5JIHA

Crystal structure of her2 binding igg1-fc (fcab stab19)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
212
structure length
212
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEYLSDSVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVPRHSETMRRWAHGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Fcab-HER2 Interaction: a Menage a Trois. Lessons from X-Ray and Solution Studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jihA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jihA01
2EYTB 4P9ML 5DF0A 2AXHA 2PYEE 3PV7A 4HWUA 4TUKH 1JI2A 2H2PD 1SY6H 3RNQA 4PGCB 32C2B 4L3EA 5TDOA 3DUSA 3T2QA 3CH1A 1CXHA 2R1WA 4BFBD 4YHNA 1R0AH 5C8JA 3VXRB 4GKZA 2F54D 4W4OC 5FHAL 1HNGA 1ZEAH 1YEEH 1MCKA 1XGRA 1DBKH 1IQDB 2HVKA 2AEPL 2PN5A 3BYTA 4NRZA 2VXVH 1F6FB 3PABB 3P11L 3V5DB 4NM4L 4M7LL 3VFSB 3FQXA 2PCPB 5EZJA 2UZIH 1QOKA 1W72L 4H25B 2A6DB 1RZKC 1WSST 4HIJB 4R90H 4QXUH 1K2DB 1CLCA 3HPLB 3CFDB 3SGJC 1AXTH 1WIOA 3L3IA 4P57B 4HS3A 2F54E 3RI5F 1S78C 1P7KB 4CDHA 1LGVA 2YUWA 1AHWA 2JTDA 2VLKD 3L3OA 4G6ML 4M1DH 2A83A 3HS0B 1OCWH 5HDBF 4JRYA 3PXHA 1UADC 4WFHD 4FQIH 2HFFA 5TFSL 1CLOL 4XNZB 2IGFL 2C4XA 4PJDA 5MENA 5EUKA 1JIBA 1H5BA 4JFQA 2Z91B 2AV7A 4PJ8B 1XH3A 4MD0B 2R15A 1MSPA 2EO1A 4OQ1A 5GGVL 3MRKB 1DCLA 1WIPA 3QDGA 1JZ8A 5I0DA 3UO1H 4OD3H 3O2WL 4XTRC 4RISL 3LS5H 2OBGA 4S1SL 4EI6B 5B39A 5BVJB 5IW6A 4YEEA 2OZ4H 3C08H 4Y1AD 5SWSA 1UH3A 3MZGB 2DDQL 1QLRB 4KVNL 3L5IA 3NIGE 3T4YB 3ULUL 3DI2B 1OGAA 3WIFA 2IBGA 3TBWA 4WFGE 3GEWB 2E5EA 3CLFH 4KV5F 1ZS8B 5D72H 3O6LH 5DVLA 1KXTB 3WUWA 2LVCA 3W5NA 4OCWL 4PJAF 3LHPH 4MA7H 2CR6A 4URTB 4YHPA 1QBLL 2C3VA 5CKGA 2D4DA 4LCUB 4JY6A 1KXVC 4APQA 3IVKA 1G6RA 5LCVH 5J6GB 2X1QA 3L3KA 5C3LD 4L8DA 4YHOH 1XR8A 3ROOA 4I3RH 2VXTL 3QUKB 3HG1A 3TZVC 3S4SB 3ULUD 5J57B 3D25A 4KXZH 4UDTB 2HLFD 1CD1B 1C7SA 4JPIA 4AQ1B 4PLJD 1ZGLM 3VJ6A 4X7TA 3P3YA 2DI8A 2KDGA 4JFEB 1A2YB 3VDBA 1YY8A 4YBHA 3EFDL 5ESVA 1XGYH 3BEWA 4KJQC 1KB5H 5IG7B 3EOTL 3BN3B 3LV3B 4FZ8L 4PD4K 3DX9B 4OLEA 4OI9A 1TETL 5EZLA 3RP1A 4UOW1 1JZ5A 1DUZA 4FQPA 3G6JB 3F8UB 5E2JA 2P5WD 1DBBL 3CCHB 4GRMB 3U79A 3S98A 5E99H 1DVFB 1OTUC 4OFPA 3ULUE 3VFPB 1FJ1A 4Z77B 5HHXH 2DQEH 3QI9B 3OBAA 1HKLL 3WFEH 4UINH 3CSYA 3U30C 1KF9B 3AC0A 2LTQB 4ZSOA 2E7BA 1QFOA 3DX7A 2C1PA 2WBJB 3P73B 1D5ZB 3KHOA 4GRWB 5IWLC 1PLGH 4HLZG 2EEDA 1I85A 3GM8A 4Y5YC 5E0QA 2VWEE 4NQVB 1AKJA 3TN0A 5ICYA 1JL8A 1PKQB 4MX7B 3CFJA 2YD4A 4QXTA 5IJKA 5C0BE 4F58L 5M7QA 2IF7A 43CAB 4CL7A 3UTSD 1C16A 4FFVC 1X4ZA 3LS4H 3NIFE 1B0WA 3HI5H 2UUDK 3FHQA 3I3BA 3TJHC 1RZIB 4OLYH 5F72S 5C6TL 4WU7B 5C08B 1F42A 4L9LA 3GSNA 5J12B 1G1CA 5IB5B 1YNLL 4YHKH 3QWOA 3Q5OA 3X12B 2OYPA 3O9WC 5J9PB 3RWDB 1JPSH 2DJ4A 4U1NB 2Z31B 4P23A 3SDDA 2ZUVA 4OF5A 1RV6X 4Y5VC 1FH5H 1H3GA 2J8OA 2BFVL 2OM5A 3RWFB 2WINA 2IAMB 4NC1E 4OZHF 3E1F1 1T5XA 1WV7T 5ESAA 5ITBL 4TTDC 4KK5D 2HT2D 5DQDL 3GB7A 5FYLH 2HWZH 2OQJA 4HGKC 4U05A 1MRFL 1NCCH 1LE9B 4P5TA 3FB5A 5IF0A 5ANME 1N5AA 1BGXL 4RGOH 1K6QL 5LQBL 2DLGA 5EO9B 1U8NB 3QH3B 4BM7A 4TPRL 1BZ9A 5I66A 3T3MF 4UT6L 2IFGA 1JWUA 4XWOD 1EVTC 1OTSC 4BK5A 3SDXE 1MJ8L 3K4AA 2XV6B 3D48R 3DX8B 5DFTA 1AO7D 4WI2A 3MGAA 4NQSA 3ROLB 5DRWA 3VH8B 1ZA3B 5C1MB 5IT2L 1MHPL 3TBTA 1RIUH 3K8LA 5D7IE 3DVIA 1A6WL 1DR9A 1Q9WB 4FXGB 1WCBA 4LLUB 5FOBA 5TDNB 4KDTA 3C8HA 5I8CA 2XY1A 4CVZA 3KXFB 5L0QB 5IB3B 4QRRD 4OTXH 1J0HA 4JFOB 3ZDZE 1J1PH 1REIA 4HX1B 2NX5A 4OLUL 4GW5B 3DV6B 2Z0BA 4P2OD 3X13B 4CNIB 2FJGA 2EXWD 3ULVL 5J89A 1P84K 5CJXA 4KKNA 4MLSA 1BFOB 1C1EL 3RL1A 4DWHA 5FCUH 3IJYA 3NCJL 5FOJA 4EDXB 5KOMC 5FA3B 4I4WB 3NCYS 4TTGA 2B1AL 1IAIH 3AB0B 1A4KB 4XBPB 3RWJB 4OF0A 3EO1B 2AW2A 4MXWL 3HMXL 1C5BL 3V0WH 3Q0HA 3RIAF 1QVOB 1WZLA 5H2BA 5DJ8B 2VDLH 2X7LA 4QRRE 3PGCA 4GH7B 1MQKL 3RJQB 5L6YL 4HS8L 2X2YA 3NAAH 1VPOL 1YQ2A 4H1LB 4LVNC 5JOEA 3I2CL 4ZOBA 2F53D 3K2MC 5HGBB 1G0DA 4J3VA 5I16A 2ZJSL 4JRXD 3FN3A 3OXRA 1VDGA 3L3GB 4KU1A 1ZHKB 4GSDL 4HUUA 5D2NC 2FEEI 3B9DA 4UV7L 1LEGB 2ADJA 4MA1B 2FJFA 4AH2A 1MI5A 4KK8D 2IBZY 3QJFA 2VR5A 5HDQH 4WEBL 1MPAH 1X5GA 4TUJA 1TNMA 4X6DA 3SO3C 1VGEL 1VEPA 4XH2B 1QACA 3MNZB 2W0LA 4GQ9H 2XTLA 1HXMB 3O3BA 3PQYB 3WN5A 4ZFFB 1LO4H 2EC9T 2IMNA 4V1DD 3D2UA 1E4XI 1XGPA 4ZDHB 4BQBA 3ULVE 4K23L 2IADA 1SJEB 3I50H 12E8L 2P8LB 4FG6C 4Y16D 4MD5A 5L8JB 4HWBL 4HF5H 1HILA 4GBXC 2PO6B 3HAEH 1LO5B 3BZFB 3HNVH 5I1GL 2EDNA 3AS1A 1Q72L 4FNLH 1XMWA 1URLA 1FO0A 2PXYA 5FGSA 1C12B 4X7CC 1DZBA 1JTPA 5DD1L 1L0YA 3KPSA 4HS6B 4DEPC 5DMKA 4P59L 4M6NH 1MJUL 1GZPB 3HA0A 5GGSY 4NNXB 2P5WB 3FQWA 5IFHH 2R23A 4Z7NF 4JY5H 1FNAA 1K8DA 5INDA 1RFDL 3TYFA 5DRNA 5JXEC 4D2NA 4Z9KB 3BWAA 4OBRA 4JLRB 4YIQA 1AD0B 2VUOA 4ONGH 1BIIA 4DKFH 2NY0D 1DSFL 1IAOB 3PJSA 3HZVB 4BZ2H 1G9NL 1J8HD 4HQQL 3MRCB 4PG9B 4X8XA 2GJZA 4P2QE 4FQQA 5K9OA 4PJEA 5IW1A 3UTSB 2K3TA 1XIWA 4KRLB 4YNYB 4MXQD 2YXFA 1CU4H 3TGXA 2AJUL 2D31B 1W0VB 5GGTH 2N7AA 3BRDA 2VN7A 2J4WL 4Z0BL 4YAQA 2J88H 3WFCH 4PP2A 4XNXH 2OL3B 2NTFB 3B9KB 3GSXA 3I9GL 3HCVA 4PRHA 4GG6F 2EDXA 4PJBF 4FQJH 3RDTB 4LLDA 5ANMA 3PGFH 5T5FH 1MWAB 3ARFC 4NWUL 3NACH 3BIAX 5D96B 5EU6D 2K1MA 1DQJB 3IGAB 5KVFH 