5JIHA

Crystal structure of her2 binding igg1-fc (fcab stab19)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
212
structure length
212
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEYLSDSVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVPRHSETMRRWAHGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fcab-HER2 Interaction: a Menage a Trois. Lessons from X-Ray and Solution Studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 37
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jihA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jihA01
5IG7B 1KPUA 1KIRA 2IPTL 5F7NC 3TT3H 2B0SH 1JNHA 3QBTB 4JN2B 1N0LA 4LLVB 4Z7WA 5EU4B 4PB9L 1NDGB 2J8UB 4NRZB 4PJXA 3FAWA 1A7PH 3S96B 4P46D 5EC2A 3DOSA 3QXWA 4OLYH 1HXYA 4BH7B 5DEGA 1EX0A 4Z0XA 5IHUL 3OJDA 5F96L 2DQEH 5HHMD 5CP7B 4P23C 5BXFB 4ZFGL 3QO1A 1AE6L 5JOPD 4PTTA 3GK8L 4PP2A 4PJ5E 3NIDE 2EZ0D 1CYGA 2FDBP 4KRMB 4MVBC 1R3HA 4EEEA 4KHTL 5IR1B 1LVEA 4Y4HD 1NDMB 3UYRL 1WWWX 4HUVB 4AYFA 3LQZB 2NY3C 1RK0A 4Z8FL 1E6OH 1IEHA 2W0PA 4HFWB 2VLJB 4NKOB 5MI0C 2KQNA 3QZWG 3MRLB 1EAJA 2GYSA 5AUMA 4MJIE 1SY6A 4AMKL 4E5XB 1MJ7H 4ELMF 4X80L 1RUMH 1WITA 3E2HC 2H26B 2GJZB 5JIPA 4XC3L 1IGCH 2P45B 2AEWA 2A73B 3TPKA 3MLVL 3NPZB 1C7SA 2NTFA 4LRIC 3QIBC 4KXZI 4MDIA 2QQQA 5HDQH 4BSVB 1FCGA 2XN9B 2PNDA 1BF2A 4OCSL 4DZ8A 2C3GA 1JRHH 4JEGB 1LO0H 1JL8A 4OZHF 5ALBH 3WFBH 1G9NH 1MFCL 4I3RH 4X5LA 2QADB 3GBLA 1YDPA 1JP5A 4YBLB 3ULUL 1UADC 4PJ7F 3QIBA 3MLZL 4HWEL 2XFXB 1NC4D 2WBJD 3H9HB 2AV1B 4RQQB 4HH8A 4QOKE 4P5TC 3E3QE 3KPOA 3MYJB 3TT1L 5FDWA 5CCKH 1FZOB 4WVRA 3MUZ1 1NBZA 1XF3B 1MF2H 2EDFA 3NA4A 1A6UL 2UZXB 5E2UL 2YUWA 1JNLH 2EDRA 5GS1C 2NXYC 3AB0C 4HGWA 2UWEE 5EFIA 3GSRB 4NQEB 4KH2A 2AJ3B 5JR1L 2WWMD 3HI6L 5LXGL 3CU1A 4Z95H 1VFUA 1V5JA 4QT5B 1I9IL 5L2KB 1NGQH 1PZ5B 5E5UB 1U92A 3REWA 2W60B 1NFDA 3DUSB 3UAJD 3TNMB 4LGPB 2JB6A 3RGVC 5KSBA 3PNWB 2WQRA 3U83A 2VZ1A 3SGJC 5IQ9B 4OF7A 2DL2A 3MRPA 4NZUH 4H0GA 4TUOA 3SKMA 2ZCLL 4OZGE 1XR9A 4DW2L 1ZOXA 4ISVB 5TE7L 3VFGH 4QRRB 1DBMH 3SDXB 5GSRB 3VWJA 3LZFL 4I9WE 2P7TA 2A38A 3T4YA 1J5OL 3IDGB 2FO4A 3SN6N 3L5IA 3V6FB 3MCG1 2UZYB 1I8LC 2AI0L 5IM7B 4KKLD 4F7MA 1NFKA 3U9PH 1OW0A 2W0FB 3RVXC 3ARUA 3X11A 3O2VL 4HH9A 4PUBH 3F5WB 1U8MB 1YQVH 4LK4A 4NCDA 1NLDH 5EA0L 1LEGA 1F4HA 3HI1A 5EZIH 1KLFA 4NJAL 3V0AC 1S78C 3HFMH 4LVHB 3ZTJH 1LP9E 3K4DA 3GI8L 4HK0A 2YD3A 1KEML 2FR4B 2A6IA 3RQ3A 1G9NL 1MFCH 2HLAB 3G6JE 2VUOA 1G6RH 1HOCA 4PJ5D 1DLFL 3IGAB 2A9NL 4F15B 5FO8A 5JW5B 1DQDL 4JQIH 1FVEA 1OPGL 4L1DA 1MCKA 5E2VL 4OCYH 3KPSD 2NZ9C 4LRIA 2R0WH 4CDHA 2YZ8A 3MLVH 3T3MF 3NA9H 4ZPVA 4Q9QL 3QUZD 2YC1A 4WWKC 2PYEE 3FQWB 2DIAA 1T03H 4YHYB 3GIZH 2HKFL 2UVFA 4JO3L 3UTTB 2HLFC 1DBKH 2YMXL 4H0HB 2IPKB 3BGAA 4RFEA 1JPSH 1F58L 1ZT4A 2QHRL 3FO0H 4WI3A 4HKZB 5BVJA 1FVEB 5JW5A 4MA8L 1YY9D 1P53A 5DQ9B 3WL9A 1KV3A 5HGGS 1IKNC 3SDDC 1IGYA 4P4KA 4BQCA 4Z6AT 3LIZH 3VFVA 5T3ZD 1R3JA 3ARBB 5C08D 1BWMA 1R3KB 3JV6A 3PWVA 5T1KB 3N85L 4UU9B 2R2EB 4XCEA 4ZUSB 1FL6A 3WLWC 4WU5B 4JFOA 3TGXA 1RZIA 1CIDA 2LVCA 4KVNL 4O5LH 5I19H 3WDHA 3VD4A 2R4RL 3HCVB 5C0RH 3EOBB 5F96H 5DRXB 3TO4B 1I3GL 4YHOH 4JFZH 3NGBC 4LVOB 4AIOA 1KB5L 3F7VB 5JA9A 3MBXL 5CSBA 4F57L 2B0SL 3BD5A 1I7ZA 4XZUA 3W39A 1D5ZB 3P9MA 2D7TL 5I1CH 1KCRL 1RUQH 3G6DH 3HNVL 3T4YB 1NJ9B 2DQUL 4I0PB 4J3SA 5J9PB 4D9QE 1LP9B 4QRRA 5E4EB 4M5YH 4MA1C 2H1PL 3G5YA 3MRRB 4GMSH 5HGHB 1CLYH 4WHYG 1TJIL 1XR9B 3BWAA 5FKAA 4YX2H 2OZ4H 1PKQB 2BVQA 1JF5A 5F9JA 3MODL 5H2BA 2H6PB 4CBPA 2D4FA 2DJ4A 1AH1A 3PP3K 4DTGL 2VDPL 5IFAL 2W0LA 4JY5L 2Q8BH 4CVZA 4QT5A 4G8EA 1ZSDB 4JM2D 1BEYH 4YDJB 1R6VA 5D2LA 1RK1B 3RWIB 2R8SL 2VIRA 3PV6A 4AEIL 3GSRA 3ILPA 2ZOKB 3K4AA 5DJCB 5H35B 15C8H 4YHOL 3DETC 2CKBH 4U2ZA 4ZO8A 4CMHB 3VD7A 1UWEL 4OCMC 4YQXL 3FQUA 3O9WD 4KZEL 3BP4B 1QFUH 4Z76B 5ICZB 4UTBL 4I5BB 4PJDB 1G7IA 4AT6A 1M6OA 3OTTA 5D7IA 1AXTL 1PG7H 3FMGH 5DF0A 3ARGC 1QQDB 2BOBA 1CF8H 5MEQB 5EO9A 3BH8A 3MLUL 5C6WH 4U1MB 1PKQE 3ZKND 1QPXA 4FXKB 2G75B 4DUWA 2I9LB 2UZIL 2H8PB 4H1LA 4FQ1L 3EO0A 3IDXH 5GRJL 3O4OB 1MUJA 1LE9A 2R15A 3K8LA 4KQ4H 1RZKH 2BNRB 1JPSL 4DN4H 1FV1B 4XMPL 4LLAA 4PYGA 4MD4A 2H2PD 1U2HA 3JUZA 1C7TA 4RMQA 5C0CA 2N4IA 2VN4A 3GIZL 1WEJH 1MI5E 3LCYA 3SBWA 4TQEH 1TVBB 3CH1B 3O6KL 4KC3B 2VDLH 2WBJB 2F19L 2YHGA 3QJHA 4Q2ZA 3T08A 3DVNB 4HGKC 4L4VD 2OSLA 3TO4D 4YK4B 5BJTA 1ZHKA 1TJGH 3SKUD 5I1IH 1YYMH 3MRLA 3PXJA 3K81A 4EUPB 3CX2A 4QXWA 5A3IC 2MFNA 1JZ2A 1OSPH 3D9AH 2AK1L 4PR5B 4PJXF 4PB0L 4P3WA 1WISA 4N0RA 1S5IH 4XNZC 3IVKB 1I7RA 4JDTH 4M7ZB 5GGSA 1KOAA 1OCWH 2XG4A 2JCCF 5IR1A 1H5BB 1U8LB 3WJJC 4EI5C 2VDOL 2NPLX 3KJ6H 1GPOH 4DKFL 4NJAH 3FQXA 1JPFA 1JUFB 1FYTA 3KXFE 3S37X 2A6KA 3SQOL 1YQVL 2AP2A 2EIDA 1S9WA 3GKWH 2VSCA 3VI3E 3SCMB 4PJCB 4ODHH 3VFNB 2CR3A 2GTZA 5EO0B 5IGXH 1Z9OA 4CGTA 4ODVL 1P4BH 3L5XL 3UEZA 3EO1B 1KPUB 4I77H 4IJ3C 2O5XH 2XKNA 4HKXA 2QR0A 3VFRA 4HG4K 3B2UC 3DXAA 2F5AL 5FA4A 5D9SA 3UBXI 1YPZF 3WXVL 4NOFA 2HFEB 1RULL 4YHZL 2GTWA 2VLLA 1Z9SA 4GBXD 1FH5H 4L8DB 4RCAA 5KVMC 5GRXG 1LO3L 5KN5B 4G42B 1ODAA 1HKFA 4GG6E 4O2FB 2B1AH 1A4JB 4JGUA 1GHFL 2AVGA 4HPOL 4LKXA 3MCLH 3QQ9D 