4Y1AE

Immune complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
240
structure length
240
Chain Sequence
b'AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRPRDPVTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aE02
2PTUA 3ZMRA 3RAJH 1CICD 2ATKB 1OY3B 5I9QC 2ARJQ 4NO2B 5TE6H 3ISWA 3VFTB 4LCYA 1IRAY 1QFOA 5ESVB 3BGFC 5GRVL 5J3HC 3CZJA 3MRQA 1W2KT 4X8JA 4WW1A 3PP4L 3T0EB 4N8PA 3UYRH 5HYSA 5D93B 4I18B 4J3VA 4PJ5B 1SBSL 5I16A 2AK1L 4P5KA 4ZS7H 5IEKB 2DTMH 4NKIH 1OLZA 1RJCA 2ZOKB 2BMKA 1EO7A 4K3JL 4M6MH 4Y2DC 3REWA 5KSAB 1UB6A 1RZIA 3BWAB 4XMPH 1T4KA 2YKLH 1XF3B 4UMGA 3QDAA 4FOMA 5LGHH 3ZE1E 4ZO9A 1G7PB 3T3PF 5SWSB 5C0GA 3RPKA 5I8OH 5EZLA 2OTWA 1DL7H 2I9TA 2J88H 3T77B 3DOSA 4YXKL 3VGHA 4AIZA 1X5AA 4P9HL 5CINH 4X7TB 4U1GB 4JFPA 3EYUH 4LLVA 4J6RL 3KPRB 3S8WA 4RZCB 1J0IA 3T0XA 1WFOA 2VLKE 4JRYB 4NQVB 3CFBB 4RCAA 2IGFL 4TTDD 4G6ML 1MCIA 1ZHBA 4RFOH 1KJ3L 3HNTH 4KVCH 4R90H 4KRNA 3QEQD 1I1AC 3QUYC 5CBAA 1A7OH 3VCLB 2EXWC 2DQCL 2ARJA 2LABA 4YHMH 3QUZB 5MP6H 3VH8A 2VR9A 1M1SA 5I1LB 5D7LB 3VXUB 5IWLA 3WV0A 5DI8A 2QQQA 4QLRA 1OWWA 2FEEL 4OCNC 3Q6GH 3E2HC 2G75B 3DMMA 3DX8B 2R0WL 4Z5RB 3JV6A 2GK2A 2R1XB 1T3FA 4YXLH 2D03H 1AXSB 2AEPH 4YFLF 3SJVE 4M93B 2K3TA 5D2LF 4GG6F 43C9A 3VJ6A 3T2NH 1U92B 1F6LL 1KB5A 4OZHA 2XPGA 3WIFB 2V9RA 4DEPC 1UWEL 1MFNA 1MI5E 3S35L 5AAWA 4MNQB 4Z6AT 1RQ5A 2I07B 3WDHA 1KIPB 1HXMA 1T1XB 1Q0XL 1F5WA 1EXUA 4HCRA 3BP7A 4OBRA 3TT3L 3QIUA 2I9LB 2FZ3A 3HZVA 4O58L 4ZYKB 1W0WB 1YNLL 4CVXA 4JJHA 3QDME 2CK2A 1RUPH 4O02L 5HYQA 4QRTB 1U8JB 4OLXL 1JYXA 1TJGH 5D1QA 3N1GC 1EFQA 2DQFB 2F53D 2I25N 4OUOA 2JIXD 1P6AB 3BGFB 4PJ7A 2OR9L 3IAQA 5GRUH 2OP4L 1KEML 1LNUA 4E5XA 5GS0D 1X4XA 3V6OA 5J6HB 4OAWA 4CMMA 2A6KA 4NZDA 5DS8B 4J12A 1WCBA 3EYOA 1TVHB 4Y2DB 3TBYA 5I8KH 3QUMH 3GM8A 2X4RA 4GAJL 3MYJA 1J1XL 3IYLW 2QHLA 4CMHC 2X1WL 1Q0YH 2K9UA 5DJCB 2R9HC 5E6YA 2WUCL 1R0AH 2JE8A 2DBLH 1SMAA 1CQKA 4LEXL 3WSQL 2LFGA 1RIHL 5GGTA 5TJWK 1WEJL 2DIJA 3FO1A 4WI7A 2GTWA 3IDGB 5EUKA 2DB8A 1JGLL 1YYML 3GSNL 5JW3H 4HLJA 1L6XA 3VFMB 1NGXA 1QHOA 3DXAA 5CAYB 4MCYB 3V4PL 5ANMA 3S5LA 3HR5A 1X4ZA 2J8UF 1I1AB 1FSKB 3QUYB 1LP9A 4JRXB 5DD3H 3QUMB 5EOCH 3DVNA 1I7ZB 1VHPA 2D7TL 5BMFL 3V0VB 4F33A 1OCWL 1IC5L 7FABL 4NRXA 3SDAD 4OIIH 3QZWB 3PL6C 5CSZB 2OTPA 3D25B 1BQSA 4RRPG 1AKJA 1N5YL 2YOCA 1NCBL 3DV4B 3E2HB 4OKVA 2Z0BA 4WDIA 4XX1G 3TN0A 2YPLD 1UA6L 3D0VA 5DD6B 3V7AG 1P53A 5JO5A 3O9WA 3ARGB 5MENB 3K8LA 5FGRA 4P49A 3BD5A 3QXAA 4FZ8L 4L8CB 1M71A 1BZQK 2IPTH 3F62A 1BQUA 1KJ2H 4V1DB 1M6OB 3QDGB 5LXGH 4DEPB 2P47B 3H42H 1T2QH 1KCUL 3LN9A 4G8FB 2FB4L 4JHZA 1A21A 4ZOCA 1BWWA 2MNUA 1CTNA 1LO4L 1ORSB 2ZKHH 3MUGA 5FDWA 2ZCHH 4ORZC 5IW6B 3MLYL 3VG0L 3U4AA 2HFFA 5K9QG 2Y7QA 4U1MB 3WS3A 3KLAA 5T3ZL 1XF5B 1RD6A 4N8CL 3RA7H 4OF5A 3INUL 4IEFB 4M48L 2VNCA 4OD1L 2UY7A 3HG1A 1TJHH 3F58L 1NSNH 1OTSC 3S3SA 1SJXA 3QUXD 4XBPA 2NW2A 2K1MA 4PJFE 1KJ2B 3LSOB 1CLZH 3W39B 1IGTA 5GGRY 2AXGA 2YA0A 3L6FB 4WW2B 1P7QD 1U8PB 2G5BB 3NCEB 2CIIB 1XF2B 1AH1A 1KJMA 2L4OA 4KAQL 3CX5K 4OQ1A 5KJRH 1XGUA 5LG1A 5DMGC 4Y5YC 5IBLC 1TDQA 3DRQA 3GMRA 5IMLB 4IS6A 2DQTH 4UT9L 1X5GA 4RMTA 4ALAH 3KLDA 5DRZA 4H8WL 4JG1L 1WAAE 3A67L 3LQMA 4FTVA 4NUGL 2D7MA 2BFVL 4NSKA 5DHYB 4K3DL 2BZDA 2O5XL 5TPWH 3JVGA 3B2UC 5HVHC 3GJEB 2AK4D 1INDH 3ZDYE 2A9MH 1INEL 2VISB 3D85B 5JOEA 5C0IB 1JMXA 4K3GA 4ZXBA 2X4SB 1GVIA 2LU4A 5DYOA 4NM4L 5EU6E 4A2LA 4NHCH 4OI7A 1EMTL 4ZFOB 4MXVF 3V52L 1RZ7L 1LE5B 1UADC 2YPVL 2MMXA 5GPRA 4M8QA 1WIPA 1AO7A 3I6LD 3J7HA 1TZGH 3ME0A 3WDJA 3CPLA 4F7PB 4C55A 3FB7B 1N7MH 2XWBA 1IT9L 4EUPH 3KYOA 2Q8AH 1J10A 3GMMB 3WO4C 1ND0A 2ESVD 4S1QL 4W6XB 1S7UB 2W0KA 5I71C 3AM8C 3EJYD 3HLAA 4PJ9A 3TCXA 1FVEA 3PL6B 2P5EE 4LLWA 1JYVA 3PQYA 5C07D 3DGGB 4D0BA 4AQOA 4EBQL 3QHTC 5HHVL 3OAZK 2CD0A 2PYFA 3JWOC 2QADD 3VGFA 2ICEA 3O6FD 3RWHA 3IVKA 2Y36H 1G7IA 3KDMA 4LHJB 5JR1H 3IDMB 4DQOH 4MAYD 3UPRA 4RWYL 5A43C 3P4MA 3P4OB 4Z0XB 4I2XE 1V3JA 2V9QA 2H8PB 5HXMA 3PGCB 4EUPB 1U8LB 4KK9C 3RPIA 4LCUB 2GSGA 3E0GA 2I27N 4TVPL 4LDLB 2B1HH 2GUOA 2I60H 1KLUA 2AI0L 2DKUA 4RISH 3PHSA 2JCCE 3UTSA 3MRNA 3CDGA 4AG4L 1CLOH 4HIEA 3MXWH 4NN6B 1JZ4A 4YHIB 2LAGB 4CRPA 1KPUA 1JPSL 2KH2B 3VDAA 1F02I 4GH7B 5FYLE 2X4PA 1T5WA 5A1AA 3MYZA 3BESR 4MJIB 2IPKB 3K2MC 1MEXH 1FLTX 4X4YB 5FYJL 1FDLL 4HFUH 1MRCL 5DFWH 3BISA 5AZ2L 3SKMB 5I76B 3CDCA 4Z18A 5IFAH 2PXYA 1JGUH 2GT9B 2VDOH 3L5JA 5FKPA 1CT8B 2IH1A 3DYMA 4Y5YB 1B4JH 5SX5H 2AKRB 3VXNA 1BM3L 4OLYH 1JNNH 4IIQC 1DQDL 3A6BL 1BVLB 1YECL 3K0WA 3GMPB 1OAKL 1YMMB 5GRZA 1UCBL 2A77H 4H1LA 1IQDA 3S36L 5HVHB 1VEMA 4AMKL 5F7NC 4IDJH 5D8JL 3NIGE 1D6VH 2R0ZH 3U36A 4ZUTB 3GO1H 3JWOH 2V7NA 1UACH 2NQCA 3DLQR 1JP5A 2ADGB 3ARFC 5JTWA 3WN5C 5ESQA 3OXSB 2DN7A 3JTSA 2YD4A 1CFTB 1ZHKB 3VWKD 1UWGL 3VMOA 3QXVA 1IC1A 3IAGC 1NBVL 1EV2E 4YX2H 1ED3B 3N06B 3MCKB 2ITCA 4Y4FC 5GJTH 2BVQB 4BSVB 3MLSH 5I0ZA 4FQCL 5I71B 3KHOA 4IRSC 3C6SA 2F8VA 4HH9A 5GSVB 3MRKA 5I1IH 1P1ZA 1BGXL 3L3GA 4HPYH 2OK0H 4X99B 4HKJA 1F3DH 4PRHE 5C08E 2HMIC 4U6XA 3UTTA 4GKSA 4K94L 2WANA 4DN4H 2IALA 2ZSVA 3BE1L 4LLQA 4Z7VB 