1EHLH

64m-2 antibody fab complexed with d(5ht)(6-4)t
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
217
Chain Sequence
b'EVQLQQSGTVLARPGASVKMSCKASGYSFTSFWMHWVKQRPGQGLEWIGTIYPGNSDTSYNQKFKGKAKLTAVTSASTAYMEVSSLTNEDSAVYYCTRRSGYKYYALDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-(D(5HT)P*(6-4)T)-3'
molecule tags Immune system
publication title Crystal structure of the 64M-2 antibody Fab fragment in complex with a DNA dT(6-4)T photoproduct formed by ultraviolet radiation.
pubmed doi rcsb
total genus 42
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2000-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ehlH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ehlH02
5HDQH 5MHSE 2DL9A 3GKWH 3LY6A 3QPQC 1JZ7A 1UADC 3VMPA 1JUFB 2Z35B 1MCNA 1UEMA 3GIVB 1BX2A 1J0ZA 5INDB 4CGTA 3RWIA 3FFCB 4PJ9A 1ZKAA 3O3EA 2XWTA 3JTTA 3LZFH 2R1WA 1JGUH 1CGXA 1O7VA 4BFGA 4TSBH 1Y0LA 5MENB 4XVTH 4MA8H 3O41B 3T8XB 3QNYA 1P9MA 3IDGA 5I0DA 1A7QL 1LEIB 1EFXB 5KVEL 4RMRA 3NN8A 4PGDB 1R0AH 2ADGA 2YPVH 4JAMB 4HFWB 5DJYB 2ERJB 4ODVH 4KTEH 1L9MA 3QEQE 3RWIB 1V5JA 3T0ED 5GZNC 4GMTL 1KCSL 3OJ2C 1D5XA 4NO0A 5JTWA 2NY6D 4PJHA 3MLWL 1UZ6E 1KIPA 3L3IB 3TV3H 3WNNA 2EDHA 3MRCB 1IQWL 2AK4D 3QRGL 1I1YB 1A9BA 3CXHJ 3GIZH 4MWFB 1TPXB 4JO2H 4Q2ZB 5IMOB 2C1PB 3CSYB 3MV9A 1NAKH 3HPLB 1OSPH 1QSFB 3ZKXC 43C9A 1Z3GH 2N56A 1PDKA 5IW1B 1KENL 1CYGA 1P4LB 4JFYB 4H1LH 4LIQH 4Y16C 3A6OA 1YQ2A 2C3VB 1MLBA 4NPYA 5D1ZC 4NQXB 3C6LA 4R3SB 2AJXL 4XNMB 1LO4L 3QPXH 1VEOA 1KPRB 2GIYA 3CVHH 3THML 4ZAKC 4WGVB 2J12B 5E8NB 3OJDA 4HJJL 5EB9A 4CVXA 2VLMD 4FFVD 4WTZA 2DWEB 3STZA 2GQHA 2VABA 3VI4E 3Q3GA 4S1DD 3GM8A 4HLJA 3RNKB 3QUXB 5TE6L 5JZ7C 5KS9A 4XMPH 4OLZL 4WV1C 1VGEH 5J8OA 2QQQA 4JO4H 5DK3A 2BC4A 3IF1B 3FN3A 2EDBA 3CZFA 3PWPB 4JFHD 5MP6L 4YNYA 3QZWG 2Y25A 2B7DT 4Z8FL 4H5SB 4JZJB 3ULVD 1JV5B 3AB0B 3MLPA 2EH7H 4U1JA 2F54E 3AM8A 1I9JH 3NCFB 1U8NA 1HILB 4TNVF 5IVXB 4GO6B 3UAJD 1ITBB 5K93A 3BPOB 4UB0H 2EIDA 2XZQL 1MFAH 2J4WH 4M7JH 2VXTL 1VFAB 1XIWA 2M1KA 3MFGB 4OCSL 2AXFA 2BOCB 5C0AB 4WWKD 4RWHA 1JF1A 4JANA 1JL8A 3V4VL 1MI5E 2ZNXA 5C71A 3LAFA 5KOMC 3BWAB 3HC4H 2DN7A 4IRJA 4KKAD 4WI4A 4XPTH 1DBJL 3QAZC 5I9QC 2OXHA 4MA3A 4YBLB 1KIQB 2FJGB 2ZUQC 1AJ7H 5LVEA 5CSZB 1AE6H 4G80B 5IHLB 5KSAA 3TPUB 3AAZA 1A14H 3GSRB 1MFNA 2RHEA 5HY9A 3PWVA 1HYSD 4J3OC 5TE7L 4D9QE 3L3JB 1FFPA 1EEYB 3ARBC 5HHMB 1JI2A 4HH8A 1EJOH 3R06A 5JMRA 3D3VA 5IVXE 4ZODA 1WWAX 3RKDC 4I3SL 4XP5H 3SDYH 5L7XL 1U9KA 3TVMA 4YWGL 3W82A 3F7RA 4HWNA 3U36A 4JKPH 5K9OA 4YR6B 2JELH 1N6VA 3B5GA 2AJ3B 3V5KB 3TH2T 4WI5A 4DN4H 3LKSB 3MA9H 3WFDL 2XT1B 2UWEF 4PJBA 1QRND 2CH8A 3O6MH 4LVHB 1R3LA 4M03A 1Q94A 2DM2A 3QO0B 4D8PA 4LEXL 2ADFL 1F8TL 3EO9H 3HLAA 4MJIA 3TBVB 4OCXL 1R6VA 1L7TL 3H0TA 5JIIA 5J6GB 1WFNA 3O2VL 4ZTOH 5DJXA 5ILTL 5B39G 3RWJA 4NN6C 4N0FB 5IQ7H 1QRNB 3GNMH 3FO9A 3UJJL 5FO8B 3GI9L 4JO4L 3KXFA 3WIFB 5I73B 3MRPA 3ARED 5A3IC 3KHOA 2IQAA 3QPQD 1W0WB 3IDNA 4XWGH 4NJAH 3U30C 3C5SB 3QWRD 3T0WA 1REIA 4QHUB 3VD5A 5KTEH 3RIAF 1ZHKB 1BZQK 3U4BH 4U1HB 2VLKE 5HYJE 5JQ6H 4U6VH 3O2VH 4ZTOL 3MRNA 1DQDL 1AY1L 2XICA 3P30H 4UUJA 4Z7OE 3FRUB 5GS0C 5GGTA 3BUYB 1RZIB 4ZYKA 3FJTA 2NY0D 2CUMA 2XXMB 1VEMA 4ZOEA 3BVNA 3QO1B 1D5IH 4HKBB 4JQVC 2DLIA 5I19H 3TIEA 3CFBA 3FN9A 1KLUA 5E94B 3GHEH 3PG2A 4XRCA 1OAQH 2AKRB 1G7PB 5CJQL 4X5WA 1JZ5A 4ZTPL 3E8UL 4UNTA 2QJDA 5C3TA 3CGTA 1ZLWK 3SBWA 1H3GA 4GXVL 2Z93B 3ISWA 1J8HB 4HS3B 2I9LB 2L7JA 1SEBA 3LH2L 1AGFA 1RZJH 3MRLB 3D18A 1I1FB 4D2NA 2MQCA 3ZKNC 1ZTXL 5D1ZB 1S9VB 5HYSA 2VL4A 1HEZB 1RIHH 2J2ZA 1T20A 3JV4A 1Y18B 2W65B 5E99H 3JZ7A 5D2LE 1P7KB 4I3SH 2BVPB 4XVTL 4PJDA 4ZO9A 4YK4C 1DBAH 3CFJB 5D71H 2VUYA 3U82B 1F90L 2ARWA 2PNDA 2RIKA 3HHRB 2HMIC 3PWPE 3RZWA 3IDUA 3OPZL 4M7LT 4RGMB 3RNQA 1FH5L 4HPYL 3T4AB 1CU4H 1N26A 2HH0H 3SGKA 3ZDYF 4CW1B 2RQ8A 1IAIH 2HT3C 2W91A 5B22A 3NAAL 5FDWB 2OJZH 2D9QB 4XC3L 1XIWD 1J1XL 4WUUB 1PVHA 1KCVL 2ZKHL 1AC6A 1Q9KA 1FCGA 2V5TA 4MA3B 1G9EA 4LRNL 3G6AB 5E4EC 5I1AB 3SDCB 2D03L 2ZOKB 2CGRH 3LQZB 4AMKL 4CL7A 5LJYH 1MFEL 3N1GC 4UDTB 1U8KB 1UACL 4M7JL 4OZFB 4RGND 4UB0L 4MHHI 3PGFL 3NIGE 5IBTH 2IBZY 5L2KB 1OTUD 4OFIA 5C9JB 2AJVH 5HPMB 1FFNA 1IGMH 3AREB 4UOJA 2MHAB 4HKJB 4GMSL 1BWWA 4YO0B 5FA4A 3G6DH 3MGOB 2ICCA 5E94A 3QDJB 1S7RA 2VDLL 4R4BB 5F8RC 5BS0A 2WV3A 3ZTJG 2LVEA 3V6BR 1WEJL 3D2UA 3FHQA 3UROR 4NRXB 3V0WL 1B6UA 3EYOA 4YFDB 4DKEL 1YA5A 1BOGB 1IZJA 3V0VA 1DANU 1NMCC 3WS3A 1P4IL 2VE6A 5J89A 5GS0L 3VFOB 3HB3D 4KVCH 3WNPA 2Z92A 1KTKE 5I2IA 3W0WA 3ZE0E 1XZ0A 4P5TC 4P59L 4LCYB 5BV7C 5D96B 1OAZL 3BW9B 5FHBL 5ICYA 4EOWH 4XB8A 4P99A 4X6BB 5IB4A 3KXFB 3BIKA 1H8SA 5LBSL 4XBGA 3NZHH 1I8KB 1VA9A 2CD0A 4NPYB 3SDAA 4NCC1 5C7XH 1A1MA 2IFGA 1S9YB 4GRLD 5LXGH 2W38A 5FCUL 3OAZK 2XN9E 3QFJA 3KXFD 5TF0A 1K3ZA 4LMQI 3FMGL 1UM4L 1KG0A 4KTEL 5HHME 4LLAA 3EJJX 1EJ6A 1CGSH 3ALPA 3GBNH 1UQSA 2OBGA 4LPXA 4QRSA 43CAA 1XIWC 4XNQA 4S1SH 1KCSH 1U3HC 3GGWA 1UCBL 2JLLA 4KI5F 3OJVC 4OLWH 4Z9KB 5DJYA 1CFTB 1FSKB 4U1KA 4QHKI 4XVUC 1INQA 5I1DB 3H3KA 4MAYB 3MRQB 2J88H 4JM2F 4ZD3H 1M71A 1YDPA 3U7WH 2HVKA 4X9FA 2EKSA 3MUZ1 3FB6B 4BSWB 4G8FA 