1C08B

Crystal structure of hyhel-10 fv-hen lysozyme complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10)
publication title Crystal structure of anti-Hen egg white lysozyme antibody (HyHEL-10) Fv-antigen complex. Local structural changes in the protein antigen and water-mediated interactions of Fv-antigen and light chain-heavy chain interfaces.
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c08B00
2HJLB 5B39G 3W0WD 2BNUB 5FYJE 4ZTOL 1RURH 2R1XA 2WV3A 4Y4FC 2WAHA 4P5TC 4R7DB 4OF0A 3DX8A 4HUXB 2PYEB 1AGCA 4NYLB 2APFA 2XN9A 3DRTB 4KUZH 5DVKA 1S7QB 2OJZL 4X4MA 4JM2C 5D2NC 4YHKH 5K59F 3GRWA 5EC2A 1KFAL 4O9HH 3SY0A 4RAHA 2EXYD 4MSWB 4JRYE 1GC1H 1KTLB 4HK0A 3QO1B 3HI1A 1YPZF 4X83A 4Y1AE 4MA7L 4P23A 4LHJB 2WM0A 4R90L 5FF6B 3U7WL 2WBKA 4AYFA 3BGMA 3BKCL 3BSZL 3O3UN 2W0FA 2CO6B 3EDKA 3ARBA 3T1FA 4XVUD 4DEPC 3TESA 5ICXA 4FQCL 4KZDL 3MLSH 5JA8B 1G0XA 3IDIB 4L8DB 3EFDL 3RVWC 1T5XA 2NX5E 3PDDA 1LILA 1A1OB 3L1OL 1GZPB 4YGAB 5J1TC 2FH6A 2LU3A 4OUUB 4NZTL 1A1MA 1JE6A 1ZMYA 3SDYH 3EKCA 2J6EH 4M7KH 2R56H 3BW9A 1BFVH 3TBVA 3MA9L 1TQBC 1UGNA 2R4SL 5BOZG 3KG5A 1RZJC 1PZ5B 4BH7B 4PGBA 1FNGB 3O9WD 2HLAB 4XPFL 4GSDH 1GGIH 3OF6A 4NHCL 1IKFL 4M6NH 4KUCF 1AFVH 4QRPE 3P2TA 5E8NB 6CGTA 2ARWA 3EYVA 5DC9B 2ZSWA 5I73B 1FNFA 2GK0B 3KLAA 1UYWH 1G7IB 4JHAL 5FDYA 4IDJH 5CCKL 5T1MB 5DD5H 4N1EA 1NDGA 3RHWF 3B9KA 4G42A 5EO1B 2NYYD 4M3KB 5ANMB 1BQHG 1UWXK 1YMMD 2AEPH 2JIXB 3LRSA 3N1GC 2QQKH 3QT2A 4Z7OF 1JPST 4PJHA 4L9DA 2APBA 3GJFA 4QHUB 1ZLWH 4QHKI 3D18A 3QPXH 3MA7B 4UBDC 1U8NA 4ODSL 1DBJL 3CUPA 3MV9D 4G8IA 2GAZB 2E5EA 2Q8BH 1RULH 5F9JB 1W72A 3AREC 4N8VA 4Z0BH 5FB8A 3AFLA 5CD5C 3GSUB 1ZSDB 3QA3B 2AVGA 1F2QA 1W8NA 3U36A 5HYQA 4HUNB 1HQRB 5IFHH 3LQZA 5HDBF 1EH9A 1I3VA 5J11B 3GSQA 3W39B 1J05A 2BFVL 3P3YA 3X17A 1YYML 2VDPL 5J89A 2CGRL 1FN4A 1RU9H 2JB5H 1VCAA 2MQCA 2W92A 5C08E 3RTQA 4I8DA 3FQNB 2WUBH 3WDHA 3DVFA 4OZHF 1S7SB 4OQ1A 5IHBA 3MC0A 4PRAA 4OLWL 4P2YA 3MBXH 4LQFH 4PTUA 2IH3B 3E2HC 1MJJB 2HFFA 4ZAKA 3SKUD 5C0JB 2DJUA 2IANA 5E2WH 1D5BA 5D7LE 1BD2A 1HOCA 1MCLA 2G75B 3VFWB 4E41E 3B5TA 5HDOA 2DQJH 1NBVL 1ZLSL 5DD3H 2OP4L 1HZHL 4BA8A 4NN5C 1DLHA 3HPLB 1MIMH 4MNQD 5C09D 3LEYL 5FECA 1TPXB 3WHXB 1Q9OA 4UT7H 3L5XL 4U7KA 4M43H 1KJMB 4L3CA 1PQZB 3S37X 2YPKA 1KXTB 4PTTA 3RBGA 3B5GA 3O3AB 2F54A 1KCKA 4QRTA 3MCLH 3GO1L 4Y7MA 1HQ4B 1WT5A 3UPRA 2VRAA 4KHTH 3DJ9A 2OJEB 4YZFF 4YX2L 4Z8FH 2XRAH 3VRJA 4BH8A 4IJ3B 5D1ZC 1JHLL 5T1DL 5A3IC 1UT9A 2NW3B 3QHTC 1OM3L 2P4AB 5ENWA 1QFWI 5CJQH 3N0PB 2VITB 4KTEL 5IKCA 1JYWA 1NMBL 1Z5LB 3RUGA 4GMTH 3AROA 5CJXC 1IAOA 3QXAA 4L1HA 4YUEH 1ZLVH 3PABB 1AGEB 2VSCA 4XX1G 3EYOA 2O5YH 5L8LB 3HCVA 4KRPC 3I50L 3BE1L 4KK8C 4LLMB 3DVIA 5GGVH 4PRBB 1GGBH 3K4DA 4KKAC 1EO8L 4PB9L 1DQTA 1OAYH 4UV7H 3MCKA 4S1QH 4PJ7F 5IBLC 3NMEA 3LZFL 2DQDL 4N0CD 3JWDH 2P8MA 4LVEA 3E0GA 2R23B 3T8XB 3KPNA 5D7LB 2DLGA 4FQQA 3EYUH 4YHNA 4WV1A 1H9VA 3MRCA 1B88A 3MUHL 4WHTA 1SJHB 1O0VA 4O02H 4C83A 5I6XC 3HUJF 1CL7H 1Z3GL 2E8YA 3V9FA 4W4OC 3HNSL 5KN5B 4UIMB 3IVKB 2G60H 4JRWA 3QO0B 1A6UL 4GBXA 5IM7A 2MKLC 2FH8A 1YZZA 5FM5O 3SGDI 4HHAA 5I30H 2ZJSL 5I1GH 1YEIH 3MACL 4O2EA 3VXMD 5HJ3B 4FZEH 5I1KL 4NO5A 2HN7B 1IC7L 1PJ9A 1AGDA 3SGJC 3OR7A 1NSNL 3BQUB 5C07A 9CGTA 3GJEA 1MHCA 2FHBA 3MRJB 5AZEH 1MHPL 2ZCLH 3MJ6A 1A6TB 4P3CL 2IAMA 3MOAH 4WFEE 1MHEA 3UYPA 4YDLB 2BVQB 3NFNB 4XCNB 1RFDL 5C0ND 3MV7A 1GOHA 3QCUL 2BSRB 1JJUA 2EDLA 3AMKA 4OM1H 4K3EH 1BM3L 1QA9B 4QY8B 5I76A 3GMPA 3W5NA 2QQLH 3HAEG 4EIZC 1HHGB 4FTVD 1T22A 3RVXC 1MFBH 4LLYA 3Q1SL 4TTDD 1YNKH 1UM6H 2YEZA 1P7QA 2X7LB 3QG6B 4P46A 2AGJH 1QBLH 5B39B 4JPIB 4KKNA 5LBSH 4QYOB 5HHVH 4W4NA 2IADA 5EOQL 4N68A 3PWPE 5C6TH 2VL5A 3VFPA 4HBQA 2DQTL 3IETB 4F9PA 3O6MH 4OLVH 2RCSL 5I1IL 4XGZA 5EUOA 4ZFGH 4LARL 4X98A 4R96A 3JWDC 4AIOA 2WLZA 4HH9A 3DX7B 5CILH 5SWQA 5FHAL 4R26H 1X5KA 1RUPH 2C3HA 2VH5H 5TGBB 4NNPH 1FYTD 4AEIH 3T2QA 1KCUH 5ESQB 1MCCA 2DD8H 2H9GA 2NCMA 3DO7B 1NLDL 1JGEB 1NEZB 1T83A 5HTSA 4JKLA 1MCKA 3QCVL 2IGFH 3W0WA 1RZFL 5IEHB 1OOAA 4E5XA 2DIBA 4Z5RA 3U7YH 1ZLWK 3S37H 4U05A 3D39D 2YD2A 1OW0C 4I2XE 2A1WL 3DGGB 3GBNL 1N3NB 4OF8A 4G9FB 4ONHB 5BRZA 4E0RA 3CFDA 1CGVA 1ETZA 3ELAT 3QEQD 4B5EA 4GMSH 2A73A 4XB7A 1CFQA 1TTFA 3I6GB 1F90L 3EFFA 4WW1B 2QHRL 1G7QA 3TVMC 3O3BB 1I85C 4LHQB 1NBYA 1LP9B 4KI1A 3KDMA 4JPKH 3N9GL 1FL5B 1V7ML 3B3IB 1K2DA 4UQ2A 4PRIA 3PWPB 1VDGA 1EEZA 5ITFB 3D0VA 1N59A 1VERA 2NY5C 5TDPB 2Y6SC 1NCWH 3T65A 1M6OA 5JHLL 3UP1A 4U1JB 1IFHH 3REVA 5DQJA 2XQYK 1JF5A 2R2BA 4OI9A 4PGEB 4FXLA 2FR4B 3O4OB 3BZEB 2UZYB 1EVTC 2GUOB 4JQIL 1K3ZA 2VUOA 2XA8H 3VFRA 3HZVB 3IFLH 5HY9A 3OJDB 1L7TL 4YAQB 4YWGL 4AIZA 1FAIL 4U0QB 4P4KC 1PAMA 1MREH 4L4TE 2NY4C 3JTSB 3TA3B 2EE2A 1UXSB 4LCYA 5DFVC 4NSKB 2HRPH 3OKKB 1EHNA 4ZMAT 4MCZB 1FFNB 1AQKH 2NTFB 5DHVB 4J2XA 1VFAA 3MRMA 4K71C 1EPFA 2AKRB 3MRIA 4ZUSA 1M71B 4MZ3A 1F4HA 5GGTA 1DBAL 4JJ5B 3O2DA 5CKGA 1NAMH 3V5DB 1DBKL 1BIIA 2XTJD 1RZGB 3H42H 1URLA 4H5SB 1DQMH 2ZPKH 5DJXA 2Y9RT 4MB4A 2VLKE 4OQTH 4F33A 1WBZB 4IIQA 5SV3A 3EJZD 4UOJA 4X6DB 3UC0L 4M5ZH 3MLYL 1NGWB 1U8JB 3TV3H 1AIFB 