5JIHA

Crystal structure of her2 binding igg1-fc (fcab stab19)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
212
structure length
212
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEYLSDSVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVPRHSETMRRWAHGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Fcab-HER2 Interaction: a Menage a Trois. Lessons from X-Ray and Solution Studies.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jihA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jihA01
4OLZH 1HHHB 5J9PB 1P7HL 3ZYIA 4KDTC 4Q7DA 1QFPA 5EUOE 4GXVL 4I18A 4MS8C 3S4SB 5E8OA 4Q9QH 5C2UB 1ORQB 4GXUM 5DRNB 3V6OE 4M4RA 5E8NB 4R26L 1DQQB 4MJIA 3VXOA 5MEQA 4QCIB 3CDFA 4JKPH 2HJKA 1FO0H 3AREA 4WENB 5I17A 3IAGC 5DC4B 1K4CB 1MFAH 5IMLA 4PJ8D 3SJVA 2OL3A 4KKBD 2C1PB 25C8L 4OAWB 4C55A 5ACZA 1EUUA 3INUH 3E3QC 1PQZB 3VFOB 4JJHA 4XMLH 2GJZB 3KXFA 3RX8A 3ARWA 4G7YL 2YOCA 4LSSH 5KS9B 1WIUA 2HT4D 2WUBH 3VFVB 1KN4L 3WE6A 3O41B 2NMSA 4P2YA 2V7HB 2X4OA 1QSEE 2RBLA 1ERNA 4AZ8A 3MYJA 4GRWE 4DK6A 2HN7B 3VW3H 1MQ8A 1A7OL 1IGCH 3QXVA 3UTSE 4PJAE 2VKXA 3MX0A 1IJ9A 5HGGS 3I6LD 1MCIA 1KXQE 4ZNEE 5IEKA 4YHOL 5GRJH 3BP4A 5BVPH 1JPFB 3GRWH 1XH3B 1Z9SA 1DBBL 2Z91A 3T65B 1AD9B 1Y6MR 2EDBA 3LVEA 3E2HC 1W0VA 3MV8A 4V1DB 1CGYA 4MNGB 4PP1D 3CFJB 1ED3B 4U1LB 1RJLB 2EH8L 5DZLA 4FQXD 4KZEH 1IGFH 1ZVHA 5E2WH 1BZQK 2OJZL 1FYTD 3NN8A 5DHVA 1IRAY 2XFXB 1YPZB 5F9JB 4MD0A 4FQJH 4R4BB 1VA9A 3V52H 1BJ8A 1QHPA 3MRBB 5E6IA 5D5MA 2OJEA 1G9MC 1AHWC 1BFSA 1TZIA 1R5VB 4OLXH 1BEYH 2ADGB 1MCDA 1Z9OA 3WXWL 5JW5B 5KG9A 1NMBL 1QLEH 1KCUL 3DBXA 2XZAH 3VJ6A 4PGEB 4PJ7E 5M94B 1G7QA 5E99L 5HYQB 1N6VA 3C9NA 4N0UA 2KL6A 3BQUD 4LPVA 1NAKH 2AJVH 4NSKA 5SV4A 4RAHA 5HHXH 3OBAA 2J8OA 1HILB 5ID1B 2HT3C 2A38A 3TIDA 3G04B 1CLOH 3P4NB 2YK1H 2QADD 1S7XA 1OAYH 1ODAA 1A6UH 2HKHH 2DD8H 5TF1H 4X99A 1KCSH 1NGQL 4F7PB 3L6FB 3ZHKA 4HGKC 3FO9A 1TVHA 4Y5YC 3UJTL 1IQDB 3O4OB 3RU8H 1JGUH 1JPTH 5ALBH 1KJMA 5DD5L 2VLRE 1NKOA 4X6FB 2YMXH 3RWIB 4OUUA 3OKLB 5IIEB 5I1KL 3AU1A 2GJ6B 1EAPB 1IKFH 3PHQA 4YIQA 4HS8H 1CFQB 1MCFA 1MCHA 3MV9B 4PUBL 1NANH 4P46A 3NZHL 3ARBA 3HAEG 4J4PD 2DM3A 3LKOA 4NCC2 3KPNB 4UDTB 5DI8B 2UZIL 2C1OB 4HKZB 2XPGA 3WCYA 1PVHA 2KH2B 2RR3A 2QQLL 4ZXBD 4G9DA 3TN0B 3MRHB 5DO2C 5D7LB 2Z31C 3P4OB 1RU9H 5J12C 5DA0B 2F53E 5HYFA 2EDKA 3BW9B 2NXYC 5KZCD 4UU9B 1KELH 2NY1D 3CC5B 3HG1B 4KAQH 2EE6A 1YYLL 3EOBB 3QUYB 2A73B 2YN5A 1UENA 1F13A 3BHBB 3HPLB 4JY5H 3UAJC 1EERB 4HJJH 4PJ9C 4G8EA 1MFDH 2D7TH 2FHBA 4WWKC 1NCUA 3L3GB 4LMQE 4ONGH 4Q2ZB 5DRWB 4TSCH 5IHBA 3I75A 4FQHB 4Y4HA 3G9VA 3W9DB 4ZOBA 5KTEL 4LOUD 2CLZA 2OP4L 2X44D 5F9OL 2Q1EA 2RFXA 4XVJH 1HCFX 1ZGLA 1UWGL 3BN9C 3ZKXC 3H0TB 3RUGB 4BFBD 3N1GC 4JG0L 3ZT5A 3U1SL 2DRUA 4XC3L 4JFDD 3B2UD 3BUYB 2J5LC 1AGFA 4OT1H 4WY7H 5K9OB 3T8XA 3A0OA 3MBXH 4P23B 4Q9RH 4JJ5A 1ZHNA 5GRXG 2APVA 1HWHB 1YYMH 4ZPVA 3STLA 3PWJB 4NJAH 2BOBA 3SDAA 5D1ZA 3TVMC 2NY4D 3RVVD 2DQEH 1F58L 2EYRA 1ZLSL 3L7EA 1WICA 1HINH 4QOKA 4LRIA 1MRCL 4DGVH 4H1LG 3RWHB 3VDBA 4OJFL 5DUPH 1T1WB 3ZE0E 3EO9H 2CJUH 3GO1H 2J8UE 3SDXA 3EGSA 1S9VB 4TVPL 1E27B 4HBQA 3TBVB 2VUOA 5BQ7A 2W60A 1G7PB 1GH7A 4H1LB 2AXFB 1K5NB 2FD6L 3FQWA 5GS0H 5JLZB 3GMMB 1N3NB 1OTUD 3QA3A 3NTCH 5IQ7L 3MLUH 1TMCB 1DUZB 2ZCKL 4OTXL 4P5MB 5D7IF 1N5YL 4OB5H 4NN5B 1QLFA 2V2TB 3SGJC 2R0LL 5JHDD 1V7NH 3ZYZA 2HVKA 1KJVB 2A1WL 2Q87A 3HMXH 3TF7C 1UGNA 2GT9B 3FRUB 1W72B 4MNQD 3SCMC 4F8QA 4PJBF 5ISZE 5KJRH 3T0DA 3S88L 5JMOC 4RGOL 1H15B 3BKMH 4YZFF 3F5WB 4K8RC 2QEJA 3LN4B 5EOCH 4J3XA 1J1OH 4JAMB 4Z7VE 5HD8D 1D7FA 2Y25A 3QIWC 4BZYA 3AY4C 1ND0A 3GHBL 3G5YB 5IB1A 4P3DA 1J8HE 1OAUH 3Q1SL 4F9LA 2Y6SC 5E8EA 4B50A 3SDCC 3NCEB 5B8CA 3L95A 2MFNA 1U8KA 2JK5A 4WTXA 2AV7A 2W9DH 1F00I 3ZDYE 4JFYA 3ZE2E 3F7QA 1LEIA 3OGCB 3GMLA 1SEBA 5FEBA 3HE7D 2OZ4A 3FOLA 5J8OA 1P7KA 1JZ7A 1GZPB 1FL3B 1DVFD 4N9GB 5ANMB 3RIAF 2YN3A 4G6MH 1I8LA 4HUNB 2H32B 5INDA 3GGWA 3S3JA 3O11B 3MJ9A 3TCLA 1N6QL 1EEZA 2BVPA 4C58B 1EFXA 2B1AL 1WCBA 3CMOL 2QQKL 1WSST 2HT2C 3VXNA 4M1DH 5F6IC 4KRLB 3W11C 3B8SA 1VADA 1KTRL 1JZ8A 1PZ5B 3EO0A 3BYYA 4PJAF 3VI4E 4YPGB 1FFNB 4YNYA 4LSQL 2X4NA 3BXNA 5EUOA 5J1AA 1AJ7H 3BZEB 1MJ8L 4NOBA 2LFGA 5GGUA 4GQ9H 1IT9L 3V6OA 3VCLA 4NKQB 1MHCB 3SGEH 2CDGB 4JPKH 5FHBH 5L9DL 3UO1H 4DCQB 4HBCH 4NIKB 1X5HA 1NEZA 2HJLB 4P2OB 1X5IA 1Q9OA 4ZD3H 1XZ0B 4UTBH 4NQDE 1X5ZA 4OM1H 2CRYA 1A3QA 3VWKB 4PRHB 2FIKB 5EZIL 5FOBB 1C7SA 3HZYB 2WSKA 5D6CA 3FZUC 4YDVB 3PJSB 2HVJA 3W2DL 1B0GB 5DFTA 1NDMA 4PJEB 3TJHD 4FTVD 1FC1A 5I1AB 3QEUA 4NNPH 3EZJB 3HMWL 1OT1A 4KV5E 3HC3L 2J2ZA 2BZDA 4NM8L 4RQQA 4AIZA 1DTUA 3C09C 4IMKC 5ETUA 5D72L 4K3JL 3BGMA 4PYHA 1WF5A 5EBWB 3KR3L 3ULUC 1QSEA 5DR5L 4FXKB 3HNSH 5CAYB 1WITA 2VQ1B 5D71H 4M93C 1A6TA 2VLLB 1E4WL 4P59L 3VFUB 2B8OT 1UVQA 4ZNEA 5E2VH 2LTQC 3FOMB 1A4JB 5C6TH 5IESL 2R23A 3M17A 1X6LA 2P44B 3FRPG 4OZGB 1AXTH 4MD4B 4NQEB 4O9HH 5KN5B 5EUKA 1AKJB 1A1MA 2PCPB 1GXEA 3H9YA 4DTGL 1DFBH 3DVIA 4NO3A 3JWOH 3QG6A 2R69H 3MNZB 4PB0L 4Q9CA 2R2BA 1LEGB 3L9RB 2H26A 4HK3N 4HIHB 3X14A 2M8XA 5HJ3B 1U92B 2KBGA 4JFDE 5GGRB 4WGWB 3W0WD 3PWUA 1JNNH 