1EHLH

64m-2 antibody fab complexed with d(5ht)(6-4)t
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
217
Chain Sequence
EVQLQQSGTVLARPGASVKMSCKASGYSFTSFWMHWVKQRPGQGLEWIGTIYPGNSDTSYNQKFKGKAKLTAVTSASTAYMEVSSLTNEDSAVYYCTRRSGYKYYALDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 5'-(D(5HT)P*(6-4)T)-3'
publication title Crystal structure of the 64M-2 antibody Fab fragment in complex with a DNA dT(6-4)T photoproduct formed by ultraviolet radiation.
pubmed doi rcsb
total genus 42
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2000-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ehlH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ehlH02
3VI4F 1EEYA 4YX2L 3KS0J 4J6RH 3NCEB 2PTVA 1QSFA 4WENB 3UTSD 5CP7B 1YN7A 1QFWL 4KK5C 2BHYA 4OJFL 2LQRA 2XTLA 3L5WB 4K7FA 3GGWB 1UGNA 2HLFC 2P49B 5IK3B 1H15B 1WEJL 4JPVL 2HVJA 4ELMF 1T2JA 3UX9B 5GXBB 3S98A 3L1OL 3TWCH 4TUOB 3NA9H 3TJHC 2L4OA 1FC1A 1OOAA 3TYFA 4JANA 4X5XB 4LSPH 3RJDA 1I1FA 5IT2L 3CH8A 1B4JH 4D9QE 3UPCA 3CMGA 2ZSWA 4XXDA 5HTSA 1DBML 4FFYL 4RAVB 3EO0B 4HKZA 4Z0XB 1ZA3B 5B39B 3ARXA 3LS4H 4FZ8L 3OJDA 1UQSB 4JQIH 4EVNA 5DMIH 5GGSY 5IESL 4J4PA 2EDRA 2CDEB 4J7RA 1KLFA 3ZKSD 1YDPB 1CZ8L 5BV7H 2Z31B 4JHWH 4U6HA 4JO3L 2DYPA 1QNZL 5IFHH 1INDH 2VH5H 1T20B 2ZOLA 3OKOA 1TIUA 3O8XB 2OZ4A 3T1FB 3ZE2E 4HDIA 2VLKA 3DRQA 2HLAA 5IROA 2BSED 4CVZB 2NNAB 3IDIB 3OTTA 3I2CL 3IXTA 2MJWA 1FO0B 4XMKH 4YHLL 3KXFE 4RX4D 3B5HA 3TA3A 4WW1B 2NW2A 4FQJL 1CTNA 2BOBB 1A7PH 2UV3A 5C0FB 1TQBB 1KCSH 4DOHB 3KPQA 2FH6A 1QKZL 3FFCA 4NOFA 2UUDK 3HR6A 1CGXA 3VD3A 2AABL 3P4OB 2HTKD 5HGDA 3IU4L 1SJEA 1TVHB 4TQEH 5HHVL 4X0KA 5C09A 2JIXA 3QEUB 4OZIA 5JW4M 1GGUA 2ICWI 3SE3A 4GSDH 5FHBH 5TDPB 3SDDB 5ADPH 4L8CA 1N64H 4APQD 4KI5C 4I0PC 2FBOJ 3IXAB 2FX8H 1ADQA 4LBEB 3O2VL 2HFGL 3MUZ1 2VDOH 5C0DA 3STBA 1AO7D 1I1YB 3QUYA 1C08A 4WCYH 4PJ5B 5TDOA 1I9IL 2BDNH 5GJSH 5E2WH 1FFPB 2E8YA 2BNQB 2DKSA 2HFFA 1ZHBA 2VZ3A 3Q6GH 3KYNB 3VFOA 1IZKA 3K1DA 1D3CA 4LSQL 4XRCA 1F58L 4RA3A 3VXRE 4KRNA 5DJZB 4HMCA 5E4IA 2NY2C 2VL4A 5E2UL 1T04A 4XPAL 1A3RH 3B5GA 1X5YA 3QG7L 4WEBL 2XWTA 4K94L 4M7KL 4JFQA 3PL6A 2ZCKH 5FYKU 3VFPA 4RAUB 5I74C 1Q72H 1BOGA 4FTVA 5IWLA 3GSQB 5ID1B 1K8DB 1KTDB 3CD4A 5DD0L 1FZJA 1ZVYA 3NTCL 2PO6D 5IW6B 1RI8A 4U1LB 1K9TA 1LDPH 4PGCB 5GPRA 4JFYB 2ARWA 3TC9A 4KI5F 1FVDB 1R3KA 4KXZH 2IH3A 5E6ID 1TZIA 1II4E 1KCKA 1F4XL 4MWFB 4NRXB 4Y5VA 4MJ6B 5M94B 3AREA 3WS6A 1VFAB 4Y7MA 4ZS7H 1DEEA 2OI9C 3QZWG 1TCRB 4V1DA 1EHNA 3O0RH 2WNGA 3EUUA 3QEQD 3E8UH 1EMTL 4MD5B 2UWEB 1BZ9B 2FCBA 4NKOA 4XCEA 3CX5K 1JGLH 3RWHA 3ZTJH 2HJLA 1AI1H 3WJJA 3MJ8A 1NUGA 2D03L 2D4FA 3CVIL 4QOKA 1D9KB 5KVEL 4JFHD 3EW3B 4OFIA 4ETQA 4GBXD 1IAKA 4R96B 3GJFA 4F9PC 4LLAA 4R0LC 4ONHB 3QIUB 3QQ4A 5DURB 3CDFA 1P1ZB 1YEEH 1KB5A 1A6UH 2R1YA 4MJ4A 3QA3B 1KFAL 2PW2A 2Y5EA 2FIRT 5CJXC 1F6LL 3VXUE 1SEQH 4LP5A 3T3MF 1VGEH 3VH8B 1D7FA 2VMFA 1J8HE 3GM0A 1S7UA 4JHAL 5FO9A 4W6WB 5DVNA 1XR8B 1AR2A 3NMEA 4XWGL 3OWEA 4U3XA 1CLYH 4AMKL 4C59B 2B0SL 5BRZB 1T2XA 3F7QA 4JCMA 3TBSA 5ESQB 2OR9H 2KL6A 1KLGB 5CZKA 3RQ3A 1BJ1H 5I6XC 2DKUA 3MRLA 4WI6A 3QDGE 5F7WC 3VE0A 3O41A 2V17L 1PYWA 2F8OA 4LCYA 4LFHG 5E8EB 2CIKB 4QHLA 3OSKA 4IRSA 3O3AA 4OLUL 1NCCL 2KPNA 4R90H 3ARDA 1ONQA 4O2CA 3CXDL 1W0VB 5K9KB 3BP7A 1FNGA 1K5NB 1AD0A 5D1XC 4QNPE 2GIYA 2ADGA 1I1AC 3BPCB 5JMOC 1YNLH 4M1DL 3Q5YA 3IDXL 5I66B 3QUZB 4JGMA 4X6CA 5D2LF 5LAXA 4HUKB 5F93C 1BIIB 1WC7B 3FT3A 4XBEH 5F6IC 2BERA 2H9GB 4S0SD 3UBXI 1Q9WB 4L8SC 4OQTL 1V3LA 25C8L 2VNCA 4RNRB 1XT5A 2I25N 3TF7C 1KF9B 1RIUL 3FRPG 5KSAC 3RY4A 1LO5B 5JQHC 2E8ZA 4X7CC 2BNUA 1QFUL 2VLMD 5D6CB 4RSVA 1AQKH 1J9CT 3KDMB 2O61A 4ACPA 1U3HA 4YPGB 3ULVH 2W0LA 3WD5H 4WI5A 1NDGA 2W9EL 5JO5B 3RIAK 3QULB 1TQCB 1KCRH 3MCLH 5SWZB 5DHVA 2G2RA 4ZFGH 5HYEA 1V05A 3EBAA 1L0QA 5I76B 3U6RA 1TENA 4UAOC 5DMYA 3H9SB 5E0QA 1G7PA 3MFGB 3ORJA 3S96A 1JPSL 5HHPA 4TTDD 4FG6C 2Q7YA 2XZZA 2ESVE 3ARSA 4YXKH 4PBVC 1E0OB 2RHEA 1IKFL 4X6FA 2IPKB 4KVNH 4D0BA 5I1IH 3WEXA 3O6KL 4O4YL 1NGPL 5DLMH 1D5ZA 1FYTD 3RKDD 3RU8H 1I8IB 3LHPL 4FQ2L 1XCTB 2W0KA 1RU9H 2P24B 4OV5B 4YWGL 4R4FL 1BD2E 3GSUA 1NANI 3UTSA 3KPSD 1O7SA 4JY5L 1T3FB 4PRAB 4L8BB 4QHKI 2AXFB 3SGKA 1JYNA 4P9MH 4IRJC 2NMSA 3HCVB 4YBLC 2YK1H 4JKPL 4FQIH 2HJKA 3B9DA 3C60C 1BIHA 4O00A 4NNYB 3ULSB 2AJVH 5HHNB 2BVPB 3BJLA 4OCXH 3I85A 5FO7B 3DGGA 3ARRA 3BSZH 4AIZB 4MXWL 3V4VH 4XXCA 5SWQA 3SKUD 1BAFH 5ETUB 4WHDA 1CDBA 5GGTL 3A6BH 5GZNC 3VXNA 4KZEH 3BZ4A 3GMQA 4K2UL 4MA1B 1BECA 1T5WB 3O2DA 4G6AC 4MXQD 4LIQL 5ICZA 1MNUH 3WL9B 5JXED 3U0PB 2I24N 5GGUB 4M48L 1FN4B 3DMMC 5GGRY 4S0TD 3WHE0 1F4WL 1ZEAL 4S1DD 5L2KE 3MBED 2HN7B 5GS2H 1CFVL 4X8XA 1GOFA 1KENL 4JN2A 3QXDA 4KTDL 1BFVL 2YD6A 3OJ2C 3PJSA 1OARL 4G6MH 1AC0A 5BZWA 1GGIL 4KZDH 3JTSA 3JTTB 2R1WB 3KPNA 3U30B 4U1JB 4UV4L 1TLKA 1D6EA 4NHUB 2CK0H 2W92A 4RX4A 4OLWH 4JPIB 3EOBB 1FZOA 3GMMB 3I50L 1T4KB 3EYQD 3QYCA 4LKXA 1MLCA 5ALCL 4U6XA 4HJJH 1ES0B 2FZ3A 4CJ0A 1DN0B 5MP6L 4JFOA 1BX2A 3FFDA 5EU5A 3QG6A 1PKQA 3GBMH 1XCQA 3EZ8A 4APQA 1H3WM 4BQ6A 5I18H 3FMGL 3JSSA 4C54A 2DQJH 3UCRA 4BZ1L 2CLVA 3C9NB 3W11D 4RGMB 5TE4H 4XT1C 