1C08B

Crystal structure of hyhel-10 fv-hen lysozyme complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10)
publication title Crystal structure of anti-Hen egg white lysozyme antibody (HyHEL-10) Fv-antigen complex. Local structural changes in the protein antigen and water-mediated interactions of Fv-antigen and light chain-heavy chain interfaces.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c08B00
4H1LB 1V3JA 1U8LB 4G5ZL 3CSGA 4O5LH 1B4RA 4ZTOL 3GIZL 2P46B 3GBNH 4I4WA 2V2TB 2ZSVA 1FNSL 1J10A 1BZQK 3SKNA 3MZGB 3QXWA 4FMKA 4O00A 4HUUB 5ELIA 4ODSH 4Y5YB 1NCBL 3DSNA 3QUYC 5I8KL 1EMTH 1OW0A 3CX5J 5IHUH 3U1SH 1C16A 5ANMA 2YHGA 3TESA 4NQDE 3G6JA 2FX8L 4GKZA 4L3EE 2V6HA 4ODWA 4YO0A 5C0ND 3Q48A 2H26A 4OBRA 3V5DA 5A16A 5ETUA 1SQ2N 2AXGA 1IM9B 4R4FH 5C6WH 1ZGLP 4WWKD 4Y4KB 5IVXE 3LOWA 3PGFL 1D9KB 1IEAB 3W2DL 1ZA3B 2ED9A 4J8RA 2BC4A 2W38A 4K7PH 3ESVF 5T3ZL 5JO5B 3GJEB 4S1QL 1D5BA 4CDHA 4DKFH 3HE6C 3LY6A 4HC1H 1G7IB 2C3VA 4JM2D 1DBKH 2VITA 4L8SB 5DFVD 5DWUH 1MFCH 1P7QB 4OKDA 4R7NA 1QSVA 4OZ4A 4LEOA 2P24A 4KKBC 1MCDA 3QIWB 4PR5A 3B9DA 5F7EL 5I6XB 1OQXA 3ES6B 1AY1H 3F58H 5D7JB 1VHPA 3IETA 5L7XL 4TSBH 4M8QB 3A6CL 1IAOA 1PEWA 1D5MA 4MA7L 5CEZH 4XVUC 1U91A 1MSPA 1CG9A 2HT4C 4UV7H 2B0SH 1OM3H 3SDXE 3EYVA 4GQ9L 4JLRA 4X7TB 4IOFC 3J8F7 1N6QL 3Q3GB 2WAHA 2W9EL 5GRZA 2FGZA 3KPMB 5CZXD 2F15A 1AXIB 4CL7A 2QKIB 5GJTL 2HJKB 2COQA 2Z92B 3TO4B 3DPBA 2ESVB 3BWAB 1I1AD 2IGFH 1BVKB 4JGJA 4Y19A 3F7YA 3U0TA 4YXHL 4JANA 5K93A 3GKZA 5KVDH 5E0QA 5GS1C 1KCLA 4P5MB 1H0DB 5CJOH 3VXPB 5LQBH 4PJFF 2CIIB 4L29A 4LCYB 3UTQA 2AJUL 4WENB 2HKFL 1TJGL 4MQ7A 4XVJH 2DWEA 1KSRA 3Q6FB 4OZGF 1RU9L 4HXAH 3E2HB 1CF8L 4RAVB 1M7DB 3DVIA 5HYSA 4BSWA 3QPQC 3TJEH 5IW1B 4PLJD 4PLKD 3MNVB 1OAKH 3CXHJ 1YNTA 4MNQD 3ZHLA 3GSOB 2IFFL 1F00I 4IMKC 4C58B 2R0LH 4K3JL 1T3FB 2DAVA 4JFQB 1C12B 1YEFL 1DANT 3OKNA 3RI5K 2FECI 3IRZA 5LVEA 3CVHH 3BKCL 3AM8C 4TTDD 2HAZA 2LTQB 3MX0A 1Z3GH 3SOBH 5HYQB 3BP4A 2Z8VC 5I1KL 1N5AA 5JQ6L 3MLSH 2VC2L 3AS0A 1WWCA 1D3CA 3TWCH 1MHHB 5C70A 4Z7NF 2DM7A 2VXVH 3DX8B 3HPJA 2IG2L 2B1AH 4PRIB 1B0RA 3ZDZF 2VLJB 2QV2A 1J12A 1BFOA 1K5NA 3PWLA 2CGRL 3NIGF 3C2AH 5CD5D 2YD6A 4LCIL 4Z7VA 1E6JL 4NN6B 4PY7A 4UAOC 1WIUA 4NO5A 5DEFA 5E9DB 5GRUH 2E7MA 4GKSB 1UZ8A 4CNIB 5DC9B 3N85L 1KPRB 2VLRA 2AXFB 4NRZB 3K1KC 4QEGA 3PWPB 2ZG2A 3PGCA 4Y4HA 4V1DD 2JB6B 3R1GH 5C0IA 4XZUB 3G5VA 3BVNB 4WEBL 5E2VL 3QIBD 2R2BB 3C5ZB 3BZDA 3VRLF 4MNQE 1FNGA 1PG7X 4PV8A 1S78C 1HINL 4YE4H 3L5HA 1GC1C 2NY1B 1EAJA 2PN5A 1DDHB 4R90H 1OT1A 5EPMB 2E5EA 2PTUA 4JDZA 3V5KB 4EUPH 3FT2B 3HS0B 2F54D 3KYKH 2X40A 2DQCH 2YPLA 3WFDH 4EDXA 4CADA 2ZUWA 4PB9L 4P3CL 4E42B 3BQUC 1EHNA 5C0GB 3RVUD 1QBLL 1TETL 5BW7C 3L95B 4QGTA 5HDBF 2QQKL 4ZFOB 1EEZA 1A6UH 4F9LA 1CLYH 2GFBA 2NX5D 2YN3A 1HXMB 1QFWM 5F93C 3BW9B 2WQ8A 1U8JB 1SJVA 3QEQA 2AAVA 3FRUA 2WWKO 2VZ3A 4ELMF 1KEMH 5DMIH 2ADGA 5D96B 2WBJD 1F97A 3SCMD 1JPGB 1XCTB 3SKMA 2J8HA 4Q97A 3V4UH 4Z77B 3CZFA 4GMTH 1LMKA 4NQCE 3SDDD 3FOMB 3BX7C 3HMXA 4JQVA 5IGXH 1PVHA 3NA9L 4Z7OF 1V3KA 5I8CA 1LHZA 5TGBA 4TVSa 4X6CB 3WO3B 1A14H 1QFUH 4WHDA 5DK3A 1G7JA 4PRHB 3CUPA 3NFPB 4V1DE 1ZANH 3ZKNC 4JFHD 5T3XL 2IPKB 5KJRL 2E9BA 3MLXH 5C71A 3FN9A 2GJZB 2A6IB 4R0LC 4U1IB 1YEIH 3F7RA 5IEHA 3O3UN 4Y7MA 3BP5A 3E3QE 5MHSD 2WK2A 4HJ0D 2VR9A 3M8OL 4OTXH 4I18B 3F7QA 5IB1A 2F54E 2XTJD 4DQOL 1Z0MA 5GSVB 2MWCA 2EYTB 3CU7A 4HLZG 5J9PB 3ARGA 2A0LD 4JY5L 5E99L 2FYYB 5KSBA 1LEIA 3OJDB 4MHHI 4NCDA 1CLOH 4LGPB 5E2UL 5ERWB 3HZYA 5IFJB 5L6YL 3MV8D 2A2QT 1F4AA 2BNQB 2YD8A 1QFHA 5I76A 5IV2B 3LKPA 4NFBA 4PS4H 2Y4SA 2XPGA 4YIQA 3LEXB 4ZG1A 3DLQR 3RVWC 3PWJB 3B2VH 1Q94A 3EGSB 2VDKH 1T83C 3N9GL 2A77H 2C4FT 6FABH 4UNVA 3GGWB 1CFQA 4F7TA 1T1ZB 1F90H 7CGTA 1T89A 4XPGL 4YDVA 3MRDA 3DYOA 4M1CC 1A7NL 3PG2A 2YRLA 5I66B 2AABH 2FJFA 1FRGH 2VNCA 2FZ3A 2JCCF 1A3QA 3MA7A 4PJ5B 4WI2A 5DD6A 3G5XB 1M05A 5IR1A 3D25A 4JFHE 2JK5B 3WYRA 2P7TA 5DEGB 2NY2C 2A73B 2MPAL 4L5FL 4KVNL 3VD9A 3TF7C 4QWWC 4F57H 2DLEA 1F3DH 3SDAA 5MHSE 4X8JB 1WGOA 1J1PH 2APVA 3RKDC 2XTJE 3PDDA 4JRXA 1U8NA 1X44A 1TJIH 1BHGA 1HHGB 2IQ9H 4LEXL 2BOCB 3U0PB 2WV3A 5HDLA 4LQFL 1WF5A 2NX5A 3BD5A 4JPKH 4B0MM 3SDCB 3GMPB 4LVEA 5IVNA 1AR1C 3PJSA 4Y5YC 3MV8E 4G6FD 1VKXB 2Q8BL 2QQNL 1DP0A 4JJHA 5K9OA 5SWSB 1IMHC 1KYOJ 2I24N 3PL6B 4HIIA 3SCMA 3KYOA 5J57B 1JE6A 1NGYB 2BVOA 3HUJE 1IC5H 2CO6B 1JFQL 2IJ0C 4Q9CA 1C5CL 2BNUA 4HHAB 4LNRB 4QYOA 2YSSB 5A1AA 3JWDL 5JMRA 4BJLA 4Y4KC 4AM0A 4R2GD 2X4PA 3QUMA 5C0CB 3OKMB 1T21A 2RQ8A 3WN5B 5HHQA 3SPVA 1D9KC 4X6EA 4OLWL 5DRXA 2A6DA 3O8XA 3UX9B 4X6FB 4Z95L 2ZUTA 1BD2B 2CRMA 4GXVL 2QR0B 1IGCL 1YNKL 3ARVA 1WAAE 2GYSA 2VISA 3RY6C 4EI5D 1HI6B 1R5IB 2FWOB 5GGTH 4ZDHB 3O0RL 4KH2A 2E8ZA 3CFBB 3EZ8A 1CBVH 4KUCD 5BZDB 1J5OH 1BOGA 3QHZH 4KKLD 4KPHL 3RY5A 4NO3A 3V8CA 5T1MA 3QIWC 4HKBB 2XWTB 5AWNH 5I6XC 2ICCA 3B9KB 1S9XA 4KKCC 5JMOC 4DN3H 5D7JC 3O2DL 3DVFA 3DIFA 4YFEA 4PJDA 5IBLD 2MQCA 3AREB 1IEHA 4FQ1L 3U2SA 2I60H 3LKNB 4I0PB 5I17A 5I1GL 3RVTD 4DWHA 4NKOB 1QVOB 3BI9X 3PE9A 4F33A 3QUZA 3U9UA 5JIPA 1T0NA 1SBBA 4L1HA 2R1YB 2V2WB 2WIIB 