4Y1AE

Immune complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
240
structure length
240
Chain Sequence
AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRPRDPVTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aE02
3GMOB 4JY4A 2H9GB 4PLKD 3W0WA 1TQCC 3HRPA 1G6VK 2YRLA 4MAYB 2NY5C 2DAVA 3MRLA 1R5IA 1MUJB 4IM8A 1FZKA 4UTAL 2HJFB 3HE7A 4LASL 2QHRH 4Z7WB 3TBSA 1QEWB 3TT3H 3D0VB 3MUGA 4QWWC 1U58A 4XAKD 3FQRB 2IANB 3VGHA 4WNQB 5LWYL 3WNKA 4GS7B 5IF0A 2NXZB 3T04D 4ERSL 2YPLB 5D2NB 5KAQG 3ARUA 3BXNA 4NC1C 2K3TA 4KKBD 4HPOL 3UPCA 1HH6A 2Z35B 3MYJB 3MJ7A 3QIUA 4LK4A 5DVMA 4F7MB 5D5MB 4NWTL 5C0BB 2CLZA 1RULL 3P9LA 4IEFB 2R0ZH 4HWZB 3DMMD 4N0FB 1I8MB 4XPBH 1KXTB 2PYED 3QDJD 4JAMB 4JQXC 4WFEE 3VG9B 4DK6A 4LSPL 4J4PC 4XNZB 1BOGA 4OF7A 5BMFL 4GFTB 3QXTA 4PLKC 1B0GB 1U8MA 2YPVH 3ARVA 3RKPA 4KVCL 4FS0A 1P7KA 4U1JA 5KVEH 5ALBH 4BQ6A 1A6WH 1KT2A 4XXCA 4W6XB 4O5LH 2FCBA 3RKDD 3FFCD 3P73B 3G6AA 2YD2A 2ZUYA 1J0KA 3P4MB 5GISH 3MLYL 3BJLA 4NNYA 4ETQA 1KJ2A 2GITB 4EUPH 5F7HA 2XKUA 2AI0H 1J10A 4HGWB 4LASH 1C7SA 3JXAA 3VXPA 3QNZA 2B2XH 3NZ8B 3CVHB 3CUPA 5LWYH 1JZ6A 3GI9L 1H3PL 2C4FU 4UINL 1EK3A 3D0LB 5JTWA 1MWAB 1QO3A 4NPYB 5IVZA 3VXRB 4BSWB 1KFAL 3D39E 5B39G 4LOUC 1KB9K 1NBQA 4R7DB 1KOAA 1AHWC 3L5IA 1NFIA 1B90A 5ACZA 1Q0YL 3VWJD 3R8QA 1FG9C 1RULH 5EOQL 4KDWA 4F80A 3TZVD 4K2UL 3GSVA 2YD4A 2QSVA 5EZJA 2JKXA 2O93L 3V0WH 2CIKA 3V6OE 4Y16B 3RKDC 4NQCD 4X6DF 3BZEA 1KTLA 2PTTA 1R5VA 1B0RB 4U1HA 5GRJH 4KVCH 5GGUA 2ATPB 2YXMA 2APXA 1QZ1A 5INCA 1J88A 1PVHA 4OZHE 5SX5H 4E41D 2P46B 3CFCL 5DXWA 1CS6A 4GRWE 4OLZL 1N64L 1E28A 1MFDL 1RURL 3HE6D 2L7JA 4WRLA 1MJ7L 4KY1H 5HYSB 3P9MA 4LQFH 1YEFH 5C86A 5BZWA 4MNQE 2EIDA 3RNKB 4HFWA 3QUXB 1OL0A 5HHQA 3BI9X 3QUYA 3ARDC 2XN9B 4OLUH 3VWJC 4JKWA 1N5YH 4U1GB 2A77L 4UINH 4X98A 3QWOA 3TZVC 2P45B 3JWDL 3L3OB 3OGOE 1BHGA 2VLMD 3GMLA 1KFAH 5CILL 2OJEB 4G9DA 1NC2B 1V7ML 4PV8B 3D85A 4XNQA 3N9GH 1KCVL 3UC0L 2X4SA 4XP6L 4I5BB 5EBMB 5DURD 3WXWL 4M03A 4TQEL 4NYLA 4PP1D 2FYYA 4PP2A 5DRWB 5E00A 2VDKH 2JJVA 3U7WL 3VXTB 1L7IH 2A73A 2XFXB 3C2AH 5C0AB 2JB5H 3L3KB 3C5ZB 2NZ9C 4PPTA 2NY6B 4GG8B 5E7BA 4EI5B 4JREC 3LQZA 2J7LA 2CD0A 3GKWL 4XP5H 4QRRD 3HAEA 1MCBA 3HE6C 5I1EL 5D7IF 2E9WA 4J2XA 1FZOB 1PEWA 4FNLL 1UQSA 1GVIA 2B5IB 3P4OB 1I3RB 1NMAH 4LVHB 4ZXBA 5J8OA 2J88H 3DJ9A 3RVUC 3O4LD 5DJ6B 3WCYA 1GGUA 3TCXA 3VXMD 2V7HA 3HE7C 5BRZB 5ITFA 2YD9A 4G9FE 4NQDB 1D5IL 3QXDA 3B9VA 3MYZA 1FIGL 4PJIB 4NGHL 2DQGL 3PGCB 1KEMH 4OD2A 5E56A 4AG4H 4PP1C 1MF2H 2R4RH 4ZTOH 3QIUC 2VSCA 2EECA 2E6PA 4PR5A 4YC2B 2VIRA 1TCRB 4FHBD 4PFEA 2DOCA 2OP4L 4PJXE 1ZA6A 1XGPA 3T2NL 3IGAA 4HXBH 2QQKL 5FYKU 4G8GA 1NFDF 3GK8L 4AT6A 3EBAA 4RWYH 5ID0A 2ZUWA 4M4PA 1INEL 5HHPA 1K9TA 1KC5H 5FF6B 2E6QA 1CXKA 2LQRA 3F65A 3NN8A 4O9HH 1TJGH 5DQ9A 4OFKA 4AIXA 3TO4A 1LE9B 1JGDA 4FNLH 3QDAA 4QRTB 2VLLB 1PDKA 1SM3H 5D93C 1X4YA 1EO8H 2HVJA 3E3QC 1NDGB 5AZ2H 3VGDA 3FN0L 4HV8A 1NLDL 1IQDA 4CADA 3PABB 3VXUA 2NMSA 2PUQT 3ZKMD 5B4MD 5I71C 1NUGA 1F58H 1FIGH 1XIWA 3KLAA 3D69A 2O5XL 1IAIL 1UKSA 3ALPA 3SE8H 4OM0H 1OSPL 4EQ2A 3BZ4B 1MLCB 5KTEL 2DS4A 1M1SA 2F74A 3LKOA 3QO1A 3RL2A 1T0NA 8FABA 4GAFB 5CINL 5ICZA 2DWDB 3DV4A 3KPQA 1AGBB 3W9EB 4HUUA 2AV7B 1J1XH 5CP3A 1OTSC 3OSKA 2IBBA 5GZOD 2FJHA 2Z4QA 1XGTA 1ZT4B 3GMMB 1OB1B 4XAWL 1EZVY 1AP2A 4Z76A 4PGEB 5DMYA 3WLBA 3D85D 4RZCA 4D2NA 4LHUD 2EYRA 1ACYH 3P30L 3SE4A 5ITBH 1A1MB 3MV8E 2ZG1A 4L29B 4G80B 4ZPVA 3TV3L 3B5TA 3RX8A 4HJJH 4EJ1C 4HQQL 5KANG 5A2IH 4X6BB 1P7QB 4NZRL 5FKPA 2DLFL 1T6VN 2GAZB 5FGBC 1ZVYA 1EBAA 5D7LE 2Y5TB 4YDVB 3GSOA 1UB5B 2BFVL 4HKZA 1T20A 3QUYC 4G6JL 4HK0B 1S7RB 2KUTA 1HNGA 5GZOC 4GW4A 1VGEH 5DYOB 1BZ9B 5KTEH 1DLHB 4MNGE 4UUJB 5GPRA 3BP5A 1ZGLB 4ZO9A 4OZ4A 5DJXA 4JO2L 5H37H 1D5ZB 3PGDB 4OUUB 3KHOA 4DGIL 5L2JA 1OARL 3V0VA 4K8RC 4MQ7B 3ZL4H 5J1AB 2WSKA 3QG7L 1MCLA 5HYFA 1FO0H 2FD6H 3OKLA 1P53A 5FO8A 4L1HA 1JRHI 1MCIA 2Q7NA 3LMJL 1L0QA 1BLNB 2CO7B 2D7QA 5T3ZH 1C5BL 3VI4F 4Y5VB 4LCCB 4XAWH 1ULVA 4NM8L 3VFTB 2GFBB 2NXYB 3I84A 2WWMD 2B4CH 4OJFL 5H2BA 4QRUB 3C2SA 3PHSA 1FFRA 2HFGH 3WIIL 1SVCP 4J1UA 1OSZA 3HZMB 2HTLD 2ITDB 4ZD3L 4O2FB 3BEVB 5FKAA 1Q72L 3P30H 3ZO0A 3MREB 5D70L 4LEXL 3SY0B 3FRUA 5KANI 4G8GD 4P2QB 5EWIL 3DURB 1H5BA 4HQQH 2CRMA 2NX5D 3QEGH 4LPCA 2A6DA 4Z7QE 4NC2B 4JDTL 2DLFH 3T3MF 3AAZA 1MSPA 2FGZA 3MA7B 3I9GL 5GRVL 1QHPA 4X6DA 4OZFA 3SDXF 4JM4H 3VFNA 1HXYB 1C5CL 4JY6B 4HH8A 4OT1L 4JKPH 1CFQB 3CMOL 3EYSL 2V2WA 4YJZL 4P5TD 1BZ7B 3D3VA 4XBEL 1N6QH 1HILB 4FQQB 5M94B 1AIFA 4FXKB 1TVHB 2O61A 3CCHA 4FZEL 4FN0A 2P8PB 3ZE1E 3IRPX 3QXVA 3VXUD 2C1OB 4P59L 4JO2H 1NMBH 5EU6B 2V6HA 3BQUD 4P46A 2WWMC 3KLHD 4DGIH 4TNWK 2NYYC 1OARH 4Y88A 35C8H 1RZKC 3DVFA 2PF6A 3D87B 5JNYA 1BEYH 2KQNA 3QT2A 1MFCH 5IOPB 2EDTA 1U8HA 1IM9A 1JWUB 1KCRH 1ADQA 2Z31B 3L3HA 2BNRD 4X6CE 1MRFL 4PRHE 3V52L 1Q9OA 1WZKA 4OJFH 3ZDYE 1PQZB 1IAII 3OZ9H 1K4DB 4ZD3H 2CPCA 2DQEL 2A0LD 2C7UB 4K7PX 2M1KA 5D70H 4LEXH 2BNQB 3DXAB 4J3TA 4UILH 2EYSB 1RIVH 3GHBL 1F13A 4P5TC 4PLOB 1E27A 1CFBA 1JTTA 5LGJA 1TIUA 4GAJL 1PJ9A 5D71L 3I9GH 4NRZB 