1OGTB 1AO7A 2C4FT 5FYLD 3OHXA 2HH0H 1HH6B 2Q8AH 2HTLC 4PGBA 4CADB 3KYOA 3PGFL 1YY8A 1UC6A 1YMMD 1MCFA 1J7VR 4O2FB 5I8CB 3G6DL 4Q6IB 4KJPC 3WS3B 2NY3C 2AEPL 4UOW1 5D7LD 3W39B 4XP5L 4GMTH 3KG5A 4ONFH 4XHJC 2IAMB 4FFWC 3DSNA 2DD8L 1BWMA 1LVEA 2EDYA 3DOSA 1RZJC 4KK8C 1EEQA 4I0CC 4EKXA 2EDLA 3LEVH 5HGGS 4K55A 1UM5L 4HFWA 5IQ7L 4QRSA 4DAGL 3KJ6L 4O5LL 5I8OL 4AEHH 4NO0D 4RIRA 2H2PC 2CDFA 5C2BH 3L9RA 5GRUL 5CILH 1WBYA 4X99A 2OP4H 2PO6A 5I1CH 3QI9B 1TJIL 4RMVA 4H8WC 3IRPX 2UY6A 5E6IA 1LO0H 1UH2A 1RJCA 3SDAB 3JVGC 4PLOB 2L7JA 4PRNB 3HZMB 2F54B 1YQVL 5J11B 1NAMA 2FIKA 5FUZL 1QOKA 4NO2B 2JJUA 4PRID 3WE6A 5JDSA 3B9EA 3QEQA 5KANG 4DTGH 8FABA 5HDQH 1ZLWH 4KU1A 2DM3A 1LEKB 5EO0B 4JREC 2OBGA 5JQ6L 2CKBH 3Q6FB 2MOVA 1YN6A 4GBXA 1VFOA 3BP5B 1RZJH 5GGQL 5E99H 3RGHA 1R3IL 5FHAH 2WINB 3VFTB 3O9WD 1CDJA 3V0VB 1T7WA 5EBMB 2PF6A 5D72L 2IMMA 3NOIA 1X5KA 4J3SA 1IZJA 4O58L 3MA9L 2GFBA 3C5ZA 3BKYL 4MNHB 2D3VA 2DQCL 3FHAA 5E00A 3Q3GB 4JFEB 4HK3N 1P7QD 3VXUB 2VLJE 1U8NA 2IQ9L 4NQEB 3MLWH 3WIFB 3PWJB 5B4MC 2BY3A 1GHFH 2PN5A 2F74B 4JG0H 4WWKD 3MRDB 4Z7UB 4H8WH 1U8JA 5D6DC 3VFVA 1D6VL 1WF5A 2K9UA 3R8QA 5F7FA 1S7TA 4QLRA 4LLQB 3H9YA 4MCZA 5ICYB 3U9UA 3OL2A 5I75C 3WLBA 1JHKL 1UACH 1ZLVK 3LQAL 3FQRA 3ZSSA 2IWGA 4OCSL 3BYTA 4OLXL 4DGIL 4TSAL 2VDMH 1T1ZA 8CGTA 5CEZH 3PV7A 2Z31C 3SCMC 3RDTB 4J2XA 1KELH 3EJZC 3FCTA 4MA3B 4YHPA 5IHBA 2DQEH 2NZIA 3RWCA 1QSFE 3O8XC 4PYGA 3X3FH 5CAYB 1EAPB 1XIWB 1U3JA 3O2WH 3GIVB 1AGEA 3FAXA 4RCAA 4RMTA 3TVMC 4P3DA 1LK3H 3WCYA 5EO9B 1NKOA 2ZG3A 3BESR 2Y07L 3AU1B 4F58H 2XA8H 5KZCD 2ITDB 1TQBC 1NH6A 1KG0A 3L3OB 1CVSC 5J06A 1KCVL 2Z4QA 2P42B 3GKWL 2OSLB 3F7YA 1MVUB 2FBJH 1CD1B 1RD6A 2MSPA 3UTPD 3VFGL 43CAB 3H0TB 3KYMB 3SDDC 1EHLH 3VCLB 4LLYA 1RUQH 4M9PA 5J1SC 3S5LA 1ND0A 1HYSC 4XNXH 3BQUA 3LH2L 3AXLA 5EPMB 1YNTA 3D2UB 3LS5L 4RMQA 1BLNA 3L5IA 1A7OL 2EXWD 5E5MA 5KVDL 1LWRA 3MREB 2LE9A 1BQSA 4GAYB 1U8KB 3CDCA 2ESVB 4HQQH 2VLKE 4YZFF 1B0RA 3LZFL 4ZNEA 3HZYB 1CFNB 5C0AB 4WI3A 1IE5A 2NY7L 3U7YH 3HE6D 4PV8A 5DXWA 3RTQD 4PJ7B 3OJVC 1CQKA 2IFGA 1FO0H 2YD7A 4OBSA 5CEYA 4U1SA 3T0BA 4ORZC 3FFCE 3RNKA 4NN7C 1IC7L 4MQXD 5DJ2A 4P5TA 1I85C 2FJFB 3KPSA 1BD2B 2PTTA 4NKMA 5C09E 4OZIE 3IFLL 2BSSA 3CAFA 3N85L 1P9MA 3MJ9H 2VDPL 1LO3L 3S4SA 1S9XB 2YUVA 3EYUH 5E1HB 1W72A 3UZEA 1AGBB 4M9OA 4KKBC 5J89A 3MRPA 3U83A 3RWGB 1IVLA 2PXYB 4XMPH 5IB5B 1CFSA 2R0KL 1RIVH 3MRBA 2HMID 4NO3B 4MD0A 1I75A 1YMHA 5I71C 2MPAH 5CKAA 1HN1A 2EYRB 1GCFA 3QJFB 3MGOB 4JRXB 2X5PA 5EWIH 2GQHA 4GXUN 1FGNH 1S7QA 3PWUA 4OZHA 1PVHA 2H6PB 4LGSB 5GS0L 5FUOL 5JIPA 1MREL 3ZDZF 5JXEA 5EC2B 2BSTA 4M62L 1D9KC 5ABDE 1IGCL 1ZK9A 1JGVH 3T0EC 1MJ7H 3MC0A 3P9LA 4Z78A 1MFDH 4X6DA 1NGQH 1HHKB 4M4RA 3MBEA 1IEAA 1A5FL 4CUCA 2GTZB 4M8VA 3QIUC 3ECBA 1KEGH 1P2CA 4NZUH 3IFPA 1KTKE 4FTVE 3BAEL 1UWXH 3MYJA 5IKCB 1EO7A 1MAML 4XZUB 4BM7A 5BVPH 3B9KD 4JAMB 4JQXC 3EJYC 2AJUH 3KYKH 4N5UA 3V7MA 2HJFB 1O5DT 4Y2OA 3FT4B 4F9LA 1DSFL 3UYPA 3K2MC 2NXYD 3QH3A 1KN2H 2GY5A 1KUMA 3IETB 3H3BC 5DO2D 1MOEA 4OBRA 2DBJA 1BFTA 1CDHA 5DK2B 1TJHH 3FN0L 1N5YH 4NCDA 2LABA 5DRWB 4NNXB 1F3JA 3TFKD 4AEIL 3DURA 4V1DE 4HK3J 1H8OA 3NFSH 3C2AL 4GW5B 4LF3A 2UWEF 3WUWA 4KKCC 3AAZB 4UUJB 3GDBA 3OR7B 5C0RH 3SQOL 1BMGA 3BH8A 4YDLB 2AKRB 4QOKE 5IVXA 1RULH 4J12A 4GS7C 3MQIA 3FL7A 4P57A 1J10A 3ZDZE 1YMMA 4N1HB 2OJZL 3ROOA 1N6QL 5BS0B 3RY6A 1DQML 3SE9L 4ZPVA 2YPLD 1P7KA 4PJ8B 4PJAA 5CEXB 1U93A 5D7LA 2CR6A 5BMFH 2QHRH 2DWDA 3R1GL 5AUMB 2GY7B 5EZLB 1DQLH 2AVGA 1OAQL 3HMWH 4R8WL 2Z8WC 4R2GC 4JCLA 3QUZC 4YJZL 1NCAH 2ZOKA 3G6AA 1MFAL 1AP2A 2V9RA 3UROR 4KV5F 2R2BA 4PG2A 2HT2C 4G3YH 4OFVA 1IEHA 1EEZA 2ZJSH 1CDIA 5EO1A 1FNSH 2HT4C 3BMWA 4MDIA 2FD6H 4XNYH 4S1RH 4NO0A 4XNUH 4AYFA 4YDKL 3D9AH 4TSCL 3HC4L 4OAWB 2HG5B 4ZFZB 2HRLA 3EFDH 3FONA 2I9LA 1QSED 1J0ZA 4RFNB 5GS0D 4WI8A 4MAYB 4Q9QH 2GTWA 3VD9A 1T89C 3ZKMD 3RL2A 1I7ZA 1SVCP 3CK0H 3DO7A 1JYXA 4FQXB 5DTFA 4QHNA 4WFED 5EUKA 3X14B 1H3GA 3QCTH 1WZ1H 4MX7A 4QHUA 4PRIA 5LBSL 1YYLL 3T0WA 1RURL 1S7SA 3ZKQD 4M6ML 1JPST 3QZWB 4WIQA 1LILA 1HXYA 5IMOB 2O5XH 5F7HA 4JY4A 1U8MB 1PQZA 2W9LA 3MLYL 1CXLA 2Q6WA 1R6VA 4PREA 2XG5A 3DX6A 4X6CE 1VSCA 1OTSD 3KLAA 4FZEL 5FB8A 1UENA 5AWNL 4X9FA 4MLSA 3O9WA 2EH8H 2A6IA 1NFKA 3TYGL 1CGSH 3MX0A 4KV5E 3T65B 1N5AB 1BZ7B 3LEYL 1KTRL 4KY1L 1S9VB 3L5XH 2ZP0T 1P5VA 4LSSL 1AE6H 4GRWF 3SDCC 1P7QA 5DZLA 4E42A 5EUOA 1XFPA 4LQFH 3ULUH 4LPCA 1DR9A 1T5XA 1UM4H 5DUPH 4MLIA 1J0IA 4WWKA 3RX7A 2ZSVA 1ULVA 4I18C 5ERWA 3HHRB 5DRNB 3TH2T 5KTEH 5ESVB 1ORSB 1YUHA 4YUEL 2MHAA 35C8H 4FXKB 1D5BB 4WHYH 5FYJE 2BVTA 1C5DB 2XZCL 2XNAA 3VFMB 3SKMB 4NJ9H 3QQ3B 4ODVL 6FABH 4H88H 2R56L 4XC3H 3H9HA 5C9JA 4WWID 4L8DA 2W1NA 4LSTH 3IDGB 2IBZX 3LPWA 4JZNB 2LTQC 1RFDH 4NUJB 4OGAC 4JVPA 2YKLH 5EZJA 1M7IB 4U6VH 3O3BB 4YHNB 1OP3H 3F12B 3V7AE 5L8JB 4LLMB 3UTSE 4KQ4H 3D0VB 3MACH 4WUUB 5MEOB 2OTUB 4L4TD 3T08A 1GSMA 1IKNC 4Z7NF 3S4SG 1R3LB 5HD8D 5DFVC 5EIIB 4BSVA 4ODUA 3MNZA 4NKIH 3S3PA 3HNSH 3UPAA 5AEAA 4YLQT 4ZXBC 4MJ5A 5C7XH 4O2EA 2YD3A 1YNKL 1ZMYA 1HNFA 3OKDA 1XF4A 2M8XA 5T1LB 2F53D 4F37F 5AAMA 2W9DH 5DMGC 4N0UA 4XAWL 3U4AA 3O11A 1NEUA 5LCVH 