3FONA 4O51B 4HBCL 2GK0A 4PGDB 1R6VA 2HJFA 4FFVD 3VGEA 1HYRC 1EUUA 1NCAL 4AL8L 3IDMB 3GHEL 1NAMB 5FOJA 5D7LD 1A0QH 4LCWD 1ADQL 4J3XA 2FB4H 5HHMD 1Q0YL 4JFYB 5FYLL 2P5EB 4ZFZA 4MJIA 3TO4C 1SVZA 1EXUA 2Y1VA 4OLEA 2V5YA 4NRXA 1EEYB 4GW4A 4KJWD 4X4MA 1HHIB 3KGRA 4LPUA 3I2CL 2HKHL 5L9DL 1H3PL 2LAGB 2QHLA 4TSAH 3UYRL 1UENA 3VXQB 5I71B 3BN3B 1G0DA 4MB4A 3X13A 3E2HC 5DUMH 5ISZB 4WEMB 3LMJL 4OFYA 3MV01 3TBWA 5FOBB 4G43B 2BSSA 3WCYA 4D9LL 1PY4A 1UM5H 4QOKD 1G7QA 4F7MA 5E2TL 2OK0L 3CXDH 6CGTA 1OGTA 2DDQL 5I15L 1SYSB 3LQAL 5CAYB 3VG0H 2EDJA 3VFNB 4TUJA 1IKFL 3CK0L 5HTSA 1YMMA 2LTQC 5C0BD 1CXFA 1MFAL 1Q9KA 3OSKA 4OCRL 1QLRB 1AHWA 3AAZB 3T65B 3LQZA 4TRPL 2IH3B 3FFCD 2X4TB 2VE6B 3CFEB 3PWUB 3FN0L 4Z7WA 1TZHB 3H9YA 4MAYD 4GSDL 5D7LE 5L88H 5JORB 1KPVB 1U8MA 2HFTA 1QR4A 3I9GH 1PDKA 4LCWE 4OGXL 2ZSWA 1YDPB 5HHME 3U9PL 1VFOA 3ARFD 1EV2E 2VDLH 1MI5E 4KDVA 5TE4H 4A2MA 2PYED 3MODL 2CLVB 4NN6C 1HDMA 35C8L 4I0KA 3TCXA 1RULH 1DQML 1WT5C 2D0FA 1S7RA 4F3FA 3VRIA 3H9SB 4I2XB 2K9UA 4YEEA 5GIRA 3CSBA 2UYLB 2X4OA 1GZQB 3HB3D 3LQMA 3PXJA 3QWOA 4P9ML 5BS0D 5IW6A 2OTWB 1FBIH 5J1TC 1DCLA 5DDHB 1DBJH 2VIRA 2RHEA 3UBXI 1KIPB 3VXOB 1KACB 4X5WB 2IBZX 3LDBB 4ORGB 4QOKE 3QCTH 5KN5B 3T2NH 1C08A 1XZ0A 4FQXA 3X3GH 1UWXH 2NY1C 3O4LD 4L8DA 2HRPL 2AK4B 3H7LA 5IFAH 1R5WA 1PAMA 1V7ML 4F8TA 2CUIA 3CFDB 4N90E 4OGZA 1SBSL 3MBEB 1MUJA 3OQ3B 4O02L 5C0BE 3ULUD 3Q5TA 3K0WA 3HNSL 4LSVH 4X83A 4LSDA 3ZKXC 1XGTA 1QA9A 3FFCE 4PLOB 4XPTL 5C0AB 4CVUA 3VCLB 2FHFA 5DJXA 3QXTA 1TCRA 5DRZA 5B39A 1F02I 1JWMA 5CHNA 4JFDE 2FGWH 3LS4L 2R1WB 1SJEB 1BEYL 1G9NC 5FK9A 4X7CC 1F42A 4KGLA 4B7LA 4BQCA 4E0RA 5D96C 3EJYC 3MRGA 4Q0XH 3QQ9D 5D71H 4BA8A 5INDB 1B3JA 2J7LA 2PYEE 4AMKH 1WBXA 3EUUA 1ZMYA 4D0DB 1YYMH 4L9LB 3OPZL 3DHJA 3FZUC 2ZG1A 4EN3A 3V4PH 2GCYA 1AGCB 3ZYZA 1TZGL 3KR3H 1KEGL 4ZPTB 2X9YA 4I5BA 4UNTA 1JMZA 4GRMA 4FZEH 4OM1H 4M1GH 5BS0E 5C0RH 4ZUWA 2DWDA 4PGCB 2Z31D 5T1LD 1NL0L 2E9WA 5HHVH 4PTUA 1G9MH 1MRFL 3RL1B 2J4WH 1KCUH 3P4OB 2BCKB 4Y2OA 3UTTD 4PFEA 4KV5E 4FQIL 3MLTB 5MEPA 3P9LA 2ATPA 2XWJB 3FRPA 3T77A 3O4LE 4M5YL 2WUCL 3V6OC 3MV9B 4JRYB 4NJ9L 4JGUA 1BBJB 4OZHA 1EZVX 5D7IA 3QJFB 4I18C 4Q9BA 5GGUB 3ULUE 1A7OH 1ZA3A 1HNGA 1IJ9A 5JO5A 5CUSL 3GJEA 3V7AG 4Y4FB 3RNQB 1INDH 1AGDA 5JHDD 4ZO9A 4K94C 4Y16B 3RL2A 3IDXH 5AZEL 4OFKA 3V4VL 4WI3A 5DQJA 2MHAB 1MPAH 1R24B 3MUGB 3STZA 3GSNL 3MRPB 3EO1A 3IDGA 3QXAB 2XN9D 3IDIA 3BD3A 1DBBL 1DVFB 2EO1A 4K71B 1ITBB 3T09A 3ILQD 2YWZA 4Q6YA 1T7YA 1W8NA 4QRPD 2L7UA 3A6BH 4NZRH 2DQIL 2AP2A 1CZ8H 2Q76B 2AEPH 1PG7H 2FIKB 2F53B 1UB5B 3RVVD 4WV1B 5FO7B 1QP1A 3UTTE 1V8HA 4X7TA 1OD7A 4PP1D 1KG0A 1JPST 4QRSA 1QBML 1NGPL 4PRDA 3TJEL 4WI6A 3PWNA 1PJ9A 3KDMB 2Q8AH 4NNPL 4PJHB 4DOHE 1GHFH 5B3JF 3VA6A 4YC2B 2MNUA 1BVKA 3HZKA 5JHDE 1QO3B 3VDBA 1YY9D 4K2UH 3SDCC 3BKJH 3MNZB 3AROA 1KB9J 1HILA 3MRLA 3PL6C 1RVFL 2UWEF 1CS6A 5D1QA 4Y8AA 1U95A 4HLJA 1CGTA 2X4SB 1QRND 5IW1A 2GITB 2H1PL 2Y5EA 5EZOL 2MCPH 3K2UL 4HG4K 1M71A 2XN9E 5BJTB 3TVMC 2ZPKH 4CMHB 1J1OL 3Q1SH 3O6MH 3RHWK 4U6HB 5DO2C 2EDRA 3VXRB 4LP4A 4LCCB 2VLKA 4HKXB 3WN5C 3VFVA 4QRPE 5JPNA 5HPOA 3X17A 3WHE1 3WLWD 5D72H 5EOCH 4XXCC 5D2NE 3WNLA 4AH2A 4HULB 2GSIA 3VFOB 1DLHB 5HI4D 5DGQA 2BSTA 3T4YA 3MCLL 4ZFGH 4NO2B 1OTUD 3O6FB 5GGSA 1QLFB 2RIKA 1FFOB 2PW2A 5KVGH 3TH4T 4ODUB 4S2SA 4NRYB 4DKEH 1K3IA 5CFHA 1C8PA 5FA3B 1EAPB 5SV3A 1LGVA 4GRWB 3GNML 1VDGA 3ULVC 4FXGA 5I0ZA 4XPHL 4MX7B 3QQ4A 3B9KC 4Q9QL 4TVPL 3Q2CA 1TTGA 2Y36L 1RUML 4P99A 3UROR 2Q20A 4JM4L 1UA6H 4IRSA 4EOWL 3TC9A 4I0PC 4RMSA 3OMZA 4WHYG 5M7QA 1N6UA 3EYOB 4I8DA 3AY4A 4P49A 2AGJH 4TNWK 3UJTH 4DCQA 1S3KL 1N8ZB 4LPWA 5D5MB 2VXUL 4YHKL 3PWPA 4ZSOA 4FFZH 4KK6C 4ZXBD 3BGFB 2JB6A 1DR9A 4XBEL 1IAKB 3BVNA 3S36H 4KMTH 3U7WH 1W2KT 1QRNE 2R2BA 1YECH 3CDGB 4U6VH 3BDYH 1K6QH 1MWAA 4H20L 5TE7H 3CVHB 1I75A 1KEML 4J3UA 4XPFL 1K85A 1AFVH 4KK8C 4DVBA 5EPMA 2A9MH 4QHMB 4M7JL 2B8OT 1ZS8A 1QSZA 2CUHA 4DZBA 1P84J 3DX6A 1I9JL 2BOBA 5FCUH 1HQRB 1BQLH 4WW1A 4WNQB 1SEQH 4HS3B 3X12A 4NGHL 1NFDB 5EUOB 3O41B 5I71C 5CGMA 5EOQH 4EKXA 1HXMA 3HE7D 3GZKA 3D6GA 2R9HD 3MRBA 2DKSA 5D6DA 4OFVA 2VTFA 3GSVA 5DRWB 3PABB 2HN7B 2Q86B 1A4KB 1FCCA 1YEEH 5F7NC 3TCLA 2DYPB 4AENB 1CE6B 2Y7QB 5K9QG 5DSCB 1QQDA 2P1YA 3ZLQC 3H42L 3FMGH 4HMEA 4ODHH 1OPGH 4A6YA 4EBQL 4Y5XB 1S8DA 4Z0XA 4MCZB 1EHAA 5DQDL 4O58L 2BSRB 4WO4B 1OY3B 4JG0L 3C87A 1KXQE 3PDOA 3V0WH 4Z76A 2FJHB 2JJWA 3L3DB 1QSFB 4LDEB 5BMFH 5EU7E 2APBA 5CCKH 5GZOD 1JGLL 4WUUA 3ZTNH 4PD4J 1FFQA 3OV6A 1FNEB 1ZEAL 2R23A 2FATH 2V2XB 2EYTA 4YX2H 2A74A 5IMLA 1FORL 5M95B 3QWQB 1T7XA 3HC0A 4WDIB 1J0JA 4Y88A 1RK0A 5D70L 2HT3C 2EC9U 4HWBL 5DI8A 1G84A 15C8H 3NN8B 1YMHA 3M17B 1A7QL 3UPAA 5C3LD 1FYTA 1C5BL 1CFNB 5FM5O 3BN9D 3PQYD 1X5JA 3PWVB 4NWTL 3LDBC 3K46A 2Z9TA 2DBLH 2ENYA 3JZ7A 1JZ2A 4F8QA 4YHNA 5ESAA 5C08A 3OGCB 3IKCA 4DZ8A 1LE5A 1I7UA 4XP9H 4KY1H 4NZTH 5FF6A 3MBEC 4N5UA 3EYSH 8FABB 3Q5YA 2BRQA 3CDYA 1G7LA 4JFFD 2VDNH 2B1HL 4P23D 4RIRB 5E08L 1FPTL 5C07D 5DHVH 4BFBD 1T6WA 3QFJD 1LNUA 5ICZA 1PZUB 1CVSC 3GHBL 2JJTC 2IPTL 4NQTA 3SE9L 2PYFB 3EO0A 5DD5L 4DVRL 1QFWL 1JCKA 