4QTIL 4EQ3A 4PRPE 3MRKB 1X4ZA 5EOQL 4XTRD 5EDXA 4H20H 1RJCA 2VR5A 3D69B 1DANT 1VERA 1B0GB 1KC5L 3OQ3B 4P9MH 1KIUA 2OQJB 3UXFA 4F7TB 4I2XE 4U1KA 1LO2L 3LV3A 3X3GH 1EPFA 4JN1H 1RHFA 5F3HB 3RUGA 2Z35B 1CD8A 1KT2A 32C2B 3BMVA 3I9GH 4ZPTA 1YJDC 1BQSA 1JGDB 2HJLB 1YECL 1HXMA 2CQVA 4JRXD 2HWZL 4O9HH 3SGDH 4MYWB 2CUMA 1CLOL 1R5IB 1P1ZB 1NPUA 1SJEB 4LP5A 4L4TA 3C60B 5D1ZB 4EN3D 1XGTB 1CE1H 1PQZB 4ERSL 4LLQA 2B39A 3GFUA 4KMLB 2DWDB 4RGOL 5FCSH 4NCC1 5T1MA 3QI9B 1IGTB 4K8RD 1KYOJ 1WT5A 2ENYA 3OKMB 3RDTD 5IJKC 5HDQL 5IK3B 4XAWL 1QHPA 5DQDH 3P77B 4F7PB 4WFFE 5FHAH 3QG6B 4G9FE 1TCRA 1OAZL 4L29A 2JIXB 4QGTA 3O6FD 3BDYL 5CSZA 4U1HB 2VH5L 4NFBA 4ZS6C 1AQDB 1Q0XH 1ITCA 2Q6WB 5ITFA 4M6AA 3STZB 3N0PB 4XC1L 5L8KB 3AREC 5DD1H 4KK6C 4LLMA 4G9FD 2X1XR 5DA4A 1JYWA 3RWCB 2ERJC 3IT8D 1L7IL 2F53E 1ZHLB 5F7HA 3HA0A 4JPIA 1UXSB 2CSPA 1GGCL 3O2DA 1SVCP 4YHLL 5C86A 4ZFOA 3LAFA 2P49B 1RIUL 4F8QA 1AY1H 1MOEA 2FJGB 1OTSD 3A6BH 4PLOB 2QBWA 5T33H 4HZLB 3DGCR 4QOKD 1OOAA 4PP1C 4OZIF 4OLYL 2J88H 5E9DA 1SBBA 2RHEA 1BECA 2C7UA 4XHJC 3SQBA 1J10A 5BV7H 3MXWH 4C56A 4ONFH 1ZVSA 1B0RA 4HW6A 1IQDA 3BZ4B 5IF0B 3HZYA 5E08L 1IT9L 1J8HB 2FBJH 5EU6E 4F33B 3ULSB 2BRQA 4ZD3H 3D5OF 3FT2B 4RFOH 2VLRE 3IF1A 3RWDB 1WV7T 2ESVB 3LPFA 5F6HJ 4C4KT 3U0WH 4OCRH 4RDQF 3RU8L 5I75C 5DRZB 3MLXH 1CG9A 3VA2C 3ARVA 1J18A 5C0JA 2XN9E 3UC0L 1BD2A 1U8KA 4WU7A 5GQBA 1LK2B 4Y16D 3T0EC 3PHOA 2IAMB 5MERA 2XOTA 1TETL 3SY0A 1QTYT 4JB9L 3HLAA 1BAFH 1XR8A 2ZSVB 3QAZB 1AXIB 4NWTH 1Q72L 4WW1B 3U4BL 3LSOA 2F58H 1HHHB 3TCLA 3UZVB 3B43A 5EN2A 3MNWB 5D8JH 4U0RC 3FZUC 4M4RA 3EUUA 2NW3A 4Z7WF 3EHBD 5BOZG 3LN4A 2VE6A 4X7SH 4K7FB 4GG6F 5ICYB 4Y5XC 4G8GA 5BZWA 5IGXL 2CK2A 1AC6A 2XZZA 3MV11 4ESKA 2UYLA 4OFYA 1IAMA 35C8H 4ODHL 4X6EA 3MZTA 5BS0A 1I8KA 5I1LA 3MRBB 5D93B 4UINL 3G08A 2H9GB 4OM0L 4U0QB 5E8DL 2AS5M 1FG9C 2BSRB 3D25B 4JY6B 1LNUA 5L7XH 3QULB 5F89A 1A1MB 1UWXK 4EBQH 1JNNL 1JI2A 4WO4D 4URTB 3NFPB 5DUPL 4RGND 3UYPA 3MUGB 4M93C 4CADA 3MGAA 5IHLB 1U42A 1FE8H 4N0YH 1YEKL 4ONFL 3C6SA 4KRNA 43CAA 5I1IL 5MEPA 2HT2C 1T89C 3T2OA 3TO4C 3VRIB 3MR9B 1AD0A 4U7KA 3V4VL 1T5XA 2R0KL 4PJCE 4OZHB 1VHPA 4CVXB 1RZ8B 1YEKH 2NY7L 4AENA 2Q76B 3IS1X 4M7LH 3C5SA 3DTXB 2I07B 3DUUA 5EBLA 1INDH 1JZ7A 5J6HA 4MDJB 3T8XB 1A21A 4PRNB 1QRNB 4M93B 1RZKL 1F11A 3DMMB 3QHFL 2EC9T 4E42B 4Z7UA 1HHKA 5C3LD 1XF2A 4OB5H 4PRIB 2YZ1A 5AZEH 1A9EA 5ADOH 1FNLA 3WNKA 4ZSOB 4RRPG 4AIZB 2HFGH 2XTLA 4UIKL 3UTPE 1MFAL 1MRFH 4PJAA 3S88L 2H2SC 1VEOA 3RIAF 3WN5B 3O2DH 2VL5A 3CVIH 3HZKB 1CGWA 4BUGA 3VXRB 35C8L 3HRPA 5IB5B 1W8OA 4I0PD 2NY4B 1XCTB 3NACL 4P2OC 4ZXBA 2FECL 1NFIA 2WIMA 3RWJB 3IFPB 1FAIL 4POZD 1U3HD 1W0WB 5FHAL 4I0CC 3FJTA 4M8QA 1TZGH 4O58L 1A7QH 3BRDA 4J2XA 2DYPD 4PJHB 3S9DB 2R1WA 2G60L 4MA3A 1BP3B 5C08B 1I8IB 4DVRH 4NKMB 4JZNA 4F9LA 2DM4A 4NO5A 3OGCA 4Y5VB 4ERSH 1D5MB 1FLRL 1WF5A 2HTLD 3D2UD 3ULVE 4FQJH 4I3SH 1TETH 2DLIA 4K94L 2BSTA 5IVXA 4P2OB 3FL7A 4O2EA 5D5MA 1S9XB 2Q8AH 3MODH 4PGEA 3O6LL 4PRDA 2I60H 3LKQB 5HYJB 3I3BA 3HC4H 1MPAL 1JWMB 5F93C 3DI3B 3SGKC 3MJ9H 1NSNL 4P48A 4WWKA 1F3RB 1K8DB 3QUXD 5JPMB 3BKJH 5I8OH 3VXOB 1QBML 3SKOB 1A3LH 3A67L 4K23L 3LEYH 5F6IB 3UTSD 4YAQA 1ZLSL 4PRHA 5HHXH 1KB5H 4JFEE 3SO5A 2AXGA 1OAKH 1YPZE 3CUPA 4HX1B 3F6IA 2D3VA 3ISWA 3WSQL 3P30H 3BZFB 2G60H 3QIWA 2EDJA 4ZOBA 1S9KC 1KTLB 3RWEA 5D7JA 5KSUA 3MCKA 4XPTH 3BT2H 3V4PH 4L3EA 1JJUA 5GGTA 3P4NB 1UH4A 2JCCB 1IMHC 2X9XA 3L5XH 1IL1A 4S1SL 3GO1L 1A02N 1FAIH 4QHMB 3LD8C 2CKNA 4G6MH 1G6RA 3EYFA 2D31B 1HYSC 5IB1B 5IMOA 5E2JA 1JGUH 1K8IB 1VFMA 4UAOB 1JGLH 3MGOA 2HA1A 3MBEC 4I18A 3FT3B 4HUXB 4I0PC 5E0QA 1TQCC 2YMXH 4YJZL 1PW3A 5B21A 3OSKA 3BPCB 5C70A 2XNAB 3PJSA 3ARDB 1MLCB 5E1AB 2X4OB 4KUZL 4HDIA 3VRJB 3BPCA 4FS0A 2VZ3A 3ECBB 4GRWB 4H88L 3C5JA 1S5IL 2EIBA 3MA9H 1BVKA 5E2VH 4MZ2A 5EUOB 4PJBA 4G43A 1OPGH 3O41A 3MGOB 2V9TA 4WUUE 4W81A 3RX5A 2A6DA 1KCSL 3IB4A 3QCUH 3PV7A 3OKLA 4XCFL 5DD5L 1YYML 4RWYH 4ZDHA 5IB1A 5KW9L 4NC0B 5HD8D 4LPCA 3EDKA 4FQ2H 1J1XH 2AJUL 3L3HA 4NO2A 1IL1B 2F54D 3GI8H 2JIXD 4HJ0C 5CUSH 3NCBB 4KAQL 5HI5D 1X7QA 3UTPD 4G7VL 1KJ3L 3RWEB 4YUEH 5A2LH 5IQ7H 5DUPH 3AAZA 4Y89A 4YC2B 1LO2H 2OJZH 5HGDB 3FFCE 1AP2B 3T0WA 1UM5H 4EUPG 1AGFA 1TNNA 4XNYH 1M7DB 1UZ6F 4HK3J 1KC5H 4OLZH 3MLPA 5SWQA 1N5AB 3OKDA 2A83A 5CWSB 4OIBA 3ARGB 5CINH 2NW2A 3GSQB 4YGVA 4UDUB 2D7MA 2XYCA 3GB7A 3MV9E 1BHGA 4UMGA 1ZE3C 2VXVH 3VXOA 3G5VB 4D9QD 1AIFA 4GW4A 1YEJL 5GS0L 4X6BB 1BF8A 2ZUTA 5D7LE 2AEPH 1FH5L 4KZEH 1IM3B 2LAGB 1VADB 2BOCA 1E28B 2C26A 1WZLA 2PR4L 4HUUB 1GXEA 2ZCHL 3IJSB 2R8SH 2EIZB 2NQCA 3CC5A 5I6XB 1QNZH 4YEFA 4ZFFB 2F58L 1BEYL 4N8CH 5I71C 2VRAA 1UZ6E 4YXHL 5C0BD 3DHMA 2X05A 4JB9H 3WYRA 2R2HB 4PV9A 4QXGL 1I8IA 1TZIA 1EXUA 1G1YA 2VXUL 1NUFA 2R1XB 1YEFL 3H9YA 3MJ9A 4B53A 4MAYA 3LMJH 4WEBL 1IKNA 1A6UH 4E0RA 4XX1E 3QQNA 3IFLL 1WZKA 4HHAB 3RY6C 3KPLB 4GW5A 3D0LB 2EDWA 4RBPH 5C7XL 2IAMD 3H7BB 4RFOL 3VXRA 1I3VA 1A6WL 4YXKH 2DQUH 4PJFF 2EEDA 2FBJL 1WGOA 2CRMA 4I3RL 5JOPE 1Q94B 3PP4L 1RIVL 4DGVL 5E8EA 4LVEA 5DJDB 4NQXA 5BV7L 3T2QA 2Q3ZA 5I73B 3GZKA 2DBLL 1F4AA 1P2CA 1T5WB 4JDZB 1X5FA 2RFXA 3NPSC 1HCFX 