1JWUB 1RIVL 2A1WH 2NZ9C 4LIQL 1L7TH 4GBXD 3BDXA 4NZTH 5ICYB 1UCTA 4URTB 2GJ6D 4EDWL 4AZ8A 4J2XA 2F58H 5FOBA 4G6FD 4HWBL 4OCMC 3WLWC 4R96A 1MHPL 2N56A 5GHWL 5F1SA 1JPFA 3WNOA 5E8EA 5JPMB 1UQSA 1CK0L 3DROB 3P9LA 2OX5A 1MCFA 1X5JA 2C5DC 5M94B 2G9HA 3NIFF 4JFYA 5J9PA 1V05A 3AGVA 4DGIH 4ZUVA 1RK1B 4CKVX 5DJ6A 4HULB 2PYEA 1FIGH 2DQEH 2Y6SD 3LKQB 3I6KA 4FG6D 4Z7OE 1KEGL 3GMQA 3OAUH 1UM6L 2XZAH 1RHHB 4FFYL 2GY5A 2PW1A 4B7IA 4P2RB 5CEXB 4PV8B 5BRZD 8FABB 4UAOC 3CUPB 1H3WM 1A2YB 1KPRA 1ZXQA 1FCCA 5JIIA 1WQVT 2Z91A 5DJ8A 2XN9B 1WWAX 5KS9E 3WXWH 5EA0H 3C2AL 3F8UB 1EPFA 4W68A 2YZ1A 2WWKO 4JO4H 3CC5B 3LEXA 1IGYB 3VRJB 1DUYB 3CZFA 2CLRB 4FFZL 4IIQB 2VABA 2A6JA 3LKPB 1OPGH 4WTZG 3BVNA 3QRFM 5ETUA 3K4AA 1RZKC 2ZNXA 3L3IB 1YY9D 4HIHA 3MLTA 4XP9H 5HHOD 4R0LA 3I85A 4GW5B 3F5WA 4PRPA 1A6WL 1KLGA 2C3WA 3QA3B 4PGBB 3C5SA 3WN5B 2BOCA 4A6YL 1Z9OA 4F2MA 2GYSA 2AEQH 5D5MB 1YA5A 4NBZB 1K2DB 2ZJSH 5C2BL 1YMHA 2X4NA 1KG0B 5J6GA 1ZT7A 5J12C 1TQBB 4R97C 1RFDH 2HFGL 5E03A 1QVOB 2EYTB 2VAJA 4IRSB 4FXLA 2NTFA 1MWAL 3G5XB 5T5FL 1T0MA 3X3GL 5D7IA 5EPMA 3CH8A 3I9GL 2P5WE 2XY2A 3MRGA 4PGJA 2Y06H 3LS4L 5JW4M 3WNPA 3QXWA 2XRAL 3V0AC 2AJUL 1F4XL 3A6CL 1G9MC 4NCDA 4PJ5D 4NKQB 3U2SB 4MS8C 2DS4A 2AJXH 2P8LA 3MRCA 2YS4A 2GKIA 5KSAD 5GGVY 4B50A 1D3CA 4JY6B 1OAYL 5I1KH 32C2B 1CYGA 1ORQA 3BKYH 3SGDH 4NQCA 1RJLA 1CXEA 3GRWL 3IU4L 1E27A 4JZOB 5HPOA 2OQJA 2YEZB 4X6CA 1X7QB 3IU3A 3F7YB 1EA9C 3KPRD 3RZWA 5C6TH 4MD0B 4XXDB 1KTLB 1CE6A 1RZKH 2D9CA 4G6JH 4JRYD 4Y4HC 4ZOBA 3ZKSD 2P5EB 4RAHA 2Q6WA 2BNUB 1MCWM 1HZHL 2Z93A 2J6EH 1ZKAA 5A2IH 3QUZD 2HA1A 4F7MB 4R7NA 1I3RB 3H0TB 5LGKA 3LCYA 2C3VB 5EU4A 3O41A 1GAFH 1U6AL 4PRAA 1NGQL 3C8DA 3HB3D 3MJ8A 5I8EA 5I1JL 4OBSA 1OB1A 4GQ9L 4I2XB 2X7LB 2DWDB 3THML 3BQUC 3FJTA 4X6CF 2MHAA 4JPIB 4OF6A 5JLZA 5FHBH 4AENA 1Y18A 1QBBA 4RX4D 4LKXA 5EH1A 3VXQB 3UZQA 1Q9KB 1YEIL 4EOWL 4M7JL 4ZQKB 3N1MC 1FH5H 3HMXA 2YRZA 1MELA 1G9MH 2JCCB 5DQJB 4JJ5B 5E2WL 1ZOXA 3QIBC 1QR1B 4M02A 3MBEB 5BXFB 1DBKH 3OJMB 2ITDA 5B22A 1E4WH 5I30H 1SYVA 3WHXB 3CDFA 4WUUE 3BT2H 1CF8L 4RMSA 5DFVD 1CGUA 4Y19E 3ARBB 5J12B 1MUJB 4DCQA 4ZO6A 4BFGA 1KBGH 4KXZI 3RHWF 2CJUL 3PXHA 4NO3B 2QBWA 4L4VB 4YR6A 2BHYA 1S7QB 3QO0A 2Z8SA 1A1NB 1YQVH 1T83A 5I1CL 2B2XL 3B9AA 2E27L 1BFOA 4Z7UE 5IG7B 2OR8A 1DEEA 1G6RL 3F12A 5DMKB 3W9DA 2RAMA 3FFCB 4LSSH 5FECB 3QXTA 1NBYB 4AT6A 3TNMB 1DLHB 4DAGL 1MHHA 4ETYA 4NQTA 4PG2C 3QJHA 1JRHL 3STZB 3C9NA 3UPAA 1NGWA 2EEAA 2DYPB 4LP4A 3L5XL 4I9WD 4MWFB 5LCVL 2NY5C 4OUUA 1FP5A 1P2CA 1NANI 5C0ND 3STLB 1CLYL 2CUHA 1M05B 3F7RA 1OHQA 5HHQA 4EN3A 3KPTA 5GGQH 4Y4HB 2B1AL 5MEPA 1CG9A 3MOQA 4EKXA 1IL1B 5IVXB 3ALPA 4OZIA 4RDQG 3WFEL 1F6AA 1I1AD 3QUYD 5D1XC 3STBA 3B5GA 5D7KD 1I9JL 3SDXE 3EZ8A 3BSZH 4MJ5A 4C54A 4P2YA 4Q6IC 2R8SH 2XWTA 3D18A 1J88A 5D6CB 4ODBD 4LLMA 3IDXH 1T1ZB 3GMOB 1YPZE 3DX7A 2KQMA 3BQUB 3QXDA 4U1NA 4XHQA 5JORB 1KC5H 1XCTA 5FM5M 2X4QA 4X98B 1KENL 3ARGD 2VDLL 3MRLB 4WO4D 4PP1D 5SWZB 1S8DB 2EEBA 3HRZB 1AJ7L 4ZD3L 2YXFA 3UDWA 3BP6A 3V8CA 2ZUXA 2HRPH 1LD9B 4KU1A 4V1DD 1EIBA 3QDGD 4NJ9L 4L3CB 5BZDA 1AGBA 4KVNH 1AD9A 3TPKA 3QIBB 4TSBL 1U0QA 3REVB 1ADQH 4XPGH 3DVGA 4G8GA 4JKWA 2DQHH 3TBSA 4EI6A 2XYCA 1K5NB 3BDYL 4Q9CA 2Y5EA 2BVUA 4YDIL 1JUFB 4LPWA 3RTQD 3SE4C 4WCYH 3SKOB 4ZPVB 4ZTOH 2ERJC 3O11A 4JN1H 4RGOH 3O3BA 1F4HA 2B4CC 2NY5H 3U4BH 3QHFL 4PJBE 4MB3A 1YEEL 2VDKL 1I85A 4X0KA 5J56B 1QSFD 3PV6B 1GOGA 3MUZ1 4S0SD 2VLMD 4M4PA 3H6JA 3LY6A 3H9SA 3W0WA 4M5ZL 3BD3A 1I9IL 4BH7B 1AE6H 4N5EC 4O2CA 2QQLH 4Z7OF 1TJIL 5DJDA 2VDNL 1JGDA 2DI8A 4FQQB 3PIQB 1WVZA 1QSVA 3GSVA 5J1AA 3HS0B 4PRNB 5HSFA 1QRNE 1JZ8A 1M7DA 3D85D 4JY5L 3P73B 1J0HA 3X3FL 2FR4A 1IAOB 2OJZL 1GGYA 5CJBA 4WV1C 4LK4A 4KK5D 4L4TA 5C0CD 1A6ZA 3HMWH 4DVBA 5E9DE 5TDPB 3T4AA 3QQ9D 2IPUK 1BPVA 1Z3GH 5I73C 12E8H 3K8KA 4ZFZB 4RMRA 5HPMB 3PWNA 3V6FA 3VE0A 4JFEB 1KFAH 4Y5XC 2WW8A 2C4FU 3TYGL 3IF1A 3KXFA 3MLXL 5CP3A 3UTQB 2OSLA 2RGSA 3RDTA 4GW4A 2Q86B 1I8LC 3FO2B 2DLTA 1CE1H 4LCWB 5EO0B 4F9LC 4OF3A 1T1YA 3WUWB 4TPRH 1FYTB 1AC0A 2IADA 4PJ7E 5JHLH 1C8PA 4GMSL 3K4DA 2CR6A 3L9RA 4JLRA 2OM5A 3CD4A 5IFJB 5FM5O 3DYOA 2J8OA 4HWZB 1IAIM 2B4CH 4PRBB 2E7HA 2HT2D 1NLDL 3FB5B 4Y1AA 4O4YH 1JFQL 2JKXA 4ONFL 2K7QA 4JRWA 3MO1A 3QNXA 4NFCA 3O2VH 3VXTA 4P3CH 4X4XB 5LBSL 1LDPL 2VXSH 4LLYA 5DJZA 2VC2L 3HFML 4G9FE 1MJJB 4EIGB 2VMFA 1ODAA 2FWOB 5GGUA 4XCFH 2PCPA 4EJ1C 4X9HA 2WINA 1LHZA 4JE4B 4J4PC 5H35A 2X4TA 2XZQH 1LE9B 3GSOA 1H3TA 2C3GA 3GSRA 2ERJB 1CZ8H 3WUWG 1S7VA 4YHZL 5DUBA 4ISVB 4WEMB 1JNHB 3K2UL 2Z92B 4OCXH 3SY0A 4C56A 2OZ4L 4MJID 1K8IA 3MUJA 1LP9E 4XI5C 3TH4T 5KG9B 3FRUB 3EFDH 4E0RB 1L0XA 3AS2A 4GW1A 3VI3E 2V2XB 5EIQA 3SJVD 5IVZB 1G7JA 1A0QH 2G2RB 4FFVC 3IJSB 3T1FA 1S7WB 4A2MA 3VGGA 2NXYD 5IKCA 1YMMD 3PWUA 3I50L 4G6KH 5ILTL 5I1HH 4JGJA 1DN2A 2JK5B 4WGWB 3RWIB 1MHCA 3MGTA 1LO5B 4PJIE 1HYRC 3ZYOA 2JJSA 2VZTA 3OKMA 5IQ7L 3GSNA 1TXKA 2NX5B 3MLVH 4H5SB 4WV1B 3FB8A 4JQVA 5ICXB 1AI1L 3SKJL 1OTTD 4HAFA 1P5UA 4Y2OA 3I02A 4ZFGH 3W81A 5DEGA 3IFOA 4ZAKC 1PAMA 3ULVC 4Y5XB 2FH6A 2YC1B 5KW9H 4F7EA 1C1EL 5TE7H 1DVFA 