1C08B

Crystal structure of hyhel-10 fv-hen lysozyme complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10)
publication title Crystal structure of anti-Hen egg white lysozyme antibody (HyHEL-10) Fv-antigen complex. Local structural changes in the protein antigen and water-mediated interactions of Fv-antigen and light chain-heavy chain interfaces.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c08B00
4YHKH 4JQXA 5CKAA 5DI8B 5IMKB 5D7LB 2P7TB 2E7HA 2YD6A 1D9KC 5E8OB 3S8WA 1DL7H 3AXLB 3QIUA 2ED9A 3CFJB 1JJUA 1CICB 2Y36L 3GIVA 4N0RA 2B1AL 4XPBH 4LPUA 5LAXB 2APBA 1PY4A 3QDAA 1DLHA 1FJ1B 3QDME 4AY0A 4R7NA 2DMKA 1JWMA 2VR9A 3OKNA 2WQ8A 1D5MA 3BRGC 1A6WH 2V17L 4GS7B 4LSUL 1V7NL 5FYKD 4OLWL 4QEGA 1G9NH 3KPMA 5JHLL 2HTKD 2KQMA 5CJXC 1AD9A 1G6VK 3R4DA 2OR8A 4L9LB 5CP7B 1ZE3C 4N0FB 3NACH 3RWIA 4NT6B 3SOBL 1G6RA 4S10A 3KNBA 3KHOA 1JYNA 2Z8RA 4JPWL 1EUTA 4MMZC 1MI5E 1KC5L 5HHXH 3C8KA 4YC2B 1DLFL 5I1AB 1GGIL 1A3RH 3SQOH 3WFDH 3MJ7A 1UM6L 3THMH 1NANI 1OGTB 4ZFGH 1DN0A 3RPIA 4D2NA 2BNQD 4V1DA 1Q9LB 3VFTB 2ORBH 2HJFB 3FCTA 1QFWH 3MRCA 4K8RD 4D3CH 3BGMB 4HIIB 2RB8A 1QBLL 2X09A 3D0VA 4OLVH 4UT9H 5FGCB 1GL4B 5JXED 3ARQA 4QXUH 1AXTH 4XCNB 1N2RB 3QIWD 3QXDA 2NW3A 1GXEA 3ARTA 2PW2A 3M1BA 3MNVA 4P5MB 3TF7C 1U8QB 1JRHH 2C7UB 3P0YL 2BNQB 4IRZL 4DWHA 2D2OA 3DMMD 1GPOL 1KEMH 2OR9H 3ARWA 1U8JB 4NWTL 4P46A 5IMOA 4N8PA 4PLOB 1GIGL 1XF3B 2NY4C 2RBLA 4DUVA 4IIQB 1ADQH 4ORGB 1F00I 1MVUB 1D6VH 4WY7H 1D6EB 4ZQKB 4IMLB 5L7XH 8CGTA 1WAAA 4UAOB 4LGRB 3VGGA 2NY1C 4M5YH 4R9HA 3O3UN 4M93B 4YXHH 4MX7A 4QXGL 1M1SA 2DLFH 3MROA 4HFUL 5EUKB 4GUPB 5FCUL 3TZVA 2FO1A 2VXSL 3UO1H 4ODBD 5KW9H 4DOHE 1YQVH 2ZZUT 1YPZE 2EE3A 3RIAF 5K9JH 4PJDE 3MRIB 4MCYB 4WW1B 1KB9K 3ARGC 1NAKH 2X4UA 1HXYA 3QDMA 1T83A 2QV2A 3EO9L 5B22A 4QXWA 5BVPH 4C59B 1TETL 4QF1A 4NSKA 3RTQB 4RAUB 4XTRC 4X83A 5FO7A 4JY4A 4K94C 1I1CA 5BZDB 2YKLL 5BW7C 6CGTA 5IB1A 5HYQA 5TE7L 3GI9L 4O5LH 3MRDB 4UI2A 3PGDA 4DKAA 5BS0E 2VQ1A 4JJHA 2XWTB 4W6YB 1X5KA 2EE9A 4KFZC 3BVNA 1EAJA 4GKSB 3I02A 1HOCB 3BGFC 3IB4A 4M7LH 4YPGB 2R56H 3O3EA 5IT2L 3U6RA 1KEGH 2AV1B 3CCHA 1JHTB 5TQ2H 1AFVL 1KJ2H 2DYPB 1A9EB 4BQ6A 4F9LA 4QRUA 3U2SB 3GMMB 4GRLB 5CGMA 1KB5H 1G7MA 1MFAL 5IB2A 5DHVA 1KNOB 3U36A 1ZHNA 3BMWA 1E6OL 2AGJL 4H25B 4GXUM 3IU4H 1XCTA 3QDJA 1KCVH 4GG6E 4M6MH 2YWZA 4XVTL 2IPUG 2E6PA 1B4JH 4KI5F 1RQ5A 4HUNB 4XT1C 3KLAA 1WZKA 2I5YL 4LRNL 3RVWD 4E5XB 2AJSL 5IHZA 1A6PA 3GB7B 5C0RH 4NQSA 1SBSH 3CUPB 5KSVA 5MENE 1MY7A 4BK5A 1FRGH 4XH2B 4ODTL 5E9DD 4LBEA 2BVOA 1OLZA 5BMFL 1YYLH 2Y07H 4ONHA 2G60H 4YBQD 2AK4A 1G7HA 4OLZH 1CD9B 1HQ4B 4M6NL 5JLZB 1YEKL 1DQQA 3TYFB 3NFNA 2O5ZH 4R4NC 2YPKA 1KYOJ 4ONOA 3E6FA 4OFVA 3T8XA 4NIKB 1WC7A 3ALWA 2NLJA 4OZFG 4UOW0 4X4MA 3ULUC 3PJSA 3JV6A 4OJFL 4U6TA 4JZOB 1OQOA 2UUDH 1ONQB 2P4AB 4WDIA 2X9XA 3QQ3A 4DQOL 2N7BA 3DECA 1Q0XH 1FVCB 4RZCA 3UAJD 4OZHF 3WIFA 5GGTL 3ZL4H 4YFLF 3TO4C 2OL3B 3BE1H 3PV6B 3MO1B 4PJFE 4LPCA 5HDQH 4YDIL 4NBYB 4X6CF 5AAMA 1U93A 3CSPA 5ITFB 3UYPA 4UNUA 1JV5A 2C1PB 2ATPA 1CN4A 2X4OB 1RU9H 3Q5OA 2JB6B 3C2AL 4GKOA 2F58L 2AV7B 4KI5D 3ARED 3O4LD 3TM6A 3ZHDA 3AAZB 3KPRD 1PQZB 3T2OA 5D1ZC 1ZLWK 4JRWA 2H8PB 12E8H 1WWCA 2J88H 3SY0B 3DXAD 1W72A 4RBPH 5TPWH 3LKPA 3TWCL 1NGWA 3L3IB 4OTXH 4RAVB 4DVRL 5BS0A 2ZWLT 2CLVB 3QJFB 2NX5E 2DAVA 2D0FA 4UZGA 4X0KB 1Z9SA 3HUJE 1Y0LA 1JGDB 3AREB 3O4LB 4XZUA 1MHPH 3U7WL 2ZCHH 2XTJB 3KPSA 1ZT4A 1I1FA 1NCWH 3DXAB 1EEYB 3QRFM 2KQNA 5I16A 2EZ0D 4WWKC 5K9QI 2Q86B 4PJGA 3U9PL 1T6VN 3L9RA 4GXVL 2DMCA 1BEYH 3QUXD 4L3ED 3TJHD 3ORJA 3C60C 4PPTA 4WHTA 2DQJL 4BQ9A 3LRGA 4PG9A 4XNZC 3HNVL 4PV8A 3QG7L 2BFVL 2XYCA 2PTTA 5FYJE 1MCPL 4MNGE 3RL2A 4X4XB 2K9UA 4LHUA 4TULH 3FTGB 1MF2H 2G75A 3ZO0A 1U92A 2YPVH 3CFBB 5D7JC 3KPOB 4WO4D 4TUKL 5BOZG 4ZS6C 1TQBC 3QPQD 3EHBC 5JW3L 5K9OA 1UWXK 2VZOA 4ZG1A 5GS2H 5IOPB 3L5WA 3LEVL 