3MLVH 2MTPA 1AI1L 5DXWA 7FABH 1H15B 2Q76B 3V8CA 5BRZE 3VFVA 2FD6L 2DIJA 5DT1L 5E08L 1BEYL 3FONB 4JM4L 4FA8A 5CZVL 2UY6A 4ZUSA 4LNRB 3UTSB 4C4KT 2NX5E 3GMLA 5DJ2B 1SMAA 4ODWB 3IB4A 5DJAA 4ZD3L 5GIRB 1XZ0B 5F7UA 2EKSB 4OIAA 5FHAL 4I8DA 3VMOA 3FQUB 3FFCD 1INDH 1ZAGA 4OSUH 3WIIL 1F4AA 1UJ3B 2DLFL 5C6WH 3BPLB 4PJGA 4Y16D 3GSUA 5IM7A 4NC2B 1CWVA 1F4HA 2QQKL 4JGJA 5IJKA 2P48B 3PGDB 5IW6A 3T65B 2OTUB 4DW2L 2PW2A 4JFDD 1T1WB 8CGTA 4NNYB 1XMWA 1UM4H 2V7HA 4KK5D 1DBMH 5E6ID 3O8XC 1XGRB 1MHEA 1WQVT 2PXYB 1S7QB 4R26H 1CZ8L 5CJOL 2FJFB 3G5ZB 4NNPH 4PP2B 5E24E 1HNGA 4K3EH 1TJIH 2O5ZH 3CZJA 4JPVH 1NLDH 3BH8A 4RGOL 1H3VA 2CXKA 2FEEL 2NX5B 3CSPA 4GXUM 1KEGH 1OP9A 2WWKT 2FJHA 1QFUL 3FZUD 4RAVB 2UUDK 2IPTH 5D7JD 5IB4B 1KT2A 4P59H 1D3CA 2X40A 4LLYB 3H9HB 3EFDH 2R4RH 5C9KA 1J12A 1ETZA 4LSDA 4XWOC 1N5YL 3FZUC 1NCCH 4ESKA 3KPOB 4R4FH 2Z92B 3DVGB 1AGBB 3WFCL 4R3SA 3LEXA 1PG7X 4CKVX 3WCYA 2GUOA 4ALAH 4OAWA 4P4RB 1AP2A 1GGIH 3MNVB 1CICD 2DB8A 4N5EC 1GJIA 5KSVA 4P2QA 1RUAH 4L4TD 4BQBA 1G7MA 4YK4B 1HH9B 4EDXB 3RZCD 4BK5A 3MBXH 4ZPVA 3BI9X 1MCOL 5CBEB 4NDMB 4L5FL 4JFEA 1T7VA 4IRJB 5CHNA 1E4JA 2ITCB 1P6FA 2CIIB 4QOKA 5HVWA 3F7VA 5HYSB 4NKDB 4G6MH 1U8HB 4M5YL 1ZE3C 1IGML 1BZ7B 2H45A 4WW1A 4M6NL 4ELMF 1NSNL 3HE7C 3P0VL 1HXYB 4MQXD 4OFKA 2WBKA 4JPKH 5C9JA 5D1QD 4HX1A 4XCEB 5D7JB 3SDAD 1DVFC 5SWSE 1KLUB 4M7LL 1AGDA 1F90H 3W2DH 1OTTC 1WAAA 4JY5H 1DBAL 1XF1A 2AAVA 3UZQA 4GBXD 4M9PA 2WINA 1KBGL 4LNRA 1H3UA 3EW3B 3MCLL 4ZUSB 4JN2B 5D6CA 2P8LB 4RSVA 5LWYH 2YUZA 4JN2A 5DVMA 2YPKA 4DOHB 3GO1L 3V5HA 4FMKA 3PV7A 3QDMA 1H15A 4DZBB 3IDJB 3QZWA 4ZSOB 4JFFD 1GIGL 1ORSB 3WFBL 5DJ8B 1RMFL 1S7TA 2MFNA 4HGWA 3QJHB 4QXGL 4QXTA 1BJ1J 3BKJH 2BVQB 1YEEH 3QUZA 3GSNA 1HXYA 2FIRT 1CGSL 4GW1A 4B5EA 3I50L 3VD9A 5EIIB 2IAMA 4WWID 3KYKL 3LN4A 2VOTA 1I7RA 1LNUB 1NH6A 4Y4KB 1WUNT 5BW7C 2NXYC 2X1WL 4R4BA 4MNHB 4JM2A 3CD4A 5FUOL 3TBWA 3GSQB 5MHSD 43C9B 3WJLC 2DBJA 1AO7B 4YDJA 5H2BB 3G5YB 4FFVC 4E0RA 3BP4A 3QDGD 1A9BB 4R8WL 1IEAA 4MXWL 2CUHA 2KBGA 2BC4B 3GFUA 2WWKO 3SKMA 4M9OA 2EIEA 4PRIE 3RPKA 4HWUA 2AK4E 5ADPH 3U83A 4JB9H 3GM0A 4X83A 4H20L 5CINL 2Q6WB 4Z7OF 5D8JH 5I1KH 1J1OL 3GRWH 1T04A 4OZHB 4BZ1H 4HHAA 2Z31D 4M1GL 4OTXL 3EYSH 2VXQH 3V6FB 2R69L 2LQRA 4PJFF 3NH7H 4NZJA 1MCBA 5A2KH 3MRNB 3WL9A 1RI8A 2CO7B 3UYRL 5JPMB 2P8PA 2AEIT 1NJ9A 5EFIA 1MCSA 4W6YB 2DQHH 1IKNA 1X5AA 1UWGH 5T3XL 4M61A 3ZSTA 3STLB 4Y4FD 4LCCA 3QIUC 3SE9L 5JXEC 2N4IA 3VWKB 5A2FA 2FO1A 4E41E 4J3UA 4KJYA 2QR0B 2JIXB 2IBGA 1M6OA 2H2SD 2X4OB 4RZCB 4GT7A 3AVEA 2KL6A 2G5BA 4HS6A 4PJEE 5FGCB 5F7EL 1ACYH 3C9NA 4KVNH 5IHZA 1CLCA 2DQDH 2VDML 4F2MA 3DBXA 4XHQA 2F8XC 1JPFB 3PGCB 1SY6H 2NY2C 5D7KE 1TDQA 4OBRA 3JVGC 5I76A 1E4XH 1ZXQA 1ZHLB 5I71C 3DHJA 1ZMYA 1YY8A 2J6EA 4LDEB 5F21B 5AUMA 2AQ3A 3TLRA 5AG8A 4PRAB 5FGBC 3OL2A 2DQGH 4GS7B 5FM4A 3AB0C 1IL1B 1YN7B 2OTPA 4U49A 1F11B 1DQTA 3SDCA 4N9OB 1YQVH 1G7JA 4JFQA 4M6MH 5B8CC 4L4TA 4GXUN 5ABDE 1FVDB 1N64H 5DMGC 2H9GB 1M6OB 5E0QA 3OR7A 1W72A 3PXHA 2VSCA 5IVOA 4HS8L 4GBXC 4QRRE 3VG0L 1RIHL 3G08B 4L4TE 1A7BA 1BHGA 1W8OA 5FM5M 4XNYH 3SBWC 1BMGA 4WNQB 2IH1A 5ENWB 3X11A 5D2LA 4V1DA 4Z7UE 2YWZA 3HE6A 5DUBA 4TYUA 1IGTA 4LLWA 3NACH 4BYHA 2L0DA 1OAQL 1SJEA 5E8DH 2B8OT 5BO1L 3KPPA 3BZFA 2V5SA 2YD7A 2EH7L 5DD5H 4PJ7F 5CGTA 4JG0L 1QFWH 3HLAB 4MJIB 4M02A 2V9RA 5IHBA 3EIFA 1IGCH 1T2QL 3MGOA 5AYQA 1A6ZA 5E2TH 4IOFD 4XRCB 3ARBA 1MQ8A 2N7BA 1AH1A 4XMPL 4E41D 3RBSA 5CJXC 3P30L 4LSVL 4MXQC 4WFHE 4NNYA 2R9HD 4F7CB 1Q9WA 4JO1H 4W6WB 3KPPB 3O3BB 2XWBA 2NQCA 2YPLA 4XPFH 1A3RL 2Y23A 2P43B 4XWGL 3THMH 1SEQH 1ZWIB 4MJ4A 4WW2F 1DEDA 4GRWH 4UBDC 5ICZB 1HKLL 5HI4C 2ZUVA 1FZJA 4Z7UB 4ODXB 4U1NA 3UP1A 1HSAB 1EA9C 4R8WH 3QIWA 1NSNH 4CVXB 1L7TH 2HP4A 1UB6A 2VDOL 3ARDB 5E2WL 1KC5L 1QBBA 2WM0A 3LCYA 4LCWE 5C0DA 1KFAL 1QA9B 1IQWH 3O0RH 5DD6B 4X6DF 3AROA 3VFMB 5EH1A 1Q72H 4XC1H 3BKCH 3C60B 4FFZH 4CN4A 1IARB 1CN4A 2WINB 3ARVA 5JDSB 2QKIA 2X41A 3L6FB 4OLEA 4Y5YC 1UVQB 5FECB 4WDIA 5DFTA 3RWCA 2X44D 1PZ5A 3DX8B 3DRQB 2BNQA 1FO0B 2BRRL 1IRAY 4LF3A 5SX4H 3CSYA 3VGBA 4MCZA 5IB2B 4GKSB 4LVOC 2O5YH 4FN0A 4JPIA 3BIAX 1NCWL 5CD5C 3KYNA 1H0DA 1LD9A 3V9FA 3P40A 4U05A 1CK0L 1KGCE 3ILQC 4PJXA 2EYTA 3BPCB 4PRPE 5J6HA 2YKLL 1XIWB 2NY1C 1FL5B 5GGRA 4FZEL 2GY7B 4NKDA 4Y4HC 2EZ0C 2W0FB 4PRBA 3E2HC 3BUTA 3GO1H 3EFDL 3MRJB 1UZ8A 3QIWC 1MY5A 4BELD 5DJ2A 3DVIA 4BQ8A 4G8GA 4WI3A 3F12B 3OXSA 4L4VA 2EDOA 1IFHL 1A3QA 3WUWB 4WEMB 1V05A 3R4DA 4WUUA 1NLDL 4JREC 5F3HB 1OM3L 5CKGA 4DKAA 5C0JA 1Z9LA 4PRIB 3UJIH 5I8CB 1B90A 1KLGA 1YEHL 4NN5B 5FKPA 4UINH 1I3RA 4LBEA 3INUL 3ZMRA 4JFPB 4Z6AT 4WW2A 2ED8A 5CP3A 3G6JA 4MAYA 1MSPA 3PQYE 2VITB 4AEIH 5L9DH 1AGEA 1CLZH 3B9KC 4KJWD 4O9HL 3MOBL 5ANMA 3V6OC 5JPNA 1WWWX 1NANI 5DURD 3VRLE 4Y8AA 3BE1L 5F7DB 4DGVH 5D93B 4K23H 5CP7A 1JZ6A 3U46B 4NN5C 1U8LA 1L4IA 4DJMA 5DRZA 4KK9C 4P3CL 5HHOA 4OZGB 2R1XB 4I0PC 4H0HB 3G04A 3W11C 1HCVA 5F96H 3PWUB 4X9IA 3KPLA 4LLDA 4F7MA 3LB6C 4KXZH 3PHOA 5ESQA 1U36A 5DK0A 5JORA 4KHTL 2XA8L 1T83C 4H26A 3IDIA 1ES0A 3VXUA 4JM2B 4HKBA 5EORH 3VRJA 1GC1L 1KJ2H 3HR6A 4B50A 2IPUG 1EVTC 1YPZE 3U9UB 1U95A 2FD6H 1AQDA 2P5WA 