2BXZA 1MH5B 4BKLB 4Z7UB 1NKRA 4R26L 4P46B 1Q1JH 2AABL 3G08A 4OB5H 2VITB 3TJHD 3R1GL 4XP4H 5D1ZA 25C8L 3MNWA 2B7DT 5A2KH 3OR7A 1Y6MR 4YE4H 4QHNB 1AD0B 4K23H 2VSDA 1HCVA 5IWLC 4PRIB 5K9JH 2NXZC 4NRYB 1CGVA 2D7NA 1OAXL 1T21A 5ESAA 5C3LD 1XGTB 5CUSH 2F19H 4XP1H 5DFTA 5I1EH 3S97C 4YHLH 3R4DA 1A5FH 4OI9A 2VLJE 3C08L 4M7KH 4NKDB 1JL8A 1T89A 4G9DB 1R3HA 1D6EB 2HJLA 1I7RB 1JRHI 2VQUA 1NMBH 2BX5A 4OM0H 1G0DA 2GAZA 3OB0K 4YDVA 5IB5B 3SDXB 4ERSH 5CP7A 3QIUC 1G7MA 5EU3B 1XF4A 3IXTA 1B9ZA 2EIBA 5FIEA 2CQVA 3LHPH 3MGOA 5D1QC 1F2XK 2EE6A 2VZSA 4ZNCD 4LCYB 3TWCL 4HWNA 4WU5A 4NNPL 2J4WL 3HI6H 4OGYH 3MRQB 4X8JB 3CFJA 4HF5H 4WW1B 2C4FT 3VXMA 4WWKA 1MREL 3V6OC 3HE6A 5HYSB 3ULVH 1NCTA 3S88L 2HT3D 3FQXA 4KROC 5I16B 1L9MA 5MEOA 5I17A 4P5KB 1R3IH 3MV8E 3D39E 3F7PC 5JXED 1OAUH 3EYFA 2BMKB 1IILE 2YR3A 4OLZH 4Y89A 3REWB 1UB6B 1RZIB 3UAJD 1T4KB 4PJEA 4R4BA 3NFSH 4PGEA 2X70A 5JUEH 3RWEA 5EU5A 5C0GB 2XOTA 1TNMA 3MLUH 1YPZF 5EZLB 2OTWB 2I9TB 1F3JA 3LVEA 4AIZB 4ENEC 4JFPB 1JE6A 5EORL 1JN6A 2E6QA 4LLVB 4U7MA 5IB1A 3TT1L 3UJJH 1BIHA 2M8XA 4ZAKB 1DBML 4GKNA 4KQ3L 1RUMH 2WBJC 2QL1A 3M17A 5E95B 2DM2A 1ZHBB 1YY8A 5I1GL 1KB5H 5CBAB 3KWWA 5HYSG 2ZUYA 4XNXH 1PSKL 2ARJB 4IRSD 3U0WH 4XVTH 3MLZL 1BVKA 1YEFH 5T33L 3VH8B 5L2JA 4DVRL 1GGCL 2LTQB 4HCRH 5DI8B 1VEPA 4QWWC 2NXZB 1EERB 2HMID 3T3ME 4OT1H 4UV7L 2DLFH 5HYJA 3IDNA 5E1AA 3DMMB 3TN0C 4N0CD 2O5YH 3JV6B 3VFNA 1T3FB 3O9WC 3ABZA 1CD9B 1D7FA 2H26A 1IC7L 2DL2A 1HINL 1GC1L 2VZ1A 5DQDL 43C9B 3VJ6B 1KB5B 4OZHB 3Q1SH 2XPGB 4MHHI 3IJHA 1E4XH 3GMNA 1CGTA 5GJSH 3TIDB 1YEGL 4XB8A 3C60D 4ZPTA 1HXMB 4PIRF 3T2OA 3SE3C 4X7EC 2UZIL 1X3DA 4TNVF 1EXUB 3RVTD 2ZPKH 3BP7B 4HXAH 5DK2A 1XGYL 1BFSA 5ICZA 1B0GA 3QIUB 2R0KH 2FZ3B 3GMLA 5DUPH 1BQLH 4CVXB 3FB6A 5HYQB 1CS6A 4NKMB 2P5ED 3KYAA 3D69A 3TA3D 2EDJA 3SDCA 5D1QB 4OTXH 2YPKA 1FG2A 5MERA 5IBTL 3B4NA 4G3YH 1FAIH 4ODHH 2BRRH 3L1OH 4WY7L 5ITBL 1LNUB 4E5XB 3M07A 4PJCA 1VESA 1QA9A 4OAWB 4RNRA 3AREA 4CMMB 2A6KB 1R6VA 4KMLB 4KI5C 4LP5A 2NY4D 3MV11 1T7VA 5L88L 4F8TA 1WCBB 3EYOB 3TBYB 4CN4A 2LU7A 3H9HA 3SN6N 2X4RB 1IKNA 3MYJB 3ZKMD 1RURL 3WS6A 4XCCH 4YHYC 4M7LT 3H9ZA 3JVGC 4QRSA 4K8RD 4FZEL 1JI2A 1EAPA 5FUZL 2MKWA 1B90A 3QISA 3FO1B 3H7LA 4X9IA 4ZXBC 5ADPH 3BYTA 1UEMA 4XPFH 1O7SA 2GTWB 5EUKB 3MBED 1VFAA 4G6AD 4RBPK 3MR9A 1NGXB 2VJXA 2WBJB 3DXAB 5ANMB 3UTPE 1SVZA 2VL4A 3ARBD 5FYLD 3S5LB 2FRGP 4IRZH 3HR5B 5B8CA 1GGUA 1LP9B 4D9QE 1Z2KA 4ELME 2AW2A 2BSTA 4FP8L 3DVNB 5JQ6H 5B4MC 4FQ1L 1J1PH 5SX4H 3ALXA 5E2TL 4F33B 4JREB 1IQWL 4LSVL 1QFWL 1N59A 5KVGH 3QSKB 4NRXB 4PJ9C 2HJFA 2R4SL 4NZRH 5HHXL 5CEZE 2FJHA 1AKJB 3OZ9H 1ZT1A 4NC0B 4S0TD 4OKVB 4WDIB 4UQ3A 3SE8H 3TN0B 3ZDZF 2CIKA 4JFDA 3FFCD 4XC3L 5JO5B 3O9WB 4F9PA 2NY2B 3QCVH 5EC1A 3QXAB 3RRQA 5I0DA 1M71B 1WZLA 4LU5L 4HWBA 5IV2A 1S9XA 4POZC 4U05A 3MOAH 2VOTA 2DYPD 1ES0A 4XWOD 3CK0H 4H20L 1G1YA 4UDTA 3EYSL 5F71A 3S5LG 4YZFE 5DEFA 1HIMH 5IROA 5FDWB 3MUGB 4LEOA 4DKFL 2DM3A 4NQSA 4QRRA 4AEHH 4PRPE 3BO8A 2HFFB 4XGZA 1FNAA 2Y7QB 3WS3B 3P4NA 3KLAB 4Y4HD 5I75C 3LEYL 3ZKXC 3HG1B 4LSQH 2VTFA 5FYKH 1J18A 1H3UA 3UTOA 3KHQA 2CSPA 4XBPB 2NW2B 2DRUA 1NFDA 4JVWA 5LQBL 3TJEH 5SWQA 1IGTB 2AXGB 4OIAA 5EULV 3OKLA 4NIKB 1RU9H 3S9DB 3T0DA 1AGDA 4QRQA 1KJMB 3GK8L 3C5JA 3BQUD 3WKNA 2PXYC 3ROLA 1XGUB 1QNZH 4XXCC 3TVMA 3LH2H 4LARL 1MJ8H 1NGPH 5HDLA 3DRQB 1QEWA 3GMRB 4XTRC 4IS6B 2EIDA 3OL2A 5ALBH 3MCLL 4LSPH 4R6UA 1WZMA 5C0BA 1HYSC 5ACZA 3VXSE 2QEJA 4FTVB 2R1WA 5SWZD 4NSKB 4G5ZH 5FB8A 5D7SL 5EU7C 3OKKA 4IOIA 4A6YA 3O6ML 4XNUL 1IAIL 4ZXBB 5DYOB 1NFDF 2R2BA 5CJQH 2FHBA 3G5ZA 2P24A 3JXAA 3RGVA 5IOPA 5L2KE 1KELH 1D5ZA 4M8QB 2HKHH 1J0YA 1AO7B 3CMOL 3GI8H 3CPLB 1DE4A 2XWBB 1MWAA 3KYOB 4LVNC 2B0SH 3GUTA 1ND0B 2YUVA 3U83A 5HHMB 4FQ2H 3PG2A 2E7LA 4P9ML 4PJ9B 3HLAB 4KJQC 4LLWB 3PQYB 1YJDC 4D0BB 3ZYIA 3HNVL 2PYFB 4YXHH 3CSBA 3EDKA 2VDQL 4IMLA 2ICEB 3RWHB 3IVKB 1G7IB 3RWFA 4HMCA 3HC0A 3KDMB 4CU8A 3UPRB 1HILA 3P4MB 3TC9A 4AEIH 5LGJA 1D5IL 4NGHL 4FFWC 4KUCD 3UZEA 3PHOA 5IR1A 1T1WA 4XMKL 4NBXB 3GRWA 4DN3H 4HJGA 2H45A 4XWGL 3RPIB 2EDEA 2RR3A 4JFFA 2GSGB 2DD8H 4YBHA 1B0RA 1S9WA 3MRPA 3PWLA 3FZUC 1UWXK 1QTYT 1KLUB 2NW3A 4HWUA 1FFRA 1MFEH 3UTSB 1IGML 3MRNB 4RFEA 3CDGB 3FL7A 4HIEB 4OF8A 1T03L 4MNGA 3ZKXB 5E6IC 4H1LH 3WNLA 1GPOH 4LL9A 3RFZC 1B3JA 43CAA 2P5WD 4U2YA 1KPUB 4ZUSA 1CGWA 2X4PB 4UT6L 1T5WB 5FK9A 1ZAGA 3ULUE 1PD6A 1MFAL 1CWVA 1FL3A 3JUYA 3SPVA 3HC4H 4LAQL 3QDHA 3VRLE 1AIFA 1FYTD 1S7SA 2PXYB 3WE6A 1WLHA 5FKPB 1VPOH 3EYQD 1T7XA 2IH1B 4KRMB 2BNQE 3VXNB 4HXBH 4I0CC 2BY2A 2EDNA 1OARL 5E8DL 4YUEL 3BDBA 4EIZC 3ARUA 1PY4A 4H1LB 1IQDB 4Y5VC 2ID5A 4YK4B 3LD8C 4YHOH 3ILQC 1A9EA 3IFPA 4R0LC 1LO3L 1ZGLM 4XP5L 1YJDH 4JDVA 3U36B 5DVNA 2W9EH 3MJ9L 3T3MF 4JB9H 3SOBH 4JO1L 3MACL 2EEDA 2FNBA 5ESQB 3UYPA 2OBGA 3JTSB 3ESVF 1BEYL 4JN2A 3JV5A 5BVPL 4P2CG 4F57H 4Q9QL 4P23A 4C58B 1WK0A 4LPCA 3MMEA 3O2DA 4EZMA 4QO1A 1R24A 3W2DL 2ITCB 1CIDA 4D8PA 5TGBA 1C5CL 4TYUA 3C6SB 3NABH 4HH9B 4OZIE 3D6GA 2HFTA 3MRKB 3WXVH 1P1ZB 1G6RA 3L3GB 5KVEH 4KMTH 4HKJB 4YPGA 1MIMH 1AHWA 2P49B 1K6QH 2Q1EA 4H1LG 