4MDJA 2R4RH 1NKOA 3QDGA 3O4LA 3PGDB 1AY1L 3DTXA 1HIML 1RZ8A 2C4FT 4OZHA 2BHYA 4CVXA 2DIJA 3V0WH 1CIUA 4C59B 4HFUL 5AWNL 1IM9B 5GS2H 4O51B 3IDXL 2VLRA 4QOKB 2C5DC 1DDHA 4JO4L 1FPTL 4IRJB 2EXYC 5CZXD 2PUQT 2GJJA 3FO0L 2QHRH 4GAFB 4KHXH 3VWJC 1P5UA 2C3VB 4CNIB 5IWLA 2VDNH 2P5ED 4DKAA 1LMKA 1CLCA 2IAMC 4G80A 1IEAB 1E4JA 3ET9F 4UTBH 3FOLB 3EOAA 4LSTH 2DQEL 4JJ5A 4Y19A 2IADB 1CI5A 4P46C 5TF0A 3MRNA 5IWLC 1NANH 3FCTA 1NAML 2YBRB 3RI5K 3MRBA 4KKNA 3UTOA 3C9NB 3VWKD 2QKIB 2ADGB 2F53A 4MHHG 4RAUB 3SKJL 4KK8C 2UYLB 1Y18B 5AAWA 1G9NC 1ZAGA 4LVHC 3CK0L 3WNMA 3UBXB 2VDPH 1H3PL 5IT2H 5L6YL 3W82A 1PSKL 2YD7A 2HWZH 4O9HL 4EZMA 4YDKH 2D9QB 4KROB 5D93C 3QPQC 5F9WC 2ZG2A 2ZNWA 3RJDA 4F7CB 5SWZB 4LIQH 4JFDD 5I2IA 1MCWW 3X3GL 3V5HB 1CS6A 4OCXL 2CXKA 2VLKD 5AAMA 3W9DB 4WW1A 3IYLW 1ZVYA 4XH2B 4EN3A 3HLAB 1JK8B 3BI9X 5K59E 1C08B 3B5TA 3IDUA 3PL6C 1YNLH 3QEQE 1EJOL 4NDMA 3AREB 4M1GH 3AS1A 3TNNB 2BCKB 4ELKA 1VGEH 3OJ2C 2HAZA 3DX8A 4WTWA 5E8PB 5GRUL 4BH8B 5LWYH 4U1IA 1GHFH 1NGYB 1T6WA 4L4TE 5FV1L 2ESVA 5CGTA 5DVLA 4RZCA 4Y5YA 4BZ1L 2CLRB 3IF1B 2P5EA 3CDFA 3FT2A 4R4FH 2P8MB 3CFEB 3DX6A 1S7WA 1N0XH 4UILL 5IF0A 2XQBL 4HUMB 3ARBC 2O5XL 4L3CB 1T0PB 1C5BL 4Z95L 2GK0A 4XNQB 3LIZL 4PJGA 4NQTA 5E9DB 3MRDB 2EDQA 4GAGL 4JKWA 4JVWA 3I85A 1T2XA 1F4XL 4GMTH 4PJ7E 4WV1C 5HYJD 5IW6B 3QDJA 2EDLA 1KB9K 1KENH 2LU4A 5GGUA 3VMOA 1ZS8B 1T22A 1RJLB 5E7FA 3O4LD 3VXNA 4LLUA 2FJGA 4NFDA 3N1PC 3GKWL 1IE5A 4Y1AB 5CBAB 1J05A 5D1XC 4YDIH 3DX9B 4GKNB 2ZJSL 5A43C 1QRNE 3N1GC 1MFEH 3ARFA 2R4SL 5C09B 4NM4H 5AZ2H 3ULUH 1QSZA 4LLMB 4FQIL 5J13B 1DQDH 4JQIL 4XMLL 5ALBL 1O0VA 2DDQH 3JTSA 1Z5LB 3DYOA 2VNCA 3MJ7B 1KPRA 2GSIA 4M5ZL 1G6RL 5CMAB 1S7SA 5SWZE 1ONQA 3DX7A 5CSZB 4P2YA 4CJ0A 2C4XA 3KNBB 3ZHKA 1OLZA 3S36X 3BKCL 4K9EL 1C12A 1WZ1L 1VEPA 3LRSB 2XKSA 5DT1H 1O7VA 1T1XB 4DK6A 3CDCA 1HE7A 1UM6H 2IANB 3DJ9A 3C8HA 5HY9B 5T1MB 4K07A 5C08E 3O8XC 2O93L 3QUMB 4PJEB 2XRAL 1XIWA 5JQ6L 4KQ4L 3AC0A 4R6UA 4LLQB 3TYFB 2AI0H 4U1SA 1VB9A 3KG5A 1MVUB 4H5SB 1E6OL 2HJKB 3H9SA 5A40E 4Y4FB 2IH3B 1GSMA 4Z0BL 2OLDA 5E5RB 5GGRA 3LZFH 4HIXL 3UYRH 3BYYA 2VITA 2Y25A 4TUJB 32C2A 4OFIA 1ORSA 2VISB 1U8QB 3LN5B 3GHEH 5FO7B 3HNTL 1KIPA 3ABZA 2CMRH 2D7OA 3BH9B 1N6QL 3QPQD 4JKPH 4QF1B 4PGBA 4P3DB 4PY7A 1K9TA 4BZ1H 1KJMA 3I75B 4JZOB 5JOFA 4MB5A 4NN7B 1B88A 3KNBA 1CBVL 1NC2B 5IJVA 4R7DB 3HR6A 5DVOA 1X5XA 3FRUA 3OX8A 1SEBA 2BXZA 4O2FA 1S7SB 4UDTA 1A0QL 1MAML 2FBOJ 4HUWB 2PTUA 2WANA 3ARZA 3MJ7A 1RSFA 3QXUA 4L8DA 2BVOB 2Q8BL 4J4PD 4R4BB 1QP1A 4JFQB 5JXED 3FB8B 4ZFZB 5FA4B 1S9YA 4OKVB 2IQ9H 3VU2A 4HIIA 5E2UH 3AXLA 4OCXH 5TDNB 3ARFB 3LEXB 4OTXH 4LIQL 4NUJA 3OAYK 1GL4B 1JHLL 5DD0H 4Q9RH 4AJ0A 2YR3A 4MNGB 1EHLL 1LE5A 5J6GB 4LLUB 1H9VA 4ODTH 1KTDA 3BKMH 1RJLA 1ZS8A 2DIBA 1HNGA 5D1XA 1EHXA 4OGAD 3VI3F 3WFBL 4WDIA 4LSQH 1OTTC 5D2LE 2OI9C 2CIKA 1U8HB 3FN3A 1CL7I 3GMQA 4X5WA 3EDJA 1MRDL 4JCMA 3RP1A 3W5MA 3PQYD 5F7YC 4JREC 5I66B 3LDBC 3CFEA 2HVJA 3DX6B 1KEGL 1IGCL 4A2LA 4M7KH 1I7RB 4BFGA 4O5LL 2JK5B 4TNWF 1IGFH 2CLRA 4HPYL 1U3JA 4U6HA 4OFKA 5LBSL 3O45B 5E00A 2YA2A 1L9NA 2NY1C 1ED3A 1A6ZA 5I17B 5IB4A 1I1RA 4U1IB 1NUGA 5CZVH 4QRRE 2NX5A 3O11A 3DX8B 5E8PA 3BUYA 1ZHKB 4Y4HC 1FFPB 1WTLA 1A6AB 2FGWL 5KANI 1RV6X 1T0MB 5ADPL 4LSVH 3PWPA 1D3CA 4U6TA 4Q2ZB 1C08A 3CFCL 3QIWD 2N7AA 3LS4H 3WNPA 5BMFH 4JREB 3IFNH 1F58H 5TQ2H 3VD3A 2ICES 1RHHB 4OBSA 5HHNB 3W9DA 5FGBC 1FV1A 1HIMH 3V5HA 3DYMA 2XG5A 3FONB 1LE9B 3GK8H 5C1MB 3EO0B 5CIPA 3VA6A 4R8WL 3F65A 4XP6L 1CT8B 2DQTL 1U41A 5IHUH 2PYFA 3VW3H 3TFKD 2FHBA 5E56A 2R0WL 4U1NA 3CXHJ 4FXKA 3MA7A 3SGKA 2HMID 5TGBB 1K5NA 2PCPA 3DIFB 5FEBA 1U91B 4I3GA 4MMXC 5DD3L 2WIIA 5D7IB 3PP4H 2VXTL 3C8KA 3B9AA 4Z78A 1I8MB 2FRGP 5HHPB 5I71B 4ETQA 1A6WH 1NL0L 5ICZA 4PGZA 4LHUD 1OGAB 1Z2KA 2OXHA 3B9KB 5HHOA 3EHBC 1RU9L 3MRMB 4Y19B 3HMWH 1FO0H 1Q9KA 3EOAB 4HBQA 5EZIL 2CLVA 3KYKL 3VMNA 1XCQB 1ZLUK 3PQYA 1BFOA 3P0YL 1VDGA 5HVFB 4IOIA 1JTPA 4LCWD 1NLBH 1T7WA 3CNKA 2HRPL 4HXAH 1ZSDA 5F7MC 2HG5A 1LDSA 1TPXC 4P4RA 3RFZC 3ES6B 3FAXA 4DAGH 4QY8B 5KS9B 3DGGB 1V3JA 1EZVY 3E2HB 3GSVA 3VXSB 4JZJB 1CQYA 5F9DC 2PXYA 25C8H 4IRJA 1DQQB 5EU5A 4RISL 4Y8DC 3SOBH 2MPAH 5H2BB 5F9JB 2DLHA 4LPUA 4M9PA 4ZXBD 1DN0B 5L88H 2EECA 4Y4KB 5C0GA 5I73C 3HE6B 3HMXA 1LP9A 1FZMB 3PGDA 3O4LB 1MCPL 5L2KE 3EIFA 5F72S 2X1PA 3GEWB 3RWHB 4APQA 3B6SA 1DCLA 5LKNA 5E6IA 3RL2A 4CUCA 1KBGH 5CEXA 2QADC 3L3IB 3UTSE 1NGQL 5MP6L 2A74A 5DHVB 3C60C 4NQXB 5E8EB 4OUUB 3WV0A 5LXGH 1MJUH 3MOAH 1A7NL 3RWFB 2Y7QB 4HJJL 1ZLWH 1BVLB 3JUYA 1MHEB 2CRZA 2B1HL 2OM5A 1CTNA 1A22B 2Z8WC 3HCVA 3QR2A 4IHOA 4IHOB 3WEXA 3TH3T 1QFWM 4KRPC 1LWRA 1RURH 5HI3D 2ADJA 2OJZL 3S4SB 5F1NA 3U7WL 3AB0B 4FQXA 4B7LA 4OUUA 3EYQD 4YUEL 5T3XH 2FWOA 2NXYD 3TT1H 3TBWA 3VFUB 4KAQH 5CUSL 3CMOL 3T0BA 3P73A 1BOYA 5FOBB 1MIEL 3LEVL 3ULUE 2YUVA 4YHNA 3RL2B 2R1XA 3BEWB 3F7YB 3MV01 4JRYA 3QPXL 1TZIB 3B6SB 2R2HA 1FNFA 3NOIA 1U8OA 2NY6C 5EB9A 4PJEE 1FZMA 1OGAE 3LH2H 1M4KA 2J6EL 3MLRH 4F37F 5IW3A 4L8BA 4H25A 2D03H 2NY1D 3U7YH 4JKLA 5I1EL 1J8HD 1S5HA 4I0KA 3QCVH 1NCCL 1BPVA 2E6QA 2EXYD 3CSYB 1IEBA 3DGGA 4PJDF 4PD4K 3WFZA 5HYIA 3MUHL 2NY0D 