2C4FU 5D5MF 3RHWF 3S88L 5JHLH 5LQBH 2AXGA 2ZSWB 5CFHA 3VU2A 3DX9A 2ZUTA 1M7DA 1NKRA 1BM3H 4HKZB 3I02A 1QG3A 3OJDB 5IUSA 4POYA 5BJTA 4DUXA 4YX2H 1AKJB 4BH7A 4PJ9B 1QFWH 4U6HB 1UKSA 4OJFH 1GC1L 1GPOH 1A6VL 3OPZL 1TFHA 1WEJH 2XICA 1X5HA 5CINL 1PZUB 1YEIH 1MCPH 2ZOLB 2X4NA 1N0LA 3L1OH 2VLKB 1KJMA 1QVOA 1IBGL 4GG6F 1N59A 2NY1D 4JO4L 3HE6A 2D31B 3RTQA 1A0QL 3ARQA 2WANA 4MMZC 3H7BA 1OQXA 4KKAC 3PWVB 1F5WA 3TA3B 1ZGLA 5IT2H 2NW2B 1AGDA 3DO3A 3KPQB 2WUCL 1T22B 1MPAL 2JE8A 5TE6L 1OT1A 4FFYH 1PKQE 1ZXQA 5F6HJ 5GHWL 4HX1B 3KLSA 3PDOA 4EI6B 5B3NA 1RUML 2DLIA 3LDBB 3QI9C 4GFTB 4KRPC 5IESH 2MKLC 1A2YA 1KIUA 4JFZL 5MI0B 3LV3B 4JO3H 3OKNA 2DBLL 1AO7E 1QNZH 5IV2A 2V2TB 4KVCL 4PBWD 5B21A 2ITCB 4PY8J 4ZD3H 3QUYB 1C08B 3FB8A 2VUOA 5TDOB 3TIEB 1NUFA 4X9IA 4IIQB 5C0IB 2LV4A 2HFFB 1WWBX 3I2CH 1U58B 3W81A 5E94B 4YHLH 4K94C 3VFOB 5GS1A 4TULL 3BD4A 4FQJH 4XRCB 4PP1D 4XCYA 2VDQL 3SDXA 3QNZA 2BSRB 1I3RB 4HD9A 4NQSB 2QQNL 5I1JL 4LPUA 4MJID 1T04B 1UVQA 2AABH 3QFJB 1BOYA 2Z91B 3HE7D 1E27A 2BVOB 5HHVH 3AVEA 4B53A 5FOBB 1FRGL 2YN3A 3MRFB 4ZYKA 4PJFA 3VXPA 4J8RA 4YE4L 1LK2A 5C0CD 3VFPB 3BO8B 2QADB 4QY8B 1C5CH 3B9KA 1R3JA 1F02I 5F7KC 5I1HL 3GB7B 3O2VH 3GMRA 1CDYA 4ZTOL 3OX8A 4L9LC 1JV5B 1S78D 1R3KB 3L3JA 4U7MA 1T1YB 1I9IH 1UXWB 3CIQA 1B90A 3KPLA 1HSAA 4Z7OE 2ATPB 4Y5VB 5I1DA 4X6BA 2GW5A 1AGFA 1DEEB 1I3GL 4HIEB 4V1DB 5DJYA 1EGJL 2IF7A 3TPKA 3QEQE 1EFXB 1F58H 1JN6B 2BCKA 4IJ3B 2X7LA 2AAVA 3OGCA 4JZJC 4Q74A 5F1IB 3VXQA 3IFNL 2Q86B 3QG7H 4JFHE 4P5MA 2J6EH 3IS1X 4QOKB 3D85D 4HKJA 4K94H 4M7KH 4PJCA 4WDIA 5KW9L 4X7FC 4G6FB 5D7IF 4C56D 4ETQB 3M07A 4GKZB 4Z7VA 3BKCL 1T83A 5I0DA 3GJFB 2YPLA 3RFZC 1NBVL 4QRRB 3BJ91 4TUJA 4OTXL 3NTCH 5IBTL 5FGSA 4NOBA 4ZO9A 2IADA 3IGAB 2YA2A 3VXSB 1OB1A 4Y2DD 2G5BB 3T0AA 4BH8A 1EAJA 3FAWA 1F4XH 3OJMB 5JOPE 4IBLT 3IDJA 5CGYD 1J1PL 4KQ3L 1S7UB 3D3VD 5FO9B 5IEHB 3IDYB 4KDTC 4TNWK 3BIAX 4PLKD 4KHXL 2VWEC 1EMTH 1HK6A 3OKEA 3ALXA 3D39D 3ARGD 3TBSB 1QSEA 4NBYB 1Z3GL 4RDQG 3I75A 2C4XA 5E8NA 1I9JL 3IU3B 4O02L 3ZHKA 5KVEH 2VN7A 3TNMB 2P5EB 4TNVK 4LCYB 1RK0B 2Z93A 1JZ5A 4MYWB 4HJGA 5LXGH 4IS6A 1KXQE 2ICES 1FJ1A 5DRXA 5BW7A 2BC4B 4YHYB 4X4MA 3O3AB 4PD4J 4HH9A 4IMKA 1IJ9A 1KFAH 4M6NL 4D0DB 3BXNB 4KROD 3HTLX 4MXVF 3ZKNC 1ONQB 4O2CB 3QIWD 3BP7B 4XPBL 3MOBL 1MCNA 4WNQB 2HKHL 3BI9X 5DFWH 3VWKC 1BVKB 4JFXA 3MLTB 4FQLL 4KUCD 3GMNB 2GITA 1CN4A 5FFLA 1DUZB 1RUPL 5LAXB 1I9RL 3FT3B 4XWGH 1FIEA 5C92A 4HC1A 4PJIB 2A6JB 1OAXL 4AMKH 1F8TL 5JHDD 3ISWA 2B0SH 2CJUH 1FYHB 3BD5A 5HDOA 1U2HA 1X5AA 4G6JL 2D0FA 4XPHL 3VXME 2ZCLL 2VLME 5T5FL 3GMLA 2EH7L 4O9HL 2PNDA 3RZWA 2O61B 1U3HB 3QUML 2PXYC 2V17H 2APBA 3ZE1F 3EHBC 4Y1AA 4XVSL 3ZE0E 3MLSL 5DHVB 9CGTA 3GMOA 2NY6B 4OLUH 5KSUA 3MRKA 1DBBL 3U6RB 1T6WA 1UJ3C 4GKNA 1QSVA 3S96B 2FRGP 1Y6MR 3HFML 2Q7YB 3CXDH 4EN3B 3BN3B 2IALB 2EICA 2JK5B 3BKMH 3NAAL 3VG9B 4LNRA 4ZNEE 4EQ3A 1NGWA 4HKXB 4XBPA 5CUSL 1QPXA 4WO4D 1AGCA 3P77A 2CSPA 4H1LA 4PJ7F 3HPJA 1WFTA 2QQKL 4OQTH 5L6YH 5IEKB 1D5ZB 1NGZA 3BN9C 2J5LC 4FXLA 2VE6B 4RISL 5FK9B 4HUVA 1EUUA 1EBAA 4KPHL 1AC6A 3KPSE 1S9WA 1T66D 5DRZA 5EC1A 3GSUB 1NMBL 1DDHB 3UTSB 5J13B 4L4TA 1QFUH 2Y36L 3L7EA 2AQ2A 4OKDA 4ZOEA 5KSVA 4XTRD 4AM0A 1F13A 4EZMA 4UTBL 2W9EH 4QHMB 3RI5F 3PQYB 2VXSL 1CGUA 5SWSD 2XYCA 4UB0H 1A6AA 3DI3B 3UMTA 1EO8L 3MR9A 5BOPA 5EU3B 5I17A 2X4UA 1JPSH 3HZVA 2F53A 3J8F7 1HILA 5H94A 4U31A 1VKXA 5D7JD 4UIMA 4OCYL 3NZHL 1TZHA 4OZHE 1IKFH 4HJ0C 4LVOB 3IAPA 5IVXF 1PG7H 3WHXB 3MMEA 4XNQA 4Q9RL 4W4OC 3B6SA 1NGPH 3ARBD 4N9GB 1ERNA 1G7HA 4FQ2H 3FZUD 4R4FH 4YWGH 3T0VA 3LKRB 1WAAA 4ZSOA 4X6DE 5DHYA 4IHOA 3UTQA 3O81A 1CDUA 1BQHG 4JY5H 5CMAB 1CU4L 4D0CB 4ZMAT 1Q9LA 3QXDB 4WU7A 2D7TL 3PJSB 3KJ4B 1VEMA 4BJLA 4JKPH 1KIQA 4QRPD 2AJSL 2GSGB 3JTSB 4M1GL 3IT8D 5IR1B 1SYSB 5EH1A 3MA7A 2X10A 2C1PB 1ZLUH 2VLLB 4MSWB 3T1WA 3PXHA 1EBPA 1FZOB 1N7MH 1JL8A 4LKXB 5GGTH 3RBGA 2UZYB 3MRRB 4FNLL 4KMTL 3QCVH 4LLVA 2PUQT 3PE9A 4JFOB 5JW5B 5CHNA 1A02N 4LIQH 1XCQB 2R2CA 4CVXB 4K3DH 3FN9A 2F9BT 1CD9B 3B9VA 3HKFA 2DQFA 4MAYC 5HYSA 3BGMB 1DQTA 3MRQA 4KJQD 1AY1H 3GSNA 4M48H 5A16A 2AK4B 4YBQC 2H41A 2VITA 1F4WH 1ZEAH 5IVXE 2CLRB 3HB3C 5JMRA 1CFVH 2JB6B 2KQMA 4NCC1 1KENH 1YMME 4PGBB 4KTDH 1EJ6A 2B1HL 1YY8B 1OARH 5EOTB 1RJYB 5D96C 1X9QA 12E8H 4PJAE 4X7TA 1GGIH 5D7LE 5BOZG 1KJVB 2IFFH 3V5DA 3MV7D 4DW2L 4WEUD 5CJQL 5CJOL 4W81A 2YEZB 1MCLA 2XG4A 4ORGA 2NR6C 4OSUH 3EDEA 2WBKA 2AJXL 3U36A 4OF8A 3I50H 5BO1L 3C5JB 4LSVL 2NYYD 4L4VD 4MJIA 1SM3L 4HWEL 3HE7A 1HQRA 4Z77B 2EYTA 2YD8A 5MP6H 3GMPA 4HFWB 4LHUG 4XP9H 1HI6A 1H5BB 3RIAF 4IMLA 3VWJD 5C0CA 1MFBL 4P59L 5FO8A 3VD4A 1VFUA 5DWUL 1HSBA 3I3BA 3DJ9A 4LCIL 5T1KD 4NYLA 4BZ1H 4BKLB 1WBYB 1RJZB 4X99B 1G7MB 2PO6B 1CFTB 1GOGA 4HZAA 4Y5XB 3A0OA 3PGFH 3C6LD 3RGVA 3G6DH 5MEQA 2BNRD 2CPCA 3DX7A 1A6ZA 1YJDL 2P8PB 4ALAL 2AEPH 2FIKB 2WUBL 4LOUC 4PRIE 1JRHI 1T0MA 1Q9KA 4XP5H 1NFIA 3VD7A 1MHCB 4DN3H 3RA7L 5BVJA 1I7UA 2DD8H 4ZUUB 1J86A 3D87B 2BJML 1UCBH 3CVHL 8FABB 4ISVA 5IOPB 3L3GB 4B5EA 3LVEA 1TPXB 4OIIL 1CT8A 2EXYD 1QRKA 1X6LA 3UO1L 4TVSa 3D85A 4R97B 4C56A 5IQ7H 4DAGH 5I8OH 3KJ6H 4O5LH 1AXSB 2P8LA 1UADC 2EDWA 3VFWA 