1RU9L 5KTEH 3QUZD 4K07A 3SDCD 4G42B 1IEAB 3ZYIA 1VCAA 2BVUA 4JHAL 1BQHB 1LP9E 3DTXB 5GGRB 3HE6A 3G08A 4Z78A 4HFWA 1TJIH 3TA3B 1OAXH 5KSAA 1YEKL 4G5ZL 4HWNA 3V0AC 3OB8A 1QKZL 2W9EL 1NMCB 4P9HL 3V4PL 2VLMD 4PJGB 4AIXA 1I3GL 4KMTL 3OKMB 2Z8WC 1DANU 3OAYK 4HKXA 3KPOB 1JF1B 2X4PA 4JB9H 4LBEB 1NJ9A 3HUJF 1JN6A 1PX3A 5GRZA 1LEIA 4HJGB 2BNUB 1UJ3C 4F8TA 2VZ3A 4AEFA 4WW1A 1AI1L 1EO7A 3QEGL 3BDYH 4LARH 1KGCD 4WWID 3BIBX 3G6AB 3BD3A 2D7TH 1EZVX 4XCNA 2BVOB 3K3QA 3ILQC 2CJUH 1U8HA 4XPTL 2HKHH 3QEUA 1DQQA 5JLZA 3SGEI 2FX8L 2HMIC 1PSKH 2CK0H 1AGFA 4P2OB 3LSOB 4PJHA 3GIVB 5D6CA 3CFBA 4Q0XL 5DJAA 1QSZA 2G75A 2UV3A 3HZKB 4ZD3L 2MOVA 3CH8A 3VFWB 5E5MB 2QQLL 4D9LL 2QKIA 2O61B 1AP2B 4DVBA 1D6VH 1OPGL 4PRDA 3MV8E 2V9RA 4R2GB 5ENWA 3QFDB 4LP5A 2XWJA 4PJFE 3UYRL 1JFQH 3WXVL 1XZ0B 4OGYL 5IMLB 1JZ2A 3B5HA 1CDIA 1P4BH 4NJAH 1JI1A 2DQTH 3LPFA 3BRGC 5KG9B 2BVQB 1FAIH 2F53B 2ILLA 4F80A 1RJYA 5LGJB 2CDEB 1QR4A 4JRXB 5EB9A 5HVHC 1FVEA 2MKLC 3VMOA 1F4YL 2I26N 4M5YH 4Z5RB 5C0NC 1T7XA 2NXZB 5JIPA 5I0ZA 1WIUA 2EEBA 5H37H 2HT4C 3QO1A 1HKFA 5LVEA 4MHHI 4X4MA 2QTEA 5DMJB 5IBLD 3CJJA 2V7HB 3LH2L 2DQJL 1RZJL 4P4KB 2A9ML 5M95B 2IPUG 3GHBL 1WC7A 5J1TC 4GAFB 5FXCH 2IWGA 1QNZL 3PGDB 3CD4A 4JGMA 4LLYB 4JHWL 1OQOA 4K7PH 1T7VA 3T0XA 1JF5A 2P44B 1JHKH 4PRAA 3V52H 1PG7L 3I75A 3C6SA 4JKPL 3PV6B 5KSBF 4C4KT 1FYHB 1WJ3A 1UM4H 4PJ5A 1S7XA 5I1JL 2DRUA 4QHNA 3KPQA 2E9BA 3LKNA 3FFCA 5EBMA 4ZO9A 1U3HC 2WNGA 4M7JL 4X6CE 4LEXL 1DLHA 1QSEA 3RU8H 3IB4A 4MNQA 4PJIE 3T1FA 2P1YA 2N4IA 3C2SA 1UM6H 3O6FA 1N7MH 4S1RL 4XHJD 2R2EA 5I18H 3Q6GL 5TH2B 4LRNL 3ZKQD 3ZHDA 3SJVD 3VRLF 2YPLD 4MA8L 1KSRA 2DBJA 1P9MC 1IAKB 5F7KC 1QR1A 3VFRB 4L8CA 3H3KA 4X4XB 1RK0A 2OR8A 1QBBA 2WQRA 2HH0H 4Y4KD 5DK3A 2GQHA 2YPKA 1NDGB 5ACZA 4NN7C 5J1AB 3BKCL 3JWOL 3CC5A 3PP3H 4H20L 1S5HB 5J6HB 5ETUB 1Q1JL 2V2TB 5IM7B 3RTQA 5D93B 4P2QA 2GW5A 1PEWA 4EVNB 3MLTA 3IJHA 1UZ8A 4LLVB 2NY0B 2XWBB 1XF4A 5IEHA 1J8HB 3WHE0 2RQ8A 4HWBA 4NQCE 1FG2A 5BXFA 3UBXG 2Y25A 4NJ9H 3VG9C 1WBZB 3RL2B 5K9KA 2VC2H 5FUOH 3TO4D 2VQ1A 4HIIA 2VDOH 3P4OB 1BZQK 5CJOH 2RCSH 5D7JA 2QQNH 3GMRA 3IDXL 2YK1L 4ZG1A 1JGEA 1U95A 3QO0A 4MXVE 1QRKA 2H9GB 3FT4B 5JO5A 4HD9A 1LVEA 4G80A 3TFKC 3OR6B 1GHFL 3QSKB 1MIEL 1TQBC 2BHUA 5GGVY 5MHSE 3RVWD 3BESR 5SX4H 2WANA 1ED3B 5E08H 4P46D 3LKPB 1ZSDA 3FQTA 4M6MH 3RWIA 2YRLA 4TVSa 3EDEA 4KTDL 1U8QA 4WDIA 3CXHJ 1BFVL 4NZTH 4OM0H 5DJ0B 6CGTA 2EDKA 3I85A 3L5HA 1CBVL 2E6QA 4ALAL 4G6AD 5EU6B 5ALBH 3JWDH 4HGWB 5SX5H 3UAJC 2GEEA 3VGGA 4QF1A 3QUZB 1WZ1H 4JFPA 5FB8B 3C5ZC 1NGQH 1NQBA 1DN0B 3QFJE 2IQ9L 1UJTA 4EI5D 2AI0H 4M62L 3CDGA 5J1SC 2R9HD 2FO4A 3ZE0F 1LILA 2ZUYA 2EE9A 3U6RB 5D70L 1R3LA 1MFBH 2OI9C 2WW8A 4WV1B 3WFBH 1JWSB 5C0CE 1LDSA 2AJYH 3GSUB 3TNMB 3LKOB 2BNRD 1DEEA 1NAMA 2QADB 2XFXA 3BW9A 3CZFA 3O2DA 1YMMB 3OKYA 1ZA6A 3ZE1F 2OK0L 3ZE2E 4RX4A 5C0JB 1RIVH 4MAUH 3ARBB 3D3VE 1BJMA 3FMGL 4OT1L 4MJIA 2C26A 5GJTH 5DMYA 1RVFH 3T04D 8FABB 1ZVHA 5FO9B 4ORGA 2CGRH 3MV7B 5EFIB 3TBSB 1S9WB 5IOPA 1IAMA 5CFHA 3MRJA 1INEH 2XWTB 4PP1D 2I9TB 1I9JH 3MMEB 3P0VH 4F7CB 1NEZG 2B2XL 4TSCH 1RAMA 3VCLA 1CE6B 3PG2A 3BUYA 1KEGH 3FRPA 4PJFA 5CEYA 2HN7A 3HZYA 5EU7C 2PW1A 3EFFB 3VFVA 3ARGA 5E8NA 1NAKL 3IDNB 4ELMA 4KKBC 5CGYC 5DRXB 3WIHL 3BP6B 5JIKA 4EIGB 3MRDA 1C8PA 2ICWB 2R0WL 3RI5K 2XTJC 1PZ5A 5HHQA 4K8RC 4KQ3L 1NGYB 3G04B 4MWFA 2O93L 4Q6IA 4GAYB 1X9QA 3B3IB 3VGBA 5GS0C 1U8PB 4ZUSB 3V6OA 2IJ0C 4G6JL 1CT8A 5BZWA 2JJSA 4WWKB 1A14H 3V4VH 3C6LC 4LOUD 1P7QD 3SDAB 5EUOF 1TVBA 2MHAA 3BZ4A 3OB0K 1NFDE 4U1KB 5KVMC 3O3AA 5EO0B 3GHEL 3MZTA 3RY5A 1S8DA 3GKWH 3KPMA 1CDJA 2V9TA 2CDGA 3S35H 2EC9U 1IGML 4JZOA 4YHMH 2XN9D 1B0GB 5LBSH 2A6KB 1P5VA 1I7UB 4JJ5B 3GSQA 1Z6JT 5E2VH 3WKML 2BY1A 3RY6A 3VWJD 2R0LH 2A1WL 4NZRL 3GMLB 1ROWA 3QDMD 1ZHLB 3VXRE 1NBQA 1A6AA 2M2DA 1VFBA 2OTUB 4F2MB 1FBIH 2WIIB 4Y2DA 5I8KL 2SEBB 2LV4A 4JO2L 3R06A 3P30L 5ILTL 1G7MB 3L5WA 3VI4E 1XF5A 2VAAA 2AJZA 2YBRB 1KN4L 2WLYA 3U9PL 1LE5B 4OGXL 5KSVB 2XN9E 3MRLA 3S96A 3L95B 1IGJB 2MKWA 3F7VB 3NIDE 4QHKI 4YDKL 2HVJB 3H3BC 4WY7H 3MOBL 4LQFH 2P5ED 1OTTC 3QYCA 1UKTA 3DRTB 4LHUD 1RZKL 4JM2A 2O5YL 5IW3A 4NWTH 1BIHA 4P5KB 1I4FB 4LKCA 4Y4KB 5FGBC 3KLHC 1JV5B 4FFZL 3K8MA 3WL9B 5JHDB 1I8MB 5HPMB 3T65A 3QUYA 5DT1H 1IC4L 1FIGL 2IH3B 4JDVA 2V17H 4LSSL 2DBLH 2JCCA 2DLFL 3CAFA 5HYFA 3GMNA 4OCXH 1KULA 3HKFA 4OZFB 2OLDA 1NL0L 3PDGA 2O5ZL 4HMCA 1ACYH 5JPMB 1I8LC 4HLZH 3TO4B 1R5WB 1INDL 2I07B 4FOMA 1WLHA 1A3RL 2GHWB 3C09B 1FGNH 3T3PE 4N0YL 3QWRA 3RGHA 4HFUL 4E0RB 5DUML 3MFFB 4WU5A 5JXAL 5HTSA 3FQUB 2QL1A 4P4RA 2A74B 3LD8B 4X9FA 1GL4B 1TCRA 3MRMB 3HC3H 4RMTA 2UY6A 1EMTH 4KGLA 5I9QB 2JB5L 2DQHL 3WFDL 1BD2D 2C1OA 3D85D 3QA3B 3PHSA 4WUUA 1JYWA 1S78D 3DMMD 2O5XH 1N59B 3EO9H 3I6LE 2EE6A 5D1QC 1MQ8A 5DFVD 4YWGH 1MHCA 2FIKA 1A6VL 5LGHH 2P8PB 4HHAA 1YEHH 3MLSL 4CU6A 4P46B 2CPCA 2H41A 4ZPVB 2W0KA 5D7SH 3U36B 2AGJL 2FGZA 1P4LA 5F89B 4Z7UB 1E6JL 3VFTA 3GUTB 1TENA 3QFJA 1OWWA 5IK3A 3DXAD 2F9BT 3BAEH 4Y5XC 1Q0YL 4R6UA 4JZJC 1DBJL 3C8KB 4WO4D 3ZDYE 4XTRD 4EI5B 2EDJA 1OAKH 5I30H 5IFJB 3BPLB 4NGHL 3A67H 3OKNB 5C0CA 1FSKB 5I1LB 3OJ2C 4FRWA 4OZIE 