4GG8B 4PJ7A 5CEXB 1V3JA 2EDHA 3BJ91 3VXUD 1UJ3A 5CCKH 2XTJC 4NWUH 1I1RA 5DMGD 3MRNB 3RY5A 4K3HA 4EUPA 2UYLA 1P84K 3IXAA 2WMPA 3HRZB 2D2OA 4H0GA 3IVKA 4NQCD 1QRKA 4QGYA 5AZ2H 3LEYH 3IS0X 4AEHL 4XNQA 4XRCB 3WKMH 1FAIL 1BMGA 1JNHB 3BKJH 3QZWG 1E4JA 2IALA 3WFDL 2DQHL 2Z92B 2M1KA 1CR9H 3P0YL 1IC1A 3IU4L 3DVGA 3FHQA 1U8HA 3RTQD 5DVNA 3HZVA 5HYSA 5C0BE 4UIMA 5HHOA 4WFGD 3Q2CA 3B6SA 3X12B 4D94A 4K2UH 2VLRA 4LLAA 4Z77A 1IGYA 1FLRH 2ZG3A 3OKOB 4HK3J 3AS1A 1XCTA 5FV2A 1MFAL 1X5AA 5EBLB 5JHDE 1ZLVK 3N9GH 1MCCA 1HWGB 5BZDA 3RWDA 2AEQH 2WUCL 4OLUH 3LKPA 3WL9B 5L2JB 5KAQF 3BVNB 4MNQE 4XXDB 4OF5A 1YEGH 5DD1H 1KLFA 5F1OB 2ADFH 4AENA 3NABL 4NQVB 5DMIL 4IIQA 2BY3A 4EN3A 2F53A 3IDJB 3NIDF 1DQTA 2V5RA 2VB5A 4PG9A 2YXFA 1X7QA 4JHAH 5IW1A 1KB5B 3H9SD 3QNXB 1JNLL 4M61A 5J6GA 5DEGA 1RUAH 3RWCA 4NZTH 1PEWA 1QSFB 3LS4L 4K7PH 4O51A 3QI9A 5GSRA 3UPAA 1Q9KB 5BMFL 5F9WC 4Y5XA 4APQA 1TETL 3M8OH 4WNQB 1L7TL 4ZDHB 3IXTB 3LQAL 3V6FB 2E8ZA 4ZO6A 3EJJX 2V17H 5DC9B 5GGQL 5DK0A 5DURD 1IAKA 1BVZA 3BPNC 1F8TL 2YWZA 4LVHB 5FXCH 4XHQA 2WK2A 1R0AH 3F62A 2FZ3A 1WBZB 3PWVA 4LP5A 4KY1H 1BD2D 3HI5H 3BKYL 1IC7L 3IKKA 2YPKA 4OCSH 2WAHA 3GMQA 5JIHA 4ERSH 4ZUSA 1F6FB 1BGXL 1A7RH 3LKRB 5JR1L 1A6WL 5DGRA 3P9MA 4M1GH 2AP2A 2QSTA 2CIIB 4FFWD 1FJ1B 5E2TH 3ULUL 1KCRL 4ONOA 1EVTC 2DQDL 1U58B 3WBDA 2CXKA 4UQ3B 5ESAA 1EX0A 3K1KC 1XF3B 2AQ2A 2V9QA 1GRWA 5DTFB 1A7QL 4HWBL 3CCHA 4WW1A 2VDLH 5B38G 3WS6A 1U8IA 4K3EH 3RKDD 1MCPL 3KYOA 2Q6WA 3L3OA 1YUHA 3QEHA 4S1DC 2J8UA 2RAMA 3C60D 5B38B 3V8OA 5EO0A 5GS2D 3ET9F 1M05A 1UWXK 1I3GH 2D7OA 1KEGH 5ESQA 5KVDH 1U8NA 4S0SD 1LDPL 3ZDYF 1TZHB 4LCYA 3HAEA 3ZE2F 3K80A 4B41A 1Q1JH 1YEIH 4LKCA 4X6CF 3TNNA 2IG2H 4PD4K 5I0ZA 2Z9TA 3IDXL 4PBXA 1L0QA 4RMUA 4CW1B 12E8L 1S3KH 3G6JE 4BKLA 3GSNA 4FTVE 4R0LA 3C8KA 3TNMB 4Y19B 2DTML 4FNLH 4J6RH 4JR9L 4B7IA 4OV5B 3T04D 3DVNB 4RAUB 4MJ2A 2Z35A 4U6XB 4WVRA 5FYLH 4CMMA 5LWYL 3C6SA 5FGBC 2LU4A 2DB8A 5JPMB 4V2CB 1TTUA 5ISZA 4BYHA 2BSTB 1MPAL 3QRGH 3IDGA 5ADPH 1ZV5A 5F7HA 1A7BA 3RL1A 3QEQE 3O3BB 4R2GD 3DGCR 4P5TB 4IOIB 3DYPA 4TSAL 3SDYL 2P5EE 1I75A 4M8QB 4HWNA 3VI4F 1KTKE 3DROB 2FEDD 4Z7VA 1CDUA 1I8KA 1BX2A 4DEPB 4O58H 5D70H 1Y18B 3SE4C 4KAQL 3BMWA 5AAMA 5FK9A 1J8HA 2Z0BA 4WGVB 4PTTA 1DQJB 5HHVL 3GMNA 5E00B 3FQTA 4JZJA 4ODBD 4TNVK 4Z76A 3SE3C 1HQ4B 2QV2A 4KXZH 5DEZA 2BCKA 1MFNA 1BQLH 2C7UA 2NXZB 1OOAA 4GMSH 5BS0A 5ERWA 4H25B 4IMLA 2E6PA 5JORB 4BSJA 1HZHL 1D9KC 1KTDA 1SY6A 1G84A 4H0IA 3RZCA 5IFAH 5BRZA 1D5ZB 2VDPH 4XNYL 3T0ED 4KROC 1MELA 4N1HB 5IMMA 1JHKL 2K7PA 2GAZB 3V6ZB 5F96L 4Y89A 6FABL 2W0FB 3QQ3B 3CGTA 3LQZB 2YEZB 3U7WL 3O9WB 4I4WB 2VZ1A 3VXUE 2Y4SA 3F58H 5H37G 3AUVA 2G5RA 3FMGL 1A6AB 5DVLA 4YXHL 3IFOA 3J7HA 3WD5H 4GKNA 4NQCE 4OFDA 1FGVH 3TEUA 4LF3B 1B90A 4WW2A 3A67L 1K4DB 2Y07L 3QR2A 5C08E 5I1HL 5FM5O 3CH1A 1T04A 4FFYL 4X9BA 4OCRH 1VCAA 4PJ5D 5D8JH 4KK6D 5E8DL 1CD0A 5F6HJ 5T1LD 4HLZG 5EC2B 1F4AA 1N4XL 4TSBH 2AV1B 1AGCA 1I3VA 1FNEB 1Y6NR 3TBTA 4F7MB 1QR1B 1U91B 1T83A 4HS3B 1A4KB 3MUY1 4WFGE 5ICZA 4NQDA 4M6NL 3TIEA 1WZ1L 1LO0H 4F57L 4KVNL 1CXHA 4X83A 2AS5M 3DURA 4XXCC 3DRTB 4GJTB 5HVHB 4Y2OA 3TBWA 3NFNA 3FN0H 1FZOB 3VXSB 3QAZC 1CDHA 3ORJA 1QBLL 4MAYD 2DLIA 4Y2DA 1NSNH 1V7NL 2FL5B 1OB1B 3MRGB 4YHYC 4ZXBA 4UNTA 2BERA 1T7XA 4PREA 2AJSL 1B2WH 1VESA 2JB5H 4HZAA 3ALXA 4U1HA 3H9SE 3MNWB 1FBIH 1NC4A 2VITB 1D5MA 2XICA 1I8MA 3BZ4B 1FL6B 4JO3H 4X98B 1BIIA 1CT8A 1KT2A 2PXYB 5FDWB 1TITA 4FQIH 5EORH 1CL7H 3RHWK 4ODWB 3KYAA 4MJ5A 2HJFA 2QQNH 3QWRA 2BVUA 1JGDB 2UUDK 2AJZB 5IFHL 2N7AA 5DMJB 1H3WM 1F4XH 2YA1A 2WBJB 4LARL 4D0CA 3LEVL 2UWEE 4L4TE 3TA3A 2BY0A 2ITCB 3CZFA 1BD2E 3F7RA 1B4JH 4RISH 5EZJA 1Q94A 1NAMA 3SN6N 2O5ZL 4OZIF 2NY5H 5IHUL 3EDDA 5EOQL 5T33L 3MGTB 3GI8L 4F8TA 3H3KA 1ORSA 4QWWC 2AAVA 3BDYH 4X6DE 2RIKA 4I0CC 2VDRH 4HK0A 4R4FL 1TJHH 4GKSB 3WUWA 4Y4FC 2V9TA 4JFOB 3JWNC 5CILH 2HFFA 1TZGH 3ZKNC 1E6OH 2HMID 1FE8H 2AABH 5EBMB 3PF2A 2VAAA 5KSBB 1CDCA 3EYUH 1NANI 5T3ZL 2PW1A 4DGYL 4ZO7A 3MPCA 3UJJL 2E3VA 2X4SA 4YXLL 2HWZH 2XN9B 1KEML 2NY6C 1G7HA 4R8WH 4RNRB 2OQJB 2L0DA 4XBEL 1LNUA 2APBA 3C5ZD 3MLWL 2GYSA 3OF6A 1MIEL 4JPVL 5J0BA 5C0BA 4GS7B 3EJZD 5CSZA 4KMQA 1RZ7H 5FIEA 3D0LA 4JPKL 5T1KB 3GKWH 3C5SB 2BNQB 4GBXA 4S1QL 3TO4C 3UYRL 3HUJE 1SMOA 1I8IA 1H3VA 2FB4H 3EDKA 1LEKA 3PDOB 4KTYA 3LSOA 2A77L 5FYKE 4MMXC 1WISA 5B3JE 1JFQL 1S7UA 4PRIA 5GISL 3LMJH 4Z7OE 3RWEA 5C0RH 3ARGA 4MNQA 4JZOB 5K9KB 1S7TB 5I16A 1ZHKB 3VFTA 3PGDB 4WUKH 1VDGA 3IFLH 3D9AL 2KQMA 5DSCA 4P4KA 4M1CD 3Q3GA 2FATH 2Z31B 5KVEH 1FGNL 3ARXA 5J12B 1S9YA 3VFWB 4XCCL 2NXYB 1R3KB 4D8PA 2XWTA 2QKIA 3VGFA 3QIUC 4YX2H 5C0JB 1HYRC 4WDIB 4HCRL 3WHE1 2VLMD 1QPPA 3V5KB 2DI9A 3TYGH 3GMOB 4HUKB 4PJ9B 2YD3A 3VG0L 1OTTC 2X6MA 1KLGB 4DW2L 5F9DC 3MJ9L 1SMAA 4PJCA 4WWKB 4OSUL 4K71B 4JRXB 1J12A 2EEDA 1I85C 1TTGA 1BZ7A 2VUYA 3MUHL 1IM3A 5HHPB 3CVHB 1KJ2A 1UWEL 3FB7A 2F5AH 1T0NA 4CVUA 3HE7A 4I0PC 2KQNA 5JUEH 2CIKA 3G6JF 5CSGA 3I85A 5DHXB 5CWSB 1CFSA 1RY7B 4L8CB 4NHUB 2EXWC 3MBEA 5F7WC 3ARDA 2BNRA 1NCDL 3LS5H 4LLVA 1ZLUK 3TV3L 4B0MM 3LHPH 3B43A 1U42A 2J5LB 4V1DD 1WEJH 2VZOA 4Z5RA 1BQHG 3QZWA 4O4YL 