2ILLA 4KK9D 2JLLA 3IKCA 2M26A 4N0CC 4PGDB 5ACLA 4W6YB 5DJDA 3CX5J 4FFVD 3TIDA 3V95A 2A6DA 4AH2A 5B8CA 1TJIH 2GFBB 1MIEL 3C5ZB 1A6WL 1NFDA 1UEYA 3WUZA 1S5IL 1OAKL 5MEPB 4Y2DA 4YDVA 3N1FC 4K3HA 5EUOE 2VUYA 43C9A 1U8NB 1YQVH 2XXCB 5B3JF 3PG2A 3LMJH 5FUZH 3D3VA 3CLFL 4PGJA 3LQAC 3H9ZA 2Y7QA 5L9DL 3WN5A 2BK8A 1DLFL 4NN5B 1SYVA 2FR4B 3ZDYF 4NQTA 1S7TB 4KXZI 5IW3A 1DCLA 3VXTB 3FO9A 3D39A 3ARGA 3RUGA 4H1LG 5JQ6H 5IB4A 2P44B 3TT1L 3MLUL 3U46A 5IB2A 5GGQH 1T1ZB 4BQ8A 4U05A 4TVPD 4RZCA 4PJ9C 4RGOL 3TGXA 4YHPB 3AFLA 1AR1D 1FH5L 4O58H 3DUSA 4DGYL 3NFNB 1IM3A 3BKYH 2AJZA 2DQCH 2F15A 1GGTA 3QIWA 5A2JH 4JKKA 4WGWB 2IQ9H 4MNGB 5CCKL 4ZO6A 1C16B 1UG9A 5A2KH 1P4IL 1NANH 3PNWB 1TNMA 2R23A 2IC2A 3AY4A 2X4SA 1IGTA 3QXAA 1JWUB 3P73B 5JHDA 1OAYL 4N0UE 3O4LB 4S1SH 3UTPE 5E2VL 1JHKH 1KPUB 3LQAH 5B3JE 6CGTA 4OCSH 2WWMC 1MQ8A 4JQVA 3VXMB 3LDBC 4OLXH 2R9HC 2EDOA 4DGIH 4TSAH 2YUXA 3HR5B 3UEZA 1Z5LA 2XFXB 3C5SB 1ND0B 5HY9A 3VFUA 5MI0C 1OTTD 3BQUB 5KAQG 3AXLB 1ZT7B 1YNTB 5D4QA 1OL0A 5JLZB 3R06A 4DJMA 1BLNB 3TWCL 2J8UB 3NA9L 4IIQC 4G7VL 2ZKHL 5EN2B 1VEOA 2G75B 3SDXF 3M8OL 4LEOB 5DJAA 2Y07H 2AEQL 4RBPK 1FHGA 3X3GL 1B0RB 4WO4A 4U3CA 4M61A 5TH2A 4PJFF 4Y4HB 4EQ2A 4PV8B 3OXSA 1KCVH 4XX1G 5A3ID 3GKWH 3LSOA 5AD0A 2DIBA 5CEYB 3FB7A 1P4BL 4JM2D 4U1SB 1U9KA 4EUPG 3U48A 1IAOA 1TDQA 4GG8A 1P84K 3WFCL 3VFGH 3QBTB 5DJ2B 3JUYA 4P5TB 3KPSB 1VERA 5J6HB 4MNQD 4P49A 4NKMB 1JF1A 2CDGA 4GW1A 5C8JA 2NY0D 2BSSB 4DUWA 3UAJC 5BV7L 4JHWL 5HYSG 1LP9A 3BWAA 3MZGB 4M93B 3BDBA 5SWSA 2B8OT 3TBTA 4AY0A 4Z7WB 4ZUSA 3MRPB 2ZUXA 2J88L 1OP5H 2FSEB 5KVDH 4W68A 1LE5B 5T3ZD 4GRLD 4XVJL 4MD0B 4PGEA 1TETH 1YMHB 2XZQL 4HPOH 5D7JA 5F9WC 1HQ4A 1V5JA 3LZFH 3BEWA 2XT1B 4X7DC 5IGXH 4KWUA 3HMXA 4IJ3C 2DWEA 4O51B 1X44A 1G6RA 4PJCF 5C07D 3ARBA 1ED3A 1T7XA 4HS8L 1XGQA 1REIA 2UZXB 4GO6B 2MTPA 4TQEL 4NQCB 3TO2B 1DL7L 1FFOB 1JPFA 3SDXE 3QNYA 1HINL 4HIJB 1BFSA 1U8QA 2IMNA 1IC7H 5ADPL 4X6DB 5A2FA 4LKCB 1IEAB 1JRHL 3WNPA 3IFLH 4PJFE 2FX8L 4A6YA 4CVWA 4HCRH 1LO3H 3IFPB 3MO1A 1Z9SA 3MUGA 1A22B 1SMAA 4WCYL 4RGNC 3A6CL 4JM4L 4QRPA 4X4XA 3TN0A 3TZVC 1MCSA 3T2PA 2R0KH 2J1KA 3CX2A 4BFIA 4WHTA 5J1AB 5IHZA 3GO1H 3KAAA 2OYPA 5F7EL 3ZHLA 2BVEA 1XF3B 4HFUH 4HXAL 5MEND 2EIEA 4YPJA 5TFSH 4RRPG 4PFEA 3WNNA 4NQXA 5HJ3A 5B38A 5FUOH 2G5RA 1Z6JT 1A3RL 1MREH 3CUPB 3WFZA 2GJJA 5HVGB 5KSBA 4U1IA 4C57C 4M62H 1G9NL 3MUJA 1V8HA 1IGCH 1VFBA 1WT5C 2CGRL 2C3WA 5I1LA 4XWOC 3UYOD 1ZHKA 3BZEA 4IEFB 1MH5A 3P4MA 1DFBL 1A5FH 1FPTL 3LPGA 2X4OB 1ZVSA 2X1QA 4S11A 1Y0LA 5CSBA 5DF0A 4Z7VE 4UMGA 4P57B 1YMMB 3O6LL 2YZ8A 3BAEH 3IJYA 1WGOA 2YPLE 3K8LA 3NCYS 1MJJA 5CP3A 3MV7A 1U93B 3KPOA 4ZS6C 5FCUL 1A1MA 1INQB 3QISA 2EEDA 4QRTB 1FVCA 1YPZA 1H8SA 1TTFA 3G6AB 4L4VA 1S5HA 3INUH 3E8UL 2YPVH 3FN0H 2DMCA 1JGLL 2QV2A 1EEZB 5FKAA 4CDHA 4Y19B 1FZKA 4AEIH 2HAZA 1U8LA 4KK5D 3D0LA 1DANT 3T8XA 3VWJA 4NO0B 3WDIA 1MRDH 2HLFD 1KPRA 1I8LA 1UB5B 4LQ1A 3BVNA 5CIPH 3TESA 1C7SA 7CGTA 4NZTL 5T1KA 2Q76B 3SQOH 5JW3L 1QSEE 4ODHL 3TJHD 3L3DA 2I9LB 1MY5A 3TP4A 3SJVD 4E9LA 2BHZA 2GT9A 3P3YA 1LO2L 2VLRD 1RSFA 3C6LA 2NY6C 2OJZH 3QXUA 2BNRA 1NJ9A 4WFEE 3RL2B 1DQMH 1K2DB 3SE9H 3DO7B 2Z35A 4QHNB 4EN3C 4MX7B 4X4ME 2AXJA 4QHUB 1VGEL 4X8JA 4PRIB 3VG9C 1OAQH 4JKLA 4R8WH 1Q9OA 5F7DB 3QXTA 1MFAH 5E4EB 5DUBA 3CLEH 1FDLL 3BPOB 4QKXB 1CE6A 5KVGH 1KN4L 1H3PL 4PREB 4ZOBA 3KLAB 1MCEA 4YDKH 1HOCA 5E08L 4TSCH 4DQOH 3HC4H 3O9WB 2A6IB 3L3HA 5I73B 1OAUL 5HYIA 2DI8A 5D7SH 3REWB 2VABA 1BHGA 5C3LD 1U8PA 4PG9B 5KN5B 1MCDA 5F7NC 4YHKL 1P7QB 3P40A 5L2JA 2V6HA 3E6HA 2DQDH 4Y1AE 4E42B 5EUOB 4YAQB 1LE9B 2WZPD 2JJTC 3BWUC 3OXRB 3GHBL 2BFVL 3MODL 3FOLB 5LBSH 1YYLH 2ZSVB 3CVHB 4S1QH 5F1OB 2XZAH 1RURH 4M6MH 1F11B 4P2OC 4LVOC 4XNMA 2H26A 5F9OL 1YUHB 4XBEL 1INEL 1DE4B 4KI5D 4I0PD 3OAUL 3EYFB 3OAZH 1X4YA 2JB5L 2Z8VC 2ADFL 5TQ2L 2C3HA 1JTTA 5AWNH 5C9JB 5HHXL 4LRNL 5INCA 4HUUA 4UILL 3RWEA 1MFEH 2YRZA 3MCKA 5EZJB 3TYGH 1Q38A 3ULVL 2F58L 3WD5L 3LEYH 5ACMA 2X6MA 4HWBL 4KY1H 4JN1L 4NGHH 1BF8A 2VQUA 4L4TE 1J5OL 4UV7L 1K3ZA 4PB0L 1Q94A 1J0HA 5BCAA 3DROB 4IDJL 4BSVB 5F7YC 2NY2D 3N0PB 4OUUB 2GK0A 4JKWA 1LEIA 5JW4N 4EDXA 5ICXB 2J8HA 1D5IL 3LPFA 4BFBD 3U1SL 5E6ZA 4UQ3B 1FQ9C 2F53E 4ZPTA 1RHHA 4M7ZB 4U1MA 1YYML 5JW4Q 4YUEH 4L1HA 4Y5YB 2PYEB 4P2RB 5DQ9A 5DLML 3O11B 5F97E 1AXTL 5H37G 4ODVH 4R3SA 4ZFOA 4QWWC 5FA3B 4DGVL 4E5XA 3L3KB 1ZGLP 2ADIA 1GC1C 1M7DB 2DKMA 2NY4B 4PJBF 4CW1A 2O5ZL 4NO5B 3O2DH 1WAAE 1JNHB 2OJEB 3WO4C 4ZSOE 4KJYB 3X12A 1F90H 2YK1L 4FQIL 1SBSL 2YMXH 4GUPB 2AJVL 2V5TA 4OCXL 4RQQA 1K8IA 3BGFB 5D1ZB 2X4NB 4GAGL 4HXBL 1FLRL 1YEHL 3QNXA 4NKDB 1KJMB 1DN2A 3FO2A 2VKWA 3PWPA 4OCNC 5C3TA 2BMKA 5BXFB 5DD6A 3RTQB 4KZEL 4AEEA 1KT2A 3ARUA 3ZL4L 3H7BB 1ZGLB 4KKNA 4XX1E 4XAWH 4JM2A 1ETZA 4BFEA 3FKUS 2C7UA 1H5BC 5CBEA 3S88H 5CLTA 1ZLWK 1J05B 5ITFA 4AQOA 4L9DA 4MNQA 2QR0A 4PTUB 4F3FA 1K4CA 2Z0BA 1IRAY 3E3QE 3MLXL 4G8EA 5E8OA 3GHEL 4HWZB 1NMAL 1AH1A 3HC3L 3Q5OA 1HHIA 2OX5A 4Y5XC 2BY1A 2DF3A 5I1KL 4G9FB 5GSVB 3QUKA 1ZLSH 4NFDA 1TTGA 2BVYA 2VZTA 3PDGA 4GRLA 1I8MB 3QHZL 1GC1H 4KZDL 1A6VH 5E5UB 1G7QB 4WTWA 1FFNA 1P53A 1SY6L 1F3DJ 5CINH 2QSVA 5GGSB 3T3PE 