4EIZC 3RU8L 4D9LL 2VLJE 2DBJA 4WO4B 4JO4L 1A4KA 4Q74A 4Y7MA 4FNLH 3TT1H 4KRLB 2VXTL 5HSFA 3GUTB 1QTYT 3OB0K 4R7DA 1ZVYA 4NYLA 2PR4H 1BFVH 2EH8L 4WFGE 3RI5K 4NQCB 4RGMB 3S34H 1N3NB 4ZUWA 5E6IA 1HH9A 4K3JL 4XNYH 1VHPA 2F54A 3LQMA 3OZ9H 3WLWD 1ZOXA 2FO4A 2ITDA 2I25N 4PJFA 3WJJA 5H35A 1N5AA 3TYGH 3JWDL 2NY3B 4J4PD 4U0RB 4RDQF 5EDXA 2FX8H 2EXWC 3JWOC 1WWWX 3MLZL 5DO2D 3TCLB 4JFYB 4DN4L 2XWJA 4OB5L 1B2WH 4FQ1H 2DTSA 2DB8A 3QIBC 4PREA 5IVOA 1T3FA 2YD9A 4NUGL 4QHLA 4BA8A 2NX5A 4XHJC 3DURA 4RMWA 1JZ4A 5ILTL 3HNSL 4F15C 1BJ8A 2X7LB 3L3HA 1N4XL 4L8BA 2FZ3A 4FQIL 2H9GA 1EJOH 2W9EL 2EC8A 1MIEL 1NAMH 4PRHA 1A1NA 1ZVHA 2QBWA 4MXVE 1YN7B 5SX4H 3L5XL 4P59H 4G9FB 3CXDL 1OT2A 4CUCA 2VAJA 1CL7I 4FQXA 2BSRA 4IRJD 2JB5L 3LHPL 3UBXB 2XZZA 1AXIB 3VWKD 4KJQD 4L3AA 3O45B 1HN1A 4WGWB 3BEWB 4WI7A 3CLFH 1AIFB 1RZJL 2DI8A 2IFGA 4MNGA 4NHUB 1KUMA 1DSFL 1G6RL 3C6SA 4NO5B 4YWGH 1YUHB 2W9DH 3X3GH 4UDUA 5CGTA 4IRJB 5FKPB 4XMKL 1T5WA 2QKIB 2Y4SA 5I74C 1OP3H 3VWKB 4LHQB 2BDNL 5IJVA 1J1XL 1JPSH 4HXAL 5DMGC 5EBLA 1O0VA 3OKLA 4QLRA 3WFHB 3KLHC 1ODAA 2Z8VC 3BP5B 2DQDH 4Y1AE 1EEUA 1YNKL 4AG4H 5GS1C 3B5GA 1HHGB 2CR3A 2FGZA 1WCQA 3MJ8B 1HWHB 2WUBH 3QA3A 1O7SA 1I1AC 1U6AH 3U0WL 3EYUH 2B4CL 3Q0HA 5DJAA 5EZJA 3DARA 2NTFB 1YEDA 3EYOA 4L8DA 5D7IF 3SBWA 1J5OL 2P49B 4E0RA 4GBXD 2H32H 3LIZH 3OTTA 3TEUA 2RCSL 1SMAA 3CK0H 4P5KB 1RJYA 4J3XA 4Y5VA 3DOSA 3TPUA 1ZT1B 5EUOB 2XZCL 3VFPA 3LSOB 4L5FH 5IR1B 2CK0H 3S35H 5I66A 4NCC2 3VFWB 4L4VE 3WNLA 5TF1H 1T0MA 3T65B 1QRND 1XH3B 32C2B 4PJXF 2FNBA 4GBXB 4QCIA 1IC5L 2P5WD 4NO3A 4YX2H 5I1IH 4L3CB 4YBHA 1H0DA 3G5VB 1CGWA 3QT2A 3LD8B 4Z8FH 1CT8B 1DBML 1DQML 3WBDA 3EFDL 5DJCA 1KJ3H 3X14A 5FUZL 4I5BB 3VXMD 4QRPE 1YEHL 1M05B 4R90L 1FBIL 4OSUL 1JN6B 5TJWK 2YUWA 4TNVF 3HB3C 1XGQB 1DBKL 1FO0H 3U30B 3MLXL 4LARL 4R96B 1U8KA 3FMGH 4BFEA 3MR9B 4UU9B 5DR5L 3MPCA 1S7WA 3AUVA 4XWOD 4R4FH 4YR6A 2IH1B 4JM2B 4AENA 1HE7A 2YPLE 5C08A 1I1YA 4K55A 5I2IA 4PB9L 4NKMA 1JZ3A 2J8UF 2BVUA 2ILLA 4G5ZL 5KS9B 5D7SL 5HHME 2CRYA 3WIIL 1L6ZA 2FD6L 1A0QH 3ULVE 1N6QH 3JTTB 4R0LB 4PJ5A 3ZKQD 5HBBA 3F7YA 1WLHA 2IPKB 5CWSA 2PO6A 5HDLA 3LH2H 4BQCA 1MCOH 3ZT5A 5D7LE 2R2BA 4Y4HA 2LU7A 3NGBB 3R06B 4WEBL 3CPLB 3BKCL 3K46A 1NGQH 3DX8B 5D71H 5IMLA 3C09C 4PJXB 4P3WA 1QLRA 3PHOB 3EOBA 4LKCB 2A83B 4OUOA 1J05A 1EO8L 1XF5B 1F11B 1FNHA 3QQ4A 5KOMC 4CJ0A 1XGRB 1X7QB 1NBYA 4LNVA 3O2DA 2X4QB 1KJ2B 1KOAA 2H3NA 3RA7H 5HJ3A 5IFHH 4F7TA 1BBDH 4CADA 1J87A 1VFMA 1PDKA 1KB5B 4Z7VA 1Q0YL 4HKXB 4AZ8A 3RWEA 5AZ2H 4NFCA 4KVNL 4P23D 4PGEA 2E3VA 2X4PA 5FO9B 4F33B 3VW3H 2DLEA 4IHOB 2ADFL 4F3FA 4DGIL 5DRWA 3GSNH 1IBGL 2QQKL 3PWLA 3V7AE 3QISA 3T4AA 3C5ZA 5F89B 5E94A 4PJIA 2DWEB 1SVZA 4X7SL 2X2YA 1F58H 4P23B 2R1XB 3QUKB 1FZKB 4U6VH 1SM3H 4QRQB 3DHJA 3C5JA 2J8UB 5IVXA 2FIKB 3P4LA 4LIQL 4WFFE 1UJ3C 4HWZA 5SX5K 4GT7A 1JFQH 1QVOA 4R6UA 3WE6A 4HS6A 4G3YH 4JKWA 4WUKL 1G7LB 4EI6B 1FG2B 1FIGL 1UYWL 1Q72H 4I2XA 5FGCE 3V8OA 2GY7B 5D2NA 1KCUL 5ADPL 1QP1A 3DI2B 4YE4L 2VE6B 1J18A 4Y4FC 1FZMA 3DNKA 2OK0H 4OD2A 2BNQE 2ZOLB 1OW0C 1YJDL 3G08A 2GUOA 4QTHB 3BW9B 4RBPK 3ROLA 3O41A 4TVPE 3IETB 1A1MB 3UTSB 1T7WA 2H2PC 4AIZA 4XNMB 4Z6AT 5D7KD 1A6AB 3Q6FB 1W72L 4G8EA 3ZKMC 1S7UB 1CLYL 5D1QD 2NW2A 1BVLB 4RGNB 3U0PB 1PZ5A 2VDKH 4M61A 2M1KA 4HEPG 4NZUL 2I07B 2W1NA 4NC2B 2W0PA 3QAZC 3S35X 1W0WA 3L3OB 1I7RA 4NQEA 4TTGA 4YHOH 3DV6B 4KKBC 2HFGH 3ALPA 2MCPH 2CUMA 3ILQC 3AXLA 3OWEA 5C7XH 4YEFA 4LAJH 4NUJA 3CFJA 3WFEL 3SKMA 2DDQL 1JP5A 5E6ZA 1FORL 4H20H 5EU7C 4XXCA 5I75C 4ZUSB 4LEXH 4MDJB 4WTXA 1RMFL 4RX4A 3LS5H 2WQRA 1F90L 5DMIH 4YDVB 1L7IL 4HJ0C 3BKMH 1EEZA 3H9SD 3GMLA 4JZJA 5CP7A 5A1AA 4N0FA 3TPKA 4YNYA 3VWJC 4OV5A 5BQ7A 2NMSA 4K3DH 3UZEA 2F8OA 4GMSL 2Q8BH 5C70A 2BNRB 1LVEA 2QEJA 4O2CB 3CFIC 1UZ8B 1LEIA 5GS2D 4WTZG 3VMPA 2I9TB 3QO1B 1F13A 5MP6H 4KWUA 1OGTA 5JPMB 2H41A 1X4YA 3Q2CA 5DTFB 5C0AD 