4OCXH 4LAJH 1FG9C 1Z5LA 3ZYJA 3D39B 1OT2A 4S1SL 4J1UA 4QHUA 1LK2B 4XC3L 1XR8B 3U6RA 4S1RH 3SGDI 4HIJB 4L9LC 2NTFA 4W70A 1YPZB 3MTRA 3OXSA 1IT9L 1S9KC 4DGYH 3O3EA 3QQ3B 2XKSA 3R06A 4ZUSB 2NMSA 3MRQB 4GW5B 1ZVSB 3RTQD 4K3DH 2R2EA 3DVNA 1L7TL 1QLEH 1FE8L 3HI6H 1JPTH 3NCMA 1WZMA 3D3VD 5MEOA 3FO0H 5HDQH 2X5PA 3I50L 3QO1A 1MCPL 4M61B 1A7RL 2BJMH 2ED8A 3N1MC 3O4OC 3FQRA 1U3HD 3QHFH 1INEL 1H3VA 4FZ8L 3PQYE 3ARUA 5K9JH 5DD0L 1QSEB 1QNZH 4HS8L 4PLNC 4P46A 1YEDA 1OOAA 1B6DA 4HSQA 5CP7A 4UBDC 3QCVH 3DO3A 3DUUB 3L3OB 4HFWB 3SQBA 1Z9MA 4G9FB 3RDTA 5IJVB 1XF2A 4JPIA 2MSPA 2BHYA 4JFFE 5TPWH 4Y4FC 2IAMB 4Z7UF 5C07E 4K8RL 3N50A 3QFJE 5E8OA 2VXSH 4U7MA 4Y16C 1HCVA 4NQXA 3ULVF 1FLTX 5HYFA 5FCSH 3P30H 4F2MA 4XBPA 4WTZG 2DMCA 1OB1B 3FQTB 2LV4A 4OSUH 3KPRA 4XGZA 3DRTA 3UZQA 4P3DB 4ONFL 4IOIB 3F12B 3O9WC 1ZWIA 4Y89A 1YJDL 5D4QA 3WEXB 3IXAB 4JJ5A 2X7LA 5GJSL 5EBMB 1BJMA 4K71C 2QQLL 2IANB 4KRMB 4QCIB 3CFKA 3EAKA 4KGJA 5DD1H 3RY4A 4JDTH 2VZVA 1NGQH 4UDTB 2A1WH 3RWJB 1FHGA 3D3VE 1F3DJ 3MLWL 5JW3H 5C86A 4LLAA 2I5YL 1DQTA 4R8WL 1AD9A 1EGJH 4WV1C 1BX2B 1NKRA 1LO5B 3HFMH 2ICES 3CJJA 3IFOA 4U1JA 1NAMA 2CUMA 3QEUB 5BXFB 2R56L 3QPXL 3RX8A 2I9LB 4JAMA 1CK0H 2DLFH 2EE2A 3NTCH 2BVTA 2X4NB 1CYGA 4E41D 4P23A 4QF1A 4YC2C 5BCAA 4XTRC 5GRWA 4PRAA 3WDJA 4JHZA 1QR1B 2UZIH 5J0BA 1N0XH 1NC2A 4FS0A 4FQJL 1G0XA 1XGRB 1JYVA 2YD5A 1XF3B 1PKOA 4BQ8A 1GGBH 4OD1H 3P4MB 5JUEL 4Z0BH 1HZHL 1CI5A 4G43A 2EYRA 1GAFL 4PJFE 5FO9A 2F8OA 1TITA 5CILL 2FLBT 1HXYA 4JFZH 4CMHC 1HYSC 1N64L 5GSRA 3BHBA 4PJ8B 2GUOB 3MYZA 5E2WH 4LCCC 4OZGE 3RTQA 4LSSH 1SYSA 3QO0B 4N8CH 2AV7A 3VFNA 1BF2A 1FV1B 4OQTH 3BFOA 4XXDA 4OFDA 1X5FA 1F6AA 4XCNB 5I16A 4G42B 1QD0A 4S11A 3BPCA 2V9RA 1MHEA 2VE6A 3R0MA 1FL3A 3KPNB 3W0WD 5D1ZA 5C09B 1LP9F 4PPTA 5E1HB 3KXFD 2D7QA 5DVLA 4KXZI 4GG6F 3DV4B 3TBYB 1PKQB 3B9EA 5F7WC 3SGJC 3WFHA 4Z7NE 2FL5A 4F7PA 4OZIB 3PHQB 4U1KA 2YK1L 5I30H 3ZDZE 5HHXL 1CQYA 4FNLH 3ROLB 4CMMB 3NVQA 2F5AH 3HZVB 5H37G 4ZTPL 3NIGE 1I8IA 2ZCKH 3BGFC 5CMAB 5JW5A 4FQPA 4WTWA 2JELH 4RRPA 43CAA 3VXOA 3QUYD 3ZZ1A 3KPOB 3S88H 4PJCB 3SBWC 1S5IL 1U8QB 5FA4B 3D18B 4WI7A 4PJ7A 3LH2H 1YYML 4PREB 5EZLA 3NH7L 4RX4D 1CDGA 1KLGB 5A3IC 2H32A 3O3BB 5DVOA 5I2IB 5L2KD 4DEPB 3QDJD 5B38G 3ARSA 1UWGL 3B43A 3GM8A 4M1GL 2D4FA 3W0WE 3MROA 3G6AB 2R1WA 3DI3B 3LKSB 3TA3D 3KXFE 3HE6D 4YXLH 2HFGL 4E41A 3VMNA 5J1AB 4ONOA 4XP6H 3QB7C 2GSGB 4TOYL 5HDBE 1KJ3L 3ROOA 3T0EB 4BZ2L 1R0AL 3QI9D 3SGDH 1QG3A 3MYJB 3SO3B 4NPYA 4KKBD 1NBVL 3IFLL 4ELME 4XCCH 1HQ4B 3DX9A 1XIWB 2O5YL 2XA8H 2BMKB 1EPFA 4POUB 1S5HA 2H2PC 4LGRB 1IGFH 4WO4C 4AEHL 5GGRY 4LU5H 4PRPA 1YNLL 4HIXL 1R3LA 4Z7OE 1XEDA 4JVUA 4XVUD 1LO0L 5DK0B 2R0WH 1N5YH 2R4SL 3FO2A 5DJ6B 4WGVB 3OKEB 2HT4D 3MOAL 4UIKL 4BFIB 2P5WD 4M43H 5IOPA 4NQED 4IOFD 2FX9H 3WS6A 1ZT4B 1AO7B 2PR4H 4Q58C 2N7BA 4OCWH 3QDJE 2XZZA 3I6GB 3VWKC 4CRPA 4OCYH 5GGVY 1KPUA 4UINL 5K9KB 1NAKH 2EIZA 4ODVL 3SKUD 4JRWA 4ALAL 5GS0H 4MS8C 5D8JH 3CC5A 3FKUS 4HX1B 4Z18A 3TPUB 3VJ6B 4KRPC 3FB7A 4QHKI 2K3TA 2CMRL 1ND0A 4KJPD 4NYLA 1MHCB 4H5SA 3OG4B 4WU7B 3CCHB 3C09B 1BBDH 1PSKL 3EYUH 1W0WA 5F9JB 1F3JB 2WBKA 2YPKA 4LAQH 1BFVH 2F53A 1I9IH 3OL2A 2Z4QA 2AQ1A 3QDGB 2ZKHH 1H3GA 3SJVD 3L1OH 3O11B 4PUBH 2JCCE 1I7TA 1VFAA 1ZVHA 3ARRA 2B4CL 4KQ3L 4ZYKB 4PJHF 2P5WE 1BZ9A 4NQEE 4Z8FL 2DQTL 5L2KA 4XBGA 2JKXA 4GAJH 5EBLA 4LLMA 2OL3L 1A4JB 3I02B 2FJGA 1KB5H 3MCKB 5FYJD 4OLXH 4L4JA 5KVFL 4YXKH 3WHXA 1QO3A 4F58L 1RZGB 4APQA 1OTTC 4Y2DA 4ZFGL 5BQ7B 5DUPH 5KVEL 3TEUA 3TA3A 5JQHC 3T4AB 3FOLA 4OAWA 4CN6A 2VDPL 1RJLA 3KLDA 5C7XH 2X4SA 3QI9A 1RUAH 3VFSA 3VGGA 5HGAA 4PJ9B 5DF0A 1L7IH 2YKLH 2IQAB 4YHMH 1T1XB 3WS3B 2P8LB 2BDNL 3CSPA 3B9AA 4XP5L 1TCMA 2L7JA 2OI9B 5INCA 2XKNB 3GSRA 3ZE2F 3BP7A 2E7BA 3S37X 5MENA 3PP3H 3O6FA 3BGAA 3H3PH 2VABA 2J6EA 4L4TD 1F4HA 4X4YB 3WSQL 3SJVE 2NW2B 2WQRA 1HSAA 4NC0B 3ILPA 5DYOB 3SKJL 3FAWA 2D03L 3BQUD 3ZT7A 2XQBL 3D85A 5EN2A 3OX8A 2RJMA 3S37L 3U0WH 3ZKSD 1PW3A 2JJUA 4KXZH 4KTDH 4LLQB 1B2WH 3VXUA 2C1OB 1HKLH 2G75B 1AIFA 5FYJE 4Q9RH 3H7BB 3UZVB 1ZGLB 1MJUL 1P5VA 4U6XB 5T1KB 5J6GB 1RHHB 4LCUA 2YD3A 4QRUA 1YQ2A 2OQJB 1MRCH 2AW2A 4G6MH 5D5MA 3U4EB 5CZVH 1NCTA 2R0KH 5IG7B 1FIEA 4LSPH 5DVKA 2NZ9C 3G5ZB 3ZL4L 1CDCA 4HXBH 1SEBA 3WUWG 3DO7A 3QH3A 4XPAH 4M03A 5HYJB 3RVXC 3WFBL 3ZKND 5E8EB 1G7PA 1J8HA 4HGWA 4N9GB 4TQEH 4NT6A 1F11A 1WUNT 3WLBA 1IGTA 4N0YH 1IL1A 4PJEB 1P9MC 3KPSA 5C0FB 5KZCD 3OAUL 5GGQL 3O6KH 1XCQB 5CD3A 1NFDF 1U9KA 5EUOF 1OAQL 3MGOB 1JGDB 2GHWB 3FT3A 4L4TE 5EO9A 3WJLC 4OLVL 1DLFL 3VGDA 5DJDB 2H6PB 3UBXG 1NGXB 5BVPH 5I1IH 1FZKA 1DTUA 4MJ6B 3T8XA 3IT8D 3MV7B 5EOCJ 1RURH 3ALPA 1ORQB 5CIPB 1HH9B 1FVEB 2H2SD 5F3BA 2HA1A 3BKYL 5IQ7H 1LE9B 5FHAH 1S9YB 3BGMB 3HN3A 2P4AB 3BAEL 2B20A 1PLGL 2JTDA 4I3SH 4X7FC 3O3DB 1AQDA 4P2RA 2O61B 2IMNA 4LL9A 4NSKB 5ALBH 2E9IA 4UTBH 4ZAKD 3HZMB 4WI9A 3UBXB 3IGAA 3DURA 1T2QH 2C7UA 3OAYH 3EFDL 3K74B 4F15B 1YUHA 3DROA 2FJHA 4M1CD 3CPLB 1MAKA 2DQUH 4OF3A 4WUKH 3EOBA 3GI8H 2AEIT 2D7TH 1XGYL 4U1MB 1FLRL 3GSWB 4NKQB 4K3GA 3QXUA 2NY2D 1ES0A 3JV5A 5EWIH 4NKDA 1MFBH 4U1GB 5IMKB 3RZCB 1F4XL 4QWWD 