2E7LC 1X4ZA 3RVXC 4Z5RB 2XKSA 1G7LA 3SO3B 1IBGH 3TCLA 1JNJA 4JO4H 5C07A 1A0QH 1SQ2N 1QPPA 3GSVA 3V52L 1B4RA 1TPXC 3DRTA 4JDVA 3S8WA 2HFEA 5GS1B 2AEWA 3MRGB 4WRLA 1FLTX 2NX5B 3QNZB 3VRIB 1MCRA 2WUCH 4FOMA 1MPAH 4MJIE 2KQNA 4E41D 5TE6H 4JY6B 5I18L 4NSKA 3VRJA 1L0XA 5GHWH 1RZKL 1BQHB 5LVEA 5C0CE 3MRJA 3VXPB 1JZ6A 1FSKB 1RUMH 4RFEB 1FG2A 3C5ZC 3QEGL 5D1XD 1JTPA 1C1EL 1I1AD 4HAGA 4K8RL 3I6GB 1QLFB 1R3JB 1EVUA 4MCYA 4JFZH 1CVRA 2WQRA 7FABH 2DBLH 1JGDA 5JPMA 4KVCH 2M2DA 3OAYK 1XZ0A 4ZAKA 3OX8B 2NXYB 1TNNA 1U8OB 4OCRL 1PAMA 4BSWA 1U91A 5MENA 1M6OA 4L3ED 4M1CC 4FQQA 3L5JA 3RUGF 3KPLB 5C2UB 2F8XC 4XP1L 1S9YA 3D69B 5KSAD 1HSAB 3C08L 4LVHB 4MVBC 2B39A 3LEVL 1ZOXA 1AGFB 5I8KL 2GK2A 5TGBA 1BJMA 4TULH 5HHQB 3WV0A 4KJWD 4I2XA 4DZBB 2VDQH 1U8HA 3ZTNL 3OGCB 2QQNH 3IDNA 4LMQI 1P69B 2P46B 3VXQB 1KJ2L 1L9NA 5CD3A 4P5MB 4C56E 1FRGH 1N8ZB 4WDIB 5DQJA 2XTJB 4FG6D 4F7PB 3DXAD 3FQWA 3DVIA 1H3UA 2X1XR 2AEIT 1RQ5A 3G5YA 4KUCF 2YPLB 1PLGL 4OKVA 5I1HH 1MF2H 4ZTOH 2EO9A 4XAKE 2Y5TA 4FQPA 1NFDE 2IADB 4R6UA 5GS2D 1CLOL 2ARJQ 3VRLE 2DLEA 2FJHA 3STZA 1WFNA 4Q58C 4HGMA 5HDQL 4MS8C 3D3VE 3IDJB 4ODWA 1WZMA 1I3GH 4PRDB 1EGJH 1FE8L 4FN0A 2CKBL 2ZUUA 4LHUB 2A6KA 1WICA 3RWDA 4IRJD 4JRYB 5FM4A 1IQDB 3ALPA 3RUGE 1QR1A 2NY5C 3IFNH 1NCDH 3C60D 5F9DC 3SJVA 3BQUC 2YS4A 3UPRA 5E8NB 5EBWA 2VLRA 1CXHA 5I1EL 1EPFA 2A74B 1N2RA 3BKCH 3MJ7A 3OKMB 2Z93B 3UTTB 4HJGB 5C0NC 1NBVH 4IS6B 1J1XL 1I3UA 5GZND 1A6TB 1FJ1B 4FXGB 4OTXH 3VDAA 1ZA6A 5J12C 5DRXB 5IBTH 2CUHA 1N6VA 3JXAA 4JG0L 5DEFB 3AM8C 2VYRE 4G7YL 1TXKA 1U0QA 3U4EA 2WBJC 3LKNA 4Y4HC 1C8PA 5J9PA 4HW6A 1ROWA 3DMMD 3GRWH 3VFSB 5ECJE 1KB9K 1J1PH 4FQHA 4OZGB 1WBZB 4PJEB 1ZAGA 1MLBA 2P7TA 2IGFL 3LQMA 2FECI 4UT9L 3QAZB 3ARYA 2WV3A 4KHXH 4P5TC 1S7XA 5JHDE 1KYOJ 1ZT4A 2YSSA 2D9CA 4WI4A 4ZOAA 1HKLH 4H5SA 1MCKA 5IVOA 1URLA 3HLAB 2W91A 1Z3GH 2A0LC 3DETC 2R2EA 1I9JH 4O02H 4M93C 3QPQC 5IMLB 2DQEL 3GMLB 2R8SL 4J3XA 4HLZG 5I1AA 3PHQB 5HGBA 3IB4A 1XGUA 1AFVL 4X6EA 2Q7NA 5CLWA 1AD9A 2NY5H 4Y1AB 1CXFA 2EDDA 3FB5A 1UWXK 4F58L 3IRZA 1IC1A 4M02A 1GIGL 2VDRH 2XRAL 2EZ0C 2AXHA 4M6NH 5DS8A 5K9OA 2CMRL 2VIRA 4XPBH 3MOBH 2XY2A 4I0PA 3MRMB 2HKHH 4LNRB 1IQWL 1TVBA 1YEJL 4WVRA 3NZ8A 1NGWB 4ZO7A 4XBPB 5IM7B 4FQLH 3FO1B 1A9BB 5FECA 1WFUA 1I9RH 4JG1L 4H1LB 2ADJB 3QQNA 3HPJB 2HTLD 4DK3A 4YR6A 1EHLL 3GZKA 4L29A 1F8TH 1OSZB 1NEZA 1RUQL 3QWQB 3RL1A 4DCQB 2IAND 1LNUB 3SKOA 4NDMA 4XNXL 5D1QB 2MQ3A 4JDTL 5DJ6A 2GJ6D 4XPHH 4KJPD 3DVGA 2NY3D 5EC1B 5C0BB 1U6AL 4CRPA 4L4TB 2EH7H 4O9HH 1G7IA 4XHJD 4Y4KC 5GRJL 4FFWD 2YD1A 5DI8B 5KSVB 1LP9E 2X4RA 4AM0B 4KK8D 2VO5A 1RJLA 5SWSE 3HG1B 1I7TA 1A6AB 1SJHA 3LRHA 4N8PA 3TPUA 4IOIA 3W9EA 3CZFA 2YD4A 4H26A 3EOAB 2G9HB 2F5AL 3HZVB 2F53B 4H0GA 5D71L 3HFMH 4ONOA 1JK8A 4HT1L 2VQ1A 1VKXB 2H2PD 3E6FA 4UIMB 3IJSA 1C7TA 4NRZB 3TBYA 3HA0A 2DIJA 1WCBA 4UU9B 2I9TB 2ATKA 3MMEB 5HYQA 2Y23A 1UWEL 2QQKH 4QT5A 4M3KB 1KIPB 2VDNL 3B2UC 2UYLA 4M7JL 3WIHL 1FL6A 3BHBA 4RISH 1ZE3C 4KPHH 3ES6A 5GGVY 4N9OB 4QF1A 3SKNB 1NMBH 3S34L 2OK0L 3BPLC 3S9DB 1CICB 3B3IB 2XN9B 1CI5A 1ZGLM 1K4DB 1NL0L 3QJHA 5IJVA 3MROB 3Q5TA 4QYOA 4UTBH 3D25A 3VMNA 5CEZD 1X7QA 1F97A 3ESVF 4QRPE 2J12B 2VXSH 1RZGB 5EBLB 3V2AR 1J0KA 1KIQB 2H32B 3K8MA 4TNWF 5DDHA 4AEFA 3U0WL 5CBAA 2Q8BL 5IG7A 2APWA 4XPGL 2DL2A 2QL1A 3MV8E 3EGSA 4ZDHB 4OCYH 1VENA 3NZHH 4F9PA 4R0LA 1L4IA 5JOFA 4G8FA 4EUPB 4K71B 4A2MA 4Q9RH 1MJ7L 1C12B 4JLRB 1FZMB 3JWOL 1MFDL 1WWAX 5CHNB 5CJXA 5KSBE 1JI2A 4XPFL 4IOFC 4GKSA 1KEGL 2DQFB 3LQZA 4NIKB 5DJ0A 5HYSB 5A16B 5B4MD 4Q2ZA 5I16A 5IIEA 3MV01 2WM0A 1HHJA 1BF2A 5ADOL 4K7PY 1UEMA 3CH1A 1FAIL 2D7TH 1E28B 2A73A 3LD8B 4PRBA 1MJUL 2Y1VA 4OF3A 3BOVA 5GGRB 2Y72A 1QSZA 2AJSH 2GCYB 3WFDH 3MV7E 4LCCC 5E4EC 1CBVL 4WFHD 4ORGB 3BPOC 1XR9B 4XC1L 3U36B 2NZ9C 4F33A 4WFGD 3VDCA 1YPZE 2Z31D 5B22A 3SCMD 2ZUQB 4L4VE 3EJZD 1EDQA 4E41A 4AENB 2OL3L 4FNLH 5DZOA 3MRHB 4MJIB 4KMTH 5I9QB 32C2B 5HGAB 5HHMB 4J1UB 1UZ6F 4JJ5A 2YD9A 1PGRB 2YRPA 3O8XD 2EYTB 1B2WL 3EZJB 5I73C 4NHCL 3GMPB 1U92A 3NCMA 4IMLB 1RULL 5C0CB 2BVQB 3TVMD 4YHIA 1DQQA 2FL5A 1KBGL 4NWTL 4WV1C 4XBGA 4JFFB 5D1XA 1JF6A 5DGRA 3LN9A 1I1AA 5INDB 3T4AA 1U36A 2Y4SA 4G42B 1X5IA 1PY4A 4MHHG 4OLZL 3MLRL 5GSRA 4UIKL 2QHRL 3HI5H 4L8SA 2FECL 5ANMA 2B1HH 3K80A 3LB6C 1LEGA 2BNRE 4L3EA 2YPKB 4YXLL 3RGVB 5DVKA 5EU4A 3UTZB 5MEQB 5KSAA 5ESAA 3DX7B 3LKQA 2AV1A 5BQ7B 1A6ZB 2PCPA 1IT9H 4DW2H 5CJQH 5CJOH 3SDDD 4B0MM 2ZJSL 3MUY1 3M17A 5F88A 3HUJB 3CSPA 1NBZB 1HYSD 4NUGH 3WO3B 4XNYL 1HKFA 5DVMA 5BO1H 4LSVH 4JHBA 2KKQA 4XNUL 2HVKA 4ISVB 3DARA 3SHSA 1SM3H 5CWSA 4PJ5D 4NC1C 4F37K 1G84A 2QHLA 1MFBH 5C0GB 2BNQD 4P59H 3RHWK 3CCHA 5DWUH 4EI5B 3G5ZB 3IKCB 2V9QA 1J88A 5DJDB 1A1OA 3BZFA 2AV7A 1UA6L 2CRZA 4U1KA 4AH2B 3QCTL 2YC1A 5HYJD 2CO7B 5DVOA 4Y2DB 4KH2A 4DVBA 43C9B 4YEFA 1BVLA 3IVKA 5I1GH 3SY0B 4D2NA 1YA5A 4Y5YC 4ALAH 4UDUB 4BZ2H 1BBJB 3ET9F 3PGCA 1MJ8L 4XPTL 5AYUH 1ZV5A 3CVHH 1TZGL 5IMKB 4IRJA 3DX8A 5L0QB 5T33L 2V7HA 3NA4A 2CRYA 2NY4C 4OIIH 3C60A 4KKBD 3UO1H 5FGBC 1IGJB 1KXVC 4WJ5A 1ZWIA 4ZUWA 1PDKA 4PR5A 2BX5A 3DUHA 5IB2B 1NEZG 5M7QA 3OB0H 4RZCB 4G9DA 1FVEA 5JORA 3GM8A 2OCFD 1H3VA 