2J7LA 4GSDL 4HIIA 4XVJL 4XAWH 3UTTB 4GKSB 5EIVA 2IALB 2IANA 2ZSVB 4HC1L 4LLQB 4P4KD 1RULH 5CEZH 1MCBA 4GJTB 1N6QL 5GISH 1C12A 1P4IL 5FCSH 1A22B 1U95A 4IMKA 4FABL 1U8IA 2UY6A 3IS1X 2MPAH 3O6KH 5C09A 5FOBB 3RUGE 4QOKA 1U2CA 4S1DD 4R96B 5DK0A 2Z8WC 1JPFB 5E8EB 2NX5D 2ZUWA 3N1FC 1UQSB 2WBKA 5AUMA 3P9LB 2G9HB 4JFYB 3GBMH 5J9PB 3ZYJA 1CN4A 4HDIA 4XC1L 1OSZA 4ZUVB 5T1LA 5FO8B 1AP2B 4C4KT 4D3CH 4BJLA 5DJ6B 2EH7H 1HKLL 1U2HA 2PYEB 4G8GE 35C8H 3L5WA 1FCGA 1X5HA 4PJAA 1QFPA 2IBZY 3RIFK 4DKAA 3I6KB 3SQOL 5DJAA 3GMQB 3KS0H 4F58H 4P46D 2PW1B 4FQXA 3LPWA 3RWGA 1MPAH 3VDCA 1KPRB 1FFPA 4MCZA 2Z91B 4UILL 5DJ8B 4DK6A 4K7FA 1BJ1J 1WFNA 2NPLX 4OLEA 1HK6A 1G7LA 3U79A 4K2UH 5BS0E 3LEXB 4LKCA 1QFWI 4KC3B 3CZFB 1DSFL 2LV4A 2VABB 5ALCL 1NCAH 4ELMF 1AXIB 2WZPD 2A6JB 2XKNA 5F70A 3BVNB 2FJFA 4HS3A 5ETUB 2E7BA 1PLGH 3H9SE 3IFNH 4HIHB 3MLTB 3VD5A 4R0LB 4OLUL 3F5WB 4PRPB 5DJXA 1KLGB 5DD1H 3HZKA 1A3RH 1WWCA 1XGQA 3C5SB 2BOCB 1AXTL 3AY4A 4F2MB 1UWXH 5FEBA 3QPQC 4LQFL 3TP4A 3C8HA 2MJWA 2IBZX 5I1AB 1UM4L 1YMHB 2HTLD 4PS4H 2X4NB 4UBDD 3PNWA 5EWIH 2Q7YA 1FFQA 2W0LA 5J6GB 4NZUL 1ZT7B 3K80A 1N5AA 3P0YH 3MJ6A 5F9WB 2QHRH 5IIEA 1TCRA 2NTFB 1T0MB 5D7IB 2D0FA 5EPMB 3NA9H 1IEBA 1J05A 2HWZH 5IUSA 2X9XA 3MRGB 1T83C 3KXFE 4RQQA 4Z0BL 4F7CA 4G7YH 1UKSA 3IKCA 4XBEL 2VO5A 2XQYK 3VW3L 3VFVA 5B38A 4JFQA 2P8LB 3MRCB 3BPLB 2JLLA 2GFBA 4JG0L 1RJYA 4KHTH 3DWTA 4RMWA 5DO2D 4HWEH 2O5ZL 5IEKA 1ORQB 2A0LC 4MA1B 2G60L 4NQCB 4PJ8A 1FFNA 1RJLB 1A7QL 4K3EH 2AQ2A 1E27B 2Z31A 2HG5A 4G8IA 2OQJB 1NCDL 4X6CB 3DI3B 3S6CA 3IT8D 3M1BA 5F89A 3VXRA 4DW2H 3IU3B 1A64A 1G7PA 4MQTB 1DR9A 1IAII 3ULVD 4ONHA 3BP5A 2R69L 5EBLA 1CE6B 3DO7A 3O0RH 2BY3A 5I66A 2YUWA 2Q6WB 2AJVH 2EZ0D 4TUKL 2DQGH 4YDKL 5C1MB 3HMXH 1XMWA 2Z93B 4Y4KC 4KKLD 5DJYA 3FOLA 4R7NB 5L9DH 2RBLA 3EYVA 5EU4B 3O41B 1DLFL 1W72L 3CMGA 4PRAB 1N3NA 3KR3H 1ZANH 3MJ8B 5I8EB 5TH2A 1KCVL 2NXZD 3FMGL 4UTAL 1OB1B 2UV3A 4ZO7A 3I2CL 1A6UL 1T6VN 3DMMD 2MHAB 4MVBD 2AJYL 4LRNH 5JLZB 4AENB 5D7LA 1Y18B 3VXUA 4UT7L 5CCKH 4LKXB 2XZCL 1G9NC 2WP3T 1OWRM 4CJ0A 3UDWC 1CVRA 2A74A 4KZDH 4XVSH 1EHLL 4YO0A 4FQLL 3PABA 3U82B 4KGJA 1CIUA 4HJ0D 1QLEH 1I8KA 2EDXA 2VZ3A 2MQ3A 3E6FA 4P57A 3S3JA 5F6HJ 2BJMH 2F5BH 3QI9A 2ITDB 1CGYA 4G7VH 3QIUD 4UTBH 1IAMA 4DCQB 2DWEA 1CGSL 5HVWA 2C7UA 5F7FA 1J0KA 5D1QD 2OZ4A 4YR6B 5CJ8A 4OM1L 1MFBL 4GT7A 2X4OA 2PKDA 5E7BA 3S37H 3QO0B 3GI9L 3EDDA 4OGAD 2SEBA 1I85C 3VFGL 1BFOB 4PY7A 2VDRH 2R29H 1NEZA 1DEEB 1W8OA 5JW4Q 3F12B 1BD2A 3W9DB 4AYFA 4OLVL 1OSPH 1KB9J 4JFZL 1MHHB 4QHMA 1IC4H 4K3HA 3QJHB 1RZFL 2DI7A 2WQ8A 1HHJA 3VGBA 3BPCA 3C9NB 2KKQA 1J5OH 1C5BL 3E3QE 1NGWB 4G9FD 2DQUH 4Y2DA 3VRLF 3IFLH 4P9HC 5AYUH 4OUUB 1I3GH 1P2CB 3DVIA 1C7SA 2W0PA 1VGEL 5DUMH 5DJCA 4G43A 1JNLH 5HHQB 4EN3B 1OAZL 3L3KA 1TMCB 5MEPB 1CG9B 3IXAA 4HJJH 1G9NH 3P0VL 4RGMC 4TULH 5F6IC 4OZIB 1F6AB 1NLBH 1IGFL 4MA7L 4MNHA 1EFXA 5CZKA 3FAWA 1IE5A 4MJ5B 3LAFA 2XWTB 1JHLL 4OIBA 3D18B 4HQQH 3PGFL 1IMHC 4ZODA 3UJIH 4LLMB 1QKZL 1RI8A 1AKJD 1EEUA 3MJGX 1ZMYA 1NAKH 3DX7B 3FT3A 3GHEL 3QXDB 4U1NB 4PUBL 3TN0D 4WU7A 4X7CC 2ADJA 1XCTB 5AWNL 4RMVA 3TBTA 1E6JL 2EDWA 2X4QB 2NY2D 3QZWA 3D0LA 4OFYA 4X6FA 4WHTA 1KXQE 3BP6B 1M7XA 3L7EA 3PP4H 3SKNA 4X7FC 5BZDB 1AGBB 1SBSH 3E1F1 3KG5A 2AK1H 1AD9B 5HVGB 3DVGB 4G8GB 4OLWL 4K3JH 2CRMA 1HN1A 3TBSB 4EI6B 2MQ0A 2DI9A 4XMLL 1X5KA 3S7GA 3WO3B 5K59F 2VDPL 4LLUA 4DUXA 3GSXA 4PTUA 2VZOA 1LK2A 3O11B 5AEAA 3RUGF 4YXKH 4P9HH 3DRTA 3O3BB 1QLFA 4J6RH 1QBLL 1E4JA 4X0KB 2FJGA 2IGFH 2EO1A 4G6MH 3VDBA 3JZ7A 1KJ3H 2GJZA 4KI5D 3H9SB 1QFUL 3W0WB 4B0MM 5CWSA 5BOPA 2Y9RT 4QEGA 2DQCH 3MV7A 3QEQE 3LIZL 5K9OA 4O2CB 4UOW1 5FUCC 4N8VG 5CP3H 1JYNA 5DJDB 1JGDB 3MZGB 5FA3A 1FHGA 3GSVB 3HAEA 5J1AB 3N50A 4M9PA 1T5XA 3ARTA 1TENA 3QWRD 1M7DB 2HYMA 2R0WH 4NNYA 5E00A 2JJSC 2FR4B 2OI9B 2NY3B 1FRGL 2CMRL 5DTFB 1U3HC 1T2XA 4L4TB 1A6ZB 4DVBB 1AY1L 4U0RC 2VISA 3T4AB 1KIQA 4QXTA 5B39A 1AO7D 5F6IB 2Q8BL 4NUJB 3PWNB 4KH2A 3V6FB 4WFFD 3VE0B 1OF2A 5ACLA 1UWEH 3S35H 1DVFC 3KXFB 4YC2C 3QCUL 2F54E 2OSLB 1ZTXL 3RDTB 4GW4B 4Y16D 4U6VL 4F15C 1Q0XH 5D1ZC 1J8HA 4PJ9D 3TT3H 2N1KA 3FB7A 5JXAL 3G6JA 4HKXA 1T1YB 4O58H 3D39D 5HI3D 4KY1L 4OZFA 1YNLH 5JMRA 5DC4B 4O02H 3SCMA 2IADB 1AQDA 4OLXH 2YD3A 1X5LA 4I0PA 3BFOA 3L9RB 4JLRB 4Y8DC 4YDLB 1IAKA 2OR9H 2OP4H 1U8NA 1KEMH 4HW6A 2KUTA 5F9JA 1JVKA 1TVDA 1KCRL 4Y1AB 3QT2A 4NQEE 4XNMA 2CLVA 2OS7A 5D71L 1PKQA 3MO1B 4ZSOA 3QNXB 1A9BA 1T89C 3VXTB 4HBQA 4P59L 4LLYB 5DJZB 4GAJH 5DDHA 3KPNA 1J1XH 3PWPA 3OQ3B 5CZVL 3W5NA 5DVOA 2HT4C 5GGUB 2PCPB 1LK3H 2HN7A 2V5SA 1EUUA 2WINB 3UTSD 2WUCH 2UZYB 5H35B 1KF9B 2X4TB 1D5BA 4LEXH 5AD0A 3WSQH 3GSRB 1RIHH 3O4LE 1WEJH 4QTIL 1HWHB 1S7VB 5DUBB 1JZ7A 3Q48A 2ICWJ 1CD8A 2XG4A 3FKUS 4B53A 4QNPE 4BM7A 1DN0A 2BVYA 5KAQG 4JFOA 3SY0B 4C56B 1JGLH 1YYMH 1EZVY 3GSNH 3B43A 4PYHA 1K8IB 8CGTA 3T2PA 5ADOL 3V4PH 4Q6YA 3T0WA 4GW1B 3HE7A 1V3MA 1G7JB 2D03L 3QG7L 1IKFL 5GS1A 4XTRD 4H8WC 5C3TA 2D7TH 4HBCL 5BMFH 4W6WB 3OKNA 3EFFA 5IKCB 2I5YL 3T2NL 1OCWH 7FABH 1I1FA 2KQNA 1FNGA 3PWUB 4LVOB 1BIIA 1N5YH 1NCBH 3IDYC 5CSGA 5J0BA 