1PW3A 1CN4A 4G9DA 3I3DA 4KUZL 2EIBA 3U7WH 1DQMH 5C0FA 3KJ4C 4YDIL 2GIYA 4K3DL 4LVHC 3E3QC 1R3JB 2L4OA 5HVWA 4FABL 3LKRA 2DTSA 4LVOB 5DYOB 5HY9A 1MRCH 3VXPA 1S7QA 2V7NB 5A3IC 1YEFL 1RZ7L 3GMPA 1KLUA 4R3SB 3U1SL 2VZTA 5ID0A 3JV6B 3NGBB 5E8OB 3IS1X 2I9LA 2FJHA 3W9DA 4G6KL 3LPWA 3Q3GA 4QGYA 5DR5H 3UPAA 3ARPA 4K94H 4M4RA 2VN4A 4F33B 2AJ3A 4ODTL 1DQTA 4XNYH 1BECA 2NNAA 4G8GB 3Q5TA 3TZVD 3KPRD 2CLRB 2F58H 4GRWE 4PJ7A 4ZQKA 2WZPD 1NCBL 2A6JA 3TPUB 2Q8AH 4K55A 3QIBC 4DCQB 4LLMB 5EA0H 5D5MF 1PKQE 1K8IB 5CSGA 3VH8G 3F7QA 3GMQB 3SKNB 1J05A 5K9JH 4PTUA 1YYLH 3BJLA 3MBEB 2GT9B 5EORL 2FD6L 4EQ2A 3IETA 4F7TB 5C9KA 5EZOL 4UTAH 2IANA 4JJHA 1SM3H 1BMGA 4C83A 4JFYB 2QSCH 1TTGA 5E2UH 4RAVA 3V6FB 2ED7A 5I76A 1OTUD 1KFAH 3MV9D 1NFDA 1BLNA 3MNVB 3KYNB 4M1GL 3ETBF 3KAAA 4XP5L 3FQRA 3VE0B 4LAQH 5I8EA 4RA0C 2YN5A 3GO1L 3RIAK 3WHXB 3MJGX 4CVXB 3IT8D 3LMJH 5C0EB 4MVBC 1AQKH 2CRMA 5B22A 3WFZA 4PGCA 2GTZB 32C2A 5I1EL 2YUVA 2E3VA 3VXRA 5DHVB 5EDXA 4FFVD 1KN2H 2FEDC 3VWJB 1IQDA 3AS0A 3MV01 3QDMB 4I18C 2B4CH 2H32H 2N1KA 1RMFH 3TJHD 2VRAA 3PABA 4JDZB 1G7QB 3ESUF 3V4UH 1MCLA 3V5DA 1WBYB 4PRBB 3WIHA 3VFSA 3MLVL 4L8SB 2VABB 4RCAA 5AYUH 2PCPA 2RHEA 3O9WD 4TYUA 4ONFH 1Q94B 4H25A 5HXMA 2A6DA 4HPYL 1U8OB 1TTFA 4HIJA 1GXEA 3VFGH 5D2LE 1K2DA 1MRDL 1NUDA 3QNYB 3HZMB 1S3KL 3HPLA 5IMOB 3WJJC 3CFDA 2CMRL 1AFVH 1D5MB 3BD5A 4KKCC 4QRPD 1X5AA 3KXFE 3QHZH 1UGNA 4P57A 1M6OB 1CK0L 2JKXA 2XICA 5DA4A 4DGYH 3FO1B 5TE7L 4MJ5B 4G7VL 4DFIA 1DP0A 3ZKXB 1VKXB 1ETZB 2P5EB 4HEME 2XQBL 2ESVD 2GITB 3VGAB 5T1DH 1R3IH 5TQ2L 4XAKE 3EJYD 3U0WL 3MBXH 2Z91A 2NLJB 4X7FC 4PJ8A 4MD0A 4M7KL 5DSCB 1AY1L 5KANI 4ZYKB 4HKZB 4TSAL 4R0LB 5IKCB 4RMUA 4BZ1H 4JFFD 3MRKA 1OTSD 2AABL 1I3RB 3BE1H 3IKKA 4YC2C 3MREB 3HNSL 3LQZB 4QRPE 5MERB 3C60C 3RZCC 1CR9H 4EI6A 1B4RA 1S9XB 4XVTH 5BVJA 1FDLH 4EKXA 1HN1A 4PG2C 1NBVL 1QLRA 2XKNB 3O6KH 5C2UB 1QHPA 2J8UE 3T4YA 4ETYA 2YD6A 1H3PL 1FNGB 2HT3C 1XAUA 4PJAB 4OZGF 1OGTB 3RKPA 4L4VE 4U6VL 1ZS8A 1YC8A 1YJDH 4PB9H 4Y4HB 3O4OC 2Q3ZA 1BD2B 4RFNB 4WI8A 3D39B 3D85B 5JPNB 4ZAKD 1QEWB 1KTLB 1OD7A 3DMMB 4YHZH 4JFFE 3TO2B 1IAIM 5HHPB 4NP4L 4ODHH 4Q97A 4LCUA 2R1YB 1UCTA 4FQ1L 1MNUH 2FNBA 5DJZB 4OGAC 5J6GA 1YEGL 1Q0XL 1ZE3C 5IESH 4JPWH 2VDRH 3QUKA 4ZUVB 5F9WC 3S37X 2VISB 3S4SA 1GGBH 1INQB 5FYJH 4W68A 3WJLC 4UDTA 1DE4B 1X3DA 1H0DA 5GS2D 4HAFA 1CD1A 1D5IH 1WFUA 4NSKA 3E6FB 4ODUB 4JFEA 5T1LB 1A2YA 2QV2A 2YPVH 2BOCB 5L88L 5A16B 4WO4B 2ZPKH 4Z7WB 3MLXL 1FYTD 5IG7A 1A47A 1TDQA 4RQQB 2DB8A 1EBPA 3Q6FB 3LV3A 4IOFC 4XP1L 4J3SA 3DX9A 2JB6B 3MA9L 4OKVB 1CFNA 2PUQT 1V3JA 3GM0A 3CSGA 1NBZA 1QSFE 2W1NA 3O81A 3G6JA 5MP6L 2EDHA 3CCHA 4GRMA 2WBKA 1FZOB 3VFPA 4Z77A 1TVHB 2DJUA 3THML 3QI9A 1CQKA 1AGEB 1TJGL 1EJOH 5CEXB 1MHHB 5D1ZB 5AG8A 1PX4A 3MJ9H 1SYSB 1WEJL 5EWIL 3DO7B 3FT2B 5H94B 2WBJA 3P73A 2Y1VA 1D5ZA 1UB5B 5E6ID 3O4LE 5GS3A 4IBLT 4XPHL 4LAJH 4NQVA 4FG6D 1Y0LB 5FIEA 1MVUB 1PKQA 4MX7A 4Z7VE 2CKBL 3TZVB 3KPRB 1UWEL 5CINH 4M61B 43CAA 5CJQL 5DWUH 4IHOB 2VDKH 3NN8B 3DROB 1PKOA 1RZIA 3QCVL 1QFUL 4WU7A 5C08A 4D94A 1JGUL 4FQXC 5IB5A 1OY3B 1LO0H 3HLAB 5C2BH 1RUKH 1MFEL 4OCRH 3VXSB 3MXWH 4ZNEE 5J9PA 3RWDA 3ZT5A 4U1NA 2OR7A 2Z31A 1RQ5A 3RA7H 3FOMB 3PP4L 4OZHB 3S36L 3VGDA 2H26B 4TRPH 3E2HC 1WT5A 4OM1L 1SBSH 3RWFA 2IAMA 2Q87A 3RVTC 1BJ8A 4IJ3B 1LQSR 5JXED 1U8MB 3RVVC 1B9ZA 4TSBH 1U8KB 1FFPB 1LE9A 1FRGL 3GI8L 5K9QI 2BHZA 3BQUC 5EO9A 1U8NA 1D9KB 3AREC 3QH3A 4XPBL 2FATL 5KVEL 4KJPC 1NMAH 3OKKB 3TVMC 3VG0H 4MNGE 5CUSH 3BH9B 3VRIA 1F45A 4PJXE 3DX8A 3X11B 3ROLA 3ZL4L 3GFUA 2PR4L 4G8FB 3VH8A 1ZA3A 1YQVH 1JGLH 4XVSL 2FWOB 4FXGA 4LLUA 4R9HA 3O9WB 2R56H 3MR9B 1D6EB 5TE4L 4OLXH 1WBXB 5L2KD 4YBLC 3KXFA 5IB3A 4XXCC 5E2WL 4YEFA 2VJXA 5KJRH 3E8UL 4JFOA 4PUBL 3OXSB 3SOBH 4HX1A 2EE2A 2CR3A 4H0IA 3SCMB 4GW5A 4RFOL 5E56A 1L9NA 3DV6A 1A9EB 3LDBC 1KCUH 4GXVH 3K46A 4CNIA 5GISL 4FQCH 2VKXA 1WWCA 3ARFD 1KC5H 4GW4B 2AJSL 2R4SL 1BFOA 2G2RB 4G3YH 4EDXA 4XVJL 2ZUTA 5FA3A 4I4WA 4NCC2 2VXUH 3QUXD 4HUWB 2IFFL 3I6GB 1A4KA 1JNNL 2BVTA 3RWJA 5J7CC 3EO1A 4PS4H 1T6VN 4NKDB 4N90E 4YDVB 4PLNC 1QVOA 1T03H 4RBPH 1P6FA 4RGNC 5DJ8A 5BV7H 5HYJB 3MRIB 2PETA 3QAZC 5IGXL 3FRUB 3GBNH 5CGTA 1SJVA 4H1LA 3LRSB 3TBVB 2GSGB 5HGBA 1NC4D 5F70A 4NQXB 3L3GA 3WNPA 3HR6A 1ZHKA 4L1DA 1YY9C 1LEGA 4L3CB 1S5IH 4XBEL 4HXAH 1NANI 3FO0L 4JQXA 3L6FB 1UFUA 2A77L 1E6OH 4M9PA 3ILQD 4RWYH 5KBNC 5DA0B 4XH2A 4KK9C 3MNZA 5CZVL 3UPRB 3MCKB 1HXMA 4HG4J 3PQYA 4D9RE 1IC7L 3BZEB 4ZAKB 1Z3GL 4ZFFA 2WUBH 4RNRB 2EDEA 1F00I 4Y0GA 1RUML 3UJTH 2Q7NA 1ZLSH 1Z9LA 1L7IH 4ZDHA 2VXSL 1SJEA 4BKLB 1DQDL 5E8DH 3JVGC 2P8LA 3G6DL 3CVHB 3UPCA 4P99A 1A3QA 5IIEA 3UJJL 1K4DB 4HT1H 4Q74A 4U1SB 1VHPA 2C3WA 2CRZA 3OJDB 2PO6A 1HXYB 3TCXA 2VYRE 4GQPH 1LO5A 5F8RC 3BZFA 1KPRB 4I3SL 5E2TL 4Z8FL 2Y36L 3AS2A 4LVNB 5F96L 3VFUB 1FORH 1C12A 4PGBB 4RMQA 4K9EL 4NCDA 3AGVA 5IHLB 1U42A 2E8ZA 4HS6A 5I1CL 5DLMH 2XRAL 3F58H 3OKLB 4LSQL 4LRIA 1U58B 5C0ND 4ZTOL 2CUMA 1GZPA 4MAYB 4NNXA 2P5WA 1A7PH 2HT4D 3TJEL 2FLRT 3SO3B 4WW2C 1CE1H 4JGJA 2LAAA 1CFVL 1PGRB 4KZEL 1NFIB 2B7DT 5IV2B 4OQTL 5F9OH 3R8BB 4JLRA 1AD0A 4LPUA 4ZFGH 4Z7VA 