4PJIB 4KHTH 1VPOL 1A6UL 3RPIA 2XPGA 1IT9H 4MYWB 4NQSB 4F7TA 1NDGB 2RGSA 5IW3A 1DBAH 4KVCL 1N2RA 1DBBL 3TFKC 1CGYA 4J4PD 4PJ5B 1SYSB 4NKDA 4WWKA 1BECA 1R24B 5BV7B 1T2QL 4M4RA 2HTKC 2VSCA 3OKKA 4GAYB 4H26B 4P2OC 5DJ8B 4QHMB 4U7KA 5MHSD 1MREL 4P2QA 3C5ZB 5AG8A 1IKNA 3IFPA 4I5BA 2BNRA 3BO8B 3EAKA 3QDGA 1C08A 1X44A 1JPGB 3DVGB 5T3ZL 1A6VL 4YHIA 3MA7A 1BGXL 2GK0B 1FBIH 1HNFA 3BW9A 4UT9H 2Y1VA 4ODXB 3QI9C 4HFWB 1MFEL 2G9HB