1EO7A 3UTPE 1OGAB 5IT2L 3DUUA 5DD1L 1AD0B 3TNNA 5ICYB 3RPIA 3KPRE 5DMJB 4KK5C 4KY1H 3T04D 3RGVA 3GMMA 2NNAB 3Q3GB 5F7WC 3GMQA 2EYSB 1A1NA 1I1AA 4LARH 1JNLH 3C5SA 2V7NA 3CAFA 4JFOB 1GGCH 5EBLA 4NZTH 1F6AA 1T89A 5F3BB 4D0DB 3NCBB 3QYCA 5T3XD 3WHE1 4CMHC 3DI3B 2IANA 2FJGA 4Q6IC 1DL7L 4JFQB 5EUOE 2R0LH 1BD2E 3GJFK 4MNQA 2DKSA 3JVGA 1FZOB 3T4AA 3RQ3A 3QQNA 2BHUA 2NW2A 3FMGH 4ZS7L 4MSWA 1E4WL 5FYJL 5BXFA 3IDMB 4H8WH 4UMGA 2YUVA 3MRKB 4PJAE 1TJHL 5FGBA 3OGCA 1BD2A 1NLBH 4O2FA 1CFTA 1XGTA 3EOAA 4P2OA 5T5FL 2WK2A 4MXVE 5GGSA 5GGVL 1S3KH 1YYMH 5DJZB 3P11H 4TVPD 1TMCB 4OV5B 1DUYA 4F2MB 4XMKH 4LSSH 2B2XL 1AGFB 3MRLA 1J8HA 2VXVL 3ETBF 4MD4A 3S35X 1OTTD 3KYAA 4R0LB 4RZCA 1S5IH 4ISVB 3DXAB 1VHPA 1GC1H 2NR6D 1DVFB 1DQLL 3O6KL 5LG1A 4GKZB 1A6UH 1E4XI 1FPTH 4KHTH 2SEBA 3EOBB 2MPAL 2R0ZL 4JVUA 4ODHH 1MCLA 1YNLH 2PYED 2AJYL 4RMWA 1NC4A 3GMOA 3K7UA 4M4PA 4PD4J 4XHJC 3NTCL 1A7NH 1HQRB 2W60A 3BQUA 4X7TA 1J0YA 1QBMH 3UC0L 3I75A 5AD0B 1PW3A 2JE8A 4LDLB 1FGVL 3N9GH 4PJAB 1G84A 5CIPH 5D7SH 3GBNL 3WUZA 4OZGA 1KULA 5BJTB 3MOBH 3MLZL 5GISH 3WO3B 3CH1B 4OQTH 3ES6A 4PLKD 5I6XB 2YN5A 4U6YA 5FGSA 2XKNB 3LRHA 4ELMB 1OSZA 2XFXA 1XGRA 2CGRL 3I75B 4P5TD 2OK0L 5HDBE 1UFUA 4Y5XB 3GSQA 3VXSD 3M07A 5DJ6A 5MEQA 4XAWH 4PJHB 4ZXBC 2FX8L 2CPCA 2WZPD 4NQUA 5FYKE 1TXKA 3GSOB 1H3PH 1CE1L 4HV8B 1WC7A 4HG4K 4DEPC 1BVLB 5F44A 3QXAA 1X5KA 2W92A 5T3ZD 2VLRD 2NY0C 2VO5A 1YY9D 3RA7H 1N64L 4GAYB 5IBUG 4RGNE 1FL3B 4ENED 3M1BA 4OF7A 4X7CC 3ZKQD 4NWTL 4HIEB 5DHVB 2A0LC 1BJ8A 3MLXL 1QHPA 3KYMB 1NCWH 3TN0D 4Z5RB 3OKYA 4MS8C 3VCLB 1FLRH 2Y9RT 4JRWA 1JPGB 1O0VA 4J8RA 1EMTL 5GGSB 2X89A 4Q9CA 2V2WB 3VWKC 5SWQA 3O6FA 5B8CB 1WIPA 3B2UD 5FGRA 5E1AA 5I75B 4S1QH 5K59E 3F8UB 3VFRA 1YNTA 4PJ5B 3I6GA 1QSVA 4IDJL 2BXYA 2GJZA 4OJFL 2O61A 3OKDB 5I1DA 2NY3D 4MNQB 3BPNB 1PKQB 3P0GB 2YBRB 5JDSA 3PGFH 2X4RB 5EU4B 5BVJB 2CO6B 2VAJA 2IANB 3SE9H 4F9PA 4YHYC 4GSDH 3P73A 1QLEL 3NFNB 3QI9C 2R29L 2BFVH 5D7IF 1A6WH 5HGDB 3QH3A 3SE8L 3KPRB 4QOKB 4K8RC 1RJCA 4YIQB 3KPSE 4MGXA 1EBPA 3TCXA 1AXSB 4AZ8A 1E28A 5D70L 3F58L 4BSVA 3HCVA 1ORQB 2IAND 3DUSB 5KSBE 3BZ4A 2FEDC 5FK9A 1I9RH 1CU4L 2HH0L 4L8CB 5FXCH 1CDCA 3PWVB 2VB5A 5D8JL 2UZIH 3DYOA 3QUML 2YN3A 5F1NA 1JNJA 5BMFH 4IRJC 4XNZC 3GI9H 1TCMA 3VRLF 3ZE1E 4EXKA 1IGCL 1QFWL 1BD2D 4U7MA 4E42B 3C6LD 2IGFL 3QXDB 3ULVH 5CGYD 4FQPA 1I3GH 4YHPA 5F1IA 1A6ZB 1KJ2B 2WQ8A 1DANT 5CEXA 5H94B 1N0XH 4RMUA 1UC6A 3BSZH 4TRPH 4ZTPH 4OLUH 1K2DA 4RRPG 4UQ2A 3O4OB 4R2GD 1IT9L 2YA2A 3DX6A 1J0IA 3DJ9A 12E8H 1CDJA 3H9SD 5D2NC 4HIXH 1HCFX 1JPSH 3NA4A 4HS8H 4HWBA 4PREB 1YEKL 1YPZF 5DGQA 1DLFH 4WJ5B 1MFDH 5TFSL 5MEND 3O3DB 4AENB 4QXUL 4PJDE 1JHLH 4WV1B 3T1FB 3KPRD 2OTUA 3GEWB 2VZ1A 3HNVL 5C09A 1D5BA 2ZG2A 3WKMH 2OSLA 4KK6C 4U1LA 2HRLA 1LP9A 3HZMB 5I1JH 2IAMC 4X0KB 1NAMA 5EWIH 1YEFH 4TSCH 1RVFH 5IB1B 3VFUB 3KPQA 3KPNA 1WLHA 3FO1A 2Q8BH 4OZFH 2EXYD 3QEGH 4IRSA 3VGAC 3V5DA 4L8SA 4Y89A 5B3JE 2YRZA 4M62L 3WLBB 5GHWH 2CRMA 1FNFA 3SCMC 5KVGL 3KYOB 1OCWL 1F00I 3MZGB 4JFDE 1X5XA 3UYPA 5CBAA 2WBJD 4P2RB 1AKJB 3HC3L 3TA3C 3FB5B 4E9LA 4ZAKD 1LK3L 2DOCA 5LGHH 1D9KD 4JHZA 4OCSH 5C0AE 3LEYH 1MEXL 2F19H 4G8FB 5BXFB 1CFVH 3GMNB 3VXMD 2APFA 4FFYH 5CJXA 4S1DC 2M2DA 4NUJA 1VFMA 4PJDB 5EU4A 5BVJA 1OWWA 3P4MA 1Z0NA 1Z0MA 1CFQA 2DQHL 2E9JA 3KPSA 5IOPA 3LQAC 4JQVA 4DZ8A 1GZQB 5GRUH 1QSEB 3I6GB 4NSKA 1LGVA 5D1ZA 1QA9A 3BKMH 3U7YL 5F3BA 4EIGB 4PJHF 3DX9A 2H32A 4AH2A 2MQ0A 1XR9A 3TF7C 3D85B 5GGUA 1WICA 4IRJD 1UYWL 4NRZB 2PO6D 4UOW1 1N59B 1G6VK 3FTGA 5EU6B 1OVZA 3NCYS 3RA7L 4QCIB 1V7MH 3BEWB 3BP5B 1WBZA 3E2HB 3RZCB 4AT6A 3O41A 1MIEH 1CVRA 2X1OA 5FB8B 3H9HA 4KV5F 2N7AA 4HEME 1NMBH 4PYHA 4GRLC 2WAHA 1AJ7L 5CEZL 1NBVL 5C07B 4NQSB 5FOJA 3TWCL 2YS4A 5EOCH 2Z35A 1IC7H 4CU8A 4LIQL 1HHGA 1YEIH 5HVHB 5M95B 1D5ZA 3U2SB 4KC3B 1VFBB 5CSBA 1PJ9A 4R4ND 2SEBB 1T22A 3K4ZA 3CC5B 3FO2A 3L3OB 3O45A 3EBAA 4DQOH 1LHZA 2ZCLH 4YHNB 3RVUD 4HJ0D 1QKZH 1KTDA 3S96B 4OLXH 1XF4B 3N85L 1RJLB 5ISZA 3UXFA 1Q0YH 3CSGA 4HWEL 4U1MA 1JN6A 2OM5A 1W0WA 3IDNB 1NBVH 1FGVH 4YBQD 1MOEA 4G6FB 5BZDB 1MFBL 5DUPL 1X5GA 1S9WB 4FQXA 4YHOH 1F3RB 2F54D 4RMVA 4ODUA 3SHSA 1MCRA 3HTLX 1RUPH 3IJYA 3BIBX 4LPVA 1L6ZA 1DJSA 3MLSH 4FTVD 4NUJB 3K4DA 4CDHA 1EX0A 1DFBH 2FL5A 4JE4B 4EDWH 4NKOB 4L3ED 2MKLC 2P7TA 3VXSE 5KW9L 1VGEL 1OAYH 1BIIA 1XR8B 1UXSB 3SDXB 1FGNL 2FEEI 1R5WB 4R2GC 3LDBB 1H8OA 2DI9A 1LK2B 4QKXB 1IAIM 1WZ1L 3BDBA 4LSSL 4UIMB 3RDTC 3KYMA 3MOQA 1BJMA 3DSNA 3FT2B 4G9FB 4GFTB 4QOKE 5BVPH 1BBJA 4XBPA 4ETYA 1HSAA 1RHFA 3VFSB 1J86A 4K7FA 2E7CA 3I9GH 1T83A 3D3VB 3EYFA 5DTFA 5D1QC 3C60D 2LVCA 3S4SG 1DLHA 5EC2B 4DGYL 1VFUA 1E28B 1OSPL 4I4WA 1UKQA 1NCDH 3S4SB 1T1ZA 2BVOB 1B4RA 4YFLI 5A2IH 1IC4H 3SKNB 2OL3H 3QRGH 2DQIH 1FO0A 3IJHB 5CSZA 4QTIL 2EE2A 3C9NB 4ALAL 4DZ8B 4J2XA 5C09E 3FT4B 3DO7A 3BKYH 2BCKB 4HCRA 1HIML 1MFCL 1UWEH 3FQRA 2CDEA 3CIQA 1HYRC 3P9MA 4RGMC 4R4FL 3CFEA 5E9DE 3X14B 4IRSD 4WHYH 1YNTB 1A6TB 5KSBF 3L7EB 5TDOB 4HAGA 4NKIH 1BQLL 3OMZA 3EYUL 1HHKB 4HC1A 1GOGA 2IBBA 2CRIA 2J8UB 1S7UA 4TVPE 5B8CA 4Q6YA 15C8H 3BHBB 2NYYC 4UT9L 4YPGB 5F70A 2KKQA 3QG6A 4U2ZA 1DLFL 4FQ1H 1FIGH 3B5TA 4ZAKA 