5DJAB 1YY8A 1WZKA 1B9ZA 1MFDL 4L4TA 5CSGA 3T2QA 1XGPA 1KCVL 4GLRI 2KQMA 4LASL 3RKDD 1VFBB 4W4OA 2W9DH 2XACC 4LSRH 1GL4B 1ZSDB 3M17A 3T3MF 3HNVL 5D9SB 3UDWC 2A6KB 2BFVH 12E8H 1FCGA 2CRYA 3CMGA 4JKPL 1BWMA 4OIIL 5TF1L 2ITDB 3IAPA 5JXAL 1AR1D 3MA9L 4XMKH 2CDFB 1X6NA 1CU4H 5IBUG 3IJSB 1I3RA 2PW1B 5KANI 1ZLSL 2VYRE 3KPQA 2Z93A 3HG1B 4XRCA 4AEIL 3FCTB 1IM9D 3IJYB 4DEPC 2WINB 4Y4KD 5EZIH 3P11H 1Q9OA 1KIQA 2YC1B 2SEBB 2WW8A 1D9KD 1E6OL 1DN0B 3NOIA 4EIZC 4JPVL 2UZXB 1AKJA 4N0UB 1JPSL 2OSLB 5KOMC 1KLFA 1DN2A 4YHIA 5KSAB 5C6TH 3ARBB 1YPZF 5IBUB 1BVLA 2CK0L 1BJ8A 2AKRB 2R4RH 3LIZH 5CEYB 3T0EC 1A1OA 2XIDA 3ZHKA 3SO3C 1ZXQA 3EYQC 3QEGH 3L3HB 4ZUSA 5MP6H 3QIWD 4IIQA 4NCC1 5DJZA 1XIWC 1IGJB 3RFZC 1Q0XL 2YEZB 4KKCD 4LLUA 1CTOA 4RGNC 4HMCA 5D7JD 5F9OH 3QNXB 1U8IA 1TIUA 2EDHA 5HPMB 2E27L 3ZO0A 2QHRL 3HLAB 4U7SA 2EECA 3LRSA 4NO0B 5F3HA 4FABH 4LMQI 4FQ2H 4TPRL 2Y6SC 1MLBA 5LBSH 2HWZL 2OTPA 2AK1L 3LN4B 2E7LC 3TYFB 1GZPA 1GGYA 1XH3A 3E8UH 2R29H 4HKZB 3L3OA 4FXLA 4ZAKA 1WBYB 2AJZA 5DHVB 3ULUL 1YN6B 5FECB 4RFEA 1RJZB 4YHLH 3V52L 1F2XK 4JQXA 4J2XA 3TBSA 1JNHA 3HMXH 3NPSB 1CQKA 3MJ9A 1Q1JL 1YZZA 2ESVD 4XMLL 1T0MA 3RAJL 3BPNB 3VD5A 4XCFL 5ENWA 1AP2B 1VACA 1JRHI 1OAYH 1RZ8A 3C60C 2FBOJ 3OR6A 4DGIH 2VAAB 4JB9H 4W4NA 3QULA 5DJ8B 3WEXA 5F9WB 5IMMA 5EBMA 4ZO8A 4RBPH 3UJIH 3VW3L 4YQXH 2CDEA 2FEEI 4OD3L 4XNXH 4HK3J 3EOTH 1S9VB 1G9MC 1NGZB 5FV1L 1K8IB 4P2QB 5D6CA 3HI5L 2ZUXA 4M48H 2F8VA 2P49B 3WJJC 4B5EA 5J6HB 4LKXB 3OTTA 4XB8A 3VXSB 4HMDA 2QQQA 3JV4A 3GMNB 3QEUA 3DMMB 1BM3L 4P5TA 4NM4H 2VDQL 1I8KB 2X4RB 2NY5L 3TZVB 1W72A 5C3TA 4M9OA 3FQNB 4JZNB 5HGBB 1Q9WA 4JO1H 4MMZC 4UQ2B 3FB6B 4PRID 2FO4A 2H9GA 2VLJD 4TUKH 2Q1EA 1FVCB 1H3XA 4E9LA 1KBGH 5C2UB 2VERN 1QR1A 1FH5H 1IAIL 5DURB 2EIDA 2LU7A 2ARJB 1T03H 1MF2L 2ESVE 4QRRB 2D7PA 4UB0L 3GI9H 3TT3L 3P4MA 1P4BH 3DECA 5L8JB 5I8EB 3MXVL 1DBAH 4JDVB 3JUZA 1HIML 2Z35B 5ITBL 1L9MA 3KJ6H 4PJ9C 1AXTH 4HUWB 5FGRA 4KUZL 4HKJA 5TQ2H 5ACZA 2EXWC 1GGCL 2XI9A 4ZFFA 1ED3A 1CWVA 3QO0A 4IEFB 3EDDA 3QUKA 2R8SL 2OI9C 1OWWA 4XWGH 4LVNC 3JTSB 3DTXB 4PBXA 4XCNA 4NHUA 3CH8A 2DM3A 1WFTA 1PX4A 4EDWL 5ADPL 1L6ZA 2DQHH 3P9MA 4GRLC 1I8LA 2IH1B 1E28A 5F89A 1L0XA 2JLLA 4ZUTA 3WIHL 3NFSL 3T1FA 1IKNA 4RA3A 4OCNC 1N4XL 2ATKB 4DW2H 4OZIF 4QNPF 2FSEA 4OLZH 2YBRB 1HOCA 3E6FA 4KROB 4P48A 4PRIE 4P59L 3DYMA 3M1BB 2VLJE 3PHQA 3SDXF 4U31A 1Z9LA 3LKQB 4ZODA 4HGKC 1LO2L 1F8TL 2DJ4A 3VG9B 3EJYD 3ROLA 4OUUA 5IQ9B 3DUHA 2FD6L 3QUMH 4Q2ZA 4GLRH 4F9PC 5CEXB 1ODAA 3DV6A 3FZUD 4ZS7H 5JW4N 5FIEA 2V7NA 3IF1A 4YR6B 2AQ3A 4XP1L 3P4NB 4PJGB 1JGEB 5KSVB 4TSCH 5B21A 4JFEA 4ZPVA 2BVQA 2APWA 1UM6H 1MIEL 1F58H 3QDMB 2HG5A 2UWEA 4PJCA 1M7IB 5FA4A 1NUNB 4L8BB 1G6RL 3VFMA 4W81A 1CICA 3FT4A 1KN4H 4ERSH 3MXWH 4XMPL 5DJ2A 3DVGA 3W5NA 5CBAA 2X89D 5KS9B 1P2CB 1DEDA 2RCSL 4JZJB 3RWIA 1DL7L 4QKXB 4X9GA 4IHOB 2CO7B 3GMLA 3GSNB 4FFYL 2VH5H 3HPLA 1N7ML 5LKNA 4UIMA 2C4XA 1K4DB 3D87B 1A6TA 1TVDA 4HZLA 4EXPX 4GXUM 3IXTB 5J11B 3CFCL 3NIDF 3TN0B 3GMQA 4M8VA 1DQDH 2WUBL 2BNQD 3GKWL 4IS6A 3MRCA 3MRKB 2QSCL 3L3IB 2GJ6A 3NZHH 1U6AL 1T5XA 3ARZA 1BLNA 25C8L 1P69B 5B38A 3I6KA 3W39A 4ISVB 3VMOA 1GIGH 3MLPA 4UU9B 1FDLH 3U36B 1W8OA 1KTDB 2ZCHH 3S8WA 3BJ91 1MCCA 3MRJB 4V2CB 5I1CH 1MVUA 1BWWA 1RJYA 4F15C 2X41A 4X6CE 3DBXA 5EIQA 1VADB 3AS2A 4PRHE 1MHPL 4PJ5D 1MCLA 3RGVB 2X70B 5HGDA 1RUPH 1U8PA 5I1JL 4FQQB 4L4VA 4OV5B 2UV3A 3CSYB 3QAZB 4YK4C 4U1GC 2JIXB 1EFQA 3RZCC 5DS8B 1I1FA 5DUBA 1MQ8A 3MACH 3V6OE 5JA8B 2ZOLB 3D0VA 5LGHH 5TDPA 3C6LC 1VFUA 4GBXB 2XICA 2DL9A 4GAFB 5JIHA 3QDAA 3S5LB 4ZOCA 1MCSA 1PFCA 5FB8B 4W68A 3RPIB 1KJMB 1SYVB 2WWMC 4FG6C 5D1XC 4Z5RA 3FO1A 1VSCA 3BYYA 1JRHH 3MZTA 3PP4H 3PUCA 2RFXB 5ESQB 2BNQE 3FTGA 3PL6D 4PJXA 1A7PL 3P2TA 3QZWG 5ILTH 4OB5H 2WLYA 5LWYH 4NJAL 3X3FL 4V2BA 4D9QD 1WITA 4XPBL 5IBTH 3LPFA 4H8WH 4CW1A 1IAII 1IEBA 1WZ1H 3TVMD 1F3JA 1OTSC 4MQXC 4K9EH 5DO2D 5BV7L 1OARH 5C0CD 3UJJL 1SY6L 3U7AA 4J3VA 1BD2D 5F7YC 4ELKA 4PJ5E 1Q72H 1RUQH 5AG8A 5KSAC 1FG2B 4PRBA 1GVIA 1RFDL 2Y23A 3ARBC 4UDUB 3V6FB 5ACMA 3ORJA 1V7NH 5IESH 4I77L 4JPWH 3JV6B 4NNXA 5H35B 3ULVD 1R3IH 4JO3H 4XNZB 1A9BB 1UGNA 5EU3A 1JUFA 4BH7B 4D94A 1SJXA 1RZ7H 3B9KD 2NY0B 4D0BA 4QT5B 1A6VH 4YPGA 4FQLL 5E00B 4HDIB 4XCEB 4O2FA 1X5ZA 4CU8A 3VRJB 2HFFA 4UOJA 3U4BH 5JOPE 1GPOH 3DX7A 5SWSE 2R69L 2AXJA 1MCQA 2GTWB 5IFHH 4KK6D 4PGEB 1I4FB 2P8LA 4HT1H 4N68A 4D9QE 1NFIB 1FVDA 3OKDB 2HH0H 3UPRB 4H88L 1R5VA 4H1LH 3JWOL 3KYNA 2HJLB 3QEHA 2IBGA 5ABDE 1UCTA 1H8SA 4KK8D 1I3VA 5C0CE 2P5ED 2H45A 4X7SH 3NPSC 3S3JA 4EIGB 4NN5B 3N1FC 5IROC 5L8KB 4YDIL 1BD2E 3BPNC 2G60L 5DYOA 1J7VR 4LSPL 2L4OA 2VB5A 3FB8A 1LILA 5T5NG 4OF8A 4YHOH 1KB5B 3IAGC 3GMMA 5HVWA 1UEYA 1CXHA 5F9WC 5SWQA 4JFOA 1ZE3C 5ISZD 3ULVE 3SN6N 3ARDB 2C9AA 1P7KB 3H7BA 4MJ4A 3BEVB 3OKKB 1CFTA 2J1KA 2DTSA 2AEQL 3D9AH 4P9HH 5C8JA 4LLYB 3NAAL 2W60B 5TFSH 5CKAA 5TDOB 1CE1L 5JOFB 5DQ9B 5ECJE 3DMMC 1AJ7L 4ZO7A 1ZHKA 1QTYT 3OB0H 2H8PA 3SY0A 1KCRL 5J7CC 3L5JA 4PJEF 3C5SA 1BIIA 1F3RB 4N9GA 2AERT 1RZFL 2IC2A 1NMCB 4Y5VA 1RIUL 4I4WB 2ZSVB 3HUJF 3SKNB 3DJ9A 5HGGS 1XCQA 2P5EE 2ARJQ 