1CU4L 4LNRA 1MHCB 3MGTB 1UA6H 3KAAA 3OKMB 2FX8L 3GSNB 4KJWC 3OV6A 3QIWD 4HS6A 1HHIA 3FB8B 3O4OC 2ENYA 5AZEL 4FZ8H 3QQ3A 4U0RB 3DJ9A 3I02B 5JW5A 4JFXA 1JHKL 1FN4A 5DEGB 3IFOB 4PTTA 1FV1A 2MFNA 2ADGA 4F7EB 4HPOL 3D3VE 1KCUH 1DVFB 4YC2B 2FB4H 2D7PA 1EZVX 5HGGS 5IMOA 4D2NA 1LO4H 3G08B 4F15B 3V5HA 2YK1L 2YRLA 5B3JF 1PY9A 3MLYH 4I3SL 5D1ZB 3VG0H 3MNWB 1UZ6E 4XCEA 4NDMA 3OR7B 3AS0A 5T3ZH 4S1SL 4N8CH 5GSRA 1Q94A 4BSVA 3INUH 4M48H 3T8XA 4OD1H 4U1SA 4M7LL 3AM8A 5I8KL 1HDMA 1SEBA 3F58H 1NC4A 1T21B 1NQBA 5ESAB 2FGZA 2WK2A 2OXGA 1H3PL 2E8ZA 4UNUA 4C4KO 4Y0GA 4WHDA 3BUYA 1MCQA 3TO4C 5DD0L 4KAQH 1JZ2A 1R3HB 2HJLB 2YMXH 1V3KA 3UTPD 4UT9H 3VD7A 3VD3A 4H8WH 4Q0XL 5D9SA 4JG1H 2GAZB 2JF1A 3A67H 5KVFL 4D9QD 4NUGH 4YDVB 2BFVH 1HH9A 3F6IA 4K3DH 2O5XH 1YC8A 2WBWB 1IGIL 1LGVA 5CP7B 4E41A 1G7MB 1INEH 1XF4B 1N8ZA 2H2PC 3IXTB 1QACA 5CEZD 2IAMA 4YPJA 4NM4H 3MGOB 1EMTH 3EDEA 4GO6B 3V52H 4PJHA 1RZ7H 3MPCA 4XPHL 2YPVH 4WU5B 2FBOJ 4NQXA 4QHKJ 3LKQA 2ZZUT 4J3SA 5JZ7D 3CFJB 1SYSA 2FCBA 3VXMB 4DTGL 4WWKB 1U3JA 1CICA 3HE6B 3I6LE 1IT9H 2I24N 3FQXB 3AREC 2UZXB 1KN2L 2VQ1B 5I17B 5MEOB 1MNUL 2WWMC 5LAXA 4S1QH 1REIA 3EYFB 3ET9F 2ESVE 4ZUWA 3MBXL 5LXGL 1IKNC 2WV3A 4PJEB 4R4BB 4PD4K 5DLML 4F7TB 1ITBB 2CK0L 2L7JA 2VLLA 4PGEB 3WS6C 3IDYB 4EBQH 2F9BT 2A6IA 2X70B 3RWEB 2W9LA 4PRPD 5CGYC 3GBNL 5HI4C 1S78C 5EU5B 3BH8A 4PJHF 5DA0B 1P69B 1F3JB 2PN5A 3TCLA 3N1QC 2OCFD 3O4OB 5J11C 3D48R 4RWYH 1JN6B 5IB1B 3HA0A 1F97A 4BZ2L 2BNRA 4PJDA 2XA3A 4GKNB 5IFHL 1ZT4A 4JFFE 1GZPA 1BX2A 3LS5L 2FDBP 3ARFA 3M17B 1KNOA 1KXVC 3R8BB 1YY8B 1JIBA 1DBJL 4KKBC 4M1GL 3VG9C 2EDLA 4KXZH 3KWWB 4TVPH 5FDYA 1KG0A 3WFCL 1BVKB 4YHKH 3LMJL 3BMWA 3RU8L 5L2JB 2AI0H 1P7KB 1I7TA 4Y4FA 2NYYC 3VGAC 3MV9E 4HLZH 4WNQA 1YNKL 3ZE2E 4AG4H 5MHSE 5IT2L 2AJZA 5ITFA 3VXSD 2PNDA 5HYJB 2K7PA 3IDNB 5E1AB 1JPSH 2PR4L 1U8KA 1GHFL 3VFNB 4PJDF 1H15A 4F9PC 3DBXA 3TV3L 4DOHE 1XIWC 2H26B 1JNJA 1YEHL 5FYJH 1FDLH 1MRCH 5AZ2H 3N9GL 4UINL 4HUMB 5I15L 5FF6A 1FNFA 4KZEL 3U2SA 3IJHB 2QV2A 3GMNB 4NQCD 5BW7C 2VH5L 4AL8L 1EK3A 1BM3H 1CFQA 3AMLA 1KCLA 4RA0C 2H1PL 4ZPTB 3TESA 1DQDH 3A6BH 1YECH 2V17L 2VSCA 1TZHA 1OAKH 3O8XA 1UCBH 1OQOA 2W92A 5DK2B 3S36H 1NGYA 5CBEA 5ICZB 4AMKH 1B0GB 5D8JH 3GMLB 2YRPA 2HVJA 4IOFD 4I1NB 2EDTA 3Q3GA 3FB6B 3V2AR 4JPWL 3GNML 3D69B 4NCC1 3EDJA 3SDCB 3HKFA 2YPKB 2DJUA 1XR8A 1FG2B 1HQ4A 5MERB 2DQJL 4GAYA 4P5TC 1MCPL 4GS7C 3RP1A 1UWGH 3NACL 3FQTA 4PJCB 2F8OA 2DQIL 4X80L 5KSBE 1ZVSA 5J1TC 1NBVH 4RNRB 3AREB 4ZOAA 2JIXA 5F9OL 4LPYA 3TVMC 5I19L 4FQCH 1VKXA 2VWEE 4YFLI 1FAKT 1BGXH 2LQRA 4Z7NE 1EAJA 2P8PB 4HLZG 1MSPA 3MJ9A 1EAPB 1BOYA 2M2DA 3CXHK 4K94H 3BE1H 2LVEA 4PYGA 5J11B 1OGAA 1RIVH 4LIQH 2LAAA 2X6MA 3RGVC 2J3SA 1VFAB 3MODL 5FO7A 3G6AA 4EDWH 3MR9B 4O2FA 1F11A 3OHXA 2J6EA 5DQJA 2GJ6E 4JJ5A 4JO2L 1WZ1L 5B8CB 4HWBH 3ULUD 3VG9B 1MHPH 1Q38A 4RGNE 5GHWH 3UBXG 5MEQA 4JDZA 2BSTB 4D0CA 1CK0H 1IEHA 1MEXL 1N59B 2E7LC 3VGAB 2HJFB 2NR6C 2FJHB 2E6JA 5D2NE 1MAML 1SJEA 1ZT1B 4HC1A 4O2EA 4UQ3B 5F3BA 2CIKB 4JFDB 4LLAA 1KEGH 2XXMB 4FFYH 1UM6H 2DIAA 1OTUD 1JBJA 1CFSA 5EC1B 3DTXA 4RIRA 3RVVD 4U31A 5IK3A 2YPLA 5IV2B 2Y5TA 1S9XB 3WHE0 2D31A 3C2AH 1DLHA 1ES0B 4UDTB 1JZ6A 1J11A 5DEFB 1A6TA 3ARQA 3MA7A 4FFZH 4LEOB 4NM8L 1YYLL 4QRRB 1KCSL 3BO8B 1A4JA 4XGZB 5F7DA 4HUXA 4EN3D 4QRPA 1T7ZA 3P4NB 4PBXA 2UWEA 4J3UA 1YEJL 5HHOE 1A6WH 1DFBL 1ZE3C 4A6YH 1JYWA 4HAGA 1NKOA 2R1YA 1EO8L 1NFDB 4GS7B 5SWQB 2NLJA 5C2BH 3OKLB 3ARXA 1KJVA 1AGDB 4QRQB 4NJAL 3C5JB 3T08A 2HFGH 3NCMA 3ROLB 3TVMB 4OGXL 4YIQA 3RGHA 1TFHA 1QEWB 2W91A 1MWAH 5T5FH 3X3GH 2PO6D 3MXVL 1MCOL 1T1ZA 1P7QA 5C0BB 5ACZB 3I9GH 2R1WB 1B88A 5FB8B 1UZ6F 3LS4H 4AM0A 3OKKB 4Z7WF 2XRAH 4IOIB 3TH2T 2AJUH 4A6YB 1F4XH 3A6CH 3MZTA 4HMEA 5E8PA 3T0EE 5K9QI 3BN3B 2R2BB 3JV4A 3FAXA 3G5ZB 3PGDA 4PJ5E 5DC0A 2P24B 1JI1A 3RGVB 4G8GD 4BZ1L 5IOPB 1YZZA 4NN7C 4UV4L 2BVTA 1D5ZB 2AK4A 4KUZL 1K8DA 1OAYH 4P23C 3JTTA 2AEIT 1DE4B 5HDOA 1A7PL 1HNGA 4HIXL 1MWAB 1NC2A 5HGHA 3GRWH 3QCTL 3GUTB 3IU4H 5SWSE 1EBAA 1ZLUH 1E28A 7CGTA 1UM5L 1BQHA 5DMYA 5BS0D 2C1PA 4TUJA 1P5VA 5HHPA 5A3IC 3KPQA 3W11D 5KBNC 1U9KA 3ZL4H 1ZVHA 4JRYE 5CJXC 4Z77A 3H9SD 5KVMC 3RWFB 1HZHH 3HC0B 2DLEA 1HILB 4EXKA 5LGJB 3ZE0F 1Q72L 5HDQL 1AFVL 1L6ZA 4BFBD 1ZS8A 1U6AH 3PHOB 4IMKC 1NGQH 5IR1B 3TGXA 3B8SA 1T1WB 2QR0A 3BP4A 5CIPH 5I1JH 4GQ9H 4PG2A 5D7LE 3VXUE 3THMH 4HD9A 4EDXA 3H7BA 3U0TA 4HJGB 4JFFB 4PGDA 3PF2A 4J8RA 1S9WB 2NY3D 3MRPB 3PWLB 4L4TD 3OPZL 4EQ2A 2NW3B 2PW2A 4JM4L 4EOWH 1YEIH 4M7JH 4RFEB 3NOIA 4MNGB 43CAB 3CFEA 5E2WH 3KXFD 4MMZC 1URLA 3SQBA 4M43L 3RDTD 4MNQE 4ZUSB 3U30C 1W72A 5FK9B 4FQXC 2LVCA 5DSCA 1F3RB 4M1CC 1FL3B 5AYQA 3SPVB 3WD5L 5D1XA 1CF8H 1FNSL 4APQC 1GGBL 3DSNA 1AIFB 1S7SB 4Q6IA 3WE6B 2CJUH 4BQCA 1KTRL 3AXLA 4FMFA 3O2DH 4Z76A 3WFHA 4WI6A 1KYOK 5I1KL 5I1CH 2B2XH 2HLAA 2HKFL 2D9QB 2E27H 1LEIA 5LVEA 1A9EB 5H2BB 3IFPB 1EO5A 1G6RH 4JDVB 3ZE2F 4EI5C 1QYGL 5IBUB 4DAGH 4AIOA 4G8EB 3AY4C 4WHYH 3PWJA 4OF0A 4WI3A 2C4XA 4I48A 4WWID 1JRHH 4JN2B 4G6JL 3NTCL 4P23B 1FYHB 4ODTL 1BWMA 2BOBA 5T1DL 3MMEB 3RVUD 5F7YC 4XX1E 3EDFA 3OJVC 