2FLBT 2YMXL 5IB1B 5E6IB 1PDKA 3U4BL 3EKCA 1IAOA 3HZVA 2NY2B 3NABL 1B6UA 4X9IA 4KZDH 5GQBA 3RPIB 1GPOL 2A38A 4PG9A 2CXGA 3EYSH 4N68A 2E7CA 2EECA 2A2QT 3UTSA 2VLLB 1LDPL 3Q1SH 2D03H 2EEAA 1AXSB 4U6HB 4N5EC 3F65A 4YNYA 1CGUA 5E4IA 5HHMD 3T0EC 1U3HD 2D31A 1W0VA 5JHLH 1F4XL 2VDMH 1A3LL 4GG6B 3UZVB 5IR1B 3IS0X 4GOSA 3HAEB 4PJBB 2OL3A 2NTFA 3B9KA 2LU7A 1MFDL 2CLZB 1IBGL 1KENL 5T33L 3RDTA 2F19H 4GRLC 4YGAB 1EZVY 4F57L 1MWAA 1RUQL 2QQKL 3DLQR 3UZQA 4LNRB 1AHWC 4XAWH 1DQJA 2QHLA 3IGAA 1IZJA 2WSKA 3I02B 3TF7C 1IEAA 2J8HA 1U91B 3QEQE 1BQHA 2EDYA 3DTXA 5GGRA 4PJXA 2GJJA 5AUMB 2NY3B 4W6WB 1BF2A 5IBUB 3TA3A 1C5CL 1H5BC 3QR2A 1GAFL 4S10A 2M1KA 3ARTA 4YZFF 1CICA 5CEZL 4N8CL 1PZUB 4KTEH 3HUJB 4NQED 4K71B 3WDHA 3OKMA 2F5AH 2H3NB 3KPOA 1JF1A 1JPTL 4LBEA 1FLRL 4HJGA 2BNUA 3TFKD 5DMGC 3W0WB 2BERA 3C5JB 3S37L 3OL2A 5BVPH 4HKJB 1K3IA 5L2KB 3G6AA 3GI9L 2BVOA 4YUEL 3SE8H 4BYHA 4XPGH 5TE6L 1BEYH 3OZ9L 2X70B 4LSUH 4P2OA 3LSOA 1F90H 5TF1H 3X14B 3GIVA 1IGFH 1PY4A 5CEZD 3BN9C 5GHWL 3L1OL 4JAMB 1DJSA 1FL6B 1KTDB 3HZKA 2DD8L 3MV7E 5KANG 1KLFA 3UAJD 4APQC 1CFTB 3VFWA 3NFSH 3T0WA 3QUXB 4TQEL 2O61A 1AP2A 3C5ZD 4JO4H 3B2UC 4RMWA 3CDCA 3T2NH 3QDJB 3QFDA 2EIDA 3PF2A 1XZ0A 1L6XA 5IMLA 4PJDF 4QTIL 4PJCF 5KG9A 2BVQA 4FZEH 2Z35B 1QPXA 2F53A 2ZCKH 3N1GC 5H35B 5CEZE 2CDEA 1KEML 1OLZA 1NCAH 1KPUB 4JRXA 2BDNH 5TJWK 5IEKB 1IVLA 1UJ3B 2P49B 2BXZA 2R0KL 4JFDD 5IFAH 3TESA 2IQAB 4Z5RA 4EDWH 4TUOB 1DDHA 4R8WH 4F7PB 1GGCL 4FFWC 2KZ1B 1JYXA 2V7HA 3RNKB 4W70A 4BQCA 4P4KA 1T22B 3TT3H 1RPQA 2FHFA 4K8RL 4DK3A 3F7PC 2VR9A 1G7HB 4GMTL 5BW7A 3F7YB 1GOFA 3QUMB 5GS0L 3PGDA 3CFCL 1NC2B 2VZUA 4G8EB 4LLYA 3QG7H 2AJXH 5KSBB 1U8JB 2ZWLT 4OZFG 3DPBA 1I85C 4CADB 4JPKH 5JDJA 3TN0C 5HGHB 3WLBB 3PV6A 5CGYD 2VXQL 3KR3L 2GJ6E 5IJKC 1BWMA 3BXNB 2XTJD 1KTRL 3RGVB 2DMCA 4K8RD 5ESQB 5CD5C 4BFEA 3O6MH 3QXTA 5MI0B 2WLZA 5GS0D 4L9LC 1FG9C 3OAZH 1YYML 5B4MC 1HHJB 3BUTA 4BSWB 3C6LD 2KUTA 3HB3C 2HJLB 5LWYL 4DGIL 1GC1L 5BRZD 4P23C 1QLFA 3SDDC 1IAKA 5T3XL 3VFRA 5IBTL 4Q7DA 4X4XA 4QXGL 1IKNA 1MREL 1YPZF 3HMWL 1DQLL 5C0DA 3PWPE 2NZIA 5IJVB 4OSUL 4KJYB 1NDGA 1YEDB 2XTJE 5J1AA 3NPZB 1FPTL 1S5HA 1TLKA 4R7NB 5J6HA 5ETUA 5ID1B 2V2TA 3N1QC 5BOZG 5IM7A 4EVNA 4XMPL 4LLVA 1T89A 2XWBA 4P5TC 4YHLH 1J8HA 1T0NB 5J11C 1X6LA 5ISZD 2WUCH 4JO3H 1WBZA 3RL2A 1II4E 2ARJB 4KRMB 5BRZE 3P4OA 3VXOB 3ULSB 1NUFA 4FXKA 1CF8L 2YKLL 4CW1B 5HHMB 5I15H 1OAYH 1U3HB 2D9QB 4YPGB 1FFQA 2HRLA 4M3KB 1A7QL 3ZT7A 1GH7A 1HHKA 2H9GA 3FT4A 5C07D 4Q9QL 3SGKC 1DBMH 5DMIH 3EIFA 3QB7C 4AEHH 2DOCA 2I27N 1FC1A 3FL7A 2IPKB 3BPCB 4KDTC 1OTTD 3DV4B 3ZLQC 4P5MB 4HCRA 1ED3A 3ZT6A 2FHBA 4J3UA 1Q9LB 2ERJB 4L4TB 3LKPA 2YD8A 1OP5K 2R4RH 3W11C 1NCDL 5K9QG 3CX2A 4YHYB 5T3XE 4OQTA 5DJ0A 3KLHD 4G7YH 4HUMB 1HH6A 2YR3A 2J7LA 1YEIL 5DJ2B 5EU6A 5CJXC 5FHAH 1ZK9A 4HGWA 3WD5H 4KHTL 4RRPA 5KW9H 2VR4A 3QUZA 5F88B 5C07E 5FB8A 3P11H 1DN0A 5LAXB 4KUCF 4MA3B 5I2IB 5EN2B 5F6IB 4M7LH 3VG9B 3IFLH 4NRXB 1TJHH 1P69B 4HKBB 2XZCL 4U4BA 5KN5B 3U6RA 1W72H 1N0XL 1IMHC 4OCSH 4YPJA 1B0RB 1OF2B 5IB2B 1JWSA 4LPTA 3GSUA 4M02A 3TNMA 4W6YB 4U33A 4R4NC 4LFHD 3LKOA 1P5UA 1IGCH 1FNFA 1EO8L 4KPHL 2WWKO 3UTTD 3FKUS 3ZHLA 1YMMA 2FCBA 2VDQH 2DYPD 2BMKB 3OF6D 5DTFB 4QGTA 5JA8B 5C0JA 2BSTA 3DVNB 4G6MH 3SEPA 3B9EA 3ARBA 4QKXB 5JW5B 1EEUA 4UI2A 4WTZG 8FABA 2GK2A 1KIRB 5FO9A 1F58L 1CLOH 2IGFH 4NM8L 3MV7A 5BMFL 5EFIA 3TBSA 1S9WA 3GNML 4R96B 5FYKD 3G5VB 2XWTA 1G9MH 3LPGA 2I9TA 3MMEA 3WN5C 4F7CA 2C4FT 3X17A 1YN7B 1CE6A 2HTKC 2W0FB 4Y4FD 3SQBA 3O2WH 4JFZL 1DUYB 4OFYD 3C5ZB 4X80L 3EFFA 4AYFA 3F5WB 3IDNA 5DRXA 4U1LB 5FA4B 3BP6A 5LXGL 3M8OL 4JE4B 4BH8B 4KVNH 4P49A 2FECL 4HDIB 4K2UH 3ULUH 4U1GB 4NKMA 1NGYA 4NC2B 3G04A 1R6VA 2PTTB 3IXAB 2QSVA 4NRYB 5MEQB 4GAYA 2UWEE 3B3IA 4OCYL 1JMZA 5D5ME 5A3ID 1AR2A 1U8PA 2ED8A 4ZUSA 2PXYC 4P3CL 4WWKA 4JFDB 1LK3H 2ZOLB 1QBLH 2XKUA 2EZ0C 1A4JB 1BZ7B 3SDAA 2ZP0T 1SMAA 3NIGF 3VFOB 5I8OL 4U1KA 1NCNA 1RJZB 3ISWA 2CO7B 2RJMA 1RUAL 5EO0A 5HI4C 4LHUG 5AAMA 4J1UB 1TZGH 4FHBD 4R26L 1AGCB 1EHLL 2X10A 1B0GA 2A6KA 4Z95L 1I7UA 4JJ5A 4TVPL 2NW2B 3E3QE 1H8NA 2VWEC 4JREC 5T3ZL 2VO5A 3QIBD 1MJ7H 3G9AB 2GJ6A 1ZHLA 5FECB 5CP3H 3T0DA 1X5JA 2OTUA 3EOTH 1K3ZA 5CHNB 4F2MA 1CYGA 2WIIA 3IXTB 4FZ8H 2SEBA 1TETH 2DMBA 1YN6B 1R0AL 4PV9B 1M05B 1G7MA 4O02L 1J0YA 1ZEAL 1XIWC 1OB1B 5F97E 3MV11 1DBKL 4WFFD 2YBRA 5EULV 1LE5A 2HTLC 5KSVA 2EKSB 4K3JL 4TVPD 4XPFH 2O26U 5IVOA 1HKLH 1IGJA 3L95A 3F7VA 2AXFB 2HVJA 2WK2A 1JNJA 4J6RL 1S7TA 1J5OH 4PREB 2N56A 4NC1C 4R90L 3DRTA 1QO3B 2B5IB 5B3JE 1F6AB 2L7UA 4MVBD 4U49A 3TYGH 3ULUF 2OL3H 1QRNB 1KCRH 2G5BA 4P5KA 1I4FA 4Y4KA 3KYAA 4F58H 1JV5A 4NO0B 5EBLB 3WL9A 3EOAA 5JHDA 1I8MA 1J1XH 4X9BA 1ZVYA 2IH3A 2FEDD 1EFXB 2BXYA 4MD4A 1OCWL 1MWAH 1ADQA 4NQDE 4LSVL 2P8MB 4ODSH 5T3ZE 4OZFA 4FQIL 4A6YH 5D7LE 3ARZA 1YNLH 5JPMA 1IE5A 1RUPL 3IYLW 4QY8B 3TO4A 1R5WA 2I07A 2D7NA 2BX5A 1HNFA 2GSIB 3NIFF 4E0RA 3MFFA 1NEUA 5HHOE 3FQUA 1U3YA 1B4JH 2A74A 3N85H 5DEZA 3MRMA 2CRIA 3UO1L 3K2UL 4HUXB 4LCWE 5T5NG 1J10A 3NCMA 5E4EC 3BGMB 1A7RL 3R0NA 4KKCD 3LS5L 5F7HA 1JHTB 1J0JA 3QA3A 1RURL 1N59A 2OZ4L 2DQDL 2UUDH 2ZNWA 