4Y2DB 4K23L 3STBA 2D7NA 4XWGL 1A8JH 1OY3B 1XF3B 1C5CH 5HVHB 3KLHC 3EYSH 5FA4A 1I4FA 2DWEA 1JMXA 4HT1L 1XIWC 1VFOA 2VLKE 1I1AA 2CK2A 6FABH 3MBEB 3TBWB 1UJTA 3FO0L 5EFIA 4OFPA 3D25A 2IF7A 2IAMB 2VRAA 4ODWB 4XVSL 5HYSG 2AJZA 4X7FC 4HUMB 3GBNL 4Z7NE 4BYHA 3V52H 2X4UB 3RRQA 1XF2A 2J8UE 1FVEA 2P8LB 4NDMA 4OTXH 4HULB 4M43H 4QEGA 4JVWA 3Q6GL 1R0AL 3LV3B 4FQ1L 3SE4C 3LSOB 3HNVL 1NBYB 3ULSA 1ZS8A 5AD0A 2ED7A 4F3FB 4EQ3A 1T1ZB 1QBAA 4WV1A 1QD0A 5BO1H 3UJJL 2ZSVA 4LSSH 3VFMA 1UXWB 2HN7A 5C0JB 5D7SL 4XP4L 2J6EH 5EOCH 5I1DA 4RMWA 4MWFB 5EIIA 3PWNB 3MRQA 3BP4B 5HBBA 2LABA 3WHXA 1FC2D 2R1XA 3B9KA 2HH0H 1EH9A 3BKJL 1UG9A 2BVTA 2DDQL 3TIEA 2D3VA 3X12B 3O81A 3CX2A 4OFVA 5MERA 2W59A 1JL8A 1J8HD 5MHSD 4OCNC 3FO0H 3NA9H 3B4NA 1CE6B 5I6XC 4JM2A 5DJYB 5EH1A 2CGRL 2HFEB 3FQNB 4K7FA 4JQVA 5F7FA 3KR3H 3D3VD 2NY0D 1QA9A 1IGYB 2ADJB 3OR7B 4MDJA 3S3PA 1ZWIB 3L95B 2EDFA 3PWJA 4KI5D 4PRNB 4X99B 5DD0H 1OAZH 2CXGA 4LLQA 4MSWA 5C92A 1FL6B 4AH2B 2XZQH 4P46D 1YEKH 3STZA 2JB6A 1RZGB 3BUYB 2CLVA 4L9LB 4YNYA 1XCTA 2J8HA 5F1IA 3HZYA 1AI1L 4J8RA 5J11B 3OAUL 3HNVH 3D39B 5INDB 3VFVA 5EORL 1J1PH 1U8LB 3WBDA 1H5BC 1QSEE 1RK1B 5IW1A 5EO0A 1EFXA 4XP4H 2K1MA 3OL2A 3SQBA 1S9WA 1UWEH 1UZ6E 5FB8A 1EIBA 5I19H 4JFZL 4JKMA 2AKRA 1PLGL 3MRKB 3P0VH 1CICB 2V2XB 3BKJH 4ONGH 5FGRA 3ULUH 4LCYB 5ESQB 5C0CA 4M3KB 3WL9A 4KI5C 5DRNA 5FM8A 4OZHB 4L8DB 2AEQL 4P46C 1JNNL 1OAQL 4DGYL 2J5LB 1S78D 3O0RL 4GRWB 3DV6B 3DROA 5H8DA 4PJ9A 5IVXB 2ZUSA 2HMID 1MHCA 1NCCH 5GIRB 1XGQB 1TJIL 3N0PB 2ZCLL 2ZSWB 4UV7L 4HUNB 4HUXB 5HYJA 1GHFH 1YMMA 3T77A 4H1LB 1R24B 4X7EC 2VZ3A 4W70A 5F8QC 2MHAB 2XA8H 3LEXB 4XNXL 3M8OH 1IE5A 1TVDA 5I8OH 1W72H 2Y36L 2YRPA 3MOBL 1KN2L 3V6FA 1NCWL 3OX8B 4NQTA 1DVFA 3G04A 3BRDA 1NBVL 5D6DA 4L4VA 1ZT7A 1QR1B 5HHXL 4PRIE 4LQ1A 4UDTB 4OLXL 2X9WA 3SKNB 4LU5L 4NC0B 1F2QA 1PLGH 2XTJE 3IF1B 5F1SA 3HN3A 3CH1A 4NJ9H 4PRAA 5BS0E 4KK5D 3QZWB 1G6RH 2AERT 1C08B 3CFJB 5DZOA 2WM0A 4WY7L 4FQCL 1U3YA 3ZT5A 4KTYA 4X7SH 1I9RL 4N0UA 4OZGE 4PJAF 1M05B 1UJ3B 4XZUB 2AEQH 4HHAA 5IR1B 4PJFB 2BDNH 5CEYA 3MUY1 2ZP0T 1OAQH 1RHHA 5HHVL 3U46B 3V5HB 3S5LA 4WWKB 2JCCE 4YDJA 3G6JE 4G8EB 3RVTC 4DQOL 3EKCA 5E1HB 4XPTH 3U6RA 1A7RL 5AZEH 2GHWB 2J3SA 4L3AA 4G9FB 4LVOB 3GB7A 4YH6A 5F9WB 3WJJA 1P2CA 4JM2D 1A5FL 4LKXB 5EO1A 2BVQA 3TN0B 1UEYA 2GIYA 4G6AC 3GGWA 4M5ZH 3QPXL 5FO9A 5HGBB 4KV5E 3VI3F 5CWSA 4YAQA 5DHVH 4WV1C 2NY2B 2Y36H 5LBSL 4RFOH 4KK8D 2ICWA 4KK5C 3KPLA 1NGXB 2OJZL 3SHSA 3SJVD 3NCEB 2CLRB 3MLVL 1RUAL 5EA0L 4YUEH 1Y0LB 5I75B 1UB6B 5AEAA 5JQ6L 4IDLA 1EFXD 4AM0B 4XCEA 3O3EB 4WJ5A 3QUZB 3WIFA 4RCAA 2M8XA 4DZ8A 1JYXA 4U3CA 5F44A 4LLWA 4NO2B 3L1OL 3FOMA 4RAHA 1AD0B 5CCKL 2ZUVA 1WWCA 4JHWH 2V9RA 4JM2C 5FOBA 4WUUB 1U91B 5BQ7A 2AXFA 2A83B 4JQVC 2VKXA 2PR4H 1MH5A 1TPXB 3PDOB 4P23B 2AV1A 3TWCL 2NTFB 3C9NB 4IRJB 5C0CD 2BVPA 1KJ3L 1CFNB 4DEPC 4ZUTB 2I25N 1JZ7A 1U3HB 1Q0XL 4KK8C 2BP3A 3AY4A 5J6HA 1FL5B 1XH3B 4PJ9D 3MRGB 4Y5YC 3GSNB 4PBWD 5HYIA 5T33H 4D9LL 1HI6B 3RTQD 3TC9A 2HRPH 4JHAH 3QEUA 4QRQB 1V8HA 4MHHI 3ZT7A 4WCYL 5LBSH 4BQ8A 3MGOB 2OJZH 4QGTA 1KELH 2G2RA 2H26B 3V5KB 4WU7B 4LLUA 3QJHA 5EN2A 5JOFA 5D5MF 2E7LA 4OIIL 3FQUB 4P2CG 2FX7L 2BJML 3NCFB 3PGFL 4JRYE 4DAGL 1YEIH 1JF1B 4EUPA 2VDOL 2AJXH 3ZMRA 4S11A 4L4TA 3X17A 4ZMAT 4RBPK 1CDUA 5HGAB 1T1XA 2W9DH 1PG7H 5ACMA 2WP3T 4V1DE 3IXTB 3KDMA 2AEPL 2IH1A 4EIGB 2XI9A 2FGWL 4LBEB 2F8XC 5KSAB 1MJJB 4NO0B 4PJ9C 1INQB 1NC4A 1RZFL 2AVGA 3TWCH 2CR3A 1EMTL 4U1SA 4WU5B 2ED9A 3V6BR 2C3GA 4RWHA 1M71B 4MA3A 5D7LB 2NY7L 2X7LA 4HIEB 2EDNA 1KUMA 1IC5L 7CGTA 1YECL 2P4AB 3W5MA 4QTHB 1QRNB 4YHLL 3C5JB 4JFQB 4NC1E 2UVEA 4OCSH 4PJGA 3KPSD 4D9LH 1HHIA 3H7BB 2VXQH 4KHTL 1LHZA 4NO5B 2ARJQ 4WENB 2BMKA 4MD5A 4BK5A 3S37L 4WCYH 5SWZA 3RQ3A 4R97C 4KQ4L 1U8NB 1WQVT 2OSLA 3BSZL 3TVMA 5EUKB 4EDXA 1DVFC 4IMKA 4Y5XB 2AJYL 5D6DC 5AYUH 5IMMB 4NUGL 4PY8I 3R1GH 2UUDH 4XCFL 5D9SB 2FX7H 3HI1A 1X5LA 1YYLL 5DI8A 4U1NB 5CJOH 4YXHH 4RAVA 4MJ6A 5E94B 2FSEB 2FJFB 5IFJA 4X4ZA 1U92A 4YPGA 2CK0L 4N90D 4JO3L 4ZOBA 4WUKL 5EIVA 1N5AA 3IKKA 2PTUA 1ND0A 4QOKE 2YWYA 1LO5B 2AEPH 1I1FA 2R39A 4HS8H 4K7PL 2XKNA 4FQXB 1LEKA 3BUTA 3PDDA 3ROOA 3HCVB 4G3YL 1PX4A 5C9JA 5DTFB 1RZIB 4KTDL 4F7PA 1ZHBB 4NKDA 5F9OL 3GSQA 3G5YB 4RAUA 2DQDL 3QCVL 4PRPA 3WJJC 4L3EB 5F71A 4B5EA 1FNEA 5IVNA 3QFJD 3MV9A 4C55A 4F37K 2MQ3A 3L3IB 4RGND 3OV6A 4YHLH 5CEXB 4NO3A 4GRLA 4KHTH 1F4YH 4QY8A 3RI5F 2X6MA 3QDGE 4KROB 4LHQB 4HAFA 5BV7B 3VXSA 3CXHJ 3S88H 4X5XA 5D1XA 1A7OL 1ED3A 4X7TB 2AJYH 3DETC 3THML 1KB5L 4X6CB 3BD4A 1YJDL 5HI3C 4PRHB 2GT9B 2ZJSL 4N8PA 3OKNA 1JFQL 4AL8L 2NLJA 3MFFB 1YYLH 3NABL 4WI9A 1AXSB 3PF2A 4O51A 1SJVA 4PJ5B 4WGVB 4DCQA 3BT2L 4G43B 4YHNA 1VEPA 2CK0H 1MFEL 1QLRB 3MRCB 1QFHA 1A6TB 2G75B 3BW9A 4OCYL 4WUKH 4HUKB 4ZDHA 3VD7A 5AUMB 1EHAA 1FZJA 3VH8B 1U95A 4RGNC 4G3YH 4L4TD 3H9HA 4KTDH 1I7UB 4HUVA 4WW2B 5F9OH 5EO9B 1QSFD 2HJLA 4GAGL 1H0DA 2YEZA 1A3LL 2R2HB 5HHOA 4M5YL 1IILE 4U6VL 2VLKB 2CKBB 3AY4C 4JRWA 4B7IA 1NC4D 1SYVB 3KS0J 4X4XA 1JVKA 5DJ2B 2YD5A 4TSBL 1NBZA 2XG4A 1DQQA 4PJIF 4UQ2A 2WBJD 1BFOA 1JZ2A 5E70A 