3GB7A 2VLLA 4HFUL 4HWEL 1TTUA 5DJDA 1C16B 1FO0L 5ANMB 2HRLA 5LXGH 3G6JB 1ZVYA 4GKZB 4ODWB 4PJAA 4Z7UA 4JKLA 3HMWH 2V7HA 1MFEL 2H26B 3V5DB 3BRDA 5DC4B 3WUWA 5A16B 5ETUB 1AQKH 2AXGB 2HT3D 4KJYA 4XNUL 1WAAF 4G6KL 1LEGA 5ISZE 1A5FH 4ODTL 4HF5H 4G3YH 4XVSH 1G7MA 4FTVA 4J8RB 2BC4B 2OP4L 3PV6A 2W9LA 3LV3A 2YPVH 1R3JA 4F80A 4DGVH 2Z8WC 1D5BB 3QWRA 4MNGE 4JO4H 5E94A 5H2BA 3SDYL 1UG9A 3P0VH 2C3VB 5C0DA 2VITB 4X0KA 4LARL 2AI0L 5DZLA 2OJZH 1S7TB 2CKBL 3MBED 5E6YA 2ZUQB 1CLZL 3VMPA 4L8CA 2E8YA 4R7NB 4M6OL 3RU8H 2HT2C 4LEOB 4OZ4B 2P24B 3S34L 2OBGA 4PR5B 3MQIA 4KROC 3WFEH 2JJSC 3UTSD 4EEEA 3IETB 2K7QA 4XHQA 2PCPA 4FRWA 3VE0A 2DI9A 1JHKH 1YQVH 4U1SA 2AJYH 1IAOB 1JF6A 3MRNA 1LP9E 1DQLH 1OWRM 1II4E 1U91B 4GG6E 1LO4H 1CG9B 3CH1A 2Y07L 1QHPA 3CVIL 3HKFA 2MQ0A 4OKVA 1GJIA 3EYVB 2VDML 4M7ZC 3EJJX 4JLRB 3H9SE 4I2XE 4HJJH 5C9JA 4BQ6A 1D5XA 5JZ7C 4TTGA 4U4BA 1KFAL 3D48R 4HK0A 4UZGA 3EIFA 3SE4C 1LDSA 1PY9A 4GO6B 4LLWB 1UEMA 3FQXA 2OR9L 1MREL 4Y19B 3F7YB 4MNGA 3U0TB 4JANB 4HCRA 3X11B 43C9A 2FR4A 4C56A 4GAGH 1O7SA 3MV9D 4L29B 3UTQB 5FDWA 5IK3A 1EBAA 32C2A 2SEBA 4XC1L 2DWEB 3IDJA 3VXMA 4HIEA 1FNFA 4Y4FD 4I48B 2Q6WA 5HYSB 3O2DA 5C0AE 2UY7A 4OCSL 5I8OL 4NM8L 3HR5B 3QHTC 3S3SA 5J11C 1YNTB 2BERA 5ACLA 4OLYH 5DT1H 2P48B 2XQYK 3UEZA 3OKNB 1UKSA 1MWAH 5E7FA 1GSMA 4QXUL 4BZ1L 1LVEA 3BDBA 3S9DB 4GG6A 1GGUA 1MJ7L 3S7GA 3O9WD 1CL7L 5IHBA 4KZEH 3BP4B 3R4DA 1N5AB 3GJFK 3ULSA 5EORH 1MAJA 1LEKA 1BAFL 1X3DA 3TV3L 4MD5A 3LPWA 2B2XL 3HPJB 4NO0A 1B0RB 3QUXA 3QFDA 1H3TA 2E3VA 2OZ4A 1BFOB 4X80L 3RGVC 1K5NB 5IWLC 5HY9A 5HD8D 4AJ0A 3TYFA 4HPYL 1CGUA 8CGTA 1T22A 4Z7VB 3QAZC 4PY7B 3SE8L 3DARA 4NO5B 5DEFB 3WXWH 1UZ8B 3MV9E 4S0SD 5EU6D 4K3EH 5GGRA 2DQDH 3LRHA 4LP5A 4QHKJ 2VLRB 1IGMH 4FP8H 4M1DL 4QRTA 2V5MA 2FH8A 3PGCB 4Y4HB 1JNLL 5C0IB 1UKQA 2BY2A 2VRAA 4XNQA 4XTRD 3G5VB 4M6MH 1UCBH 4A6YH 1JTOA 3IYLW 2N1KA 1KGCD 3NABL 2YA0A 5CJBA 4JHAH 2WM0A 3UTSA 4UTAL 1FNGB 4PV8B 1VPOH 2CLZA 5BO1L 2X1QA 4BQ9A 4JCLA 1OGAD 1T7VA 3JBG7 1FGNH 3O3AA 4EQ3A 3EO9H 3JV0A 1U8KB 2ZZUT 4JDZB 2UUDK 3WXVH 5E8DL 4X98A 2YPLB 4EDXB 3MOBH 4CADB 4PGJA 2UVEA 2JF1A 1HYSD 3U7YL 1P4IL 1ZT1A 3VXRD 4YBQC 5CEZD 1UYWH 1MQKH 4YDKH 1EEZB 1KC5L 3REVA 2GFBB 2ZNWA 2NY6C 3QEQB 3FRUB 4G7VL 4X5LA 3GMNA 4KMQA 5E6IA 4F37F 3EKCA 2BX5A 2ADGB 2J6EL 1NANH 5CLTA 3SKMB 3TZVA 1MCWM 3CZFB 5GISH 5IM7A 4JZNA 3R0NA 3TFKC 5DD3L 5EU6E 1AD0A 4XNZC 5GS0C 5IHLB 2DQJL 5DR5H 5IF0A 1ZLVK 4MD4A 1YEKL 1LD9A 2NY0C 3GBML 1HHJA 3OR7A 4PJHE 1G7JB 5KVMC 3CUPB 4UILH 3RX5A 3TNNA 2PXYA 3NACH 3ARWA 3MLRH 1KGCE 1KJ2L 1WCQA 1KTLA 4GW1A 5LGKA 3HC3H 2NPLX 1GGIL 1OGAE 1KN2L 5IEHB 3P0YH 5GHWH 2XOTA 1E4XL 3IU4H 4NZDA 1I9EA 4HQQH 5SX5H 2FBJH 3O9WA 1NCWH 4AZ8A 1XAUA 1MIML 4D9RD 3MBXL 1IC4L 3MSPA 3ARGB 5KSBB 1LEIB 4G8EA 3VXRE 3JTSA 5GRVL 4NUGL 5CEZE 4C57C 3HZYB 2B7DT 3MLVL 1G0YR 5E95B 1YN7A 2AJXH 1GH7A 3O6LH 1YEGL 4HJGA 4OLUL 5A3ID 5GRVK 3L9RA 4MAUL 2XPGB 4YIQB 1NCDH 3ZE2E 4QXTA 2DD8L 1X4ZA 2V5SA 1KIRA 1Q94B 3O2VL 2EICA 3LHPH 1OCWL 2YBRA 5EU6A 4JFXA 1CFQB 4F7TB 4NQSA 5BRZA 5GS2H 3ARDC 3MRDB 2NYYC 5FYJL 5E2JA 1JGVH 2FJFB 3GIVA 1FL5A 4LSUL 2FZ3B 3MA7B 5EU5A 3OZ9L 5F21B 5DD6B 1HN1A 3W11C 2ZJSL 1M05B 5B8CB 5IR1B 1HEZA 3MR9B 2BRRH 2DYPD 2E7HA 4PJGF 2P7TB 2AJVH 2UVFA 5E8PA 5KSVA 1KULA 5JXEA 1AE6H 1Z9SA 2LU4A 4FXKA 1JWSA 4U6YA 5E4IA 1E4WH 5GXBB 3SDAB 2H2PD 3DGGA 4IDJL 4RFNC 1EO8H 4WO4D 2Y06L 3VFPA 4PV9A 1T0PB 4JRXB 1U8NB 3ULVH 1UQSA 1QSFD 4JHWH 2EH7H 4D9RE 1NMCC 4LGSB 3VDAA 3DUSA 1EJOL 3FFDA 5KS9F 1CL7I 2NX5B 1GC1L 1T66C 2A83A 3PJSB 2BNRA 1OW0C 5CJ8A 4R7DA 2D2OA 3VWJA 1A2YA 4ZS6C 4HIIB 3SCMB 2R1XA 4D3CL 3P9WB 2BVOB 3GK8H 3VWKD 5FGBA 4RGOH 2BNUB 1TQBB 2HLFC 4QYOB 4JG1H 1NFDE 2J88L 5EUOE 5DMKA 4AM0B 5KANG 4MS8D 1FZOA 3ARTA 2X4PB 5DTFA 1RUPL 1NAMH 3QUMB 5HHQB 1T21B 3MRKA 3SPVB 4KRPD 4X6EB 4PJIA 5DRXB 4JKWA 3GO1H 3SGJA 4OUOA 3RGHA 2A6DB 3O8XB 1JBJA 3QG6A 1NDMA 4X6DF 2BXYA 3BOVA 1FZMB 2VDRL 4LDOB 4BUGA 4Y1AD 2VISB 1MAMH 1IC1A 1E4KC 2A6JA 4YFLF 5I1EH 4U1HB 2ZUQC 5TE6H 3FQWA 1EDQA 5EIIA 1CDYA 1M7XA 5FGCB 4NO3B 5T1MB 1ZOXA 2C5DC 4DJMA 4Z9KB 4C54A 1S9XB 1QSFE 1FYHB 5I75B 1WEJH 2E9JA 3DIFB 3CSYA 4PJDB 1OL0A 3FO9A 3INUL 3MRHA 2O5XL 4G80A 4CAGA 1N3NA 3D39D 3UO1H 5I17B 5D2LA 3RUGA 1C7TA 1BGXH 4F33B 3QUZB 3U9UB 1RUKL 1D6VL 1T0NB 4LPCA 4ZQKA 4C83A 5DK2A 3FONB 4WU5A 4JN1L 2GK0B 5KAQG 1KJMA 1SYVA 4N0FB 3ZE1F 3L7FB 1WZLA 3BESR 4DUWA 3CLEL 1U36A 1OTTD 1EHXA 2GY5A 1LDPL 1Y0LA 5C9KA 4GKNA 2DKMA 1CGSH 2IPUG 2BVYA 5HVFB 3DXAA 4ZFZB 2FX7L 4MJIB 1FIGH 3T3ME 1EXUB 4UMGA 1UM4L 1IFHL 4K8RC 1OSPH 4NRXB 2WZPD 3RWFA 1QSED 1GOHA 2CK2A 4GW4B 3K2MC 1MVFA 4UV4L 4DN4H 4Q7DA 1NMAL 5EA0H 5SWZA 4M6NL 4GMSH 1NBYA 1WLHA 4R97B 5D7SH 1OP3K 1TVBA 5DFWH 4G9FD 4ENEC 2X44D 3X13B 3VXNA 5F1IB 3X14A 3TBWB 2BSSB 1FG2A 1ACYL 1D6EA 2EDNA 1WWWX 4LRNH 1G7QB 4F7MB 2OMNA 1U3ZA 4EUPA 4ZD3L 3QZWA 5E5MA 4WFHE 1OGTB 4LHUD 3B6SA 4G6FB 1I3GH 3HC4H 3D39E 4JQIL 4TUJB 5J8OA 1YMMB 4YEFA 5FYKH 3T0BA 4AIOA 1SM3L 3HR6A 3CX5K 1I7RB 3WIIL 1AHWB 1YPZE 3LQZB 5MEQA 1RIHL 2H32H 4D8PA 4YWGH 3VRJA 3MJ6A 3LEYL 4R2GB 1U8MB 3V6ZA 1A6WH 1BQSA 