4F7EA 3BD3A 5E6ID 2OL3B 4BSWB 4X6BA 2IG2L 3KYOA 2VQ1A 1RZ7L 1XCQA 1FRGL 5CD5C 5J0BA 5DR5H 1ACZA 1Q9KB 3GI9H 4XBEL 3GSQA 2ZOLA 4ZUUB 3MRMA 5T3ZH 5HHOB 2WLZA 1BFTA 2ZSWA 3GSXB 5SWQB 3C6LB 3RZCC 4XP4L 1DVFB 4FNLH 3C8KB 2FB4H 2VLMD 5FGSA 3RVTC 4XBGB 5E2WH 3VFSB 2ARWA 1FGNH 1SM3H 4MJ6A 3FT4A 5B39G 1U91A 1G9MH 4ODSH 5TF1L 4HF5H 2LV4A 1K5NB 2PCPB 3DIFA 4HKJB 1YMHA 4C58B 1XF1A 2PYFB 1JF1A 2IBGA 4YHKH 3CXDL 2QSCL 1CT8A 2CR6A 3SDXA 1G6VK 4EI6A 1RUKL 1KACB 2E7BA 4ISVA 1B9ZA 1UWXH 3LEYL 1B2WH 4MNQB 4N9GA 1QBMH 1SYSA 8FABB 3Q5OA 4NJ9H 3KR3L 4JPKL 4KRPD 5IQ9A 1OAUL 4UNTA 3MJ9L 1E4KA 1MJ8L 4M3JA 2JB6B 4OD2B 4HDIB 3O3BB 2H3NA 43C9A 1U92B 2X4OA 2FATL 3M17A 2R9HD 5ID1A 3KPPB 1ED3B 4WGVB 4PJAF 2Q87A 4CU7A 3C87A 3O45A 3VGGA 1FC2D 5DC9B 1Z0MA 1BLNA 4XVSH 1T2QL 1K2DA 1MH5B 2BDNL 5EFIB 4X7TA 1UKQA 1S7XB 4A6YH 2HVJB 1PYWB 4Z7WE 4CDGC 3WBDA 4D9LH 5J12B 1UQSA 5E6IC 4QHMA 3IJHA 4PS4H 4JQVC 1FZOA 2I5YL 3OKYA 4ODXB 2CJUL 3EDFA 4X98A 5D7JB 3H9HA 2I26N 3IAPA 4LVNC 2Y72A 5B3JE 3QIBB 3QIWB 3BZFA 4GG8A 4NPYB 3QQ3A 4H0IA 1YDPB 4LCIH 5DJ6B 4HS8L 4PV8A 3TPUB 3MPCA 4PJEF 3O8XB 3TO2A 5CJOH 2HTKD 4OSUL 1UVQB 3V6OC 4XVJL 2GY7B 3MLWL 2CLZA 4NQDB 1G7JA 1I1FA 5HI5C 3VFTA 4OKVA 1Q8MA 2A73A 5AZEL 2MTPA 3J7HA 2OTUB 4E41E 1GGIH 2P8LA 4JG0H 5EBGA 5BMFL 1XMWA 3NTCH 4Y19D 1L6ZA 2DQCH 2H26A 4J6RL 5I1HL 1GGYA 1T89A 3JWOC 3B5HA 2BNRE 2AV7B 4U6VL 3TN0B 3IXTB 5FV2A 1C16A 1NC2A 3D6GA 1E4XL 4NKDA 1J8HE 4HFWA 4OQTA 4LDLB 2HMIC 4HWZB 4LQ1A 1KJMB 3I75A 5FM5M 4HPYH 1N7ML 2D9CA 4MJID 4LVOC 5GZND 5C9JB 4MJ5A 4MQXC 3HR5A 4KI1A 1KIPB 1YC7A 3DSNA 3D39A 3B9DA 4R90H 1E0OB 5C07D 5FUCC 5FM4A 1ORSB 2VISA 4PG2A 4PYHA 5K9KB 1QSFD 5K93A 1KCLA 5B3NA 1T4KA 3L3KA 1J1OH 3K2UH 4MSWB 2IH3A 5E4EC 1EERB 2EE6A 3TA3B 4RX4D 4ETYA 4AH2B 1A1OB 2Z31A 1ZKAA 1FNGA 3EJZC 4NYLB 5HVGB 4U3XA 1JWUA 4OCWL 1OGTB 3CPLB 4N9OB 3QISA 1RUAL 1CDJA 5IG7A 2DQJL 5DK2A 1BGXL 1U8PB 2VL5B 2IAND 5KVGH 4X9IA 1X6LA 4GT7A 1KGCD 4OF0A 4OTXL 1PGRB 3G9VA 3BO8A 2ITDB 3F58L 3WKNA 3LRSA 4XNUH 2B5IB 4NNPL 4AIZA 3GJEB 1D9KC 1A9EB 3B9VA 4WW2B 1H3WM 1OD9A 3BE1L 3EAKA 1XF2B 4WFGD 5IMKA 3MNVB 1ONQB 2VLKE 4YHMH 3T8XA 5CMAA 5ESQB 5J6HB 2IANE 4IDJL 3QDMA 5LAXB 1UM4L 2JLLA 4DQOH 1EO7A 1Z5LA 3V5DB 1NMBL 4MZ3A 4JQXA 4G6AD 4KTDH 5DMIL 3AS0A 2J12B 4OZIB 3MREB 1N59B 3OWEA 3PABB 2DMKA 3MR9A 3N1QC 4W4NA 1YY8A 2RAMA 3IU4H 5GGQH 1CFBA 1TENA 4PP1D 4JKPL 5MEPB 1OQXA 4LSSH 3H3PL 1A6TB 1QSEA 4AG4H 5CBAA 1NUNB 1CGVA 5GJTL 1MEXL 1TJHH 4X99A 4GRMA 1TTGA 4HD9A 1QR1B 1CFQB 4JRXE 2LTQC 1OWRM 5DD6B 2YD5A 1OAYL 2V5YA 4KDVA 3Q6GL 3QIUA 1LNUB 5IV2B 1GVIA 1F3DJ 3WFEH 2BSRA 4WEMB 2XZAH 3LD8B 5AD0B 3ZKXB 3VFMB 3HN3A 2E7HA 3BEVB 1V3MA 4OIIL 5GGTH 4AIXA 4XB8A 1ROWA 1FDLH 1QKZL 3L7EA 4XNMA 1E4KC 5GGVL 1T20A 2AGJH 2DQDH 2VC2L 1NGYA 4K7FA 4GXVL 2Z91B 2W9EL 4FQHA 3V7AG 3H8NA 4OLVH 2BFVL 3RDTC 3KYMA 2JB5L 3MNWA 1WCQA 5EIVA 1L7IH 5HSFA 3S98A 5IMMB 2ICEA 1QFPA 3MBEA 3GBMH 4ZYKA 4JFHD 3ULUF 5DHYB 3WNLA 4RA3A 4XVTL 3CJJA 2QTEA 4JRXB 5I2IB 1I9JL 1SHMA 4KKBD 3F62A 1WC7B 1JHTA 3ZDXE 4WUUD 5IEHB 3ZT5A 5KVFH 2HTKC 4NHUA 4YHPB 3BDYH 2HT4C 3QWOB 1BBDH 1JN6B 5F7FA 4Y2DD 3ZKMC 3L3GB 2OR8A 2X1WL 3TM6A 4YC2C 2CO7B 1F4XH 4RAUA 5I18L 2ORBL 4D0DB 3BPOB 3BEVA 5DO2D 1I9RH 4LLDB 1SQ2N 1P6AB 2YBRA 3VFMA 4RGNC 5ABDE 3MRNB 4OAWA 1WAAE 5GGSY 4Q9BA 4KI5C 5HGBB 5C0DA 3U46B 4MD0A 3QIUB 3EYQC 4U2YA 3VG9C 2H32B 3BQUB 4WI2A 1IEAA 4X8XA 2I9TA 3O3DB 4DKEL 3L5HA 5KSAC 5TPWL 1AFVL 4C56D 3UJTH 5JIHA 3BP7A 1KIQA 2EXWC 2FIKB 1IC4H 2VMFA 4UB0L 1WTGT 1DDHB 5MEOA 2ATKA 2IPUG 3KPMA 3GMMB 4HK3N 4O51A 1C5DB 5KSAD 2XY1A 3NZHL 4K71B 3VGEA 3JSSA 4OZIA 3C6LD 1YMMD 5FIEA 3PUCA 1F4YL 2ZUXA 4NN6B 1G7PB 3FTGB 3UJJH 4HPOH 2C3WA 5C0IB 1HILA 4NNYA 2HKHL 5ITFB 2OS7A 1IAIM 1CDBA 5ESQA 4OD3H 4F9PA 5EBMA 5C0AA 1H3PH 4NT6A 5FF6B 3O8XD 1S7RA 4NQCB 1TCRB 3QG6A 5IBTH 1JYVA 3GJEA 2YD1A 3DECA 4Y16C 4JY4A 3NBNA 4AEHH 3BO8B 2WBJC 4AM0A 3V6OA 3VXUE 3U2SA 3AU1B 2VQUA 2EDEA 4X5XA 1IAIL 5JXAH 5DJXA 5T1DH 2P5WB 3O6FA 1YEHL 4W4OC 5HBBA 1RJZA 1X44A 2Z31B 3CX5K 5GJSL 1XGTA 2XPGA 4HHAA 4LSPL 4L4TB 4XCYA 3EOTH 3D3VB 5A2IH 1R5IA 4MSWA 2ILLA 3VXUD 1T4KB 4P3CH 3I6KA 2VLJE 4ZPTB 4X6DA 1CWVA 5TE6L 4NWUH 3RUGB 5D70H 5I8CA 2EH7H 4PV9B 5HYEA 4OQ1A 1AC0A 2J8UE 1DP0A 1JBJA 3SJVB 5CHNA 4UNUA 3D69A 1BZ9B 1IFHH 2RQ8A 1J88A 3C09C 2DLFL 3WO4B 3O3EA 5JO5B 3IJSA 3ZZ1A 3M1BA 4JPWH 5EWIL 1A9BA 4BFEA 1QFOA 4OLVL 4TYUA 1OHQA 1T0NB 1IM3A 2Z8VC 2DD8L 1AR1C 3SDYH 1YPZB 2KZWA 3V5KB 1NEZB 4JG1H 2DQHH 2VLLB 3ILQD 3GGWB 4Y4KC 5KVEH 2OTUA 4OIIH 5HDOA 4ZUWB 4YNYB 4WI9A 3DXAB 2X2YA 4U7SA 2OMBA 5HHVH 3VFRB 4BZYA 3O2WL 4YGVB 1FC1A 2NW2B 5LG1A 2Q86B 4LMQI 4NNXB 5CWSA 4FQ1H 3RY4A 1CQKA 4NM8L 2VZOA 4JM2C 2NTSP 2UZIH 4G8GD 5EO0A 1NCAL 2GTZB 4G6JL 2Y1VA 3NCFB 5C7XH 4CW1B 2EH7L 1CF8L 3AAZB 5DVKA 4M43H 1AO7B 2N1KA 3L5WB 4HAGA 4OFPA 4X98B 4HGMA 4GRLA 4JFFD 1FO0A 4M61B 1XGYL 4ODXA 5KSVB 3QAZC 5FUZL 4QTHA 4FG6C 5ENWB 2CKBL 1CXLA 1ZANL 1ZT7A 4X4XB 1XF4B 5IFHH 3BP5A 4QRPB 4LBEB 4QHLA 2BZDA 3DSFH 3QEQD 3CVHA 4HT1L 4YE4L 3IVKA 5J3HD 2DM7A 5I0DA 5K9QI 3TH4T 5EUOA 5I15L 1EH9A 4KPHH 4HT1H 4EUPA 1VEMA 1AGBA 3KPPA 5ID1B 