3B2UD 1CU4H 1T0PB 1Q9LA 2HJFA 4J2XA 3BGMA 3IF1A 1ACYL 4Y19D 3QWRD 3RGVC 4X5WA 5TDNB 1ZHBB 4GKZA 1F4AA 1VGEL 1WZMA 3V4VL 5ANMB 1YC7A 4FXKB 5F9JB 4CMMA 5CJQL 1MEXL 3GK8H 2BNQA 1XGYH 4WUUD 3S88L 5T3ZD 4HPYL 1MCJA 3DUSB 4HEME 1NCCL 3P2TA 2A74A 5E70A 3QXTA 2NY6C 1RZ7H 3QIWA 4IIQA 1MH5B 2GAZB 2YC1A 2QR0B 4QYOB 5B39G 5KVDH 3DUUB 3O2VH 3ARSA 4WUUB 3D25A 3DMMA 4U1GB 2XG4A 3V4UH 4MXWH 1MCQA 3QHZL 2G5RA 3I2CL 3B9KD 5KSAB 2C4FU 4N68A 2ZPKH 3MRNB 1IGYB 4KU1A 4JO1H 1CFNA 2YD1A 4FZ8H 5GGUB 4Z9KB 2NZ9D 4MJ2A 1KT2B 3HZMB 2GKIA 3B9KB 3BUYA 3HI5H 2WBKA 3IS1X 2UZIH 1RUAH 1HSAA 5BZWB 5CS7A 5T3XE 5GGQL 1L0QA 3TN0C 5EO1A 3ARBA 4LVHC 1V7MH 1NAMB 1X4XA 3RVTD 5FYJL 4OCSL 1G7IA 1F8TL 4KY1L 2R15A 5CJOH 1OGAA 3KS0H 3WN5B 1F42A 5BZDA 5H94B 4WV1C 4C57C 4NQVB 3RBGA 4D94A 1H3TA 3PGCB 4XVJL 1GZQB 4YDJA 1OSZA 2Y72A 3W39B 3BXNB 2DLHA 2V2WA 3DUHA 3HFML 4KI5E 5T1LD 1QEWA 5HI5D 3O4LE 3ZDXF 2DL9A 3KPRE 4GKSA 1MAML 4IOFC 1EBPA 2CKBH 3AS0A 3G6DL 5E8EB 2XTJE 2FX7H 3OXSA 3DXAE 2NY5H 4JDTL 2Y23A 2R4SH 2E7BA 3FB8B 3GMMA 1AI1H 3V5DB 4PJHF 5IJKA 4MVBD 35C8H 3F58L 1FLRL 5DUPL 3TVMD 4ODWA 2P8LB 2F74A 5EWIH 5DJDB 5E4EC 4IRSC 1TFHA 1GC1L 3FOLA 3NZHH 3TBSB 4KKLD 3KYMB 2BOBA 3G6JF 2XI9A 5FYLE 3NCYS 5C07D 3BJ91 3VFGH 4I1NB 5M95B 3UZVB 4XH2A 2H32B 2VXVH 5IWLA 2YD7A 1INQB 1HCFX 2AQ3A 2DLIA 1A6ZB 4Y2DC 4UV7H 3NAAL 1YMMB 1UCBL 4NKOB 2HRPL 4LU5L 2XWBA 4JFDD 4W6XB 1LO3H 5C07B 1B88A 1QQDB 5E8NB 1IQWH 1EGJH 4JLRA 4Z7WA 5JLZA 4NN6B 3MRBB 4G8GD 4X6CE 3LKRA 3GMNA 5E9DA 2OYPA 4XAKD 4XPTL 4CKVX 2HTLC 4UIMB 5GRWA 2JTDA 4TUJB 4OCYH 5KSUB 4U3XA 4JFDB 5GRJL 1TTUA 4JZOA 1I8MB 1JPFA 1ONQA 5LCVL 5GS0C 5GGSA 2WW8A 5IUSA 1JPGA 1MLCB 5D70H 1NFIB 3UYOD 3FQWB 5I9QC 4NQCE 1DN2A 2BMKB 3VFOB 4PJ9C 4DZBA 5F1NA 2OL3A 2XTLA 1HHHA 3SGJC 4IDJL 4OM1H 1FO0B 4DTGH 1MCKA 5ITFA 3U1SH 3CVHH 3EYFA 2ADGB 3VDAA 5BV7C 3E3QC 1UGNA 3ULUH 4OGYL 3SJVD 2HP4A 4YDKH 1OY3B 4PRPD 4E42B 3L3IA 3QUYD 4FQQB 2CLVA 3TFKD 15C8H 5JPNB 5F3HA 3NPSC 4PGCB 1EMTH 1DE4B 3G6JB 5JW5B 3W5MA 3AREA 3O4LA 5MEOB 3KPRA 4GQPH 1Q94B 3SJVB 2HJKA 1TQCB 4XC3L 4PRPB 4ZTOL 2CIIA 2HWZL 2YA1A 1XIWD 4RISL 4LVOC 4AEIL 1N5YL 3MNZB 3V52H 1WVZA 3AC0A 1BJ1H 1CZ8L 1V3LA 3O2DL 4G9FE 2C1OA 4RGOH 4ZO8A 5EU6D 2FSEB 3KPQB 3QFDB 1WBZA 2GJZB 2JJSC 3VD9A 1CXFA 5IB5A 1DQJB 1IEBB 1JHKH 2APFA 3WO3B 4XNUL 4MLSA 5C1MB 1YY9C 3RVXD 2BVEA 1JTTA 5EU6B 3NFSL 3VCLB 3QUXA 4L3EA 1EFXD 2VZ1A 3CFBA 2BK8A 4ZD3L 5AAWA 2O26U 1AD0B 4Y2OA 4TOYH 1Z3GL 2DQEL 4IOIB 2PXYC 1OM3L 4OZHA 3V9FA 5GSRA 2YD5A 2JCCA 4X6CA 3GSNB 4UQ2B 3NIFF 4AEHH 3K2UH 5DMYA 4LLAA 3I85A 1ZT7B 1E4JA 2CD0A 5L88H 3ECBB 2EXYC 3GI8L 5I17B 2DQCH 5ECJE 5DVNA 4CN4A 5HI3D 4EN3A 4YK4B 3AU1B 4DKFH 3HG1D 1R3IL 1K4DA 1CBVH 4QRTB 3BP7B 5FECB 4KJPC 3AMLA 1AXSB 4ZPTB 2FH8A 1QFPA 5FGSA 4LPVA 4LSQH 1EO5A 2DICA 1IT9L 5I8EB 1LD9A 2VR5A 2RJMA 4Z7OE 1FGNL 2D7TH 5IW3A 4PGBB 2GIYA 1TJIL 4IJ3B 2Z35A 3BWAB 5J12C 3N85H 4N0YH 1GZPB 1P5UA 3HCVA 4YXKH 3UYRL 4BQ8A 4HGMA 1A5FL 4ZUUB 5EH1A 4RWHA 1FPTH 4J4PA 2GSIA 4OLEA 3PP3H 4PRIB 4X9IA 4PRAB 4CRPA 5LGHL 3MMEB 2CDEA 1ZA6A 3P3YA 4MXQC 1YN6A 2EC9T 3JWOH 5C0EB 4EI5C 4DFHA 1YN7A 4LASL 5IG7B 3C2SA 1T03L 2X70B 2VL4A 2XV6B 3TJEH 4YXLH 4P49A 3X3FL 3O45A 1MHCA 2BSTB 3KXFD 3D9AH 3BEWA 3FHQA 4XAWH 1YECL 2OI9C 4XVSH 5KS9E 4Z7NE 1T66C 4JPIA 1D9KD 1SEBB 3P77A 3S3JA 1A6TB 4RWYH 1IL1B 1JPTH 2EH7L 3PHQA 3SE9L 5FYKL 1S78D 4IRJA 1JI2A 5FKPA 3VWKA 3QCVL 5I1LA 4KROC 1CWVA 1XMWA 4CVWA 3WFHA 1I1RA 1A6VH 1JZ5A 4PV9B 1D9KB 3FO9A 2XFXB 1LO4L 3K8KA 5SV4A 4OCXL 1ZANH 3UJTL 4F9LC 2ZG3A 2C3VA 5IW6B 1FL6A 4Z76A 1B90A 1UWGH 1YEGH 5J56B 2EKJA 1KIRB 3MJ8A 1P4BH 4PJXE 5T1MB 4HJJH 2VH5L 1EZVX 4KVCL 1KCSH 1QPPA 1HNGA 4U33A 2I9LB 1KGCD 3QUZC 1F4WH 4IDLA 3VFRB 2IMMA 3MBEC 4K8RL 1UENA 5INDB 4RRPG 4U2YA 3QEQD 1SJEA 5KAQF 1ZT1A 4I77L 2NY0C 3LSOA 1E28A 1YEJH 3VFMB 3HKFA 5JOFB 5M94B 1E4XI 5FM5M 3QXVA 