2ZSWB 1CD1A 4G7YL 1EA9C 4ONGL 5EBGA 4BK4A 5F1OB 3VGHA 2DIBA 5EB9A 3QCUH 3MCG1 5FHBL 1WTLA 2NZ9D 1QSEE 1HDMB 4Y1AA 5C2BH 5EC2A 1MY5A 4EI5B 4MWFA 1W72L 1S7RB 5J3HC 4N5EC 4LIQH 3VRIB 1OSZA 3IU3A 5GIRB 3V79C 2EE3A 2X4OB 3QWOB 5IW6B 3N06B 4G9FE 4Y4HC 2P44B 1MRDH 1EHLL 1V3LA 2VIRB 3NFNA 4HPOL 4NWUL 4KZDH 3RQ3A 4J6RH 4Q74A 1HHHA 2BY0A 4MDIA 1C08B 1XZ0B 4FQXB 1P1ZB 5M94B 5I1HL 4L8DB 2F5BL 1I1RA 2APFA 4RWYL 1R5WB 1KCSL 5I9QB 2X4UB 1OAZH 3EBAA 1MUJB 4G8GA 4XNYH 5AZ2H 5AD0A 4MLIA 5K9QI 1UWEL 1XGTB 1AXSA 5LCVL 1QA9B 1W0VA 2IANE 4MA8L 2V17L 5DJXB 3GBLA 4F9LC 3ZKQD 1JWMB 1F5WA 2IBBA 5CHNB 3P4LA 1HWHB 2MJWA 4L3CA 1WQVT 2VQ1A 5FK9B 4QTIH 2DQEH 4I0CC 5SV4A 4PG9A 1WBXB 4QY8A 1JHLL 2D0GA 2RBLA 1CR9H 4JN2A 4EN3B 2GCYB 4N9OB 4JQVC 4LNVA 5C09D 4J3OC 4HWBA 1V05A 4W6WB 4I5BB 4GRMB 2R15A 2EKSA 3TO2A 3MLYH 5FDYA 5DGRA 4ZUWB 2DWDB 1QEWA 1G7HA 2FCBA 4YDJA 4XCYB 4PLJC 4JGMA 1U8OA 4PTUB 5IT2H 2ICWJ 5KTEL 5GS3A 3AB0B 1ZLUH 2YMXH 4IRJA 5DMGC 3CXHK 3BT2L 3TYGH 4HWUA 1MEXH 4YGVA 5MEPB 3P9LB 2ATPB 3C5JA 3T77B 2VZ1A 3MREA 4RCAA 3THMH 4OZHB 4M62H 1V5JA 5D7IB 4GOSA 4HWNA 4PB0H 1KF9B 4FQCL 3LEVH 1IBGL 3FHQA 2NR6C 4PJBA 3ARGC 3WMSA 5CJQH 2QJDA 4YHPB 3U46A 3LRGA 2XZAL 1AGDB 2Q3ZA 4YBLB 4BH8B 3L6FA 4YNYA 3T0AA 5E03A 1WCBA 3RL2B 1LO4L 1MNUL 1S7TA 3LD8C 4LLVA 2EC9T 2PYEB 1DFBH 2VQTA 2YWYA 5DQJB 3CFIC 3STZB 1RHFA 3CDFA 1R3KA 4YUEL 3EO1B 3IDGB 4IRZL 1NSNH 1J88A 3IDIB 4I13B 5CWSA 5C09E 1T89C 3HI1A 2KKQA 1CFVH 5I19L 1NLBH 3G08A 4XAWL 5ALCL 1JV5A 1I9RH 4JR9L 3T0ED 4NQDA 4QNPE 4OZIE 4L3EA 1FAIL 5HVHB 4DK6A 3EYQD 3BIKA 4KQ4L 1KG0B 4G6JH 5IVXA 4HUMB 2OXHA 4RGND 4NHCL 4QRSB 5TQ0H 3SDAC 4PRDB 4PBVC 3PWNB 1ZA6B 3S96B 4O2EA 3U79A 2Y72A 4LLWA 1N0LA 4GRWH 4RGMB 4TULH 1Q9LB 1JNNH 4KHXH 2Y6SD 3X11A 1J8KA 5MERA 2VAJA 3HZKB 2DQFA 3BSZL 1JIBA 1C5DA 3SE3A 1AI1H 1FSKB 3STLA 2EE9A 1E0OB 2HVKB 3RA7H 3DETC 1HILB 3MRLB 1CFBA 1AO7D 5D1QB 1U95B 1FGVH 4LSTL 4I48A 4WCYH 3HR5A 1M71B 3ARYA 5I18H 1F4WH 4QXGL 3BYTA 2C3HA 5JR1H 2JB5L 2VLKB 3VFVB 5JPNB 1G9NL 3SQOH 5BVJA 3O8XC 4AH2B 3F65A 3C60D 4NQVA 2GSIB 2Z31B 1DBML 5T1LB 3T4YB 2BSTB 3T0EE 4I9WD 1DQJA 1PEZA 4M5ZL 3NIDE 3QT2A 3SDXA 4XT1C 1IC7L 4XP4L 2F58L 5GGSB 1A6ZA 2PW2B 4WHYH 5HI3C 4M7LH 4S2SB 1HSBA 2RR3A 4PP2A 4WWKA 5HHOD 2VXTH 2NY7L 4RGNE 1QKZH 3MUY1 3UDWA 4FXGB 5H94A 3STBA 4DOHB 3D2UD 3QQ4B 4Z7VF 2C3WA 3IJHA 4DAGL 4AEFA 4NOFA 2NY3B 5I75C 3QDGD 5K33A 1IQWL 1BOYA 4KVCL 3C08L 4NQCD 5F7DA 4IRSB 3S35X 4JM2A 3OJ2C 4ZNEE 1YEHH 2J8UF 3VFGH 3QG7L 3QUZC 4JY6A 4DCQB 1A47A 3GRWL 2XG4A 2YN5A 1IE5A 1ZTXH 3FJTA 4J7RA 1AO7E 4ZSOB 4AG4L 4LHQB 1H3WM 4IM8A 3S35L 4X6BA 4RQQA 1J1XL 3B4NA 3EHBC 4Z78A 5E7BA 1MWAB 2VKXA 4MXWH 4K94L 4OT1H 4LSQL 3PGDA 3WD5H 3OKOA 4DVBB 3BE1H 4YPJA 2CD0A 1U8KA 1ZS8B 1XF4B 4DZBB 3DX6B 4MXQC 3F5WA 5GQBA 2BOBB 4I9WE 3MLUH 3KLSA 1HWGB 4PJ9D 1QYGH 4WW1B 1KELH 2EXWD 4O2CA 3EW3B 3X12B 1KXTB 3V0VA 4R97C 4YHZL 5EUKB 1KENH 5HHOE 5T1DL 2PTTA 4PRNA 3ELAT 1F4YH 3MRBB 5FUOH 5IKCA 3GSVB 4I3RL 2DTML 1I1AA 2QSVA 3NCYS 4J23A 3QDGE 4GRLD 4KTYA 2ZG3A 4GJTB 4Z7QF 3O2WH 2PO6C 3LS5H 4EQ2A 3Q6GL 3TCLB 4QHLA 3PIQB 4NZUL 1QQDB 2O5ZH 5CJ5A 3WHE0 2OX5A 4ACPA 5IVZA 4O4YH 1RSFA 3MNWA 4A6YB 1S8DB 1AHWC 4Z0XB 1I8MA 5DHYA 4OGYL 1KYOK 5ESVA 2F74A 1JTTA 1JI1A 3O45B 3WIFA 3QRGL 1NUDA 3PDOB 4Z76B 4MNQA 4M9PA 5I1LA 5T1KD 2XZCL 4UT9L 3SKOA 4WUUB 1CCZA 5F88A 2ORBH 5DLML 3B5GA 2EDBA 4H8WC 3B9VA 1C1EH 1XT5A 2R23B 4NP4L 4NDMA 3CLFL 4K9EC 4OQ1A 2QTEA 1XGQA 3VI4E 2A74B 3MRMA 1UJ3A 4MD0A 5IMLB 2CJUH 2DLGA 1ZAGA 3HC0B 3GMOB 3TT1H 2VDOL 1RK0B 3BP6A 3C9NB 4R26L 5DI8B 4KKLC 4WY7H 3P73A 1J0YA 5J13B 5ADOL 3WFCL 3TH2T 3QP3A 2I26N 5EZJA 1YMHB 2F19L 2XNAA 2ZCLH 2A9NH 3D2UA 1FYTB 5L8LB 4RAUA 3MRRA 4N8PA 4YAQB 1QPPA 4NQCA 1K8DA 4H26A 3BKML 2Q3AA 4FQXC 5ESAB 5C08B 4YHNB 2X4QA 3IKCB 4DZ8B 5J4MA 1LE5B 1I7UB 1S7UB 5I9QC 3F62A 3MRIA 5FF6B 3MV7D 1U42A 4FQHA 3NCBB 4V1DA 1RMFL 5KSUA 2R0ZH 5CSZA 1L6XA 1G7LB 2YD9A 1J9CT 3TBTA 7FABL 3QIBA 4N0CD 5ICZB 5B8CA 1LNUB 1HE7A 3MR9A 4OM0H 1NH6A 3WL9A 3MGAA 3CNKA 2EH8H 3MMEA 1U58A 3EO0B 5HVGB 5T3XE 3MLZH 3MJ9H 1Z5LB 3LN9A 1TDQA 4JO2L 4J1UB 1NMBL 2F54A 5E1AB 5AYUH 4QHUB 2QL1A 5CINL 1JPFA 3U6RB 3KJ4B 3ECBA 5I1DA 3IFNH 5JNYA 2NTFB 4NKIL 1RZKL 1A3RH 4EN3C 3OXSB 2DQGL 2DBJA 3O3EB 3AS3A 2XZQL 3R06B 3LKRA 4OJFH 5HYJE 2VSDA 3MJ8A 1RZJH 4NFDA 4IMLA 2R2EB 3DVNB 5MEOB 4PJEE 3RZCD 2WBJA 4OF6A 3QO1B 2ADFH 4WW2A 4GRLA 3FQRB 2D0HA 3VH8A 1OVZA 3C6LD 4UT6L 3SDDA 4P4RA 4P46B 1YEDB 1TJHH 2VZTA 1NJ9A 5CP7B 3ZTJG 3L5XL 1CXKA 5D1XD 2WWMD 3MV7E 4FG6D 4X99A 1GYAA 3OJVC 2AJ3B 2VXQL 4P9HC 4FN0A 1ZHLA 2PKDA 3LPGA 3RDTB 1XF2B 1PYWA 4JPIB 1HH6A 3NZ8A 3LVEA 1JZ8A 4KAQH 1FZMA 3FQUA 2LAAA 4DFIA 2AJSL 5E8OB 1RIVH 4R3SA 2QLVB 4U1LA 2CR3A 4QRQA 5GRJL 1GRWA 5IW3A 1B4JL 4HCRL 5T5FH 4L8SC 1OAXH 5D93B 4U1HA 3JUYA 4NQXB 3WNPA 3HG1D 3ZE0F 4F2MB 1VB9A 4XBPB 1OTSD 4MQXD 3KPRB 4XGZB 3DRTB 2OL3A 3WBDA 1KIUA 4PJDF 1ZWIB 2HTKC 1OAUH 1NC4D 3LZFH 4JJ5B 1D5IH 2X7LB 1H15B 1T04B 3F7VA 5T33L 3HNTL 5FUZL 3CFKB 1H5BA 5KSAD 5F96H 3MV8A 2DOCA 2OS7A 2V5RA 1NLDL 4HUXB 4LOUC 1LK3L 3K4ZA 3N1PC 1FZJA 4UOW0 1R3HA 