4FXGA 1KF9B 1P4IH 3QJFA 1F3JB 3M17B 1KELL 3IAGC 4W6WB 1MLCA 3VH8G 3BE1H 3RVXD 5SWSA 2WBJA 3QJHB 4LRNL 5HYSB 5GS3A 3UO1H 1YEJH 4JVPA 3CFKB 4MD5B 4G7YL 3ZYOA 3KHQA 1U8NB 2VXQL 3O9WA 3KHOA 3GSNB 5IW1B 4MD4B 1JGEA 1V7NL 1JPTH 5FGBA 1IC1A 4MNQA 4N9GB 5EH1A 1MCOH 2GJ6E 4M5YL 2BNRA 1YEGL 1U95A 2DTML 4ODBD 2D31A 1G6RB 3QWRD 2DYPB 2IF7A 4FZ8L 2H8PA 2JCCA 3P4NA 4CVWA 1FFNB 1TDQA 4PRAB 4Y5YC 3WJLC 5EO9B 4HMCA 1W72B 3LQMA 5IVZB 2AK4D 4L4JA 4R0LB 2D0FA 3BIBX 1S7VA 4DKEH 2J5LC 1KXVC 4YPGB 4NGHH 1TQBC 1W8NA 3ROLA 2A1WL 2I24N 5CBEA 2AEQL 3CUPB 4FQLH 4JR9H 4YDVB 3BP4A 2OMNA 5I19L 1EGJL 3SE9H 4PJHF 4TOYL 3SBWC 5GRZA 3VGFA 2BK8A 1A14L 3BSZH 4J3VA 5JQHC 3ILPB 5EWIH 4PRPB 1CN4A 3T77B 4E41D 1AQKL 3PV6B 2VQ1B 3CSGA 5A1AA 1P4LB 5DHVH 5LQBH 2QQLL 1SJHA 4KY1H 1H3XA 3D2UA 4DGYL 4WWID 4XPAH 2D0HA 2GJ6B 2GQHA 1WT5C 1REIA 1JHKL 4KVCH 2DN7A 1PG7X 2X70A 5FYJE 1S78D 5CJ8A 5TE6H 1N5YL 1FORH 1UACL 2FX8H 4WTZA 4XNXH 5D5MB 4PJHE 3EYUL 4KWUA 4KUCF 4KVCL 4L8BB 4EOWL 3X13B 3ULVL 1XH3B 4Q9QH 2AAVA 2CIIB 1U3HA 3GBML 2QQLH 3L3DB 5FGCB 3BIAX 3ZKQD 2VZSA 2ARJA 3OAZK 4YR6A 5DVMA 4RNRB 5C2BL 4I0PA 1IAIH 4MA3B 3BEWA 3F7YA 3P11L 4XPGH 1XGPA 2F54E 2V6HA 3I50L 3WUWA 5L8LB 4XZUB 1J0HA 3QUMH 2H2PC 4P0DA 3ARSA 3MV9B 1HSAB 5CJQL 3B9EA 4QRTA 4KUCD 2JELL 3TN0D 3F7VA 4M4PA 3U9UB 5GGVH 5F1NB 4XWOD 5I1GL 3REVA 5DRXA 1RZFL 3FN0H 4TVSa 4QO1A 1CFNA 1T2QH 1HEZB 4ZODA 5ICXB 2DM3A 2XT1B 1VKXA 4Y7MA 2EDHA 2IEPA 4IEFB 3RWFA 3UJJL 1F4YH 1CICB 4KTEL 3THMH 3LQAH 2EYRB 5DGRA 4ZSOA 1BX2B 3IKCB 4BQ8A 3OJMB 4U1GB 4RSVA 4GBXA 5FYKH 5F1KC 1TQCB 3VE0B 4EVNB 5CKGA 5KZCB 2EZ0C 5DJAB 2BY2A 2FJHA 3LPWA 4APQB 3F6LA 4L4TD 5EBLB 4HJGB 4RFEB 4RFNC 3GUTB 4AENB 2WUCH 4Y4KA 3CXHK 4Y2DA 2VAJA 4O4YL 4MQ7B 5E8NB 1KCKA 5SX4I 3AFLA 1XGUA 4M9OA 1DQQA 1QRKA 4IMLB 2QSCH 3KPSB 4UBDC 3VXSA 1RZJC 3IDNB 5ESVA 5C0BE 1I9IH 2ZG1A 4DVRL 4CADB 3QUZB 2F9BT 4PRPD 4DK3A 3IGAA 1GRWA 3QH3A 4HBCL 4F37K 1A7QL 1JTOA 3PQYB 1PDKA 1WICA 4LARL 2C3XA 3IAQA 5CGMA 5IFHL 2CLVB 4J7RA 4Z9KB 5CJ5A 2BP3A 4Y4FC 2FR4A 1QEWB 2X7LA 4JY6A 5GXBB 1UYWH 4NNPH 4H26B 4QRQB 1OGAA 3B9KA 3LRHA 1HZHL 3Q6FB 3GMPA 1RZJL 2W92A 2P43B 1XGRB 8CGTA 2AXFA 4PJIE 1OSZA 4UOJA 3O2DL 3OBAA 5EC1A 3T1FB 7FABH 4HWEH 2W0FA 3SEPA 3ULVF 3QDMD 4F7MB 5D6DA 4G8GB 5ICYA 4OKDA 3B9KC 5TGBA 1G0XA 4U1NB 2VE6B 5JZ7D 3QEGL 2BFVH 5HHVL 1INDL 5JNYB 1CGTA 1EFQA 5C0BB 3ARRA 1ETZA 2NY7H 3BMWA 1FYTD 3GSUB 1IGIH 5HHNA 3MRPB 3HE7B 4JG1L 1YY9C 2J8UF 1HQRA 4S10A 4AY0A 5MERB 5KSBB 4JZJC 4KMTL 3WLBB 1YA5A 1T0MA 4WU7B 3WS6C 1U93A 1A6AA 1MJ7L 4MNHA 2D4DA 1EUTA 2MWCA 3BUYB 4ONOA 5L2KA 2H2SD 1FE8L 4N0YL 3JWOL 2J6EA 4NP4H 4BYHA 2PTTB 2Z93A 3BP6A 1A6ZB 4JPVL 1QSFA 5GRYA 5E00B 5HVWA 1Y6NR 1XEDA 1PFCA 4M1CC 1RAMA 2OX5A 5EULV 3OPZH 5BRZD 4APQD 1F45A 1RMFH 3KJ4C 4IRSB 1SBSH 1MRCL 3FFCD 3E8UL 1NCWH 4NWUL 4PLNC 4JFHE 2FD6H 4LCWB 1XF3A 1B0RB 4C56B 3QRGL 2CDFB 4DEPB 2CIKB 2BRRL 1IGMH 3KPOB 3UROR 1X4XA 2XFXA 3ULVD 2R23A 3QNXA 4U49A 1S3KL 3T0EA 5J6GA 5FA3B 2BY1A 4NC1E 1KGCE 1FBIL 4TPRL 3PIQA 4ZFOB 2CJUH 1UM4H 4QHUA 4YIQB 5IHZA 3W9EB 4MJ4A 3LEXA 3GRWH 2MPAL 5ETUB 5FAAA 4HIIB 3QG7L 3WXWH 1U0QA 1H3UA 1Y0LA 2P47B 4JFQA 3BPLB 3MRCA 3OKEB 2XA8L 1IAKB 4X7FC 5C8JA 4YBQC 5FYLD 3UC0H 4HUWA 3WFHB 3TA3D 4U1HA 4L8SC 2WWKT 2F8OA 5DMJB 4Q9CA 3KYKH 5IJVB 4NKOA 1S7TA 1G7MB 4FP8L 3JWDC 3PWLB 4HLZG 3BJLA 3C09B 5IOPB 4R9HA 1DJSA 2LFGA 2NYYD 4PGBB 4I48A 3KR3H 3KPQB 4UQ3A 4WRLA 2BVYA 1Q9OB 5DJ0A 3BH9A 3UDWC 1C1EL 1B4RA 2EKSB 3BPLC 4IOFC 5TH2A 2DKSA 3EZ8A 3ARQA 4EIZC 4FFVD 5DZNA 2W91A 1WFOA 3CLEL 4NKIL 4FABL 3QO1B 4JFPA 4PY8J 3C60A 3HG1A 3VJ6B 5GISL 5E7BA 1HXYB 4BH7A 4Y4FA 3KYNA 2HJKA 3H9SB 4BFBD 1HXMB 1T21B 3MRJA 4R8WH 4C57C 5ELIA 3RHWF 4UT6H 5KTEH 1RPQA 3T3PF 1O5DT 1MCJA 5K9OB 3E0GA 1JNHB 5T5NF 3GMOB 1UZ8B 5I18H 3E8UH 3I02B 3HPJA 4XXDA 5HY9A 5L9DL 3NTCL 1B0GA 4NHCL 5I8KL 3WCYA 3IFNL 5IP4A 1ACYL 1W2KT 4N5EC 4PBXA 3P3YA 1TZHB 1MFDH 1BBDL 2VR4A 1NAKH 3DI2B 1MQ8A 1MY7A 3IJYB 4Q74A 4X7CC 4YO0B 2GCYA 4ZTOL 5CZVL 2XZQL 5FM8A 2FZ3B 3VXUB 5KN5A 3JTSB 1Q0XL 1EBAA 3V6BR 2BVUA 5DZLA 1F00I 1TNMA 4NQED 1IGFL 1CLZH 2Z4QA 4W4OA 2AJVH 2JB5H 4LEXH 1OTTD 3UCRA 1DVFD 1TZHA 1P7QB 4CRPA 2WZPD 2YKLH 1VFAB 4UQ2A 1UC6A 2L7JA 2W0KA 3DX9A 2NY2B 5ESAB 5E99L 2J6EH 4D0BB 1EBPA 2GKIA 1N4XL 2V9RA 3MV7E 5E95B 5BO1L 3FZUD 3BKML 3DO7B 1T22B 5CD3B 5B8CB 4XVSL 3QDJB 5IW6A 5C07E 5B3JF 3QEQB 3GSOA 1Q9WB 1BQUA 1I7UB 2ERJB 3INUL 1GGBL 4JFXB 3H9ZA 3WIFA 4ONGH 4GKOA 1H5BA 5F7EH 1TTUA 1UYWL 4ODWB 1S7WB 3T2NH 3H6JA 4R96B 2P8MA 1TJHL 5JHDD 5B39B 2FNBA 2P5EB 2ZCKH 4Y5YB 5GRVL 1F2QA 4TVPL 1G7HA 4WUUB 5MI0B 4AG4L 1G7MA 3DUHA 2APXA 3NIFE 2APFA 1Q0YH 1NCBH 3NAAH 3P0VL 4LCWE 3KDMA 1RUPH 5DFVD 3MRGA 3KWWA 5DK0A 3QI9D 5DTFB 4QHKJ 5C8JB 3DVNA 5K9JL 3BGFC 4NDMB 3TVMC 2XY2A 5DWUH 1RVFH 2FCBA 2OYPA 5DMIH 1JK8A 5ERWA 5ISZD 1RUPL 3H42L 1F3DH 5C2UB 4XH2A 3SDCC 4L5FL 1F8TL 4HCRA 3KPRB 5J1TC 3MYZA 2FX7H 4FNLL 3W9EA 4WV1B 5SWZA 3R1GL 2OTWA 5EZLA 4XPFL 3U4EB 4YIQA 3OKOA 1P4BL 4NO0B 2E6JA 1KNOB 1S8DB 2I9LA 4YBLC 5ISZE 4ZUTA 4X6CE 3T0EB 3UBXA 1ND0A 1PAMA 3D85D 3QUYD 3CFDB 5JUEL 3QNZB 2X89D 2VKWA 3BGFB 3V8OA 3WLWD 