3DUHA 3FL7A 4JANA 1I8KB 4MVBC 1MJUL 3O45A 4NRXA 2J1KA 1A2YA 2DI8A 3BGFB 3Q6FA 1ZVSB 1G7IA 1R3HB 1OTTD 5DJ0B 3U83A 1A7OH 1BFSA 1SJHB 5I0ZA 5DD3H 2E7LC 3THMH 1U8KB 1YJDH 3EJZC 3MLRH 2ZJSH 1HINL 4ZPTA 3O9WA 4WFFE 2J8UB 1GOFA 2JIXD 1CXLA 2QL1A 1HDMA 3QUML 1FAKT 1YN7B 4ZO7A 3PIQB 3U4AA 4OLEA 4ZNCD 1NCUA 4GG6E 5JHDA 1W0VB 1N0XH 1X5GA 3U0WH 3LKPA 1QYGH 3P0YL 4C83A 5F1OB 2PN5A 4YHKL 4R8WL 5GS2H 3W0WE 4POYA 4YO0B 2OMNA 2VN7A 2GSIB 4GMTH 3OG4B 4NKMA 3WEXB 4GQ9H 2VLME 2X41A 3OTTA 1S7TA 1T2XA 4LL9A 5ISZA 4F2MA 3K2MC 4FFYH 3TLRA 4FXLA 4Z8FH 4R26H 5A2KH 1YQ2A 1VACA 5IP4A 4Q9BA 1E4WL 4GAGH 3F8UB 4LCUA 4TOYH 3QZWG 5A16A 3FB6B 1HHKB 4M5YH 5FEBA 4BKLB 1OTTC 4P2OA 5EOTB 1IQWL 3N06B 1BMGA 5D2LF 4GBXB 5CKGA 4GUPB 1IBGL 4I2XA 1CTNA 1AQDB 5FIEA 4PRPD 1HYRC 3FT3A 3WHE0 3K3QA 1WIOA 5TGBB 2R69L 4PY7A 3ETBF 4MLSA 3OGCA 5HHNB 4Q9RL 1M7IA 3TVMC 2PXYA 2Q1EA 4PYGA 4WO4D 4IMKC 4YR6A 3QRFM 4F9PA 1FFOA 3U0TB 4X9GA 1G0DA 5IV2B 4MJ2A 1NEZA 4O58L 4F7CA 4LAJH 2XXCB 3FRPA 5ADPL 4H0HB 1GJIA 3T1FA 5B22A 1T4KB 5D1XD 3E6FA 4ZQKA 3VWKD 5D7JB 3S8WA 3TCLA 3D18A 2W1NA 1J8KA 3SGEH 5B38B 5EU3A 4Y4FA 1HZHL 1QSEB 4YHKH 1I1YA 3E3QE 4R96A 2H32B 4GRMA 5K93A 3FO2B 1WFUA 3QDMD 5HGDB 4ZNEA 1OTUD 3VFRB 3IDUA 1Z9SA 2VTFA 1SJXA 4LSTH 4X9BA 3IFLH 2WUCH 5IIEB 1WIPA 1M7DB 4OQTL 1ZLUH 1WBYA 1N2RA 5EPMA 2KH2B 2QJDA 1XGUA 4K94L 3NOIA 2BK8A 4YXLH 1OAXL 2V9QA 3SKOA 4WO4C 1IQWH 3G5VA 3P40A 1FL3B 5ESAB 5IB4A 5CAYB 4MNHA 1S7QA 2YA0A 1OGTA 3OXRA 4HCRH 4NSKA 4GRLC 3WFHB 1UH2A 2DKMA 3MODL 2AS5M 2LFGA 3ARBB 2P48B 2CDEA 1T6WA 2R0LL 4RGOH 5GS0L 1YYML 1KPRB 1MRCH 2ZCHH 2RR3A 5D1XC 3W39B 2FIKA 2GY7B 1G9NH 1NCDL 3T2PA 3JWOL 4YZFE 4JFPB 2HRLA 1WBXB 2RHEA 1WTGT 2GJZB 4O58H 1KG0B 1S7VB 1SHMA 5CHNA 3WLWD 3DX6B 4IOFC 1OTUC 3U79A 3O8XB 3N85L 4W6YB 5ADPH 1U8IA 5IWLA 4R2GB 2JLLA 5DEGA 1CGWA 5EUOB 3O41B 4D0BA 1LO4H 3KJ6H 4BQCA 2QQNH 3P4NA 4UIMB 5AG9A 3JWDC 4QNPF 3KVQA 1S9XA 2OZ4L 4YGAB 5E99L 4N8VB 5GS1A 2BVOB 3BHBA 4PRIB 5ESVB 4F7TA 4LPTA 2WWKT 1EERB 3GIVA 4HWBL 5CBEA 5L2KA 2XTJB 1TTGA 1Z2KA 2H8PB 1Y6MR 5BS0B 2GY5A 4TN9A 2R8SH 5JIIA 1IL1B 1BF2A 4RX4D 5ISZD 2H3NB 3LN4A 1OLZA 3CLFL 3MRJA 4OZGB 3MGTA 3OR6B 3B83A 1JHLL 2WP3O 4CRPA 1VEOA 1EEZA 3MODH 5JW4Q 3B3IB 1DBKL 1Q9WB 4UV4H 2FX8L 3CFEB 5L9DH 4Q6YA 3C08L 5FYKH 3WLWC 1U2CA 5GS0H 3G6JB 4JZJB 2VE6B 4HIJB 1OP5K 2R2BA 3DPBA 4KXZH 1HSAB 2BSRA 3CDGA 1CQYA 1ZGLP 4U1MB 3AREB 1C16A 2P5ED 3JWOH 3O9WC 5DO2D 4IIQB 4ORZC 4F57L 1CT8B 3X3GL 2CUHA 1OF2B 4KH2A 4K71B 1AFVL 3V4PL 4I0PA 1RUPL 3VDBA 2PW2B 4X8JA 1LE5A 3IFOA 4YE4H 5I1GL 1XCQA 3X13A 5DJ8B 3EYQC 2C3VB 3EO1A 4OCRL 5DMGC 3SDCD 1AJ7H 3GJFB 5JPNA 4PRBA 5E08H 1U8OA 2DRUA 4PJ7A 5DS8B 2LVEA 1ORQB 4NFDA 1X9QA 4IMLB 5SX5K 2QQQA 1DQMH 5IK3A 4M6OL 1NL0L 2NXZD 4FP8L 1F2XK 3AS3A 5FUZL 2YPLD 4ENED 3GEWB 1GGCL 5HVFB 2BC4B 3MLSL 3O6MH 3N1QC 5C09B 3I02A 4KDVA 4LPYA 4DVRL 4OD3L 3DX9A 4HKJA 1SQ2N 5SWSD 1A1OA 2GTZA 3ECBB 4ZUWB 1TQBB 4DKDC 1JHLH 3O11B 1OCWH 3F7YB 5KVFL 5F1NB 3SCMA 4QHNB 5DO2C 3BP6B 2CDFB 3C08H 4WHYG 15C8L 3BEWB 2N4IA 5HY9B 2PXYC 3NGBB 1RJYA 3INUL 4OZIB 1RIHH 4G8GE 3ES6A 1KLFA 1BJ8A 2BHUA 4XH2B 5B3NA 4Y4HD 4QCIA 2J6EA 3SDCC 3QFDA 3O3BA 1FFNA 2ADFL 3LAFA 3K8LA 2JE8A 1INDH 3FONB 1YPZF 1PKQA 3SGJA 4QYOA 1AFVH 3WN5B 1JV5A 4MX7B 4ENEC 4JDVB 4Y4FC 4OCRH 2HLAB 2HT3D 5H35B 1JRHH 1FYTB 2LU4A 3JSSA 4CN6A 2QHLA 1FJ1B 3V6ZA 3VJ6A 1MRDH 3ZTNH 3VXUE 1NL0H 3C6SA 3PHOA 2NW3A 4PREA 1VFUA 5FUZH 5E4EB 5DDHA 1WF5A 1UACL 4JRYB 1G9ML 2XPGA 2P47B 2IALA 3RWFB 4HIIA 3WKNA 5I66A 2BCKB 4QXTA 1JK8B 2UWEB 1U3ZA 1UC6A 1OPGL 3F12A 4M93C 1PG7W 3AS2A 4DVRH 2VXUL 2YC1B 1AH1A 4L9DA 5DQDH 1FHGA 2VUYA 5E8OA 5EBWB 2B0SL 1E4XL 3EYVB 4Y4HC 1N7MH 4N8CL 1BIHA 1YNLH 5MP6L 1TQCB 3C60D 3VH8G 1I7ZA 2Z92B 3X14A 3VW3L 1BOYA 3CJJA 15C8H 5B8CA 1B6UA 4Z9KB 4F9LA 3INUH 3SE3A 1TVBA 4MGXA 5E8PA 1I7TA 3KJ4B 1G7MA 2AQ2A 4S0SD 1A22B 3TA3A 1RY7B 2HT3C 1BX2A 4NQVA 4OI7A 3O2DL 2Z91A 1QQDB 1MHHA 3SKMB 2G9HA 5IWLC 1UM5H 1BQHB 1IEBB 3IVKA 1X6LA 1PZ5B 3RVXD 5IMOA 1WJ3A 3EDEA 2GQHA 5JHLL 1EBPA 3TH3T 1LP9B 4IJ3C 5E24E 1RIUH 3L5XL 3TGXA 4OFIA 5BW7A 3FO1B 2ARWA 3J7HA 1P4IH 5GS1C 4P3DA 4P48A 1IGIL 1DBBL 1CYGA 5C71A 5F88B 1UACH 32C2A 2JJTA 1ITCA 2VLRA 5AWNH 2XWJB 3VFPA 4L8BA 1HXMA 3MNVA 2DKUA 3FQTA 3EYFB 4H5SB 4TUJB 9CGTA 5IFHL 4LCWD 2H45A 2I24N 3U7YH 3DRTA 2B0SH 3UTPD 2ATKB 1EO7A 1ORSB 1MJ8L 3QEHB 2NW2B 4QOKB 3T3PE 4EXKA 4J3UA 5DT1H 1GZPB 4M6ML 3FB8A 1FVDB 5TDNA 4MD4B 5J6GA 3IDGA 3RVXC 1W72A 2IADA 4GRWF 3T4YA 1N4XL 2W9LA 4MJIA 5DK2B 3WS6A 3AC0A 4KJPD 1XGYH 3O6FD 5JW5B 3HFMH 1P84J 1PSKL 4X4YB 1BJMA 1NGWB 1X5KA 4L5FL 4KUCF 4P9HL 4PUBH 4LNRA 3DMMB 1CU4L 1XR8A 4NQXA 4UT6H 5DGQA 4ZUUB 2PYEB 4U1IB 4KKAD 4I0PC 2I9TA 1AHWB 4XMLL 5MEPB 4JZOB 1SVZA 5ALCH 2BNUB 1A14L 1G6RA 4LP4A 5I1CL 3KPMB 2DICA 3CVHH 2B39A 4JPWL 1MWAH 5MHSE 4X6DE 4LAQH 4YHIA 3FFCB 2MOVA 1FNGA 4TULH 4JPIA 1KV3A 2HVKB 3SOBL 2ICWJ 3D3VE 1T5XB 3PWVA 2B1AH 4FA8A 3HLAA 5J3HC 1P1ZB 5ID1B 4UU9B 1CGSL 3RWIA 3HZVB 3MRRB 3T2QA 1KCLA 1I9JL 4KI5E 3GNML 3BPCA 1BGXL 1CG9A 1JWSA 3G08A 3LKSA 4WEBL 5GRZA 1LEIB 4G6ML 4ODUA 