5IJKA 2W65B 3Q6GH 4K9EH 4I0KA 5L2KB 3RWFB 4ZG1A 1U36A 1IGTB 3GK8H 3C87A 3QNZA 4CGTA 5ENWB 3ARQA 3QCUH 1T2XA 4Y8AA 1U3HC 1C08B 1NCAH 3GB7B 1UFUA 3NPSC 3MO1A 3U36A 3CUPA 1QSVA 2E27H 2XWBB 4LCWA 4JQIL 2VQTA 5GS1C 4PJXB 3WLBA 1NH6A 3EJYD 4X80L 4KI5E 3G08A 1BLNA 1FNHA 3OXRA 4BZ2H 3PE9A 4ZOCA 5HGDA 1BZ9A 4N5EC 4CBPA 5I73C 2MCPH 1GHFH 1CFNB 3MREB 2BY1A 1QLRA 4X5XB 5DWUL 1A1NB 1DQLL 5I1DB 3QIBC 2ZKHH 4ODXB 3VFGH 1KPRA 3S34L 5JW3L 5JZ7D 1U6AL 1S7RB 4P2QB 3PP3K 1CU4L 4QHKJ 1TLKA 2IJ0C 1DQML 2DMKA 4X7CC 3OV6A 2BVOA 1YEGL 5DD1L 2EIZA 3QEQA 3J8F7 1IKNC 3FT2A 2P5EA 3IDMA 3ZHDA 1RFDH 4J3TA 5I76B 1JZ6A 1CLYL 4OF7A 5K93A 1FYHB 2MHAA 4YGVB 4JHAL 4N8CL 2GJ6D 4PJ8C 4HZLB 4QXTB 4LSRH 4AEIH 1HHKB 3MV9D 1NMCC 1FNLA 4HIEA 2C3VA 3OR7A 5CEYB 5BOPA 2CKBA 2BRRH 4MXVE 1GPOL 5DD0H 4DQOH 3QUKB 5J57B 2YD9A 2XZCL 3V4PH 3FB6B 4DUWA 4YDIL 3RBSA 5IMOA 3TN0D 1N0LA 2XKUA 5D7LD 1KN2H 4KK9D 1VEMA 1ZANL 4LNVA 2HFEB 1M7DB 4WI8A 3MV11 3C08L 3HG1D 1LE9A 1KLUB 3QUYD 1FO0B 4JFXA 5BXFA 4J2XA 4PS4L 5FA3B 2W0PA 4KY1L 3CFDB 4Z6AT 3IB4A 3GZKA 4CU7A 1WWCA 3IDIA 5EZOL 4PJIB 5A40E 2R0WL 3RPIB 1MRDH 2CUMA 2FEEI 2J6EA 5TF0A 4WFHD 3ES6B 3L3KB 4F58H 3B5GA 3LN9A 3PWNB 4F7EB 4MNHB 1RUKL 5D7SH 3OJDB 3D85B 1I1AB 4RFOH 4FQXC 3MXVH 4OD2B 5DJ0A 5CJBA 3QJHA 3RDTC 5C08A 1FFPA 2DQJH 4XNXL 3QO1A 3MRMA 4WHDA 1QTYT 5E1AA 2VDLL 3G9AB 1V8HA 4UOW0 1GZQB 2ERJB 1NFIB 3ULSB 1HNGA 5EIQA 5EDXA 3MACH 1CZ8L 1CD1A 1WFTA 4IM8A 3VD3A 4ZMAT 3Q5TA 4HWZA 2X9XA 3TZVC 4AIXA 4YC2C 3WO4C 5JQ6L 1KEGL 4P23D 3WJJA 1D6EA 3DV4B 4PGCB 4WU5B 4FFZH 5E0QA 2X1PA 1YEEH 1I9JL 3VFRA 5E94B 2NY2B 1PGRB 4G7VL 5L6YL 2DQFB 4I13B 3PGCB 4QLRA 5DD3L 4RGMC 2Z93B 3VD9A 2DWDA 2BP3A 1FFRA 2FJGB 5IFJA 2D31B 4NKIL 1I3RB 1UM4H 4YWGH 2YKLH 4CADB 3PWPB 4WFFE 4NRZB 4JN1H 2F74B 2QADC 5K59E 1N59B 3T4AA 3EYSH 3ILPA 2MKLC 3HCVA 1QUNA 3V5DA 1ULVA 3QRGL 2AI0H 4XH2B 1SEQL 2OL3H 1PFCA 5F3HB 3H9SA 3P73A 4M93B 4L4VB 3O3DB 2E9BA 5FFLA 1X4XA 5FOJA 4NZUH 2DI8A 2VLME 3BP6B 3RWGB 4LCCC 4G9FB 1I1YB 2H6PB 2PUQT 4U6HA 3MRPA 1RIVH 4J4PC 5CS7A 1XF4A 3M1BA 1R3IL 1S7VA 4ELMB 4UQ2A 1MWAA 4Y4KA 4R4ND 4Y1AB 3EO1B 4RZCA 1JTOA 3HUJF 2UWEA 4L4TA 1RJYA 2YC1A 5CLWA 4OD3L 1BD2A 2G75B 3VXTA 2CR3A 5DEFA 3TWCL 1ZT7A 5F8QC 1HHIB 1YN7B 5B3JF 1VEPA 1KNOA 5JIKA 4Z7OF 1R24B 1MF2L 2A6JA 2OR8A 3L5XH 4X6DA 1IL1A 1WZKA 4OF3A 1UKTA 5JO5B 5IWLC 4MNGE 1R3JA 1IGJA 3N85H 4L8SA 4MDJA 1KIRB 3FB8B 5DHVH 4ZS7H 1CDJA 4F37K 1RI8A 3OXSB 4FP8L 1YPZE 3PGFH 4PRDA 3NFSL 2R1WA 5AUMB 4FXGA 4QHMA 3RGVA 1Z5LB 1MHHA 1FZKA 3IF1A 4G6AD 4LLWB 1D5IH 2YBRA 1C5DA 1E4XL 5I1JH 1LQSR 3C60A 4X4ZA 4X8JB 4HC1L 1CBVH 5DJCB 3QDAA 1HOCB 1GGCH 3B2UC 1MCWM 2L7JA 4JPWH 5F1IA 3TJEH 3UBXI 1EO5A 4JFHD 1NC2B 3WFHB 2Q7YB 5GZNC 2CD0A 3VXRB 3MOQA 5EO9B 2VQUA 4EVNB 1LP9B 3S5LA 1ZHBA 2IQ9L 3VGEA 2NY4C 3PIQA 1BJ1H 4M43H 1J5OH 4IJ3C 2ZUSA 3DI3B 3GJEB 1LHZA 1PW3A 1JHTA 2RCSL 4TUJB 1ACZA 3PDDA 3FTGB 4HAFA 4NQSB 2EDLA 2YA2A 2ADJA 1I7UB 5HDQL 4FQ2H 1NSNL 1HH6B 4LEOA 1E0OB 32C2B 3NBNA 3HNVL 1MCLA 3OL2A 4P2OD 4MVBD 5CFHA 4H8WC 3O6FC 5KW9L 3VWKD 4PRHD 1JL8A 1WC7A 3TH2T 3WFZA 4UT7H 3ZSTA 3X3FH 1S78D 1YEHL 2GJ6E 1NDGA 3MV9E 4PRNA 5T1MA 4KPHL 1H5BA 4IEFB 3QDMA 1RUPH 2R4RL 2BVYA 4LSDA 4BFGA 2VDKH 5KVGH 2HFTA 1EXUB 3DO3A 5B3NA 4HS6B 1R3LB 3HZMA 3D3VB 3MRRB 1GGBL 3E8UH 1A6PA 4FQCH 5IVZB 4TVSa 1U8PA 3BPNB 2PTUA 3CD4A 3QH3A 2BDNH 4G8GB 4HUUB 4NRYB 5T5NG 1T5XA 3I3EA 4HKJA 3HG1E 4Y0GA 2DYPB 1JE6A 2MQCA 4IOFC 5HD8C 4GUPA 1IILE 4OCYL 3H42H 4POYA 5D9SA 4TNWF 1AQDA 3I2CH 1P9MA 5F3BA 4D9LL 2NR6C 3QWOB 5FO7A 4WFHE 4K3DL 4IRSA 4KJPD 3VDCA 4JGMA 4ZQKA 4NQED 1AKJD 3UTPD 1V7MH 3QG7H 2EDOA 2FBOJ 5ID0A 3QUXC 3BZFA 3MYZA 3MOBL 3M07A 5LQBH 5ELIA 3EYUL 3MRFA 5TPWH 2MQ3A 1WJ3A 2P46B 2B2XH 4WUUA 1LGVA 3RUGE 3BP5B 1DVFC 4YO0B 3MLZL 2JJSC 5T1LA 4IRJB 4MXVF 3RBGA 3WN5B 3RZWA 2ZNWA 3MLYL 1JPGB 4I8DA 4KVCH 1RZJC 5F97E 3U7YL 1JTTA 4R90L 3P4LA 5L8LB 4ZS6D 3BE1H 2AXGB 4W6YB 2CDFA 4QTHA 1QRNB 3HTLX 4WTZG 4X5WA 1YQVH 5FYJD 4KTEH 4WO4B 3O8XB 3BUTA 3IKCA 5E6ZA 4JG1L 1FRGH 5ITBL 2HP4A 1AIFA 5CP7B 3U46B 3JV4A 4CRPA 2FB4L 5E70A 4KXZI 4ETQA 2J4WH 3H9HB 5DT1L 5IB5B 4FFVC 3I50L 1JK8B 1NMAL 1VPOL 4QHUB 5IJVB 5JXEC 1A7NH 4WWID 2AJ3A 4Z7UF 1AE6H 3FFDB 3KLAA 3OJVC 1CFBA 5EOTB 4PJDB 1J0YA 4LVEA 2EECA 5AWNH 1AQKH 3GJFK 3WDHA 4JM2A 3MXWL 5EPMA 4QRTA 1GGIH 4UB0H 5AZEL 3K74B 5FECA 4X6EA 5E5UB 1VFMA 1UH2A 5D1XC 4M6AA 5H35A 1F97A 1T1XA 4AMKH 4XNZC 1TCRA 1FVEA 1RZGA 4QYOA 5TE4H 3TJHC 4YR6B 3PL6B 3T3MF 4XBGB 3EOTH 3MRQB 1UYWL 1Z0MA 2PETA 5HGAB 1JWUA 4ZFFB 5GJTL 3QQ4B 3U30C 4OLWH 1MJJB 2C3HA 3UYPA 3BKCL 1FIGL 2DBLL 2E7MA 3OR6B 1GVIA 1D9KB 4M6ML 2FECL 1ZLVH 2EYTA 1BQHA 1RHHB 2A6KB 3BIKB 4H0HB 2HLAA 3S36H 4KROB 3LCYA 3O2WL 4LIQL 1T22A 2Q8AL 5IG7B 2LU7A 3EOAA 1QNZL 2AEIT 1TJGL 3K4ZA 5DVMA 3JUYA 3VI3E 5K59F 1G7MB 1MFCH 4Y5VA 3KWWA 3DGGA 4H8WL 3PHOB 4C59B 5IHZA 2X7LB 4GRMB 3WUZA 3QHTC 2V6HA 2ZNXA 2OZ4H 2FDBP 4XMKL 3WIIH 1B6UA 1OGAA 1XMWA 3GSVA 4X4XB 3BZDA 4XWGL 2DQGL 5TH2A 5FO9B 5ANME 4NGHL 4XPFH 1A7PH 1QEWB 1PDKA 4U3CA 4OBSA 2IFFL 4M3JA 1F4HA 2W38A 4BSWB 1XR9B 5KS9F 2UY6A 4MQ7A 1J0JA 2DMBA 5IF0A 3V4VL 2WP3O 