2P24B 3EYVB 5KOVC 5DQDH 3T09A 2M26A 3T8XB 3JV5A 1MCFA 2P8PA 3MRRB 1QHOA 4FMFA 1BGXH 3CLFL 3I6KB 4IRSC 3O6LL 4P46A 3LZFL 3VXMB 5LQBH 4OZGE 1UB6B 4TPRH 4ZPVA 1V7ML 3KYKL 3U36A 4UT6H 3LHPL 1BBDH 3AU1A 5B38G 5F89A 4Z7UA 1MCNA 3GUTA 5JOPD 1BVKB 1P1ZB 2VLJD 5D71L 1QBAA 3MODH 4HUNB 3QXAB 4NHCH 3U46B 3P2TA 3C8KA 1IC5H 2CLVB 3BT2H 3C60D 4YHOL 4EI5A 3RZCD 5IFJA 4ZO7A 5IT2H 2DIBA 3OKNA 5I1LA 1MHPH 1U9KA 1A6WH 4NO3B 2ZKHL 1IEHA 1MCWM 4Z7WE 4PGEB 1XF1A 4KTYA 4HMDA 3TNNB 1R3JA 3SDXF 3CFEB 3GDBA 2AP2A 5DYOA 4G9FB 5C09E 5DK0B 2B8OT 1QSVA 1XGYL 2ARJQ 4I5BB 1KB5L 1ERNA 4PD4J 1KPVB 1MIMH 4HJ0D 4R3SA 3JV6A 3WLWC 5D7IF 2BY0A 3BVNB 2YN3A 4KC3B 5L2JB 4QOKD 1W8NA 2CIKB 1C1EH 2MPAL 4ZFOL 4OGAD 3PUCA 4AM0B 3RWEB 4F33A 3F7RA 3ZDZF 2VL4A 1NKOA 5AYQA 3AM8C 2DM3A 4G8GA 5HHXL 4E41D 2DQEL 2CLRA 1EDQA 3TPUA 2BNQD 1I7ZB 3FONB 4DCQA 3RRQA 4LLMA 4Y5XB 5L6YH 4Y4FB 2J2ZA 2YZ1A 1VPOH 4J3TA 5DZNA 1PLGL 3I2CH 3MXVH 4H8WH 4XWGH 3GMQA 3SKNA 1RULL 4IOFD 4YR6B 4I48B 1NSNH 3MBEA 2GT9A 1UCBL 4GSDH 4G6FD 5K93A 1Z5LB 4F7TA 4M3JA 2E9WA 2EDTA 2JJVA 1JPFB 3WNMA 4LVHB 4JFYA 3LS4L 4AK1A 1T20B 3AROA 3MGOB 4XP4L 2AK1H 2J6EL 3V6FA 1UACH 3HI5L 3VXSE 4YK4B 4OLYL 2VUYA 1KCSH 2EKJA 4JDTL 1VFAB 2OMBA 3MNVA 3KYNA 2BVPB 1KIPB 4YHKL 3WO3B 3SKMB 3VE0A 3EOBB 3ARRA 5GRUH 4YQXH 3O6FC 5F7MC 1JPSL 3WHXA 4NKOB 4CVXA 5AZEL 1FH5L 5C0EA 3MUHL 3SKOB 1MEXL 3MACH 1UENA 2BHYA 3MRHB 2RB8A 2GTZA 3GIZH 2QHRH 4XCFH 1TQCC 5DHVA 43C9B 2DTML 5FYLL 2HWZL 2I60H 2MFNA 3QDMA 3ULVF 1LD9B 1X5LA 5BZDB 2WWMC 4L3AA 1Q72H 3RTQC 2ADGB 4JDZA 3QQ3B 1G7QA 4FQXD 1WBYA 2YWZA 1OSPH 4PRBA 4L8SA 1KT2B 4M00A 1IGTB 1Q94A 4FA8A 1U8OA 1MJUH 1AXIB 3S5LG 3QNYA 3HZMA 5IMOA 1MAML 5CBEB 3NH7H 5D7JC 4FMKA 4IOSD 1T5WB 1M7DA 1D5MA 3S9DB 3RVTD 1M6OA 3VWKC 4TN9A 3FO1A 4MJ5A 3RVVD 3ZTNL 4RDQG 1MLCB 1VKXA 4I3GA 2P5EA 2W9DH 4OB5L 4PRPB 4XVUC 2GITA 1Z2KA 3VXUB 5CP7B 4MDJB 3ARED 1P84J 4KJPD 3BKYL 1FNEB 4PBXA 4HCRH 4U3XA 5DSCA 4HKZA 1NDMB 4R0LA 4UTBH 5IKCA 4C58B 3C5SB 5ALCL 5E7BA 2NTSP 1I3RA 1BQLH 1WWBX 3MREA 1GJIA 3H9SE 5FCUL 4I18B 3LQZA 2X05A 3O0RH 4XNUH 5MERA 1GOHA 2ICEB 1SY6A 1G9NC 4NIKB 2J3SA 5FYLE 1S9XA 1IAIL 3PNWB 4JFXB 1NMBH 5D4QA 5HHOA 3M1BB 5SWZB 4CVWA 4Z0BH 2XKNA 3V0WL 4YDLC 5FYKU 5F7FA 2BK8A 4OD2B 1FNGA 4M5ZL 2ZG2A 3BPOC 4PJAA 1BP3B 1OGTA 1V05A 2H32B 4C56E 3NAAL 1UXWB 3WV0A 1J86A 3MRFB 3IDIB 4Y4HA 5I1KL 1BD2A 4LHJB 3D39A 3D85A 5JPNA 1F02I 1KTLA 1QEWA 3DMMA 3TO2A 5HHPA 2R1YA 3SBWA 4WI9A 4NWUH 1N3NB 1QYGH 5DJZA 1IGYB 1QPPA 5HDQL 2X4OB 1MPAL 3GSRB 4FTVD 1MCIA 4JHAH 4ZUVA 2VISA 4PRID 1INQA 4GQ9L 1DE4A 3OKOB 2DLEA 1LO4L 4RGND 2VLJB 1YEKH 5SWQB 3E6FA 4ODUA 5T1LA 1KCLA 4P9HH 2BOCA 5A16A 4WO4A 1I3GH 4Z7WA 3AY4A 3CMOH 3FAXA 4RQQA 1OAUH 3Q6FA 1LP9F 2Z93B 1ZT1B 4OKVA 1AI1H 1YY9D 4HF5L 3QEGH 3KYOB 3MRNB 3HNVL 5FGCB 1FZOA 4U2ZA 4PRIE 4FNLL 2FX8H 1TVHA 2EDWA 4Q6IC 1FFRA 1AGEA 3LN5B 4XP9L 4RGNE 4UQ3B 1IM9B 5CEXA 2AK4D 1MHHA 5CJBA 5D1ZA 1XF3A 2DKMA 2JJSC 2JLLA 4U31A 3FB8B 1SYSA 2QSQA 4QOKB 3FT2A 4Q0XH 3DO7A 3OAYH 4M6NL 4LNVA 1YNTB 1UB5A 4HV8B 1R3KA 5DC0A 3L3DB 4ZD3H 2BJMH 1AGDB 1Y0LA 3JTSB 4JY5L 2V5TA 5F9WB 4OV5B 2KPNA 4DAGL 1MVUA 1OPGH 5T1KB 4GKSB 4E41B 1OAZH 3KPRA 4HH9B 1EXUB 4M61A 2W59A 2BNQB 5ABDE 4Q2ZB 4IHOA 4X83A 3UYRH 4CGTA 3NN8A 4IEFB 3DROA 3P0YL 4ONGL 1TPXB 4QHMB 5D9SB 3RY6C 4DZBB 2VZSA 3T0VA 4NKIH 5J13C 2ADIB 3BGFC 1ZVSB 3HLAA 3VXSA 3U4EB 4G6FB 4WI5A 1F4YH 4PJFF 4XPAL 3NCCB 1VFUA 2P7TB 3FOMA 4OZHA 3AUVA 4I0PB 3LH2H 2XI9A 2DQJH 4UQ2B 1CU4L 4P48A 3VXQB 4X5XB 2R8SL 3ZSTA 5D8JL 4PBWD 1U8MA 5FK9A 1U8KA 5GIRB 2J88L 1FFPA 3V0VB 5AAWA 1FQ9C 4XNXL 4JHWH 4JM4H 1DBAL 4LCIL 4LPXA 4U6XB 2CK2A 5K59E 1D9KA 1RZJC 4JM2C 3EYUL 4FQJL 1GYAA 1EHXA 3X3FL 3OKKA 4L3ED 3PGFL 2V5RA 4WUKH 4PY7B 1XGQB 5I1JH 1UEYA 3BH9A 4O2EB 3NACL 4LSTL 1EGJA 5E70A 4N5ED 3QUYC 3LRHA 2FO1A 1N6UA 1P53A 2Y07L 3X11A 3LN9A 3T0ED 3RIFF 1F11B 4G8FA 4M8QB 5KTEL 4FQXB 5GSRB 2ICWJ 3DBXB 2Y06L 3EDDA 3O9WA 4S1RH 3MR9A 1D6EA 1UM5H 4OZFH 3ZYOA 1OAXL 1WTGT 1T2XA 1WBXA 3Q6GH 4LRNH 1KYOK 3BJ91 1A6UH 1FLTX 4MA8H 1A7NH 3CU1A 3OXSA 3W0WE 2F74B 4R4FH 3E2HB 4HWZB 3SCMA 1H3XA 4X6CF 1A9EA 4MCZB 4ODXB 3IU4L 1XCQB 4JB9L 4KDWA 5AEAA 4GRLD 2GTWB 4PJIF 3FO9B 3INUL 3FO2B 5EU4B 3G5XA 4GS7B 4KI5C 3DHJA 3HPJB 3JWOH 4GW4A 5BJTB 3DUUB 4Y19B 2G2RA 5HHVH 1RIHH 3BDYL 4LARL 4BQ8A 4MQSB 2V6HA 2FECI 4RIRB 3V8CA 1FZJB 1L0QA 1S9YB 5GS1C 4ETQB 1I1YB 4HUWA 3I6GA 3V6BR 4G8IB 4OJFH 4ONOA 2CK0L 5MEND 2Z92B 3W5MA 1AQDB 1LNUB 4NKDA 2HP4A 4YDVA 5HYJA 3MRIA 1JGDB 3FRUA 4FP8L 2DL2A 1MFAL 3LRSA 4ZUUB 3QDGD 2GSGA 3BD4A 3FJTA 2D7MA 2YS4A 3IDXH 5ITFB 4JG1L 4LCCB 2YK1H 4CAGA 1QP1A 4NQXA 1D6VL 1G6RL 5FM5O 1FV1B 4JHZA 2Q3AA 5DMGD 1WZMA 4FS0A 4UT9H 5SWSD 4L3CA 1GHFH 4YBLB 4NN5B 3BOVA 3L6FA 3J7HA 4JRYE 2ID5A 5JMOC 4J3OC 2ORBH 2X1PA 1P4BL 1OGAD 3KWWB 4NJAL 5IVXB 2DQTL 5MENE 1FAIL 3LDBB 4QWWC 3MCKA 3UPRA 4H88L 3BZEA 4ZAKA 4MXVF 4DN4H 4GKOA 3GMMB 3NMEA 4RNRA 4F8QA 3BN9D 3QZWG 4W81A 4LF3B 5FYJU 4ALAH 4MQXC 4M5YL 3M45A 4DOHE 4BKLA 3GSOB 3HE7A 3JSSA 4APQD 3EDFA 3T08A 3CVHA 4FTVB 4XNQB 1FL3B 3IU3B 1K4DA 4CBPA 2IQ9H 4U1SA 2CO6B 4ZFZB 3B2UD 1U93B 2BRQA 3OJDA 