4K8RL 1FE8L 5DA4A 1R24B 3L5XH 5LCVH 4MMXC 1HQRA 4ESKA 2JELL 3FN3A 4D8PB 5TGBB 2Y72A 1PW3A 1CLYH 2YD8A 5ENWA 5HYIA 1G6RB 1JGVL 2B1AH 2DAVA 1U42A 4YPGB 1FO0A 5FYLL 3WFEH 3S98A 4MDJA 4HIIB 4JM2D 4NP4L 4PJGA 4W70A 4TNWK 4X5XA 2RCSH 2IANB 1I9JH 2N7BA 2L7UA 3QULB 1QBAA 4JRXE 1PG7L 5DD5L 2EKSA 3FRUA 1PJ9A 4HHAA 5D7KE 3SO5A 1A1OA 1C12B 5IBUG 4OCYL 3UYOD 1BREA 5E08L 1U95B 4R2GC 1U8IB 4ZMAT 5JIKA 2XWJA 2G2RA 4P5MA 2ZUSA 5C09B 4KKCD 5DJ0A 4QOKB 5KSBF 4KQ4L 1FGVL 1U8QA 5DK0B 4HK3N 4BH8A 4PJ8C 1NL0L 4WRLA 3TYFA 1KENH 5AUMB 2VDLH 5L7XL 1GJIA 4YJZL 1FVDA 5I30L 1RZ8A 4JR9L 4JO3L 5MENE 4ZD3H 1AJ7H 4HKZA 3X17A 4CBPA 4KK6C 1OSZB 5T1LB 4MQXD 3ARDD 2ZCKL 4F37K 4HUUB 3HUJA 4NJ9H 4L3AA 1NCUA 4WV1A 5D72L 1S7TA 3L5WB 4PJAB 1DVFD 4TSBH 4ZNEE 5DJAB 1P7HL 5TFSL 4FQXB 4WHYG 1U93B 4YNYA 1T22A 3WL9A 3RWGB 1T0PB 2YC1A 1CFVL 2AJ3A 1FFPB 4U6TA 3BDYH 4MCZB 1I3VA 2KZ1B 5IP4A 4YDIH 4K7FB 1N6VA 1G7LB 1O7VA 4NQDA 4XZUA 4NWUL 2QSQA 4LKCB 5BRZA 3AUVA 3N1PC 3QHFH 2XKNB 5J13C 1H8SA 1YEEH 2VDKH 4N1HB 2FJFB 4HS3B 4NRYA 3ZKNC 1M7IA 5I74C 1GCFA 5KOVC 5DJXB 3OG6B 3HZKB 4M5ZH 1XGQB 3R8QA 1I9IH 3BXNA 4L8BA 1DBAL 1TJIH 1ZWIA 1OD7A 3GIVA 5IHBA 4KV5E 4U1IA 3PNWB 2Q7YB 1T66C 4Y7MA 2WWKT 4PR5A 4JY5H 3OSKA 3QFDA 1N5AB 3A0OA 1NBZA 4U3HA 4P3DA 1SM3L 3X3FH 2OJZH 5CHNA 3GM0A 3KGRA 5IIEB 1TCRB 2X89A 2VXTL 3EOBA 4J4PA 1UYWL 1J05B 1RZGB 4RQQB 5IVOA 4F7CB 4OI8A 1RUQL 3VXMD 4WWKD 4CJ1A 4XCNA 3CXDL 3HE6D 2A73A 4MA8L 3TYGH 2XA8L 3IKCB 3MLXH 5LWYL 2CDGA 2DMCA 3AAZA 3VFVB 1FQ9C 4JFQB 4PY8J 5K33A 5B38B 5IB3A 1BBJA 1S7XA 2GFBB 5EIIA 1RJYB 4Q9RL 2NTSP 3OJDA 4BA8A 1U91A 3OGCA 3B5TA 4YLQT 3DV6A 2BSRA 2X41A 1QLRA 1ADQL 4S10A 4GMSH 4BK4A 4DKEL 4PJ8B 1FFNB 2HTKC 4MZ2A 1N64L 4KJWD 1ZGLA 2Z31B 2HG5B 5I1DA 4G8IB 4ODSL 5BZWA 3M1BB 5F89B 3VXRB 3BMVA 3BGMA 1NLDH 4ONHB 3BP5B 5EBLB 3DO7B 1JFQH 4ONFH 4BFEA 2DLGA 4QXWA 5TQ2L 5I66B 2Y4SA 3GJFA 3U1SL 2NY6D 5LBSH 4MHHG 4ZAKA 4LMQE 1LDPH 2VC2H 3HFMH 4OGZA 5DJYB 3FOLB 1XGPA 2YWYA 5D2LA 4GG6A 5B38G 3EYVB 4PLOB 3ES6A 1N3NB 2BVPA 1GGTA 2AXFA 4KK8C 4LHQB 5TH2B 4QY8A 4JQXA 4M6NL 5JMOC 4YHZH 5HYJD 1JPTL 3U4EA 3K2UH 3QNYA 4NN5C 5J13B 4PFEA 3A6OA 2OZ4H 2V7HA 3ZHLA 2VL5A 3EW3B 2P45B 5TDOA 5BOZG 5I74B 3LV3A 2A74B 3RVXC 4MJIE 4YO0B 1QQDA 3PABB 2QSVA 4TVPD 1HXYA 2X44D 5DGQA 4FHBD 2Z9TA 4BUGA 1I8KB 3E6FB 4P57B 4CADA 2HLFC 4CUCA 1EDQA 1NGZA 3QI9B 5HDBE 2EIZA 3I50H 5ILTH 3QEGL 2F54D 2HAZA 1YMME 3HHRB 3TIDA 2W0FA 4I13B 3AB0B 2DWEB 1G7QA 3VFOA 5EUOF 3UEZA 2C7UB 5E94A 5IQ7H 3SDCD 3VFSA 1AI1H 3SKJH 3BW9A 2X4OB 3DETD 1R5IA 4PJXA 2SEBB 4NKMA 4PY7B 1LWRA 5I9QB 5DR5L 5KANI 1NEZB 1EGJL 1C1EH 1LO2L 3ARED 4OZGA 1BD2B 1I3UA 5ISZA 3X14A 3H3KA 4R26H 3MRHA 2AABH 4NQED 4ODVL 1V3LA 4QHMB 3R1GH 1SEQL 25C8H 4AJ0A 2QSCL 5FV2A 4UNTA 1Z9MA 1HHJB 3BPCB 1C7TA 3RX8A 4OSUL 5DJ2A 5CGYD 2J8UA 5HI4D 1MY7A 5C0JA 1OAXH 3ZT5A 4RRPA 1IFHL 3KPSA 1UKQA 4O5LL 4PJXF 2W65A 1UJ3A 3O4LD 4G43B 4Z7VE 5IB2A 4BK5A 4B41A 3L3KB 4OZGF 3C08H 3IXAB 3EO1A 3GEWB 4CN1A 4MNHB 1EFXB 3TZVC 5IJKA 1GOHA 1UZ8A 2WBJA 1TTFA 2EDKA 2HVKA 5DVMA 4U6HA 1RVFL 3V5DA 4MD4B 1U8HA 2GHWB 4PG9A 3FT3B 1QHPA 5HJ3A 2V2TA 3SCMC 3EJZC 4WU7B 2ADJB 5ERWA 3VWJC 3TBTB 4I0PC 2EH8L 4MD5A 3TWCH 4FA8A 1GC1C 3BKML 3D0LB 4WEUD 2A9NL 4NNPH 4X6FB 2J4WH 4WHTB 1B6DA 1DBBL 4MLSA 4P2RE 2R2HA 3L7EB 3SKNB 1HI6A 2NZIA 1MREH 3UO1L 4TSCL 3BI9X 4OFIA 3S88H 2XN9E 4WO4A 1E6OL 5SX5K 4YGVA 1QR4A 2FEDC 2XTJC 4MXQC 5JOPE 4ONGL 4KJPC 3D3VD 4L5FL 4QRRD 3RKDC 3RKPA 3BGAA 3H8NA 5IW3A 3LZFL 3VMPA 4LLUB 2XQBL 2ED9A 2GCYA 3U9PL 3GSXB 3SE3A 3HAEH 4IJ3C 4PTUB 1LK2B 4UUJA 5EZIL 2YWZA 3DRTB 5GZNC 1QLFB 5EORH 2Y25A 3TT1H 2VR4A 1DBMH 3QZWG 3RTQA 4KQ3H 1XEDA 2D4DA 2FJGB 5D5ME 3JWDL 5F6HI 5I1GH 2CH8A 5F96L 2GJZB 3HE7C 3FN0L 3QNZA 4X6DA 5CWSB 2GSIA 3MJ7A 3D2UB 1PSKH 3MV7B 5GS1C 5K9OB 4YHLL 1QSFA 3MLZH 4KKAC 5T33H 2A83A 5DMIL 4DVRH 1GGCH 2BDNL 5FA3B 2MSPA 3HAEB 3J8F7 1NUNB 1T5XB 3B5HA 4UV7H 1WWWX 3BEVA 1K3ZA 4NNYB 4OZFH 2VZVA 4WJ5A 3PJSA 5E00B 4CMHB 1AQKL 2FSEA 4LSTL 4MJ6A 3RGVD 3H3PL 1UJTA 1IC7H 4LASL 1HINH 4ERSL 1A3LL 1GC1H 1ZA6A 5DQDH 5K9KA 1KIQB 2UYLA 4QXTB 5B39B 3IKKA 2X40A 4X6DF 1OF2B 4N9GA 4MXWL 5E2VL 4FQHA 4JHAL 5IJVA 1ZSDA 4XBGA 3S37X 1YEGH 5C0CA 4WW2F 3D9AL 3T09A 1PBYA 5F21B 5F88A 1KN4L 2VUYA 4OD3L 2UZIH 4JDTL 3DIFA 5HD8C 3FQRA 1J8HB 4CAGA 2DIBA 1XGYH 3R0NA 3B9KD 4J1UA 3G6JB 4XHJD 5TDNA 3AC0A 4HKXB 2FH8A 4OZFB 2CR3A 2P48B 4G42B 3KYKL 4KV5F 3SCMB 3HAEG 1AQDB 4I0PB 5HI5C 1Y0LA 3BPNC 3D5OF 5FM4A 4YBLC 5IBTH 4BYHA 1IAKB 3LPFA 5F1OB 1U8NB 4WY7H 5ITBH 5F9JB 4LDEB 4MYWB 1TQCC 4LOUD 3G9AB 2CLVB 2OL3L 4XNMB 5KSUA 1PKQB 4ZSOB 2VLRA 5B39G 1ZEAL 2XTJB 1A9BB 2ED7A 1E0OB 3FFDA 5L88H 4JFFD 5E4IA 2VXQH 2ZWLT 3P30L 1OOAA 3MTRA 4NO5A 5DDHB 3KPNB 3PWPB 1RURH 3L7FB 2HN7B 3QEUA 3HI1A 2XKSA 4L8SA 5DRWA 4XNZC 1D5BB 2VLKA 4IJ3B 4FZEH 5AD0B 5FUZH 4N90E 4XNXL 1OL0A 1S9VA 4OZFG 5MHSD 3MV9D 4UB0L 3QJFA 2IAMC 2WUBL 1DN0B 2CPCA 4PLJC 3P77A 2QKIA 4JFOB 2FYYA 5C70A 4P2QB 4LGSB 3ZE1F 1XZ0A 3DURA 4HK0A 3HE7B 3RVWD 1CICC 2X05A 4FNLL 3TFKD 4FP8H 5GS1B 3EAKA 5D96C 4FQ1H 3OKNB 3EFFB 5E2TH 