2E27L 4HFUH 5EH1A 4JFHE 1PG7H 4G8IB 1OM3H 1PAMA 2X1WL 4U1GB 2P7TA 3D2UA 5DK3A 5LGJB 3KYKH 1U3JA 4RAVA 4XPGH 4TQEH 3TBYA 4JREB 5C0AB 2ZJSH 3CDGB 3DX8B 4YHNB 1CL7I 1S7QB 2YHGA 4G8FA 1LO3L 2QR0B 1G7JA 4ELKB 1OL0A 2F19H 4ZUTA 1YMHB 5DRNA 5KSAC 1EDQA 2ZKHL 4CL7A 3S36X 3R06A 4YXKH 4QXGL 4NDMB 4KQ3L 4LK4A 3RTQC 2DLFL 3S98A 1OAZL 3KPSB 4Y16B 5GZOD 3B5HA 3QCTH 1CN4A 5TGBB 1YPZF 3NFPB 1HKLH 5DFVC 1K4CA 4JQVC 2ARWA 2HH0L 3MRKA 3O2VH 1MIML 1RFDL 1T3FB 3OG6B 4P2RB 1KB9K 5SWSB 4Z7NE 2OI9C 5F89A 2I07B 4J8RA 1PQZA 4WV1A 4G6KL 4PJEE 2EE9A 4IRZL 4MXWL 1KYOK 1OARH 2ZSVB 2XA8H 4Y19D 1UWXH 1HCVA 4AEIL 4AT6A 1RZJL 2ATKA 4Q97A 4LCIH 3HNTL 3I9GL 4X6BB 4X9HA 4UV7H 2IH1A 1X6NA 2R2EB 3P77A 4M7JL 3V4PL 3GI9L 5LCVH 1OPGH 3ZHLA 4XP5H 4GRWH 5CJQH 3MGAA 4P5TD 4M48H 4DAGH 1A5FH 4CVZB 2VO5A 4RFEA 3RY6A 5DHYB 1VKXA 2CGRL 1XIWC 1GAFH 1UB5B 4Z78A 1JPFA 4KJQD 4XHJD 1J8KA 3LOWA 5HVWA 1KFAL 1JPSL 2YD6A 4P3CH 5JIIA 3FFCB 1TQBC 2R4SH 4R6UA 1IQWH 1A9EA 1MRDL 4U1LA 4J3WA 1RJLA 4Y4FB 3MRLA 3UTPE 1BVKB 3ROOB 4U6YB 1T66D 3HI1A 2NXZD 3K0WA 4LLMA 4F58L 3LV3B 2EKSA 1DZBA 3DSFH 5D7SL 2YD2A 3LRSA 3UBXG 2V2WA 4L29B 5GGTA 2R8SL 4C56B 4XP6H 2CK0H 2F9BT 4UT9H 4ZFGL 4U1KB 1HSBA 5GSVB 2OR9H 1IAMA 1R5VA 5JW5A 1IGIH 3SKMA 2FGZA 1U95B 1A3RL 4MSWB 4O2CB 3B9KC 5C8JA 1X5YA 1PLGL 3KNBB 4KKCD 3ZKQD 1YY9C 4HJGB 2V7NA 2QHRL 3VFMA 4HLJA 3KLDA 5HPMB 4JFFA 4LRNH 3O9WD 2R0KL 2VH5H 1RJZB 4F80A 2I60H 4EUPH 1QYGL 4JGUA 3K8LA 4FFWC 4LVNB 5BVJB 1CLZH 2H3NB 5FYJE 2J8HA 3X13A 2A6DB 4TOYL 1FNSL 2P8LB 1YJDC 4KMLB 4MJ6B 1EGJA 3GMRB 2GK0B 3LH2L 3QHFL 4FFZL 3P40A 1X5GA 4JPIB 1BBJB 3TO4B 4AH2A 5BV7H 1MHEB 5DLML 2YA0A 2X1XR 5D7KE 4BK4A 4EI5B 3SE9H 3TT1L 2E9WA 2IPTH 3DHJA 3LB6D 3GBMH 4YLQT 2B4CC 1EHAA 4HKBB 2D4FA 5FM5M 1JRHH 1VFOA 1I7ZB 3DIFA 2FX8L 5D2LA 2IQAB 3V8CA 4MS8D 4FZEL 1MCKA 4BZ1L 4O5LH 2NNAA 3CVIH 3QJFB 4D3CL 5CBEB 5I30L 5L88L 2YPVH 4N5UA 4K23H 2GIYA 4RIRA 3HC4L 2HFGL 5GRUH 3R1GL 3A6CL 1YNLH 4ZAKB 1UT9A 5H2BB 4Y4HC 2GJ6A 1EAPA 5D93C 3RUGF 1RIHH 2XI9A 4LU5L 5MHSE 1IBGL 3VXSD 3QXAA 1P7QB 2F54E 4B5EA 1P5VA 4YFEA 2B5IB 3KPNA 1YY8A 4O2EB 3WSQL 4HKZA 4CKVX 1TNNA 1LO5A 4ZTOL 1KUMA 4YDJB 1EJ6A 1UXWB 1P4BH 4YBQC 1RHFA 3MRJB 4KJYB 2ICWB 2CLVA 2WV3A 4XZUA 3RL2B 1FN4B 3HG1A 4R2GC 1MLBB 2DQIL 3MZGB 1CCZA 4JM4H 4F7TB 5I1LB 2ZSWB 4KKLD 1EEYB 3OB8A 2PXYD 2I27N 4ORGA 2W91A 4JHZA 1JJUA 1AR1D 4YFDB 3LZFH 3HC0A 3L3GA 3X11B 2NW2A 4NPYB 1TVBB 4TYUA 4NO5B 1HIMH 2VDOH 3D1MC 4NUGL 4LLYB 1KJ3L 5FGCB 4RGNB 4KHTH 3VGHA 1EH9A 5IB3A 1A6VH 3AMLA 1FG2A 1T89C 3IJSB 3IT8D 4JHWH 2ED8A 4PJGA 2R56L 3MFFA 2QSQA 4XPAH 5LJYH 2H2PD 3T0EC 5CKAA 5H94B 2UUDH 3W81A 3BP7B 5CP3A 1KPUB 2ATPB 2XWJB 4OQTL 5F7UA 1X3DA 2VDNH 4P23A 1GGCL 1XF5A 5F70A 5GS1B 1J0IA 3DV6A 5FF6B 3ZDZE 3B2VH 5C0EB 3I6GA 4I48B 4NKMB 4HPYL 3ALPA 3UC0H 1EHLL 5ILTH 3T4YB 3VWJA 1J1PL 4GG6E 1EEQA 2BMKB 3PQYB 2K1MA 2MMXA 4YBHA 1DBAH 2X09A 2HLFD 4ZUWB 4AQ1B 5I73B 2XN9D 4HUXA 1QVOB 2OK0H 4BH7A 5CJXA 4DVBA 5EWIL 1DEEA 3QIBB 3VI3F 1GOFA 1T5WB 3FN3A 1G7PA 2P1YA 3HAEH 3NGBC 4OZHB 5FCUH 1JGVL 3ZE1E 3VXQB 5J56B 3OKYA 2PYEE 1BF8A 5T1KD 2VXVH 4JLRA 1MWAL 3KLHD 3QRFM 2BNQD 5DRZB 4P5MA 4NN6B 5EN2A 3IU3A 5ESVB 3DRQB 5E7FA 3B9AA 2D7PA 1OSPH 1MCJA 3IGAB 5F1NB 3GSNH 3KJ6L 4X9GA 15C8L 1CTNA 4N90D 1KJVA 4Y19E 4LSVL 4M62L 1QQDA 4XTRC 2YD8A 4MAYC 1UCTA 3MTRA 2PR4H 4UT6H 3HZKA 1NGPL 1OGTA 2XRAL 3MCLH 4WJ5B 3TT3L 4MQTB 4XNMB 5DS8A 4RWYL 4OFPA 4M9OA 4PRPD 4JVUA 1YJDL 3F5WA 1KXTB 3MLXL 3LN4A 2Z31D 1MOEA 1PKQB 4YHKH 5C0GB 4JAMA 1IAIL 4PJFB 2NXYD 2VSCA 2B4CL 4HPOH 1S9WB 3N1FC 2MCG1 4Z95L 3VXMB 4IS6B 1TFHA 3UAJD 3BPCA 4PJ9D 1EO7A 3H42L 3ZTNH 1MRFH 1ES0B 3LN5B 1C12B 3P4MB 4ZFZA 2JKXA 3V0WH 2R1YA 4WWKD 1D5BA 4XVTH 5IMKB 1B9ZA 1K8IA 4JRXD 2P8PA 3QUZA 2XNAB 2YWYA 4KUZL 5C9JA 4NN7C 5T5FL 1A0QL 4HIIB 1SY6H 4MD5A 4M9PA 4N8VG 3RDTB 1ZS8B 1F45A 1UC6A 3MJ8A 4Z7NF 5CBAB 1A3LL 5ANMA 2GCYB 4QRPE 4PJEF 2DQCH 3BN9D 4YE4L 2KUTA 3ARFC 4RA0C 4WTZA 4QRUA 1WTLA 1MCQA 4KFZC 2ESVD 4N8VB 4PG2C 3P9WB 2EDEA 3O81A 5TDPB 4CVXA 1A1OA 2VE6B 3TZVB 1S8DB 4YC2B 5J3HD 5IVXA 1HQRA 2EO9A 2GSGA 1PZ5A 2Q76B 5I8CB 2ZCLH 2IPKB 1R5IB 4I77H 4RGMB 3O6ML 2G2RB 1ZA6A 3BMVA 3QDGE 3MMEA 4HT1L 3HKFA 1ZLUH 2ICES 2XTLA 2UV3A 2VLKE 3V0VA 2NW3B 3B4NA 4OZGF 3SOBL 3TH4T 1ZKAA 3VMNA 3C5ZC 4H20L 4LLDB 5JTWA 4NRXA 4OIBA 3FO2A 1A6ZB 3FQRA 2IAMA 3QUMA 5MI0C 2NY3C 4IDJL 2FIKA 4NP4H 1F4WH 3GSXB 1CG9B 1NBVH 3IDNB 4PIRF 4RX4D 3EYFA 1KENL 4NJ9H 5B39G 1GGIL 5LXGL 3VXSE 2ZUVA 3E3QE 3DOSA 3IAQA 2IMMA 1Q0YH 1T1ZA 4G5ZH 4DKEL 3PXHA 5B39B 4P2QD 2ARJQ 2P8MA 4HIJB 3VDAA 4HEPG 2B1HL 3D5OF 4U49A 4ZTPL 3I3DA 4UINH 2DQUH 4P9HC 1BREA 1CYGA 1W0WB 2CKNA 1LK2B 1UM5L 5DVKA 2FX7H 1M6OB 2R2CA 3KPMB 3JVGC 4YDKH 4K8RD 2VABA 3ZT6A 4NUJA 3FKUS 3VFUA 5DJDA 1RSFA 1EZVX 4M7LH 2VIRA 1G9EA 1BPVA 4X4YB 3C5JA 3S36L 1JV5B 4L3EA 1IAOB 4PY8I 4X4ME 5I2IA 5KN5A 5IEHA 4TVPE 1UZ8B 3MFGB 1RVFH 4N68A 5GGSB 4L3CA 3B5TA 1B3JA 1Y0LA 4HSQA 1T0MA 3MNZA 4MA7L 4BA8A 1NAMH 3S35H 2BC4B 1MHPL 1XGQB 2CO6B 1OF2B 4ALAL 4HIHA 4XCYB 3QFJB 1PD6A 2VJXA 4M5YL 3K4DA 1U92A 4N0YL 4E5XB 4R7DA 2FBJL 1U8OB 1DN2A 4DWHA 5IGXH 3BAEL 4QHNB 