2DAVA 5AZEL 4X5XB 4JRXE 1MRCL 4OLVH 3K8KA 3QXDA 3RFZC 3BQUB 2ZUQB 4XP4L 3MNZB 1IM9B 5CEZD 1QQDB 1JN6B 1QFWM 1CGYA 2FNBA 2G9HB 1CT8A 5DHVA 5F6IC 3DROB 3T2QA 1X4YA 3LN5B 3QBTB 4YLQT 4ZFFB 2A6DA 5EUOA 5EU7C 5BV7B 3D9AL 4ZO7A 4MDJA 5BQ7B 5LQBL 4MVBD 1QVOA 3KPSD 4IRZH 4Z0BL 4PLNC 3DUUB 1HN1A 3SPVB 4E0RB 3SDDC 1M7DA 1W72B 1E4KA 2VDLH 5A2JH 4XXDB 3MRIA 2FL5B 1AXSA 4LSPH 2DTSA 2VZUA 1AR2A 3HFMH 3DROA 4PGCB 2PTUA 1CR9L 1ES0B 4ZUUB 3VXUB 4XVUD 1SYVB 1MVFA 4RAUA 4PFEA 5T3ZL 4CBPA 4LSTL 5EOCJ 3W0WD 4PJDF 5F97E 1SY6A 2AJVL 3PWUA 2YD9A 5GPRA 4K3JH 4P23D 1YNKH 1LO2H 2A77L 4PRDA 4XPAH 5D7LE 3C2AH 4LCUB 3B6SA 2X9WA 3PDOB 5I30L 1YMHA 4JY6A 1SQ2N 5IJKC 3LRSA 4G6JH 4R6UA 2F5BL 1YMMD 5E1AB 4LL9A 3C5JB 3QQ4A 5FM5O 4QY8B 3CFDB 1IFHH 2HA1A 3B9KB 4G7VH 3W9EB 1WZKA 5C0RH 4ONGH 4RAHA 2G2RB 4M3KB 1EEQA 5SWZB 3OKLB 3EO0B 1E6JL 2O5XL 3J7HA 2YD6A 4HIHB 4K2UL 5FYLH 2E27L 3HI5L 1T03H 3E0GA 3MR9B 2CLZB 3HNTH 4M93B 2B1HL 2PTVA 3LKOA 2DQUH 4RMSA 5CBAB 4ZFOL 2P45B 5L8KB 2P8PB 1CXIA 3KAAA 4GAJH 3NFPB 2Z8SA 5FO7A 4U1KB 3VFSA 1S7VB 5JW4R 5E8PA 2W65A 5TF1H 2VH5H 3WFEH 3RX8A 1FLRL 3EOTL 3AAZB 3VFGL 4MA7H 3TCLA 5F9OH 5JW5A 5EC1A 1DUYB 3S34L 3MRHA 3U0WH 1G7QA 3WD5L 43CAB 2NTFA 1RUML 4QHNA 3I3EA 5D7IE 3CFDA 4QRQB 1EEZA 3NCYP 1OLZA 3OGCB 3MRKA 1MJUH 4G7YL 1DQQA 1FLTX 3UEZA 4MDIA 4NO2B 4GS7C 4QYOB 2Q8AL 4GRMB 1NFIA 4GAGH 2AABL 3STLA 4G7VL 3EO1A 1R3JA 2PXYC 5DR5H 1T5XB 2PYFA 3FB5A 1H5BB 1MCHA 3MJ6A 3ZYIA 2WBJC 3RWFB 3JWDH 5L6YH 1X4ZA 4NQDB 3M45A 5FF6B 5JNYB 3MBEB 3PDGA 1SVZA 1G7LB 4WO4C 3RY6A 3PP3K 4HXBH 4ODTH 5JQ6L 2GAZA 4WFED 3MLTA 4U1SA 5DQ9A 4MAUL 4XH2B 3ZHLA 3FB8A 4RDQF 1PX4A 5C2BL 2ADJB 1B9ZA 5D1XB 3KS0H 1L6XA 4NC1C 3BDYH 5I1LA 1WEJH 2BP3A 4MMXC 3MUJA 5I8CA 1KCRH 3IDYC 1GZPB 5F7KC 3TT1H 1FV1B 4XT1C 2J3SA 3VWKD 5C09B 5HYSG 5GS1B 4IIQA 4OGYH 5D7IB 4P9HH 5FYKH 2K7QA 3T0VA 5JUEL 3FB8B 3W5NA 4LEXH 5K9JH 2BHYA 4Y2OA 2VQ1A 4GKNB 1AO7E 5IB5A 1N4XH 4HDIB 1KJ3H 3SGJA 4RISH 4C4KO 4ELMA 3D9AH 3QG7H 4W6XB 1F4YL 1OF2A 1SBSH 1A9EB 2Y72A 1Q8MA 4G5ZL 2OR7A 4ZS6C 3HZKA 3FKUS 3TYGL 2HT3D 5J12C 5E5UB 5C0BE 4OGAD 5CIPB 2B0SH 4HKXA 1QNZH 5T1KA 4CN6A 3VXTA 4F7TA 2C3XA 2GT9B 2G5BB 1CICA 1I7ZA 5HI4D 4RFOH 1PKQA 4JRXA 1B4JH 1KIPB 3R0NA 4LP5A 4PG9B 4QWWD 1RK1B 2KH2B 4KRLB 4GKOA 4KROB 4NQEB 4EVNA 4BQCA 3MC0A 1MCKA 2A73B 3N1FC 4NGHH 4ERSL 1QEWB 3HUJB 5GS0D 4PLKC 1A5FL 4EN3B 3BKYL 4FG6C 4PBXA 1FNSL 2AJZB 4Y5VB 5DC4B 1C12B 1OGTA 3VA2C 2D31A 3MLUL 3QXUA 1DLHB 5F7YC 1MNUL 1GRWA 3FQWA 5FAAA 5IUSA 1JHKL 1JPGA 4Q6IA 3T8XA 1HQ4A 3O2DA 3VGEA 4U6TA 3IVKA 1MPAH 2J8UF 3WLBA 2JB6A 1BBJB 2A6JB 3E8UH 4XBPB 5DYOA 2DQDL 2VDMH 4G9FA 1T7XA 3QB7C 3MRJA 1ACYL 4ZOBA 2X1XR 3EO0A 1K3IA 1A1OB 1UXWB 5FYKU 5GS3A 2QV2A 4NP4L 3F7VB 4KTYA 3LS5H 2Y07L 4RNRA 4FQHB 3EOAB 1MH5B 1U91A 1KTRL 3HUJF 4KH2A 2XZAH 2RCSL 4JRYD 3ZDZF 1DDHB 3VXOA 1C5BH 3D69B 1ZHBA 3PGCA 3X17A 5IT2H 3ARPA 5F1KC 1U8IA 2VQ1B 4GKNA 2I5YL 3E1F1 5EZLB 3MOAL 1HWGB 1HILA 1DSFL 3RDTD 1JHTA 3NCEB 4KV5E 1GGYA 4QRUB 4X7EC 3GK8H 5IROA 2AW2A 2OCFD 4JRYB 3L3KB 3VH8B 2XG5A 5DD6A 3WMSA 3QUZD 2VLLB 3OX8A 2ZPKL 1CG9A 5T1LD 1DFBL 4M1GH 4GW1B 4K9EH 4BZ1L 4WUUE 3MLSL 1IC5H 1FBIH 4M1DH 5EU5A 4F80A 4WW2B 5FOBB 4C57C 1CFBA 4G8GE 4D0CB 1KJ2A 1A21A 1R24A 4PYGA 1R5IB 2VABB 4LKCA 2FLRT 1U6AH 2FX7L 1K8IB 1QLFA 3MQIA 3VXSB 1J05A 2V5YA 3I2CL 4XAKD 3QCUH 2CK0L 2GAZB 1NC2D 3V5HB 1QPPA 3ZL4H 4E42A 2OJEB 3Q5OA 1LMKA 2XTJC 1NC2B 4JN1L 3WE6A 3CXHK 2HLAB 3EHBC 2EDXA 4P46B 3QDGA 1K4CB 2QLVB 3D0LA 4WI7A 4I5BA 4PRPA 3V7AG 1VCAA 4CDGC 1A3LL 3EGSB 2LTQC 2VDPL 1SJVA 4AEIL 3MRRB 3SOBH 3U9PL 1H8NA 2OR8A 1EUUA 2C7UB 4DQOL 1ZT7A 3INUH 1WBYB 2Q86A 1YEHH 1FNGB 3REVA 2VDQH 4M8VA 3RWGB 3S37H 1ZGLP 4XP4H 3AU1B 1XGYH 2MHAA 1CD1B 3EJZD 3HZYB 4OZIF 4TSAH 1U8LB 4PGJA 3VGDA 1B2WL 5E8EB 3LKPA 1TQBC 5EBMB 1C08B 4C55A 3C5ZD 2PN5A 5LGJA 5HI3C 5GIRA 5FECA 3QR2A 3OBAA 1RJZA 1DEEB 4CNIA 2FATL 4M00A 1OY3B 5DRWB 4YHZL 5F72S 4B41A 3W0WE 2YUWA 1FZMA 4W4NA 3NA9H 5D1XC 1NMAL 1C12A 2CR3A 2Y5EA 1I3VA 4M8QA 3QDGE 2ENYA 2FSEA 1KIUA 2ZCKL 2E3VA 4G3YH 4JQIL 2B4CH 1NCDL 4HMCA 1FVCB 1RZ8A 4F37K 2J8HA 3P0VH 1GH7A 4N0CD 3SOBL 4KRPD 3TESA 2JB5H 4X6BA 3BKCL 4FFZL 3QDMD 3MCKB 4JRXB 3IXAB 3RX7A 4OD1L 4PJEB 5FGCE 2V7NB 4MJID 4JZOA 1KV3A 5ITFB 3ZL4L 3QFDA 1A1NB 1GOHA 4K55A 1I8MB 1C08A 2EDJA 1OCWH 4KJPC 5F6IB 2H8PB 1MRFL 3SQOH 5ESAA 4UV4L 4F15B 5C6TL 1X6LA 3L5HA 4HCRH 4Z76A 3IXTA 5CLWA 5DUML 2G5RA 3DNKA 4DWHA 1KG0B 2EEBA 5BCAA 1TTGA 1WCBA 2EIZB 2HRPL 2IALB 1MHEB 2PXYA 3ESUF 2NTSP 4MCZB 5IB2A 2VIRA 3VE0A 1FO0H 1KN4L 1NGPL 3Q6GL 4LSQL 2WANA 3O11A 1A6AA 1FVEB 2VKWA 4FQJH 2GJ6D 2ITCA 1FORH 4PS4L 4C56B 3CK0L 1LILA 2QKIB 3U0PB 4BQ9A 3VFTB 1N5AB 4JZJC 4Q9BA 5J13B 4HK0A 1X4XA 4HJJH 1KEGL 4V1DB 1QVOB 4A2MA 2BVQA 1MFDL 3MYJB 1TJIL 5EZJA 1OP5K 3UTSE 1U3JA 2DM7A 2X42A 5I8KH 3MGAA 4HZLA 4NM8H 3V4PH 4AM0B 2FHBA 1TVHA 2VLLA 3OX8B 5GJSH 2P8LA 1T1XA 4OD3L 3BYTA 1MCIA 4XP1L 4HK3J 2IMMA 1ADQH 4XVJH 2QBWA 3SY0A 4Q0XH 5BS0B 4PJFE 4DW2H 3CFKB 3RNQB 3ARRA 4IIQC 3MV9E 3PIQB 2OZ4A 1A8JH 1BAFL 3DV6A 2AJUH 2C1PA 3HE6D 2C26A 1R3LB 1T21A 2JK5B 1WV7T 4LVOB 3V0AC 5CFHA 4LCCC 4AEHH 1P7QA 5J11C 