4L4VE 3C09C 1IEAA 1IQWH 4LSVH 1QFWH 3HZMA 1I1FB 1YEDA 2R4SH 1FNGB 5HHXH 1I8MA 3SJVA 4XXCA 1BIIB 1H8NA 4R4ND 4EUPG 2AV1A 1WT5C 1M4KA 3QBTB 2DQDL 4LNRB 4LVEA 3V4UL 5DZOA 4XC3H 1MI5A 4HS6B 2FEEI 1HHIB 3FFCE 5GS3A 4LBEA 3QQ3B 3NAAL 1I75A 4JPVH 4LU5H 5JW5B 4JFXB 1FN4B 1R3KA 2V2WA 4PTTB 1FV1B 4X9BA 1TVBA 4YWGL 4OV6F 4H20H 4RMQA 3EYSH 1WV7T 4KDTA 3QDMA 5GGTL 2QSTA 2IC2A 4HGKC 5TQ0L 3TO2A 2C3XA 4QRPE 5IMOB 4DKFH 1FAIL 1KOAA 3V5HB 1NMCC 4MAUL 4XCEB 2FGWL 5IMMA 3X12A 4NDMB 2YUXA 5A3ID 1JV5A 5CGTA 5HDBF 3WO4B 5GSRB 1Q94B 3LEYH 4QCIA 2CKBL 3T8XB 1QSEB 4U1SB 2VXUL 1HDMB 1SEBB 5IVXE 3BPNB 4L1DA 1NC4B 2IQ9L 3Q5TA 3WMSA 1BAFL 4M3JA 5LQBH 1VB9A 4H88L 5TF1L 4Z7QE 2Z35A 5E5RB 1TQCB 4NRZA 5L8KB 15C8L 3BUYB 4UDUA 2Y23A 1Z5LA 3IRPX 3UZVB 3GK8H 4D9LL 5C09D 1CFNA 2V5RA 4LARH 1R3JA 2CO6B 4U1HA 1E4KA 2VAAA 4X7SL 2UUDH 3MCLH 5D9SB 1QP1A 3M8OL 4RGND 3O8XC 1HH9B 5D7SH 3S35X 3DUUA 3FQNB 5SWZE 4E41B 4XNZB 4Q58C 2AVGA 3O6MH 4ZS6D 1N8ZB 4XNUH 3SE9L 2KBGA 1IAIH 4WTZA 2IAMB 1B2WL 3IS0X 3RZCD 4PJHB 5FO8A 1AP2A 4FQXD 5E6IA 1YN7B 3MRIA 4NQXB 4WTXA 2KL6A 3CMOH 1N0XL 1X5YA 1C16A 1SYSB 1CICB 1MLCA 2H2SD 1L0QA 2JJTC 5E24E 5D96B 4U6YA 4KWUA 1CXHA 5LAXB 3O6LL 1CI5A 3C09B 2IJ0C 4OCSL 3MNVA 4P9MH 1NBQA 3BAEL 5GS0C 4ZUWB 3C5ZD 4JFHD 3UROR 4ZFFA 2VLLB 1OT1A 3DSFL 1L9NA 2A6IB 3HNVH 2IWGA 1SY6L 2VDQH 4WI9A 3BH8B 1ROWA 3TCLB 3CU1A 4P4RA 4WI8A 1VSCA 4Y5VA 4C57C 5ABDE 2BCKA 2BNRB 4PJDB 1D5IH 4NGHH 3N85L 1ZT4B 1GZPB 1BX2B 3ARFB 1S5IL 4XMKH 1KNOB 2FATL 1A7NL 4XWGH 3OGOE 1RUAL 1NMCB 5I1AA 1WFTA 2PUQT 4OQTL 3LB6D 4JAMA 4N68A 4PJFA 1I7TB 4D9RE 4Y4FB 4WNQB 1IGMH 2XV6B 1WIOA 1T04B 5DF0A 5DURD 1QNZL 1T03H 2AJZB 1UH2A 5ITFB 4L9LC 3NBNA 4AH2A 3RWJA 4JFEE 4LSPL 1U8KB 1CR9L 2VDML 3QYCA 4WIQA 3NCJL 1MJ7L 1H15B 3QQNA 3DBXB 4UT6H 3VRIA 1QBML 3SDAC 2CUMA 1MFAH 3GZKA 3T0ED 3LRSA 2FIRT 3NPSC 5L6YL 4LAQH 3OKOA 4LCWE 3QFJA 5FF6B 4GRWH 4BZYA 3WIIH 5DQ9A 3I3DA 5TE4L 4TSAL 3OTTA 1FYTE 1NCCL 1CFQB 4PJFF 2Z31D 5EU6A 1OARH 1TZHB 3O8XB 5E8DH 4YUEH 4OD2A 1NGYB 1FL6A 5CBEB 1MCJA 1R3LA 5SWSD 2D3VA 2HVJB 3Q5OA 1LO3H 4XP5H 3Q3GB 3C60A 1Z9LA 3MJ9H 4JO1H 1OAQL 3MACH 1UT9A 1CBVL 1JWMB 3G6DL 1XR8B 1HQ4B 1HHGA 1WAAF 3ARSA 4GAYB 1NUFA 4LFHG 1BEYH 5BVPH 4Q9QH 2R15A 3GGWA 4GRWB 1JMZA 3FQTB 1LDSA 3ZDYF 2DMBA 1ZVSB 3TA3A 2F5AL 1MRDL 2F53B 4WENB 3W2DH 1H3VA 2JIXB 4GXUN 4UAOB 1VFUA 2ORBL 1VKXB 1UXWA 1C5CH 5D7LD 3VXUD 2DF3A 3KYMA 4PJGE 3ZKND 4KJYA 3PHQA 4LSUH 1PEWA 2CLZA 4GSDH 4XVJH 2CRZA 5H8DA 3MFFA 4HMDA 5E56A 4QHKI 4HC1H 1EEZA 1OGAB 5IMKA 2YA2A 5D70L 1N6QH 4PP2A 4KKNA 1GZQA 1P4IH 5FO7B 1CGXA 3G6AB 3QI9D 4FABH 4ETQA 5JPNA 3QHZL 3MOBL 4O2FB 1F11B 3OHXB 1GPOL 1T66D 4MNQD 3T0BA 3NCYP 2VRAA 5MEQB 3ROOA 4JDZB 3T4YA 4D0CB 3BKCL 2GQHA 4PD4J 5MI0C 1N6UA 2NX5E 1X9QA 4R97B 1FBIL 4XC1H 2X2YA 1HKLH 1SJEB 1PDKA 4O2EB 5F3BB 1BD2D 3CVIH 3QO1A 3SQOH 3SGJC 3KJ6L 5J3HD 4KI1A 3EJYC 1CFSB 3DTXB 5FGBC 4RIRB 5IK3B 1CLCA 1OLLA 2JCCF 3RNKA 2EDDA 4GAGL 4UILH 2YPLB 2Y5TB 2QADC 4O9HL 2D31B 4PGZA 2RHEA 2R23A 4Y2DD 1PZ5A 4PRIE 1MVUA 3FCTA 3FRPG 1A6TB 1DSFH 3BZDA 3MA7B 4M03A 2YZ8A 5ALCH 1HWGB 1A4JB 5F7DB 1HSBA 3RI5K 4DUVA 2BC4A 4HUXB 5D6DA 4QRPB 2UWEB 3DARA 3V9FA 4K7PH 1VADA 4OLUH 5JQHC 1ACZA 1AGFA 4RDQF 1EFXD 1AXTH 5DC9B 2RIKA 2R1YB 5F7HA 4LQFH 1H5BA 1K4DA 3O3AA 5J06A 3TBWA 2NLJB 1LO0L 1UM4H 3MLRL 4JRXD 3NIGF 1KJVB 4M7ZC 1RHFA 1WC7A 4NZUH 2EXWD 3QRGL 4Y4KA 4NOFA 4U7SA 2FBJL 4POYA 4KTDL 4PRHA 5C08A 5CEZL 1OM3L 4YIQB 1UVQB 3PP3H 4JKKA 4PB9L 5DGRA 3VI4E 4W4OC 1P7QB 3T3PE 3BRFA 1I1YA 4S11A 4Z0BH 4AM0B 3F7QA 5C71A 5E7FA 5MEND 5E8PB 1F90L 3CLFL 4XBEH 3E6HA 3VW3H 3JV4B 3PGDB 3S36X 2HLFD 1N2RA 4R4FL 4JG0H 1VENA 2AK4B 3L95A 4U1LA 5F72S 4N1CA 4TRPL 1K8DB 2PTTA 4Z7QF 3NCBB 2O5ZH 3JTTB 1JF6A 5GIRA 2DTSA 4GKOA 2G60H 4JPKL 4F3FA 1A7QH 1NC2B 4N0YL 5HGHB 3SGKA 5MI0B 1NCDH 4ONOA 1E28B 1WFUA 1RZJL 3HI5L 3PDGA 3VWKC 1BQHB 1YN6A 3LPGA 2C1PB 3R0MA 4TUJB 3Q6FA 5HHPB 2R69H 3KPQB 1SJVA 4PPTA 3MNZA 4K55A 4N0UB 3ULVE 1F4AA 5KS9A 3ZTJH 4Z77B 4H25B 1IGCL 4TVSa 4TUKH 1EHXA 4YDKH 3NN8A 2P8MA 4JZNA 3UC0L 4GLRI 4GG8A 4JVUA 1MFDL 3MRRA 3WKML 3V95A 2X5PA 2OTUA 5E1HB 1DLFH 1W72H 1ZS8B 2YD2A 3RL1A 2WMPA 2QR0B 3BP4B 1KCVH 3FMGH 4UTAH 4EDXB 3I2CH 4H0HB 3H7BB 3U0TB 3ALWA 1A6UH 2D2OA 4Q2ZA 2AJYH 4PGDB 4GBXC 4J8RB 4FRWA 3K4ZA 3ZYZA 1EJ6A 4UT7H 2R9HD 3VXOA 4KRPC 3JSSA 2EC8A 2XZCH 1S3KL 4Z8FL 5GS2H 1VERA 3MSPA 2PW2B 5KS9F 1BQHG 2DICA 1EHLH 1MQKL 2HJKA 4FQLH 4YAQA 2AXHA 5DTFA 4KMQA 3CFEB 4OZHE 3JV0A 2WIIA 1UKTA 2Q3ZA 1W72B 1FC1A 4NUJA 5DSCB 5D1XB 4M7ZB 5HGDA 3VGEA 2P5WA 1ZA3A 1CGSH 2ILLA 3RWCA 4FG6C 4Q6IB 3MX0A 1VDGA 4GFTB 4KUCF 4PRDA 1EHAA 3AXLB 4Z76B 4GOSA 3WFHB 3PL6D 4LPTA 4OM1H 1MFBH 1OVZA 1YUHA 3GI9H 3LKRA 3AU1A 1H0DA 2HLAB 1LEIB 3GJFK 3VFGH 4IRJA 4J3WA 4OLVH 3ZTJG 4XVUC 1QPXA 1FO0H 2FEDD 3V6OE 4MJ2A 1U3YA 4JFZH 1FPTL 3RY5A 5M7QA 2H9GA 4KJPD 3PWJB 4XPBL 4EQ3A 4ZTPL 4I48B 4DZBA 1YY9C 1RZFH 3O3EA 1CDIA 3PWPD 2JTDA 3W82A 3LEVL 4HEME 1DCLA 1J1OL 1C5BH 3WFBH 2BOBB 2R0LL 2IG2L 1HQRB 2OMNA 4FQIL 5GZND 5IQ9A 2ZOLA 4PLKC 5DT1H 1VGEH 4NT6A 2VN7A 4BQ8A 1UEYA 