1JGUL 3NCJH 3HUJA 4KI5C 5EOTA 3PQYB 5JHLH 1AD9B 1NCCL 1EFXD 2NW3A 4KTEL 2GT9A 4N0FA 1DSFL 4U1JB 3IFOB 3L7FA 5F7LB 2LVCA 4UT7H 3QIUD 3UC0L 1YEJH 4JAMB 1MI5D 4G5ZH 4RGMC 1YYLL 2OZ4L 1A3LL 4XVTL 5FYLD 4ZTOH 3GIZH 4P23B 4QF1B 3CMOL 3P77A 1WAAA 5C07B 1FNSH 4OI7A 4PRAB 5FYKU 3IVKA 1NC2B 1FSKC 1MJ8L 1NCBH 5I8KH 2BVUA 4QGYA 2RAMA 3HG1E 3KNBA 1CGWA 2LVEA 5D1QC 2FX8H 1FFPA 5F1IA 2EYRB 1XF5A 2I07A 5FO9B 3W9EA 4PIRF 1MCKA 1OP5K 1HXYB 5GSRB 3BHBB 1JYNA 4N0UE 5IHZA 3PGFH 4M7KL 5JDSA 3RTQB 4FFWC 2OTUA 2AV7B 2XA3A 4H25A 5IB2A 4N90D 4XB7A 3W2DH 5T3ZH 3G6DL 4XXDB 3WKML 1AGBB 5GGVL 4S1QH 3H3KA 1F6AB 2XRAL 1I7RA 5I16B 3BPCB 3C6LA 4PYGA 4NBYB 1IGIL 4Z7WF 1MHEB 1VGEL 3QNYA 5ID0A 2YZ8A 4U33A 5H37H 1CLCA 4JFDD 1FL3B 4TNVF 5D1ZB 2IWGA 1BFSA 3DSFL 4P2QD 4RRPG 5D1XA 4KRLB 4DTGL 5F7EH 4H0IA 4CVZA 2NY3C 4Q6IA 5FYLE 1WV7T 3WFHB 3OAZK 5J1SC 3VXSD 2FL5B 5F7MC 4F7PB 4YJZL 4IRSC 4U1KB 4EI5A 1GGTA 4KHTL 1XR9B 3W9DA 5L7XH 3DMMD 4K23L 2I27N 1QRKA 3A6CH 4U6TA 4MA7H 5AZ2L 5KW9L 3AY4C 3OHXA 3L7EA 4R4BA 1KTRL 3OXRB 3BZFA 3IDUA 2NZIA 4KDTA 3CDCA 1I8IB 2WMPA 1MCOL 5JW5B 3SGKA 4GQ9H 1NC4A 1X5YA 1UT9A 3C5ZC 5CJXC 2HVJA 43CAB 1N6QH 4JVPA 3A67L 3ILQC 2W9EH 1UACL 4QRRD 3BPOB 1J05B 1P1ZA 2DQEL 4RFOL 1WC7A 1WIPA 1JL8A 4CVXA 4U7KA 5CP3A 5GJTH 3U83A 3ZKMC 4PJ7B 2X4UA 1BREA 4O5LL 1EO5A 5EZLB 3KPPA 3GBNL 4YXHH 5BOZG 1CGXA 2H32B 4H0GA 4J3WA 4QHNA 2AJUH 5LG1A 2HKFH 5D7LA 4ODSL 1TJGH 2JJVA 1EMTL 4LCWA 1ZGLM 1H9VA 5IHUL 3GSUA 2AVGA 3QIUA 3U1SL 4B41A 1RU9H 3MROB 1CF8H 4P2QE 5D6DC 1MI5A 4K7PX 5K59F 4E41B 3BDXA 4R4FL 2IFFH 1T4KA 2CSPA 3ROOB 3VXSE 4K3JH 1YEFH 3RWGA 2HT2D 4NPYB 3BKCH 2K1MA 3DX9B 4K7PL 4X7EC 1KT2A 1KB9K 4KROD 3ZDXF 5I1KH 1S5HB 5JQ6H 2XQYG 2VC2H 4DKFL 1TENA 4XCYA 4HC1L 1DBKL 1RD6A 4PRPB 4QOKA 1R3LB 3LKOA 1JK8A 4JVWA 2IG2H 5DWUL 4P2OD 5TDNB 1MFCL 1UFUA 4LBEA 4QRRE 1PD6A 2A38A 4OZHF 4M93B 3FO2B 5D7IF 3WLWC 2CGRH 4RNRA 5C0BA 4P4KD 3NCFB 1AY1L 4LCIH 4OCLC 5IOPB 3F58L 1A02N 1E6JH 5JZ7D 3FFCA 1EBPA 3QDMD 4YHPA 4TSBL 1KPUB 3N85H 1S7SA 4G8FA 4JFDA 1A7BA 4MAYA 4BH8A 2EIZB 5CEZL 1URLA 1UADC 4BELD 1CFSA 4ZOBA 4OFIA 3SGEI 4PY8I 1S9WB 3ARFA 1MH5A 3CC5B 4UV7L 3BISA 4WEBH 1JN6A 2J5LB 2B0SL 1OM3L 5E2VH 3FB7B 2PYEA 1VENA 3AXLA 3DRQA 4U1NA 3GJFB 1HINH 1U92A 1ND0B 4NYLB 3NBNA 4H5SB 4ELMB 1AR2A 2XFXA 3UTOA 5BS0A 3H9HA 5IB3B 3IKKA 2IGFL 1W0WB 5LAXA 4PB9H 1T20A 4P3CH 2OJEA 4KI5F 1IZJA 3MUHL 5KVDL 4TYUA 1QBLH 2YPKB 1TETH 5CJOL 5LQBL 5E24E 2Z4QB 2QQKH 3QUYB 2CH8A 4XVJL 2C3XA 2OLDA 3O4LA 4HXAL 3DI2B 1AGFB 1AC0A 1DQQA 1I7TB 1VFAB 4E5XA 1ZA6A 1BZ9B 1OAKL 1T5WA 1MCEA 3KJ4C 1RJCA 3BJLA 1MCNA 3S96A 4MLSA 5I18L 4PJGE 5L2KB 2WP3T 4XBGB 1ITCA 1P84K 5FV2A 5EBLB 2R0LL 4LLMB 5EFIA 2FJGB 3QDME 1JNJA 1Q9LA 3WNOA 3NA9H 3CVHL 3L5WA 3L5IA 1UZ6E 3RGVD 3WHXB 4OI8A 3VFRA 4HH9A 5EO0B 1ZT7A 3PHOA 4APQB 1Z3GL 3SOBL 2HVKA 4Y2DB 4BQBA 4GG8A 3TA3B 2JIXD 3L3JA 3FOLB 4OAWB 3MLSL 2YUWA 2YXFA 2YOCA 3TWCL 2XY2A 5JDJA 5T3XH 1RJLB 5KJRH 4WGWB 1WBZB 2VXVL 3QI9B 2HP4A 5KS9E 2B1AL 4R6UA 3VFSB 3C8KA 5J56B 4WFED 4P46C 3RWDA 5HGAB 4CKVX 4ZNCD 3M8OH 3C2AL 4DQOH 4LQ1A 1MLCB 2G2RA 5INCB 3RDTC 2Z31A 3GSRB 2G5RA 4JY5H 5E99H 3LB6C 5F8QC 5T1LA 3NMEA 3VFUA 5GRUL 3BP7B 5MENB 4HGMA 2XXMB 5E2UH 4P2OA 3UTTA 5L6YH 4NKMA 3NCCB 2C26A 2VABB 4YHYB 1QFPA 5D93C 1T2XA 2ZOKB 1HSAB 2ZWLT 3ILPB 3R1GL 4JHBA 4P4KA 4X6DE 4UUJA 3ET9F 4PD4K 5B3NA 2Y5TA 3D85B 4LRIA 4XNMA 4YBQD 5EN2B 3OX8B 3REWA 3VFTA 4BFGA 3N9GH 1VCAA 1DJSA 4YE4L 4B7IA 1OLZA 4OQTA 3VXUB 3AREC 2NY6D 5CIPH 4R90L 5HGHA 5JHDA 5IJKA 1AIFB 4XPGH 4LPTA 2V9TA 5J12B 1JF5A 1QPXA 1A7NH 3KYKL 4KK5C 1EK3A 3E6HB 4LCUB 2DQCL 4QRUB 3WFDL 5GS1B 5E4EB 1EVUA 3W5MA 2VN4A 1NUFA 1X7QB 3TFKD 2XYCA 1KV3A 5FGSA 5GS0D 1A6UL 2MPAH 1CLYL 2XN9A 4KVNH 4L5FH 4X4XA 2NY0D 4WFEE 1SEBB 3DO7B 3QH3B 1ZKAA 2ZUUA 4QRPA 5DMIL 1G7PB 1J8HB 5D2NA 4HGWB 3V4UL 1T1WA 4NT6B 1F11B 5DRNA 3WLBB 1UXSA 1XF4A 4GMTL 1IGTB 1IL1B 2XWBA 3KPSB 2IMMA 4LEXH 3ZE1E 1DEEA 1RK1B 3UP1A 4QTHA 5AEAA 5IGXL 4LQFH 5CD3B 2Q7NA 2X09A 1ORSA 3FT3B 3WNNA 2QQNH 5EO9B 1A14L 3PDGA 1QFUL 2Q8BH 3WIHA 5EUKA 4WIQA 4X6DA 1EEUA 4MJ5A 1ZANL 1BQUA 1FZKB 2YRZA 3V8OA 3T8XB 5J89A 1BQHG 1JFQH 4U3CA 1C5CH 2NQCA 3MLXL 5C0JB 3MGTB 3JWDH 1YEIL 5F3BB 3ESUF 2HTLC 2E6QA 3IDNA 3GSQA 3PIQA 4OTXL 1AQDB 4P2RB 4X6CF 4OLWH 4Z95H 4GXVH 3IFPA 1IGCH 1BECA 1YNKH 3BZ4A 1CLOL 3LSOA 4DFHA 1QRNA 3IGAB 2EDWA 3DURB 3O0RH 3UTZA 3O45A 2C7UB 1YC8A 3TBVA 2NYYD 1YUHB 2X1PA 3DROB 3LN5A 5F7FA 1Y18A 5D1ZC 3T0DA 3EOBB 4KPHH 2FHBA 2BY1A 2GK2A 4PS4L 3W11D 1G6RA 1KUMA 5AUMA 3B2VL 2VDKL 2A77L 2M2DA 5ITFA 1ES0B 3O2DH 6FABL 1INQA 4NKDB 1WWBX 1UJTA 1NEZA 4FQ1H 1YY8B 1F90L 4N8VA 1T7WA 4MB3A 4L4TB 4MSWA 2ED7A 3GMOA 2EYSA 1XGPB 1L0YA 1JHTA 5I1GH 1X5AA 2AABL 4J12A 1FRGL 3C9NA 2R2HA 2CXKA 4ZOEA 1NEUA 1CTNA 2N7AA 4HBCH 3SGEH 1NCAH 4AL8H 1T66D 3GHEH 1T1YA 5AYQA 4XHJC 4GUPA 4YAQA 4YBHA 3QA3B 1ADQH 4F57L 3BPOC 1Q0YH 4KJQC 1KNOB 4ZS6D 4ZUVA 5FYLH 1GCFA 3JTTA 1J1PL 3D69A 4XH2A 1I3RB 2OR7A 1S7UA 5IEKA 1TJIL 2Z93B 3KPQB 4XRCB 2HLFD 5JPMA 2IQ9L 3AU1B 4ZXBA 5F7KC 3T0WA 4UOW1 3FHAA 1F6FB 4WFFD 1Q9OB 1QFOA 4LKCA 3I2CH 