3MXVL 4KVCH 5JOFB 1ZLVK 4JGUA 1BFOA 4XAWL 4R4ND 2KQNA 2BOCA 4PJGA 4HXAL 2VB5A 4O58H 2VZTA 3BKJH 1WWBX 1EERB 4HWEH 5D8JH 1IE5A 2FL5B 1R0AL 2VXQL 3OAYH 4OGXH 1ZVHA 3QI9B 4UNVA 2BVUA 5GS2D 3QUZA 2E27L 1X5HA 3L7EB 5MEOB 1FGVH 3W9DA 1L0QA 5GS0D 1NFDE 5DRWA 3FRPA 3RIAK 5JXAH 2YPLD 2GT9B 1P69B 1RZ7H 2EDTA 5TPWH 3QXDB 3TYGH 2B39A 3QDJA 5IF0B 1T1XA 4J3XA 4XCYB 3RUGF 1KIPA 3P9WB 3QIUD 1UH2A 4U1MB 1GAFL 2C3VA 2NXYC 3QH3A 1MRFL 4H1LG 1K8DB 3VD3A 5AD0B 3NPSC 4U6HA 1CT8A 4X6FB 5KOMC 4EXKA 4PJ9D 5ETUB 2YA2A 4OFYA 4D9QD 1DSFL 2VLKB 4M5YH 2FX7L 1CDJA 1QSEA 1D5XA 4XCFL 4P57B 2G9HB 4WW2A 5E7FA 1EZVX 4U1IA 4OQTA 2EEBA 3O8XC 3DUHA 1BVZA 3IS0X 2FECI 2ADJB 1R3LB 2FLRT 4PS4H 4U2YA 4LCWD 1BF2A 4HFWB 5KZCB 5IJVB 2JKXA 1OP3H 1EBAA 4IHOA 4LAQL 3RZCA 3FO0L 4ZNEE 5FK9A 3TCLB 1YECH 3RWJB 1SMAA 2BNQA 4NQDD 3UTSE 1MAML 4Q6IA 4H88H 3X11A 4UIKH 1XGYL 4M1GH 1J1PH 4AY0A 4RA0C 5J6HB 4GW5A 2Z92B 1D5MA 3F7VA 1CK0H 4XTRC 4X5XA 5E4IA 3N1QC 2IFFL 3VXUD 2VDKL 2ED8A 2WWKO 2QEJA 1GYAA 1TVHA 4J8RA 5BV7B 3HRZB 4C57C 5KSUB 1JNNL 1KTDA 2B5IB 1MCEA 4EIGB 5L2KE 3ARXA 3VFNB 3ZHLA 2CDFA 3T0ED 4ODTH 1I8KB 3TN0D 2HWZH 4ZOEA 2OL3L 1QKZH 3LN9A 4Y5VC 3KPLA 4JCMA 5EUKA 1DTUA 2NZIA 4XNMB 2Y72A 1XR8A 1EJOL 2JCCE 1OTUD 1FFOB 4NO0B 4P2QE 4XB8A 4I3RH 2Q76B 3C5ZD 2PR4H 4LIQE 5DJYA 5F71A 3WNKA 4BZ2H 2W9LA 2VLRD 3K0WA 1Q0XH 5MERB 4UDTB 5D2LE 4TSBH 3VWKD 2X42A 2X4QA 4GO6B 4K94L 4PRHE 4EN3B 4O2FA 2P8PB 2VXSL 5DYOA 2XV6B 1NH6A 3TC9A 2Y7QB 2NY6D 4HPOL 2FBJH 2RBLA 3MNWA 4F3FA 1OWRM 1KIRB 4MA8L 4LPTA 3V52L 6FABL 5JQ6H 4RQQB 1WZ1H 3OKOB 3OXRB 3C60B 3OPZL 1FSKB 1JI2A 3UTSB 3BWAB 1ZA6A 4XNUL 4C56A 1B2WH 3HE6C 4YDIL 1B0RB 3WN5C 4F7EB 3X13A 2EDNA 2CIIB 3HC4L 5C7XH 5DDHA 2E7MA 1X3DA 2XNAB 4OLXH 3JWNC 1YEHL 5HYIA 3F7YA 3MRDB 2AAVA 4DCQA 1DBMH 1MCWW 3IU4H 4LFHG 2GY5A 5L2KB 4PREB 3KXFE 4G8EA 1CU4L 4K9EH 1BP3B 4LCIL 4WEUD 5DJCB 5B3JE 5C0BA 4M9PA 4ORZC 2ZOKB 1RK1A 4B41A 4Y4FD 4P5TD 5C0DB 5JOEA 4R7NB 1D9KB 4X7DC 4Y0GA 4Z7VE 3CCHA 3VH8A 3D5OF 3D6GA 4WWKA 4BSVB 1A6AB 2EIDA 4P2QB 5E2UH 1RMFL 5JHDD 1CXLA 2CUMA 5D2LB 4JM2D 1JFQL 3MFGB 4J3TA 1JGUL 4PRHB 1ZVSB 3U46B 4EUPH 1HINH 2WBWB 4PG2C 1T89A 4EXPX 1JHKL 2P47B 4HXBH 5IB5B 5F3BB 4NQVB 1UACL 3GMMA 2B4CH 3E8UL 1XIWB 2V5RA 3BZ4A 1QFOA 4P59L 4M1DH 2YBRB 1F8TH 4LASH 3GSXA 3WFCH 4MJ6A 4R0LB 4LVHB 4MJIA 5I71C 3GBLA 2DQFB 4WGWB 3NA9L 3RVWD 3QIWB 1A6ZB 4W6WB 4HIEA 1NMAL 5E6ZA 3PL6C 4YHMH 1GGTA 4R6UA 4QHNA 4GKZB 3RWDA 2HKHL 5C0AA 3MODH 2R8SL 5CUSH 4YLQT 5GGTL 1X6NA 1ZHNB 2BVYA 5LXGL 1P4BL 3HE7B 3O3DA 2VDRH 5D4QA 5I18H 2B1HL 3A6OA 1UQSB 4HUKB 3U1SH 4ZUUB 2CKBA 4MD0B 3OXSA 5LJYH 1R24B 2HFEB 2IALA 4F7MB 3P0GB 4UTBH 4Z7VB 3SQOH 4DZ8A 2XXMB 1REIA 4JY4B 1U3JA 5JORB 1U93A 3OAYK 4G80B 4WCYL 4R4FL 4JFZL 2CRYA 4QO1A 1DVFA 3STZB 5DJ2A 3FO2B 3ARVA 4HF5H 1CICB 4ODWA 1U58A 2Y06H 4K9EC 1INEL 4UUJA 2DQUH 3PDGA 1FZMA 5ERWA 5JMOC 1JZ3A 1IQDA 4FQ1L 5I1AB 4M48L 4JO4L 4PBWD 3CFKA 4AT6A 5IVXF 4S1RH 3LCYA 3WJJA 5GQBA 3PHOB 2Z8WC 3MBEC 4Z76A 4PJGF 1MAKA 1QLFB 3BUTA 4UBDD 2YA1A 3Q5TA 4X8JA 1O7SA 3NIDE 4CL7A 3FFCA 3TZVA 3ARED 4GLRI 5EIQA 3CDFA 1FLTX 4LSDA 4PJEA 4JRXA 3X14A 5CD5D 4K3DH 4QRUA 3HMWL 1BGXH 1VKXB 4TOYH 1Q1JL 4KROB 1KCVH 1GPOL 2W9DL 2B4CC 3MLPA 3KPRB 3ARFA 1T2QL 2PKDA 1BJ8A 1OP3K 4RFOL 4UOW0 2GTZA 1FBIL 5I66A 4GRWB 4S1DC 2L4OA 3K4ZA 5JNYA 2R0KH 5FKPA 4JHZA 1KN2L 1Q0YL 1XF4B 5EU6A 4P9HL 1AD0B 3WIFB 4TNVF 3CGTA 5AAWA 2KDGA 1H15A 2OTUA 1LDSA 5MP6L 2KUTA 3LOWA 5CEXB 1JK8B 4F58H 1TJIH 4IMKA 4PYHA 1OB1A 2UV3A 3FMGH 1ES0B 1U9KA 4PJCA 2JE8A 3RDTB 3VDCA 3V6BR 4TULH 5A2JH 3NN8B 3DXAE 4IS6B 5FDWA 1YYLH 1WBYA 4M8VA 5DC4B 3OR6A 4HKBB 3HLAA 1GGCL 1OLLA 4URTB 4ODXB 2OX5A 2JJVA 4OZIE 1I3GH 1N2RA 4BQCA 1U8IA 1ZS8A 1BOGA 1FLRH 5MI0B 5JOPD 3IDGB 4ODUB 3DRQB 4EVNB 4KQ4L 5HDLA 3VXNB 5D1ZD 4HT1L 3MJ7B 4Z78B 5A3ID 2YPLA 3I02B 1LO0L 3ARZA 1FIGL 4PJIA 5CAYB 1XH3B 1NCNA 4OZFA 2GCYA 3QCTL 3JV6A 2P7TA 5TE7H 3IJHB 1QTYT 3QIUA 3VU2A 3SE4A 4I0PC 1X5IA 1NLBL 3O6KL 5ACZA 1MVUA 1P7HL 2LQRA 1EDQA 1NC4D 3I9GH 1KPVA 4NC1E 2Y23A 1IQWL 1FV1B 1QYGL 2IPTL 4KRPD 1P4IH 2F53A 3LSOB 4GRLA 4KK8D 1CD1A 4KKAD 3NZ8B 1DJSA 3EO0B 3OZ9L 5GGRB 3VXRA 1QRND 1ND0B 4KZEL 4OLYH 3N85L 2AJZB 5IBLD 5IMKB 3IKCB 5T33L 3KPSD 5DVNA 1G1YA 5B38A 2YMXH 1RD6A 2QADB 2FATL 3P0VL 4U33A 5K59E 4ORGB 1FJ1A 1H5BB 1S9XA 2FX9L 3LQAH 1R5WA 3BZFA 1A7OL 4Q9QH 4YDKH 3AVEA 3RWIB 2FB4H 1BQLL 4YR6A 3ZE1F 3ZKNC 4M1CC 1YPZE 5HYSA 5DRXB 1ZOXA 1KOAA 3CLEH 4OZIB 3OBAA 4YDJB 1QP1A 4RWYH 1DANT 3UJJH 3F65A 3H6JA 5MEPB 3RX8A 4LRNL 4PJBB 3T77B 1DN0B 4Y8DC 4IEFB 5SWSE 4CN1A 2ERJC 2AEQL 3DVNA 4DKEL 5JPMA 4ZODA 5C86A 1OGAA 3PHQB 4ZS7L 1VFOA 3U2SB 3QBTB 1QR1B 1D6VH 2VQ1B 3SO3C 3AU1A 2RGSA 3D2UA 4PJ5E 5GISH 2BVOA 2EECA 3PGFH 2O5ZL 3QHZH 4XPGL 1YA5A 2F19L 4MQ7A 4FQXA 3VXOB 3D69B 4ELMF 1IC5H 4TSAH 4NN7B 1CYGA 3QUMH 4UOW1 1UCTA 1CGSH 1V8HA 5EU5A 3DUUB 3ZTJH 2V6HA 3Q3GA 5J56B 3GHBH 1VESA 4KH2A 3RVXD 1UXWB 1NCDL 4OZGA 5BW7C 2XWBA 5GRVL 2JELH 4NKOA 3IDYB 1DBBL 5CGMA 5BMFL 4HV8A 5DA4A 2BY2A 4O5LL 3PWNB 2IH1B 3LKPB 5J1AA 1MJ7H 3QDHA 3INUH 5HGAA 3GZKA 1C12B 2AJSL 4KI5F 1RUKL 1N6QL 