2V7NB 3L3OB 2DQJH 1D5XB 2XRAH 2A0LD 4QCIA 2F53B 4K3JL 4RAVA 2QKIA 3FRPA 2CDFA 5EBWB 3MACL 4I5BA 4PJDA 2Z8SA 3N06B 3FQUB 3TV3L 4F9LC 3DRQA 3ARED 1NC2D 4LNRA 3D1MC 2GJ6D 5E99H 1FIGL 5IBLD 1KJ2B 4M1DL 3VXTB 1MJJB 5DJCA 4WFFD 3OR7A 2FH6A 5SV3A 3U30C 1AGEA 3GNMH 2VIRB 4GKZB 5EUKA 4UIMB 3NGBB 4H1LG 1JGVH 2AK1H 2OR9H 2ITCA 1LD9A 5F1IA 1T04B 4XPGL 4GRLC 4KGLA 2AJVL 1CFSB 4FQIH 1LDPL 2EDDA 4K8RC 1U93B 4PJDE 4G3YL 3GM0A 3NCEB 1QLFB 3BPNB 3AMLA 2XWBA 1TIUA 3K46A 3LHPH 1FIEA 1E4XH 3HI5H 1HNFA 2Y6SC 1HQRB 5F9OH 1JTTA 3EYUH 1JVKA 5IVNA 2FX8L 5E9DD 3GSUA 3U0TA 2XTJC 4S1QL 4U1GC 5DDHB 4B50A 4NBZB 1RURL 5J1AA 2C3HA 3LS4L 5GRJH 2W38A 4OQTH 4P2RB 5DEFB 3EJYD 1KJVA 2JCCE 3QDHA 5D1QA 1CD0A 5L9DH 2H41A 4JDZA 3UTQB 3P9MB 1VCAA 1I7ZB 3KPTA 3OAYH 3W39B 3NCYP 1GC1C 3BPNC 4MNQE 3I6GA 3A6CL 1GC1H 4ZO7A 4UT6L 5DJDA 4P2CG 3T1FA 2A0LC 3HI5L 2HRLA 4XPBH 5LBSH 2VXSH 3TZVD 4X4MA 1UJTA 2X4QA 3C2SA 1NCDH 1EGJH 1XGRA 1T1WA 5BW7C 5SWSE 1QFUL 1M71A 3FB6B 3Q6FA 1F02I 4PG2C 1MCPH 4H26A 4QRQA 3HZMB 1IC7L 3DMMC 4GSDL 1B6UA 4JFFE 15C8L 1VACA 4HKBA 3HRZB 1NUDA 2MCPL 4UU9A 3WJJA 5DFTA 2N7BA 3GNML 3NIDF 4ZNCD 2AJZA 2FO1A 3IDYB 1YC8A 3VFVB 4PS4L 3ZKXC 2WUBH 1FIGH 1F4WH 3SOBL 3F7PC 2P5WD 3RNQB 5MENB 2YXMA 4PLJD 1YNLL 4HKZA 5BVJB 1J0YA 5I1DB 3IDNA 5ESVB 1NC4B 3KXFB 3KPSA 4TVPD 1EEYA 1KUMA 5CEYA 4IMKC 3UTTA 5I8EA 2R2BB 2AJSL 1IQWH 2DLGA 4HXBL 4M03A 5D5MF 3GUTA 5J7CC 3B4NA 1E28A 3PWNB 1D7FA 3WXWL 4FTVE 3VWKC 3GRWL 5FB8B 1P4IL 2VDRL 5AG8A 4GAJH 1VFBA 3BYTA 2X42A 1F8TH 1KCRH 1RUQL 3VE0A 4EVNA 1IKFL 1HOCB 3BKYL 2ZUYA 3NIGF 1BX2A 3GMNB 3HB3C 1S3KH 3MROB 5EU3B 1CICA 1HWGB 3B5GA 4UDUA 3MLTB 3SGDI 2FLBT 2MHAB 4YHKL 1UEMA 1U3HC 3O4LE 4OUOA 3VFPA 4JDVB 2BJMH 4S0TD 4GG6B 4P2OD 4OI7A 2OJEB 1M7DA 2IMNA 3HC0A 3NAAL 3P0VH 3WN5C 3W5NA 3REVB 4PREB 4EI5B 5L0QC 1AP2A 1YJDL 3IXAA 4K94C 4TVPH 1SBSL 2EYSA 2Z9TA 2Y07L 2JJTA 1T1ZB 1MI5B 3TIEB 4PBWD 3T2NL 1NCAH 4HIEA 4PLJC 4ACPA 3BW9B 4NO2B 2VAAB 1U3HB 1GGBH 3O2WH 2KQMA 2HVKA 2IQAB 3V2AR 1OQOA 4DUXA 4AQ1B 4HMDA 3BUTA 4NRYB 1BFVH 3C5JB 1N4XH 3ECBA 3TNMA 1NFDB 1SY6H 4QRPD 2RBLA 4FFWC 2R1YA 5CIPH 5E1AA 3WFDL 4D8PB 2I27N 3D2UB 2AK4B 4JFYB 4PGDA 2A9NH 4JPWL 4HG4J 4TSBH 4HUXA 3V6OE 4JJHA 2FHFA 2AJ3A 2YD9A 4LFHG 4P23D 4QRUA 1UG9A 4M6MH 3BPOC 2LTQB 5KS9E 1OF2B 4XRCB 1JIBA 5F70A 2EDXA 5C0AE 2IGFH 1HCVA 3HFML 1MFEL 3IFLH 1NBZB 4BUHA 1MWAA 2CKBB 1FCCA 1TPXB 4YPGA 4P3CL 4HWBA 5A16B 5C09E 3BQUC 4HC1L 3RAJL 2AV1A 5KSUB 3BZEB 5D71L 1W72A 2VXUH 4Q6IC 5ID0B 3MC0A 1ES0B 1EHNA 1MFNA 5A16A 4PRAA 2YPVH 5GHWL 4NHCH 5I8KH 1DEDA 2AJXH 4K7PY 2B1HH 1HH6A 2PKDA 1LO5B 5KSAB 4S11A 4Z77A 1FNHA 1MWAB 4GMTL 5T1DL 2DQGL 4M3KB 3TBYA 5HDBE 1U6AL 1DBML 2I25N 1QNZL 1A0QH 1MAMH 4PRHB 3JTTA 1OF2A 3JVGC 4XRCA 5AYUH 1P7QD 5TE7H 4BSVA 4D0CB 2ZCLH 3CFKA 4MD5A 4UV4L 5JPMA 3PHSA 4R4FL 5HYSA 2NXZB 4OD3L 4JFYA 3H7LA 4BKLB 1DEEA 4D8PA 2R1YB 2F74B 1F3JA 4LPVA 5L88L 3QJFB 3LKQA 5AUMB 1NBYB 3WDJA 5HYJA 1HHJA 3L7FA 2G5BA 3BAEL 3D3VE 3GDBA 4JHWH 5HDBF 4OT1L 4FFYH 1S9XA 1U58B 3FO9B 4P2OA 1RK0B 2K1MA 5IVXB 3LQZA 2IQAA 2H32H 4F80A 1P6FA 4HUVA 3ARDD 4QHLB 4P46A 1QFHA 2B7DT 1UM5L 2R69H 2W9DH 1CICD 4JM2A 3T65A 3UJTL 2VO5A 5HTSA 3C6LC 1GGTA 4RGNB 4N5UA 3P4MA 4G7VH 3TIEA 1FO0B 1CXHA 1I1YB 5BXFA 1T1ZA 3FN0L 5FDYA 2EYSB 1R5WA 1AO7A 4KJPC 4MA7H 1W0WA 4CW1A 1DZBA 2HLFD 3IFPA 4LGSB 1NFIB 1A3QA 3HC0B 1XCTA 4LLVA 2DTSA 5KW9H 1TCMA 3SKJH 3AY4A 4Q97A 3EBAA 1LO0L 2ORBH 1NMAL 5KSBF 5TJWK 1NKRA 3GMNA 3G6JF 3HTLX 3MROA 5DLML 1UB5B 2YK1L 4JQVA 4LSDA 4XP6H 3QRGH 2XWTB 4LPXA 3P4LA 4E42A 4PJIA 1YPZA 5DO2C 1N5YH 2ZJSH 1NCWL 4PRHE 1T0NA 3VGDA 1N64L 3RVWC 3NN8B 2F53D 2FX9H 4U6XB 4WENB 4XPAL 3M1BB 1I1AC 4KY1L 1AD0B 1KENL 4NUGL 3JWDH 3VRIA 4Z8FH 2BNQA 1BZ9A 3ZHDA 1KPVB 3RA7L 2YEZA 4X0KA 4EDXA 3D48R 4KHTH 1DUYB 3QUKB 3LB6D 5I1DA 2E3VA 5F7LB 3VXSE 5I8CB 3QUXA 3VG0H 1QLEH 4FQLL 4OD1H 3WSQH 2V7HB 2VTFA 4NQSA 3M8OH 1GH7A 4CU6A 3WD5L 1MCFA 3VGBA 4G8IB 5IFJB 1VACB 4HKBB 2A6JA 2HFFA 5HHXL 4AL8H 3CZJA 1DBJH 4OLXH 4Q7DA 3QEGH 2P5WA 5GRUH 5DJXB 4K23H 1A3LL 2IPTH 1E27A 2X4QB 5I8OL 1T7ZA 5SV4A 1I8KB 5I1LB 3RIAK 1C5CL 3MRIB 1MLBA 1U2CA 2AXJA 2DTMH 1IZJA 1W72H 1EA9C 2B8OT 1SJXA 2IH1A 3HC4L 5DC0A 4NQCA 4PLKC 5BZWB 2ZUWA 5D6CB 5K59F 4NN5B 1QUNA 1IGJB 2WWMC 3UTQA 5EBMB 5C0AB 4NIKB 5D1QB 1WCBA 3V6ZA 1BBJB 2ATPA 5ACZA 3OHXB 1KJVB 4WUKH 2NW3B 5GZOC 1NCNA 3ZYIA 4YDKL 4MJ2A 5C0IA 2V2WA 1XGQA 2E9WA 1G7PA 4U4BA 5DDHA 5GGQL 3NPSB 4G5ZH 4POUB 5L6YH 1K6QH 5LVEA 3WHXA 5M94B 2ZP0T 3TBVA 3GIVB 1ZWIA 1TVHB 2DI7A 3WFCL 2VDMH 4JO1L 4XBPA 4XVUC 4X8JB 2BC4B 4KPHL 2ATKB 3KPMB 2IAMA 3MGTB 4U31A 1NMBH 2XWBB 2ADFH 4WO4B 4OFVA 4Z7UF 3TYGH 1KIQB 1LGVA 3EJJX 4IIQB 1XIWC 2DICA 4IRJC 1CG9B 1FZJB 3MMEB 1PLGH 2VLJD 4JAMA 4Q58C 5JA8B 2YPKA 4ORGA 1YN7B 3WIHH 1GZPB 5EUKB 3RWDA 4ZO9A 2H32A 3KLHD 5HYSG 3TA3C 5FYLH 1KJ2A 3VGAC 4JANA 1J8HA 5I74C 4U33A 5HGBA 1QYGH 4LNRB 4Y1AE 3TWCL 1UCBL 3HZYB 3S88H 1WBYB 4BZ2H 5CINL 4KK9D 5FYJL 1SYVA 1FGVL 2EEBA 4JANB 3MO1A 5EBWA 1FPTH 4QCIB 3C5ZC 1IRAY 1GZPA 1ZHBA 1ND0B 2D7NA 1A7RH 2B4CC 4P2QE 4IOSD 3D85B 4LCYB 3GSNH 4PJFB 3VXRD 3HUJA 4NHUB 4RMVA 3KPRE 4NO0A 