5EO1B 1KIQB 2HKHH 4JPKL 5L9DH 1H3PH 1EJ6A 4U2ZA 3UYRH 4UNUA 1AKJB 1VERA 2Z91A 1J18A 2EZ0C 4YHIB 3LMJH 4QLRA 1IC5L 1K4CA 5E1AA 3C6SA 1I85A 4D9LH 5KZCB 2OK0H 1BVLB 5E2TH 1A1OB 1D5ZA 3F6IA 4BK5A 2DDQH 5I15H 1SJHA 3LQAH 1O0VA 1IKFH 2P47B 3CK0H 1X5LA 4IIQB 5DJZB 2FECL 4WJ5A 1MFAH 3OJMB 4LLUB 3HE7A 4OCRH 3EDJA 4KAQL 3E0GA 2AEWA 4TRPH 1U8IB 3WO4B 4ZUUB 1JYWA 4MVBC 2IEPA 5GGTL 3RWCA 1F13A 3FN0H 3LRSB 1CBVL 5FEBA 5F3HB 4GSDH 1J5OL 1ONQA 1K2DA 4OGXH 1MLBB 3QHZL 4G6AC 3U9PH 4TUOA 3TIEB 3G6JE 5AWNL 3V0AC 1J0KA 1GZPB 1XGUA 1XH3B 4URTB 3MODH 2CDGB 2GKIA 4XWOC 4MCYA 4DN3L 35C8H 2AJ3A 4ZAKB 3WS6C 2AJZB 3BXNA 1IQDB 2ITCA 4RFEB 1DQMH 2I60L 1SY6A 1KOAA 4WFFE 3TBSB 1JNHB 2ADJA 3T3PE 3EZJB 4P9MH 3VFWA 1T0MB 2CIKA 4Y19D 5FUCC 3Q5OA 3KLAA 3QNZA 2VZSA 2GY7B 2NY2B 5ENWB 1VACB 1RZ8B 4HWZA 1M6OA 2D31A 1RZIA 4QO1A 3OR6B 1A0QL 3PNWA 2WNGA 3QULB 4MJ2A 4EVNA 5C6PB 4ENED 2FB4L 1H15A 5IMMB 1DVFC 1T04A 2HRPH 3VXTB 4LF3A 5DJCA 3QISA 1V7MH 2CDEB 1SBSH 4O02H 1CXLA 1FL6A 3HNSH 2GAZA 4HUXA 4MGXA 1NGWA 5D6CB 1S7VA 3BZEB 4HD9A 2OR8A 2ZUSA 4XPTH 4YZFF 2Q7YA 3PQYA 2LQRA 4TSAL 2XG5A 3G04B 3JV4B 3LS4H 2VO5A 1BEYH 4PTTA 5DUML 2MMXA 5IIEA 4P5TB 5KOVC 1W72B 5EU4B 1TTFA 1UM5L 1Q9WB 3OPZH 4JFFA 2DLTA 2FO4B 3CXDL 2H9GB 3WDIA 3EJZC 3U48A 5C07A 1TZGH 3QFJA 1KEGH 2GEEA 1NKOA 3VG0L 1OF2A 3QXDA 4APQC 4Y2DC 1TPXB 3UYOD 4Y19E 3TA3C 4OFPA 1E4KA 1NL0H 2HLAA 5KG9A 5JLZA 1XF1A 1MRFH 5J3HD 4N5ED 3QI9C 2W59A 4BSVA 2VLRD 3HCVA 5L88L 3I9GL 4FQIH 3C8HA 4CN4A 4M5YH 2WUCH 4HKJB 4Y4HD 4NJ9H 1AGEA 1FFRA 5ACZB 3BRFA 2VDLL 5TE4L 1ED3B 4ZFFB 2CPCA 4R9HA 3QUKB 3D3VA 5A40E 4OIBA 1AGBA 5CUSH 1RULL 4EJ1C 4NHUB 3GMRA 1U3HA 4PG2C 4MXVF 3O6FC 3P9MB 1E28B 5F89B 4YHYC 1L9NA 5EBWA 1FBIL 2YPLD 5AZEH 3ME0A 4ZUTB 3BMWA 1DBJL 3V4VH 3T1FB 1HHKA 3GSNH 4G9DA 2BVPA 2FSEB 3QCTL 1HOCB 3T2NL 3E6FB 3X3GL 1DBBH 1FN4A 1NPUA 4N0RA 3QEQD 3VI3F 4NUJA 5IFAL 1XR9A 5J12C 3ALXA 4OUUB 5F7UA 1FO0A 2DQIH 1VGKA 4LSVL 1ETZA 4Z7VE 4Q2ZB 3OXRA 1UWXK 5E4EC 4JZOA 5FKAA 1TZIA 3DV6B 2VMFA 2V7NB 3IF1B 4KJPC 1RPQA 4PJFA 1TVHA 1QFWI 3QJHA 4PGBA 2VLRE 4JFEB 4ZPVB 2BVQB 2FGWL 2W0FA 2J8UE 2HG5B 4OZGA 3AC0A 2UWEB 2W0PA 1QBMH 1NGPH 1PQZA 5F9AC 1J05A 4PJ7F 3JVGA 4Q0XL 5D71L 4NBZB 1CD0A 4AMKL 3ZMRA 4NNPH 3CGTA 3VFMB 1CICB 3FT4B 5DMGD 1BPVA 3B8YA 1B90A 3V4PL 2P8MA 3KR3L 5DJ2B 2CKBA 3DVGB 5DJYA 1WFUA 4FZEL 5CBAB 4OCMC 4OM1L 4EZMA 3RWIB 3B8SA 5C0RL 1QUNA 1FJ1A 2D9QB 3MFFA 2NR6D 4D0CA 2YPLE 3GMLB 3HPLB 1RVFH 3ARGD 2IF7A 1X5IA 5HHVL 5IB4A 2VN7A 1G9ML 2X1XR 4UIMB 2J4WL 5E8NA 1A6TB 1KCUL 4HZLB 1I7ZB 2H1PH 2YS4A 5EZOH 5DJ0A 3K2UH 5HYIA 3GMQB 1J1OH 3ALWA 5TJWK 1JWUA 3BH9A 4IS6B 3QEQE 3MRCB 1N2RA 5FFLA 2GJ6B 4AIZA 1XMWA 1T5XB 1BLNB 2WANA 5B38B 1A7OL 3I6KB 3W39B 3MCLH 4Y5XC 4Z7QE 5LGJA 1INDL 1MVUB 1RJYB 2N4IA 2YA1A 2J8UA 3IDXL 3K8KA 3DBXB 3TJHC 5TDNA 3K1DA 2W65B 1JF1A 3GNMH 2YZ1A 3MO1A 5BZWA 4XPHH 5HGDB 4KKNA 1MPAL 1U8PB 4Q9QH 4TVPH 5FXCH 4NNYA 4M4PA 4L4VB 2Y36H 1RUMH 4JM4H 1I1FB 4XI5C 4EOWH 5DUBB 1J86A 4JFPA 5GPRA 3SDAD 3D0VB 3GSXA 5TDPB 3A6BL 4NZRL 4MZ2A 3W0WA 4POZC 4W4OC 4JRXD 1CZ8L 2XXCB 3ZKXB 2AEPL 1S3KH 3MJGX 1PG7L 5ICXA 2VXUH 4YHKH 3VGAB 1S9WA 3KXFA 5KSBE 4XBEH 1M4KA 1CT8B 4Z5RB 3PXHA 2DICA 3FO1B 2BP3A 4H20H 1JZ4A 5IMOA 3GJFA 3BIAX 3DETD 1DUZA 3FTGB 4XPFH 3BH8B 4PJXB 4ELMA 4UQ3A 1P6FA 4M7JH 2Q8AL 3QPQD 1GHFL 1I9JH 2RGSA 4CW1B 5IB3A 1N26A 1IEBB 1MCBA 3VD7A 4K2UL 4R96A 3BKJL 3FL7A 4NGHH 3QUYA 2NLJA 4P5KA 2DS4A 3QQNA 3O8XD 5EDXA 3RRQA 4ELKB 2AXHA 3NCYP 1NDGA 2EIBA 1AGFA 3VD4A 4HUVB 3EOYG 4PRBB 3R8BB 4KWUA 1UXWB 4ZO6A 1NBZA 2MCPL 4RX4A 5HI3D 4S10A 2ZPKL 3QDJA 3Q1SL 4NNXB 3O6ML 5A2LH 4LHJB 4BKLA 1EVTC 5C1MB 3EYFA 2DKUA 5EU3B 1JUFB 3UCRA 3H42H 4IIQC 5D72L 5EOCL 3RIFF 4JRXE 5EO0A 4D0BB 1Z2KA 4EBQH 4YPGB 5DQDH 4B50A 1WIOA 2I25N 4O58H 3WO4C 3HE6A 4ESKA 4JG0H 4O2FB 1DE4A 2H2SC 1WJ3A 5KVGL 2HFFB 2NX5E 4JKKA 4DKEL 1WBZA 1B0GA 3RBGA 3DX7B 3QUZD 2I9TA 4XX1G 1EX0A 1JGLH 1F6LL 5DZOA 3OGOE 1ZEAH 1BJ1H 1FVDB 3CFJA 1MLCA 3EHBD 4ZAKC 3EDEA 1MCWW 3HAEA 4HV8B 5HJ3A 1UA6L 1R5VB 3S36X 1FORH 3KYNB 3BO8A 3QEHB 3DWTA 1S78D 4K7PY 2IAMC 4JQXC 5FO8A 2NNAA 3I84A 5D70H 4MJID 4HWBH 2VL5A 1HKFA 1U93A 2AGJL 2KBGA 3UJTL 4MXQD 4JEGB 4GRWF 2JCCA 4HS6A 2ZOKA 1A7QH 4FFZL 2VKWA 1C5BH 2P5WA 3S36L 4KMTL 3U7WL 4NQEA 4CU6A 3H9ZA 3FB8B 4NWTH 1YECL 4U6VL 3BDYL 1K6QL 3GMMB 5TE7L 1NUGA 5SWQB 4JFOB 1RZJC 3KPLB 1AFVL 4F7EA 2J3SA 9CGTA 4OFYD 5FGCE 3ZE0E 2AQ2A 2A9ML 1TMCB 4N1CA 3E6HA 1CFTB 3EFFA 4J3SA 5D5MF 1KJ2A 5FCUL 2PO6D 4PJDE 4CVWA 5GS1A 1BQLL 1G9EA 2B1HH 5C8JB 2X1WL 1FPTH 4ONHA 5E08H 1X7QA 1SEQL 1ERNA 3GHBH 2IPTH 1YMMD 3SE9H 5EOQL 5DD5H 4DVRH 1QFWH 4P5TC 1ZHKB 4S1SH 5HSFA 3G9VA 3KWWA 2H8PB 4XC3H 3SY0B 5L2JB 3C5SB 3TVMB 1BIIB 3MPCA 2W07A 4IMKA 1YEEL 4Y5VB 1IT9H 3RJDA 1RK1A 1S7WA 3ARXA 3G9AB 4KK9C 3AM8A 3GB7B 3FMGL 2VLLB 4MJIE 3SJVA 3HRPA 4ODHL 1L7TH 4CU7A 1IRAY 1FE8H 1TPXC 1OPGL 4OF5A 4AT6B 4NN7B 1Z9OA 3I50H 4X4ME 1MCPH 4MA3A 4PJAB 1A7RH 4Z7UB 3V0WL 2V7HB 1INEH 4FZ8H 3WUWB 5DD0H 5BMFL 2ICEA 4KJYB 4HS8H 1ZHNA 5C0JA 4LMQE 3D0LB 3MGTA 5F1NA 3H0TA 5CCKL 1LEGB 4PJ8C 3ZTNL 4L1DA 2C1PA 1UVQA