5ENWB 5T5NG 1EGJA 1L7IL 3VFWA 1OAZH 2EDQA 2BSSA 3P9MA 3P0VH 1OTSD 1FO0B 3DUSA 1LEKA 4Z78A 5I8CA 5HYEA 1MF2L 2DM4A 1EX0A 1IGFH 2VR5A 3DXAE 4LQ1A 4MA7H 4MDJB 5KVDL 3ULUL 5ANME 4PJGB 4X5XB 1BZ7A 2V5MA 4I4WA 2VERN 3FQUA 2EKSB 1I9RL 1T6WA 4HHAB 1JHLH 1A1OB 3PGFH 1SQ2N 4RAUA 1QKZH 3OKEA 3DX9A 1TETL 1V7ML 2XWJB 5DMGD 2ZNWA 4HFWA 5C0DA 5F93C 4P5MB 5IBLD 4I18C 4NZJA 3GHEH 2IH3A 5DJ0B 1AR2A 4NC1C 4P4KA 4PUBH 1U8QB 5AWNH 4BH8B 1E6JH 3TYFB 1S5HA 5KSAC 4KRPB 1FVDB 3B2UD 1RZ8B 5FUOL 1B0WA 2E3VA 4HKZB 5BV7L 1P4LA 4G6FB 3QR2A 4I77L 4TOYL 5DRNA 2YSSA 3HUJB 4WUUA 4UU9A 4Y19A 1RUKL 1S7TB 1N0LA 1U3HA 4FXGA 1Z0NA 3EO9L 1P84J 5GXBB 3K81A 1IJ9A 5I73B 4OLWH 5GGSA 4UNVA 4YNYB 1T22B 3WL9B 2AJ3B 4IDLA 4XMLH 2VDPH 2A2QT 3NH7L 4TUOA 2KPNA 2CDEA 4NQDB 4XZUB 3BZEA 4U49A 4JQXC 5HI5D 2VKWA 1NC4D 3QUZC 5BRZB 5T1MA 1BOGA 3HG1E 1K3IA 1I8IA 3NA4A 5DK3A 1QBLH 1DTUA 2DQUL 4QRUA 1L0YA 3RBGA 4WEBL 1BZ9A 1M7IB 2FECL 5A16A 1X6LA 3CX2A 4FMKA 4XCYA 3L3DA 3WFZA 1QFUH 1RIUL 3MLWL 4WI2A 3BXNB 4L8BB 4KI5E 3LIZH 3KJ4C 1QRKA 4M93C 4QT5A 1ZWIB 3SDDA 3GIVB 4HK3J 4NBYB 4Z7UF 1IBGL 4KK9D 3VFRA 4U1IB 5JDSA 1X6NA 2IMMA 5DHVA 4FTVE 3IDJA 1U41A 4PR5B 3QFDB 1HH6A 1NBZB 1KYOJ 4P3DB 1T2JA 5FYKE 5J57B 5CHNB 4PLJD 1FRGH 2CMRH 3RQ3A 1WBYA 3EOBB 1AY1H 5DFVC 1ZHNA 6FABL 1OP9A 1A4KA 1OGTA 2AGJL 3QP3A 1LVEA 2Q8BH 1FZJA 2APVA 2DKMA 1AO7E 3CVHL 1G6VK 4UIKL 2A73B 4XCNB 1YPZA 1BBDL 4WFFE 3BJLA 3QCUH 4P2RD 2CDGB 1ZTXH 2ZP0T 3CJJA 3AAZB 4U6VH 1K4CA 2ATPA 5IB3B 1BBJB 3GJFH 1S7XB 3WNMA 2XN9D 5EIIB 5HHME 1Q9LA 3OJDB 5JXAH 1U91B 4IOSD 4KY1H 1FNHA 2VQ1A 3OGCB 5FA4A 5JOPD 4MQ7A 1MFCL 5FKAA 3PQYE 2BSRB 3DV6B 4LCCA 1QLRB 4J3OC 4CGTA 3SDXF 1ZGLB 4PV9A 1LEGA 4F7TA 5I1DB 5BZWB 1MCDA 5IHUL 1UJ3C 2BNRD 2VLRE 3VI4F 1WGOA 5JHDA 3BGMB 4R9HA 1ZLSL 5ID1A 1KCRH 1DQJA 3E8UL 5D71H 3ARFD 1BFVL 3U0PA 4QYOA 2EYSA 4CNIA 3GJFB 5C0NC 5IJKC 4P59H 2P1YA 1XGPB 3V5KA 1FGNL 5D2LB 5CZVH 4F8QA 4PJBA 4GG6B 2EXYC 3ES6B 4Y4FD 5E99L 4DKDC 1DQML 2BVPB 1FSKC 2AXFB 1V7NL 1EEYA 1IGJA 4QY8B 5HGBA 2ICES 3UTSE 4QTIH 1F8TL 3FOMA 5FXCH 4LFHD 3U4EB 1EJOL 1AGCA 5EUOB 3ZT7A 1P7KA 1UH4A 3QNYB 2XTLA 4HEPG 2X1XR 2BK8A 2V7HB 3NZHL 2OL3A 2VL5B 4DFHA 1JF5A 3QWQB 5ADOH 3X13A 5C2UB 1KTDA 1KULA 5TDOB 5GRJL 3LV3B 1T0NA 3OXRA 4JHWL 1QQDB 2NZ9D 3I75A 4OCWL 1HXYB 1QRNA 3QG7H 5CKAA 1IKFH 3ARGC 3ULVF 4WO4C 4NQUA 4PP1C 3KJ4B 1GOFA 4HBCH 4PJBF 4X5WA 4CADB 2I5YH 3TO4A 1NGZB 2EECA 3O8XD 2D7OA 2EIZB 1VFOA 3O45A 3OJ2C 5CSBA 3WLWD 4Q97A 5BVJA 5E9DA 4P2OA 2W0FB 5EU7E 1CU4H 1G7QB 3VFOB 5J4MA 5E94B 2FX8H 4K71C 1QZ1A 5EG6C 4P48A 3VFSB 5AZEH 3BW9B 2Z8VC 1JHKH 3VH8G 1MRFL 1R5IB 2J5LC 4PJXB 2Q76A 4HT1L 2YD1A 3RTQC 2XY1A 3NZ8A 4HPOH 5AG8A 4OZGB 5ISZB 3X14B 3G5YA 3MRHB 2YK1H 4MB4A 4OZHF 1CQYA 4I3SH 5KZCB 3HN3A 3H9YA 1CD0A 4WW2C 3I84A 2VUOA 4KROB 1VFBA 1JK8A 4S1SH 3ZSSA 2WQRA 1KTKE 2RFXA 5DJ2B 2Y1VA 2J8UB 3M45A 4XPTL 4M7LH 3NIFE 5DZNA 5C0JB 2FIKB 4C83A 3KPSB 2V5TA 1H3PH 1OGAD 3UTTE 2D0HA 2EIEA 2W65B 2P8PA 3K8MA 1LK3L 1RSFA 1UJ3B 4JKLA 4N90D 1XH3A 3JUZA 1GH7A 4G9FA 5IB2B 3BZFA 3IDIA 3ZLQC 5IHZA 5EOCJ 1PX4A 3EO1B 4PY8I 4PJ7F 5DD0H 1CXFA 4RFNC 3LN5A 2VB5A 4GRMA 3HPLA 4OF7A 5F97E 1QG3A 1CXKA 5EOQL 4KK5C 1UZ8B 4Q0XH 4LPVA 2W60A 3QQ9C 5KVFH 2HVKB 4PGCA 2CKBA 4U6HB 3V5DB 1G9EA 4XP6L 1U8HB 1IM9A 1IGIH 4L4VD 4NWTL 2XIDA 4PG9B 5HJ3B 1AC6A 1BECA 4HS8L 4L8DA 2V2TB 5ERWB 2PYEE 2UVEA 3GFUA 4MJ4A 4MD5B 4QF1A 4XPHH 4QXGL 4WUKL 3I6GA 1JPGA 1J86A 1KCKA 1BP3B 3BH9A 1FZKA 4HGMA 2R2HB 2AV7A 1S9KC 1HI6B 3IETA 4DTGH 2EDRA 4MS8D 3C8KA 3B9DA 2HRLA 1KN2H 1XIWA 4WO4B 1FJ1A 1MNUH 4X4ZA 4YGVB 4PJIA 4AY0A 5C9JA 2HT2C 3CIQA 5C0RL 1LP9F 3D1MC 3MBXH 5CS7A 4NO0A 5DLMH 1A6VL 2CK0H 1NAML 5BW7A 4QRPD 3IAPA 3VI3F 4DGYL 2FLRT 5T3XE 3OR6A 2GCYB 1VA9A 3GBNH 4L8SC 2R2EA 4K71B 4UUJB 1OW0A 4BZ2H 2J5LB 2VE6A 3RTQB 2AJSL 5IFHH 5J1SC 3LS5H 4HG4K 4NN6C 5I18L 4PJIF 4U3XA 4IHOA 2BY0A 4P5TA 1DBJH 4M1GH 3QNZB 4X6DB 3BPOC 3P11L 2GSIB 3MJ7B 1ONQA 2C3HA 3CU7A 1QSFB 4M00A 3WFCH 2QQNL 4FQJL 2R4RL 3LMJH 2A83B 5BO1L 3RU8H 1SY6A 1VGKA 1YEKL 5D7IE 1ZGLP 1YNKH 5IT2H 4M9OA 2VLJA 4XT1C 2YMXL 1FVCA 3BJ91 3BEVB 5EZJA 5GGVL 2CRIA 2PR4H 4WJ5B 5T1KA 3PJSB 2NXYC 1GHFH 1VFMA 2FSEB 4YHYB 3TV3H 4MJ6B 1T80A 2ADFL 3QFJE 3HNSL 2FECI 4R8WL 1ZA6B 1YEHH 3QWRA 5K9KB 1DJSA 2UYLB 2W9DL 4FQPA 3N9GH 4UINH 3QEHA 4M6OL 4RFNB 1KT2A 5I15H 3QIBD 4KZEH 4YEFA 2ENSA 4N9GB 4U0QB 4FQHB 5CLWA 5IJVB 1ZSDB 4XBGB 2VH5H 4AL8H 2F8XC 5C0CB 4KDTC 1NC2D 3FQWA 4OQTA 5F88B 1OTTC 2H1PH 4NQCE 2V17H 5LJYH 3DIFB 1WBXA 4KI5F 3FQRB 4LSRL 5C86A 4LHUA 4J1UB 4X6CE 5TDNB 2L0DA 4WFGE 1BJ8A 2DKSA 1P9MC 3AROA 4JPWH 3GNMH 4Y16A 3SDYL 1RMFL 4L3EA 2J8HA 3TJHC 3N0PB 1Y0LB 1GIGL 2DQJH 5CEYA 3MV8A 3TIEA 4AQ1B 3D39A 1MCPH 5C7XL 3NACH 1DQLL 2DQIH 4X80H 4E42A 4KFZC 3P0GB 5KSUB 3QDJA 2VLRB 3FT4A 5F9OH 3FFDB 5I19H 1E4KC 4NO5B 1G7HA 3QEUB 3HI1B 4JQIL 4RMUA 3MUHL 4L8SB 5DRWB 1CDUA 3NFNA 2VLKB 5HBBA 2E9WA 3GIZL 1S9VB 4ZDHA 4D9RD 3VFPA 3QJFB 2M26A 4M61A 4YHKL 1HHKA 5I75B 3P77B 2QKIB 2VXVL 2FYYB 3MODH 3BWUC 4JFED 1CTOA 4XB7A 3CSPA 3WBDA 5D1XD 4I5BA 5FCUL 3OF6A 1YNTA 2AERT