3U4EA 5HPMB 2DQHL 3PL6A 1KTRL 3KPRA 5BS0E 3QZWB 2BC4A 1WBXA 3PDDA 3QHZH 4XBPB 4OI8A 2VWEC 1ZWIB 4X6FA 4UTAL 4HLZH 4RWYL 2IBZY 5FKPA 4G8GE 3WHXB 2CD0A 1XGQB 4N68A 4XMLH 3STZA 1T1YB 5HI3C 2D7PA 5TFSL 5T5NG 1AQDA 1WCBB 2IMMA 3ROOA 4XCNA 4FQHB 2Z91A 3QQ4B 3AS2A 2R4SH 1T20B 5DUBA 3L7EB 5ITBH 2E7MA 5D70L 2MCG1 3BFOA 5CLTA 3EYVB 2QLVB 4LAJH 3ESUF 3DBXB 1AKJB 3QI9A 5MENE 4CKVX 5AEAA 3ZTNH 3H0TA 3RL1A 3SO3B 2AERT 3WIFB 4MXQD 5IV2A 4G6ML 4YXHH 1CICC 4G8IA 4MAYC 5IFJA 5EUOE 4LQFH 1EO5A 3GSOB 4YZFF 1QR1A 5B8CA 2V7HA 2MJWA 3ARFC 3TJEL 2XQBH 1MY5A 3QDAA 3QUXB 1KT2B 1OB1B 3FFDA 2XQYK 2HN7A 3SE9L 2YPLD 1QSEB 1L7TH 5ESAA 2FJFB 1DUYA 2AEQH 4JR9L 2E9JA 4DWHA 2NNAB 1QOKA 5SX5K 1J1PH 1X3DA 5C07B 4JO2L 1JMZA 2HKHH 5L0QB 2WP3O 5GS0H 4LSRL 5DRWA 5GS0C 3SDDB 3MRKA 3MREA 4JHAL 3RIFF 1I85A 3V52H 3NN8A 4LDOB 3DWTA 1L0YA 4LKXB 4O02H 3V5DA 3QDMB 2QQNL 1TXKA 3U0WL 3SKNB 4F58L 4Y4FD 3MNVA 5J13C 4FG6D 1CVRA 1MJ8H 4XNYL 2P5WE 5I16B 2GCYB 2XWTA 5IMKB 3SGEI 1HI6A 1JPGB 2HFEA 3OKKB 4XHJD 1NCUA 2PW2B 4JFDB 4HIHA 2GFBA 2K3TA 4GS7C 5E08H 1U3YA 2EDYA 4TVPE 2FEDC 4KK8D 3BQUD 4Y4HB 1J8KA 1RUKH 1EHAA 1PZUB 3U79A 3I02A 4ZNEE 3WMSA 2NY4C 5GRVK 1RJYA 4S2SA 3UTTD 2VL4A 5CJXC 5K9OA 4FQ2L 2ZNXA 4S1DC 4RIRB 4L3AA 3VFNA 3MRJB 2GHWB 5DD5H 1QFWI 4NC2B 5F8RC 3EFDH 3TA3A 1N6VA 3KYNB 1RIUH 2M8XA 5F9AC 5H94B 3HG1B 4K3DH 5LGHL 3Q3GA 4OLWL 2JJUA 5K9KA 5KVDL 4H88H 1FYTB 5B4MD 1BQHG 3UMTA 3D39B 5ISZB 5TH2B 4LF3A 4XI5C 5EPMA 1FG2B 1U8LA 3K1KC 1XGYH 3G6AA 1I75A 5C9JA 3KPQA 4LASH 5EZOL 5IROC 5DEZA 3QXDA 3ZKMD 4K9EC 3HE7C 4HS3A 4MB3A 1YNTB 3O6FC 3LKNA 4K71C 3RZCD 1S7TB 2IALA 4KHXL 1U8IB 3IXTA 3L7FB 4N0FA 4UT7H 5EZOH 1HHJB 3TZVA 3MXVH 3WFHA 2Q1EA 2F74A 1JV5B 3PWUB 4KXZH 1LEKA 1NGWB 3GO1H 3JBG7 1BMGA 2DWEA 3LDBB 2Y5TA 3ZT7A 4XAWH 5DQDL 3T4AB 2ICWB 2D03L 3VFTB 4EN3C 4WHCA 4MLIA 3VWKB 4NQDA 1AO7E 3KJ4B 1TVDA 2GK2A 3P30L 4HUNB 3LH2L 2DM2A 4IRZL 4GOSA 1MUJB 4X4YA 3L6FB 5IHZB 2AXHA 4QHUB 3TBYB 4XHQA 3PIQB 4OV5A 1G7QA 1WZMA 5FGRA 4EIGB 3J8F7 1BQLH 4U1MA 1H3GA 1EGJA 3QQ3B 4NQDE 4WHTB 4DGVH 1ES0A 3I9GL 2Y4SA 5MHSE 1QQDA 2BOBB 3QA3B 3BZEA 2A2QT 2XN9D 1OW0C 1OAYH 1N2RB 1M6OB 2NY6D 4JLRB 3FHAA 5BVPH 4LLYA 1ZEAH 2NXZD 5INDA 4Z76A 3AUVA 1RIHL 4KJWD 1CE6B 1E6JH 2EH8H 1UQSB 4N1CA 4F58H 3D0VB 5EIIA 1MFBH 4O02L 5IVOA 3U0PA 5H35A 5GZOD 6CGTA 1AXSA 2ZOKA 4HS6A 4UOW1 4WEBH 4UINH 2Q8AL 3EOTL 1DN2A 4I8DA 3MCLL 3E6FA 1NQBA 1KCVH 2GEEA 2ICWJ 3CGTA 4LSRH 4QXGH 5DURB 5D2LB 1MHPH 4KJYB 3RI5F 2E8ZA 1YN6A 3MLYH 1UB6A 1WAAA 1FN4B 3CFBA 4YFDB 3BN3B 1UKTA 3Q5TA 4QWWD 43C9B 4FFZL 3UJIL 4OD2A 3S36H 4ZG1A 3FO1A 1AHWB 1WFNA 2ZCHH 2H6PA 4LCUA 5FYLE 8FABA 4FTVD 3BGMB 2X41A 3CCHB 5FKAB 4FFZH 3UJIH 1NGXB 5L2KD 5C0BA 3RY6A 4Q0XH 4XP9L 4PGJA 4EI6B 2A9MH 3CVHL 1SMOA 2YA1A 3MLSH 2VAAA 3RUGF 4DAGL 4OFDA 1YMHB 3L95A 5D72H 4M02A 1MI5A 2NCMA 4K7PX 2DLTA 3KLAA 4MJ6B 4V1DD 5ECJE 2C1OB 3ZMRA 1MFAH 2FYYB 3JVGA 4GQPH 2V5MA 1NGPH 4PJ8B 1DVFA 1I1AD 2MOVA 3TO4A 1J1OL 3K2UL 2XKUA 2ZG3A 3L1OH 3GSXA 2R0ZH 3PWPE 3VFPB 2YXFA 4K3EL 2VDKH 3RVWD 4RMUA 4PB0H 2X4PA 2MHAA 2ZOLB 4ZUUA 4WU5A 1INQA 4M7LL 1KJ3H 1K3ZA 4OCNC 1AKJD 2R0KH 1R3KA 3JV6B 1BD2D 3CDGA 3ARBA 4MXQC 5DS8A 5I1AB 2A77L 2OL3A 3OZ9H 2GSGA 1UH2A 3EFFB 5DQ9A 3WL9B 1NEZG 4OGYH 1VGKB 3F12A 4KMQA 4MNGE 4LPWA 5FB8A 1ZT4B 1IEBB 2G9HB 3OG4B 4Z18A 4GUPB 3TVMA 2Q7YA 2R2CA 1S5HB 2OL3L 1D6VH 4PJ7B 4MQ7A 5E8NA 2F54B 2R2BA 2F54A 2V5TA 3FQWA 4JG0L 3QB7C 4KUZH 3V7MA 5E94B 2NY3D 3MXVL 4GUPA 3TVMB 2GITB 2FGWH 5C6TH 3O0RH 1U8OB 5FHBL 3QP3A 4Z7QE 1UCBH 5DD1L 5MENA 4OSUH 2FIRT 5FO8B 1AXTH 5FOBA 4JCLA 1JGUL 1IAOB 4GBXB 2HLAA 5C0NC 4U1JB 3VXQB 2AJZB 12E8L 4R0LC 5DGQA 3DO3A 3HRZA 1OAZH 1DQMH 3S4SA 1FP5A 5ICXA 2X4PB 4QGYA 1MRDH 1M71B 3WEXB 4XPTL 1T1WB 3C08L 2VLKA 3RPIB 3R06A 3K0WA 2Y7QA 2Y06H 4GW1A 2AGJL 2DQDL 1F13A 1U8MA 5IROA 1FQ9C 3UYOD 4D9LL 5KG9B 4CVUA 1Q72H 1HSAA 2CGRH 2FYYA 3I6GB 2CUHA 2VLRD 3M45A 2VKXA 3OXRB 3DRTA 3WUWB 3QXVA 3V6FA 4NZJA 3L95B 4GXUM 1XGPB 3IDGA 5KAQG 4Q9RL 1G1CA 5E6IB 2P7TB 3B3IB 5BRZB 4RNRA 2ARJB 4YR6B 1KN2H 1OT2A 3L3DA 5ILTL 3HUJE 3HE6A 1NGXA 4DVBA 1DTUA 4TUOB 3SKMB 1I3RA 3CCHA 1T6VN 1RD6A 2XV6B 3N50A 3R8QA 1JZ5A 2BSSB 2VR9A 1Z0NA 4XXCC 3H9SE 2X70B 1PX3A 3DUSA 3HNVH 2VOTA 4KRLB 2GJ6A 1KN2L 1QD0A 3BHBB 3HMXL 1UB6B 4Z7NF 4P4RB 1DBJL 4AL8L 1H15B 1HN1A 4DFHA 4HCRH 4JO2H 3QCTH 2Z92A 3CU7A 3E6FB 3V8CA 3QQ9C 4EDWH 3VXTA 2X40A 2OK0H 4BA8A 4KK5C 3VD9A 1FJ1B 2VN7A 1Z9MA 3O3AA 1X5IA 4JFED 4XMKL 4OZFG 3IFOB 3RA7H 2Y5EA 4G6KH 4PG9A 3MYJA 1DQML 4E41A 1D5XA 4ONHB 4OZGB 2V7NA 5DMGC 3JWDL 3F58H 5DRNB 1DVFC 1FFNA 5KVGL 4ZUTB 1PVHA 1R5VA 1S8DA 1G0YR 1KNOA 2DYPA 2PO6B 4PJ9C 5DJYA 3OKOB 4PJCF 2F5BH 5J12C 1A7OH 3P9LA 1U95B 4U3CA 2NZ9D 4RFNB 5ITBL 3TBTA 2UV3A 1R3LB 3MSPA 4NQCE 3O9WB 4CN4A 5D96B 2ICWA 3BISA 4KI5D 3TJHC 5TFSH 5I1EH 1FNSH 1NMAH 4NN7C 3PWPB 5JHDA 4FXLA 1NGWA 2NXYB 4TNWK 2BNRD 1FFPA 4MX7A 4JE4B 2NX5B 4RGOH 3KWWB 5DK0B 3RVUC 3QXAA 4P57A 5I17A 4N0FB 5IBUB 3V0VB 3DVGA 2IALB 3LKNB 3QPXH 3EYOA 4WO4C 3QYCA 3QXDB 3RVUD 5KOMC 1WEJL 1NDMA 3MRHB 1HSBA 1TLKA 2NLJA 3QFJD 5J57B 1NFDE 1CU4H 4X4XA 5EA0H 1R3HB 4J6RH 4LF3B 4X6CA 