3HG1D 3S3PA 1HXYA 5D70H 3QAZB 5DJXB 3OTTA 1KPRA 1MCBA 1HH9B 3VFUA 5TGBB 1FIEA 4RA3A 4PGBA 1JHKL 4GUPB 4MCYB 4EOWH 4WEUD 3V52L 2VH5L 2AAVA 3RKDC 5J8OA 5BCAA 3OKLA 2AXJA 5BV7B 5CSBA 2OK0H 4ZXBB 1U58A 1A5FH 4MAYA 4D8PB 1XT5A 4U7MA 4YE4L 1GOGA 2FX9H 4FFWD 4U3HA 3U2SB 4XGZB 1Z0NA 2BC4B 3LQAH 1LHZA 2Y7QB 1H3WM 3BO8B 3HG1E 5ICXB 2VLRB 2AK4B 4ZNCD 4OUUB 1NFIA 5ACMA 1UM6L 5IV2A 1WAAE 1N7ML 4OLWH 3ZE2F 1TZHB 3GSNL 3FQNB 5I18L 1FC2D 2BSRB 3UBXB 4UV4H 5IB1A 5E6IA 4B7LA 4WEMB 4KKAC 1NBYB 4IRJB 2KKQA 4PB0H 3RPIA 4Q6YA 1AKJD 2HH0L 5E03A 1BOGB 2VLLA 3TBYB 1FNHA 3ES6A 1OARH 1AXSA 4U6HA 2WM0A 5CILH 1T1ZB 5F9AC 3MPCA 5DHVH 5CLTA 5C6PB 5CKAA 4KGJA 5CD5D 3H9ZA 2YD2A 4EBQH 1CDYA 5B4MD 5IMMB 5IR1A 3NTCL 3N9GL 3HAEA 2VC2L 5FUOL 3HB3D 4PJBA 4ZSOE 4HWEL 3KYMB 1WCQA 4WGWB 4EUPG 2VDOL 5CJOL 1EV2E 2CLZA 3SDDD 3V5HB 4OI8A 1EHNA 4U1HA 3DSFH 4UUJB 1IGMH 4M6AA 2APVA 4MNHB 1NANH 2I25N 2PYED 5JTWA 2JK5B 4LNRA 3WKMH 4X99B 5IUSA 4JQIL 4KUCD 2HFEB 1NFDF 2FZ3B 4DKAA 5A1AA 1U91A 4TOYL 4PGZA 4M1CC 1QQDB 4XNZC 4M6ML 4XI5C 5AUMA 1BAFH 4J3XA 4KY1H 3G5YB 3OB0H 3UTQB 4PJ8C 4NZTL 4JO2H 4LSDA 2KBGA 4P2RB 2OS7A 4J4PA 3HUJA 1OP9A 3JWDL 3T0EB 2H3NA 1I8IB 2AEQH 3U9PH 1WZ1L 1EEYB 1NGQL 5HJ3B 2LABA 3W0WA 1RHFA 4B7IA 2CSPA 3C5JA 4YDKH 3B83A 3QIUA 4HKJA 5L2KA 4NNYB 3MOBH 4MLIA 1MFBL 2A73B 2VNCA 3VI4F 3WFBL 1WITA 4O4YH 1A21A 2AJYL 1RZKH 2X4TA 1NEZB 2O5YH 2X70A 5DDHB 5GGTA 3W11D 3X14A 4QO1A 4GRLB 3P40A 3N50A 1Q9KA 3QHTC 1IC1A 3L3IB 3NIDF 4O2FB 1A1OB 3U7YH 4JAMA 1FL6A 1KTDA 4MS8D 1FFNB 4JN1L 1E4WL 1FHGA 1W8OA 2A6IB 1CFTA 3RAJH 4WI4A 1IILE 5GJTL 2NY5H 2K7QA 3QUXA 7CGTA 1RVFL 4I9WD 4I77H 1NL0H 2Y6SC 2CGRL 3O45B 4F7EB 2CUHA 4PJCB 3QDJA 3CX5K 3SQOH 4ZS6C 4N0UB 4M7ZC 5GGSB 1O5DT 2AERT 5MEOB 2HFGH 4HIEB 4HFUH 4U6YB 5DUMH 3ZHKA 4TSCL 3ECBB 4I0CC 3QDGB 2Z35A 25C8H 1KEGL 5H35A 2NX5E 4R4ND 1KPUA 4EN3B 2JB5H 2DQHH 5CMAB 2QQQA 5IEKA 1UJ3A 4WFGD 2IQAA 3JUZA 2CDFA 4TUOA 1YEJH 3T3PF 1S9VB 4F7PA 4PJ9C 2C3GA 1Q8MA 3KLDA 4ORZC 4WIQA 4I9WE 2AEIT 3RNKA 1S7VB 1C5DB 4C4KO 1T22A 1Y6KR 3B6SB 1A02N 3A6OA 1G7HA 3F7YA 3WIIH 3AFLA 2C3XA 3Q2CA 3QUMA 1ZV5A 1A14L 3V4VL 3PHOB 4I2XB 1NC2A 1FO0L 3ZKMC 2XOTA 1M7IB 4G8EA 5E95B 2LTQC 2HTKD 3VXTB 3D2UD 5KSBA 1U8JA 2WBJC 3LN4B 1DBJH 4U1IB 4CADA 4AEEA 5FHBL 3GKWL 1HZHH 4ZTPH 5HGHA 3WLBA 3B9VA 3S35L 3S88L 3BXNA 1IQWL 1MI5E 4DZ8B 3GK8L 5E2VL 1MOEA 3FZUC 4YDIH 3RGVA 4X6DE 2R0LL 1TMCB 4FABH 5ESQA 5EBGA 1MH5B 3O8XB 3ZDYF 3UC0H 1YEFH 2FB4H 4ESKA 2PXYD 1KJ2B 1HHJA 1CZ8L 1FBIL 3NCFB 2XXCB 4OZIF 1M7XA 4BSWA 2EZ0D 4WI3A 5I1AB 4U0QB 4G6KH 1YPZB 2HJLA 3VD3A 3UJIL 4AMKH 2Z31C 2ED9A 3BH8B 1WAAA 1UQSB 4CMHB 5E9DB 1WT5C 5IJVA 2IAMC 4KJYA 2H2SC 1YEDA 1IAII 3K1DA 1NCBH 2ZNXA 4R7NA 4WY7L 5ID1A 4LQFL 3H6JA 4HZAA 4U0RC 2NMSA 2Y5TB 3MRBB 1T0NA 5C0BD 2H2PC 3KPSE 4NWTL 4U3CA 4GRWF 1EFQA 2ARJA 3CFIC 5EORH 2NY6D 1U36A 4HPOL 5I74B 3VXOA 1EH9A 3ULSA 2XQYG 2ZZUT 3PDDA 4OCLC 4CW1A 1XIWD 2V17L 3QCTH 2DBLL 5T5NF 1U3HA 3VI3E 2JE8A 4OCXL 2F8OA 4YPGA 2HFTA 2HTLD 4LFHG 3MOAL 3RUGB 3HNTH 1EGJH 3UEZA 3V5KB 1TNNA 4JR9H 4KRPB 4BA8A 4DW2H 4M1GH 1LO3H 1ACYL 2OP4L 3OGCB 4HBQA 5DEGB 2IPKA 3BPCA 1FGNL 3GO1H 1CI5A 3DV4A 1G84A 3QIWB 4P5MA 2FSEB 5L0QC 2XA3A 5CBAB 1Q9LA 4LHQB 4L4TA 4M9OA 3TT1H 5MEPB 1ND0B 4PY8J 5I1EH 3B9AA 1ORQB 2ARWA 4PJEE 4UB0H 1T5XB 4KI1A 2PYEB 2O5XL 5DD6B 1CGSL 5DJ2A 5HDLA 3WO4B 1WWAX 3O41B 4YWGL 3VDCA 5F88A 5LGHL 1OAQH 1N2RB 3CMGA 1YEHL 3BSZH 3MCLH 5BS0B 5LAXA 1FE8H 1PG7X 4MA3A 5I2IA 5EN2A 1NGWB 5D1XB 3MLVH 5D7SL 4NRXA 4HKBA 5KN5A 1T83A 5DD3H 1JWUB 3CGTA 1B0RA 1OF2A 2YD1A 5IB2A 3O3UN 2DN7A 4PRHE 3IDGB 4EXKA 1S3KH 2DWEA 3MLZH 4KQ4L 2ZUSA 4KH2A 1CGYA 3QPQC 4ELKB 1KOAA 5EOCL 3UTZB 3NZHH 1OAKL 4LIQL 3WS3B 3A67L 5DTFA 2BMKA 3HR5B 3KJ6L 4G9FE 5TE7H 3DVNA 4M48H 5GRJL 3U7WL 15C8H 5JW5A 4NT6B 5D2LF 4FQHB 3J8F7 4UU9B 4JQXC 2F54B 2IBBA 2ADFH 1KIRA 5EU5B 4IRSD 5FUCE 1CLZL 1MRCL 1HQ4B 1TVDA 3TWCH 4R96A 3SDYL 3U0WH 3G5VA 3DYPA 1QFWH 2OCFD 4HJJH 1YMHB 1AY1H 1YN7A 2W0FA 5DR5L 3CXDL 3HNSH 3C5ZA 1G7PB 4LGPB 1U6AL 4XNYL 4HIXL 3F5WA 4U1LA 5FA4A 1HHHB 3CVHH 5A2IH 4HDIA 3PWLB 4J23A 2GYSA 2Q8AL 1JPGB 2PO6C 3QQNA 5EIIB 4PLJC 2X7LB 3NZ8B 5GS2H 2VLKB 5BO1L 2PTTA 1U3ZA 3IXAA 4NRYA 5MEQA 1NLDH 5CAYB 4PJHE 3B2VL 4JG0H 4JFDA 5K9JL 3WLWD 2ZOLA 7FABL 1YYLL 1A4JA 5C86A 1BZ7A 1W72B 5C0IB 2AJVL 4NP4H 2ZUQC 5FO7B 3VFOA 2J8UF 3EGSB 4UTAL 4LIQE 3WSQL 3IRPX 5EO1B 1RJZA 4LRIC 2HJKB 1SM3L 5E2UL 1Q0XH 4J1UA 4HBCH 5FV2A 3U9UB 1KFAL 1AGCA 3PHQB 4BFIB 3ULVD 5L9DH 2NW2A 2XNAB 2CKNA 3BIKB 1F4WH 3N06B 4X5WB 4Y1AB 1XEDA 4AQOA 5FECA 3L3HA 3LMJL 2JF1A 3I84A 3MLXH 3FB7B 5CHNA 3IXTA 5FM4A 4HULB 1SQ2N 5CJ8A 1YN6A 2P45B 4PV9A 1AE6L 1M05A 1NH6A 4PJ5D 1KN2L 1OB1A 3IF1B 1IRAY 4X4ME 1BOYA 5F1KC 2B4CL 2DM2A 2V5SA 2EKSA 5FGRA 3THMH 2PXYB 1T1WB 4X6EB 4OUOA 2VE6B 2AXFA 4YFLF 4RDQF 5AYUL 1ZXQA 4Q9RH 3O6FD 1WEJH 5EWIH 4PREA 4ZO8A 3LRGA 1CLYL 1BHGA 1X7QB 3B9KC 1QO3A 3FQWB 4XPHH 3TV3H 4K3HA 1F6AA 1JTOA 1QRNA 1HSAB 4F9PA 1K9TA 5B8CC 5H8DA 3GJEB 1AFVL 2CKBH 5HI3C 4PRPE 1UWEH 3RDTC 3QHZL 3TYFB 4NO0A 5EBLA 3BP4B 5CJQH 4PJ5E 4DGYL 1CG9B 2C5DC 5GGUA 1EFXA 1SVCP 3U83A 