4TRPH 4X7CC 1LEGA 1I75A 3SE9H 1XZ0B 1F4XL 2EE9A 3R4DA 3ROLA 3E6HB 4KKAC 2X42A 3FT2B 5DHVA 1HK6A 5FYJE 2E8YA 1JBJA 2JK5A 3D2UD 3VWJB 1P6AB 4P3CH 3UZQA 5I76A 1DQJA 1DUZA 5H94A 4LVNC 5IG7B 1K8DA 1RMFL 2X89A 3TZVB 4H8WH 2DYPA 1XF4A 4O02L 1E4XI 1I8LA 2E6JA 1Z3GH 5GHWH 1A14H 3MJ6A 4GKZA 3NCMA 3B8SA 1D5MA 3T0EA 1JPSH 1E4KA 1JIBA 1WC7B 4E0RA 1AR1D 3OKDA 1F97A 3WIHL 1VKXA 5DUBB 4HUWB 4E41B 5F9JB 4PJXF 4LP5A 3KNBB 4JREB 4BZYA 4K9EL 3PWPA 1NGQH 3RY4A 4J23A 2DJSA 1FIEA 3HE6B 2V17L 4I3RL 1CGSH 1MIEL 4ZUVB 1I9JH 3GNMH 3TNNA 3MO1A 1BGXH 2MCPH 5ERWA 1SJEB 3QIBA 3S7GA 4G6MH 3W0WB 4GLRI 3B9EA 4N8VG 2C1PB 5B8CC 1F4XH 4F9LC 5LQBH 3QDHA 4CN4A 2ZOKA 3LKNB 2I26N 3VU2A 3SE3C 2WWKO 4PJDB 3IDMA 1AC0A 3S4SB 3ZKND 2UY6A 4UZGA 3S3SA 4D0CA 4I1NB 3TA3C 3EIFA 5IF0B 5DURB 1LK3L 3WS3B 4ELMF 1XR9A 3KPPA 2WK2A 1P7QD 1AR1C 3BXNB 4O4YH 4APQA 1MFBL 1RUMH 4G7YH 3L5WA 5DR5L 3FQXA 4MJ4A 3IKCA 3OKKA 3S3JA 3RWGA 3VRIA 3ULUC 3LS5L 1NKOA 3UTQA 2VLJD 3P9LB 4QRRB 5FM4A 5BW7C 1CDJA 3KYAA 5F3BA 5E6IA 4MQXC 5DRZA 4Y1AA 3O3DA 1NCAL 4TSAH 5IB1A 3U9PH 4MCZB 3SKJH 3UEZA 1U8MB 2A6JA 4K9EH 1TMCB 4MJ5B 5JLZB 3FO9A 5K9JL 1WISA 3O4LB 1P7KB 1P9MA 3VXMB 1EUUA 1KT2B 3ZKNC 3DGCR 3KYKL 3B2UD 5D93B 5A40E 5KSBA 1NUFA 1FRGL 3GUTA 2EDEA 5CD5D 3WHE1 4NNYB 3MLZH 1KJ2B 2QQLL 1REIA 3VDAA 1H3TA 5EBLA 1W2KT 1H15A 1S9YB 5I71B 1S9VB 3WS6C 3QNZB 1P69B 4ZSOE 4KMQA 3CUPB 1T7WA 1LK3H 5KSUB 2Y4SA 2HFFA 1AGFA 1Z5LA 5IVZB 3UMTA 1KYOK 3HPLA 4HDIA 3RHWK 1MCRA 4BUGA 5C0FA 4U0RC 1K3ZA 5JUEL 4N0YL 1HOCB 5IBTL 3MOAH 4ZS6D 2OQJA 5JDSA 4BM7A 3VFGH 3GSVB 2DYPD 3DTXB 4IS6A 1S7SA 5EZJB 2E27H 2CIKB 3TBTB 1B88A 3B2UC 4KRPD 4LMQE 4KZDL 2PCPA 3BZEB 2PTTB 2YKLH 5C2BH 2IG2L 2PYFA 5CD5C 5CBAA 1T5WA 3GFUA 2IQAA 1FE8L 4M7LT 3KAAA 5GGUB 5C0CE 5C0RL 3T09A 3HC4L 4JRXD 3QQ4A 5INCB 1YNKH 3KYKH 1JGVH 1JGEA 2Q8AL 4QHKI 1S8DA 3PWPD 4DTGL 1A7PL 4XXDA 4QRSB 4MD0A 1YY9D 1KXQE 3T65B 4P2YA 5BZWB 4GKNA 2H6PA 1T21A 4RIRB 4HFWB 1EGJL 4JFXA 4NKOA 5HHQB 3QUYB 1D3CA 5CD3A 5HYJE 1YMME 4ZS6C 4X98B 3QWOB 4N1EA 3TBYA 5C0DA 4OD1L 3HS0B 3IJYB 2W0LA 3GMLB 4M6NH 1MCJA 1I8LC 4G9DB 4P4KD 2GJJA 4XNQB 3D85B 4JHZA 2A9MH 3ZTJG 4LHUB 3ZE1F 2X4SB 3T0EC 4NYLB 4PP2B 4EOWL 1E4KC 4NN6C 3NFNB 4L4VE 4R4ND 4CU8A 3FN3A 4OGXL 4APQD 4LIQE 4Y19D 1B2WH 4TTDD 4HMDA 5F1KC 3QR2A 5IW3A 3QEQA 1NUNB 2IG2H 4JCMA 2YN5A 1OAYL 1VPOH 4X6CF 4P2RA 5F9DC 4GO6B 5C6TL 3OB8A 4N0UE 2GK0A 5E6ID 3LH2H 5FA3B 3ZDYF 3HC4H 1GGBL 4P57A 5D96C 5DQJA 1UQSB 3I6GA 3WUWA 4K3EL 2M26A 3QIBC 4P9ML 5T1DL 4ZUSA 2R9HC 1BFVH 1AD9B 3T3ME 1ZHKB 2H2SD 3L3JB 3UPAA 2F54A 3NCJL 5D1ZA 2LAGB 5GRXG 4DTGH 1D6VH 4CU7A 4HC1H 4DUVA 2V7HB 3IJHB 2X4PA 1NPUA 3KGRA 1CVRA 3U48A 5D7KD 4ZOEA 1QOKA 4I13B 4R4NC 3HNTH 4APQC 2XQBL 4R4BB 4TTDC 3B9AA 4JHBA 1IGFH 4PR5B 4WFED 2VIRB 1T04A 3DGGA 1X5ZA 3U82B 1XGPB 3WV0A 3ARZA 1EVUA 4EOWH 2JELL 2LTQC 1QRKA 4DZBA 2VZOA 5E6IC 4XCYB 4XVUD 4G8GB 3BKYL 1EJOH 2DLGA 2ZWLT 4KTEH 4AEIH 4URTB 3LKQA 2D2OA 2H2SC 4NQEA 4PJ8A 3HUJB 3BIKA 3NN8B 5IQ7H 4K55A 5C6TH 4FXGA 1P9MC 1JMZA 1JGUL 2J8UF 4PGDB 4XMKH 1CLOH 1U8QB 1LILA 1JGDB 1T2JA 4HGKC 5DFVD 5JA8B 2FECI 4P5TB 4LLYA 2B8OT 3QCUH 4P5MA 4RGNE 2X2YA 3NCJH 3HG1A 2DQHH 5JW4M 1WGOA 5TF0A 4YBQD 4JFYB 2UZIL 3VXUB 1TCMA 5CIPH 5CS7A 3BQUB 1MCCA 5J9PB 3TO2A 1MPAH 3D39D 2VDMH 4KGLA 4XPGL 1A9BA 3MXVH 3CDYA 3AVEA 5IJKC 1KBGH 2FLRT 2BNRB 3UJTL 4Q7DA 3JV4B 1JP5A 4XVUC 5B39A 4KMLB 2F74B 2XQBH 3LKOB 3LHPL 3QUMA 3RL2B 2IPKA 1E6JH 1AO7A 3KPQB 4HUUB 2X70B 1MREH 1CR9L 1GZQB 4H88L 3DX7B 2JELH 2Z4QB 3U2SB 5CZVL 3MJ9L 1KCSH 3MNZA 3OJDB 5CSZA 1ZLWK 4U1LA 5DFVC 4ELMA 3WLBB 4FABL 4RZCB 2BSTA 1ETZA 2CJUL 3A6CL 5E5UB 2EYRB 2DQCL 3U1SH 4NZTL 1JZ3A 4L4TE 1ZK9A 1CI5A 3VFOA 4YBQC 4ZPVB 4E42A 5TDPB 1DN2A 2GYSA 1DQLH 4POZD 2XY1A 3V7AE 2AXJA 3K80A 4KUCD 4MNQD 3QEQD 2X4NA 5FKPB 1JPFB 1A7NL 4MAUL 4HCRA 4ZFOB 3BN9D 3GSOB 2AABH 5AYQA 1ONQB 1F11A 3EFFA 1CL7L 1T20B 4HKZB 3L7EA 4HZLB 4HX1A 4XPGH 2F54D 5D1ZD 3GIZH 1MCNA 4GW4B 4PJGE 1G7LA 3H9SA 2ADGB 3X11A 2OR9L 5I6XB 1R3JA 5JA9A 4QTIL 1I1CA 4TPRL 5L8KB 3TT1H 3BDBA 5L2JB 3V0VB 5SWZE 3MR9A 1NCTA 4OCWL 1RU9H 1IRAY 1CR9H 4H88H 3OKLB 3LS4L 5FHBL 5IKCA 5FO8B 3D48R 3S4SG 1AE6L 3MRNB 1ZLSH 2CRIA 4POZC 3IU3A 3QHFL 1NAML 4LLVA 4MA7L 5JORB 5FK9A 4UT7H 2CJUH 3A6CH 4J1UB 1BD2A 5IM7A 1OSZB 5DUPH 5FKAB 3HR6A 3RPKA 5J56B 3FFDA 4QXWA 5GS2D 3TBVA 4CAGA 5EU4B 1QPPA 4EIZC 2A6DB 3MX0A 3RAJL 3UBXG 4KK6D 3VGFA 5D1ZC 4OLWH 1J8HB 3BH9A 4X6DB 4OZFB 1FSKC 1H3UA 4HMEA 3VFNB 3OKEB 3BGAA 4PRPE 2BZDA 3DBXA 3GI8H 5FCUH 1BAFH 2NY0B 3D3VB 5IBUB 4OV5A 5IEKA 1AIFB 1LO0L 3TYFB 1OGAA 1GAFL 3HG1D 1B0WA 3F7VA 1YJDC 1X7QA 4K8RL 1CXHA 4NN5C 1MCPL 2AAVA 5LAXA 4ALAL 4P46B 3OHXA 3O6KH 2MMXA 4QTIH 3QNYA 3ULVH 4PGCA 1B6DA 2ENSA 3Q1SL 3VXSE 5JNYB 2B7DT 2CH8A 2F19L 2XY2A 3QPQD 1I9IL 1U8HB 5C07A 3J8F7 4KQ3L 3RIAK 1AE6H 4IHOB 1ZKAA 1Q9OB 1PX3A 3QUZD 2JCCF 3V5DA 2OTPA 2YSSA 3CK0L 3TNMA 2CIIA 2UUDK 4PJ8C 4M61A 5CJQL 5DSCB 4X6EA 4Z5RA 1BVLA 1RJLA 4IRSA 1GGIL 2YPKA 3WMSA 3ZE0E 2Y72A 5IESL 3GZKA 4KV5F 3MNWA 1U3HD 3ORJA 3WFCH 1QP1A 2Y06H 3DX8A 3NZHH 4JO1L 4OF8A 2Y6SC 