4LF3A 4K23H 3U82B 5E8PA 4PBVC 5SX4I 2A38A 1R5IA 5CINL 1NGYB 3QEQB 4S1RH 2OCFD 2O61B 3E8UH 1LGVA 2VLLB 3RP1A 5KSBF 3K7UA 2JK5A 5ESQA 4YQXL 3SE8L 2YEZB 4LPTA 1FGVL 1QRNA 2J8UE 5J3HC 3LMJL 2P5WA 1LP9B 1NGPH 5ACMA 5KVGH 1S5IH 2JE8A 4M6OH 1MQKL 3IDIB 4B7LA 3PWUA 5C9KA 2PW1A 2NY4D 1W2KT 4EXPX 4BH8B 4H1LA 3MLYL 3CVIH 1BBJB 3D39D 3QI9C 5DA0B 3V2AR 1FAKT 1RHHB 3VD5A 5FF6B 1BREA 1U95B 2EIZA 4I0PD 4N8VA 5A40E 3VXMA 3MRPA 4UMGA 3WHXB 4GW5B 3WL9A 2NY1D 2YR3A 1OTTC 3ARDC 4LCUB 3UTSE 5HYSG 5I1HL 4DEPC 5IBUB 4LSTH 1QFOA 4PJAF 5C2BL 4O4YL 1OAXL 3MC0A 4UTAH 2E7LA 4JO3L 1TCMA 4R0LA 4RGNE 4NJ9H 5CZXC 2NZIA 3T04D 5D7IA 4LRIC 5E2UH 2NY1B 2FYYB 3ARGD 3FJTA 1AY1H 3MRGA 5D5MF 3IAQA 4BFBD 2DIBA 5F8RC 4BSVB 4CDGC 4L8SB 4O02H 5E08L 1PEZA 1U58A 3KLDA 3HRPA 4CNIB 2X1QA 4LKXB 2YWYA 4TNWK 2QSQA 4GAYA 1ZLUH 3WXVH 4X4YA 1NCAH 2YBRA 4NNYB 2GITB 2A1WL 5K9KB 4OZ4B 1H8NA 1F11A 4D0BB 1F5WA 2CKBB 4ONFH 3OKYA 4JFHE 3ZDYF 2FGWH 1R0AH 3MLRH 2W60A 2X4QA 2IFFL 3PXHA 3G5YA 4LQFL 2APVA 2Y5TB 4MA3A 4Q9RL 3NFPB 4HKJA 3SO5A 4OZIF 3TNMA 4YGAB 3EDKA 1NC4D 3ESUF 4PFEA 5MERA 5JOPD 2OJZL 1OAQL 4XCEB 3HE6C 4F33A 2K3TA 2YD3A 4PP2B 5TFSL 3SCMB 4EVNB 3BGFB 1T1YA 2B1AH 4D0DB 1S9VB 1XGUA 3BMVA 2FB4L 1XZ0A 1RVFL 1NC4B 4P23A 3LN5A 4MDIB 1FZKA 3AM8A 3LVEA 1I9RL 3EYQC 1NL0L 3WKML 3O3DA 1URLA 4MAYB 2J8UA 2FIKA 2V17H 4GKNA 1V7NH 4LSUH 3NTCH 4OLWH 4R3SA 5EOCL 1DZBA 1VACB 3QXAA 3DO7B 1MCCA 1RPQA 3RBSA 3SOBH 3GBNL 2OL3L 3VXRD 1E27B 2KL6A 5JO5B 1MJJB 3IDXL 3FHAA 3HI1B 4JPWH 1INDL 5ANME 4KK5C 1CQYA 5C0AE 3P4MA 3SDXB 2AERT 3M17A 3BW9A 1X5XA 4R4ND 1DLFH 3MA9H 2DQHL 1RK0B 1UEYA 3NH7L 1UKQA 3RZWA 4IOSD 1UM6H 4WFED 1H8SA 1A6AA 3CSGA 4DN3H 1WEJL 3BH9A 1S7UA 5IHUL 4H0IA 1HYSC 5IBTL 1C7TA 4WUUE 5ISZD 5C0IB 4PJEF 5SWSB 3CVHB 5FUCC 8FABA 2VDLH 3TO4D 43CAB 1A7NL 4NC0B 3D85D 1T89A 3DVGA 3DV6A 4OZIB 4X99A 2CLZA 3N9GL 3P0YH 1OCWL 1Z9LA 2OTUB 5D1QA 5F96L 2EYTA 3LKOB 4TSAH 3K4AA 4NDMB 4Z0XB 5IB3A 3GHBH 3QO0B 3NA9L 1NDGA 1GIGH 3RRQA 5HGBB 1RSFA 3VGHA 2BY2A 2DQTH 3CSYA 3PWNA 3TO4B 4DFIA 1QFUL 5C6WH 1UWEL 3LKSB 5AUMB 3EGSB 3KHQA 4RCAA 2XG5A 4PJCF 3HMXL 1JWUA 4KDVA 5D1ZB 5IW1B 3RI5F 4HHAB 3FFDB 4P9HC 4QXGH 4HFUH 3H3BC 4RA3A 5A2FA 1MPAH 1QYGL 2A9NH 4PBXA 4F58L 2VXSH 3QUMA 4WWKD 1BM3L 2XRAL 3ARYA 3QWOB 1UZ6E 1OARL 3D69A 1MQ8A 1KIPB 4IBLT 3WNMA 3OPZL 3UJJL 5I15H 2QQQA 3H9SA 1Z6JT 3C60D 3I6KA 2FLRT 3GKZA 4U6YB 3MOBH 3L1OL 3EO9H 4YZFE 2VUYA 2A6IA 2AXGB 2Q3ZA 3BQUD 5FB8B 2RFXB 1TETH 4KUZL 4WWKB 1LDSA 4QY8A 5E1AA 1B0RB 4M1GL 1TLKA 2A6DB 2XKNA 3MV7D 3PQYB 5I1KL 4NZTH 5D7JD 2YKLH 3IFLL 5FK9B 3MREA 3EYSH 4PUBH 5TE7H 1BQHG 4R97C 3GI9H 3PDOB 4XNZB 1NBVL 1CTNA 1R3JA 3EHBD 4Y5VC 3F5WA 1WFUA 5C0AA 5F9JA 3UDWA 3MLTB 4C58B 1CR9L 1F6LL 1OF2B 1O5DT 2PNDA 4HV8A 5IT2H 2ZNWA 3MV7B 5DRNA 2EEBA 4KH2A 1AFVH 4Y19A 3O11A 3QWRA 1Y18B 4XCCL 3R0MA 2ZG2A 2HMIC 2CRMA 3PP3K 2VC2L 3PNWB 1YMME 3ZE1F 1MFAH 4QYOA 4ZUTB 3DUUA 1MJ8H 5C07E 3DTXB 4K3EL 2AGJH 2NR6C 5I8CB 1NBZB 1WIOA 2PN5A 4XVTH 1P2CB 1CG9A 4M1DH 1UADC 4U1JB 2XY1A 4J3UA 3U9UB 3MRNA 1N26A 3MFGB 1X44A 4XNQB 2I5YH 4LRNH 5J6GA 1OWRM 2AJSH 4YHKL 4JFDE 2AKRA 2EXWD 3LEYH 5GGUA 1JTOA 2EDKA 4ODTH 1KT2A 2MHAB 2DQIH 3B9KA 3QIBD 5BMFH 2JELL 1HQRB 2NNAA 5C71A 3ZDXE 1KG0B 4XHJD 5BZWA 4JZNA 1UVQB 4HT1L 3WJLC 2XPGB 4M6NH 3BKJL 3TO2B 3O2WH 1YEKH 4M1CD 1EH9A 4OQTA 3EFFB 4RA0C 5F1IA 3WHE0 4PJHE 3B43A 1NJ9A 2CGRH 5EC1B 1INEH 1IAMA 4OJFH 3MFFA 4NQVA 2LAAA 5E00A 3BT2H 3LY6A 3IXAA 4P2OC 1T22A 3W81A 4YHPB 1FVDA 3W39A 1RJCA 2Y5EA 3BXNA 4DQOH 4F15B 3G6JE 2WZPD 3LOWA 3NACL 1TITA 1CFVL 3SJVE 4I18C 4PRPE 4YDIH 4JHWL 4KZEH 4Y5YB 4APQB 1QD0A 5GGVL 3C2AH 3FB8A 1WWAX 5DQJB 2EDEA 3MGTA 1VEMA 2X4TA 4KJYB 5T1LA 4YHIB 1A3RL 3SQOL 5J6HA 3WFDL 3THML 5HYJD 5CJBA 3TWCH 2HA1A 2YRLA 4DVRH 4S1DC 4U1LA 5C0JA 2ORBL 5DMGD 4FA8A 4UT9L 4X7TA 3U7WH 1AXTL 5HPMA 3TVMA 3QWQB 3SDCD 5EU6E 