4C54A 5D96C 3FFCE 1MJJB 4ODVH 5F21B 2WWMD 2P8MA 5C0BB 3KPNA 3RTQD 1JGUH 4P2QD 1QSEE 5E5RB 5T1DL 1R3IL 4L4JA 4N8VG 3PJSB 3KLAB 4MNQE 4Z7VF 4ZS7H 4QY8A 3MBXL 1MLBB 5IROA 2NY6B 4JO1L 3L5JA 3TA3C 5K9OB 2EDDA 3TH4T 2GSIA 4BZ1L 4DKEH 3PP4H 4GFTB 1VERA 1I9IH 3BE1L 1NGXB 1CICC 1NMCC 2BRRL 4HUXA 3BGMA 4CVUA 2R69H 1JHTA 1CR9L 3C9NB 4N0RA 3VWKD 1ODAA 1FDLL 3L3JB 3EYVA 5I1IH 3O6KL 1IARB 3T8XA 3OPZH 3MRRA 4IMLB 4XVUD 4MDIB 2FGWL 3I6KA 3HCVB 2JELL 3VXMA 3ARDC 4ZO6A 5HYSG 1YJDL 1M1SA 4XPBH 1UB6A 2FATH 4M8VA 3IFPB 4P2OC 1MCPH 1CDUA 4NOFA 2HA1A 3SE9L 1N4XH 4KJWD 4OD1L 5E8EB 1BVKA 1IGIL 1P1ZA 1PJ9A 4ODHL 1EIBA 1WISA 3QXAA 1GIGH 5TQ0L 5AZ2H 3U46A 1NAML 5KZCD 2CLVA 3O2DL 2DS4A 4JPWL 4IDJH 5JQHC 2VDRL 4IOIB 1QLEH 4XVSH 3SDXB 2EO9A 2I5YH 1UH2A 4NO3A 4UIKH 4WFEE 4KMLB 3UROR 3DGGB 1X5IA 2VB5A 4R2GC 4YDJB 4PGEA 1FVCB 3KS0H 4M6OL 5FDWB 3TNNA 1D5IL 1RK1B 2F5BH 3CFEA 3OMZA 5GRVL 1OQXA 4U1JB 1JGVL 5E2WH 4PJXF 1NKRA 4G9FA 5D7IB 5DK0A 3CVIL 4A6YB 4I5BA 2ZPKL 1KPVA 4S2SB 3V95A 5JW4Q 3BVNA 4FQ2H 2W07A 5L2JA 2CIKA 2DJSA 2PF6A 2R4SH 4RX4D 2NXZC 4QHLB 4UIMB 4AM0A 3P9WB 3RWEA 4L5FH 1IJ9A 4Z7OE 4IRSB 4MJID 1U8HB 1OM3L 3QXVA 1AO7B 1WUNT 4P4KC 1HINL 3RIFK 1JNLH 1HIML 1N6QH 3QDHA 1I7ZA 3FONA 5BW7C 3HFML 2FDBP 1CIDA 3ZMRA 4Y5XA 5IGXH 4Y4FA 3E6HB 2Z8SA 3C2AH 5DURD 3QUMH 3GKZA 3MV8D 4OFYA 1CXFA 3R0MA 4LASH 4QRRB 4F9LC 3U0TB 3FN0L 4I48A 4YR6A 4UILL 3B4NA 1Z5LA 2E7LA 5FV1L 1JPFA 4XBEH 1L0XA 3RVXD 5GRYA 3FO0H 5C0RL 3MGOA 4MJIE 1UT9A 1E27A 5DVOA 3R4DA 4DQOH 5I1HH 1H8OA 1VFAA 2BVPA 5DO2C 5SX4I 1KIPA 1Z3GH 5C2BL 3SKMA 1RUKL 4OCRL 3EOBA 5ICZB 1RHHB 2YD9A 4NKOA 2VXSH 3MSPA 3RA7L 1DQDH 4NHUB 3SKOA 3S8WA 3G6DH 3MRHA 4TRPL 3V6ZB 2W0PA 4OGZA 3UJJH 4WGVB 4ELME 1IKNC 4X6FB 3DURA 4F15C 3FCTB 4XT1C 2AQ1A 4TSBL 43C9A 4J2XA 5I1DB 1CQYA 4I3SH 1LD9A 3KS0J 5F6HJ 5E2TH 4BUHA 5LKNA 5BZDA 2Y36H 4Z8FH 2F8VA 5I6XC 4XX1E 5D93C 2ADGA 5DHYB 3QQ3A 3V6OE 3ESVF 2C9AA 3DGCR 4CMMB 2E9IA 5I1CH 3OAUH 1KT2A 1IGTA 3HC0B 1EBAA 3VG0L 4X6BB 4XMLL 2HRPH 4OAWB 1UWXK 4QHNB 1V3KA 3TEUA 2P47B 3EZJB 3TJEH 4V1DB 5CBEA 3GRWH 1T5WA 4IS6B 1MCQA 1YQVL 4K9EC 1DLHB 3K4DA 4NUGH 2W92A 1JGLL 1DL7H 4Y16B 1XF2B 4KZEH 2BOBB 2R56L 1MLCA 2K7PA 1SJHB 3H0TB 4OLXL 3TIEB 4PRPA 1A7BA 3VXUA 5KJRL 3DX6B 2B0SL 2EH8H 5CP7A 4MDJA 3SOBL 4H26B 2YD3A 1U2HA 1EERB 3MLWH 1GPOH 3MJ7B 4JM2D 1LO2H 3P77A 1FNEA 4GXVL 5C0AE 1NDMA 3G5ZB 2ZOKB 2ZUWA 1LDPH 3C5SA 4FQCL 2V2WB 5ACZB 5CZKA 5CSZB 3T2PA 3QUYD 2FL5B 4AG4L 2OXGA 4NQCD 4G3YL 4JFHE 5LG1A 2ICEA 3K74B 4NDMB 3QUZC 1JNHB 2XZAL 4KKLC 5JQ6H 3PNWA 4JFXA 5IEHB 1F4XH 3DETC 3M1BA 4L8BB 1A3LH 1SEQH 5SWZA 2E27H 4LP4A 5E1AB 4PS4L 4BJLA 4CN1A 3DO3A 1T03L 3QQ9C 4OD2A 4X9GA 4X8JB 4HIIB 2H32A 1NLBH 3GBNL 2A0LD 3FB6B 5J0BA 5F7NC 1UXWA 3NCEB 1IBGH 3MRFA 3IDIA 2ZG1A 4KK6C 4PV8B 3NA4A 4Q9CA 4N8PA 3VWKB 5MHSD 4F57H 3VRJB 3CLEH 2QADC 5IVXE 2QQKH 3IDMB 4KI5D 5DFWH 1N3NA 3OHXB 4YGVB 1A8JH 2XA8H 1S5IL 4O5LH 4HXAL 2JCCE 3ARBC 2X4OA 1T21B 3WXWH 1E6OL 1ONQB 3GSRA 5DD0H 1YECH 3RWCB 1F6LL 2Y9RT 5J3HC 3JUYA 3OKOA 1C5CH 5INCB 1GAFH 2VLJA 5FO8B 3IDUA 3K4ZA 4UNTA 1J9CT 5SWQA 1ZLSL 5CEZH 1L7IL 4N8CH 3QFJD 1LP9B 1PAMA 4NZUH 3RWHB 2DQIH 5DQJB 3MRQB 3H3PL 2YRPA 2Z93A 1ZT1A 4HT1L 4KI5E 4WUUE 4PG2A 2Q76B 3KPPB 4JCMA 5F1OB 5C0CD 2Y5EA 3S37H 5KS9B 3Q5YA 4X9HA 4UZGA 3KYOA 3MRNA 2DQUH 1PVHA 2DQGL 1OSZB 3UX9B 5TE6H 3OZ9H 4QWWD 2WAHA 3LN5A 3ABZA 3UXFA 4UQ3A 1IM9A 3D3VD 4QHUB 2ZCHL 3SDCB 2OJZH 5GHWH 4WWKC 5DLML 3FB8A 4QOKA 3F58L 4N9OB 3CU7A 3SDAC 1YNTA 4HV8A 1T2JA 1MAJA 5HHNB 1A7PL 3L3DA 1AGDA 5IBLC 3JTSA 2MWCA 2FIRT 1Q9OB 3QISA 4KAQH 4OV5A 1I9EA 5T1KA 2D2OA 4GKSA 4E41A 4HH9A 2BVEA 1R5VB 1HQRB 1EXUA 2BNQA 1NCWH 4Q2ZA 5F9OL 3D9AH 3PL6C 2AKRB 2NCMA 4ZFGL 3TP4A 5L8LB 4JQVA 5D9SA 4QHMA 4DZBA 3MV8B 4HW6A 4PJFB 3W81A 4KZDL 2ADIA 1ZVSA 4GXUN 3MROB 3RKDD 3U4EA 4OKDA 5E5UB 3KPLB 1I1AC 3BPNB 2P7TA 3Q1SL 2D03L 3NA9H 1V3MA 1GGCH 4I0PA 3OJVC 4NNPL 1U92B 4UQ2A 3VXQA 5JHLL 4K8RH 4GAGL 4Y2OA 3PE9A 4PJ7E 3H42L 5FUZH 3LAFA 3LQMA 5GS0H 2WP3T 3OKDB 5GIRA 3V0VA 4QTHB 4PLOB 4R97B 1TZIB 4KKAD 4U6XA 4RGMB 3ALPA 3KR3H 3MJ9A 4Y4KC 4PY7A 2DQFB 4IIQA 1U41A 2W9LA 4YXHH 2IANE 4O2EA 3VXRD 3DVFA 1KJ3H 4XAWL 5I75B 1R3HB 1F11A 4M8QA 2GCYB 4FQXA 5GSRA 5DD5L 3CSPA 5J13B 2H6PB 2HAZA 3BGFB 3P4LA 1YYMH 3DBXA 5B39G 2YD7A 2X42A 4OFDA 2OTWB 3PWNB 4EEEA 4X6CB 3C09C 4H5SB 1MCEA 1HOCB 3O3EB 4Z7QE 3EUUA 4KVCH 4PJIB 4KTEL 1IFHH 1CGWA 2F74A 4HWZA 4MCZA 1MREH 1A9BB 4ODXA 3HMWH 4NUJB 1XCQA 4K3EL 1SBBA 3OX8A 1PEZA 3WUWG 2GTWA 5I9QC 3FO9A 2EH7H 3FO2A 2D7QA 5EU4A 1H3VA 3HPJA 5BJTA 3DUUA 1H3TA 2J5LB 1FPTH 4Y19A 4OF7A 2QEJA 3OKEA 1GC1C 4RIRA 5C0AA 4XMPH 1IEBB 5JR1H 1FZJA 1S9YA 4LVEA 4ETQA 1I1YA 4G8IA 1X5KA 3SE4C 4GG8B 4TULH 4M1CD 4P46C 1BEYL 1U3JA 2Z92A 1CXIA 1F90L 1AQDA 4XB8A 1LNUA 5TF1L 1IGFL 4F7MB 1T7YA 2VQUA 4PJ8D 1N6VA 1JGDA 1J88A 3QXUA 4JZNB 4NQCB 2XG4A 4ZUUA 5ITFA 4LCCA 3NFSL 3PWJB 5DUBB 5EC2B 5FEBA 3SJVB 4N0UE 2YPLB 2R2BB 4QRSB 1A7OH 4Q9QH 4EI5C 3RPKA 1FV1A 5JW3H 3BPLC 4UT7H 1FSKC 5DS8B 2R9HC 3T2NL 2QLVB 1S7WB 3F12B 3BDXA 3S36X 2IPTL 2M8XA 5IVXA 3KWWA 2NW3B 1KCVL 35C8H 4CU8A 4LVOC 4FZEL 4P4RB 