5CBEA 4YPGB 1JGDB 2ESVA 8FABA 3P77B 4Z7OE 2AJUL 4MQSB 5KSVA 4Z7UB 2Z35B 4TUJA 3U0WH 5TE4L 4PJFB 1EFQA 1MCSA 1MF2L 5T1LB 5SWSB 1LEIA 4MMXC 1JWUA 1G7PB 4NPYA 5EZJA 3WFHB 2EDXA 1A3LH 1FPTL 3LQAC 5SWZE 5K9KA 3OAZH 3EW3B 5ID0B 2X4UA 1FNLA 2MFNA 4RNRB 5JO5B 3ZSTA 4XC3L 2FNBA 3FB6B 4J12A 2W0KA 3L9RB 1DQLH 1KPUB 5I1DB 2BRRH 3FTGA 4P5TA 2AERT 2ATKB 7FABH 1YEFH 3MJ9A 4PJ5B 1E6JH 4X80L 2X5PA 1U3HB 4J3SA 4LLWB 3QDME 1N8ZB 5DS8A 1FORH 3RWGB 4G8GE 5E9DB 4EI5A 4NQTA 2R29L 3O45A 5IR1A 1KT2B 3STLB 4U7SA 1Z9OA 3RY6A 2PUQT 4JE4B 5F72S 5HD8C 5F70A 3TJEL 5IWLA 2CDEA 2QR0B 2R2EA 4OZHE 3RY4A 1PKQA 2YUVA 4GXVH 4PG9A 3C6LC 2WUCH 2IG2L 4TUOA 5KSBF 3TVMD 3KYKH 1N5AB 1XF2A 5ISZB 3W2DH 1Z0MA 3NFSH 5MENA 4DKAA 5EC1B 1PG7W 2ICES 1QBML 2DLTA 5JR1H 4D8PB 1XCTA 4JLRB 2EDJA 1XGQA 4M7LT 3S35L 4GKSB 4P0DA 2Y6SD 2P5WA 3BVNA 1AO7A 2OK0L 3LN4A 4MHHI 3THML 1I8LC 3BX7C 3TPUB 5JIPA 4HMCA 1LE5A 2D9CA 2AV1B 3MUGB 1IAIH 2IWGA 3MRKA 3JTTA 4UU9A 3B2VH 5DJAA 1CZ8L 3T4YB 1EEYA 3C5JB 4YZFE 3S7GA 3HNVL 4QOKD 4K07A 2CLVB 4P4KD 3GSNH 1XT5A 3EDJA 2NY4D 5HHNA 4WEMB 5E8PA 3QIBA 5DFVD 1HXYA 3EIFA 1YMHA 2O26U 4L4VD 1MSPA 3QDMB 4APQC 5FGCE 2VLLB 2HVJB 2FJFA 3QFJE 1JPSH 4GW4B 2CRMA 3FN0H 4KK5C 1UZ8B 1RVFL 5E94B 3ROLB 3N50A 1OQOA 3TBTB 4OGYH 1MCBA 2ZKHL 4KMQA 1X4XA 4UINH 3LV3B 1T0NB 1KTRL 3D3VB 4F57L 3NABH 3QEGH 2H6PB 5IVZB 2IPUK 3CDGB 3VFVB 1BZ9B 4ZFZB 5HPMA 4R97B 4I18B 3SPVA 1R3KB 5D1QC 4ZSOE 4PJCF 5KSAC 2C1OA 1MJUH 1RHHB 1ZKAA 3MLRH 2H32A 3RU8L 1GH7A 1OTSC 2DRUA 1QVOA 3QWRD 1U41A 1F6FB 3L95A 5GS0L 4OSUL 4AZ8A 3LEVL 4JFDB 4HMDA 1J0YA 4YK4C 5EZIL 1IBGL 1I75A 4ZFFB 1D5ZA 3TBYB 2MTPA 3IDNA 1JGLL 1I7UB 1HHKA 3NZHL 5TDNB 3UO1L 3EYFA 4TSCH 1FO0B 2LVCA 3MLVL 3QDGB 4I9WD 3GFUA 4Y4HB 3IDJB 5IT2H 1A6WH 3R1GH 4YDVA 3UTZB 1BEYL 3BOVA 5FGCB 3T09A 4DFIA 1FE8H 1NUFA 4NKMB 2V9QA 4YBLC 2NXYD 3H9SE 3SKMA 3HTLX 3MLZH 2DL2A 5T1KB 3SGKA 3WXVL 3B8SA 4LNRA 3GKZA 4X6EA 4WY7L 3CXDH 2XI9A 2XQBL 4OLZH 5HI5D 2AABH 3O11A 5E2VH 4PR5A 4ZPTA 3BHBA 2XN9E 2OR9H 3DX9A 1RI8A 1PG7L 3O8XD 4NNXB 5E1HB 4ZSOB 3EAKA 3BP4A 5F7KC 4X4ME 4DN3L 3L7FB 3BP5B 3VGBA 1MNUH 3SOBH 4XMKL 3BAEL 4M6ML 1KCSH 1CFTB 5LWYH 1HNGA 3F58L 1DQDH 5F88B 4ZPVB 3HB3C 5DFWH 1BWMA 1KENH 3CDYA 2CD0A 4IRJC 4OCXL 3JSSA 4QHLA 1VADA 4H8WL 2JLLA 4HCRH 4GAGL 2P5ED 3DX6A 3EGSB 4XTRD 1H3WM 5F6IC 4LCCC 4BQBA 4KXZI 3EHBC 4LGRB 2EYRB 2E7LC 3LS5L 4JB9H 3WFBL 2YPVL 1AE6L 5ALBL 4HIHA 4PIRF 1MCNA 1J8HB 1VB9A 1OCWH 5BO1L 2CIKB 1AD9A 3LPWA 3NGBC 3H9SB 1IRAY 1OY3B 2N7AA 1HSBB 2XZCL 2H26A 1ZTXH 1FH5H 5GGVY 4QRQA 4ZO8A 2R1XB 4G9DA 4A6YA 2D0GA 4JO2H 1PW3A 4CJ1A 3DX8B 3OAZK 4EOWL 1U8QA 1AGCB 3P73A 4MD5A 2CK0L 3L3JA 2XN9B 1CWVA 1OD9A 4OBSA 4OZGF 5IMMB 5FM8A 1YNLL 3P4OB 4XT1C 1DP0A 5EC2B 4KQ3L 1DFBL 4K2UL 3SY0B 3Q6FA 3GMOA 3U48A 3MQIA 1KELL 2CDGA 4XC1L 4Y19E 1NANH 2XWTA 3MV8A 1UM5H 4HK0B 3ZDXF 3HI1B 2GJ6E 2MOVA 1MFEL 5BQ7A 1RJZB 4V1DA 2UWEF 5CD3A 4PLKC 1KB5A 3SKOA 4P23B 3UTPD 4XPHL 4JO1L 3HE6D 3BGMB 2W0FB 5JUEL 3LKRA 3U9UA 1ZXQA 3ARBB 3ES6A 3T1FB 3I85A 5ICXB 3KPOA 4LSUH 4WI6A 3UJTL 4JFFE 3QRGH 1PGRB 4JY5H 1KEML 1S5IH 1T5XB 4UV4H 3MLXH 3IAQA 2I5YH 4OCRL 4XNXL 3O4LA 3AXLA 3SDXA 2LVEA 4MJ2A 3TO2A 2IBZX 4NM4L 1A1MB 4LGPB 4XCEB 1ADQH 5KW9H 1OP9A 4YFLF 2AXGA 3TBVB 1BZ7A 2Y4SA 4JGMA 4ELKA 4PGBB 4ENEC 4JFPA 4RFNC 2A74A 1E4WL 3RI5K 4JM2F 4U3CA 5IW1A 1WFTA 1IILE 3C6SA 3T3MF 4NUGL 1AQDA 5C2BH 3EYVB 2ZSWB 4WI3A 3TT1L 5D9SA 3BT2H 3JV4A 3VXSA 2J88H 3KLAB 2EDHA 4PRPD 4KDTA 1CD0A 5I15L 2XIDA 1KCRL 5GGSA 1NDGB 1CDHA 2HJKA 2IANE 1PKOA 3B9KB 4G42B 3NCJL 2MHAA 4RWHA 3SE9L 5L88L 2R39A 1HXMA 1CGTA 5E2TH 2YK1L 1NKRA 1RUMH 4PJHB 2HFGL 3GJFB 5CP3H 3KJ4C 5L2JA 3D18B 3SCMA 1RZJL 5DVMA 4QF1B 3FCTB 1U8NB 4G8IB 3CUPB 1WITA 3ROOA 4JFFB 1W72B 3GSRA 4N8VB 3PL6D 2ORBL 5FB8B 1S8DA 3SBWC 8CGTA 4RGNE 1QFWM 3NTCL 5F1NA 5E6IC 4GUPA 1LK3H 5HHOE 3WCYA 2VXVH 4HFUH 4DQOL 3U36B 2B2XH 5DURB 5HYQB 2YXMA 3U4BH 3LQZB 2PYEA 1SHMA 3U30B 3RUGE 3GSQB 1J05B 3M8OH 1RURL 3ARSA 1ADQA 4NZUL 3C9NA 1FN4B 4YO0A 4TQEH 3EOTL 2VLMD 1QSFA 4EEEA 4NUJA 2OLDA 3LQMA 3RTQB 5IV2A 2W07A 1BJ1H 3OTTA 4NP4H 4KVNL 4X7FC 3VW3L 4KUZL 4PRAB 1GL4B 5K33A 4PTUB 5FYKU 1GIGH 4ALAH 2O5XH 2HFFB 3IFPA 4ZAKB 1P4LA 2P46B 2IANB 4AK1A 1KJ2A 1D5BB 1HKLH 2H8PA 1BD2B 1HOCB 2A0LC 3MOQA 5DWUH 3KPTA 2I9LA 3DOSA 1IZKA 1DLHB 2A9MH 3OKLB 4M3JA 4XBGA 5FECB 5LGHL 1Q9OB 3MRGA 3BIBX 4NQXA 4L3CB 5EA0H 2YPKB 4QOKA 1A4KA 3MLSL 4PTTB 3DIFA 3DO3A 4RAVA 4MXWL 1CGXA 4QRTB 2F54B 2X9YA 1G7LA 3LMJL 4K7PH 3K8LA 3UPRB 4JR9H 4RGNB 3UMTA 3IJSA 4BH8B 3VRJB 1ZHKA 4LDOB 1QOKA 4L4VA 1MWAA 2YC1A 3SDYL 2DWDA 5ENWB 1CQYA 2J6EL 2WW8A 4M7KL 2R56L 2EEAA 2DQHH 1KF9B 5DQDH 5IKCB 1BFVL 4PJ8D 4H26A 4S1DD 5IOPA 3RUGB 3S6CA 1A9BA 1F42A 1IAOB 3QXAB 2GK0A 3EYOB 3LIZH 1MY5A 5L9DH 5FCSH 2F9BT 3GIZH 1GGIL 4GSDL 5E5UB 3HCVB 1ULVA 4M6NL 1AFVL 5F7HA 4NRYA 4YHLH 2DM4A 5EO1A 3MV7E 4D9LH 4JRYA 5KG9A 3KR3H 1ZV5A 2K1MA 1UYWL 3MCKB 4LHUD 3IS1X 2RAMA 1BQUA 2BHUA 4WUUA 5DD5L 4JM4L 5I73C 4Y1AA 1G9MH 2P8MB 4Y4KA 4S10A 1IGMH 2HA1A 2MKWA 3QWRA 3KPNB 1MELA 2X1PA 3S4SG 2AEPL 4FQQB 3D85D 2ZCHL 4YHNB 4WV1B 1SMOA 3MRCB 