4QTHB 2R0ZL 2MKLC 5ISZA 2DQCL 4LPTA 5KSVA 4EBQL 1U8HA 3ZE1E 5MHSD 2XXCB 4M61A 1I7UA 1BIHA 4ZAKA 5CP7A 5EOCL 5EU6D 1AJ7H 3QEQA 4WGWB 5H94A 1JMXA 1J5OH 4D2NA 1UH3A 4KZDL 4GS7B 1NDGA 2J8UA 4D9RE 1LE5B 2R29L 4MNGA 1H8NA 1L9MA 4D0BA 2EO1A 5C0EB 1D6EB 3MLSL 4NNXA 2EEAA 2X4UA 1V7MH 1S9YB 5B38B 1HDMA 3FB8A 4UV4H 4ZFZA 1ZGLM 3OKKA 4QLRA 3RWGB 5DJ2A 5EU7E 3GGWA 2DRUA 5I16A 3W81A 4XB7A 2BVOA 3TYGL 2ADFL 2XA3A 4X9GA 2GY5A 3VXUA 4M1GL 1WBZB 4UDTB 2DQGH 4XPHL 3FRUB 2WMPA 1KCUL 1A9BB 1ZVHA 2BDNH 1DE4A 1N8ZA 4Z5RA 2YD2A 1VFOA 1Z6JT 3IDMB 3O3EB 3WS3B 3KGRA 4HXAL 3EOYG 4PLKD 2YRLA 5C07A 4P3DA 4WFHE 1XF5A 4G9DA 2E8YA 4QF1A 1MF2L 4AEEA 5JMRA 5CHNB 2ID5A 1KTKE 3RDTB 3HPJB 4XXDB 3MV7A 1GPOL 3VCLB 2FJFA 4XAKD 3K74B 5FO7A 3GMOA 2NY5C 4MJIA 5IT2L 2H1PH 4GMSL 3F8UB 2VITB 3CK0H 1NCTA 3ZE2F 3EO9L 1C5CH 4M7LT 1IT9H 4APQC 5JW4Q 4TNVF 2D7TH 5I1CL 4XCYB 4N0UA 2QQKH 1B2WL 2ZUQB 4KQ3H 4TSBL 2UY6A 2C1PB 5TDOA 4MXWH 5DFVC 4HAFA 5HYJE 4PJEA 1NAMH 3GJFH 4JRYE 3HAEA 2BVPA 3RIFK 3RZCA 3EYVA 4ZTPH 1O7SA 1G9ML 4ODSL 2F19H 4LSTL 4XC3H 4KTYA 3FN9A 5D1ZD 3A6BL 5D7IF 5T33L 1IBGH 1I3UA 4XP5L 3S34L 4CU8A 3PWLA 2OXGA 3QEHA 5KAQF 3L9RB 1DLHB 5F7DA 4PJXE 5DUBB 1F42A 3TIDB 1YNKL 2O5YH 4X80H 3N85H 1DQTA 2QV2A 4NT6B 3QQ4A 4M62H 5FF6A 5TQ2L 3U6RA 1D9KB 3ALXA 3S5LG 2BY3A 1QLRA 5F6IC 5LGJA 3HZVB 5D4QA 1Q9LB 5JTWA 2PW1A 1BIIB 4MA8H 5DXWA 4LSVL 4MVBD 4XBEH 3FTGA 4LHUB 3BWUC 2X1OA 5DR5L 4JGMA 2FX9L 5FKPB 3V0WL 4K55A 2J8HA 4PRHD 1XT5A 3UTSA 3RBSA 1YNKH 2O5YL 3GMMA 5C09A 5LJYH 4BM7A 3QZWA 3TF7C 5GSVB 1CTOA 2AABL 2VH5H 3X12A 4GKNA 4YDLB 1VSCA 1J05B 2WK2A 2YK1H 4KKAC 4PJFA 2R56H 1A7PL 5GGUB 4K3DL 4OZFA 3MOBL 1AGDB 3RNKA 2CUIA 1MWAH 4XNQA 5EORH 1IKFH 1R0AL 3MO1B 1B0WA 1IM9D 1WVZA 1XAUA 3W0WA 1WBYA 2VDRH 3NVQA 5IFAH 1EHLH 1T3FB 2L0DA 1VENA 4J1UA 4N5ED 4Y16B 4L9LA 4RZCB 3VFOB 1GIGH 4ORGB 2YPKB 1QSFB 3BXNA 4CMHC 3DV6B 1FZJA 2PTTA 1E4WL 5HHOE 2YPLA 2COQA 4BH8A 4YFLI 2BNUA 5JORB 4H20L 3AREA 4HJJH 4XPHH 4JRXA 5J1SC 4FFYL 5HYFA 1N6UA 5DHYA 1OP3K 2NY2D 3BAEH 4JHWL 4ZUVA 1TVHA 3HE7A 3T0EE 3P2TA 3FFCA 5EZJA 3WNNA 1AI1H 2ICEB 2DKMA 2MCPH 2VZUA 4LHUG 1J1PL 2V9QA 1LO3H 3B2UD 4MWFA 5IMMA 4ZNEA 5JNYA 5IIEA 2PF6A 4MAYD 2KH2B 1I1AB 5C0RL 4UV7H 2W65B 2L4OA 5IB3A 2CMRL 1ITBB 2F5AH 3UPRB 3PGCA 3ARTA 4XPBL 4XNMB 4OIAA 5IEKA 1MCBA 1Z3GH 3DNKA 3ZKSD 3RGVD 3A6CH 3VI4E 4CL7A 4KZDH 4WNQA 5GIRA 4WTXA 4X9HA 4XX1G 2ADGA 3RGVA 2FL5B 3X17A 1X5LA 1AJ7L 2AXFB 5SX4H 5EOCH 5GRWA 5EIQA 3GMPB 2NY5L 4FTVA 2Q3AA 1OT1A 4U6YA 5JQ6H 1MCEA 3RAJH 4FZEH 1NLBL 4JJ5B 1MNUH 4XNZB 1JRHI 5HYQA 5DD6A 5TQ0H 1DUZA 3ZLQC 2V2XA 4DKFH 5IHBA 3QH3B 5D2NC 1ZXQA 1OAQH 2PN5A 3MLZH 3PHQB 2NXZC 4DGIL 4X6DF 1M7XA 1NAMA 5C0CD 2AJUH 5DFWH 3QUKA 4LGRB 1ZK9A 4X0KB 4OCYL 3HAEH 4TRPL 2YEZB 1WFUA 2XIDA 5EORL 3RY5A 1FLTX 1HH9B 3QCUL 4XCFH 2G2RB 1XGUB 3MFFB 2J3SA 3PP3H 2BNQB 4FQXD 5E24E 4UTAH 5J56B 3TBSA 5AYQA 3D39E 1SY6L 4J3TA 1JI1A 1KEMH 5AZ2L 1OAQL 4HJGA 1IC5H 4DGIH 5HD8C 3ELAT 5FYJD 3JV0A 2RFXB 4PJIB 1A7BA 5TQ0L 3GSNL 4JFEA 3W0WD 4W6YB 2GAZB 4WW2A 4FZEL 4JGJA 4XMPH 3IKCA 4AMKH 4KV5E 3ZKNC 4R7NB 4D3CH 2ITDA 3KLHC 3NMEA 4QYOB 2KL6A 2XWJA 4S1RH 1ZLVH 4LCCB 1FGVH 1QO3A 3JV4A 1HEZA 3QNYA 3H7BA 1D5BA 4XMKH 5C0AD 4M62L 4NYLA 5DA0B 3VFGL 5D2LF 3BVNA 3V4PL 2MQ0A 5CZKA 3KPLA 4GW5B 4AH2A 4DW2H 2VJXA 4UILH 1YJDH 1YUHA 4QXUL 3ZDZF 1R5WB 4D9RD 3L3KB 4ZFGH 4E0RB 1FL5A 3RTQB 4LLWA 4KDTA 3BDXA 2QHLA 3P4MB 5IVXE 2HP4A 4PRID 4P23B 1PLGL 1S7UB 3KS0H 3QUYB 3QCTL 1A3RL 4KK5D 3BD4A 4C55A 3C5ZB 4JM2B 4P2QA 1JWSB 3HNSL 2RGSA 4N0CD 3HR5B 3HMXH 2CIIA 7CGTA 1XH3A 3A67H 1VPOH 4LSQL 1A2YA 1Q0YL 3BKYH 4ZFFA 5F7UA 3WE6A 3BKJL 1ZA3B 3MJ8A 4P9HC 2VDML 3FO9A 4JO1H 3KVQA 4P9HH 2IWGA 5T5FL 5D7JD 4ZSOE 2G5BB 4QNPF 5CJBA 3TN0A 3LKPA 4FMFA 4UT9H 1JHLH 1VADA 4IIQC 2VDQL 1F2XK 1JZ6A 1DEEB 1FZKB 4WUKL 4BKLA 2AJSH 2BERA 1BJ1H 1PJ9A 4GLRI 5LGKA 2EDKA 2P8LB 1EAPB 1P4LA 1AIFB 3ZYZA 1ZA6B 1CDIA 1MIMH 3SE3C 3GJFK 1KCUH 5IKCA 2DMBA 5HGAB 3PGFH 4OZ4B 1UVQA 2CGRL 3JTTB 1TFHA 3PE9A 3MX0A 3OKDB 1OTSC 4Z7UE 3WIHA 2NY0C 4PV8B 3TPUA 1Y6MR 4KKAD 1EFXD 4X9BA 2ED8A 1D9KD 5DJ6A 1LO5A 2JJWA 3HNSH 5KSAA 3C08H 1CGUA 4NRXB 1MCDA 5HGDA 1S7VB 4GG8B 3TH2T 1H0DB 4POYA 4V2BA 3E6HB 1A5FH 1I4FB 1T66D 4L4VB 3VG0L 1CGYA 3SDXE 4ODUB 4QEGA 1NCDL 3IETB 4QXUH 2AABH 2P8PB 4S0SD 2VZTA 1A8JH 2R29H 4P2QD 2Z8RA 2FEEL 3OKLB 1RY7B 3GSNA 4Z0BH 5IW1A 4NC1C 1BLNB 1OLLA 1LILA 2APBA 1BVKB 3W11D 4MCYA 2W1NA 3QHFH 1I7TB 5AWNH 2J5LB 1KLUA 3G5XB 2AK4A 3VRJA 1KG0B 5CZXC 4WW2C 1DANU 2F8VA 4V1DB 3LY6A 5SX5H 4A2MA 1DBKL 4P5KB 3S34H 1UM6L 1OTUC 1G9MC 3U36B 4MCYB 2DOCA 5D1XD 2P5EE 1WZ1H 1IC5L 3FT3A 5I75B 4OGYL 5CLWA 2W07A 3ETBF 3KLSA 1SYSB 2DBLH 4QHNA 4BJLA 3BIKA 4NZRL 4LBEA 4MXWL 1XF4A 4ZAKD 4M5ZH 4LL9A 2QQKL 2LU3A 4KQ3L 5CILH 1RIVH 2P8PA 1JGVL 3BW9A 5A2JH 1B4JH 5SWSD 4K3EH 1MCLA 1CZ8H 4BQ6A 4GRLB 3CIQA 3FT4B 3QIWC 2YSSA 3ZT6A 5E03A 4R3SB 4XBGA 3VFSA 2J1KA 1MAJA 1MCRA 3T0DA 2F5BL 2ZSWB 4OGXL 2APTA 1YEFH 1FNAA 1JNJA 4RWHA 3OKNB 2XTJB 4Z7VE 4XP9H 2ZPKH 3ULUC 4GRWE 3PL6D 2AEIT 1DSFH 1G7LB 4GAGH 1K8DA 3N1FC 1Z9LA 4NO0D 4BSWA 5FYKD 2FX7L 3V5KA 1FZKA 4J8RA 5EU6A 1GZQA