3DUHA 1NGWA 3ECBA 2ESVE 1V3LA 1QD0A 4O2CA 1EHAA 1F6FB 2X10A 3HI6L 4HFUH 3EYVA 5E8OB 3VDAA 1KJVA 1WFOA 4BM7A 1P2CA 4UU9B 5GGVY 4UTAL 3QEQA 5C0AD 4YHML 1I1CA 2GSGB 1DP0A 3LZFL 3MNWB 3HC0A 4JM4H 3AS2A 3ULUH 1CGTA 1E6OH 5T3XE 3V6ZB 2R1YA 1LWRA 4YHIA 3RIFK 2Q7YA 4DK6A 4O4YH 4RRPA 4EN3A 4S11A 1SY6L 5HHOE 5I8EA 4L8BA 1HXMB 3BJ91 3FQTB 4DVBA 2QHRH 4P2RA 1PBYA 1I7TA 3TO2A 3QA3B 3FB7A 4GLRH 5B39B 4LVHC 2R56H 4NP4H 3VJ6B 1SYSB 5CS7A 3U4EB 3FOLA 3U6RB 4U3HA 1ETZB 3W9DA 1EV2E 5EBLB 2DQTH 1ERNA 3ZDXE 4F3FA 4BZ2L 5BS0D 2NX5A 3D2UD 2DDQL 1BQHB 4KUZH 3RGVB 5DJ0B 5E7BA 1GL4B 5ICZA 3QUZC 2CRZA 1ZLWH 1BBDL 5HI5C 3AC0A 4XCNA 5I76B 2MKWA 1U92A 3L9RB 4L1DA 1V8HA 4XCCH 1G7HB 4ZDHA 3GGWB 3B2VH 4PJ5D 2AEQL 35C8H 3JWDL 4D9LH 3QXWA 4U6XA 4APQC 3O3DA 2HJFA 4DTGH 1CVSC 2VRAA 1TTFA 2I60L 3SJVD 4P4KC 4U1GC 1P7QB 1ZS8A 2CKBH 3ZTJH 3RL1A 4HH9B 4PRNB 2Q8AH 2DQEL 3FRUA 1CE1H 2AK1L 4LQFL 3HG1D 2APBA 3B43A 4LGPB 1FDLH 4XB7A 1TNNA 3WN5A 5LCVL 4OKVB 2LABA 1PSKL 4ZFFA 3VFPA 4LVEA 3MJ9L 4GW4B 3TBSB 1DQJB 4MA1B 4O58L 4FQCL 3MLTB 2DLTA 5ELIA 5EOTA 3G6AA 5CUSL 1QFPA 3BW9A 1I75A 1K8DA 1Q1JL 3QEUB 2DDQH 4KUZL 2ICWI 2X9YA 4YBLC 1OPGH 4RDQG 2VAAB 1CLOL 5EDXA 3P0YH 4YFEA 2Q76A 3UTTB 3N06B 2BHZA 4OZGE 4JDZA 4JFZH 3I6LE 1A7NL 4G80A 3QHZL 4X6EA 4PRNA 2R15A 4NWUL 2R1YB 4N1EA 3M8OH 3TIDA 5SV4A 4K3DH 4YH6A 5T33H 5MEPB 3MCLH 1YYLH 4YIQA 3F58H 4O4YL 1KIRB 4B7IA 1MFEH 4R7DA 4F8QA 4NKQB 5LKNA 2M8XA 2VL5A 1EZVX 2PW2B 4QHMA 4PJIF 3S97C 2VL5B 3W2DL 1HOCA 4XNQB 4ELKA 3TVMB 3CXDH 3EZJB 5J6HB 3KLAB 4LCWD 1MCPL 1RK0A 3U0TA 1NGWB 1CDYA 1RZ7L 1J1XH 5CBEA 4Z18A 3C2AL 1LEKB 3VD7A 4S0TD 5ESAB 2JK5A 4WNQA 1XCTB 1FZKA 4UTAH 1NBZB 2LU3A 5INCA 1KNOB 5C0CE 3MUGB 3F65A 1FNGA 3V4UH 3KLHD 2DMCA 2PW1B 5ITBH 5IG7A 1FZOA 1EAPA 1RZJC 4NT6B 4P2QE 2IFFH 3N0PB 3K0WA 1JF5A 3S6CA 4XVSH 2WLYA 3O6FB 1Y6KR 4NQEA 2D7QA 5BOZG 2FWOB 2HLAA 4TUKL 4POZD 1R3HA 3N1QC 1W2KT 3PWPA 5JDJA 1F4WH 5IB3B 2E5EA 3MLYL 4V1DE 1I1AD 3IFOA 5I2IB 1K5NB 4HQQL 3Q1SH 3E3QC 4MQSB 3MLXH 5DRXA 1B3JA 4X7SL 5DLMH 1JF1B 1FNEB 4Z78A 3DTXA 3HPJB 2Z8VC 4CUCA 4KMTH 5ALBH 3K2UL 3ZTNL 3BFOA 3IYLW 2IANE 2O5XH 5JOPD 2Q3AA 2YPLB 3RWFA 1S9VA 5HDOA 1NCNA 1D5IL 4EUPB 1FIGL 2BY3A 5D1XD 2FIKA 4YXHH 3PXJA 1NGQH 4U1JB 5EZLA 2IQ9L 5D72L 5IBUB 5K9KA 1G7HA 3JXAA 5IMOA 3X3GH 5L0QC 5DURB 1WCBB 3UPAA 4ZMAT 1DQDH 2GEEA 4HUWB 1OAKL 2OQJB 5C8JA 3TO4B 3IFLL 2HKFL 1JZ8A 4G6FD 4MNHA 1ZHNB 3P9WB 5HSFA 2V2XB 1JTOA 1JCKA 4KJPD 4FQLL 4YDLC 1PQZA 2VSDA 2H6PB 4I5BB 4PRPB 2ADJA 1A2YB 5HDBF 5E9DD 3QIUB 3BEVB 1KN2L 3B2VL 4XPBL 2BSED 5EIIA 1LQSR 4LLQB 3GMLB 3GDBA 3PP3H 4ZOCA 1WBZB 4L8DA 1UH3A 1R5IA 4P5TA 5C86A 3VFPB 3PP4H 1NC4D 3IU3B 5IWLC 5IFHL 4PRHB 4JM2C 1NCUA 5EIQA 3HUJA 3O6ML 4GKZA 3BP4B 1M05B 3TJHD 1S7QA 4OCLC 2IMNA 3GKZA 4WI8A 2WWMD 1A47A 4ZUWA 1ZGLM 3P77A 3DO7B 2FX9H 3TBWB 3MXVH 4YXLH 1FVEA 3OKOB 3G6JE 1JWUB 1NMAH 3QEQB 5CZXD 5I18H 1MWAB 3MGTB 5GGQL 3P2TA 3ZYOA 3MLVL 4POZC 4K3GA 2EZ0D 3P3YA 3HZYA 2XY2A 3TN0A 3IU4H 4P2OB 1LEKA 3MBED 2EEDA 4PJXE 3QCTH 1MREL 5K59F 2AXFB 1VPOL 4KZEL 2YA1A 5CKAA 3O6FD 3QNYB 4HIIA 1NUFA 3NIFE 1PZ5B 1M7XA 4K07A 5IVXA 4K7FB 2A6IB 2YZ8A 3PF2A 4NO5B 3VD3A 3FHAA 1EZVY 4OFPA 4LPUA 3U4EA 4X99B 1W0VB 5KVFL 3WEXA 1U0QA 4D0DA 1OTUC 3BRGC 2OZ4L 1RY7B 3NCMA 2C5DC 3RWHA 4L8BB 5J13C 2AEPL 3SGDI 3LKNA 4U1NB 1C16B 2YRPA 5AYUH 4YBQC 5FCUH 1WISA 3GI8H 4P4KD 1W8NA 3W5MA 3QQ9D 2DWEA 2AQ2A 3WS3B 4G42B 3G9AB 2V5MA 5HGHA 1QBLL 2ZSVB 3R8QA 2WWMC 1G7LA 3IJSA 1KGCD 2VDRH 1T20B 1DCLA 5EOQH 1E4KC 4Z77B 1RJYA 1ZA3B 1V7ML 3ES6B 1A6VL 4YJZL 3IDIB 4WFGD 5F7MC 5SWZD 4GRMA 5GS0H 3D48R 5DJDB 5FIEA 3ZT7A 1A3RH 5DD3H 1HH9A 4EDXA 4L4JA 4YHLL 4EBQL 1M7IB 1M7DB 2ICEA 5ALCH 3AREA 2ATPA 4KQ4H 5FV2A 5TE6H 1BIHA 4Y5YA 1DSFH 2HJFB 4LQ1A 4DN3L 1C1EH 1DN2A 2ESVB 3EDJA 3V8OA 3TJHC 2A2QT 4MHHG 3T3PF 3V95A 4EUPA 3SKNA 5C6TH 1U8KA 4OZFA 2RCSH 3JWNC 3L9RA 3UBXG 3RI5F 5DGRA 5F1SA 2YC1A 5KS9E 1A64A 3IJSB 5SX4I 1JWMA 4KRNA 5F9JA 2HRPH 3VXQA 3FQXB 4PBWD 3HN3A 5MI0B 1CBVL 3VXME 5A1AA 5SWSB 1HDMB 2K3TA 3B8SA 1UEYA 4EI5C 1HHIB 2B4CL 1ROWA 4EXPX 2OZ4H 5IIEA 2YPKB 4H88H 4OFDA 2X89D 1RURL 4NUGL 5EA0H 1FVDA 4ZSOE 3F7PC 4XBEL 2VQTA 3QWOA 3FQTA 3VG0H 4KI5E 5C08A 5SV3A 3VGHA 4DVBB 4ODBD 1U58A 4Y4HB 3NAAH 1MIEL 3L3DB 1EGJL 3O6FC 4DVRL 1UM5L 5J3HD 4QRPE 4WW2C 5E8EA 5HGAA 4JANB 2YPVL 4DGIH 1R0AL 2YD3A 3ILPA 2D0HA 3QCTL 4XNUH 4TSAL 1TIUA 2E7MA 4JREB 1RZKC 2X4PB 1BQHA 1ZLVH 3ULUD 3VWJD 5I1IL 1T66D 1F2QA 1C7SA 3CFBB 4OD2B 1U8NB 1OAXH 3O4LA 4ZUUA 4AG4H 1VPOH 1MHPL 1N6QH 4JFEB 2E8ZA 4XZUB 5MENE 4K71C 4V1DD 2ZUYA 1WFTA 3NFPA 3RP1A 4PJHE 3ROOA 3ZDXF 3QCVH 5GGQH 2CMRH 3AMKA 4M6AA 5C3LD 2X4TA 4XTRD 3O8XB 3RPIB 3PIQA 2OI9C 2UVEA 4M5ZL 5D4QA 5EO9B 3RKPA 3HG1E 2NY5L 4H88L 4G6AC 5IFHH 5D1ZD 5LGHL 1D5BB 4HG4J 4OGYL 2DBLH 3IAGC 4WFHD 4OZHE 3UCRA 3RAJH 1EHXA 1IM9A 4KI5C 5EN2A 3GRWA 2XZZA 4QY8A 4WVRA 5GGSY 5HYQB 3LB6D 3G5XB 5I1EL 5FYJD 1RIVH 1JFQH 1UJ3C 2WIMA 3ELAT 5JNYA 1B88A 4RAVA 5FO8A 5EU6A 4PJBE 4ORGA 4I0PD 2Q6WA 5FYLD 1A02N 5ACMA 3QSKB 4POYA 1G0XA 4NQTA 5IV2B 4A6YH 3MTRA 2ARJQ 4RWYH 2VXQL 1G7PA 3SGJC 4ODSH 3SCMD 1N5AA 2AQ1A 3MUHL 4PJ8A 3IGAA 