1BX2A 2K7QA 4WHTB 2C5DC 3BWUC 4C83B 1C5CH 2NX5A 5HYJD 2F58H 2AQ1A 3BDXA 3LDBB 1MHHA 2ICWI 5ICYA 5K9QI 1U2CA 1ZSDA 4GBXB 5IM7B 2Q8BL 1RULL 5FGBC 1KYOK 4K55A 4HHAB 4Z0BL 3HR6A 3O2WH 3CSGA 1MCDA 4O2EB 3DV4A 3IDUA 4NO5B 3BKYH 1NCAL 2EH8L 1I9EA 3JWOH 4JDZA 1RK0A 4I0PD 1AGDB 5IFHL 3CPLA 3OR7B 3LH2L 4A6YL 1S7RA 1C7TA 5C07B 3S88H 4QRPA 2VKXA 3GJEB 3W0WE 1OPGL 1MHCB 1K9TA 1RU9L 2JB5L 5IVNA 3QEUA 4K8RC 4D9RE 2J8UF 5J11C 4JG0H 1MJJA 2IAMB 4HSQA 4KGJA 1MHEB 4LL9A 2NY3B 4P2RA 3TH4T 3PXHA 3MV7B 5TE6H 3MBXL 5BRZE 5I76B 5GSRA 3GMPB 2HP4A 3ME0A 4GQPH 3FHQA 5I2IA 2ZP0T 1T22B 1S7XA 4HWBA 5E2WL 2UUDH 4LLYB 2XTLA 4DOHE 2DM2A 1L4IA 2DQJL 5HHXH 2VOTA 3UYRL 5DD3L 4YC2B 1KIQA 2YEZB 1P7QB 4D0CA 4P46B 3TF7C 1MIML 3ZKND 4M1CD 3ARYA 5GS1A 2IADB 2YS4A 2VL5B 3VFPB 3CSPA 4L9LA 1SM3H 2WZPD 3RX5A 5EN2A 2OS7A 4OT1L 3QQ3A 1TPXC 3MCLL 4XGZB 5EUOB 2D0FA 2YXFA 3BZDA 4X98B 1G9MC 4R96B 5DQ9A 3QXWA 5JA9A 4KHTL 4HH9B 5DZNA 4Z8FL 5SWQB 2XRAL 3GHEL 3GMLA 5M7QA 1Z9LA 3GM8A 2CUIA 2V9RA 5CJQL 5K9QG 4L3EA 2CJUL 2DMKA 3VFGH 3M1BA 4IJ3C 2H9GB 4JZOA 5C08A 2EIZA 4OFKA 1KYOJ 5IGXL 1QR4A 4XMPH 1N7MH 2NW2A 4GMTL 3CFCH 4EQ3A 1V3KA 1RZ8A 4JJHA 4X9IA 3W0WB 2QSTA 4WU5A 3ZHKA 4E5XB 4YHIA 2BY0A 4NC2B 1OAUL 4Z5RB 3DPBA 1MFCH 3A0OA 4ZO6A 2O5YL 4Z7QF 4J6RH 2KBGA 4Y8AA 5GGVL 4D0DA 1CFBA 1KCLA 3CH1A 4UV7L 3UCRA 1G7MB 4E41A 5BRZB 4E0RB 4ONFH 3CFDB 4S1QL 1ETZB 1IGIH 3JWOC 4PJXA 4Q7DA 1WZMA 2A73B 1CFQB 3JWDL 2DQGL 3EFFB 1PEZA 1WTGT 1G7QB 4FQ2H 1AP2A 3TO4A 2YHGA 1NBYB 1YMME 3EYUL 3SDCC 4NT6A 3SJVD 3GI8H 2OXGA 2Z91A 3KDMB 2GI7A 4O02L 1CL7L 1IEBA 1K2DB 4UQ2B 2O61A 3HE6A 4PRIB 4G6AC 3QG7L 1EEZB 4NDMA 1TIUA 3D0VB 5I0ZA 1N59B 1TTUA 3HG1A 4FQHA 1R5IA 4PJGE 3CX5K 3T65B 3MV9E 2HN7A 1M6OB 5I30L 1OT1A 3KS0H 3REVB 4MNHA 3X12B 5DQJB 2YRLA 2R0ZH 2R2BB 4JDTH 1YEIL 3RIAF 4FZEL 4PY8I 2OI9B 2NNAA 3QUYA 5HHMD 3VFRB 3ZKMC 4JZJA 5HY9B 4AIZB 1JMXA 2WP3O 5GSVB 5JTWA 1XGUA 5E1AA 1PY4A 1WEJL 3BIKA 4LCYB 1Q9LA 1NC2D 2GJZB 3BQUC 4U1GB 2ZCLL 1BBDH 3MOAL 3QDJE 2CPCA 4F7TA 4U6XA 1VFAB 4AQ1B 3MRMB 1EHXA 5HD8D 1F3DH 4OM1L 2NY5L 4JPWH 4ZUSB 2E7HA 4KK9C 3MNVA 2QQLL 1KJ2L 1OVZA 3C6LD 3I2CH 4JO3H 4YDLC 4AMKH 1TNMA 1BIIB 5F1SA 2MQ3A 2YD9A 4PLNC 1MFBL 2DYPA 3BPOB 5DJXB 1AC0A 1EIBA 1YNKL 2X9XA 1Z9MA 1UM6L 4F33B 5I1LA 2YD7A 2VQTA 4NQED 4IIQB 5HI4C 5A1AA 1QBLL 1YEJH 5FCUL 4HS6A 2MNUA 5J1SC 5HHVL 5BZDA 4MNQE 5JXEC 3GEWB 1BFOB 2EEDA 2KKQA 2PTUA 5EO0A 3WIHA 4NZRH 4YHOH 4YHYB 3O6ML 4OLVL 4PJGB 5GJTH 4I1NB 4ZFGL 5IG7A 5CILL 1MWAL 5E8DH 4R26L 2N56A 4LPXA 2BNQE 4ERSL 1EZVY 1IGTA 2CLZA 5GRYA 5DHVH 4X8XA 1KCUL 4XZUA 2DD8L 3TIEA 3QUZB 2ZUVA 3R0MA 4DWHA 3W5MA 1OHQA 5C92A 3W9DB 3AY4A 3U7YL 3KNBB 5DRWB 4YXHH 1MUJA 4APQD 3S37L 4QKXB 2FX8H 3VD9A 3QDJB 1T1XB 4KK5D 4WW1A 1PX4A 1P7KA 1KIPB 2V7NA 5CINL 4EBQH 1ORQA 5C9JB 3CLFH 4MZ2A 2C3VB 3QH3B 2A38A 5GGQH 4FA8A 4UZGA 4U6HB 1CT8B 3LEXA 2XG5A 2H2PC 3P11L 3UJIH 3B3IA 5A2KH 1F4WH 3VRIA 1QSEB 5D1QD 1D5XB 2FDBP 4YNYA 5KSAD 4JKMA 4JPKL 4WW2B 1PLGH 2VO5A 4U1IB 5DVLA 1EFXD 1D5IH 4XP4H 1OTSD 1E27A 2FSEA 3WL9A 2NY7H 1F5WA 1QEWA 4CVWA 3ZE1E 4IHOB 3CH8A 3RZCB 1HI6A 1BQHA 5FK9B 5JIIA 2BNQB 3VI3F 1R6VA 1WICA 3HS0A 5GGUA 4Q6IB 1HIML 1I7RA 4QRRD 3X11B 2UUDK 3IFLL 3O4OC 2HT4C 4GW5B 5DSCA 1D5MB 3F7VB 1OARL 5IEKA 4X5XB 4I2XA 1QSVA 3ALWA 4PJ8A 1MREL 1X4ZA 4QXWA 4U6VH 3RGVA 1TVHB 4J8RB 2PXYA 5L8KB 2GSGA 1T0MA 2HRPL 1DUZA 1KTDB 5FUCC 1P53A 4ZD3H 1AQKL 1SEQL 3TA3C 4WI4A 4XNYL 4AM0A 1LNUA 2DOCA 4HWBL 2JK5A 3VGDA 3KPLB 2YUWA 4MXVF 4OIIL 5EUKB 1MQ8A 2D7QA 4ELME 1XR8B 3H42L 4FTVE 1NGWA 3T0VA 1T3FA 1DQML 2ZPKL 5DJYB 3WS6A 5DT1H 5F7YC 5CJ8A 4B7LA 4XP6H 1HHJA 4M5ZL 3MLWH 2X4QB 4KVCL 1FDLH 4FZ8H 4O2FB 5DYOB 1FGNH 1SJEA 1OAXH 4K3HA 4PP2A 4OD1H 3A6CH 2LE9A 3O3EA 4KI5E 4N90D 3MNWB 4O58L 4FQJH 4F3FB 5C2UB 3FT2A 3HB3D 3BKJL 2B1AH 4IRJD 5BV7H 4Q74A 5EBMA 5D8JL 2Y1VA 5EULV 4L4TA 5FYJU 1FVCA 1ZA6B 2EDQA 1J8KA 25C8H 2MPAH 4S1SL 4MJIE 5HGGS 3WMSA 2W59A 3UBXI 2R0LH 3X13B 3EHBD 3SDDC 4Z95H 5DDHB 1FGVL 3K2MC 3E3QE 3F7YB 5FKAA 3VG0H 5JXAL 4DCQB 1X5LA 1RZ7L 3VFSA 3RRQA 3TYGL 1BECA 4G8EB 4U49A 2OZ4H 2Z93A 5F96H 1MH5A 5C0BB 1MCRA 3FOMA 2BDNH 1RK1B 1IAMA 1XGTA 3CCHB 2DM7A 2DM3A 3BYTA 3VH8B 4WWKB 4WO4A 3H0TA 1S7VA 2ZUTA 5BS0A 2AEWA 4LSQH 5KSBE 1I3RA 1IM9D 3Q5YA 4IRZH 1UWEL 5IHUH 1OGTA 4BSWA 4PJDF 1QBAA 4X7EC 4YQXH 1BVLA 1A0QH 1L9MA 1F3JA 3QFDA 4K3GA 3WFDL 5DMIL 4F8TA 2R4RH 1RIVH 4OFVA 5K93A 4PLKD 3GMMB 5ID1A 2I60H 3BZ4B 4JGJA 2CRZA 2C7UA 4H88L 3GSXB 2VLJD 2EDRA 4MJ6B 4UIKL 1NFDA 4M1GL 4MJIB 4NC0B 3H2WA 4WUKH 5HVWA 1U8PA 3QQ9C 4QTHA 5I16A 4RGOH 1YUHA 4HIEB 5DD1H 3ZO0A 1ONQA 4QHNB 4MB5A 3RWDB 4LIQH 1UWGL 3UTTA 5C0AB 4CMHB 4UT9L 5BV7C 4RA3A 3UBXG 5I17A 1TVBA 5KVMC 4ODTL 2ARJA 1ZHLA 3SHSA 1HH9A 3O3DB 2B5IC 1QKZL 3U9PH 1I9IH 3UDWC 2ADGB 2CKBB 3OXSB 2VUYA 2IALB 3QEHA 1EV2E 4DZ8B 3ARDA 4ZOBA 2PR4L 1LO4H 1U93B 1XCQA 4BZ2L 4Z7WF 3NBNA 2Y7QA 1I9JH 3NVQA 1DVFB 5DJ2B 4DW2H 3NA4A 4TSBL 4ODWB 3WIHL 4RDQF 1U58B 3LAFA 2ADIA 4KTYA 5K9JH 3I6LE 4UUJB 1FZMB 3IU3A 3HAEA 4KJPC 5ERWB 4PJCE 4HK3N 1IQDB 4EN3C 5EU7C 5JQ6L 1MCOH 3ZL4H 2D7NA 3CFKB 4AT6B 1M05A 