1ETZA 3A6OA 3NACL 3MRNA 3HB3C 3VH8B 3REWB 5HI5D 3D85D 1I1AD 3R4DA 5KSBE 3QDJE 4KK8C 3L7FA 3T09A 2GTWA 1Z9MA 5FUOH 1UZ6E 2IGFL 2W9EL 3BGFC 2XN9E 2WP3T 1RUMH 3O2DA 3O3AA 3UTOA 4KWUA 1JGLL 4OCXL 2X4PA 4WI5A 4RMQA 4K94H 4Q74A 2GUOA 1H8SA 3S9DB 4M03A 1KACB 2P49B 5C09B 2VLJA 3MUJA 3WIFB 5GGVL 1PY9A 1ZA3B 3TPUA 2OSLA 2CDEA 2X70A 4OFYA 2BNQE 3EJYC 3O6FB 4ISVA 5I6XB 5CD3A 3H7BB 5HI3D 2AXHA 1S7WB 4HGWA 1MH5B 3IFPB 4GW1A 2F54A 2JELL 4FZ8H 3GSWA 2WIIB 5IK3A 4PV8B 1OLLA 5L2JA 3OX8A 4PTUB 5EU7E 3GIVA 1AO7A 5GIRA 3I6KA 4N0FB 5E5RB 1P4LB 4L8DB 1G7LB 1IMHC 1IZKA 4PRPE 1QO3A 4JFZH 4UIKH 3QHZH 2BVTA 3ULUD 1G0XA 1OPGL 4UOW1 35C8H 3O4OC 1H9VA 1F3DH 3G6AB 1MLCB 1U8JB 4L4VD 1FFOA 4TULH 43C9B 2XG5A 1AXSB 2AK1L 5ICXB 5INCA 1MAJA 3BGAA 4WNQA 2ZOKB 5IB4B 4WEUD 4G9FD 5CZXC 3UBXA 1IM9B 1FDLL 5CEZL 2J12B 4JRXE 1KJ2H 1RZKC 4Y1AD 3TN0C 1HHGB 4JY6A 3GIZH 4JKLA 3QUXB 4KK9C 4A2LA 1I1FA 4ODUB 1BVLA 5DQDL 3O4LA 5GRVK 4MCZB 1WAAE 3ILQD 1IGMH 1JHLL 4MB4A 3FCTB 4NM4L 3QUYC 5IBLD 1K3ZA 3JTSA 2ESVE 5HBBA 2SEBB 3LKRA 1SJEA 1CXFA 1YNKL 1J9CT 2D03L 4R0LC 5HDLA 4YHML 3TGXA 5E8PB 4P48A 4S2SB 2JB6B 2NX5B 1MCOL 4PYGA 4P9HL 1MFBL 3BO8B 1NCCH 4ZFOB 2OTUB 1KTLB 2XXCB 4GG6A 3WFCH 3ARYA 4JFEB 3T1FA 4M7KH 3B3IB 4WIQA 1NL0L 1QG3A 3W39B 1FZJA 2BHZA 4U0QB 3GBNL 4BELD 4OLYH 4XPTL 4XCNA 4PY7B 2E9IA 1JRHL 1KG0B 1SM3L 3O6LH 4P9ML 4JZJC 4NO0A 5E9DA 2E9JA 2PYEA 4LP4A 4YHIA 1DN0B 5D1QA 3DNKA 2JF1A 1NC2D 1P2CB 4PPTA 5J11B 5IBTL 1BFOB 3VXRD 1BFVH 4LCUB 5D7JC 1Q72H 3P11L 2FJHA 3RA7L 5C0DB 4QF1A 4JZNB 4HH9A 5D1XB 3VFNB 4OUOA 4GXUN 4PRAA 2DMCA 3VRLE 1LO4L 4Y19A 5DF0A 3RZCC 4MWFA 4LLUA 4DVRL 1FNGB 2I5YH 3DVNA 1CWVA 1UA6H 5ALCL 2I9LA 2ZPKH 4P2QE 1IC5L 1DLFH 4WU7B 2NY0B 1ZLWK 3F6LA 4G3YL 1IC4L 4WHTB 1EJOL 3O3EB 4QHLB 3UCRA 2A9ML 3OKNB 2Y23A 4S1SL 1INDH 1F2XK 1T4KB 2QSVA 4LSTL 3B83A 1Y18A 1U8MA 1J10A 4OBRA 2HYMA 2GSIA 2I26N 4AL8L 1DQJA 3ULVH 2CKBH 1MJUH 2QSCH 4P4RB 4Z0BH 2GTZA 4P99A 4DZ8B 5EB9A 4PV9B 5J6HB 4I18B 1EO8L 3D3VD 3FO1A 3K2UL 1G9NL 4MJIB 2ZCHH 4R4NC 4G8GD 3H3PL 4OD1L 3T0AA 1LD9B 2HJKB 3SGDH 1HH9B 3AREB 5GS0D 2DYPD 1R5WA 3QFDA 4QRPA 1U93B 5I17B 1CICA 5I1CL 2BFVL 5IMLB 1CXLA 3SJVB 2OL3B 4G42A 2GAZA 3V6ZA 4DGIL 2W0FA 2J6EH 4PJIE 3LKQA 4F9PC 5ACZB 4I4WA 5TFSL 5TQ0L 5JOFA 1G0YR 1XGYL 2YS4A 3OGOE 3DUSA 1GSMA 3KXFB 3U4EA 3NAAL 1OAXH 3RWJA 3B8YA 5IQ9A 3WE6B 3IYLW 2EDNA 3QEGL 2X4OB 3QBTB 4X7EC 2LVEA 1CK0H 3TP4A 2EE3A 1N0XL 3MYJB 3QDGA 4KDTA 1GC1C 2VXTH 2VLKA 3MA9L 4IRJD 3BOVA 4OGYH 4GOSA 3BT2H 1R3HA 5IEKB 4KTDH 4F7MA 3BP4B 1RZKL 1U91A 1A4KA 1KOAA 2Z91B 3H2WA 2ZUQB 1W0VB 1QRND 4Z8FH 2J88L 1LO2H 1BOGA 3FN9A 5IUSA 2BHUA 5EA0L 4HUVA 3O8XD 3VU2A 4M7ZB 4GMTH 3UPRA 1FZOA 3NN8B 1ITCA 5DHVB 4ACPA 4MD0B 1F6AA 2VXQH 1TCMA 3R0NA 1MCWW 3MRGA 4LSUL 5E08L 43CAA 5D5MB 2OJEB 5FA4B 3P0VH 1ZT4A 3NCCB 5I1GH 1NFDE 1TZIB 1J18A 5KG9B 4DOHB 3GMPA 4ODVH 4PLKC 3K8KA 3VJ6B 3ABZA 1OQOA 5KSBF 1NCNA 4EOWL 1A21A 3ULUE 1G7QB 1F5WA 3V4UL 4F15C 3C9NB 4P2OC 4N0UB 2ZOLB 4MVBC 4L4VE 2VITA 3VWKC 3MLRL 5I1EL 5L7XH 1C1EH 3BZ4A 2BJML 3EUUA 4NSKB 3JV5A 1SYSA 1T2JA 3KJ4B 3Q5OA 4HPOL 1S78C 2YRPA 2IFGA 4HF5L 4OFIA 2XKNA 1XIWB 2R1XB 2WANA 2AERT 3TIDB 8FABA 7CGTA 1CDGA 2AJZA 2R15A 3PL6D 1TQBB 4F3FA 1S7XB 3ZTNL 5HTSA 1LK3L 3FQUA 2B0SL 4X99B 5T3XH 4K94C 1JWSA 3GJFH 3NIGF 4Y1AE 1K6QH 3FO9B 5T1DL 5KBNC 1TVHB 5H37H 1UKQA 5DVOA 2FO1A 3DWTA 5EOCJ 1D9KD 4R7NA 5EFIA 1FC2D 1KJMB 1FPTL 4XCFH 1KIPB 5C7XH 1AHWA 5KOMC 4KROD 4ZSOA 5EU4A 3AU1B 4YIQB 3OPZH 2Y36H 3RI5K 4P46B 3ARBB 4GKSA 1JF5A 4L9LA 3LKOB 4HLZH 3E6FB 3CFBA 4Q0XH 2XPGB 2XTJE 3U6RA 4X5LA 3LKSA 3QDJA 2JJWA 2Q20A 1FCCA 4LDLB 1BM3H 1VERA 1CIUA 4G9DB 3HLAA 2UVEA 4WHYG 1MREH 4I77L 5GS2H 3U0WH 2Y9RT 3LIZL 3SE8L 5MP6H 4F33B 1KF9B 4RRPG 1W72L 5SWZA 3VGAB 4G8EB 2ZUWA 3NH7L 4Y5YA 2DKSA 3TH3T 1Q0XL 1ZTXH 5AEAA 4OM0H 2C9AA 5JDJA 5C0AD 1LP9E 2D0GA 5FYKH 5DGQA 1WAAF 4PB9H 3CX5K 4Y4HB 1OW0A 1F90H 1N2RA 5FGRA 5DC0A 5FUZL 2CLZB 4P0DA 5C07A 3O6KL 1NBZA 2A9NH 3MBEC 3LEXA 1T6WA 3G5ZA 4A6YH 2G60H 1ZHKA 3PXJA 2EIEA 5DJYB 3UXFA 1MAKA 4G5ZL 4PRPA 4NBZB 2VNCA 1OHQA 3U2SA 5BO1H 5JOEA 5D6DC 2EZ0C 3KAAA 3KPSD 4Y16D 5MEPB 1AGFB 1LDSA 4NNXA 4WCYL 3T8XB 3KPRE 1O5DT 4XC1H 4ZPVB 5C0CE 3STLB 5C0JA 2BOBB 3SDAB 3OMZA 5D1ZB 1GC1L 4P2RD 5SWSD 1DQDL 2AGJH 2AJYL 1WTGT 2EYRB 4JDVB 3L7EB 4QOKB 4PJ9A 5SWQA 3WNMA 1E4KC 4JDZA 4WWKA 1MVUA 4PJXF 3D3VE 1X5KA 3SDXB 3WJLC 1RJCA 3EGSB 4E41E 1RURH 1IFHL 3TYFA 5BQ7B 5HHPA 3CVHA 2W60B 2FSEA 3FQWB 3HA0A 4G8GE 5C0NC 1RZ8A 3K46A 5GHWL 1J7VR 1EMTL 2XT1B 5E1HB 4BH8A 5IKCB 3WNPA 3QA3B 1VEOA 2O5XL 5CWSA 1UCBH 3EFDL 1V3MA 2OXHA 1NUDA 4O2FA 4J3SA 3SQOH 4KZDH 1MCBA 2ESVA 1QLFB 1VFBA 4LLQB 2G5BA 3D25A 3CU1A 3FFCD 2HVKB 1ZHLA 4LHUG 1MCSA 4Y4FD 2EDWA 1E4XI 3UTTA 4JVWA 3TVMA 3O0RH 1SJXA 4C56D 1SBBA 3SKJL 1MFEL 3WHXA 4BJLA 4YUEH 4AG4H 3GSOA 4K3GA 1ZXQA 5TQ2L 4KKNA 3U4BL 1N64H 1RUML 4XAKD 3EYOA 3SKOB 1CD8A 1ND0B 3FB5A 5IB1B 3C2AL 2IEPA 4P3DB 3ULVC 3SY0A 5E8EB 1SBSL 2NY7H 1K85A 4XCEA 4LBEA 5B8CB 1T2QH 5KVMC 2JIXA 1QRNE 4N0RA 3L95B 2DOCA 3CFKA 1U8KB 2JK5B 2I9TA 4YH6A 3MRIA 4NYLA 3U0PA 3ARSA 4RX4A 3TO4D 4ZODA 4BSVA 5A43C 