5EIQA 2EECA 2OQJB 3B83A 2HFFA 1JRHL 5IMMB 2GQHA 4A2LA 4MZ2A 1A6ZA 2IJ0C 1KEML 4J1UA 4NKOA 3U9PH 4GXVH 5FIEA 1CK0L 1PSKL 3MCG1 1AC0A 3HPJB 5E8NA 3UTPE 2SEBA 4AYFA 1ADQL 4MD4B 1H3WM 5DK2B 3MRBA 4Z7UA 2DQJH 1QSEB 3REVA 4JM4L 3BO8B 3OAYH 1I1AB 4MNQD 3HNVH 3QG7H 2BFVH 5L7XL 4U05A 2UWEF 4TUJA 2J8OA 1MCPH 2NCMA 3CC5B 5D2NC 1I8MA 3O6FC 3GSWB 4YXHL 3FN9A 1N64L 2G9HB 4G8GA 5C92A 3QEUB 1D5IH 4TUKH 3GMPA 5I8OH 1ED3A 2BMKA 5KW9L 4KJWC 4MNQB 1YQVL 2PYED 2AEQH 5JW3H 3GJFH 2NXZD 4Q2ZA 3S9DB 4AEFA 3STBA 2X9WA 4OZGF 3LKNA 1NAKL 5F9DC 3LEVH 2EDQA 2IF7A 5DC0A 3RU8H 3B6SB 4D9LH 1RZKL 2ADGA 2WM0A 4JO4H 4M7LT 1NCBH 1KLFA 5BVPL 5C0CD 4MA1C 3OKMB 4PJHA 3HB3D 2PYEB 5BJTA 1J88A 5HYSB 3BIKA 3DVNB 3BD4A 3WXWH 5GS0H 4FQQA 3DIFB 5IKCB 3HC4L 3KPLA 2KZWA 1ZLUK 1A3LL 1ZV5A 4JAMB 1CFSB 4PRIE 5MEOA 4O5LL 1J7VR 1Q94A 3SJVA 4PRPA 5F1KC 2OMNA 3JWDH 1NMBL 3HS0A 3QUYA 4JFQA 1FZJB 5BV7H 1C12A 4JGMA 4ODXB 1OB1A 2FDBP 4X8XA 5TQ2L 1UB5B 4DN4H 1KJ2L 1JZ8A 4XXCC 4HMDA 4J6RL 1RFDL 1XT5A 3X12B 2RIKA 3KPQA 3QFDA 3LCYA 2HT3D 2GJZA 1KB5L 4NUGH 4RFOL 4KXZI 1XIWA 5DT1L 5ID0B 1I3RB 5HHPA 5ILTH 1H15A 4JZJC 3Q5YA 1K8DB 2ED8A 4NQUA 2UWEB 4QGYA 4FTVD 4FQIH 5H2BB 4HWBA 3TLRA 4NO0B 3WNKA 1MIEH 1BIIB 2AJZA 1I3VA 1SBSL 2Z0BA 3VI4F 4EDXB 1BFSA 3MGOB 4H5SA 1NUFA 3FO2A 3L3DA 3LHPH 5DVLA 3C09B 1EFXA 3RWHA 4UQ2A 2EDJA 4P2RB 2DWDA 4FQJL 4Q7DA 4HULB 1RZJH 4RQQA 5I17A 2Q76A 2YSSA 3D0LB 5FOBB 3MACH 1DSFH 1G6RH 2CXGA 3NCEB 3FO0H 2Z4QB 3QNYB 3VE0A 3G9VA 5JA9A 4QRTA 3MNWA 3VU2A 5E2VL 3V8CA 3OKDA 1AXSA 1VFAB 2BDNH 4X6BA 1Z0MA 4ZPTA 1AGEB 1J1XH 1FV1B 2YOCA 3H2WA 4HXAH 5KZCB 3BN3B 1UXWA 3VFUB 3TBWB 3GMOB 4Z77A 3LV3A 1QOKA 4YUEL 3QIWC 1BZ9B 4RIRB 3ZL4L 1KGCE 3HG1A 1AGCB 2HFTA 2HVKA 3MV9D 4YAQB 2W65A 1ZGLM 1C5BL 3QEQE 3U0WH 2B4CH 2XQBH 3ZHKA 3SO3C 1GGCL 1JWSA 1JUFA 3FOMB 4NZJA 4GRWH 1J5OH 2PTUA 1UJ3B 4Y4FD 1CFTB 2RCSH 5TPWL 3A6CL 1BGXH 1GOFA 5DLMH 5HVFB 1IKNA 1LP9E 2XZCH 3HZVB 1S8DA 2XY2A 1BF8A 4D8PB 2G2RB 1G7PA 2W07A 1MHPL 2MPAL 5I1JL 5L0QB 1T2QL 2KKQA 4Y4FB 2Z92A 3QJHB 3C08H 4HIJB 5FHAH 2YA2A 4HAGA 1MNUH 1WBXA 4TRPH 4LP4A 1XR8A 2OX5A 3ARBC 1KIQA 3V5HB 4RNRA 4I3RH 4Z5RA 5J1SC 2UY6A 3HI6L 3BN9D 1DBMH 1DQMH 3FQXA 3PWPD 1XEDA 3SKJL 3O0RL 3EFDH 3CU1A 2Z91B 4KKBD 1SVCP 3DX7B 5FUZH 1PKQB 1PJ9A 4R90H 1A6TA 1BVZA 3FQTB 3ILQD 5F88A 3OBAA 5FM4A 2ZUUA 3E1F1 5JORA 2ADJA 4JDVB 3ET9F 1RZIB 2ICWB 1DBKH 3QAZB 3WS3A 5JQ6L 3MLXH 4LARH 2I60L 4TULL 3KXFA 1UB6A 5DR5H 4HXBH 5ALBH 2YPVL 3S36L 3GBML 1HSBB 5CIPA 4WU5B 1K9TA 2ITCB 3OR7A 4Q9QH 3KLSA 1AP2A 1WT5A 2AXJA 4HJ0D 3GGWB 4PB9H 5JW4M 4PTTA 5CLTA 5FYJU 4ERSH 2IAND 3HMWL 5D7SH 3O3BB 5EBMB 1KJMB 2PCPA 2ICCA 4HS3B 4X7CC 5L8JB 1F4XH 3VWJD 4NP4H 4YGVB 1CGVA 5KSBE 3I3EA 4FNLL 1B0GA 3QULA 2QQLH 3VFRA 4HUXA 5HVHC 4JY6B 1FC1A 1M7XA 2V9QA 5INDA 3Q6GH 1OQXA 5TH2A 1CGYA 5CJXA 1RJLB 1BFVL 1BQHB 1G7JA 1I3UA 4ORZC 3JTSA 3S34L 2VLMD 3VWJB 3WEXA 2CO7B 5IWLC 2PTVA 3OR6B 4LOUC 3P0VH 3IDGB 1BX2A 1MRDH 4H0HB 5DHVH 3TIEA 5HDBF 5T3ZL 1S3KL 1EO8H 3A6OA 1IAKB 2FX8L 2X40A 2VLLA 3RGVD 4OFIA 2F9BT 5DFTA 5JOPE 4UOW1 3A6BL 1Z5LB 3BIBX 4X5XA 5DYOB 1V5JA 4KK9D 3EOAB 4JN2A 4RMVA 1MUJB 1HNFA 4WCYH 2FECI 5IM7B 3IFNL 1Q0YH 4JFXB 4PJAE 1I7ZA 1NCDH 1H5BC 2NY6D 1AGDA 1BOGB 1WITA 2ADFH 2F8VA 1S9XA 4HIXL 4HUUA 2R23B 2QQKH 1RHHA 5BO1H 4PRBA 3GNML 4BKLA 4MJ5B 1LO2H 1RJZB 2WINA 4OCRH 3Q3GA 1H3PL 4LSVH 2NY6B 4GJTB 1ZGLP 4JRXD 4LIQH 5F8QC 3D39A 3UAJC 2QQNH 4X6DA 1JI1A 4I0PA 5L9DL 3VXPB 5EZIH 4B7IA 3P4NB 1UYWH 1N0LA 3AS2A 1QBML 5ADPH 3GDBA 1QSZA 1WFTA 2FYYA 3O6LL 5SWSE 3ROOB 1AR1C 3ZE2F 4AIOA 4BSVA 3BDBA 4JRXB 3QFJB 4YWGL 4YE4H 4WFEE 4NBXB 3VXNB 3X3GL 3ULUE 4LLMB 1AGFB 4I0KA 4CNIA 4GW1B 3TN0D 4OZIE 4MQ7A 3D18A 1JPSL 3GSVB 3TBYA 2BSSB 2CH8A 4TUOB 2GITA 4O2FB 2DQDL 3ARGA 3RNQB 3SDAB 3B9VA 4EQ3A 5K9KA 4OZ4A 4Z0BH 2DJUA 3BUTA 2DKMA 3VFNB 5EIVA 3H7BB 1AE6H 2M2DA 3HC0A 4OI7A 