1U6AH 1F58H 2ITDA 2KZWA 4Z76B 4HJ0C 4MDIA 5F21B 5IW6A 1E6OH 5JW4R 1MIEH 1B2WL 4N0YH 5ALCH 2JJSC 3C60C 2WWMC 4X8JB 3FFCB 3TZVB 1FSKC 1RSFA 4H20H 4QTIH 1QO3A 1PY9A 3LHPH 5C7XL 4OLXL 5T3XH 1A3RH 4JRXB 4PJEB 3X14B 1U42A 5E6ID 3Q6GL 4ZS6C 4QRUB 2YPLE 4ONGL 3O6FA 1JRHH 5CJOL 4FRWA 5D7IF 4K9EL 2JCCA 1TCMA 4NFBA 4ODHL 1NL0H 3JVGC 4Y89A 3ZDZF 5KVFH 4PP1C 3WE6A 4M7LH 1T2JA 5B8CA 2GTZB 3MZTA 4U1LA 5I66B 4YH6A 5JNYB 5FKPB 3HI5H 4M00A 4C55A 5E2UL 5HHQA 4PRHA 5EU6B 2NXZB 3M17A 1UG9A 4N0FA 4D9QE 1D9KC 2BVPA 2C1PA 1H15B 2XYCA 2YSSA 5JLZA 2VXTL 2OTUB 3VXRE 3DMMC 4TNWK 3QP3A 3W9EA 3G6JA 1OB1B 3OV6A 2DJ4A 2DMCA 3KJ6L 4IOIA 4PJCB 1TVDA 4LCWE 2A0LD 5F93C 4LF3A 4R0LA 3H9HA 4HXBL 2WBJA 2B4CL 1WBYB 1FFRA 1F8TL 4LASL 4NQDE 3WFCL 1UJTA 4WI7A 2V2TA 3OR6B 3HLAB 3GGWB 1OLZA 4KTDH 1JYVA 2V5SA 3OG4B 3QHFH 4ZQKA 1N2RB 4NNYA 1U8IB 1ZS8B 1BOGB 4LVHC 3KXFA 4GRWH 5D6DC 2X40A 5T5FH 1SEBA 4QHMA 3REWA 2J5LB 2AI0H 1X5XA 2RB8A 2YPLB 3L6FA 3QIWC 4M4RA 4PJIB 3HI6H 3MODL 4OZFB 2GCYB 5CUSL 2DQCH 3JV6B 2GITA 2P7TB 3RFZC 3F6IA 3T0EE 5JORA 3QIUB 4X4YA 5I0DA 1INDL 5I18L 3U1SL 5HHPA 5ACZB 4JFYA 3MRNA 1BAFL 4PY7A 1Q9KA 3HE7C 3SQOL 4EZMA 1KPVB 3ZTNL 2UY7A 2IJ0C 2F53B 4GRLB 2EXWC 2VLRE 3H3PH 1CD1B 3MRFB 3HR5A 4HF5L 3VXRB 4HJJH 5KSAA 1KEGH 5CP7A 4C58B 2FCBA 4DVRH 1SY6H 1MJ8H 4W6XB 2Y06L 4HWUA 5MEQA 5JW4N 5KJRH 2DQUL 5B38B 2AEIT 3LVEA 4OZGE 1CICC 4XBEH 1E4XH 4PBVC 3WUWG 1X4YA 2GHWB 2BOBA 1FJ1B 5D1XA 4PB0H 1S9XB 3ZT5A 5IQ7H 4S1RL 1HCVA 1CLZL 1R5WB 3BZFB 2JIXD 3HMXH 4X6CF 4LSVH 3ZDXE 2ESVE 4YR6B 4QRRA 5HYSB 2UWEE 2GTWA 5C3LD 3CZFA 3Q0HA 4PYGA 4FXKA 3V4UH 5IB4A 5AYUH 1J0KA 5AAMA 1XMWA 3VE0A 4TOYL 2VZ3A 5JPMB 1KCVL 1JTTA 1OGAB 3I84A 4RX4D 4WRLA 1J0ZA 4KROC 2DS4A 3AU1B 3DBXA 2R0KL 4K8RD 5IROC 2EDFA 3TFKC 4UB0H 3D2UB 2PO6A 2IMMA 2BVOB 5IJKC 2XQYG 3V0WH 1L0XA 4FQXB 2DI7A 5JHDE 1K5NA 1CL7I 2X4OA 4U1SA 1TJIL 5EU5B 4F58L 5DJ6A 3W11C 3FMGL 2IBBA 3Q3GB 2XFXA 1I8MA 3N1FC 4FFVC 4AQOA 4H1LA 5J0BA 5EO9A 4OZGB 2XWBB 4GAFB 4NKOB 4XP5H 3EJYC 3B9AA 4TULL 3I3BA 4HV8B 3W81A 3MOBH 1JF1A 3CVHH 3MRRA 3RDTC 3DHMA 5J1AB 1A7QH 2R0WH 3V6OA 5HGAB 2X89A 3AS3A 5LGJA 5CBEB 3L3IA 2ESVB 8FABB 2HRLA 2NMSA 2F15A 2P5WE 4HIJA 5J6GA 1T1YA 4X7SL 5KSVB 1MCJA 2WQRA 4TUJB 5DMKA 2WQ8A 4MQXC 4Q2ZA 1T6VN 5EOTA 5J57B 1T03H 1LEIB 2APVA 4Y2OA 1JWUB 1S7TA 4MMZC 1S9WA 4ETQA 4NPYB 5EZJB 4A2MA 5K9KB 5TE7L 4LLQA 2X4UB 1DL7H 1CDUA 4HS3A 4LPCA 1HEZA 3VD5A 2ZCKL 4LKXA 3FTGB 4P5TB 2LU7A 2A77L 4Z0XA 3WJLC 1P4IL 5DS8B 3VFUA 2EICA 4EI5B 4P2OA 1CGYA 3O45B 5IR1B 4OLYL 3NOIA 3OSKA 2CDEB 2R2EB 1DQQA 3DXAA 1PKQB 2NQCA 1ACYH 4PG9B 1AXTL 5D72H 3LRGA 4TUOB 1FZJA 1RUQH 1EGJA 1X7QA 2Q20A 4MVBC 3SDCD 4LU5H 5AG9A 1XF2B 1KFAH 2QADC 3LQAL 5MENB 2BJMH 5D7LD 4Q9QL 4CUCA 2APWA 2OMNA 4YDKL 2FB4L 3K1KC 2F5BH 4G6AD 1FRGL 1H5BC 1XCTB 3W82A 3CVHA 4JKWA 4OBRA 1XGQB 3WFZA 4MA7H 1AY1H 2FGWL 2BHZA 3CLEL 3U7WH 2P5WB 3BVNB 1AO7B 3V4VH 3JZ7A 3LN4B 3BKCH 4RWYL 1U95A 1UVQA 4JQVC 5C1MB 1JZ8A 1LE5B 1ROWA 1T5WA 3MRKB 3JTTB 4UU9B 5DO2C 5DJAB 3V8CA 3ZKMD 1EEYB 2VYRE 5ACMA 3L1OH 1JZ2A 1TLKA 3V8OA 4NZTH 1R3JA 1D6VL 5HHNB 5J9PA 5E8PB 3QIBB 2BNRD 1HXYB 5J13B 1WISA 1V7NH 3BQUD 4WDIA 4NO3A 5GISL 3MA9H 4AEHH 3PGFL 1YMHB 3QHZL 2R4SH 4NRZA 1ZT4A 4UTAH 2FJFB 4HIIA 3T0BA 1IC5L 4JFED 4TSAL 1JPTH 3QUML 4KK9D 1CGSL 4I0KA 3S9DB 3HZMA 4NHCH 1N0XH 1ZK9A 2LAGB 3PWNA 3BD3A 3GHBL 4R2GC 4NN7C 5IQ9A 4OCWH 2JELL 2CK2A 3PGDA 1N5YH 1YC7A 4J1UA 1YPZA 3G6JF 5HPMB 3DLQR 5CFHA 5HI4D 2WWKT 1VFMA 4JQXC 3FFDA 4X5WA 3SPVB 1TENA 1MJ7L 3IDYC 3INUL 2C1OB 4XWOC 5EBWA 5JXED 2H32B 3MTRA 1Q94A 2IF7A 1QVOB 1QACA 4Q9BA 3ABZA 5KTEL 2X09A 3L95B 3U0WL 5L8JB 1A6PA 1HDMA 2WMPA 1AXSB 1J0JA 1D5ZB 3IDNB 3LN5A 3IJYA 5FUZH 1A3LL 4KDVA 3F8UB 1HHKB 4BFGA 2L7JA 1YEGL 3EYFB 3ARWA 4FABH 3BRGC 1DN2A 4ISVA 4POYA 1M7IA 3IKKA 2HJFA 7FABL 1YEFL 1E6JL 1ZEAH 4YDVB 3GSWB 1FORL 3A67L 2BFVH 2Y25A 2CGRH 4YEEA 1U3YA 1DANU 4RIRB 1U3HC 2XACC 1QRNE 2J8UE 3SKMB 3MRHA 3PWUA 2B0SL 3KPSE 1T21A 3OMZA 2H2PD 2XA3A 1VGKA 2WUCL 4G9FD 1SBSH 4GXVL 3S5LG 4LNRB 3KYKL 4X6EB 3H9ZA 1C08A 4WTZG 4KJWC 5I8KL 3O11B 3NFSL 3VRLE 4PR5B 4ZPTB 3BHBB 3DX9B 5AUMA 1T1ZA 1NBVH 3BP4B 5JR1L 1ZLSH 4OTXL 1T80A 1M7XA 3HC0A 2OP4H 1FO0H 3OJ2C 3WEXA 2DQEL 2XPGA 3LEYH 3PWPD 4F9LA 3L5XH 2EO1A 5SWZA 1VEOA 5DZLA 2VE6A 5JIHA 4QHLB 4K7PY 5GZNC 1JWMA 1VADB 3O6LH 1IAIL 3B2VL 2LU4A 1N64H 1Q9WA 2HT4D 3HKFA 3DX6B 1NBQA 3AM8A 2IPKA 3GSNL 4G8GA 3CFBA 4XVJL 2Q7YA 3VGFA 5BVJA 3B9VA 4NFCA 4IRSA 3FQXA 3IF1A 3SDXE 3TA3D 4HIHB 2XZQL 4OZHA 3RI5F 1JPSL 2VWEC 3FN0L 1ORSA 1Z9SA 1UKQA 1AD9B 2V5YA 4JN2A 4OGYL 2H26B 1PEWA 4QRQB 4UINL 4H0IA 4PB9H 4G9DB 4A6YB 3ULSA 3NABL 4HBCH 1FNSL 4QLRA 5D7KE 1U8QB 3P73B 4MD5B 2QL1A 2CUHA 3L3JB 3K80A 4OKDA 1INQA 2D7OA 3VXSE 1MJUL 3HRPA 4R97C 1IKNA 4I18C 1MCWM 2ICWJ 3Q6FB 4KV5E 3ARGA 3GMOB 1Z3GH 2CDGB 4DN4H 4XXCA 2XWTB 3MV8B 4FFYH 2C26A 2X44D 1YJDH 2C9AA 4YHPB 5BQ7B 1JI1A 1A6UH 4V1DB 2FD6H 5DJ0A 3CC5A 1KB5B 3TBWB 1Q72H 3BESR 4RGMB 5GHWH 4ZXBC 3KPQB 1KC5L 3LKRB 3U9UB 4TSCL 3ES6B 3MMEA 3SDDD 5TH2B 1H0DA 3KPOB 3QFJA 3L3DA 1TZGL 3CU7A 4KAQH 5IT2L 1NSNH 2AXFA 1A6WL 