5DSCA 3K2MC 3EUUA 3WFHA 1LVEA 3T0BA 1IGJB 4LPYA 3TZVC 1FIEA 3N50A 4HIXL 5IR1A 4QXWA 5IW6B 5KSUA 4OFVA 3PQYD 4XP6H 12E8L 3L5IA 3OGOE 1G7IB 1IT9H 4GRWB 5IK3A 1GC1C 3KR3L 2Z9TA 5FYJE 1TCRB 4DUXA 3SEPA 1G9NH 1RZGB 4U0QB 3S36L 4MDJB 1DBBH 3HCVB 5GRZA 3D85A 4FNLH 5DC9B 4NQCB 4N0YL 4MD4B 4GG6F 2HWZL 5F93C 3TA3A 5AZ2H 2NZIA 3A6BH 1YEEL 3O2DL 2JTDA 1L0QA 2X4PA 3FB7B 4JY4A 4MJ2A 4LSUL 1XR8A 1PY9A 3HI5H 4WEBL 1BIIB 4YE4L 5E6IB 1T03L 1MNUH 3KLSA 3SJVB 1AFVH 4AEFA 4DCQA 5IGXH 1KCUL 4O5LH 2NY7H 4J4PD 1NBZA 4L4VD 3DX8A 2YK1L 2G75B 5I15L 2GW5A 4NYLB 4LDOB 2ITDA 4FQXD 3WN5C 2F54A 4XVSL 1U8OB 4Z95L 5I9QB 1ZGLB 1S9XB 2BNUA 2I9TB 4JPWL 3HE7D 5SWQB 1I85A 1F58L 1U8PB 1MREH 1HOCB 4KZDL 1F4YH 1ND0A 4HIJB 3Q6FB 4LEOA 4K94L 1WAAE 4L3EA 2HMID 3OHXA 1TETH 1BM3L 3BZEA 4JO3H 3UTZA 4ZUWB 2VR4A 3ZHDA 5C0EB 5FO7B 4F58H 3E6HA 4KDVA 1CDBA 1V3KA 1ZEAH 2J7LA 2YRLA 4U1IB 4NQDD 3GSXA 3RVTD 3C5ZC 4GAYA 5E6YA 3NPZB 1AD0A 3TNNB 5HHXL 3A6CL 5TPWL 1LE5B 4LCCB 2VERN 4ZPTB 2XZQH 3WLWD 4X8JB 4MLIA 5E00A 3GMRA 1FYHB 3QNXB 5J7CC 3DECA 4F33B 4KKNA 4PUBL 1I8KA 1DBKH 2XA3A 3BXNA 3AGVA 1KELH 5JO5A 1JYVA 4NWUH 2YD4A 1H3XA 4HT1L 3I02B 5JPMA 3L5JA 5FYKL 1KELL 1KIQA 4U1SB 4EUPH 5D5ME 1RULL 3CUPA 1EH9A 3PP4L 3RIAK 4UUJB 2G60L 3OJDB 3QFJD 3FRPG 5C2BH 3V6OA 2KZ1B 5T5NG 1CXHA 5KVMC 1A2YA 5F9AC 5GGTH 1A6UL 1N59A 5EZJB 4QHUA 5IV2A 1DE4B 4ZG1A 2ARJA 5D7LA 3BDYL 4Z7QE 3DSFH 3ZYZA 2I26N 2VISA 4DEPB 3DX9B 1TZGH 4DUVA 3HA0A 4PB0H 2Y6SD 4LFHG 4HGKC 4ODUB 3QQ3A 3GHBH 4MDIB 4NO2A 3F7QA 4Y19B 2HFTA 2AKRA 1CD0A 4LKXA 3NVQA 3T3PE 2V2TA 1QP1A 1JMZA 3B3IB 5CEZE 2FLBT 2NXYB 5I16A 2I60H 5GRWA 3UBXA 4HMEA 1WZLA 2EDYA 1S5HB 3QO1A 2QSQA 5HHVH 4O02H 4M1CC 2GITA 4Z95H 2XQYK 4GW5B 5DF0A 3MRIB 2VLKB 5HYJB 5JLZA 1Z3GL 4V2BA 2MCG1 1JNNL 4DKFH 2ZUUA 1NL0L 4PB0L 3MJ9A 3EOBA 5C0JB 4DFIA 2ADGB 5E95B 4M93C 3QUZB 2A83A 4LHUB 3GMPB 2OXGA 1FNEA 3RJQB 4QTIH 1Z6JT 4LSUH 1T80A 1XF3A 4YZFF 4ZXBB 5I1LB 2FBJH 1O5DT 3S8WA 2GFBB 1TJGH 3O6LH 3MREB 1GIGH 4OUUB 4Z7WA 2Y36L 5IKCA 3A6BL 3FFCA 4PJ9B 4PGBA 2DLFH 3WBDA 4P23B 3SCMA 1UJTA 2BDNH 3L5WA 3FONA 6CGTA 3ULVC 4X0KA 3EFFB 2A83B 4Y16A 5GGUB 1HWHB 3OAUH 4H1LB 4XNUL 4NOBA 1CE6B 2UYLB 1WTLA 2D7MA 4JFED 5TGBA 4PJXF 2B1HH 1EVUA 3WJJA 2VLKA 5HYJA 3H9YA 1M71B 1YDPB 1MCCA 3EOYG 1IGIL 4FXKA 3UPRB 5IMLA 3TNMA 5JW4Q 2CDEB 4I48A 5E6IA 3JUZA 2YZ1A 5D9SA 3QWOB 3BPLC 5GS2H 3O9WA 2XRAL 3KLAA 2R4SH 3X12A 4NO0B 3IKCB 2R2BB 3OR6B 3D85D 4KZDH 1M05A 3LKPB 4HFUL 3HI6H 2APVA 2WP3O 1YYML 2XXCB 5BRZA 1ZLVK 4HKZB 1I8LA 3N1PC 1QZ1A 4I4WB 2JJVA 2D7PA 3TPKA 1PFCA 4MD0A 4OZ4B 4LLMB 2AJSH 4K3DL 4X6DA 5T33L 3VFWA 4EIZC 3T0DA 1YEDA 3L3HB 4K23L 5GQBA 1C8PA 4P2YA 1KSRA 4HIHA 1RIVL 4KRPC 3DARA 1GGIL 3I02A 1UWXH 1RFDL 4WWKA 1QR4A 5JHLH 3QUKB 1LK2A 4OI7A 4WWKB 3SDXE 4RMTA 2ZCLL 5C0CD 3SJVE 4D0BA 3O2DH 4XI5D 5I0ZA 3VXPB 2DBLL 5DHXB 5AEAA 4ZPTA 3HZMA 3OB0H 3UJIL 4P2QD 1GGCL 2O26U 2H2PD 5KANI 4RFNC 1JNLL 4PJ7E 3EDEA 5C0BD 2ZCHH 2EDRA 2IPUK 1D6EB 4I1NB 3P4NB 1IAKB 5L88H 3MYJA 1W72L 1T66C 3QDJD 15C8L 2V5RA 3KR3H 4TUJB 1UH2A 1CG9B 4HK0B 1I7RB 3EYUH 3P73B 4FABL 4YDIH 3SO3B 4RFNB 3KPSB 1ZS8B 1T0MA 2VLRB 4FZEH 3CK0H 2NXZC 5JW3H 4FS0A 4YDVB 2VC2L 5IMLB 4NNXA 1CXFA 4PJ7A 3Q6GH 3QEHB 1S78D 3PL6B 3QO0A 5ESVA 3VFRB 5FYLE 4DGIL 4JDVA 3D39B 5D96C 4UTBL 3TVMC 2VDNH 3I6LD 4YNYB 3DVNB 1HZHH 2BRRH 2BVEA 3MACL 4HCRL 5JQHC 1LE9A 5H35B 2CLRB 3TGXA 1VENA 4FFYL 1C5CL 5KVFH 1FO0L 4YR6A 4NZRL 3F12A 4L4VB 4XC1L 4TTGA 1I8MA 4KTDH 4PGBB 1F6AB 2OS7A 4NUGH 4HC1L 4X6DE 5IKCB 3BRDA 2DQIL 1QQDA 2RR3A 5FHAH 3SGDH 2XN9B 3KHQA 1J7VR 1T7YA 1ZV5A 1QFOA 5T1KD 4OIIH 5IESH 3NIDF 1KYOJ 3ARWA 1ZLSH 3MRGA 2C4FU 4P9ML 1XCTA 4OF8A 3DUSA 3KPMA 3SDXA 1ULVA 3BT2L 1S7UB 2IAMD 3RIFF 1FC1A 4LSRL 5E08H 3I9GL 3PHQA 5FFLA 4BFIA 1XEDA 1JWUA 1MHCA 2I27N 4R7DB 4MCYA 1YUHA 3IKCA 1E27A 4ZFZB 5F9DC 4EDWL 2DRUA 1RHHB 4H26B 4HSQA 3IFNL 1CGWA 2NY6C 4KQ4L 3C09B 4OCYL 1J11A 1QUNA 5K9QG 4AK1A 1F02I 5L2JB 4G9FD 3ZE2F 3HUJE 1ONQB 2GUOB 3CX2A 1A22B 2Z93A 4HFWA 2Q7NA 3O2WH 4WO4A 2PR4H 3RY6C 2NY0B 3FFCE 1T21B 5FKAA 3BP7A 3X13B 3LKOB 5A40E 4OM1H 1MFBH 5SX5H 4UIMA 5KN5B 1JZ3A 3FRPA 3RU8L 2NY1D 4XXDA 5CJQH 4HWEH 3QRFM 5C7XL 1FL3A 4XVJL 4WHTA 4OT1L 3NZHL 1IGJA 2VC2H 3H9SA 3LQAH 1MIML 5J1SC 2AV1B 1X7QA 2P24B 2FJFA 2AEPH 2NLJB 4FFWC 5HHVL 5E5MB 4LHUG 4QRPA 4QWWC 4ONOA 4WFEE 3IRZA 4NM8L 4UDUA 1XR9B 1DTUA 2KZWA 3FFDA 5BMFL 3KWWA 1P5UA 3H3PL 1CI5A 2FO4A 3UBXI 1BWMA 3VW3L 3MRPB 5C0ND 2CKNA 1CIUA 3BGMA 3BHBA 3EJYC 4C56A 1F4XH 3MV8A 5FEBA 3MXWH 1YUHB 3IFNH 2DQJH 2I5YH 4O51A 3L7EA 1IAKA 3QQ9C 1ODAA 4QYOA 2DWDA 5C0CA 4PJ5E 1KLGB 2EIZA 4UBDD 3O3UN 5IQ7L 3SDCD 2Y6SC 1X7QB 2GHWB 2OMNA 2P24A 5F7NC 5HJ3B 1WVZA 5C0BA 1MEXH 5B4MC 2CSPA 4KAQH 3KXFE 1A6VH 5HI5D 2NTFB 3QULB 1WITA 4X4YA 2BSTB 5E8DL 2BSSA 2CXGA 1MY7A 5DMIH 5C0IB 4Z7WB 1CT8B 5E4IA 4CAGA 2P49B 4J3TA 4YAQA 5T5NF 1Q9KB 4L8CA 3UZEA 1HQ4B 4F58L 4YHIB 4RA0C 1EMTH 3QG6B 3ZYJA 3MRQA 25C8L 5FDWA 4TVPL 4MD5A 3UPCA 3AREC 3KDMA 3FCTA 4PV8A 1AC0A 3RDTB 1UA6L 4HUVA 2XWJB 2R9HC 1J5OH 5DWUL 1EXUA 2OMBA 3L3DA 3UZVB 2DMBA 3VRJB 4F9PC 1CQKA 2R0WH 2OTWB 2KQNA 4EKXA 3N1MC 5IF0A 2BVPA 