3MREA 1LEIB 1DUYA 3BSZH 1SEBB 3GMLB 5EO1A 4OZFG 4EI5D 1PSKL 5K9JL 3F7PC 4L8BA 4DUVA 3FOLB 4PJIF 1D6VL 4RCAA 3MOAL 1AI1L 3RIFK 1NLBH 3IJYA 5INDB 3SCMA 3GGWB 2AW2A 2D7QA 2R29L 1U2CA 1RMFH 3TCLB 4JDTH 4PJDE 3AFLA 1EEZB 3EDJA 1DBJH 2BVPB 2NLJA 4JFZL 1I1CA 5GGVY 4UTAH 4YAQA 1WCBB 3VXNB 4LQFH 5AAWA 1WGOA 1RV6X 3QIWA 3OAUH 1VADB 3AY4A 4H26A 4X7SL 3EO0B 1P7QD 1R6VA 4HKXA 5CJOH 4YNYB 4J3OC 3SDCA 2X4NB 1OTTD 5EUOB 5J1AB 1SVZA 5EC1A 5GGUB 3VCLB 3DXAE 1MEXL 3T77A 3PABA 1S7SB 1FV1B 5FYJL 3WEXA 3WJJC 1YECH 2BHYA 1NEZB 1OAKH 1JYVA 1I7RA 1YEJH 1Q9OB 5DZOA 4P5TC 2EC8A 3L3DA 1RIUL 2Q3AA 5FA3A 2E6JA 4DEPC 1DBMH 1H3PH 3ARFB 5D6CB 2EXWD 4PJIA 3TBSA 1W8OA 2HVJB 5MEOA 2Z8SA 3QQ9C 4C57C 1NDMB 1UADC 2VSDA 2P48B 3QEUB 1A2YA 2FJFA 3GSUA 3CK0L 3BI9X 1ACYL 5FYLD 4RQQB 1T66C 4RGND 5ETUB 4AIZB 2NXZC 1NQBA 3MLVH 2DICA 3ELAT 2VC2H 2H1PH 4HH8A 4LGPB 1W0YT 4NZDA 4C83A 1P4IL 4GRWB 3ULSA 1OP3K 4FABH 1RUQH 4MDIA 3CLEL 3RJQB 1C5BH 4TPRL 5K9QI 3STBA 4NKOA 4ELMF 1L7IL 2X4RA 1XCQA 3O9WC 3QISA 2R23B 3M17B 1S5IH 3SHSA 3OZ9H 3RJDA 1FCGA 2NY3B 4PJBE 4AK1A 4Y4KC 3AXLA 1I9IH 2Z93A 4LAQL 1KB5L 1NLDL 4U33A 1ADQL 3PQYD 4RDQF 4YZFE 4I9WD 3NA9H 1MQKH 2D31A 5E4EC 1RULH 1F42A 1P53A 3MCKB 4L5FH 4NHCL 4OLEA 4W4OC 1X5JA 3WIHL 5FB8A 3QXDA 2R2BB 2Y72A 3QIBD 4JRWA 5I66A 1NFDA 1YQ2A 1N59A 3T2NH 2ICWJ 4Q58C 1IARB 4IMKA 4EUPG 3KPSE 5C71A 1YEKH 3PWUB 3SO5A 4JRYE 4PJ7B 4W70A 5HHME 4GRLC 3HI6L 5F3HA 2VXUL 2Y06L 1CQKA 4UDUB 4L4VA 4HWBA 4EUPB 3IXAB 5SWSE 3WO3B 1G1YA 2DKUA 4DKFL 2IANE 5HVHC 1VGEL 3IVKB 3F7VA 4JFQA 3QQNA 4OLVH 4XNQB 1I1YA 5HYSG 1YMMA 2HRPH 5BV7B 1ZT1A 4YQXL 4XAWL 2IALB 4EI6A 3BWAA 2X4TA 4LEXL 3GNMH 4EBQH 5JOPE 1B4RA 1U8HB 1HI6A 3HZVB 1DSFH 3C6LA 3EO1A 5BCAA 3MODH 1LP9F 5HHOB 1Z3GL 2WINA 4EDWL 1WCQA 3B6SB 2VLRB 3A6BH 1YN7A 5CIPA 3NCJL 2EH7H 4Z77B 1IGYB 4FQ1H 5GRWA 2YD7A 3DETC 1XCTB 3VXMD 1MAMH 4KKLC 2I24N 1XGRB 3BESR 4BQ6A 1FL5B 3WFBL 1OLZA 2PXYC 1UQSA 3DUUA 4P5KA 4O02L 3FFCE 3FT3A 1AR1C 1LWRA 3RWDB 2IBZY 5BZDB 3LKPB 1KIRA 3FB8A 3WFEH 2PKDA 3U9UA 1FH5H 5E2UL 3MJGX 1XR8A 2WNGA 4XP1L 5GGTH 4AENB 4EZMA 4NCC1 3KPLA 4IIQB 3JTTB 2P47B 4C56E 3RDTD 2F53B 2WBJC 4QT5A 2Y5TA 3BGFB 3LRGA 5IW1B 4XAKE 4M61B 4X8JA 4DFIA 3RWCB 1KBGL 4OF0A 5DJCA 2H2PC 4O51B 5GSRB 4OCWH 5FUCC 4Y5XB 1X5XA 5TDOB 1UKSA 4MHHI 3FQXA 1ROWA 3TZVD 1DL7H 3THML 5EO9A 5A2IH 4YHLL 5DK0B 1IAKB 5TDNA 5ACLA 4LPUA 3BH8A 1YNTA 4OGXL 3U48A 5KSVA 3HE6C 3FJTA 5EIIB 2VXSL 5EULV 4B7LA 4GMTL 4NKDA 4TUJA 2HLFC 3PWVB 3IFNH 1ZVSA 2YPKB 1WV7T 3GMQB 2AJUL 1A9BA 4IRSC 3P9MB 4GS7C 2HKFL 1EUTA 3KPRA 4KRPB 3KLHC 1OWRM 5C0CA 1L0YA 5ESAB 5FYKU 2FGWL 4FS0A 2FCBA 3CCHB 4WW1B 3DX6B 2OCFD 1U8IB 4JQXC 1QFHA 3MLPA 3ROLA 4KHXL 4S1RH 3KYOB 2Q6WB 3L3OB 1YUHB 3QEHB 4AYFA 3D3VA 3PP4L 1GGUA 2J8UB 3REVA 5EU7C 4E41A 2ZP0T 5DYOA 1M05B 5ESQB 1U8NB 1A47A 4JO2L 2J1KA 1M71B 4LCYB 3HAEB 4YHZH 2DYPA 3HFML 4LKCB 5KSUA 5I0DA 1F3JA 3TNNB 4GSDL 2BOCA 4OIIH 5GJSL 2O5YL 1DP0A 3AVEA 3GUTA 1OY3B 4QY8A 4P57A 1I9RL 2AK4A 1FORH 4GAGL 1FVDA 3GSNB 4R0LB 3C8KB 1F4YL 3MROB 2CRIA 4M5ZH 1OAQH 5F7YC 5AYUL 4OKDA 1YEFH 3K81A 2Z35B 3AMKA 2BSED 4PJDF 4CMMB 1H8NA 4K71C 3U9PH 3C6SB 5I18H 5FYLE 5FGCE 5ISZB 4Q0XL 3RAJL 4HQQL 4G6JH 1TJIH 3IDGB 4RRPA 2Q8BH 5C70A 2XKSA 3RL1B 5KVFH 4RWHA 4ODSL 5F7FA 1GJIA 4XP9H 4Z7VB 4TRPL 1I8KB 3QFJD 1BX2B 5CP3H 2AJXL 3MV01 1QFWL 2DS4A 3NCBB 5FK9B 1J8HB 4PTTB 2ED7A 1NGZA 3GDBA 3FQTB 4JZJB 1MNUL 2AXGA 3IAPA 4Z76B 4XGZA 1AY1L 5LBSH 5F7EL 5GZND 2BCKB 8CGTA 2A74B 2VOTA 2C7UB 3B9DA 1BJMA 2H8PA 3AAZA 5J3HC 4BUGA 5B21A 1KV3A 5D7JB 4NQUA 2WBWB 3PQYE 5ERWB 5BS0B 5I8KL 3U46A 1Q9LA 4IMLB 2VN7A 1QFUH 3NIDE 2F8VA 3MGOA 1KTDB 5JPNA 3H9HA 1F90L 5F7LB 3RZCB 5BRZB 1AFVL 1P1ZA 3CLFH 5FKPA 3ZL4H 1J1XL 5CKGA 1TPXB 4XPBH 2ILLA 5C09D 2DN7A 2FX9L 5C6PB 5E24E 4E0RB 3SGDI 4CN1A 1N7MH 4NQXA 4YPJA 1SYVA 3O6FD 3X3GL 3NA4A 2FO4B 2JJUA 4NFDA 4OI9A 3IFOB 2BSSA 4GKNB 4AIOA 1E6JL 2ADIA 2P42B 4NO2A 4G80A 3S6CA 3KYMB 1HHJA 4WW2B 3SE4A 2BXYA 2Z8RA 4LPTA 1G9ML 3CH1B 1T04B 4U7MA 1C5CH 5GQBA 2VDQL 4MX7A 4GAJH 4ZUVA 2AEPL 4XBGA 2OTWA 4LASH 3SE3A 4NT6A 1QP1A 3QQ4A 3DXAA 1AGCB 3TBTB 2DLHA 1NGXA 1PKQE 4XP4L 1CF8L 5ICZB 4PJFE 2NZ9D 3L3IA 3MLSH 4LHUA 4NQDB 4BQ8A 1G6RH 1DCLA 3KPPA 4HXAH 3DURB 4IOFD 5JXAH 4IHOA 3NFNB 3TBWB 4FOMA 2XZQH 4JB9H 4IOSD 4KDVA 3ZKMC 3BIAX 3I6LE 3O45A 1IM9D 4MAUL 4Y2DB 2NR6D 3ARVA 4YEEA 4HWEL 3WXVH 2QQQA 3BD3A 1FG9C 3QB7C 4TUKH 1B0RA 3MQIA 2LE9A 4X7DC 4M4PA 5K9QG 5KANI 4ZXBB 5IW3A 2HG5B 4PREB 2XQYG 4X4XA 3QUXD 2DDQL 4DN4H 5HDOA 1N5AA 1FYTE 4JO1L 5FO9A 3T0BA 3GHEH 2CXGA 4X6CE 4DN3L 2G9HA 4RMWA 4U1HB 4QXUL 1MJ7H 1QEWA 1NC4B 3Q0HA 5D7IA 1D5MB 1H3XA 4HCRA 3P9LA 5GRZA 4BSWA 1XR9A 2APWA 1BIIB 1KT2B 1MI5B 4RMSA 5A3IC 1HYSC 4MLIA 4OZFA 5JQHC 5JDSA 3OB0H 2NX5D 4G8IA 4MJ5B 1CE1H 3JWDH 2ORBL 5C2BL 1RZIA 4GKZA 4KMTL 2MTPA 1CVRA 2VDMH 2P24B 4PJBA 3VD5A 3NVQA 4XXCA 5HI5C 1I1AC 3CDGA 4YHNA 4LSPL 4XX1E 5JHLL 4JFED 3ZTJH 5LGHL 4JO4L 3SO3B 3TA3B 2XQBH 4HX1B 3CZFB 1JP5A 4OV6F 2ERJC 3DYOA 4K07A 3WUWG 1S9XA 1Q94B 1NAMB 1DDHA 3FT4A 4FFVD 3N0PB 3ESUF 2GITA 2V9RA 2IADA 5JXED 2XOTA 1FHGA 1ORSB 3KPSA 3QUMH 