3VXOB 5A3ID 4IOIA 5LGHL 1WZ1L 4X9HA 2DQTH 2V5SA 1A7QH 4LSUL 1I4FB 2DWEB 5FA4B 5E2UL 5HHOE 3ZSTA 3MRIA 5KSVA 1X5HA 3U4EB 1GAFH 4HKBA 5DZNA 4QHMB 5EFIB 4MCYB 3D25B 4ALAH 4R4FL 1X5XA 4J6RL 3Q48A 4U6TA 3VXNA 3HPJA 1U42A 4U1KA 1GYAA 1KJMA 2AJZB 4NT6A 5IFAH 25C8L 4M8QA 4KQ3H 3H9SD 1AXIB 3I75A 3MV8D 4WFGD 1AKJA 1XF2B 1CFSB 1FVEB 3CK0H 4PJCA 2AK1H 2VDRH 1CE1H 4PIRF 5IMLB 4CNIA 1WFTA 2IFGA 5JHDE 4HWEL 3LPFA 1ZS8B 1KENH 5GGSB 4NO0D 2OI9C 5IB2B 4LHUG 4NHCL 3MLTA 4GXUM 1MCWW 4WV1B 2GUOA 2P5WA 4YIQB 3H3KA 5IBLD 3VFMB 3MRBB 4P3WA 2HN7B 4PTUA 4KRMB 4Q0XH 3MLWH 1BD2D 1RZJH 4J3VA 1KPUA 5TQ0H 5ISZE 5IVOA 4JO1H 1NFDB 5DJZA 1L6ZA 4NUJB 2K7PA 5EIIB 2CUIA 4PTTA 3CSGA 2YUXA 3WHXB 3QYCA 2R1XB 1UA6H 1SY6H 1PBYA 5TDOA 4PJBF 2D0FA 2VXVH 2FBJL 5HDQL 3HI6L 1K2DB 3MSPA 2Y9RT 1F8TH 1MQ8A 1HQRA 4I2XE 4JM2B 4J6RH 3D5OF 3BN3B 3NVQA 3SKUD 5I74C 1N6UA 5GS0D 4MAYA 2EDYA 1MUJA 4KVNH 4YHYC 4MDJB 1Z6JT 1DBJH 4QXUL 1SMAA 3PWJB 4DEPB 1QEWA 4LLQB 3FQRA 3KG5A 4WNQA 5IBLC 3STZB 1MHPH 4ZSOB 2CLVB 4YNYB 4JN2B 1XCTB 1Q9LA 4YWGL 1ZT1A 3ARGA 4J8RB 3N50A 4JFFA 4Y5YB 5EIQA 1IM3B 1U2HA 2Z35A 3AB0C 4K3JH 5C07D 3VFVB 1A6UH 4RMTA 4O00A 1BWWA 1KIRA 4OQ1A 4K94C 1I1RA 4MMXC 3JTSA 5IW1B 5EO0B 3EUUA 1EFXB 4HWZA 4JO4L 4ZNEE 5BCAA 2RFXA 4M7KL 4N0FA 5DMIL 2EEBA 3B2VL 4JAMA 5FDWB 5EZOH 2VZVA 4DWHA 5HYQA 5TQ2H 3CLEL 1U8PB 3LRSB 3NACL 2AKRB 5I1LA 5FM5O 2WANA 5GS0C 3BE1L 3TF7C 3MJ8A 1IZKA 3OF6A 5T3ZE 4J3SA 4KROD 3HI5L 5C0CB 4ZFFB 4RA3A 3WL9B 3L6FB 3DRQB 3JWOC 4UAOC 4NM4L 3P4MA 3O2DA 1Q1JL 2YUZA 2WLZA 3BAEL 4PG9A 3AXLB 5TE7L 2GITA 4FZ8H 1ZEAL 3DROB 1LQSR 1W0WB 4Z6AT 3RDTD 3NAAL 4PJ9B 2DBLL 4P99A 1KLGA 4J3OC 1KPVA 3NZ8A 5IROA 3CVHA 1CN4A 4XVTL 4I4WA 3D0LA 1YEHL 1WLHA 2WW8A 1DSFH 3G6DH 3VXRA 3IXAB 4BSWA 1QKZL 4QT5A 3IDYC 2EYTA 2UY7A 2BRQA 4KI1A 2DM4A 1URLA 1NCNA 1F4WL 5HI5D 1DL7H 1ES0B 1HHJA 4IRSC 5E8DH 2XWTB 4GKSA 5JXED 3BKML 4R97B 5DJAB 3WXVH 5BVPH 5I1IL 3V6FB 1Z0NA 4M7KH 5DMIH 3G04B 2RAMA 1ZT7B 3U0PB 5L8JB 4FRWA 4XP1L 2OTUA 2QADD 3SGKC 5L2KE 2R1WA 1B0RA 4M7JH 1TETH 2EXWD 5DJDB 2R0WL 2YMXH 1YDPA 3LPGA 1EHLL 1ZLUK 3H42L 3HI5H 2N7BA 4N0UB 5C3LD 4XCCL 2EH7H 1CF8H 4HHAB 5C0NC 4PV9A 5CEYB 3W9DB 5GRUH 1RHHB 1ADQL 2FLBT 5FYJL 4YDJB 1T1WB 1J0HA 1M7XA 3NH7L 4HSQA 3CFKA 4PY8J 5E95B 3KPSB 3U6RB 1HKLH 4MXQC 3MRDA 1AQKH 3Q3GA 3QUXA 4UIKL 4UMGA 4LDEB 5HI5C 3LD8B 3GB7B 5C70A 2XN9A 1I85C 4D0DA 4D8PB 3NFSH 2BVQB 4DKAA 5JXEC 4DN4L 3L3OA 4MS8D 4HIHA 4TNVF 3CMGA 5FO9B 2OJEA 4WHYH 1NC2A 2YR3A 1MFAL 4YAQB 1OM3L 3RIFK 4I5BA 4GMSH 2EXWC 4PJ7E 1RZ8B 4YHOL 2VISA 3ET9F 4C54A 2ICWB 1B4JH 3CU1A 1T22A 4JFFD 3WNOA 1T1YA 4LPUA 2OCFD 3L3KA 3C5ZA 4GSDL 4HFUL 4GG8A 1ZANL 4KAQL 1J0ZA 1SBBA 2XZCH 4DW2L 5MI0B 2X4TB 2A9NH 2W0FB 2R0WH 4XCEB 3QQ9D 2GJ6A 3MA9L 3QIWA 4WJ5B 1P5VA 4XNYL 3KYNA 4MXVF 2Y07L 4JPKH 2FWOB 4DZ8B 2VDQL 3SO3C 3C5SB 3FOMB 1GIGL 5BQ7B 2AXFB 3QFJB 4GG6F 3V4UL 2VAJA 2DMBA 5J1SC 4MS8C 4RGNB 3UAJC 2NQCA 3FB7A 3ELAT 4OZFG 4JGMA 5A2JH 2VDLL 4JY5L 4WTWA 1A47A 3T8XA 5GXBB 4JR9L 4IRZH 3HB3D 5IBUG 3PGCA 4X5LA 3W2DL 4KZEH 4HEPG 5I8EA 4N1CA 1BBJA 1FFPB 1RVFL 4R9HA 3ARGC 3PV6A 1PKQE 2KBGA 2XQYG 5DK0B 2CO6B 1A4JA 4OIBA 5CEZL 1JPST 5DWUL 3JUYA 3WFDL 1MFAH 1G7JA 3S98A 2XXMB 3QEUB 2JTDA 1OM3H 1TCRA 4UQ3A 1YN6A 2VZSA 1HQRB 3TESA 2AJSL 2CKBH 1G1YA 3QJHB 1WWAX 4ETYA 3LRGA 4D9QD 5I15H 2W9EL 4I48A 1HEZB 1FGNL 2ZNWA 2YA2A 1ZANH 2VDNH 4KAQH 3TPUA 1BBDH 3HZKB 4DW2H 4M62L 1MHEA 3D6GA 2SEBA 3QRGL 5LCVL 3NPSC 2HT4D 3ARBD 5BJTA 4L4TB 4JJHA 5DK3A 2X9YA 4XTRD 1LE9A 2Y07H 1P4BL 1QLEL 1T1XB 4DN3H 2VLLA 3HB3C 4EXPX 1QSFB 4WI7A 1QFPA 1NDGA 1UWGL 4UTBL 1YEGL 5JDJA 2IH1B 4UT9L 3V4UH 1DQDH 2VERN 4KJYA 1NC4B 3PABA 2VMFA 4NNXA 3L3DA 5CUSL 5T1MB 2I60L 2R29H 5GQBA 2VABB 2ADIB 2WBJB 4U33A 1PD6A 1LO2H 1TZIA 2DQUH 5IROC 5GZNC 2X7LB 4PJBA 5DD1H 2IEPA 3DUUA 1FCGA 1EEYB 3BZ4A 1MLCA 3KPOB 3LIZH 3QP3A 2YK1L 5D2LE 3MFGB 4L8SB 3RVVD 4PJGB 1HHIB 3HMXL 3ESUF 2F58L 3WFDH 3CU7A 1BREA 2BMKB 4MD5B 4PRID 5SWZB 1GL4B 4M8VA 3S34L 3ULUE 4XRCB 1ACZA 2R1YA 2HT4C 2AJSH 2OSLB 5TPWH 1ZT4A 4EDXB 3GMMA 4RGMC 1OB1A 5F7NC 2BVUA 4HS6A 3HI1B 3IFPB 3GM0A 2VLRE 2HTKD 1FNLA 3OWEA 4RAVB 4MJ6B 5LCVH 2EDDA 4I77L 4XT1C 1AY1H 1A3RL 3U36A 3CC5B 4L29A 4G80A 3VG0H 1U92B 4YPGB 2ITCB 4UOW0 5JXAH 1I3GH 5MEOA 1DLFH 5DFTA 4G5ZH 4X6BA 5DJCB 1ND0B 2EDOA 1GC1H 1I1FB 4H8WC 4UT9H 1T7XA 4KRLB 1LEKB 5LXGL 3ROOB 4EKXA 5I1HL 2X4QA 5E0QA 2GJ6D 3QIWD 5C9JB 2Z8WC 1C12B 4F7PB 1M4KA 5CUSH 3UDWA 4NKDB 3QCTL 4MJIE 3GSQB 3QUXC 5I9QC 4RAUB 3HNSL 3IFNL 4HK0A 3WD5H 1D9KA 4OB5H 4PRPB 1S7RA 5E1AA 5L0QC 1A6AA 3PQYA 4HXAL 4U1GC 1J86A 2H32H 1XF5A 4WO4B 4YFLI 4UUJA 5HHMD 3PGDA 4NO3B 4GRLB 5L88L 3O3AA 5EU5A 4POUB 4LCIL 4QHUA 1L7TL 2HTKC 3S34H 2VOTA 3VXSB 4EBQL 4A6YL 4X5XB 1BLNA 5D1XB 3VWKB 1ED3B 4Y5VA 4LCCA 1UM4H 1YZZA 3PP4L 3C5ZC 2GFBA 1NH6A 4FQIL 3VFTA 1QBLL 4QRUA 2NY6C 3OKNB 5DEZA 1MY7A 2NLJB 4LSRL 1TNMA 2VH5L 4O51B 1QFWL 2AEWA 2APVA 2EIEA 3QDMB 4DKFL 4DCQB 4HC1A 1LDPL 4YHNB 1FORH 3QIWC 4AEHH 5F89A 4ORGA 4CJ1A 3ALXA 4P2QA 3DURA 3VA2C 5M95B 5I1KH 4LPXA 4ZDHB 4QNPE 3IDXH 2ZCKH 5LXGH 2VWEC 