4GMSL 3RX5A 2XI9A 3BGFC 2R0LH 1CLZH 5D1ZC 3ULUL 5F9JA 1BEYL 5DUPL 3EFFB 3OKLB 1MIEH 1A6WH 5GRWA 5J7CC 4KROB 5DMJB 1OAKH 1AQDB 4PJXB 5KTEL 1D9KD 3GNML 1QYGL 4UQ2A 3DMMA 3T0ED 1E4KC 3CLFH 2E3VA 5L8KB 2CKNA 2E6JA 1WCQA 2R23B 3S3JA 6FABL 1DLFH 3QIUD 4M5YL 4R7NA 1R5WA 4NT6B 4LPYA 4PLNC 1W2KT 4HBQA 4NQVA 3TEUA 3QCUH 4U6VL 1X5XA 3EJYD 1SBBA 3TT1H 1A7BA 1QEWB 3MLUH 4P5KB 4KQ4L 2B20A 3NIGF 2AK1H 4LLUA 4G8GB 1JWMB 4UOW0 3EO1A 3VFUB 1A9EB 2X09A 1OF2A 5SX4I 5J8OA 4RGOH 3HNSL 5KS9B 2IQAA 1RK1B 4R26L 1YEGL 2DJ4A 4DGYH 5BRZD 4XVUC 3SO3C 1FV1A 2ORBH 1WZLA 5LWYL 5DJAB 4CL7A 2PKDA 4KKCD 1R24B 5CCKH 3PWPE 1IGYA 3G5XA 3RNQB 3UZQA 4WO4B 1KLUA 1P4IH 1EZVX 4M61B 3F8UB 5TH2B 2V7NA 1B3JA 5LQBL 2OQJB 1BWWA 4D9RE 3OXSB 2NXZB 3HI6L 1OAYH 4K3JH 3BKJL 5BV7C 4LU5L 1VACB 2IANA 4U0QB 2GJ6A 5E2VH 2FYYB 1IAOB 1FSKC 4MNQE 4NPYB 2XIDA 5H35A 4AG4H 1JF1B 2W65B 4GW1B 4YGVA 5C8JB 1V3MA 2V2WA 4R2GD 2YXFA 4HGKC 1LP9B 1GPOL 3OMZA 3QUZD 4K23H 2XKNA 2Y06H 3BWAB 4H25A 5DEGB 5SWSB 2HT2D 3QIBC 1YEIL 1MCPL 3ARFC 4ZQKB 1GXEA 2JCCF 4PY7B 4ZUSB 2W60B 5T3ZE 5DC0A 5C0JA 3H42L 2HT4D 1PZ5A 4G7VH 5E7FA 2ZKHH 3EDFA 5DHXB 2EDQA 3NIGE 3M8OH 1ITBB 2AEQH 4S10A 2DQHL 1NBYA 2VL5B 3X3GH 2HRPH 5GIRA 3BEWB 5E1AA 2ARJA 1MHHA 5K59E 3F6IA 3I6LD 1A14L 2DWEB 1G6RB 1IEBA 4I9WD 1ED3B 5SWZD 5FGCB 4YGAB 1G9MH 3DV6B 3JVGA 1JPFB 3FTGB 4WFFE 4KMQA 1P4BH 1L7TH 4LCUA 3WFCH 2XTJC 1MRCL 1NGYB 5H2BB 4RAHA 1QA9A 3WNLA 4ZTPH 1WBXB 1SEBA 4A6YB 3MNVA 4OI7A 4XB7A 3E0GA 2FJGB 1F6AB 5T5NF 5DMKA 1JGEA 4ZD3L 3VFRB 4X4XB 3TN0B 2J88H 3H3PL 1NCNA 4JFDB 4DEPB 5C0EB 3VI4E 3M45A 3WNOA 4WHTB 4BFIB 4XVJH 1L9MA 2XZQH 3RRQA 5CP7A 3V0WL 3MV8B 5MENE 2CLZB 1G9NC 3L5WA 2B1AH 3LRGA 3GGWA 3JV4A 4ELME 5CZXC 5GRVL 1GYAA 4HS8H 1IFHL 4OB5L 2OR7A 1RPQA 1DL7H 4I2XE 3SDCD 5KSBB 3AC0A 1QTYT 2OTWB 3VGAB 1HINH 3G6JB 4X5XA 2BY2A 1U42A 2O26U 1FAKT 3HPLB 1MH5B 3P4MB 5EIVA 1C5CL 4GW4B 1JRHH 5D6DA 1NAKL 1Y0LB 5BW7C 1CFQA 4RAVA 2VJXA 4PRHD 1A4JB 2QSCL 2X4QB 3A6CH 4JM4H 1ZA3A 3PHOB 1UQSA 1MJJB 1CIDA 5AG8A 3V8OA 2CDEA 1GRWA 3BUYB 1A1MB 5F7EH 2FLBT 1YDPA 2Z31A 4OGAD 2GAZB 3SCMA 4R7DB 4AT6B 1KTLA 1YPZB 4HXAH 3QAZC 4L4VB 1S5HB 5H8DA 1KV3A 5FYKE 3T1FA 2APXA 1MWAL 4LVNC 5GQBA 4QXUL 3MGTA 4CVZA 3VWJB 3D0LB 3IDIA 3T8XB 3TVMA 2J6EL 1NQBA 1FO0A 5DFVD 1G9NH 2YWYA 2CGRH 3BVNB 4ZXBD 1T1XB 4KKLC 1H8NA 3VGDA 5T1KB 1JZ7A 2BOBA 5C0FA 3SJVE 1DFBH 3L3DB 1FPTH 3MRIB 4F7TA 2VLRE 3JV0A 2GT9B 4OM0L 2Z9TA 5HVFB 3P4OA 4URTB 3MJ9A 2J8OA 3O6LH 1TVHA 3QEUA 5DMGD 2Z35B 3VJ6B 1IAIM 5ALBL 3NBNA 5TDPA 3SDDA 4HH8A 4OFYD 4X8JB 5FCUH 2COQA 3IXAA 1U3YA 3RI5K 4ONGL 4LBEA 2WK2A 2OL3B 1IARB 5E5RB 3AGVA 3HRPA 3L3IB 1I1YA 1VHPA 4PJ5A 3GSOA 5EZIL 3P9MB 4WW2B 2ENYA 5KOVC 4PJEF 5I8EA 5D1QC 2BNQA 4OQ1A 4XH2A 5DUML 1HOCB 1ZSDB 3KYNA 2APVA 1Q1JH 3L3HB 3V79C 4NZTH 1KNOB 5JW3H 1QD0A 3CFBA 1S7RB 4ODHH 5CD5C 5DJZA 5TPWH 1MVFA 5LXGL 1CXEA 1YEFL 1LO2H 3BUTA 4PB9L 5IW1B 3SN6N 5HYJA 1OLZA 4KKAD 3KPPB 1QQDB 1K6QL 5L2JB 1KCUL 2XQYK 3E6HB 4QRUB 1MFCL 1YEDA 4RAUA 4BUHA 4WTZA 3GSQA 5ID1A 5ISZB 4HZLB 4TSBL 3QUXB 2DDQH 5E70A 2I60L 5IW6A 2WQ8A 1PKOA 4U1LA 4PGCA 4JFYA 4KI5E 1FDLH 5ITBL 3QI9D 4KRPD 5HPOA 5D9SA 1FVDA 4I4WA 3ULVC 3D18B 1KN4H 2CJUL 1H3PH 4KTEH 4PJHB 5FKPB 3ARPA 4MQSB 1LD9A 1YEKL 1VFMA 3NIFF 3U7WL 4MWFA 4MJ6A 2F54D 5INCB 5E08H 1VFAA 1HE7A 3RPIA 1TCRA 4H1LH 3L6FA 2E27H 3IDMB 1F6FB 1DLHA 1I7RB 1CICC 1OAUH 4MD5A 1L6ZA 2UWEA 1BZ9A 2FNBA 4U6TA 1MHEB 1DUYB 1OD9A 2H8PA 2F19L 4UZGA 3UDWC 1HHHA 1D9KA 4YHKH 4MA8H 3T0EA 3QEHB 2GK0B 5FF6A 1LEIB 1KIRB 1NSNH 3GHBH 2BFVH 3BKML 3MODH 4R96A 5KOMC 5JXAH 3QIUA 4EIGB 1P1ZA 2N4IA 5EU6B 3U0TA 1RHHB 2RFXB 2AS5M 5F9OH 2NCMA 4K71C 4J3WA 3QA3A 1INEH 4P23C 5L6YL 3OAUH 4JQXA 5AZ2L 1HDMA 3T3ME 3WFEL 2HT3C 4JFED 2JB5H 2ADFH 4ZFOB 4OD1L 1RZIB 2VXQL 3NIDF 5TQ2H 5JR1L 1LQSR 4U1NB 5HHXH 4LRNH 4NQED 4E5XB 3ULVF 4BK4A 3CFEA 4UILH 2FEDC 3MCG1 1QBML 3R0NA 5HI3C 2F58H 2HA1A 1KPVB 1XR8A 5IVZA 4KJWC 5KAQF 4HWBH 4JN1H 4M8QB 2CQVA 4RWHA 5BRZA 4XGZA 1J5OH 4UV7H 3X12B 1UZ8B 1OP9A 4P4KC 4UB0L 3VI3F 4PB0H 3BDYL 4HUWA 3J7HA 5E9DA 1U95B 4IDJH 3GBNL 3S35L 1K8IB 1V7NL 4X98B 4B50A 1DVFC 1OGAB 1WWWX 1D5IH 3FO2B 3PWPB 3U1SH 2ZUQC 3S36H 5E8EA 2H32H 2CIKA 5DD6B 3EYOB 4HS3B 1PG7L 1YYMH 2ZG1A 4FQCH 5I9QC 3NCFB 4NQDD 3U2SB 3RZCB 3BRDA 3G5VA 4JM2B 1AXTH 2OS7A 1W0VA 2X4PB 5ITFB 1JFQL 3GK8H 1K5NA 1WSST 3RWFB 5F9AC 4F3FB 1K4CB 3BPCA 4DGVH 4EXKA 3R4DA 2NY0B 3CMOL 3AS2A 3N9GL 4EUPH 2DL9A 2KDGA 1X5JA 4QCIB 2O5ZH 5D2LE 1WC7A 5KVFL 4X9BA 2H9GA 2XOTA 1Q9WA 1HHIB 3GSXA 3T2QA 3ARWA 5T1DH 3ARVA 3QUKB 5JOEA 3RGVC 1SBSH 1WTGT 1LO5A 5DK0A 3F7VA 3OKKB 1FFNB 3KR3H 5D6CA 3BPNC 3I9GL 4GAGH 4HXBH 1FLRH 4LEXH 4YPGA 1YEHH 2NLJB 1CD0A 3W0WE 2VAJA 3FRUB 1N7ML 3SGDH 3TCLB 2DICA 5JO5A 3QULA 3D2UD 4TUKH 5FUCC 1N4XL 5SWZA 3VI3E 3QCVL 3GSVB 1T89A 1RZKC 3PUCA 2DRUA 3ZL4H 5I76A 2DOCA 2L7UA 4K3DL 4E41E 1U8IB 2XY1A 4P2QE 1MQKH 4K8RC 3Q2CA 1AY1L 3GUTB 4EI5C 5JA9A 4N0RA 2NW3A 2ICEB 4OFKA 3MLXH 5C0AD 4MQ7B 2IPKA 3MRJB 3GHEH 3HI1B 1NMAH 4LLWB 3RVWC 3ZKND 3HC3H 1JHTB 1FG2B 2ZUWA 5LGKA 3VWKD 5I1KH 1I8IA 1XCTA 12E8L 4LSRL 2P24A 4MCYB 4OV5A 3DVFA 3WFBH 4PRPE 