3RVUC 1U3ZA 3R1GL 3O4LB 3AXLB 3SDXB 4M8QA 3TO2B 4Y4HC 3TM6A 4L8CA 3VCLA 3UTOA 1FE8L 4F8QA 4PJ7A 2HKFH 1RY7B 2AXGB 1BZ7B 5I1JH 1RFDH 3LD8B 1ZAGA 3GRWH 4ELKB 3QCUH 5B3NA 1QSFE 3CXDL 4JFPB 2A74B 3L7FA 3H9YA 4OLZL 5IB2A 3TYFA 5IW1B 5E2VL 3JUYA 3C6SB 4G6JH 2OR9L 4HQQH 2HLFC 5GPRA 3Q1SH 1EAPA 3HUJA 2OTPA 5D9SB 3JV4B 2I27N 3VXSB 1T4KA 4J4PC 1AHWA 3SOBL 5EFIA 3FN3A 4WI8A 2R1YA 1NDMA 4NHUA 4K23H 3HZKA 5GGSB 1MOEA 2HJKB 3QNZA 3CXHK 5LWYL 1NGZA 2MHAB 3RA7L 5IBUB 2HVKA 3RL2A 5KZCD 1HXMB 5DMYA 2DI8A 1KENL 4HCRL 4HIXH 4ZO9A 4LARH 5L2JB 1AR2A 3ZKXC 4MJ5A 3SCMB 3QQ9D 4QOKE 4FOMA 1WWWX 3ROOB 3GSRB 4X6BA 1F00I 3D87B 4JB9L 1S8DB 4WI9A 5F7WC 5F1NB 1UB6B 4GUPB 4L4VE 3QCVH 5GRUH 1RZFH 4QNPF 1OCWL 1CCZA 4RDQG 1YJDC 5EOCJ 1FL3A 3ARPA 4HPYL 3CVIH 1ZTXL 1FH5L 5KVGL 3GBNH 1U2HA 1G7JA 1DLFH 4G7YH 4OI7A 5IMMA 3C9NB 4YO0B 5IW3A 1QSFB 4HEPG 4NUJB 4JO2L 3P4OA 3FB8A 4EDXA 3MGTA 5IV2B 3SDCA 4FXGA 4HG4K 4Q9CA 2QHRH 3EYSH 1A7NH 5KANI 3GJFH 1A6VL 1U36A 4I77L 4KJPD 1RJZA 1CXHA 1N26A 2NY2B 4WUUE 3IFPB 3MUJA 1WBXA 5EBGA 1EHLH 1P4LB 4EN3D 1IGYA 1KJ2B 1SYSA 4OIBA 5D7JA 2H8PB 4NQCA 1UM5L 1W72H 3LKQA 1P84J 4UQ3A 2I9LB 2DAVA 1S3KH 5H35B 4HJ0D 4PY8J 5JHLH 4EDWL 2R2HA 5DJDB 1I1RA 3ZDYF 5I1EH 4HGWA 4XBGB 3C60D 2WWMD 2P44B 5D5MF 4FG6D 3MRGB 4WI2A 4NQXB 3CSYA 4QOKB 4P23C 1A4KB 3VI3E 4LSUL 3DIFB 4RAVB 4I3GA 1JWSA 4JFQA 5L0QB 4I9WE 4LP4A 1G7LB 1S9KC 5IB1A 3GI9H 4XCEA 1S5IL 2D03H 4UV4L 3MLXL 4ZS6D 4YWGH 2I5YL 4KKBC 5ITBL 3IJSB 1ZHKB 4L4VB 1Y18A 4NBZB 2A6DA 2ICEA 1MWAB 1O7VA 2YC1B 5DUPH 2DWDB 4JFEA 4PP1D 4AIXA 5KW9L 5L2KD 3QUXA 1NUDA 3AS1A 3OKEA 2IBGA 4H26B 2X4NA 1LGVA 2V9TA 4XHQA 5IOPB 5E8EA 5F7EH 1EMTH 1A9BB 2E7CA 1PBYA 4G6FB 1DBAH 1D9KD 3PIQA 4MXVE 4PLJC 4ESKA 3BGAA 4HULB 4P2RE 3AS2A 4P2QD 4NRYB 4EUPG 3DMMD 4Y19A 1PZUB 4JRYB 3BT2L 5KG9B 4QXGH 1ZVYA 5JXEA 2Q3ZA 1U8MA 1IJ9A 3G04A 3BI9X 1EK3A 2GJ6A 2Z8VC 4WUUB 4M62H 4Y1AB 3T2PA 4Y4KB 4P2CG 1A64A 1MCFA 4Y16A 4QF1A 3FCTA 5F7DA 2UZXB 5E2TL 5KANG 3SE3A 1MFDH 3B9KC 1BX2B 2WINA 2UYLA 2AJVH 4JFFA 4HUVA 2BCKA 2NX5B 4LVOB 4CU7A 2P5EE 1J87A 1GC1C 1MHHB 3BKMH 2BMKA 5ICYB 3QPQC 2A9NH 4O2CA 2H3NA 1J1XH 2VXQH 4QWWC 4X99B 4Y2DA 5FA4A 4MS8C 5T3ZD 2E27H 4LHUG 2CXKA 3QIWD 3ARQA 3BPCA 4Z77A 1LK3L 4JCLA 1BREA 3DV4B 3ARTA 3QZWG 4L3EE 5FYLE 4JDZB 4ETYA 1RK0B 3U4BL 5I1CH 3CPLB 3ZT6A 1S7RB 3OHXA 2M8XA 4QRPB 4C4KT 3HE7D 4TQEL 4CRPA 2H2SC 3QEUB 1MRFH 5T3XD 3U30C 1CBVL 3VGGA 2EXWD 4K7FA 1L0YA 2K7PA 3MRPA 4P2RB 4LKCA 1AGBA 3RTQC 2R1WA 3HPJA 3MJGX 2EO9A 5GSRB 5IHZA 5C6WH 4PJXE 1GIGL 1KNOA 4OM0H 3WO4B 4ALAL 1S9YA 5I2IB 1CDCA 3EO1A 4OGAC 4AH2A 3AGVA 1S7XB 1JV5A 3KHOA 4Q9RH 3IRZA 1TNNA 3OKLA 4PJDE 4JVUA 2HG5A 4ZAKC 5M94B 1KIQB 1U91A 4D0CB 4U7MA 4TPRH 1TDQA 3UTPE 3K2UH 4LAQH 1KLGA 5GS1B 2DIJA 2LV4A 5ILTL 3RJDA 2QHLA 4L9LB 1UADC 3HG1E 4K8RL 1MAMH 5EN2B 5HHOA 3QQ3B 1XGYH 2G2RA 1R3IL 5DQ9B 1VENA 5AEAA 3R8BB 1X6LA 3GMLB 5IVOA 1P6FA 1WT5C 3SDAC 1AR1C 3FQUA 4L3EB 1JNNH 4KROD 2P8LA 3M1BB 4JZOB 5DQDL 5C08B 2EIZB 4ZUWA 4E42A 1CTOA 3C09C 3UZQA 4GH7B 1KB9K 3KPRD 3KYMA 2NW2B 3TFKD 1RZ8B 3VG9B 4CDGC 2EE6A 4WU5B 4YHIB 2OL3H 1X5FA 3BUYA 1ZE3C 5A16A 5L9DL 5HYFA 1LVEA 3GIZL 1QLRA 4YHLL 1IAKA 4D0DB 4D9LL 3LS4H 4OV5A 2VXUL 3W11D 3CH1B 4Z7WE 4E41B 4BQ9A 1UM4L 4PRPE 4FFVD 4PJXB 1KULA 1G9ML 4XBPA 2VZVA 4ONOA 5C9KA 3EJYD 4MAYA 4ZG1A 1IGML 4BUGA 4YE4H 4F7CA 2VR4A 2YD6A 1AP2B 3TO4B 3BH9A 3GNMH 3RDTD 4HPOH 4NT6B 2QSCL 2Z91B 2VL4A 3DTXA 1G9EA 4MA8H 3U0TA 3V52H 1IEBB 1C5CL 2YD4A 4WV1C 2F58L 2O61B 3HE6B 3OPZH 3ILPA 4NO2A 5JMRA 4NDMB 5I8EA 2ZUYA 3HG1B 4FQHB 1R5IB 4XNUH 3R8QA 4MQXD 5F9WC 3LDBC 2IPUG 4MNHB 3J8F7 3GJFK 2Z31A 1HHIA 4GBXC 3TT3L 1EBPA 2VZUA 2V2WA 1AXIB 2MCPL 1TJHL 2NNAB 4HC1L 3BKYL 3JWOL 3QUYB 3RPIB 1UKSA 4M7JH 4JZJB 4XVTH 4NJAL 2YD3A 1P9MA 1H3UA 3S88L 5D7IE 1XGUB 1QFHA 5E1AB 4PGCA 1I1AA 3BIKB 1Q9LB 3ZDZE 2VLME 3BD5A 4ZFOA 4JG0L 2QQQA 4F7TB 2OL3A 4U6XB 4G5ZL 4M03A 5TE6L 2IAMC 2RJMA 3MNVB 4M93B 3VWJA 2BC4A 3EDFA 1HYSC 4MVBD 1KGCD 1JGUH 2DYPB 3P9MA 3DURA 5HHXL 2QADD 2OQJA 4FFZH 5I1LB 2MCG1 1TMCB 4HGKC 5LGKA 2Y07H 4HS6B 5E6YA 5F1KC 5BZDB 1UACH 4YC2C 1HK6A 1LE9A 2NLJA 2EDYA 4P46C 1SM3L 3ZYOA 5EO0B 3PUCA 3HN3A 1NAKH 5IG7B 1C1EH 1XZ0A 4F9PC 3B43A 5DO2D 3KYOA 3FHAA 2V7HA 1NMCB 4NZJA 4DTGH 1IGTB 2CLZB 4QGTA 1FC1A 3OKYA 3VFGL 4XZUB 2VC2H 3X3GH 5CLTA 3TIEB 3CFJA 5FV1L 2HKHH 1N7ML 2R8SH 3CFCL 5GGTH 2WANA 5D7IB 3O2DH 2QSQA 5LXGH 1P4BH 1G7MA 1J18A 4XPBH 1T83C 1BMGA 1KV3A 2UVEA 1MUJB 4Z7NF 3ZTJG 2EYTA 3NCFB 4DVBA 4J6RL 1P7KB 3T0AA 5HDQL 2V7NB 3T0DA 3JXAA 4HEME 1ORQB 1J88A 4H25A 1FHGA 4JFZH 5E8OA 3QNYA 4ONFL 4DUVA 1IGIL 4R2GD 3BEVA 2X41A 3LEXB 4FQ2L 2CR3A 2Y5TA 4DGYH 2KL6A 3GKWH 3VRIB 1RZIA 5CIPA 5F8RC 1IAII 4YNYB 4XWOD 4HWZA 3ULVH 4FQ1H 1VA9A 5GS3A 4ZO7A 4JO4H 2VABA 4V2BA 1IC4L 3X12A 1E27B 5HYJE 2FSEB 3WL9B 1LO3H 5F6HJ 1QEWB 4X6CE 5GIRA 2JJWA 2HMIC 4CMMA 3DSFH 1ZGLM 3WXWH 4N0UE 4Q0XL 1HI6B 2RHEA 3WNPA 1BQHB 1KACB 2CO7B 4RCAA 5GSVA 3NH7L 5GGUB 3HS0B 5T1LD 5SWSD 1I7RB 3QJHA 2GJZA 3O9WA 1I4FA 1GJIA 4WU7A 5DSCB 1YEEH 3OGCA 3QXUA 2OI9C 5IEKB 3NCYS 4I2XB 5JDSA 2CXGA 4PJ8B 3RGVB 1V5JA 