3TN0B 3G04A 2QTEA 4LVHB 5KSBA 1U6AL 1LO5A 1EA9C 3KYAA 3CDGA 4MAUL 4IOFD 1QKZH 1LEKA 3TJHC 4WV1B 3ZMRA 3LIZL 5BRZB 3RDTD 3CK0L 1ORSA 4G8FB 2O5XL 5M7QA 2R2CA 1FFOB 4PP2A 2CK0L 3WFEH 2GCYB 1LDPH 4EVNA 4PLKC 2DDQH 3GSXA 1R5VA 2KH2B 4V2CB 4D0DA 3AY4C 4M8QB 3HR5B 4IRSD 3SDYH 1T1XA 4PTUB 4ZFZB 2IG2L 4YX2L 1RMFH 4CMHC 2V5SA 3P9LA 4U1KB 5I30L 1F90H 1L7IH 4Z8FL 1ZS8A 4A6YA 4PJAA 1OVZA 3LPGA 4EN3C 4LHUG 4IRSB 3GJFK 3PQYE 1KJ3L 4MJ4A 4Y2DD 3LS4H 3X13B 1ZHKB 3T77A 5D5MA 3OHXB 3HI1A 1FO0L 4GMSH 1C5DB 3ME0A 3T0ED 3MV7E 1FP5A 1I8KA 4OGZA 5EIIB 4R4FL 2HTLD 2QADB 4JFED 3VXRA 1P9MA 2CDGB 2EYRA 2R0LH 2HH0L 1X9QA 2Y06H 3I75A 5GS0D 4J4PC 1ACYH 2BC4B 1I9IL 3SGEH 1V05A 5HHOD 1U8PA 5DO2C 4HCRA 2LABA 1MFBH 4PJ9D 1A9BB 2BCKA 43CAA 1ZWIB 3MRQB 3V4VH 4D9RE 4BM7A 4OZIA 5CJQH 1MEXH 1PG7L 4I4WB 2APXA 5I71B 4HPYH 3O8XB 4MHHI 4LDEB 5I9QB 5ISZA 4GOSA 1NCCH 1N8ZB 3UTTD 5HXMA 1IAIM 3QO0A 1U9KA 3TC9A 2XOTA 3S6CA 5HGBA 4UTBL 4PJ9B 2DIJA 3S96A 4QNPF 3D85A 3Q48A 5D71L 1FDLL 3FL7A 2C3HA 1S7RB 2X4RA 1MFCL 1CCZA 1RI8A 5EBWA 5BV7B 3L5JA 3EZ8A 3UTTB 2P47B 3BP6B 3FFDA 1J0JA 1U3YA 1D5BA 1BBDL 1FH5L 2P8PA 4W4NA 4GRWF 4ESKA 4KJQC 1T2XA 3QWOA 3NPSB 3QZWA 4LLQA 4JREC 5AZ2L 1EIBA 1VSCA 1KIPA 4XGZB 3F65A 2CIKB 1CIDA 5DVKA 4XHQA 4CVXA 5ESVA 1KPUA 5K59F 5GGQH 3GIVB 4LVOB 1GJIA 2RFXA 4WWKA 4UINL 1DLHB 5FYJH 1YY9D 1FN4A 1F8TH 4KY1H 4P9HH 4U6VL 1SM3L 1JWMB 1IGMH 3OKNB 3RUGF 1D5MB 3GMRA 4KQ3H 3C60A 2WLZA 1T1ZB 3H3KA 4Y5XC 1NKRA 3PDOA 5C6TL 3KPMB 5A2JH 3BQUA 4PJEA 2PXYD 1AD9B 5IEKA 4Q6IC 1Q72L 3HFMH 4NPYA 3MLTA 3RWIB 5C0NC 1MAMH 3KNBB 7CGTA 5I76B 2HYMA 3KJ4B 4IEFB 5D7JA 4B50A 1Q9KA 1BQUA 3F62A 3RVUD 4JDTH 3ZZ1A 2OK0L 1SBBA 5FDYA 1X5GA 2EXYD 3C8KB 4HIEA 3BEVA 1FCCA 3BRFA 1I9EA 2XN9D 3ALXA 3G5ZA 3HR6A 1FLRH 2VKWA 2IADA 1JMZA 2XA8L 3MRRA 2UVEA 4JFFD 1NBZA 1DN0B 5EA0L 3RPIB 3MV8D 1GC1H 1OAUH 4V1DB 4HC1A 1P2CA 1XR9A 3FCTB 1QSEE 2WK2A 3PG2A 4PJCA 1ZVSA 3HAEA 1J12A 4U1JA 4M3KB 2VDKL 3D0VB 5LXGH 5A3IC 3LQAC 5F3BA 4XP1H 2XN9B 3FB7A 5DQ9A 3QXDB 2NW3B 5DJ8A 2PW2B 3M1BB 3MNVB 4GRWB 3UP1A 4I13B 2DL2A 2IEPA 2HFGL 5JHDA 2MCPL 1SJHA 3NAAH 1KPRA 4MNQE 2HRPH 4LU5H 3H42H 2AJXL 5IMOB 4ENEC 5DDHA 4IM8A 3L7EA 5C0BD 5AG9A 4H20L 1U8IA 3VFSA 2HT4C 5FFLA 5J12B 3QIBA 2E7LC 4FQCH 1CXHA 1JF6A 3LS5L 5EC1A 2PYEE 3RUGB 5DMIL 1J1PL 5GRJH 4MQXC 4EI5D 2J7LA 3BKML 5AYUH 3GRWA 1UM5L 5LCVH 4MX7B 3MROB 2WWMD 1JGLH 5DQDL 5MEPB 5C0BB 3TZVB 1LNUB 3IFPA 4LVNB 1FL5B 4KAQH 1KJVA 1LK2B 4ZOBA 1MCLA 4IDJH 4FXGA 4LHJB 3R8BB 2Q8BL 1T66D 1HXYB 2X4UB 3BHBA 1JZ2A 5B3NA 5DQJA 4KJYA 2EYSA 4OGYH 4QF1B 4NSKB 2DQUH 1FC2D 2YRPA 1CL7L 5JIIA 4WU7A 1OL0A 4KROD 5FO7B 4JY4B 4ZO6A 2AABL 3UTOA 5MI0C 5HYQB 2ICEB 3PGDB 3U7YH 2UWEE 3BESR 1LMKA 5HYJA 2VQ1B 2OQJA 1Q9WA 4ZTOH 2PETA 43C9A 3ZSSA 3BVNB 4RISH 4KROB 3WIHA 3I02B 5IMMA 4AEIH 3O3EB 3U6RB 1YDPB 4TSBH 1CZ8H 3CCHB 3RJDA 1S9YA 3HN3A 3O2DH 5EOTA 1WV7T 4P4KC 3AM8C 5GS1A 4TVSa 3QUZD 1RZ7L 4QRUB 4CVZB 4MD4A 3MBED 3SDCA 5DK2A 3VA6A 3W2DL 5HGGS 1G7MB 4AH2B 1UH2A 5IB2B 4P2RE 5GRYA 3U36B 2NY0D 4XNUH 1K2DA 1Q38A 3V4UL 1GGTA 3BPOC 2VKXA 1A7PH 3QDJB 3O4OC 3HE7D 3FFCD 3QUZB 4HSQA 2YD8A 4ZD3H 2VAAA 4JO1L 4TNWF 5JIHA 5FCSH 2DQEH 5IHZB 4NQSB 2NY0B 4KUCD 4EOWH 4MNQA 4KV5E 2EE6A 1OM3H 4LBEB 2EDTA 2BVOB 5J3HD 5FXCH 2CPCA 2R4RH 2GI7A 1F2XK 2BZDA 4ONHB 4D9QD 3GSOA 2AK4B 1G7HB 1RIHL 4G7YL 3OKMA 1DQQB 5HTSA 2PYEA 5HY9A 3NFNB 1W8NA 5HYIA 2VN7A 3DVNA 3BFOA 1IC7L 1QLEH 3E6FB 3M8OH 3QI9D 5CJOL 2W0KA 1MRCL 1WC7B 1R3IH 2NLJB 2NXYD 3JV6B 4YEEA 1DFBL 1DVFC 5LG1A 5C0CA 3E2HC 4WDIB 2MQ0A 3SGDI 3ARDD 4RZCB 5DJ6A 3WIFB 1FZJA 1FGNH 4U1MA 1V8HA 2BSED 2FX7L 5DF0A 4ODXA 4S0SD 4U1NB 3T0DA 1AKJD 1U93B 1T7YA 1JV5B 3PHSA 2VNCA 2ATPB 3X12A 5CZXD 3UYRH 2D31A 5CGYC 3VI4E 4Q6YA 4GH7B 4K94L 3IU3A 1U3JA 35C8L 4EDWL 5ID0A 3KPSD 1I3RA 3UPAA 4AM0A 3LKPB 1NGWB 5LGHH 1PKQE 1MCHA 3NZHL 2UWEA 4HF5L 1HHJA 