3QHZH 1JGDB 5JPMB 4NWUL 2IFFL 5DVLA 4ZAKB 5ANME 1SY6H 5FA4B 4MD4B 4OSUL 4L3EE 1AHWB 4PRAA 3KXFB 1U91B 4FQQB 4L8BA 3BEVB 1WJ3A 2DQUL 4ELMB 3DUUB 3K4AA 3TH3T 5L0QC 2PW1B 4OIAA 3V52H 2NTSP 4P48A 2EEAA 5GRXG 4NNYA 3C2SA 3SDCA 3ULSA 5HHNA 2BVPA 4XP9L 2PXYD 2FATL 3MFFB 4AZ8A 1CR9L 1U8HB 5FO7A 2GJZB 3LCYA 3EHBD 1QZ1A 3EYVA 1EO5A 4I18A 1E6OL 5D5MA 4JRXD 5I30L 1RZKH 2A83B 3MUHL 1JHLL 4EEEA 4YC2B 4K9EL 4PRHA 2J4WL 4XNZB 1T5WA 2QLVB 3QEGH 2D0HA 1C1EH 3G5YB 1K3IA 1MEXL 1MRFL 1RUKL 2YUWA 4K8RH 4OKVB 3U0PA 3U4BL 1G7JB 5GGUA 1VEPA 3BIKA 1KJ3L 4MA7H 2HWZL 1B0GA 1SJXA 1M05B 4OCRH 4DN3L 3BN9D 5F21B 4PJDF 4C83A 4XP1H 5ENWB 1UCBL 3CFDA 3VXRB 3C08H 3TNNA 3WSQL 1A21A 1IKNA 5I8KH 4HUNB 4UINL 4GG6A 1Q0YL 2R1WA 3JTTA 3ZT5A 2A6KB 1XGPA 3BT2L 4JQVC 4NHUA 5T1MA 2SEBB 3WXVL 4ZXBA 3LAFA 3ZTNH 4JPIA 3EOBA 2YOCA 2X4TB 3DVNB 3GMMA 1T4KA 4YO0B 1QR1B 3G08A 3VW3L 2XV6B 1KJ2H 4U33A 4ZUVA 3UPRB 3TH4T 3V4UL 2VLRB 1DN0A 2GYSA 2OM5A 5GISL 3FO0L 4I3GA 3WJLC 1CF8L 1PLGH 3FQTA 2P4AB 2Q87A 3PP3H 4HJ0D 2BOCB 4OFYA 4DZ8B 4JDZB 4ZO8A 3LMJL 1CLOH 3O6FC 4PLJC 4XCFL 3H6JA 2MMXA 4Y88A 3VA2C 1NCTA 1OGTA 5D7KD 1MWAB 1SJVA 3HS0B 1HH6A 1A47A 2XKUA 2NXZC 5J9PB 1A64A 1B6DA 5IB1B 3KWWB 4Y4FB 1WIUA 5BS0D 1FE8H 3VDBA 2VSCA 2P7TB 2Q20A 1F3RB 2IPTL 4LPTA 3W39A 1S7XB 2DJUA 4OF7A 4L5FL 4H5SB 3V6ZA 3DBXB 4CVUA 4HK0B 2C3VA 4KTYA 2R0ZL 3DV4B 3W9DA 2R2EB 5I1EH 3DYPA 5IJKC 4XMLL 1ORQB 3P0YL 5HVWA 2F8VA 1BQUA 4PJGF 1VDGA 4PPTA 3QO0B 1I8KA 3BW9B 1J1XH 1AD9B 2N7BA 1JUFA 3FT2A 3PP4L 1JCKA 3CSYA 3FB5B 2EDFA 1ZT1B 5JTWA 4YEEA 1J8HB 1G1CA 3ZKXB 4G7YH 2VIRB 3QI9A 1XF1A 2JJSC 4MAYD 4U2YA 4AIOA 4KHTL 4OZFA 1XEDA 2VTFA 4I0PB 4ELKB 4DVRH 2XQBL 4YBQD 3NZ8B 4S1SL 4JFPB 2CUMA 3DGCR 2Y6SC 2AQ3A 3HB3D 3HZMA 3HNVH 2EIZB 2IGFH 2F54A 4UT9H 3B83A 2K1MA 4NO2A 5HDBF 5A2IH 1TCMA 2IANE 3QDGB 4KDWA 1NEZB 3RL1B 2GJ6E 1P4LB 3RY5A 1RZ8B 3TO4B 5DJ6B 1DQDL 3V7AG 1LEKA 5KANI 5EO0A 2R4SL 2NR6D 2R8SH 3JV6B 4HGWA 3TN0C 4X4YA 3FQNA 3Q6FA 3PF2A 3JZ7A 4P2CG 2NY2B 1AFVH 5D7IA 3BP5A 5J1TC 4NKQB 3MJ6A 3ZMRA 3PGDB 5FCSH 1GL4B 2WINA 4BK5A 5CZVL 1M71B 1GIGH 1SJHB 5EBMA 3V0VA 3LIZL 1NDMB 2XRAH 2OZ4L 4H26B 2Y9RT 4HUMB 2CMRH 3MGAA 2R69L 4V2BA 3WFHB 4MDJB 1AXIB 3IJSB 4MNHA 1IQWH 1YEJH 3VG0L 5F8RC 1WCBB 2A38A 1HYRC 4JFEA 3CPLB 1OCWL 3VGAC 1PSKL 2ATKB 2VISB 4LASL 4JG1H 4NQEA 4L9LA 3WIFA 3MRNB 4L1DA 4QXTB 2ID5A 5HI4C 3HMXH 4QT5B 5HYQB 2F74A 5H37H 1G6RH 4Z7UA 5F7LB 1BVZA 4JDTH 4LLQA 3CU1A 4JGJA 2YBRB 4LOUD 1U6AH 4NC0B 2VDLL 5F6HI 1MUJB 1Z9LA 4PBXA 1T0NA 4OGZA 5GRJH 5E56A 3T4YB 4J23A 1SVZA 1IC5H 5CEZE 5HDBE 2LU7A 1HIML 1ADQL 3QSKB 1X7QB 1TETL 4JZJA 4ZFFA 4HPOL 3CSBA 5E8DH 3CC5B 1RUAH 5CBAB 2JELL 2W0FB 3GJEA 4MA3A 5IGXL 3DECA 1CIUA 4G5ZL 2F5AH 3JWOC 4PY8I 1EERB 4NQDA 5D71H 4HV8B 3KNBB 2FX7L 4LFHD 3O3EB 4HT1H 3EGSB 4WUUD 4YXHL 1EAPA 1FYTA 1WLHA 1NPUA 5EA0L 3GIVA 1QR4A 4N0CD 3ZSTA 1WWCA 3DWTA 4G8FB 1IILE 1CLCA 1U41A 2DQTH 4I1NB 1UWEH 4GLRH 2ITDA 2YA0A 4FMFA 2VDNH 5D2LB 5CJ5A 4M7JH 3L3OA 3CDGB 3U79A 3WIHH 4HCRL 4YNYA 5T1LD 4F7EA 1NCBH 2A1WH 3FQXA 2OSLA 4UDTA 1MVUA 4GH7B 4Q2ZB 3S34H 3VXOB 2OK0H 1CD1A 4KDTA 4Y16B 2X9WA 4XVTL 43CAA 3KYMA 1NL0H 3MLVH 2J2ZA 3GO1L 3VCLA 2MQ0A 4PP2B 1G0YR 4JR9L 4PRBB 4MB4A 2W59A 5IQ9B 4XI5C 1B88A 5EPMA 4HFUL 3EJJX 3W0WB 3U0WH 1FL3B 2Q8BH 2XPGA 3D2UA 2WWKO 3MOQA 2DLGA 4WFHE 4XPGH 5DJXA 5TFSL 3MOAH 4WFGE 4WW2C 5FGRA 1A4KB 1AKJD 3MREA 4PJ9D 4GAYA 4KK6C 4BA8A 1T21B 5IFAH 4P2QB 4YZFE 2OXGA 1TJGL 3JWOH 1E4WL 3HZYA 1CFNA 5C0AA 3V6FB 3E2HB 3OAZK 5L2KB 4OQTA 4M6OL 4XPFH 4YHIB 2VXTL 5IB3A 2FL5B 1JZ3A 4PJ7A 5T3XE 4M3JA 3SGJC 3VWKA 5TE7H 3X17A 2FB4L 4DOHE 2D4DA 1JZ8A 5GSRB 2EC8A 4PRPB 4L8SB 1KC5L 5ADOH 5ANMB 2AI0L 5EZOL 1R0AH 1FAIH 5J6GB 4L3EB 1KB5L 1MJUH 2E5EA 3QUXC 3DYMA 4HIXL 5ESAB 4OZ4A 2BHUA 3LKQB 3L95A 4P46B 3INUL 2WWMD 2YPVL 1CBVH 5DD5H 1VB9A 1WISA 2R9HD 1LGVA 2QJDA 1X4XA 5F71A 5F88B 2PXYA 4XC1H 1GAFL 1AIFA 3V4PL 3F7RA 2ICWA 4NO3A 1MRDL 1WZKA 2OL3H 4PJ5E 2EYRA 5CWSB 4WW2F 2CIIA 3QJFA 4JRXA 1B2WH 1UJ3A 4NHCH 2BNQE 5EU7C 1Y18A 3V6OC 1KBGH 3CCHB 4HMEA 4D9LL 4NWTH 4NJAL 1A7QH 4NZRH 4XB8A 5FV1L 1A1NB 4G43B 5I2IB 5EC2A 1A1OB 4OLZH 4XCCL 3QDMD 5F3BB 3MLRH 3O3DA 1FBIH 1RAMA 4UIKH 4BQCA 5HYJE 4AQ1B 3FQUA 1HHKA 2MWCA 2YC1B 3MV9D 3QFJD 5KG9B 4BUGA 1DP0A 3QRFM 2GTZA 4YXLH 3TJEL 2DLFL 4U49A 2PYFB 4CN1A 4DVBB 2N56A 3CLEL 1NUNB 3S35X 3OQ3B 3QWOB 5IKCA 5KVGL 4FP8L 4XZUA 3B2VL 1XGTB 5HXMA 4JAMA 1UWGL 4YDJB 3UAJD 2BZDA 1FL5A 2HJFA 4OZFG 3FT4A 4IRJB 3QDAA 1UYWL 4YBLB 4TOYH 5SV4A 3V5HB 2V7HB 1PG7X 4DQOL 5GGTA 3C60B 3IETA 3KS0H 5FEBA 2QTEA 3QWRD 1QO3B 5D7SL 5TDNA 3WNKA 5DK2A 3ULUC 1XGRA 4ZUWB 4PR5B 3RVVC 1ZHNA 4KGJA 4NNXA 2L0DA 1TQCC 3VGBA 1QP1A 5D93B 3H7LA 1T7ZA 2D7QA 4GW5A 2UWEE 1EFXD 4JO1L 2DQDL 1UA6H 5FM5O 4W4OA 3AAZA 4UUJA 4UT7L 2C3XA 4S1QL 1MELA 2XZAL 4M7LL 5LG1A 1IM9B 3T0EE 2NTFA 4LLDA 4G6FD 3DMMB 1OW0C 2A2QT 3ARZA 3RZCC 3F7PC 2EDNA 2P5WD 5BS0A 3SPVA 1MJ8H 4XPTH 4JE4B 5KJRH 4QRRD 1NLDH 1HHGA 4WTXA 5DJ8A 5FYJL 1GJIA 4R7NB 5AUMA 1TZGH 1R5WB 2RIKA 3RX8A 5EZLA 2IJ0C 3QDHA 5T33H 4RGND 3CXHJ 1MFEL 3TZVD 3VXSD 1HXMB 2AJ3B 1JVKA 5IVNA 1HEZA 3KPRD 1U2CA 4NGHL 1CTOA 