3I6LD 2ZCKL 3H9HB 2C7UB 1NCDH 4LPWA 2X4QB 2AV1B 3GMMA 2BDNL 3AXLB 5IFAL 4LF3A 3NGBC 4L9DA 5DGQA 4YFEA 4Z76B 4LCYB 4EDWL 4BQ6A 3EOYG 4KHTH 3GSOA 4NPYB 5GS1B 4XNQA 2R29H 1FL3A 4XC3H 3RJDA 3IU3A 4I2XE 2VITB 3A6BH 2YHGA 4ZFZA 4JANB 3TT3L 2Y6SD 1U93A 2LE9A 1T0PB 3I3EA 4ZS6D 5EH1A 1N0XH 4KRNA 5IQ7H 5C92A 1P4LB 5DJXA 3LEVL 5FYKH 5ECJE 1OP5H 5F1NA 1T2QH 1HH9A 5TGBA 4GUPA 4MCYA 2IALB 4JPKL 4XCCH 4KPHH 4AIZB 3ARUA 3MBEC 3BX7C 4ZXBA 4D8PA 2VDPH 4PJ9D 3QRFM 2FYYB 3U2SA 4X4YA 4XGZA 4LGSB 5F7WC 5ERWB 2X4NB 1ZTXH 2BC4A 3EDJA 1F58H 3DNKA 2Y7QA 5HY9B 3BO8A 5ICXA 5BMFH 2VLRA 3D3VB 2AK4A 5CCKL 1KLGB 4OUUA 4ZOEA 1TZHA 3ZKMD 3FQNA 4LOUC 3UMTA 1JUFA 2BSRA 3UBXA 4JFEE 3K7UA 4OCNC 2X4RB 1L7TH 1NBYA 3MFGB 4IRJA 1UG9A 4X80H 1BOGA 3WYRA 5LXGH 2LVEA 3M8OH 3TBYA 5CZXC 2BNRB 3G6JE 4D3CH 3R1GL 3FZUD 1T1ZA 1I1FB 3CUPB 2XACC 4PPTA 4BUGA 4WHCA 4YHLL 5GXBB 2LU4A 5JUEL 3GJFK 3K8KA 5EOTB 2HG5B 2ITDB 5IMMA 4LKXB 4RAUB 4JO3L 1AJ7H 4ODWB 4L8SC 2RGSA 3KYMA 5F7DB 2VAJA 4O00A 2Z31D 3IAQA 1RUAH 3V5HA 1SJXA 5KSUB 4GAJH 2UWEF 3QXDB 1DLFL 4UUJA 3P9LB 2IAMD 4KJQD 4MNHA 4P2YA 5DMIL 1J8KA 1UKQA 2JK5A 1OW0A 4K7FB 4TVPH 4AEIL 4X99A 5E24E 2XKSA 3ZKXC 1F13A 2HFEA 5HYIA 2NY7L 1EAJA 2FZ3A 5C08E 5EZIH 3VGAC 1H8SA 1QQDA 4XC1L 2VSCA 2R4RL 1KJVB 3G5YA 2P4AB 4NFCA 4OLZL 3UTQA 1TFHA 4MHHG 4G7YL 4P2RA 5BS0E 1UC6A 3H8NA 4O02H 4R0LC 1N5YH 1YUHB 4GLRH 3WD5L 1U0QA 4N9GB 3T0EA 1G7JB 1P7QB 5KW9L 1I8IA 4QEGA 2EYTA 4K3JH 1EEYA 3VD4A 1B6DA 2RBLA 5HJ3A 1DANT 5D7KD 1KB9J 3IFLL 1T66C 1TJHL 4J6RH 2W91A 4NNYA 5IP4A 2UZXB 2A73A 1FFOB 2XN9B 4OCSL 4XCEB 5I17B 4EIZC 3KXFD 4XP6H 1NEZA 4XNMB 5DDHA 4GRLA 2DQCH 4Y4HC 1IGCL 4RFNC 2CUIA 3TM6A 4O2FA 1A1OA 3DMMC 3K80A 5EG6C 2VDQL 2NY5C 1FFNA 4XAKD 3SBWC 2A6IA 4XMKH 5DFVC 1XGUB 2VL5B 4LSVH 1ZHNB 4OZ4B 5B3JF 5D7KE 2WMPA 3NPSB 3O45A 4F7EA 4PJCA 1RUPH 4QNPE 1G9ML 4N0UA 4HK3N 5GGSA 4HC1A 5DHXB 5MEOA 4HIEA 4U6YA 1P7KA 4LSRL 4TTDD 3ECBA 1Z9SA 5KAQG 4B50A 3HS0A 4QLRA 3K2UH 3QPQD 2JJTA 1ZT7B 4WO4C 1A7RH 5FKPB 4EN3A 3AY4C 5CMAA 3GBMH 2ZCLL 4KROC 1RURH 3BKJH 4LHUB 3U0PB 2VLKE 4L4VD 2DQDH 1I9RH 2Z9TA 4NO5B 3QWQB 1S9VA 5EC1B 4K2UL 1QFWM 4WFHE 4EJ1C 1S7VA 1C5DA 4RWHA 3LZFH 2NY4C 1D5BB 3B6SA 1V7MH 1S7SB 3KYKH 4NBYB 5SV4A 1N8ZB 3PQYD 1LK3L 3H2WA 3PHOA 1AC6A 1G0YR 4I2XA 5D1ZC 3STLB 1M7IA 3QRGH 4JKKA 5D71H 3VXTA 1MCSA 3LN4A 4ISVB 2J1KA 4U1IA 2CRYA 4OIIH 1HK6A 5L7XL 2W38A 4Y1AE 1TZGL 3KG5A 3EHBC 4BH7B 1QFPA 2ZKHH 3ARVA 4DZ8A 4M7ZB 1H0DB 2X89D 2PO6D 1I3UA 3JV4B 3U48A 1MJ7L 5GSVB 4NSKB 2HJFB 4OZIB 1MH5A 3O8XA 1KJ2A 3PQYE 3T4AB 1QSFD 3HTLX 6FABH 4BSJA 2NXYC 5I1AA 1CFNB 4Z7WF 1YPZA 4UNUA 2YZ8A 4PJ9B 3IFOB 1NBZB 2MPAH 3BH8A 2XZZA 1UQSA 3JWNC 3DXAB 5E9DA 5FF6B 4XPFL 3DIFB 1UEMA 5DRZB 5C9JB 1D7FA 3KNBB 4IJ3C 4Y8AA 3O4LD 3TPKA 1U8LB 3EYFB 1J5OL 3MTRA 4AIOA 2Y5TA 3MRBA 2FR4B 3BDBA 5J06A 2D4FA 3TYGL 5I73C 2OL3L 1D9KC 1RULH 1DVFA 1KCRL 4HEPG 3NFNB 1UCBH 3MUY1 4LU5H 4S1DC 2MSPA 3MLRL 1J1XL 4MSWB 2P5WE 2EE3A 3UDWA 4XP4H 2J6EH 4DN3L 1MWAL 1MF2L 1J87A 3ALWA 4ODSL 3RUGA 3UBXI 3V5KA 1O7SA 4JDTH 3VA6A 4A6YL 3OGCA 5IHZB 2NYYC 3MLUL 5DEGA 1TTUA 2PYFB 3QIWA 1U8IB 2FSEA 5AZEH 5B38B 3B9KD 4GBXD 5CIPB 4BSVB 5CBAA 2GI7A 1MEXH 1B4JL 5MEPA 3N85L 1E4KC 3NCBB 1ND0A 4WNQB 3SCMC 1ORQA 4LLQB 2CXKA 2X1WL 5HI3D 4L1HA 3RDTD 3UTSE 2PYEA 3SO5A 5DD6A 1BQSA 2DTMH 3O41A 3X12A 1AD9B 2IG2H 4U0RB 3D5OF 1N2RA 5GGQH 5DJCB 2Q20A 5BS0A 1BFTA 1F8TH 1GRWA 3LEYL 1CFSB 1NGWA 5D1XA 3EJYC 1BBDL 3MV9B 3LEXB 2NPLX 4JVWA 3TA3D 2WIMA 5DK2B 1Y18B 1ES0B 1ZANL 3U30B 3IDGA 4NOBA 3MODL 1JHLL 5IVZB 1CICD 4NHCL 3VRIB 1MAMH 1HDMB 1IC5L 4ELKA 4PTTB 1XR9B 3IJSB 3BT2L 5C7XH 3UTZA 3SGKA 3WS3A 5D2LB 1PQZB 4Y5YB 3GJFB 3HR5A 1LWRA 1HI6B 3ZTNH 3ZDXE 1FNSH 2KL6A 1BM3H 4YXKL 4NT6A 3L5XL 1S7RB 4FQHA 4OB5H 4UU9A 2F54A 4N1CA 5EU5A 5KVDH 3ARDD 2G60H 4IM8A 1HQ4A 1A0QH 2FX7L 1MCOH 4J8RB 3N1MC 1MIML 2D0GA 1JWMB 3BKYH 3L7FB 1YMHA 3JBG7 4ZAKC 4E42B 4ERSH 5ALCH 2XY2A 1M71B 1AO7E 1Q9WA 4PJGE 1X4XA 5TDNA 3HI6H 3MJ6A 4IRZL 5IHUL 3HE7C 4N90D 1H15B 4NC0B 1G7PA 1KJMB 4Y5VB 3ZO0A 1DEDA 1HHHA 1WWWX 4YJZL 3PWLA 3D0VB 4QRPB 4R2GD 4ZODA 1JPGA 3X13A 4M5ZH 5EIIA 3NZ8A 2VLKA 1S9KC 2YC1B 5A43C 2Q1EA 1X6NA 3MXVL 4H8WL 5I1KH 2J8UB 2ESVB 4XWGL 1KELL 4L4VB 3BP7B 4Q9BA 1NSNL 1W72A 4NBXB 4GMSH 4XBPA 5C0IA 5FO7A 3EGSA 5EO1A 2HJKA 4MAYC 2NXZD 4D9RD 1MCDA 2AK1L 1UACL 2HLAB 4JFFB 3U9UA 1KCSL 3PHQA 4P4KD 4BFIA 3BP5B 1BREA 4HK3J 4QRQB 3STZB 4OV6F 1W0WB 2XNAA 4NN6C 3BIKA 4X5WA 5GRUL 2ITCB 4YQXL 4Y1AA 1RZGB 4LGRB 2MCPH 2V5MA 5E6IC 2F53E 1CFQB 1B88A 3FB7A 4Z0XB 3MACL 4JRXE 2NY2C 3S5LB 1X5YA 3GIZL 5IIEB 1JRHL 1ACZA 2HMID 1KG0B 2QHRL 4XCFL 3DRQB 4G43B 2NY1C 3IF1A 5SV3A 2I60L 5F1IB 2YSSB 1RZ8B 3TBVA 4DTGL 3WKNA 4OF8A 4MJ6B 1T1WA 5DO2D 1QSFB 3AMKA 4X6EA 2VE6A 3QQ4B 1OSPL 4XP9H 1ZT4B 4V1DE 4V2CB 2ZUQB 5I19H 5GJSH 4UDUB 1X7QA 4B5EA 4LDLB 1B2WL 4X7SL 3HC4H 4O58H 2VMFA 1HSAA 3NH7L 4DAGH 3GJEA 3PWUB 3WHE1 1ZGLB 1AH1A 4XZUB 1FYTB 3BP4A 3O4LB 1UVQB 3T1WA 1CG9A 2K9UA 3S3SA 4UMGA 5D2NB 1MJJA 4Z7VB 1CXEA 3P0YH 2W9DL 5C0BA 2W65B 1YNKL 4POUB 3KLAA 3MC0A 5CS7A 4EQ3A 1MLBA 2NY3C 5GZNC 4S1QH 4HCRL 3IAGC 4XPAH 3RFZC