3O9WB 5CJ5A 4WJ5A 3TZVA 4IOIA 2GJ6E 4J23A 3M8OL 3D87B 4NGHL 2XKNA 4OGAC 3DV6B 3S35L 1IAMA 5CGMA 3RDTA 1WT5C 4XAKE 1S7XA 3RTQD 3KS0J 3WIHL 4OLUL 2FBJL 1HE7A 2YPLD 4FQQA 3DVGA 1LDPH 3PJSA 5KJRL 4KKBD 1NAML 3LPGA 4M48H 3MYZA 1JPSL 3F62A 3JV6B 1YN6B 3C6SA 3RKDD 3CUPB 5DVLA 1NAMH 1YZZA 4KXZI 1WJ3A 2EYSA 5I1CH 1AXIB 1T04B 2HN7B 2UUDH 5D7IA 4IOSD 5T1MB 5FA3B 3M1BB 4F7CA 1NC2A 3WE6B 4ONHA 1WZMA 3BGAA 4PP1D 2ICEB 5IK3B 1IEAB 1VFBA 2P5WB 2HG5A 3DIFA 1FN4B 2DQFB 4DFHA 1HHJB 3JTSB 2XKUA 3I2CH 4WUKH 4NRYB 4U6VL 4KKAC 1IE5A 2UV3A 5ACZA 4WO4D 2F9BT 5TPWH 4Y0GA 5HHXH 3O11B 3CLFH 4HIJA 2UZIL 2RBLA 4O00A 4FQIH 1KXTB 2R29H 2PXYD 1NGXA 3TFKD 1QLEH 3JSSA 4XTRC 5CILL 1RULH 2DYPB 3F5WA 2O61B 4LP4A 3GK8L 4K94H 3ARYA 4P5KA 1Q9LA 4HT1H 3L1OH 4GKSA 1MCWW 1JPFA 4QNPE 2FH6A 1DBKL 3E3QE 4OCXH 4FQ2H 2BNQB 5F1IB 3BAEH 4KFZC 1FSKC 3CDCA 1IGIH 1BFOB 1F8TH 2H32H 3EO9L 3OF6A 4WDIB 2PETA 5JA9A 4FP8H 5IFAH 3O45B 3FO2B 3CC5A 4Y5XC 5CGYC 5E7FA 1EEZB 1NLBL 3A6CH 1HQRA 4X7TB 1UM6L 3W81A 1U2HA 5I15H 2K9UA 1W0VA 4M7ZC 5FYJH 1L7IH 4KUCD 4H8WC 1OP5H 3GMNA 5KSAC 3CCHA 1F6LL 2DL2A 1RUAL 1F11A 2A6JA 5DYOB 4M48L 4NQCA 4EI5D 1RUKH 4D3CL 1BPVA 1AKJA 1KNOA 4ZXBA 1RUMH 4TNVK 4QCIA 1XGPB 2IH3A 2DQJL 4Z0XB 1ZT4B 3LSOA 1OAXL 1TCRA 3QUYD 3ZDYE 4G8GB 1JP5A 3HC0B 3S35H 5JXAH 3GSWB 2VH5L 3RUGB 5IMMA 4G43A 4ELKB 2VLJA 5CUSH 5JHDB 4HBCL 1U95B 2NYYD 4HPOH 1PQZB 3BGFB 3VFUA 3H3PH 5LWYL 2JCCB 1JNNH 4DKFL 1TNMA 1S5HA 5IOPB 2AXGB 2CR6A 4WEBH 5DD1H 1NBYA 4P2RD 3VRIB 4EUPG 3LKQA 4HUWA 3ZE2E 4XCFL 5ADOH 5JW4M 1P4BH 1J5OL 3V4UL 1ZA6B 2ERJC 3V6OE 3RWGA 5IEHA 3GBML 1NKRA 3RWDB 4EJ1C 5HHOB 5ETUB 2HWZH 1H3PL 3CFIC 1X5JA 3TO4D 4YFLF 2YUXA 1NGXB 1RPQA 4XP1H 3RU8H 1NJ9B 5EFIB 2P5WD 4FQIL 1EFXD 4LHUD 4NQVA 4N8CL 5E70A 1OHQA 3JWDC 3DMMB 2BVYA 5DMIL 4NHUA 5HPOA 2Y7QB 4MQTB 3RGVD 1N4XL 5ACZB 5E6IC 1IAOA 1QBML 3TP4A 3UC0H 5M7QA 2H1PH 4WUKL 4WU5A 3VXRA 1BP3B 2BOBA 2HTKC 4LPWA 4PR5A 4Y4HD 2HVJB 3BH8B 2VE6B 4L3EE 3D39E 5D7SL 5C8JB 2YD5A 3CSBA 1K85A 3G5ZA 1YNLL 4PP2A 3MBEC 3C8KA 5DEGB 3QXAB 2MPAH 4RX4A 3TJEH 4HLZH 4L9LA 2BY0A 3O3BA 4L4VE 4P4KB 2R23A 4U1GB 4IHOB 1IAOB 1ZEAL 2W9DH 1S5IL 4EBQH 1KXVC 3L95A 3DLQR 4JO3L 2DYPD 5K9QI 2DLEA 3LHPH 3U79A 2CMRL 3QI9A 4X6FA 1M7IA 3WFZA 2DKUA 4NQVB 4BFBD 3LVEA 5GGRY 6FABH 1I9IH 3CU1A 2EIBA 4Y19A 4XNMA 1DQLH 2CIKA 4LLMA 5MEOA 5KVDH 4Z76B 4U7KA 1F58H 3ARUA 4GBXB 4K3EL 1HHKA 2YMXH 1RV6X 2MNUA 4KROC 5CCKL 4WIQA 2NMSA 4WW1B 1OWRM 4F7PB 2AJ3A 1D5MB 1DE4A 1JGDA 1CXEA 4OV6F 4TQEL 4LF3B 1FL6B 4N90D 5DRNB 5IESL 4J12A 4YHMH 3T77B 4JZOB 1CFNB 2ZJSH 4TULL 4JLRB 1E4WH 1RD6A 4HC1H 1CQYA 3HE6C 2YHGA 5B3JF 1P5VA 4URTB 2Y06L 4D0BB 5MI0C 1EBAA 2O5YL 1MHCB 2X09A 3MLWH 1PLGL 1YY9C 2FGWH 4J7RA 3G5VA 3MACH 3IDXL 1CE6A 2UYLA 3FCTB 1BAFH 4GMTH 3SGKC 4JM2D 2VWEC 1LP9F 1MCEA 3RI5K 1YEGH 5C1MB 4P5TB 3O2WL 1NANH 2EE3A 3DXAA 3GSVB 5ISZE 3SCMB 4BSVB 4WTWA 4R0LA 3S36H 4NZDA 3GSNH 5ACLA 1JYXA 4OCYH 1K4DA 3JTTB 4MA8L 3PE9A 3NABH 2XWTB 3VGFA 3G9VA 1U8HA 3FAXA 4J3VA 2DTML 2D7TH 5HYIA 3KPNB 4O2CB 1XAUA 2XPGA 5F6HJ 4HGMA 3HR5B 3IU4L 1SEQL 1CDUA 5BS0E 1BVLA 1L9NA 1F97A 2HJLB 4PJ5A 4NBXB 5JOEA 2F5BH 3VD4A 2EXWD 4YPJA 2FYYB 4EI5A 4R7NA 4NOFA 1A1MB 4Y4FA 1OAYL 1U3HB 4PREA 1G9MH 5IVNA 3NCCB 4LGRB 4BZYA 1MJ8L 4MQ7A 4OLWL 5FUCE 1AHWB 4Q9RL 3HG1A 3VW3H 1NGPH 3VWKA 1HI6A 3VCLA 2EC9U 5GRVK 3MMEA 4NZRH 1DN0B 2OL3A 1UB6B 2ZSWA 4PGCA 3T2OA 4GW4A 1S7TB 2AJSL 4HGWB 4QXTB 3DRTA 3KLHC 3WO4B 1HHJA 1CR9H 3RWEB 3OXRB 4JKMA 1S7SB 3WL9B 1FRGL 2Y7QA 3QDMB 1A4KA 1QBLH 5J57B 3H9SE 2YPLE 4NRXA 5FYKD 1J87A 1QFWI 2XWBB 4WY7L 1I8LC 4OBSA 3DI2B 3QNXA 3TO4A 5ID1B 5GZOD 3NZ8B 5MEQB 1A6AB 3OSKA 3AS3A 1T89C 3FOMA 1OAZH 3U1SL 4L9DA 3NABL 5EOQL 5CEZH 4TPRH 4WEUD 3NA9L 2GKIA 4KKBC 4A2LA 4D9RE 2W1NA 3GSNL 1P1ZA 3QIUD 1Z9SA 5EU7E 2D7TL 3SGEI 3V79C 1YECH 3P9MB 3ARGB 1GZQA 1ZTXH 1NFKA 1KEML 2X4RA 1VKXB 1MPAL 2E6JA 3JWOC 4O2FB 5HYQA 2VDKL 2RGSA 5I66A 5JIKA 5D93C 1I85C 1WBXA 5B39A 3KNBA 4X6EB 4JFPA 4CVZA 5DVOA 4MSWB 2DM3A 1A7RH 3O0RL 1MQKL 4GUPB 5DUMH 5E00B 4P48A 3DGCR 3S5LG 4ERSH 4X6CF 3QI9D 4DAGH 3VFNA 5JOPE 4JY4B 1EEUA 4CMHB 1EPFA 3MJ7B 4F57L 3VA6A 5ITBL 5I66B 1FNHA 4FQ2L 1CICB 3PV6B 4OI8A 2ZJSL 4TULH 3WS6A 3HMXL 2BVUA 3Q6FA 4ORZC 2R4SL 1KACB 5BZWB 3QULA 3WN5B 3AMLA 3CXDL 4F9LC 4K8RD 4G3YL 4WI2A 3WXVH 1A9EA 1TLKA 5T1LA 4C54A 4M62H 5TQ2H 4PLJC 4OTXH 4I3RH 3UYOD 5CD3A 5HGAB 1FYTB 1F3DJ 3FOMB 2W0KA 4DCQB 3L7FB 3UTQB 1BJ1H 4P9HC 4HUUA 4TUOB 3UTQA 4XGZA 1OAKH 2DICA 3BZFB 5DK0B 3CDFA 4MXWH 4P4KA 4Y4KA 1OTSC 3JTSA 5IBLC 2XFXB 4JHAH 3BUYA 1PG7H 3F6IA 1WGOA 4U6HA 1JE6A 5KSVB 1JPTH 1Y6MR 1NGQL 2ZSVA 2XQYG 3NACL 5KZCD 3DTXB 3HPJA 1KB5A 4PTUA 1P84J 3RWEA 4PR5B 3T3ME 4N8VA 4HXAL 4K9EC 1C16A 5TE4H 1K5NA 1VB9A 3H7LA 3GI8L 3IFLH 1Z9MA 1TETL 5DI8B 2NW3A 4J1UA 1NUNB 4P3WA 3VXPA 3HMXA 2X7LB 4TRPL 1SYSA 4YGAB 3U6RA 4AEEA 5LCVH 4U2YA 5L7XH 3S9DB 4LMQE 4X7SH 5DLML 3L3KA 2E7LA 2GSIA 3DETD 1NMCB 3KPTA 4KRMB 1FDLL 2HT2C 1MLBB 2FSEB 2H41A 1JTPA 4HUUB 4TUOA 3TO4C 4Y5YB 3V52L 2OQJA 4KHXL 5TDOA 3SKJH 1FNSH 2HTKD 3QAZB 3C60C 3BEWA 3BP5A 3GBMH 4S0SD 1FP5A 5FK9B 4AT6B 5IW3A 5IEKA 1DDHA 3VXOB 4QLRA 2BY2A 