2LVCA 1R5IB 3B8YA 5SX5H 1N0XH 3S5LG 3N1QC 4PV9A 3ULUF 3LY6A 3NGBB 4GMSH 4HLZH 4CJ1A 2A9ML 3NCYP 5BRZE 2VLJB 2HG5A 1D5MB 1BEYH 3SBWC 4OLVL 4HWNA 3C8KB 1CD8A 4PD4K 3STLA 5I19L 1FV1B 5IMMB 5E9DE 1Q0XL 4HKBB 4GOSA 2FX9L 3P11L 4MAYA 1GGYA 3GNMH 1QYGH 4XWOD 2FO4A 5L88H 2N7AA 4MA1C 2P5ED 3QXVA 2EE6A 2X40A 2H2SC 4LP4A 3ME0A 2RJMA 2V7NB 2Y25A 4HAFA 3X14A 5HPMB 4M5YH 3TLRA 3IF1B 1LHZA 2IANB 1JYWA 5D2NA 3QZWA 5IMOA 1FCCA 1KOAA 3EDDA 1Q8MA 4NN6B 3O2DL 4H20L 2NY3B 1U8MA 3VGEA 1QHPA 2EDJA 4IRZL 4ZS6D 5H35B 1EEYB 1XAUA 1QSFB 1F90L 1J18A 1YN7B 3Q48A 2YMXL 4K7FB 4LVEA 1OY3B 3U30C 4ZAKC 2HVJB 2WWKT 4R26H 3MSPA 1YEGH 1AHWC 1S7WA 1N5AA 1PZ5B 2M1KA 2X1OA 1S9VA 5LWYH 5E03A 3TYFB 3UBXA 1XF2A 4JANB 3CU7A 5IF0A 4GRWE 1NBYB 1I1FB 1G1YA 5GIRB 3I6LE 3ZZ1A 1NUDA 2X1WL 1MHHB 4I9WE 2VR9A 1PX4A 1IEBB 3MLZH 4X7EC 4XXDB 4C58B 1BFOA 3HI6H 2DN7A 3BKJH 2NY6D 4LU5H 3DNKA 4N90D 1ORSA 1EJOH 5ESVA 4RGMC 4YC2C 4EVNB 4FXKA 3P4NA 1D5BA 4HG4J 1DTUA 4EN3D 4QXWA 4XNZC 1E4XH 1ZLSL 1QA9B 3QQ3A 3IAQA 3OG6B 3EOTH 1SEBB 3MNVB 4Q6IC 2DYPB 3C8HA 1F45A 2V2XA 4NUJA 3OKOB 5C08D 2R1XA 1DJSA 3DRQB 2IAMC 4HDIB 2HLAB 3ZE2F 4ESKA 4FABL 1M7IA 3UJJL 3H42H 4YHNA 3F12A 3IXTB 4LLMA 4F7MA 3D0VA 4Z6AT 4WUUA 5MEOA 2OTUA 1QACA 2JTDA 2DQHH 4Z7NE 1WQVT 3DSFL 5DQDH 1R3LA 5DA4A 3JV4B 2CR3A 5EIIA 2Z8SA 3KGRA 1A14H 3NABH 3FFCB 2VAAA 3PQYD 5HGDB 1SJEB 4X0KB 5C09B 2JIXB 1RY7B 4OZIB 3WUWG 5T1LA 3P30H 1BREA 1J12A 2ZZUT 4L8CB 3WYRA 2VQTA 2DJSA 1MRCH 5D5ME 1Y6KR 3SDYL 3SDAC 4P2OD 4RMUA 3FRPA 4H0IA 7FABL 4LHJB 4PRHE 1CFQB 5DEZA 5C0DB 5J11C 2EEBA 5I75B 3H3PH 1PD6A 2XQYG 4ZG1A 1ZHBB 3U82B 5JPNA 1AKJA 3JUZA 3V0WH 4PJ9A 1NAML 2J7LA 3B9AA 4Y4FC 3SCMB 2VXVL 1KTLB 2DQIL 4CGTA 3FB6A 4KRMB 4QRQA 3T2NH 3MGTB 4GG6E 4DKFL 1IFHH 4OB5H 5FYKH 3TVMB 2D31A 2XWTB 1MCWW 4JFQB 5HGHA 4QEGA 3PL6B 1LO4H 4KFZC 3HC0A 2W38A 2KBGA 3PWVA 1BOGB 1FGVL 4HPYL 3BX7C 4FTVB 3ZYIA 3JWNC 3RWIA 4F7TB 1T22A 1FZJB 1NAKH 1CG9A 4P3CL 4OF5A 1MF2L 4HUXA 2QBWA 4HX1A 1GZPA 2QSCH 4ODXA 4EI6A 5GZOC 2IH3B 3ZKXC 5J0BA 2EC9T 4BQBA 1TZIB 3W82A 4Y8DC 3PWNA 4L4JA 4G80A 1IGML 1CDGA 4QWWD 4OD3L 3AREB 4YHOH 2AK4D 4HLJA 4NFCA 1MIML 3LV3A 4YFDB 1F2QA 2V2TA 2EDEA 2ITCA 4Z0BL 4NKOB 4XCEB 3RWHB 3DPBA 1MWAH 2FEEI 3GSOB 3TIEA 2HJLB 5J3HC 4QXUH 4IIQA 3MJ8B 5I8EB 1NCDL 2MCPL 2XXMB 5C0IA 1JGUH 3EAKA 3RDTC 3S6CA 3TO4C 5E8PA 2BVUA 3QHFL 4XH2B 3QHTC 1U58A 5E94A 3NPZB 2WIIA 4UTAL 1IAKB 4JRWA 4FA8A 5J4MA 3CFBB 1GH7A 1XIWC 1MCJA 3PWLA 2G60L 3QDMA 1PX3A 2BSRA 1I3RA 2WSKA 3QQ4B 4NQSA 5DT1L 2V5MA 5EBGA 4OM0H 2ZPKL 3MV9A 1KB5B 3QFJA 2Z91A 2R1YB 4HCRA 5HYJB 4DK6A 2BVOA 3S3SA 5FOBA 2PW2B 3MRFA 2YR3A 1YECH 1XF5A 4NN7B 4OFPA 4X80L 1YEDB 3BO8A 5ALBH 4QY8A 3GRWL 4OLYL 4POZC 4ONGH 3GB7A 2YD2A 4Z7UF 2WMPA 1JV5A 4RBPH 3THMH 4P3WA 5D9SB 4I4WB 5SX4H 1HKLL 1T1YA 5EZIH 3OBAA 3L5HA 1UXWA 3QWRA 2OXHA 3F58L 1LD9B 2F54E 3O6MH 2ATPA 5D8JL 5I71B 5DUMH 5AZEL 3MRLB 4HIEA 3RPIB 4R4NC 4V2CB 3L6FB 3VE0B 3O41B 1DLHB 3RVXD 1YQ2A 4ZNCD 1EFXA 1PYWB 1JN6A 2NY5L 5JIIA 1YEFH 2MKWA 4QHLB 5HI5C 5F1IA 3BD3A 4PB9H 2H8PB 4IRSB 2Q86A 1HHHB 2VDRL 3L7FA 1K6QH 5D7IE 1KCUH 3ARDB 3QT2A 1PEZA 1MFCH 4X9GA 3HN3A 4GKZA 3T0EB 5FF6B 1FNGB 2P5WA 1CL7L 1AD0B 5IBLC 4QNPF 2ADGB 3PV6A 4TSBH 4QRRA 3UBXG 3U0TB 2I60H 4X6CB 1HCFX 3VGFA 1QLRA 4UBDC 3V6BR 5ITBH 1NCUA 3IGAA 3C5ZD 3B8SA 4WEMB 4Q6YA 3TZVA 3VXSA 3TBVA 4JFEE 5TF0A 1MCOH 5ILTH 1HDMB 5C6WH 2G5BA 3KPRA 4GAJL 3RAJL 3RVUC 1YEKH 4J3VA 4NQEE 1NCWL 3U7WH 2DS4A 2BNUB 3CFEB 3SE4C 5I15L 5JOPD 1EXUA 5IEHA 3AS0A 3BE1H 4Z7UE 5CIPA 4GKOA 4Y16C 4M1CD 3ZO0A 5IVZB 1NDGB 2BRQA 1C5BL 3B5TA 4MVBD 4MMXC 2WP3O 4XGZB 2G2RB 2F19H 4HUWB 5FM5M 1W72L 3KVQA 3NN8A 5E9DB 3IU3A 1G7PB 1WT5A 2CD0A 5HHPB 3TNMA 1PW3A 2P5EA 1RK0A 2RBLA 4GS7B 1KCLA 4Z8FH 1MCHA 3JWDL 5GGVL 4NP4H 1GOHA 4X6FB 4NQDE 2H45A 2QKIA 4D0BB 2BC4A 4F57L 3WEXB 1FYTE 4D0DA 3G5VB 3BXNA 3E2HC 1F4AA 4MXVE 5AZ2H 3WFEH 4OD1H 3OGOE 2VXQH 4WNQA 5JR1H 3T0XA 1BVKA 3MLTA 1FG9C 3GMNA 4ENEC 1QBMH 4R2GB 1DUZA 1HNGA 4GAFB 4PJIA 2A6JA 3GSXB 4MS8D 3O4LD 5C1MB 2IPUK 4LHQB 2HJKB 2P45B 3BDYH 2RB8A 2VWEE 5DK0B 5HSFA 1R3HA 3F7VB 4LL9A 2VOTA 3GBNH 4YDIH 4P46C 2RR3A 3S35H 3VXMD 1V7NH 1F00I 3DGGB 4GRWB 5SWQB 2XA3A 1NLBL 3ZE1E 3BQUD 3VXNB 2NPLX 3BZ4B 1CCZA 3GMQB 4YDLC 1EHXA 4K7PL 5C0ND 4JZOA 5ICZB 3G04A 4AK1A 4EN3A 1JFQH 2IALA 2JK5A 4NNPL 4OGYH 5C0AE 4HKXA 2NW3B 3GI9L 3CMOH 3N9GH 5F7UA 4X5WA 4DKEH 4PJ7E 2WBJD 4PJ8C 5KVFH 4Y4HD 3ILPA 4JN2B 5FYLL 4Y0GA 3OB0K 3AMLA 5C08A 5IEKA 1JI1A 2FEEL 2VE6A 5FK9A 5BZWB 3PABA 4H0HB 1TMCB 3WFDL 3KPNB 2Z92A 4Z76A 1DDHA 4P5TD 1D6EB 2X1PA 2QQLL 3I9GH 4CBPA 3ILQC 1MLCB 3PHSA 4U6XB 2A0LD 3DETD 3K81A 4QHMA 3PQYA 3O4OB 1N4XH 2FZ3B 3QPQD 3WXWL 5EU3A 3SDCB 1BX2B 3FFDB 5EU5B 3QG6B 1PKQB 4K9EC 4Q0XL 4RFNC 3MTRA 3E1F1 2JJTA 4APQB 1J8KA 2I5YH 3ZLQC 3SE8L 1OWWA 3EYVB 4JRXE 5D93C 4I18B 5D5MB 4XP4L 4WUKH 1UJTA 3MJGX 4TYUA 5EOCL 2EZ0D 4P2OA 2CLVB 4CNIA 3KLHC 5FYLE 3WHXA 3MXWL 4FQXC 4HIIA 1AO7B 3OHXB 4PRHB 3HI5L 3KYOB 4PJBA 1VGKA 3B43A 4N9GA 1S8DA 4NQCD 4LSRH 4EIZC 2EKJA 2PTUA 3LKRA 4NWUH 1IT9L 3BIKB 2ENSA 4FS0A 1B0GB 2LTQB 4MAUL 5CMAA 4M7LT 5FM8A 2DI9A 1OTUC 1AJ7L 4NUGL