2IQAA 2PXYB 2ZUQB 2DLFL 1B6UA 3DETC 5BXFA 2GSGB 1T0MB 1DUZB 3RP1A 2Q3AA 1BBDL 2PCPA 1MRCL 4PJ5D 1EEUA 1U3HD 2AJYH 2Q6WA 4AM0B 1KN2H 1VACA 1ZHBA 4U1GC 1LNUB 5E9DD 4OF3A 4P9HH 4JPWL 5INDB 2JK5B 1WIPA 1DUYA 2OMBA 1YMMA 3I2CL 5MP6H 3S98A 1T3FB 2DTSA 5FGSA 5BS0E 5FOBA 4XX1E 1UCBL 3GMQA 5IVXA 1LP9F 5GRXG 2Y36H 1HHJB 1YEJL 3BPOC 5ISZD 3MV9A 4G6KH 3U83A 2R2CA 1SJEB 4IIQC 4PP2B 5KS9A 2VDOH 4NZRL 4YHOL 1B6DA 1JUFA 1B0WA 3BPNB 3O3EB 4TVPD 1GGCH 3FT2B 2J4WH 4YHYC 5E8DL 5GZND 5EBMB 2Q8AH 5C0EA 3T1WA 1NJ9A 5IB3A 4NGHH 4L4TB 4KQ4H 2OR7A 1F13A 1FVCB 5DA0B 3KNBA 3OX8A 1S5HA 3ULVC 3OKMA 1FIGH 2FHCA 3FB5A 4KY1H 1LO5A 1AKJD 2W65A 1L7IH 3QUZC 5C9JA 3G9VA 5FKAB 4HUWA 4YXHL 5GRJL 4OZ4A 2FX8L 3VFSB 3UTTE 3A6BL 2AJXH 4LSPH 3QDMD 2Z93B 3CLFL 3G5YA 3KPMA 4JHWL 3V5KA 5FO8A 1MH5B 4BK5A 3ULUL 5GGQL 3FOMB 2FHFA 4FQLH 4FP8H 5DD0H 5DK3A 4G7VH 1XGTB 3UJIL 2FJGB 4RRPG 1TJGL 4WO4B 3H0TB 4U3HA 1S7VB 4MNQA 5C09A 5BS0B 4K3JH 5F9OL 3D3VD 1WIOA 4X6DF 3SJVE 5F9AC 1X44A 1HILA 1VFBA 1I3RB 3P0VH 1PLGL 3P40A 2AV7A 3ULUF 3KYNA 1D5IL 4XP4L 1ZT7A 3BH8A 1OGTB 4BSWB 4WW2C 1NPUA 3TPKA 1VGEH 4RMRA 1BVLB 3UAJC 1BQLH 1F3JB 3QFDB 4OCYH 3SKNA 2ID5A 1BVKA 4QRSA 2AS5M 4LPWA 1X5GA 4KJQC 4PPTA 4ZNCD 1IGCL 4OV6F 1PX3A 3S4SA 5ID1B 2E9IA 4JFDD 4ZXBD 4DFHA 3MXWH 5EBLA 3RL1A 4UILL 4LRNH 2C7UB 3RZCC 2VDNH 1NFDB 4ODBD 5HHME 1I7ZA 1U8PB 4QTHB 2Q86A 5I16B 4Q6IC 1YUHB 1IC1A 2R9HC 4ZFOL 1JTOA 5GGRY 4ACPA 4ZS7H 3QDGD 2X4TA 1ONQB 4ZD3L 4Y4HD 4KMTH 3BXNA 4PBXA 3UTTB 2E3VA 1CD8A 4MA1B 1NGQH 2O5ZH 5I17B 4B50A 4KRMB 1TVBB 4XPGH 2F19H 2ARJB 1ZHLB 4XPAL 1RZKL 1HH9B 4P3DA 4TNWF 2EIEA 3FO1A 4DGVH 3QEHB 1TCRA 3RBSA 3ARDB 5E00A 4KWUA 5ELIA 5T1KD 1XCQB 5EIIA 4XP6L 2HLFD 3C8HA 3QULA 1NCDH 3ARRA 5DJ8A 2V17H 1AJ7L 4NQEE 1DBBH 3MLWL 4J4PD 2VDMH 4OF7A 4M4PA 5IMLA 4LSSL 3G6JE 5D7SH 2ADIB 2YN5A 1FDLL 4FZ8L 2RR3A 1FGNL 1H3PH 1OAXL 4OD1L 3A6CL 3IU3B 3HAEB 2C3XA 2KQMA 4IOSD 3VXMA 1N6QH 1ZA3A 4FQJL 4XPTH 2B1AL 3PP4H 5BV7L 4LCUB 3EDDA 4NWTH 1CXFA 4BZ1L 1E0OB 1M05B 4FN0A 2ITDB 4MDIB 1U0QA 5IW6B 1MF2H 3KAAA 5HHMB 4DGIL 2R0LL 2VDQH 4WHYH 1QO3B 2P1YA 4WVRA 4X9BA 3GK8L 4XXDA 3WD5H 2CKBH 5J8OA 2AK4D 3VG0L 3WNOA 3O6FB 4ELMA 1SVZA 5DD6A 3OKNA 4FTVA 2JCCB 3VJ6A 1JNLL 1LK2A 3P9LB 2OZ4L 1J8HD 2JB6A 5F96L 2ICWA 4NKIL 1NGYA 5IFJA 3WE6B 5B8CB 1A5FH 3FJTA 4N9GA 4U1LB 3H9SD 32C2A 3B6SA 3MLUH 2J3SA 5HHQB 3M17B 3WLBB 4G3YH 3MV11 4N0FB 2FLBT 1E4KA 4LSQL 2BVPB 2C1PB 2IG2H 4L8SA 4WWKC 2YSSB 5JLZB 1OP5H 2WIIA 2BY3A 3W9EB 2N7BA 4IRZL 3G6JB 5IHUL 3IB4A 1YY8A 5A2LH 4I13B 4YQXL 1L6ZA 4YHZH 1QBMH 3DUSA 4IOIB 1BBJA 2F5AH 3QR2A 1FYTA 4LF3B 2R4RL 1AI1H 3H9HB 2WBJB 3TCXA 4PV9A 2XZAH 5E2JA 1T89C 2I60L 5FO7A 4KI5C 35C8H 3GSOA 4U6YA 3EOAB 3THMH 1A3QA 2VIRA 1NKOA 3BISA 4HX1A 2V2TB 4R4BA 4XP9L 4QRRE 3OB0H 2L7UA 4P23D 4IDLA 4O4YH 1G6VK 4RGOL 3TEUA 5DTFA 2JF1A 3D39A 2V5TA 1W0VA 4ZQKB 4NNYB 1IGFL 1MI5D 3HNVH 1JMZA 3KXFB 4GRMA 5EH1A 5DD1L 1SEBB 3BFOA 1O5DT 4KKBD 1QFPA 4QHMB 2QSVA 4FQIH 4WJ5A 4X7TA 2DTMH 3REWB 3L6FB 3QEQA 5E5MA 2EE9A 2ADGA 1BHGA 3E3QC 2GITB 3CNKA 5EZOH 2OSLA 4X4YB 4NM8H 5LCVH 3U9PL 4CMHC 1I9IL 5HHPB 3IFNH 5KSBA 4JFYB 3MRNB 2AJ3A 4LPUA 4PY7B 5D6CA 3GUTA 1Q9KB 1WCBA 2HAZA 5FAAA 3KLHC 1ZANH 3R4DA 4PLJD 3DYOA 1LO4L 1JL8A 2OCFD 1I9JL 3HR5B 4DW2L 5KSAB 3OF6D 2Z8RA 5CP7B 4CU8A 1OSZA 5HPOA 5EWIH 3SGEH 1IMHC 5K9JL 5MEQB 1DVFC 3CMOL 4OLEA 4W70A 3VA2C 2AQ2A 3E6FA 5T3ZL 4JN1L 4N90E 1T6WA 5BZWA 2BOBB 1MCOL 5D1XB 3B9KD 5KS9F 5GS0H 3V6OE 1U6AL 1HYRC 1JHTA 1MIEL 4OZFH 4N0YL 1D6EA 4QRRB 5ALCL 2J8HA 5EZIH 1IBGH 3WJJC 5F44A 2GTWB 3WV0A 4H20L 4QTIL 1J1OL 1JGLH 4QWWD 3CZFB 3LHPL 4MS8D 1CF8L 3B2UC 4FXKB 5T3XL 5IB4B 4C54A 2QKIA 3TZVC 5CSZA 3MLVH 3VE0B 2C4FT 3I6KA 5HVHB 4FNLH 4EI6A 3U7AA 1NL0L 3FONA 5B3JF 3PGCA 5GJSH 1NFIA 3MCG1 4M7LL 4RISL 3ARFC 4NQSA 4Z7VF 2H2SD 3DBXB 3TIDA 2PO6B 3WFEH 1WAAF 3LKNA 4LRIA 5TQ0H 3C8KA 1A7BA 4B0MM 2CSPA 3KYAA 1K5NB 1SYVA 3RTQD 1OD7A 2NXZC 2X4OB 4U1SB 3B9DA 5DJ6B 1T0PB 5L6YH 4OGAD 2XFXB 1I8MB 4HZLA 3EJZC 4H1LB 3MRQA 1FG9C 5EO9B 2R69H 43C9A 1CGWA 4IMKC 1N4XH 2WP3T 4ZAKD 3GGWA 4XMKH 1BPVA 2IAND 4Y5XA 4KKLC 1JF1B 3MRRB 1BD2D 4IRJB 1LEKA 2X4RA 4MD4A 3F58H 2D0HA 3L5HA 3S34H 3TH3T 5LGJB 2VLJE 1EUTA 3L3IB 5JPNA 2VKWA 4KTDL 1MFAH 3S36X 4HIJB 1NCTA 5J6GB 3QHFL 1T1YB 4PUBL 2PNDA 1DEDA 5DMKB 5T5FL 1AKJA 4Q2ZB 2F54D 5EOTB 3GMNA 3SDAD 5CZVL 1AR1D 1S7TB 3HI6L 1S9WB 4ETQB 5E7BA 3L3GA 1A1NA 3LS5H 2DQCL 4PJ9A 3WFBH 2YD8A 4LLQB 3I75A 2ZUWA 2J5LC 3NGBB 4U4BA 5CS7A 4HS3B 4QNPE 1G7HA 2XY2A 3OAUH 4GRWF 1HEZB 5EG6C 3MRFA 4LKXB 2PW1A 3AMLA 4GFTB 1IT9H 2XZCH 4Z0XB 3SE4C 1II4E 4OFDA 3VFUB 4P2OB 3H3PL 5CZXC 4LCWA 5TF0A 1GVIA 1KEGL 1UB5A 4DVRL 5H94A 1SY6L 4GRLC 4EOWH 1S7UA 2AXHA 3T2NH 2CK0H 5FYKH 1DQQB 5KJRL 3DXAB 4XBEL 1FZJB 4NQDA 1X7QB 5DJZA 3K3QA 2FJHA 4PB0L 4K2UH 5IQ7L 3ETBF 1KELH 2HTKC 2PTTA 3VXUA 2QBWA 4ZUTA 3HMXL 5IESH 4ZXBA 4LSVL 3OKDA 4XVSH 3RWEA 3CVHB 3CX2A 5GZOC 1PD6A 2WK2A 5DHYA 5IFAH 3ZDYE 5E03A 4JO1H 5FA3A 5D5ME 4L8BA 3V4UL 2KH2B 4L5FH 1U95B 1OP5K 1UVQB 4GBXD 2BSTA 3T0EA 4N9OB 1I3UA 4NFDA 3MJ9H 4Y5YA 3TN0A 3WIIL 4PRDA 1T5WB 1JZ7A 