4G7YH 4JHBA 4F7EB 5E2JA 3LIZH 4WUUD 3E6FB 2QHLA 4FFWD 3K1DA 4MAYC 1LO0L 4P57A 3K1KC 4L3AA 2ED7A 2VR9A 1OD7A 1E4XL 4L29B 4IS6A 5CP7B 4L29A 4X9GA 4I13B 2UZXB 1PG7W 2E7BA 4IMLA 4OF6A 3EOTH 5DD0L 3T4YA 3BGFC 2OP4H 4WU7B 1ADQA 1P69B 2ZG3A 5IMKA 3VXRE 1DBBL 2IH1B 3PWNB 5DJCB 2FX9L 1CF8L 1G7MB 4IDJH 2QR0A 1WFUA 3FQUA 2CLVA 3CX5J 3C08L 1Y0LB 1MFAL 2J4WL 3TH4T 4ENEC 4X98B 5DJAB 1U58B 1UGNA 2LFGA 4M8QB 3IU3A 2V17L 4C58B 1E6JH 3ULVE 1CTNA 1QPXA 2WUBH 4M7ZB 3L1OL 4LHQB 4P46A 1R5WA 3HRZB 2J6EL 5DD0H 3OXSB 1H5BC 2IPKA 1G7JB 4L1HA 2Y36H 1T5WA 4NKMB 4CNIB 1TJGL 3O6LL 4NO3A 2ORBH 1AQKH 5KVGH 4N0UB 3T77A 3NH7L 1HEZA 4D94A 3V7AE 3MJGX 1U3YA 1R24B 4K7PL 1E6OL 5ISZD 3MFFB 3WYRA 4JFXA 4OLZH 5GZOC 1IAII 3FQXA 4LRIA 5HVHC 1HNFA 2EYTB 3ARFB 1CD1A 1KOAA 5MEOB 1RK0B 2ICWB 4ZS6D 3DGGA 2XACC 3Q2CA 4UILL 4WCYH 1AFVL 2VLME 5B3NA 1P2CB 1MVUB 3PDDA 4UU9A 4NWTH 1JGLH 4GJTB 3WNOA 3ZZ1A 3CVHL 1KIRA 2R8SL 2Z4QB 4YDVA 4JFEE 5DHYA 3D6GA 4RFOL 3RGVC 3ULUF 1IM3B 1K9TA 5E2VH 3PHOB 5ESQB 4ZPVB 4L9LB 4PGEA 1NDGA 1FYTA 4ETQB 1GGBL 1MRDL 3ULSA 3O3AA 2MOVA 2F8VA 4NHCH 1A4KB 2QADB 2R39A 1F42A 3D5OF 5GISL 2QQNL 2XPGB 1AXTH 4OCWH 5DJ0A 3I50H 5GJSL 5L2KA 1MAKA 4ORGB 3V7MA 1PSKH 2QQLL 1SJEB 1MLCB 2ESVD 3STZB 1N6QL 1B0RB 2NR6C 2QQNH 2X7LA 4EI6A 4AG4L 5I8KL 4IJ3B 3MMEB 4RMQA 3RGHA 3O9WC 4NFDA 4AY0A 3FL7A 1MRCH 2DI8A 3NTCH 5D5MA 1R3HB 4G42A 4CADB 3VJ6A 2QADC 3MV9D 2FHFA 5JO5B 4UT9H 2Z31C 3QUKA 5GSRB 2D31B 4PJIA 5DJXB 1JPTL 1EAPB 4NT6A 2R0ZH 1NFIB 1MJJA 3CX5K 5TQ2L 2X4TB 4NCC2 4Q2ZA 5FO9B 5K9KB 1IJ9A 3JBG7 2H26A 4FQJL 3BPOC 2VYRE 4OGXL 1F3JB 2NXZB 2BCKA 2KPNA 3AXLB 4X6CB 3LKSA 4JLRA 1MH5A 1U91B 3ZT6A 2GK2A 3OKNA 4UAOC 3BQUC 4AIZB 5CMAB 1VEPA 4WWKC 3IJHA 3U7WL 4JY5L 1J0HA 1KPUB 4HIIB 5EULV 5EUOF 1A6WL 1T1ZB 3QPXL 3TA3D 2I9LA 4HS3A 4GRWE 3ULUL 2ORBL 4CRPA 3IXTB 4P49A 1KB9J 4MD5B 4OCRH 5J12B 4PJ8D 2J6EH 3UAJC 5GRYA 1ZK9A 2IH3B 1NAKL 4Z0XA 1UCBH 1JZ4A 4NFBA 3WNKA 4ZS7H 5BW7A 1X5FA 4YAQB 3LD8B 4JDZB 2XN9A 5KANG 4HS6B 3IDJA 5IVXF 3RWHB 4MXVF 5C08B 3LPWA 1WCQA 3WJLA 1TJHH 3GIVA 5INDA 3MLRH 4RQQB 1MAJA 4DAGL 4PRHE 1T1XB 1HZHL 3WNLA 3EJZC 3NIGF 1BF8A 3BH9B 1JYNA 1PAMA 3MREA 1FG2A 2DS4A 1CFNA 4GUPA 3CDGB 1K8IA 3VXSA 2NY1B 3OV6A 5EG6C 2AV7A 1DL7H 2A74A 4PRAA 4GAJL 4OKVA 5CIPA 3S3SA 1IM9D 1AD9A 4C83B 4ONFL 1CIDA 4PBVC 1I8IA 3DV4A 1IEBB 1QRKA 3LIZL 1EGJH 4OZHF 4D9QD 5MERB 4I0PA 4KVCL 1KJVB 5D5MF 5B38G 3D2UB 5IB5B 4PG2C 4KI1A 4P3DB 4KHXH 4PJFB 4UT7H 1CL7I 1MF2H 5JORB 3MV9B 3U1SH 4DTGL 3P4NA 3N85H 4P2CG 3QFJE 2P5EE 3NMEA 5CJOH 1CZ8H 1BGXL 1ZT1B 1YJDL 1PD6A 3UO1H 2R1XA 4KGLA 4PS4H 4LLUB 2HLFD 2C3GA 3KG5A 3V4PL 3HR5A 2FIKB 3P9LB 3ARDD 1NFDE 1N3NB 2BX5A 3R0MA 5D7LD 3KJ4B 4LHJB 5FV1L 1BFVL 4CADA 2OL3L 5D5MB 3SE3A 1RU9H 1DVFD 1TFHA 1ZLUK 2D7NA 3RAJL 3LEVH 2E8YA 1FVCA 3BXNB 3RVVC 1UENA 2V2XA 3WIIH 1MJ7L 1INDL 2XG4A 3GJEA 3B9AA 3P9LA 1GGTA 1UKTA 4FG6D 4RIRA 5DQJA 3HPLA 4CVZB 1OQXA 4GH7B 1OTSD 2QSCL 3FO0L 2UY7A 3V6ZA 2CDFA 3FQRB 1U3HA 4LLVB 3RVTC 2J88L 3OKMB 3D39D 2IADA 1EHNA 3NOIA 3H0TB 3OAYH 1HH6A 4IOFC 3Q5YA 4P9MH 2FB4H 4PD4K 3NPSC 4FZ8L 2J5LC 3IKKA 1D5MA 2IALA 4KROD 4NQED 1Y6NR 5AAWA 4U33A 4LSRH 5F7LB 3HZKB 2F15A 2P1YA 1LD9B 1ZANH 5FUZH 1OF2B 3U0TB 4X4XA 2NY5C 5J0BA 4RFEB 2H8PA 2R2CA 1C5CH 1G6RA 2ZUXA 4KUCF 5TH2B 3ZT5A 2A74B 2XYCA 3PWLA 1MUJA 4ZNCD 4Z5RA 5IWLA 4APQD 1Q9OB 2B20A 5EZOH 3AM8C 5DDHB 1MFCH 1UWEL 2APTA 3PV6A 5EO0B 3MRRA 5A2LH 3UTSA 4N68A 5DVNA 2NPLX 4ZYKB 2WBJB 3QDAA 1J0KA 2R2HB 2DLHA 3IDXH 2ICES 2IC2A 4LCWB 1WWCA 5E2WH 3TBTB 1KEMH 3UTTA 2VDNL 1CCZA 4X98A 2Z0BA 1AGDB 3QIBC 2P5ED 2P7TB 1HDMA 2VDPH 4HW6A 1YMHB 4JY6B 2YMXL 5CCKH 4JKKA 4Y1AB 5EUOB 1E0OB 5INCB 1CBVH 2IQ9H 5D72H 3VFOA 1WBXB 5EU5B 4LARL 2FZ3B 1MF2L 3PWNA 4XH2A 3GZKA 1K8DB 3Q48A 3QEUA 5I1GH 1CICC 2CRYA 1JWMB 4NHUB 3IDYB 1RJZB 4TPRL 1F13A 1B0RA 3ARGA 1TZGL 1AHWA 1X44A 1QBAA 4YX2L 4HUXB 2BZDA 2BNRB 3MJ8B 5ALBL 2VLKD 5HYJD 1TVBA 2VISB 1KCKA 4OLYL 3I6KB 4Z7VA 5IW1A 4MA1C 3EDKA 4IMKA 1ZT1A 3O3AB 1G9NC 3G5YA 4K7PX 4YHPB 3BKML 3T3MF 1PYWA 5C2UB 2V7HB 1NBYB 4PJ8C 1Z2KA 4WHYG 5GRUL 5BRZD 3QCUL 4PUBH 1FC2D 5K33A 4CU7A 2FDBP 1VFOA 4PRHD 3O81A 4P3CH 1EXUB 5TDPA 3TT1L 1RFDH 3R8BB 3QFDB 5D2NE 3DGGB 4HLZG 1CD8A 3C8KB 2IAMB 4KMQA 4N8CH 3O8XD 5I1AA 3IF1A 4M7KL 2HYMA 3ET9F 4GMSH 1Q0YL 4YGVA 2JF1A 3FT3B 5HHPB 4OZIA 1UWXK 1JK8B 4BKLA 4PRPD 1QKZL 1I1AC 1OAUL 1X5IA 3BD5A 2OJZL 5L6YL 1QEWA 3J8F7 4GG6A 4AH2B 3W9DB 2GTWA 4YZFE 1ND0B 3LMJH 4LAJH 3VU2A 5F3HA 1CDHA 1FH5H 2FWOA 4HPYH 2PO6A 5EOCL 3HAEG 4LRNH 5F8QC 2NY2D 4XNYL 2XZAL 5J1AA 4YXHL 3AY4C 4UT7L 3QHTC 1A4JB 3OAUL 1I7ZB 4Y4KC 1X5ZA 1RVFL 3PWJA 4OGXH 2PW1A 2BDNL 3MV7D 1DQMH 4M6OL 5IEHB 3WKML 3OAYK 4F7PA 1SEBB 4CVWA 4PV8B 4KZEH 4M6ML 3P0YL 1BECA 3WDJA 1UJ3A 2F58H 1XCQB 1KUMA 5IHUH 4FQXB 4J3WA 4ZFGL 1YEGL 2F5AH 3MLYH 1SYVA 1HH6B 1KPVA 1UVQA 1PEZA 3ECBB 3WV0A 5MEPA 1L0YA 2EXWC 2GY5A 4LVNB 2ZP0T 1UM6H 3D3VE 2WMPA 1LEIA 1QRNE 2WIIA 4O02L 4YHNA 1FFPB 1FN4A 1AXTL 2AK4B 2Y06H 4N90E 4OCWL 1FV1A 3AY4A 5ID0A 4JJ5A 4XXCC 3QNZA 2F19L 4NHCL 4JN1H 1L7IL 3GSRA 2W9EH 3NFSL 4JDVB 1IVLA 3GUTB 1IGFH 1RSFA 2IGFH 1KLFA 3GHBL 5FOBA 3H2WA <