4XMPH 4QTIL 4JRYA 3B9VA 4HK0B 3CVHL 4H88H 4KQ4H 4ZOAA 1GIGH 4F15B 1JTPA 2HFFB 3L1OH 5K33A 4N0CD 4XVSL 3QCVH 2VAAB 5SWSA 2NY2C 4UTAL 5J89A 2IANA 4E42A 5HI3C 4IBLT 5D1XD 2PW1B 1JMZA 5I19L 2ZSVA 4I3SL 1WZMA 1ZEAL 1G7HB 4I3RL 2MPAH 1IAII 3CPLA 5DMYA 4X6BA 2D7MA 5AD0A 4NNYA 2EDRA 1J0HA 1LNUB 4D2NA 5BZWA 7FABL 2NY0D 3RKPA 4QRSA 4CVZA 2ARJA 5C0BB 1DANT 3D0LB 4JKKA 1RZFL 4UAOC 4GBXB 1OAKL 1CGSH 3V7AE 2V5SA 1I8IB 3UTSA 1U8QA 4PJAA 1LEKB 4YHPA 2CRZA 2A6IA 3LSOB 2WWMC 5ITFA 1T03L 1ZLWH 1CE6A 3K4AA 1S7UB 4MA1B 3IDYB 3CXDH 5E56A 4PRIB 1CFVL 5GGRY 3AS3A 1A22B 3AM8C 3ARGB 5I16B 3RY4A 5HI4C 5I1IL 3VFTB 4MHHG 4MJID 4ONFL 4NFCA 3QPXL 4P4KB 3CAFA 2IBBA 4HG4J 5F6HI 5DJ8B 1S9YB 3RQ3A 2DQTL 1BF2A 4HXBH 1L4IA 3QFJE 4D8PB 3SJVD 4O2CA 2XWTB 4G43A 3ILQC 5FO8B 2QKIB 3RI5F 4RFNC 5IBLC 5C9KA 4KUCD 3FO0L 4FQLH 4PRBB 4UILH 1NGWA 3KXFD 2E7CA 4N1CA 4PJCB 4RBPK 5F7DA 4XNUH 1ZMYA 2F58L 3VE0A 1UEMA 2GK0A 5CZVH 3TO4A 4K8RL 1BBJA 5H8DA 4J23A 5E5MA 3F6IA 3O2DH 4HFWA 3G6DH 1IM3B 1BAFL 1KJ2B 3FB7B 4UV4L 3CFCL 3CX2A 3HE7B 4LFHD 2F5BH 4ODHH 2CIKB 4NZRL 4ODTL 5DUBA 1CFSB 1I7TA 4LIQE 4DUXA 3MBEB 3ARDB 2BNRB 5KSAD 3QJFA 4OLZL 4X0KA 5C09E 4LLVB 4I5BA 2Y7QA 5HY9A 1NGYA 3S8WA 3RPKA 4FQQA 4JVPA 4Q9QL 5DUMH 1BOYA 1VB9A 4Z5RB 3QZWB 5DFVD 1BQUA 2Q86A 3QIUA 4JKPL 4HD9A 1FO0L 4HHAA 3QNZB 1H8OA 2RB8A 3KPTA 3EFFA 1A14H 4PLJD 4NWTH 3V2AR 2YUZA 2Q3ZA 3ZYJA 3VGDA 4OZIE 3INUL 1YEDB 4GT7A 3MO1B 1NCWH 1I85A 1Z0NA 3CUPB 2ICWA 4XMLL 4LCWB 3OKMA 4QNPF 1C8PA 3BRDA 3WLBB 1LVEA 4WFED 1DSFL 1MLBA 4LSSL 3KPOA 4I0PA 3G08B 1BLNB 2BVEA 2WUBL 4ENEC 2GEEA 3OXRB 3VWJC 5I8OH 5HGDB 3OKDA 1BZ9B 1XIWD 3V9FA 4GXVH 2DLEA 3VW3L 3BEVA 3WNNA 1IGCL 1QLRB 1G7IA 3HN3A 4OZHF 5HYEA 1WWWX 1NBYA 4NO5A 4R26H 1KPRB 5GRJL 4NC1C 1JI1A 5I8EA 5BVPL 2VZTA 3GRWL 2R2HA 1MUJA 3VRJA 2EIZB 3QEQB 25C8H 3FT2B 2P5EB 3H6JA 3IDMB 4KZEL 1IGFL 4I2XE 5E2WL 2E6QA 5GS0C 2DJUA 3U7AA 2MHAB 1U3HA 5EG6C 2W07A 4W68A 4FQJL 5DXWA 4QO1A 1ZWIA 3B9KD 3V52L 3CJJA 4P46D 1YY9D 1B88A 2C3VB 4HIEB 3ARBD 2HTLC 4G7YH 2CKBB 4OLXL 1BEYL 1KN4H 1ITBB 1MVFA 1HDMB 4NKMA 1QLEL 5MERB 2XZAL 5ECJE 4PJFF 1M4KA 4D0DA 2VL4A 2N7BA 1KIQA 4QRQB 2EKJA 4JFEE 1A7OH 2LABA 1UB6A 1OSZA 1QVOA 1NAKL 5HGHB 2AJVL 4YFLF 4YHOH 3Q6FA 3QIBA 4UI2A 1LE9B 3BD4A 5HHXL 4JFXB 3FAWA 5BXFB 4JANB 1DBBH 5F93C 4IRJC 3RIAK 1XGPB 3WN5C 4XI5D 3SBWC 4L3AA 3IDIB 5I74C 1CLOL 4K7PX 2VZUA 2YK1L 2EH8H 1OAYL 1PZUB 1A6UL 2HKHL 2DD8L 1IKNA 5TF1L 2D9CA 2OJZH 3FQNA 1KCSL 5ESVA 3DRQA 1YC7A 2B7DT 5J1TC 4WO4C 4Q6IC 4PJ8A 4Y4HD 3O8XC 3RU8L 5DJ0B 1JGUL 1JPTL 3HS0A 3QJHB 4JKMA 5ALBL 4ZUUA 3IDUA 1FFPB 5C08B 3QO1B 4WI6A 3MRMB 4WI9A 2YMXL 3WXWH 3K3QA 1NMBH 5J7CC 5E1AB 1KCUH 5CSBA 4HC1A 1IKFL 2QHLA 4HS8L 4L9DA 4XNMA 1JZ2A 5E99H 3ARTA 3DX7B 4J7RA 5DJ2A 1CD1B 2BXZA 4YBQD 5LAXA 4HWZB 5F1KC 2AKRA 3ZO0A 4PJFA 4BQCA 1D6EB 2R9HD 3JWDC 3BDBA 5KANG 1EAJA 3VFRB 4YHZL 3SDAD 5D1ZD 3G5XB 1RU9L 3V5HB 2PYFA 4X7TA 2MNUA 2DWDB 4OIIL 2NTSP 4QOKD 1KELL 5F72S 2QBWA 5IFJB 1C12A 4Z7WB 4PP2B 1NGQH 3VFPA 5J13B 4JY5L 4CN4A 1JZ5A 3PL6C 4HJJL 3UJTH 5IOPA 3OAZK 4HIIA 3T4AB 1MFDL 3RVWD 2D7TL 3ILPB 3ZYOA 4MJIE 5DD5H 3HCVB 4FQXA 1XT5A 5DA4A 2IAMC 4Y7MA 1FYTA 3V5DB 5F8RC 2GCYA 4X6CA 3F8UB 5I1KH 4ONGL 3H9SB 3P73B 4TSCL 3CFEA 4PGZA 4PUBH 2APTA 3NZHH 3KLSA 2XY2A 3WKNA 2NTFA 3HPJA 4XVJL 2ICEA 2UZIH 2FWOA 2VE6A 3TZVA 5IBUG 2QQLH 4H5SA 3W0WE 4U6HB 3MRPB 4R97B 3KPQB 1XF4B 3M1BB 5I75C 1S7VB 3EYQD 3BQUA 4OT1L 4JE4B 4UQ2B 4Y4KB 4WY7L 1X4ZA 3MLTA 2FYYA 3MBXL 4RZCB 1YYLH 4Q9RL 3GJFB 4KK5D 1YYML 4GW5A 5JW4M 2UWEB 3GSRB 4L4TB 1RJYB 4NJAL 2YC1B 5E4EB 1BD2B 3VXTB 5HVGB 2NW3A 5DEFB 2DQEL 1ZT7B 4DZBA 4QHKI 1HINL 1KNOB 4TN9A 4DGVL 5DUPL 2A6JB 2X42A 1PX4A 3D0VB 3EO9L 4X6DB 2VL5A 1IL1B 2CJUL 3GO1L 3GSXA 1CXEA 4GRLB 1INQA 3EAKA 2YR3A 1R3JB 1IGJB 3IDNA 4L8SB 4MDJB 4U1GC 5KTEH 2OP4H 1VFAA 5F9OH 5GS0L 4JREC 1UWGH 2ZWLT 4PRDB 2R1WB 3MUGA 3NTCL 3MLUL 4QHMB 3RGVB 3LAFA 2Q7NA 3CSYA 4LCCA 1MHHB 1FZKB 4JG0H 3IF1B 3U1SH 4XTRD 2OLDA 2YBRB 4OB5L 1C5DB 4J4PA 4XC3H 3JWOC 3PWLA 4DOHE 4HIJA 4K7FA 1P84J 4FRWA 3HMXL 3S5LG 4Y16C 1QFOA 4UUJA 1PYWA 2IH3A 1F58H 4OCNC 1ZLSH 1J05A 1WQVT 5KJRL 2BX5A 1MRCH 5IHLB 1T21A 3BKML 3DYMA 2V5MA 4OJFH 5DMKA 1ZHBB 5EOCL 4X4YA 3PIQB 2VR4A 1J1OL 4PGJA 4TVPH 4JB9L 1JHTB 2FD6H 5DQ9B 1OAUL 3DJ9A 2EDQA 2PW2A 1KSRA 4LEOB 4C4KT 5IQ7H 4J1UA 4A6YB 1OP9A 2ZCKH 4OTXH 3TFKD 3IJHA 2C26A 1N5YH 1XGQA 2W9DL 1WC7B 2ZG2A 1Q9WA 5C0IB 2R0LH 1WK0A 1OCWH 3DSNA 3ARFD 4PR5A 1M7IA 5F44A 2CSPA 2A1WH 1NDGB 2IC2A 1U8OA 3LD8B 4PRNB 5T1MB 2ZUUA 5EU5A 3F7YA 4U1MA 5ACMA 1H5BB 3QDMB 3T0XA 3EYVA 4JFDA 4G6ML 3REWA 5KOVC 3C2SA 4RGOH 3KVQA 3HZMB 2XG4A 1U8PB 3QH3B 3TPKA 1VACB 4M1DL 5CINH 3HE6B 3GHBH 3Q1SH 4TTDC 1NEUA 1NJ9B 4GUPB 5D9SB 3DX9A 3WIFA 1ZA3A 5F3BB 5CEZD 1AJ7L 5FYJU 3RX5A 4IRSB 3LKNA 4HUWA 3ARZA 4GQ9L 2NY3D 4LVNC 3I02A 5FHBL 4MCYA 5FHAH 3UO1L 2CLRA 4HBCL 4XT1C 1OP3H 3TO2A 5L0QC 5ID0B 2J3SA 4ZD3L 4UTBL 1JWMA 4OM1L 2EDJA 2MQ0A 4EI5C 3MRFB 3EBAA 4R96A 5JHDA 4WUUB 1AP2B 4OZIA 4ZYKA 1PBYA 1N6QH 1O7VA 2O61A 2IF7A 4OGAD 4JFPA 2B1AH 3JBG7 3CMOH 2QQKH 4NNPL 3RVXD 3MRCA 3BPOB 4U1NB 1UXSA 3E6HA 2CDFB 