3BPOC 1SEBA 1QUNA 3TIDA 1DFBL 1RUQH 2XRAH 4YXKH 4HUVB 1HXYA 2NY1C 4KMTL 1KLUB 1CFQA 4KJWC 4B50A 1T03L 1BZ7A 1HILA 2VDPL 4FQQA 3UO1H 1I7RA 1TVHA 2UZYB 3K1DA 4HXAH 1GPOL 5HHOB 2P8PA 5HDOA 1JHTB 1IT9L 1EAPA 1IGJB 2IH3A 3O2WL 4U2YA 1DQQB 5EU6A 5F6IC 1WAAF 2AJUL 2NY4D 3QXWA 1BFOB 5L88H 2LV4A 3H3PH 2QLVB 4JANB 4K9EC 3V9FA 12E8L 3O45B 4NRXB 5KVDL 4OF6A 1A2YB 4M1GH 1L7TH 4M1CD 2EEAA 2XZQL 3T0EE 5IOPA 3Q6FB 4A6YH 1JWUA 1G7IB 2Z31A 1MOEA 2QKIA 4FQIH 3PL6D 1QBLH 5JOPE 3RJQB 4ZPTB 1PQZA 2QHRL 5DEFA 4WHCA 3PWPE 1G1CA 3TT3L 5KOVC 3H9ZA 4DKFH 5I16A 2NY3D 4V1DD 3WNPA 2C7UA 5CIPA 4QHLA 4O2CA 4HLJA 2BNQA 1F3RB 3DXAA 4XX1G 2I9LA 3GKZA 5IB3A 4Y7MA 5JW3H 4AEFA 5FYLL 1MI5A 4XGZA 2DQIL 2E7HA 3EOBB 4QWWD 4NKMB 1S5HB 4LMQI 3DI3B 3D1MC 4F2MB 4NRZA 5ISZB 2R0KH 2R0ZL 4XPFL 2W0PA 3BPNB 2NY4C 4KMTH 4LLMB 1VACB 4XPBL 3ZHDA 2OMBA 1MAML 4XB8A 1U9KA 3DOSA 3OB0H 5KN5B 3GO1L 4LCUB 2HKHH 2P8MB 4HAGA 3CX5K 3GJFH 1FGVH 2DB8A 3ZHKA 3MBEA 3UJIH 3GSWA 3TBWA 4ISVB 4IOSD 3O2WH 1J05B 3B8YA 2IAMA 3CSBA 3PL6C 3VGBA 3VGGA 5KVEL 4ODWA 4I2XB 5ALBL 5IHUL 2XV6B 4O5LL 3K0WA 4J4PD 4ODVH 1HHHA 1YMHB 43C9A 2IBGA 1M7IB 2NY3C 4RQQB 5GISL 2PXYB 3QBTB 4YR6B 4Y1AE 4FFWC 2Q20A 2AI0L 3LY6A 3F58H 1MEXH 1UCBL 5JO5B 3SDCB 1K8IB 2FEEL 1YPZE 4JEGB 1VFMA 1HHGB 4F7CB 2B2XL 2R4SH 3LV3A 5BXFA 3UTSA 4QOKD 1CZ8H 1KGCD 3F5WB 3T1FB 5ICXA 2UYLA 4ZQKB 1HSBB 5HGHB 1ZE3C 3D18B 5L7XH 2FEDC 3DARA 5EU3B 3RWJA 4Y4FB 5KSBE 3SPVA 5F96H 4OCLC 1I1YB 5FYLH 5IGXH 4R96B 5D7KE 4BZ1H 2DI7A 1BZQK 4GRMB 2DQIH 2O26U 2WQ8A 2A74A 1T7YA 4MWFA 1DE4B 3GSRA 5SWSB 3DSNA 3UDWC 4XPFH 1LVEA 3G9AB 5HPMA 2CUMA 4KGJA 1VFAA 1MAMH 3F7PC 1D9KC 4LOUD 1N2RB 4O2EA 3V0WL 1QFWI 3GO1H 5FGCE 5D6CB 1MIMH 3X12A 4M93B 1GGYA 3VMNA 3QDGD 3SKOB 3MJ9A 3G5VB 2VKWA 5GRJL 2YA1A 3NTCH 1OGTB 2NR6D 5DJYA 4Y4HB 4PJEF 5IHUH 3ARFA 1CLCA 4WI2A 1F3DJ 3NIGE 5CGYC 2CDEB 1IGYA 4JE4B 5DRXA 1F90L 5IEHB 4S1RH 3L95A 2FIKB 4Y5VC 3T3PF 3VFUB 1FL6A 3AM8C 3RGVD 4AH2A 4KY1L 4LQFL 1UCBH 1YEFL 4YGVA 4DFHA 3TP4A 4GT7A 2VQ1A 4Z95L 4OLUL 5CHNB 3ZTJH 2NY5H 4Z18A 5INDA 1U8IB 1I3UA 4OCXH 1N5YL 4HWNA 1DEEB 2ICWI 1U8LA 5DEGB 1RK1A 4D0BB 3P4NB 4IJ3B 3C8KB 3N9GL 1OP5H 3ARDD 1E4JA 1U41A 4LGPB 5GS1B 1OAKL 3BHBB 1U0QA 1IEAB 3MRKA 2VDKL 1IC7H 2NR6C 3GIVB 5CBEB 1L7IL 3C2AL 5E5MA 2JB5L 3C60B 1FN4B 1MI5D 3KXFA 3RJDA 2AW2A 5E7FA 5ESQA 2F15A 1AXTH 4XP5L 1NAMA 4JGJA 4L8DA 2BY2A 3MRJB 3KHQA 4PB9H 3NIFE 3RGVC 5ETUB 3MXWL 1EEZB 1RSFA 3JV6B 4TUOB 4KI5F 3ZDXF 1V5JA 2NZ9D 4U2ZA 5IVXA 1F90H 1NMAL 3CH8A 4WFFD 2AXGB 1CTOA 2VXSH 3FQWA 3RBSA 5GIRA 2Z31C 3K2UH 1XGQA 3T0WA 2R2BB 4BFEA 2J88L 3CSPA 2YN3A 4WI6A 3RZCD 2DM2A 4M9PA 2ZSWA 5EC1A 4X6FB 5KVMC 3QEQE 3ZZ1A 1R24A 3I6LE 4HPYL 4P2RE 4Z95H 1L9MA 3LEXA 1UZ8A 3W0WD 1WITA 3F62A 1KEML 1MCEA 1CDYA 4AG4L 1MF2L 3RVUD 1LE5B 4NOFA 1XCQB 2R4RL 5CJ5A 4ZTOL 3EO1B 3HE7D 5JPNB 2OR8A 1U8OB 4PJ7B 1CCZA 3ZSSA 2KKQA 3OX8A 2F54E 3Q5TA 1PY9A 4RFEB 4LCWB 4UDTA 5IK3B 1OAKH 1KJVB 1WT5A 3EO9H 4HXBL 3WKMH 3T4AB 1VGKA 3QIUD 2DL2A 3RU8H 3OXSA 3QZWA 4RWYL 1D5XA 3I02B 4ONHB 4PB0L 1KC5L 2P43B 3DX9B 1G7QA 4HKJB 4WHDA 2GTZB 3LN9A 1UJ3A 3REVA 3RZCC 2R56H 2YHGA 2BY0A 1BQUA 5IR1A 4PJFA 5HXMA 4O9HL 1TJGL 1SBSH 3MXWH 2YXFA 3O6FB 3V5HA 5IJVB 4E5XB 4HJGA 5MEQB 1SM3L 2FRGP 2DBJA 1EO8L 5AZ2L 4YFLF 1P4LB 3P77A 1FNAA 3ES6B 4WI3A 3P9WB 4I3SH 2EH8L 3K4DA 3ARFD 3LDBC 3TN0A 3O3BB 1FFNB 4LVNB 1F58L 4CVXB 4HPYH 4NQEE 4KFZC 3A67H 5HGBA 1WAAA 1WIUA 1JV5B 5HPOA 3SE8L 4OM0L 2XOTA 1SY6A 4YBLC 3NMEA 2ORBH 5KZCD 1NGXA 4PD4J 4X0KB 3AS1A 5HSFA 3HG1E 1J1XL 4HH9A 2NW3B 3MROA 3PHOB 4PREB 5LGKA 2FB4H 3R06B 4AM0A 4HIIB 3MUJA 1JNHA 2X1OA 4Q6IA 1F6AA 4JB9H 4PB0H 3IJSA 5SX4H 1ACYL 1U36A 4CVWA 1OTSD 5ITBL 4XNMB 3C09C 4NQSA 4OKVA 3OPZH 4WUUA 4R0LA 2A83A 3D2UB 1AO7E 3ARFC 2BX5A 4F37F 4XXCC 1EA9C 3KXFD 3PDOA 4HJJL 4P23A 4UB0L 1NANH 2HG5B 5DUML 3X14B 3C9NA 4HS3A 4IRJA 5F97E 5B8CB 2F9BT 4JM2F 5E6ZA 1JPTH 5E8PB 3LOWA 4ELME 2EH8H 1TNNA 2ID5A 2DN7A 1Z9LA 2VUOA 5D2LB 4C57C 5J11C 3EOYG 1V7NH 4KDTA 3IVKB 1QVOB 1VGEL 5IMOB 1DQTA 4YQXL 4OGYH 1CGUA 4PYHA 4JVPA 4UDUB 3MGOA 1X5IA 3QUYD 2H26A 4PGBB 1ZHLA 3ZL4L 4OFDA 1FO0L 2FD6L 3MPCA 1C8PA 4P3DB 3DO7A 3DUSB 2YOCA 1JF1A 1RUKH 5T3ZL 3CZJA 5FHAH 2ZPKL 2B4CL 1HWGB 1HXMB 3PWLB 5E2VH 3VA6A 3MNVB 3FQTB 2HFGL 1JZ4A 1RD6A 4K8RD 4PS4H 4ZG1A 4BELD 3H9SE 3DHJA 2E7MA 3AMLA 4NP4H 4WFGE 3IXTA 1QBMH 5HTSA 4UNVA 2J5LC 1Z9OA 5EU7C 3OBAA 4LBEA 2E9BA 4Z77B 4C56A 5DUMH 4UB0H 5KSAA 3FZUD 4U3HA 3QEGL 5TDNB 3KPRA 1O7VA 2YS4A 2V7NA 3IDGB 4MA1C 2IADB 4RMQA 4HIEA 5FECB 4U6HB 4JM4L 5KG9A 1N8ZA 1BD2E 4AYFA 1QRNA 2VLJB 3NA4A 4JKPL 1XAUA 3ALWA 3C5JA 4JFQA 4LNRB 5BVJB 5IHZB 1XR8B 4KK9D 1N6QL 4ZXBD 3ARRA 3H7BA 2DTML 4PJEA 1UGNA 2I9TB 4UOW1 5BOPA 2F8VA 4U0RB 4YQXH 1G6RB 1NMBL 5FO7A 1SEQH 3TYGH 2W65B 35C8L 4YEFA 1A7BA 3LB6D 4XBGB 5IMMA 3M17B 4UNUA 1BEYL 1WWBX 5D9SA 1TXKA 1MFCL 4U31A 4YHIB 1OD9A 1G7PB 1PYWA 1KCRL 1WT5C 5I73C 1FNGB 5FYKE 4U1NA 2DTSA 4JPIB 2ZPKH 5E94A 2FSEA 3PWVB 2FJFA 2F53A 3FZUC 1OGAE 2NYYD 3RWIB 4W68A 3QQNA 5I17A 3OZ9L 1FAIH 3BPCB 4DJMA 3E1F1 5KJRH 5J12C 4N0CC 1N59A 