3GEWB 2HVJB 4E41A 1T20A 1WTLA 4DK3A 1Y0LB 4XCFH 4XZUB 3VFGL 2Y6SD 3KPSB 1ZT4B 1I1FB 4KMTH 1T03H 4LEOA 4O00A 1UXSB 4CN1A 4L4TD 4M02A 1DBJL 4FTVA 1KTDA 4OZGA 4PJGB 4K7PY 3L9RB 4LDOB 1LO3L 2VXUL 1YECH 3W9EA 1I4FB 4WHTB 1DEDA 4U3HA 3A67H 2BVTA 2D9QB 3HE6D 2VXQH 1L4IA 4PG9B 2EH7H 4X98A 3SE9H 5FYKH 4PV8B 2QHRH 4WGVB 2EDFA 4X6EB 2PTTB 4MB3A 3V7AG 3RL2B 3QCVH 4LHUB 2GJ6A 3ZTJH 3ABZA 1AGEA 2G75B 1U92B 3ZT7A 5D72H 3EYQD 3ZTJG 5IQ9B 2OS7A 4OCXH 3UJTH 1AHWA 2Y1VA 2AK1L 3K74B 3OB8A 3OAZH 1MRFL 3AFLA 3T2PA 2IQAA 3U79A 3WYRA 4OM1L 1WZLA 3L5WB 3FQUA 3CVHL 2QHLA 1A4KB 4QHMA 4UQ3A 3ULUL 1PFCA 1A22B 4KK5D 2NPLX 3GSRA 1MWAA 4R7DB 4NYLB 2QSTA 3MV9A 5ACZA 4DUXA 4ZUWB 5E6IB 1HH9B 3VFVA 2PUQT 2F54B 4QRRD 3CJJA 2FO4B 2ITDB 5H35B 5DEFB 1N5AB 2EDRA 4H26A 5C0GB 1R3LB 1YEEL 1HYSD 2X1OA 3RGHA 1OW0A 5CINH 3I6LD 1FAIH 5TDOA 3GSQA 2E5EA 2XWJB 4YQXH 5A43C 3SE8H 3QHFL 1IAOA 4X9FA 1S5HA 1FGVH 1M71A 4PREB 4M5ZL 3U4EA 1G7QA 1MCFA 4PRHD 3NN8A 4BSJA 3FQTA 3DURB 4P57A 4G6FD 3PL6C 4Y16D 3NABH 2H26A 5HI4D 3MLYH 3PWPA 1LE9A 3L3HB 5KANG 3P40A 2FZ3B 2H9GB 2C26A 4JRXE 1QR1A 1X5FA 3CFKA 3EJZC 4PBWD 4PRHB 4WU5A 5CSGA 1A1NB 4G6FB 4W68A 4W6WB 1IEAA 2UZYB 4YH6A 5JW4R 1CDCA 2R0WH 4BELD 2DOCA 4FQXB 2BSRB 5IQ7H 4WW2C 5EBMA 1KJMA 5HDBE 1U8OB 5C2BH 2VL5B 4LP5A 4LPXA 4JO3H 3T3PF 3ARVA 3GKWH 4MNHA 5DD0H 5L88L 2WP3O 3BX7C 5HHQA 4L1HA 4CBPA 3TH3T 2IANA 5E08H 2B2XH 1NCNA 5INCA 4NQTA 1T5WB 2C4FT 3VWJA 3EJYC 5BRZE 1OP5H 5IJVB 5FA4A 1NC2D 5EBLB 3VXOA 3OKLB 1DTUA 5CZVL 1LHZA 2A1WH 3WV0A 4LSQL 1VPOH 1FZOA 3KR3L 3RZCC 3MA7A 4HC1L 2DM4A 1S9KC 5DUBA 1WGOA 2IFFH 3QA3B 1NC2B 1ORQB 5DYOA 2X9YA 1P4LB 3N85L 1FFPA 4N0YL 5DJAB 5EZJB 4YXKL 1KLUA 4NC1C 4Q9RH 1S7SA 1YEDB 1CD1A 3EYOB 4L8DB 1FPTL 1NKOA 4E0RB 1CE6A 3RGVA 1RJYB 4Y5VB 2WIMA 3TPUB 3VFPB 3TBTB 2IQ9L 5TFSH 4MZ3A 5D6DC 2E9BA 2Z31C 1T0MB 3IGAB 1ITCA 2NR6D 3JWOL 2X6MA 3K4ZA 4MJ5A 2FB4H 4L29B 4QCIB 1CDGA 5HD8C 3ZE0F 4NO3B 1ZAGA 1I9RH 1NL0H 3WKMH 2VABA 4FFZL 1H0DB 5D1XA 5EOCH 4YXLL 4X5LA 4U7SA 3GRWL 4B53A 4M48H 2JIXD 3HNTH 1BFTA 1Z0NA 4XAWL 3CXHK 5DJCB 1GSMA 3X14B 3MLVL 4XVSL 4Z7VF 2FJFA 2LFGA 3ROOA 1JPTL 3DYMA 3GBNH 2OL3H 4ZAKC 4JRXA 3N06B 2CUIA 3EW3B 1U8KB 1R5WA 1WIPA 1MFEL 3QUYC 2JJWA 3RWJB 2H6PA 3WO4B 3ZKXC 3T0XA 2H2SD 3GSVA 1Q8MA 2HJLB 2DQHH 2IPTH 1S7WB 3NH7H 4O2FA 4DVBA 5IV2A 4YR6B 4AENB 5C08B 3VFNA 1I1YB 1CLZL 1C1EL 5I2IB 4NKMB 4P2OD 4M6AA 5IHUH 4J23A 3TN0A 4C83A 1JIBA 1XIWC 1Y6KR 4RMTA 4OFKA 4YO0A 2CXKA 4HWEH 4JE4B 2QSCL 1A6UL 2FCBA 5J57B 3G6AA 3UTTE 4YFDB 1MHHA 4KZDL 4PJ5B 1A7NH 1F4WL 4G6JH 3F7YB 3QQNA 3N9GH 3RNKA 3WIHL 1OCWH 4P2OB 2ENSA 5CWSB 2PO6B 1JGEB 1OAYH 2DJ4A 3CSBA 3HZYA 1FFOA 5ALCH 1P7QD 2R2BB 1KN2L 1YEJL 3H6JA 1OTSC 4M8QA 5IF0A 1T5XA 2Q8AL 4S1DD 1QFUH 3CFCH 1UWEH 5IMLB 1VFBA 1QLRB 2IC2A 1TZIA 4OIIH 3RDTA 4ZFZA 3VXQA 1J05B 3QRGL 4ELMF 3QQ4B 4U1KA 4J12A 2ZUSA 1NBYB 1ERNA 3LEXA 3QDGD 2IWGA 2H3NB 5CBAB 3P30L 5HJ3B 3KWWA 4IRSA 4F7TB 1J8HD 4DGYH 3KPTA 4CADB 5C0DA 4OLXH 2EDLA 4Z7VB 4MB5A 2VDOL 4M6OL 3CDFA 3RWEB 1W0VA 1ZHKA 2X4PB 3OPZH 1BZQK 5F21B 4M43H 3CVIL 5DRWB 5HI3C 1ROWA 3OJVC 1CTOA 1J8HB 3PWLB 3T4AB 3C5ZB 4Y2DA 5EIIA 3V95A 5DHYA 5E94B 3I6GB 4PJIB 3RJQB 1CFQA 1ZXQA 4XRCA 3CIQA 3O6FD 3OJDA 3C5SA 3C5JB 4JRYD 5T33L 5IVXB 3T0EA 3IFLH 4HWZB 4Q58C 3MXVL 3SN6N 3ULVC 2YXFA 3WE6B 1NBVH 4KJWD 4TSCL 4V1DE 5B8CC 2E9IA 3VXSD 7FABL 4UTAL 1IKNC 4JFEA 4I2XB 1KENL 5F6HI 5D2NB 1CR9H 2EO1A 3MBXH 4JQIH 2XN9E 4JRYB 4O02L 1NDMA 4KDTA 4GRWE 4JB9H 1FZMB 4LLYA 4OD2B 5HHOA 4XCCH 4JJ5A 3G08B 2GUOB 1CIUA 4M4RA 4HDIA 2VC2H 4R4BA 5ICZA 1CICC 1C08A 1DEEA 4JEGB 5FKAA 4AIZB 5JXAL 4LFHD 5AG8A 2VLKD 1RV6X 4NQED 5HVWA 2CR6A 5FHBL 1VKXA 2FGWL 2NW2B 3RL1A 1R0AL 2BHZA 3QCUH 3MLRL 1PZ5B 2Q7YA 3CMOL 4M61B 1WAAE 3JUYA 2WWKO 3RUGE 5FV2A 4NNXB 1MFNA 1DQDH 1W0WB 4RMRA 1I7RB 3NIGF 2FEEL 3P4OA 4NQEB 2KZ1B 4HMEA 4LQ1A 4S2SA 