4MA8H 4QTHB 2LQRA 3NCFB 4X5WB 3P0GB 2EXYC 5CMAA 5DJZA 4ZAKC 3MNVA 5IB4A 3HNSL 3IKCB 5D71L 1U41A 4QOKE 1AIFB 1IM9A 1CGSL 1MJ8H 3JV4B 1XGUA 5D96B 2D3VA 5DD6A 1SJHA 2B5IC 1IT9H 4ETQB 4POZC 5E2VL 5L9DH 4KI1A 5CUSH 1WT5A 3WS3A 5C6TL 2AJ3B 4PD4J 3QUXA 5M7QA 1AXTL 3KLAB 3FONA 4ODUA 5EZIH 2A2QT 4HIXH 5HHOD 4O9HL 3LQMA 2EC9T 3ME0A 4HJ0D 4BK5A 4I2XA 4JM2B 5EPMB 3NZ8A 4QRTB 3W2DH 1A64A 1DVFA 5FECB 1DFBL 2JJSA 4X6EB 2C3WA 2YD1A 4U1IA 3T0EE 3JWOL 4J3VA 5H35B 1T1XB 2R69L 4CJ0A 2E7LC 3HMWH 3W82A 1TCRB 2JB6A 3HC3H 1FVEB 5IW6A 1IEAB 4QYOB 1AGBA 2PN5A 4NM8H 1VGKA 1YDPA 4ETYA 5D72H 4K3JH 4FN0A 4MB3A 4WEBH 3KR3H 1XGTA 4ZFOA 3T2OA 3HB3D 1U0QA 5DR5H 1ZE3C 1JNNL 1FZMA 1JWUB 4KK8D 1RPQA 4RGNC 4JFEA 3DMMC 5CCKL 1E4WH 4NWUL 4P59H 5I9QB 4PGBB 2EYTB 1BQHB 1X5LA 4PJ5E 5AZ2L 2IWGA 3NCMA 3LEYL 2HLAB 3L3JA 1T22B 3WKML 4GAYA 3EOAB 4Z0XA 3BKJL 2DJSA 1CR9L 1HXYA 1K8DB 3KWWB 4LCUA 3DGGB 2AVGA 4DTGH 1PKOA 4F2MB 1N8ZA 5IHZB 1CTOA 2YUXA 5D1XA 3VFNA 4U3HA 3JV6B 4PB0H 2X4UA 1OGAB 3GSVB 3VRIA 4K2UL 1HE7A 1WLHA 3T3PF 1FLRL 1INEH 2H2SD 2Z4QA 1CICC 2DAVA 2XQYK 3G6JA 4KUCF 5TH2B 4FTVA 1HXMB 1A14L 1WUNT 3RVTD 3N9GL 3WHE0 1KULA 3SGKC 2AEQL 5EZLA 4OLUL 3R0MA 3AB0B 5IF0B 1GGTA 4TUOA 1OTSD 4KRPD 2P7TB 3D2UB 1XF1A 2ADFL 3JUZA 4AEHH 2LU3A 4RAVB 1JIBA 5DJXA 3S4SG 4NN6C 3CSGA 3TBYB 2BSRA 1FAIH 3WFDH 4JY4A 4DZ8A 2DQHH 2H9GB 4G8FB 3P0YH 1C16A 4PV9A 3IU4H 1G7JB 3ESVF 2VWEE 5CZXD 5J6HA 1RUAL 4NZTL 3SDDC 4ZUTB 4K7PL 4W6XB 3OQ3B 3M8OL 3R06B 3K7UA 3OHXB 1LD9A 1HH9A 3W9EA 1AD0A 2V17L 1U93A 3ISWA 2EDTA 2VR5A 1WBXA 1Z9LA 3UTQA 3MRKB 5D5MF 1R0AL 1JF1B 4YDLB 2WUCH 2QLVB 5F89B 4J8RB 4WV1B 1T1YA 1I4FA 3PNWA 3HI5L 4AT6B 2ATKB 3W0WA 4OCSL 4ERSL 3NABH 5DMIH 1GCFA 1A7RL 2K3TA 3VXUA 3FHAA 2IH1B 4HAGA 4M1GL 3P77B 4Z7UE 5ISZD 2FR4A 5E2TL 3CU7A 2OYPA 1JNLH 3E0GA 3BYTA 4NQCA 3LS4H 3UDWC 2X9YA 4RFEB 5BMFH 5TE7H 1TETH 2E8YA 5DDHA 1VKXB 5KSAA 1L7TH 1RQ5A 1J8HD 4Z78B 2GW5A 3VGBA 4K3EL 4L1DA 3LQAH 5CEZE 3RTQA 5GGQH 2BY2A 5HHNB 5CD5D 2DIBA 1A9EB 3T3ME 1F8TH 1I3GL 5I71C 2X1OA 3MRLB 4JQVA 5KVDL 3HI1B 1U8LA 4MXQC 5D7JD 4LLMB 5BS0D 1CS6A 2EKSB 1HNFA 1Q1JL 1YEIL 2C4FT 3LRSB 2V2WB 3BKYH 1IC7H 1JN6A 2IG2L 3ECBA 3VXPA 3RZCD 1HSBB 5FA4A 1BGXH 5BRZD 1MSPA 5JR1H 1A6WH 1YN6A 3AS2A 1S3KL 3SKMB 5C8JB 3ULUH 1KCRH 5FKAA 3UTZA 4FNLL 4OQTA 2V7NB 4J6RL 3VFMB 2DQDH 3VFSA 4JFFB 4L9LC 4EIZC 5FYLL 2NY5C 1PY4A 2ZOLA 4NBYB 4B53A 1A7QH 4HWBH 3SPVB 1T20A 3X13B 5ADPL 4UAOB 4MZ3A 1XIWA 2R1XA 1MCPH 4AH2B 4JGJA 4O00A 4OFKA 1TNMA 2KDGA 2A83A 3AROA 4O58L 1AGEB 5D70L 4LNRA 3CFIC 2RJMA 5M95B 3DIFB 5D2LB 1LDPH 1DE4A 1D5XB 1ZSDB 1CDIA 2JJTC 5KS9E 1ZGLM 2NNAB 4EEEA 1NCBH 5HHOE 2O26U 4RIRB 5CIPH 4NQDD 1BQLL 3KYNA 1KIPA 3IDXH 2BNUA 3UJIH 3V6BR 12E8H 4GMSL 1WBYA 2PTTA 3SKNA 1OW0C 2KZ1B 4WHCA 2DTMH 3B9KA 4HG4K 4JR9H 4HW6A 3QXAB 4RFNB 5IFAL 1JGEA 4Y2DD 5LWYH 2VDPL 4OI8A 1YY8B 3E6FA 5E03A 1MPAH 2X10A 3LPFA 4PGDA 4V1DE 1LO5B 3SDYH 4TSAH 3H8NA 2D9QB 3F58L 4GFTB 1F11A 4ZPTB 2CLVB 4XZUB 1JUFA 1KCVH 2D7NA 3D18A 3WD5L 3D39B 1NC4D 1FGVL 4LQ1A 5HHVH 4F33A 1QBMH 5GS3A 5IR1A 1MI5D 3QPQD 4OCRL 3SDXF 5D8JL 4ORGB 3GKZA 3HC0B 3QWRD 1RK1A 2NW2B 4TSBL 3P30H 2ITDB 3RNQA 1HZHH 3T08A 5HHQA 3DLQR 3HUJA 5IB3B 4XNYH 1FG2B 1LO0L 3UMTA 3TA3D 4PJGB 1JHKH 3MFFB 5F96H 2C3XA 4CMHB 6FABH 4ONHB 3RX7A 3U7WH 3FN0L 5DJYA 5A2JH 1ONQA 2P5WB 5MEPA 3FMGH 4PLKD 4UNUA 5IROC 3WMSA 4YXHH 4QKXB 3U0TB 1XF5B 2EYSA 3PG2A 3DV6B 3A67H 2Y07H 3HR5A 5I1HH 3I6GB 1B2WL 2X9WA 3PV6B 4FFYH 5I6XC 2JB5L 4JDVA 3VWJB 4K9EC 3L3HA 5E8DH 2X4QA 4GLRH 1FBIL 2HA1A 3QP3A 1N4XH 4HUXB 4R3SA 4BH7B 4DVBB 4XVUD 1DEEB 4JO3L 5F88A 4FQIL 2D4DA 1URLA 5EORL 1CL7L 3OF6D 4M6NH 2QQNL 1WZ1H 5C0BD 4OZ4A 2DI7A 4F57H 4KVNH 5D7LE 5IKCA 5CGYD 1T89A 4JLRB 1JZ4A 3MRDA 2NZ9C 4GBXD 5CHNA 1F4XL 4FA8A 5EN2B 3IU3B 1QBLH 3UP1A 4LLQA 3T0EA 1N6UA 1OCWL 2YSSB 1AGDA 4WHYH 4MA3B 4MMZC 5E7BA 1B4JL 4RISL 3IETB 1QQDB 3MCG1 1F3RB 4PRID 4U1JA 1FFQA 3HZKB 5EBGA 5HYIA 4PLOB 1OGTB 2AJSH 2NY5L 3ARGD 5D4QA 5IM7A 4XBPA 3GSQB 3BDYL 3U82B 5DS8B 2VDRL 2PO6C 1ZGLP 1TJHL 4P4KD 4K55A 1K2DA 2XV6B 1FQ9C 1G1CA 2GFBA 5CILL 1TZGL 1E6OL 2OBGA 3TESA 1FE8L 2AABL 3OWEA 2YUVA 1H0DA 3L5WB 4PJ5A 3SKOA 5GRYA 5CINL 1G6RB 1HEZB 5EUOF 2XACC 1E28A 1TQCB 5DJ6A 2HWZL 3QULB 4R8WL 3RRQA 3BPCB 5IFHH 3G5VA 1CXKA 5E2JA 4ZFZB 5I74B 3KDMB 1RD6A 2R1YB 3DUHA 1D5BB 1K8IB 1KPVA 2P8PB 4LARH 3QUZB 3DO7A 2DM7A 5DQJA 3LEVH 5C9JB 5BS0E 1RZ7L 4MD5B 1DANU 5FHAL 1SHMA 4Q6IB 3GKWL 4HV8B 1GYAA 2O5ZH 3MJ8B 5BRZE 5HGBB 5IHUH 4MAYA 5EOQH 5T33H 2VISA 3GI8H 1QBBA 3UPCA 3OAYK 3S96A 3MBED 4QRUB 3ARDD 2BNRD 4JCLA 2BVQA 4R4FH 4RBPH 4GW4A 2OMBA 2EZ0D 3LMJL 4CVXB 5C0RL 1A1OB 5A16A 4KJWC 5T3ZH 5J11C 4DGYH 4WUKL 3UJJH 1HQRB 5IVXB 3IFLL 4GRWF 4YXLH 2GSGB 3ZTJG 4YK4C 4MA8L 1KEMH 4N0CC 2FATL 5KVEL 2VRAA 3D69A 3WDIA 4XBEH 1XF2A 3QXTA 1IEBA 1ZA6B 3MLWH 3MMEB 4YX2L 1MIEH 4JPVH 3E1F1 3V0VB 2CUHA 3TYGL 2NPLX 1S7SA 1FV1A 2NY0C 5CUSL 4LCWD 4NRXB 3FO2B 5D2NC 3LQAC 3QO0B 4S1QH 5C0ND 3UYRH 3DTXB 3FQRB 2IAMB 3QUMB 1F3DJ 4RMTA 3BWUC 4HIXL 2A77H 2VZVA 3ARFA 2F5AL 1JFQH 3EYFB 1BECA 1QOKA 2WQ8A 5JUEL 5JNYA 3N1PC 1QSFD 5GISH 4PG2A 3F12A<