1JWSB 1ROWA 3HCVA 4UILL 1IMHC 1RIVL 1RZIA 1F02I 4GW1A 3EDDA 3QISA 4KK9C 5CLWA 1ZHBA 2XG5A 4ODHL 4ZXBC 3ROLB 5C07E 3TFKD 2NPLX 5FUOH 5DHVB 3G5YA 1SYSB 5F9WC 4L3EA 2OL3L 1S5IH 4DGVL 4F33A 3UTOA 4NCC2 2G5BB 3TO4D 1S7XB 2JK5B 5EZIH 1DQJB 2MFNA 3L3IA 4OFYA 4BSVA 1R5WA 5IMKA 2OS7A 3LB6C 3SDDA 2DYPB 5ILTH 3EOAA 2DTMH 3NFPB 6FABL 1FLRH 4KRPB 3S37X 4LF3B 4QHKJ 5GGTH 4HBCH 2WIIA 4X7TA 2IBZX 4NN6B 4E0RB 3K4ZA 3OKDB 1XIWD 4JRXB 1K6QL 3MFFA 4Q74A 4ZAKA 3OAZK 5I75C 1KB9J 4G42B 4PJ5A 7FABL 4XVJH 2CQVA 3PWPB 4G43A 4JQIH 4MB3A 4OTXL 4Q6IC 4M43L 5IHLB 3I3BA 4OF5A 3TFKC 3GRWL 4OF3A 1QLRA 3MRCA 2UVFA 4D94A 1B3JA 5E4IA 2G75A 5HVWA 5D96B 3ZKSD 2HLFC 5AUMA 4R0LC 3TO4C 2E7BA 5F7MC 3VH8A 4M1DL 5BO1L 4P23C 4LSSL 2YZ1A 5JMRA 2J6EL 4ODHH 2ZOKB 5EOCL 1A4KA 4P4KB 2D4FA 2OL3H 3UYOD 3R8BB 2FNBA 4DGVH 2D03L 2R2HA 3F6IA 4PJCE 1NJ9A 2I5YH 2DL9A 2CKBA 2HH0L 4LSQH 1T0MA 3ARYA 4N5ED 3S36L 3KPRD 4LRNH 5T1LA 4MXWH 3UROR 4KDTC 4APQB 4Y19B 1D5BA 1GOGA 3VXQA 3L5WB 3RY5A 4BUHA 3FQXB 3NA9L 3OKKB 3VRIB 4PG2A 1FNSL 1R3HA 5DJ0A 3CXDH 2LTQB 1SJHA 3L5JA 3KR3L 3QULB 5F3BB 1DP0A 3WDIA 1CD9B 5E6IB 2MNUA 3O3DB 1K6QH 5JR1H 3MZTA 5IB1B 2H2PD 4XHQA 5DD0L 3VFSB 1OAZL 8CGTA 1CLZH 1YPZB 7FABH 2BOCA 2A6JB 1RZKH 3R0NA 1YEKL 2R2EB 1W0VA 3EDKA 4KUZH 4PGZA 3AROA 3VRJB 4AMKH 3GRWH 4ZFGH 4U0QB 3E8UH 5ADOH 5KSBB 3V4VH 2AJ3A 1VDGA 3GUTB 1J1PL 4DK3A 5L8LB 1HNFA 4M1DH 5KSAC 2F53D 4N5EC 3MCKA 2AGJL 4OGAD 1JN6B 2BOBB 1H15B 3KYMA 2B1HH 1UWEL 4XBPB 2AJVH 3FB6A 2D03H 5I19L 2Q86B 5FGCB 1T3FA 4IBLT 5E6YA 4BKLA 4JFFE 1T2QL 4BFBD 5KVGH 1AGFB 3P0VL 1CD8A 4ONGL 3HPLB 3S36H 4HDIB 3PDGA 3ULUL 3KS0H 4X5WA 3B5GA 2H2PC 2FH8A 4MMZC 5TGBA 5IHBA 4PJGF 5JW4R 1FNSH 2YZ8A 2OQJB 1DBMH 4A2MA 4JPVH 1MCOH 4YEEA 3SDDD 2QEJA 1IFHH 3UXFA 4IS6B 1FVCA 5IV2A 1NCCL 4QRPA 2BVYA 5CBAB 2EKJA 3KYOB 1T5WB 5I2IA 1DEDA 1NAKH 4KKLC 1GHFL 4OGAC 4XPAL 4ZYKB 2XA8L 1LDSA 1IM9D 1BVZA 1NSNH 2H32A 2DIBA 3EGSB 3M8OL 5FYJD 3V8CA 3WFBH 2VXTH 5HGDA 1JGEB 1S8DB 5I8OL 1W72L 3U30C 1I3VA 4XXDB 3HMXA 2AGJH 3JV0A 4MD0B 2Q8BH 4S1QL 4JFEA 2H6PB 2F5BH 4JFXB 4NKOB 4YHZL 1VADA 3WNMA 1ZSDA 5CD3B 2DI9A 4AK1A 4NWUH 4NNPH 5ENWB 2HP4A 3VXRE 5GJSH 4NJ9L 1T2QH 2YWZA 3TBYB 5C0DB 3SDDC 2V2TB 4D9QE 1G6RL 5IUSA 4JLRA 3WFHA 4HJ0C 4OSUH 3EZ8A 1A6ZA 4YBHA 4X7SL 1VFBA 2C9AA 4OLYL 5TH2A 1MFNA 2BDNL 1KPRA 4P5KB 4XP9H 5E8NA 2LVCA 3T1WA 4BJLA 5T1LD 1I1AD 1I8IB 4XPTL 5AZEL 4ZAKC 1BM3H 4MNQB 2GJZA 3QEQB 1KG0A 4WW1B 1S7VA 2MWCA 2P7TA 3NCYS 4LNVA 3O8XA 1S3KH 4P2RB 1ERNA 1R3LA 4HEME 4NFCA 4XPAH 4M5ZL 4P57B 3MRHA 4OCMC 3RVTD 5EUOA 1Q94B 1IC4H 4YHML 5C1MB 1CGTA 1WEJH 1N3NA 2F54B 5D1ZB 1UM6H 4RFOL 4N8VA 1KNOA 2BVOA 2AQ1A 4G6AD 4S1QH 1J9CT 3ZE0F 3TM6A 2X4PB 4YHZH 1X4XA 2PO6A 4A6YA 4YUEL 1IL1A 3JWNC 1MVUB 2IGFH 1KB5B 5CEZD 2H3NA 4Z0BH 1I1AC 3CNKA 4OZFH 3GM8A 3B3IA 4RFNC 1Q9WA 4EZMA 3CFEA 1T04B 4OLYH 3DGGB 4JHWL 4PG2C 3B9KD 2VE6A 3MRFB 4DZBB 2PR4L 4U1MA 3AREA 3KLDA 4IIQA 5CP7A 3S35H 1IAOB 1A6VL 2GJ6E 3MLPA 1UCTA 2PW2A 2GI7A 5E2JA 1U3JA 2DD8H 5DJ8A 1QFOA 5T33L 3GJFA 5DS8A 5MENA 4QRPD 2CDGB 4YHMH 2HRPL 4JHAL 5JOEA 2VWEE 4P5MB 4YLQT 4WDIB 4GW5B 4UBDC 3HG1B 5ANMA 5HHME 1UENA 1KIPA 1ZLWH 1WFNA 2FL5B 4MHHG 4PJXB 2ZKHH 1KELL 2GSGA 3TO2B 3SQOH 5F6HI 3FB5B 43CAA 5C09A 2L0DA 4BFIB 1YEIL 2H1PH 1A9BB 3B9KC 1IKNA 4K3DL 4M4RA 2AJXL 3RWHB 1MLBA 4JFED 5JW4N 5B39B 2EIZA 1DBAH 3QUMB 5IB5B 2IPKB 3VE0B 3FMGL 4QHNA 1EAJA 1AO7B 2W9DL 2YUVA 1PG7L 3BP6A 3I6KA 2CDFA 1E6OH 4M7LL 4R3SA 3BEWA 5HY9A 2EDKA 3C6LA 4X7DC 1KTRL 2AEIT 4G7VH 4OZIA 4XH2A 1RJCA 2HWZH 5CSZB 4Z7UA 4K3HA 1GC1C 1MCSA 4U1LB 4EDWH 3L9RA 4ELMB 5KBNC 2BSTB 5HJ3A 1ETZB 5FCSH 4FQPA 2EC8A 4L1DA 1A6VH 3FONA 2NNAA 2W92A 4S1SL 5FV1L 1ZXQA 4QF1A 4HKXA 5IT2H 1IGTB 1BPVA 3VDCA 3WN5A 3WDJA 3VFOB 5CSBA 2OI9B 4OCSL 2IFFH 2HLAA 5H35A 2VXQL 1CQKA 3DECA 1FYTA 5J06A 2X4NB 4MB4A 3TPKA 2OK0L 5HYJD 4XI5D 1Y18B 4Z78A 1RK0B 1YMMD 1II4E 5DMKA 2F8OA 3OJVC 4ODTH 2E7CA 5F7WC 1OWRM 5AYUL 3RWFA 4PJBE 1F11B 3EFFB 3UTZB 3R1GL 3L7EB 1JK8A 2UWEA 4LFHD 4EI6A 2HKFH 4X4ME 2WBKA 1Y6NR 4K3DH 5CJOL 4WFHD 4YXHL 1EZVX 1X5FA 1G7LB 3H9SB 1J5OH 3X11B 1DVFD 3MV8B 1R3JB 4L4VD 2HT2D 3FMGH 4PRDA 2PO6D 5I74B 3MR9B 2Z92A 4FTVA 4M7LH 1FG2B 1X44A 4AENB 4YHYB 1K4CA 5IKCB 4HS8L 3JTTA 5TJWK 5FM5M 2GCYB 1FPTH 4LLVB 5DD5H 3VCLB 4YDIH 4G8IA 3A6BL 1QQDA 1BD2B 5IM7B 3UTTA 3EAKA 4S1SH 3REWB 4Q58C 4XI5C 5KS9A 1PZ5A 3GMPB 3FFDB 1MVFA 1QSZA 5SWQA 3TBVB 4IDJH 5J0BA 4MNGB 1LP9A 1NCBH 3UYRH 1F4YL 3ILPB 4Q9QH 1KEGH 3FO1A 2N1KA 4ELKB 4JG1H 2OK0H 3L5HA 3BH9B 2Z93A 3S88L 4XC3L 5F3HA 5F88A 2HT2C 4NCC1 3DBXB 2VJXA 3PQYE 2PO6C 5CZXC 5MEND 1R3IH 2VB5A 2DQJH 4F7EB 4OV5B 5IEKB 4H5SA 5L6YH 3F7VB 2P49B 1X7QB 5I8CA 4OLVL 1NFKA 2ATKA 1ORSA 4TVPL 5LAXB 3CFDB 4UAOB 2BHYA 4JN1H 4WWID 3QNYB 3DETD 4FG6D 2B20A 5EDXA 5HI3D 4PGCB 1FVDA 4MD4A 3LN5B 2C4XA 3HMWH 5DC0A 1HH9A 1KGCE 1FV1A 1IEHA 3QXAB 1YA5A 5C07B 3I3EA 5DK2A 2OTWB 3BGMB 4TSCH 4DOHE 4JG0H 2ZNXA 3AREC 5JW5A 2IQ9L 1FP5A 1QPXA 3V5DB 4X4YA 4IIQC 2KPNA 1NGWA 2YSSB 3A6BH 2WINB 3ABZA 4J12A 3DMMA 4N5UA 4PJHA 4ZUUA 2PYEA 3C6LD 3QDJA 4U1IA 3IDYB 