3QISA 4XNXH 3RY5A 1UJ3A 4NZDA 3C5ZA 1HCFX 4NM4H 2VLRA 1R3JB 5J9PB 2HT3C 3SE8H 2EKSA 4UB0L 5C07D 4WDIB 4NO3B 3VWKA 5GRZA 2APTA 4NRZB 3OB0K 5TDOA 1ZT4B 4HIIB 2HTLC 4BFIA 1I1YA 4RZCA 4YXLH 2IAMD 3HZMB 2X1OA 4FQXC 2C3GA 1YQVH 2EDKA 4PD4K 5DK2A 4TVSa 1HYSD 5IQ9B 2V2XA 2AW2A 2NY0B 5C8JA 4JEGB 3PGDB 3MROA 4J1UB 1HSAA 4TUKH 1YPZB 2UWEA 3MOBL 3FFDB 3L3OA 4X5WB 1A7QL 2R0WL 3K1DA 5FHBL 3OG6B 5F97E 2YKLL 3CFIC 3EOYG 5EBWB 5L88H 5CEZH 1P7QD 5ABDE 4P46D 4DKFL 2NY1C 1EO7A 1Q94B 5K9OA 5F7LB 3KLDA 4NQUA 1A47A 3KGRA 1KLUA 4PJBF 1HKFA 4MA3A 2AK4A 2FZ3A 3PHSA 1DR9A 1T03L 1HDMB 3K46A 3LKSA 2MSPA 1JVKA 1J10A 4Y4FA 3LN5B 4HD9A 2DKUA 3IJYB 4G6ML 5HDBE 2CMRH 1DL7L 2WLYA 4LDEB 1WK0A 4I48A 1T2XA 3C87A 3RWFA 5JHDA 1I1FA 3CU1A 4ISVB 2X1QA 1M7IB 2HJFB 4JY6A 4JM2A 1CVSC 5D2NA 1E4JA 1CR9H 2HFTA 1ZGLA 1KXQE 5E5RB 3S36H 4NZUH 4D9RD 3EOTH 2FO4A 1B90A 2Z4QA 3ET9F 3F6LA 3UBXA 1Y6NR 4EI5C 5AWNH 3MRHB 1CFVL 2H32H 4KVNH 3VW3H 3PWUB 1T21B 1ACYL 1VGKB 5D72L 5BRZD 4OB5L 3RY6C 1WSST 3G6DL 1RUQL 1C08B 5IWLC 5EOCL 4LU5L 1G6RA 4XRCA 2BJML 1QBBA 1KN4H 5ANME 1G84A 4MLSA 5IIEA 4Z9KB 4BQ6A 5AUMB 4PD4J 1T1ZB 1NEZG 5DEFA 1CLYL 2F5BL 5LKNA 43CAA 3HC0B 4HLZH 1AY1L 3WNNA 3FRUA 3OQ3B 2HMID 1QNZH 3JV0A 3V4VL 3WEXB 4Z7UF 2XPGB 4PRID 5LGHH 5I75B 5JW5A 4O00A 1TXKA 4PJFF 1XF1A 5SWZB 5INCA 3PV6A 1MI5A 4MX7A 3D9AH 12E8H 2VE6B 4MXWH 2W9EL 4P5KA 1JWMB 3LMJH 3O41A 3D25A 1Q9WB 1RJCA 2X9WA 3LY6A 4NRXA 4MDJA 1P6AB 2L0DA 1JF6A 3HC3H 2IPKB 4G8GB 3C5SA 3CFBB 5DGQA 3RWHB 2Q7YB 4WHCA 3CK0H 3DETD 1V7NL 1V3LA 5BVJB 4AEHL 1K4DA 3RIFK 4IRSB 3FQXB 3IF1B 4OZHB 5DEGB 4UTAL 3QIBC 5J13C 4R3SA 1ORSB 1JPTL 3SQBA 1T7VA 4JN2B 4PJ7E 2P24A 2ZUXA 1N0XL 5I19H 3RWCA 1MY7A 2UVFA 1QLEH 3JV5A 4TVPL 3Q48A 4OCWL 3ULSB 1N5YL 4XCCH 3UTQA 4JM4H 1MCPH 3HUJE 1YEDA 1INQB 1K4CA 4LOUC 3AREA 3PWVA 4ZOAA 2QQNH 2ZCHH 1CXEA 4KKCC 2LTQB 1OF2A 3TNNA 4X9FA 1NCUA 1AXSA 1F4AA 3ARGB 4MAUH 3X3FH 2B20A 1UA6H 5D70L 3QUKA 4MHHG 5CEYA 4R8WH 1OAZH 5DJ0B 3CC5B 4CAGA 5I9QC 4UT6L 1FZKA 5FUZL 3ULVD 5LQBH 1QHOA 3GSWA 3EOBA 3MMEB 3AC0A 4JKPL 4FABL 1H0DB 3QFJB 1NCAH 2EH8H 2ZSVA 4RMQA 3L3DB 3QUZD 4RIRA 4CU6A 1YEKL 3LH2H 2AXFB 4A6YH 1A14H 2EIBA 1ZEAL 2DBLH 4N1HB 3S97C 4M8QB 1OPGH 2GEEA 2J6EA 4PGJA 2AK1H 4D2NA 4L8CB 4KGLA 3VCLB 1DCLA 1NGPH 4PJAA 3QDJD 3OJMB 4PJ7B 4NWUL 5DMJB 1XEDA 1SBSL 3BN3B 4LEXH 5C0IA 2YOCA 4BKLA 3D0LA 1K8IA 3FQRA 5IB2B 3TYFB 3SGKC 1I9RL 3NAAH 4XP1H 1MLCA 1NUNB 4OFYD 4XHJC 1EAPB 3HUJB 1KB5H 1OAKL 1QSED 4DUXA 3UYRH 1T4KB 4HS8H 1AHWB 5EFIB 1MEXL 2R1YB 3UAJD 1NDMB 4NHUB 1JGVH 5D1ZA 1T04A 3RVTC 1FO0L 3HZKB 4QCIA 3RNKA 3QNZB 1B0GA 1GZQA 3DNKA 1NGZB 4JFHE 4NQCE 2HVKB 4KJQD 3RL2B 3WUWA 5KVEH 5F7UA 5ICZA 4OT1H 2HH0L 3O6LL 4N8CH 5E56A 5DI8A 3NFPA 1S7WA 3SDAA 3RZCD 1N64L 1EHAA 2RQ8A 5CJXA 1LHZA 4MJ5B 1NC4A 2BNQD 5TF1H 3GHEH 1S9VA 4JAMA 4DZBA 4ZTPH 5F7FA 2R9HD 3F12A 1BFSA 2CJUH 3FQTA 4X6BB 5ADOH 2BNRE 5J12B 5ADPH 1QRNA 1TETH 2J8UA 5IGXH 1JYNA 2YUZA 3KPSA 3PQYD 3HNTL 4AG4H 4GAJL 1FL3B 1OAUH 3EO9H 4JFEE 1MFNA 4Z7NE 1A7PH 2Z0BA 4GJTB 5BJTA 4J3UA 1G7JB 4QXUH 4NCC1 1RJYA 2F8VA 1NEUA 4K7PX 1KG0A 4HBCL 2G5BA 2X70A 4W4OA 4R9HA 3FB8B 4EDXB 3MGTB 3SDCB 4FXGB 1VEPA 2DQGH 3MYJA 2FEEI 5IK3A 1K3IA 4G43A 4Y88A 4JFXA 4YHPA 1WBXB 3TBWA 2IQ9H 1ODAA 4LEOA 1IGYB 3L5WA 1SYSB 4DN4L 5D7JB 3KPQA 1CE1H 2DDQH 4FFYL 4NQCB 4OD3H 4X4XA 3QG7H 1IM3A 3LKQB 2BSSA 3SGJA 1YJDL 4UQ3B 5TH2A 2FD6L 1Q72L 2EDEA 2R2HB 5GHWL 4HGWB 4RMVA 3QXTA 5E70A 1K6QL 3CSYB 4C56D 1W0WA 2GFBA 4KPHH 4RGMC 1JWSB 4JFQB 3ARUA 3DROA 5IB1B 4KAQL 2BNRB 4U6TA 4JANA 5FO9A 4RAUA 4M6AA 3IDXL 3ZE2F 1Y18B 4O51A 2A6DB 1WEJH 2ICEB 4U1KA 5BCAA 4JFEB 4BM7A 4YXKH 2HKFL 3TWCH 4CADA 3QUXB 3OKEB 3BMWA 5I1JL 2X4NB 5DZOA 4UAOC 5BVPL 1MRDH 3GRWL 5E8EB 1G6RL 4G9FE 5C0BD 4ODVH 2NY5H 3IAGC 1KJ2H 3PIQB 3LD8C 2Q87A 4WWKD 3FZUC 4G6JL 5I74B 4HQQL 3EJJX 5C6PB 4HKZA 4Y19B 4TTGA 1LP9E 1J9CT 1U8MB 3G04B 2GJ6B 4K23L 5FCUH 3JUZA 1DDHA 3PE9A 1OWWA 5CBAA 1R5VA 4KDTC 4Y16B 5F7DB 1JRHI 3BPLB 1W0YT 2UZIL 4KI5D 3NIFF 4HDIA 2OBGA 4BFBD 2WINB 4OFPA 4WTWA 4HIXL 2UYLB 3MLTA 5FYJH 4HUVB 3GMRB 2BCKB 1MWAH 3P4LA 2A6JA 3NCMA 1UB6A 4ERSH 2EDBA 1OW0A 2BMKB 5DUMH 4O2CB 2H3NB 5LAXA 1A22B 4MJID 3V4PH 3SCMC 4Y2DB 5FA4B 3G6AA 4XWGL 5FUCE 3BPCB 4Z77B 1FIEA 5GRUL 1JNHA 2VR9A 3ZHDA 1XF5A 3DVGA 3TVMA 3C2AH 1I85A 5C0AD 3Q2CA 3CVIL 2LFGA 3GM0A 3OHXB 5B22A 5I1HH 1DLFL 4G7YL 5CINH 3KLHD 1H8SA 5ACLA 4POUB 2X10A 4YHKL 5CHNA 4YIQA 3BO8B 5IUSA 4K7FB 2VSDA 4O9HL 3P11H 2GSIA 2GQHA 3MRPB 5AG8A 4LKCB 3EYSL 4F15B 1AGBB 1GC1L 1A7NL 1XF3A 2R1WB 3HPJB 3VI4F 1DVFD 4YFDB 3QJFA 5IHZB 1KNOB 4X6DE 1GRWA 5J06A 3MBED 1S9YB 5H35A 3EO1B 3WS3A 4AH2B 1EHLL 3DSNA 3WSQH 3ULUE 1JV5B 1WJ3A 5DJDA 3HA0A 1NBZA 3NPZB 1W72L 2NY2C 4LSRH 1JZ6A 2HG5B 1FVDA 4PJHF 1JPFA 1U91B 1S3KL 4P4KA 4M61A 2RFXA 4AEFA 4LSTH 5I1EL 1S78C 4HKJA 1J5OH 1KLGB 1UH4A 1IEAA 2HYMA 1QSZA 1LQSR 3VXQA 3EDEA 4EKXA 3B2UD 2EYSA 1I1CA 1HIMH 5HHOB 1HH6A 2EC9U 3FFCD 3GI9L 3TZVD 2G2RB 2D03L 3FO9A 1DE4A 3U4EA 3GIVA 4LVNB 1OARH 3DARA 1NCBH 5L0QC 4HJGA 5CZKA 4JRXD 3ZYZA 1FNHA 4UDUA 3DGCR 5DUPL 3FQUB 4IMLB 2P8LB 3V79C 4ZUWB