3WJLA 4P2QE 5CKAA 5MEPA 4JZOA 2FR4B 4NN7B 2BNUA 1BVLB 1RJLB 3PJSA 2N56A 1YUHA 5T5NF 3KPMA 2FHFA 3B9DA 2HJKB 4CVZA 5HDLA 3B5HA 3MNWB 1UXSB 1LD9A 5BZDA 3ME0A 4PJ7F 4XC3H 3FFCA 4M6AA 2CRZA 1JPGA 5DD3L 1A6PA 5D1QA 4FG6C 4J3XA 3MLRL 1T5XA 3RP1A 5EB9A 2A6IA 5KSVB 1UKTA 1P1ZA 4MVBD 3RDTB 5ID1A 3IDJB 3MRRA 2DM3A 1NLBH 1JJUA 1ZVHA 5EU6E 4OLVH 1TQBC 4TVPH 4BH7A 1YY8B 1N0XL 3U0WL 1QYGL 3VXNB 3EJZD 4LPWA 1KN4H 1HCVA 3MBXH 3ZYOA 1XZ0A 3MACH 3C6LC 3E6HA 3FT2A 3BFOA 2MCG1 4MB5A 3WUZA 4GMTL 4GQ9L 1U6AH 4M8QB 4HW6A 2J4WH 4FFYL 3I75B 4F15B 5CJXA 4P4RB 4Z8FL 2IQ9H 4R26L 4PJCB 3MV7A 4NFBA 4FTVD 4KHXH 3BJ91 5CJ8A 4TOYL 2BNQE 4OM1H 3DXAE 4X80H 4M7ZB 4NQCA 4U6XA 2QADB 3MLTB 3KPNB 2ZOLA 2O5YL 3RL1B 1MI5E 1H3VA 3AUVA 4BH8A 4PTUB 4QLRA 1MNUH 2QSCL 3S96B 3UTTD 1BQLL 5FAAA 3IS1X 4GAYA 5DUBA 4E41A 1QSVA 5F9JA 2LAAA 4PTTB 3KNBA 1N26A 2DLHA 3EJJX 1S7WA 3GBLA 3HE6A 4MXVE 1DDHB 1JWMB 2COQA 3ZDZE 5DA4A 4H1LG 5SWZD 2W60A 3CVIH 4NZUL 2R2CA 3RBGA 4MDIA 2GTWB 3SO3B 1SJEA 3TVMD 2D0HA 2X4RA 3T0BA 3PG2A 2VC2L 2Q76A 2C1PA 1TZGL 1FBIH 3LKNA 1CXFA 1IAKA 1OAUH 4LARL 4PJDA 3S4SA 1AGEB 3IU4H 3KJ4C 1TZHB 4NHUB 4LSTL 3FT4A 3IFLL 3WS3A 2WUCL 4MA8H 4HWUA 3BRFA 4AY0A 1KF9B 1Q9LB 2YUWA 1ZT1B 2MTPA 3ARGB 4JFFB 3UTSE 4BFGA 4WGWB 4LGRB 4AIZA 3EYOA 4YXLL 5TE6H 4I8DA 1F3JA 4HGMA 1R3KA 4ZS7H 5TE4L 4RISH 4YFEA 1KIRB 5DVNA 4ZFZA 2O5YH 4HCRL 3DYPA 3JTSB 2IJ0C 1A1NA 1HIMH 4QRRA 2QSCH 3B6SB 4FOMA 4G6KH 2RFXB 2RCSL 1BQLH 3UBXA 5KW9H 5F7EH 5DVKA 4F58H 4Z7OE 3MV9D 2ZUQC 5HYQB 2VAAA 4RGOL 3WNLA 3IDIA 4V2BA 1MRCL 4NRYA 2ZCHL 4MCZA 3ULUF 1IGML 5I1LB 1G9NL 4GRLD 4MJ5A 5JLZA 4DUXA 3NPSB 3MJ8B 3O4LA 1JNLH 1CIUA 1O7SA 3VXMA 3OB0K 4LGSB 4NZUH 1HWHB 3QI9A 1IKFH 3VXSD 3GJFK 4CW1B 3RVWD 2Q87A 4JKLA 2VC2H 2JJUA 3TH2T 5D1QD 3QQ3B 3K7UA 4PG9B 2V5MA 1NEUA 1LO4L 3KJ6L 1TZGH 2QQNL 4UTAH 4KKBC 1KLGB 4LARH 1S9YA 1S9VA 1KPVB 4IOFD 2G60L 2EE6A 4I4WB 1B9ZA 2M2DA 5KSUA 3HKFA 4ERSH 3DMMC 4H20L 4JZNA 3K8KA 1FO0A 2EDBA 4QT5B 2OR7A 2EYTB 4HPOH 3QUKB 2R8SL 3MGAA 3WJLC 2EE2A 3DNKA 5DZLA 4ODXA 5FDYA 5TE4H 1PFCA 3MLXL 4LVEA 4KJQD 1HHJB 4EN3A 1DN0A 3RWDB 4NWTH 1HOCA 5C6PB 4GKSB 5F7DB 3MV7D 2RCSH 4UV4L 3DTXA 5L9DL 1AGCB 4RGMB 1V3LA 5FYKL 4LSPH 5HHOD 3TBTA 3ULVE 2UZXB 2QR0A 1NGZB 3RVWC 2OTUB 1IGMH 5BMFH 2R1WB 1ZHNA 5D1QC 3KXFE 5C0IA 2FZ3B 1YDPB 1TENA 1H8SA 2ILLA 4ZODA 2EO1A 2G5RA 4PV9B 5EU7E 3GMRA 4YE4L 3MLYH 5F8RC 5E08L 5IVXE 1AJ7L 4QRSA 5FGBA 3O9WD 3T65A 3CFKB 4RIRA 5T3XL 3MRDB 3Q3GB 5I9QB 1DQML 1EHXA 2G60H 1G0XA 3QHZL 4KJQC 5GGTA 5JHDD 5CJXC 5L0QB 4D0DB 5ICYB 3GI9H 4DVBB 1H3PH 1BWMA 2XYCA 3GHEL 2RGSA 3EYQD 4H20H 5DMGD 4HK3N 3K1KC 3HS0A 3O6ML 4HIHB 3IJYA 2QSQA 4W81A 1KTKE 3MLXH 3DYMA 4LHUA 1Q0YH 3SGEI 2DLEA 1CD1B 2VISB 1BVKB 1OCWL 4G8FB 5EOQH 4K2UH 5HGGS 3NFNA 1T22B 1BP3B 1T1YB 3U9UB 2HA1A 1EEQA 2JCCB 4P2OD 4HK3J 1RIHL 2J2ZA 5K59E 3BOVA 4F8TA 4JFDA 1LK2A 3MMEA 5C9KA 5DHYB 2GJ6B 3QIWB 1WBZA 1J0YA 3KYNB 5FA3A 3LRHA 1BJ1H 3RNQA 5DLML 2OL3A 1INDL 5A2LH 4PJFE 2PXYD 3CFCH 1AD9A 1V3KA 1ZHKA 2JF1A 3L3JA 1D6EB 3OKMA 4OLZH 2D4DA 1N64H 3BPOB 1MFDH 1RURH 6CGTA 3FB7B 4UNTA 1MJ7H 2EIBA 3MTRA 5HHMB 1JRHL 2PETA 2R23B 3T8XB 3IJHA 1Q9KA 2NY1B 3QI9D 5T3XH 3M45A 1MRDL 3ZTNL 5J13B 1NGYB 3QHZH 3VGAC 1SMOA 5I8EB 2A77H 1BBJB 3GHEH 4Y4FD 4GH7B 3JWDH 3PV6B 1WAAE 5CILH 3ARQA 4R4BA 4LDOB 1A4JB 5F6IB 1PGRB 1V7MH 1EXUA 1G7JB 4P2OC 5DQDL 1KCVH 3UC0H 3U7AA 1IAIM 4XP6H 4UQ3B 1YN6B 2WUBL 3FOLA 3WXWH 3E2HC 2ARJB 4TQEH 1N7ML 2P1YA 3LKRA 1YNLL 3GRWA 3EFDL 3OJMB 3U7WH 4XCYA 4I48B 5GSVA 5T3ZD 3L3GB 2NX5A 5J4MA 5IQ9A 3AMKA 3TPUB 2JJSA 4EN3D 3GKWH 1MHEB 5B21A 4PBVC 3ZE2F 4F9PC 3WFEL 2SEBB 3HUJA 1VERA 5I1EH 3QG6A 5BJTB 4PGDA 1C5DB 1U8QA 2IPUG 2W38A 1TLKA 5DLMH 3QI9C 3GSUB 3RUGF 3ZKXB 3L7FB 3RPIB 4WUUE 1UM5L 5J7CC 4P5TA 1EHNA 5EZLA 1GXEA 4G6FD 1AGDB 4KJYB 5C7XL 3I85A 4JFYA 2N7AA 1U8JA 2VNCA 4NNXB 3L3DB 1RIUL 4X9IA 5DD6B 5KSBF 4BQBA 4M3JA 3BQUA 2NY4B 5J9PA 5C0GA 3ILQD 1D5IH 4KXZI 5C0EA 4AEEA 1P4IL 1TZIB 3CDFA 4PJBB 4NGHH 2DQGH 3BP7B 4J7RA 4CMMA 3DUUB 3QO0A 3RWCA 5GGRA 5AWNL 1JZ5A 3RIAF 2BNRA 3JV4A 1NMCC 1NUDA 4N9OB 2KZ1B 1LNUA 3K81A 2HFTA 3PL6B 3VRLE 4Y4KA 4CGTA 1J87A 2ZG3A 3U7YL 5GSRA 4RMVA 4EN3C 2B4CC 1UVQA 2WUBH 2X70A 2OP4H 1GZQA 3PHQA 2XWBA 3QNXA 3DX7A 2R1YB 3M1BA 4P49A 2NY3B 4V1DB 4Z0XB 4YX2L 5L2KD 3U2SA 3T2NH 3EFDH 4X8XA 3WSQL 2QQKH 4TNVK 5DT1L 3OJDA 4CJ0A 3I2CL 3GK8H 3GMNB 3NIGF 4HS6B 3DIFA 4AJ0A 4BQ9A 1INEH 1J1OL 3WFEH 1XGYL 3HFML 1CDBA 3U36B 2APWA 5TDPA 4PUBL 3ZKMC 5B4MC 5D8JL 4B0MM 4UT6L 2FO4B 3ILQC 1HE7A 5MEOB 4B53A 3VFWA 1GSMA 1MAJA 4L3CB 3FN0H 5GRWA 5ALCL 4JFDD 4RNRA 4C56E 1JPFA 4OIAA 4Z7VF 1NLDH 5F70A 2X4QB 5C7XH 3F6LA 3KPRE 3CVHL 3AU1A 4ZFOA 1FZMB 1WZLA 4U3XA 3F7RA 3HC3L 1MWAL 1ONQA 1NDMB 3BVNA 1D9KB 4LAQL 4I0PD 1V3JA 4HZLA 5E1AB 4K07A 1A6AB 3PQYB 2O5XH 1IAIH 1WUNT 1QRNE 4TULL 1XF5B 3ISWA 1OSPH 1L0XA 2B1AL 3HRZB 4YK4C 3FTGA 4PJEE 2ADGA 1BQSA 1B4RA 4RRPG 3O3AB 5CINH 5EU5B 3Q2CA 4QHUB 1MCQA 3WE6B 3FJTA 3NIFF 4TRPL 4YX2H 3EYUL 3WSQH 3MRNA 4JGUA 5J3HD 3I2CH 3SE9L 4R6UA 1N6VA 4DOHB 1DCLA 5JORA 1YQVL 3V2AR 4HG4J 3MV11