5C0BE 4XGZA 2JELH 2CIKA 5E5RB 1NEZB 4RX4D 5C0FA 3IVKA 4NUJB 1OP9A 4PRDA 1WT5C 3JV4A 1S78C 3NCBB 2MTPA 4HT1H 3SKMB 1QACA 3L3KA 4K7FA 5AZEL 3BKJH 25C8H 3UBXG 2VZ3A 4QHUA 4YC2C 2VZUA 4Q0XH 4PG2A 2LAGB 1TVDA 3MZTA 3NTCL 2ID5A 1T1ZA 3NVQA 3FONA 2JJSA 1BAFH 1TJGH 1EEZB 4XXDA 4YBLB 3TNNA 3GMLB 4JZJB 3SGEI 4M7KL 1P6AB 1IM9D 5DS8A 4J8RB 3BPLB 5IIEB 1F6AB 3BPCA 3OAZK 4YNYB 4OV5B 2HN7A 1PVHA 5BQ7B 3INUL 5MEQA 4ODVL 1CFVH 4OF0A 4KDWA 4AJ0A 2GSGA 5I76A 3T08A 3WUWA 3MYZA 3MJGX 4JHWH 4PJ7F 1MREL 3QBTB 4G43B 4RDQG 3VXUD 5GGVH 1LEIB 2JJTC 2PXYA 3N1MC 3N1QC 4JO2L 5B38A 3MA9L 5E7FA 3JSSA 1FNLA 2XQYG 5ENWA 4CL7A 1QHPA 3UJIL 4DN3L 4FQPA 1MWAL 3QEGL 2LV4A 3NPZB 3IF1B 1EUUA 1KV3A 3QDJE 4RMUA 4NM4L 2XN9A 2B7DT 4ZPVA 4X5WB 3UXFA 2VDLL 4GKZB 4JFFA 4CMMB 3MV8A 4G6KL 3MODH 2FJHB 4HZLA 5D96C 5LBSH 2BRRL 3FZUC 4TSAL 2LU3A 1P4IL 5T1KD 2A74B 1CK0H 2WNGA 3GHBL 1PSKH 3QIWB 1VFUA 2DQTL 2BX5A 2YC1B 1DUYA 4Q9BA 2AK4E 4I0PC 4JM4H 5BVJA 3D25B 2EIDA 4PP1C 3DMMB 3EO0A 3RTQC 3SO3B 2E9JA 4NO2A 4WENB 3RUGA 4H1LH 5ICYA 4OQ1A 5GGSY 1JK8B 4H1LG 1AQKL 2XZAL 1N64H 4X4ME 5I1EH 1MPAL 4LIQE 2A9NL 1CFNB 5MEPA 5C0BA 5L2JA 4N8VG 3ARBD 1LNUA 1FL5A 1D5ZA 1LK2A 3BUYB 1OGAD 2GFBA 5I15L 4EI5A 3QR2A 3PABB 4YHYB 1ULVA 3MGAA 1X5IA 3UC0L 1HSAB 2D7MA 3MOBL 2DKUA 1RZKH 4Z7WF 5TGBA 5J9PA 5EO1B 3ARBB 4AT6A 3W0WD 4GRLC 1WIUA 1G7IB 1QSFA 5EG6C 1OGAB 1SY6A 4GQ9L 3HC4H 5DURD 2XXCB 3VRLF 2Y7QA 1A3LH 4NZTL 3DLQR 4Y0GA 3EYSL 1BJMA 4PUBL 4WFHD 2ICEA 3D1MC 3IDNA 4YDJB 1RAMA 1OSZB 1BLNA 2V2WB 3T0VA 3IKCA 1FNSL 1QEWB 1NMBH 5EFIA 4GSDH 2EIEA 5DURB 4NRZB 3MUGA 3BDXA 1YDPA 3KPSE 3OXSB 1HHKA 4J6RH 1A4JA 1RFDH 3VRJA 1IC1A 5B3JE 4CVZA 3RIAK 4DUWA 3RX5A 1I75A 1ZTXL 4RFOH 4PJGE 4AH2A 1VGKB 4Q9CA 3DETC 5DT1H 1MJ8L 4ODWB 5HYEA 2F74B 4K2UH 4HUKB 2YA0A 3AMKA 1TXKA 3NCFB 4X9BA 3TA3A 1TNNA 4LOUD 3FOLB 3BDYL 1GVIA 3DRTA 4M62H 4M1DL 2BOBB 3QUZA 5LWYH 2EKSA 2B0SL 5HVHB 4JR9L 5CEXA 3MBEA 3UCRA 3HLAA 3QDHA 5H37H 4JQVC 5EC2B 2E7CA 2AXFA 1AQDB 3SE3A 3LEYL 4JN1L 3IS0X 5J1AA 5H37G 2F15A 1JNNH 2DQIL 4KKAC 3HE7A 1EXUA 3FFCA 2XWBB 1E4XL 1P9MC 5I8KL 4FQJH 4JLRB 4Z7WB 1ZSDA 3ARRA 5FDWB 5A2LH 3O2WL 1OLLA 1VB9A 1LWRA 3LKRB 1IKFL 2NY7L 3GMNB 5E9DB 1GGUA 1JBJA 1ZGLB 2AJYL 2CGRL 1INEL 4UT7L 5E2VH 1HH6A 4HGWA 3BT2L 3MCLL 2WBWB 1JPFB 1EJ6A 2VDPL 4X7DC 1H5BB 5GGSB 1JPGB 1CI5A 3F7PC 4U49A 1B4RA 4LCWD 4YUEH 4G80B 1A7QL 1MCEA 2F54E 3QI9A 4JHAL 2C3XA 1KSRA 2R0ZH 4DZBB 3MRLA 5F1NB 2P24A 1CDJA 1HHHB 2JCCF 2HLAA 4U1NA 2AQ1A 4KZEL 1C5BH 1JYWA 5GIRA 1NUDA 1GGCH 1T0NA 3EYFB 3F7RA 3ARDA 1AR1D 4OUUB 2V2XA 5HHNA 1X5YA 3ZT6A 3A6CH 3FB6A 1AKJA 5ID1A 5F3HB 1QUNA 2HVJA 1QHOA 4WTWA 4LRIA 2G5BB 1S9WB 2R29H 3DBXA 3WS6A 5DWUH 2YK1L 3KPRB 4KKNA 1DQTA 2MPAH 5FUCE 5I1JH 1IQDB 1L0XA 1T2QH 2HJKB 3WDJA 4HK3J 1EHXA 2CIIB 4O51A 5F7KC 4ETYA 1UXSA 3QPXH 2R1WA 3WCYA 4PRHE 1H3VA 3H3PH 5DD1H 3HI6H 2P8MB 1WF5A 2C1OB 1BD2D 1G1CA 3SKJH 4N9GA 1J8KA 3O0RH 3IDUA 3IDMB 4UUJA 1I4FA 1L6XA 1WBZB 3RY6C 4ZO9A 2R1YB 3NIDF 3QUMH 2EO9A 2OTWA 1DBBH 4MD5B 5IB5B 3IDJA 4L4TA 3JV0A 3BQUC 5I73C 3QNXA 4X6EA 4DCQB 2YZ8A 2AJUH 4PLKD 5JQ6H 1A8JH 1QFWM 5EN2A 5K93A 3MRKB 3PUCA 1RD6A 2Y9RT 2I60H 3QUXB 4L3EB 3S97C 2VISA 3VI3F 3S36H 3GBMH 2FL5A 1D5IL 3PE9A 5IQ9A 3HE6A 5I8OL 2HFEA 4ZYKA 2FH6A 2AEQL 1KXVC 3UTZA 5L6YH 1T2JA 4OZHB 3K80A 1P6FA 3KYNA 5GSRB 3S3PA 5I1DA 4EN3D 1T80A 5GGVY 2JCCB 1IGIL 1U91B 3TESA 3HMWH 4Y8DC 5DEZA 1J1OH 4X6CB 4Y4KC 1QLFA 1NCBL 4KQ4L 4X9GA 4CMHB 3IJSA 5IFJA 3I84A 5SWQA 1PLGL 5F71A 4MWFA 3WXWL 5GS0L 4EN3B 1BZ7A 1K4DB 4UT6H 3RAJL 4LAQH 5I0DA 4F37F 2HKHL 1TVBA 1IGJA 2WBJC 5DEFA 1DP0A 1AR2A 1R3LA 5C0GA 5T3ZH 1LD9B 1S3KH 5BV7L 4GG8A 4NM8L 3PGFH 2EDBA 1FSKB 3WHE1 4MA7L 2DKSA 1H9VA 4QRRA 3A6BH 2Z35B 2W91A 2Q87A 3HCVB 4ZXBC 1E0OB 2ADIB 3IFNH 2GSIB 1CE1H 4Z7QE 4M1CC 3ZHLA 1G9MC 1BQLL 3EAKA 3JVGA 4MQTB 2YZ1A 2B5IC 2N56A 1WCBA 2CDEB 4HIXH 1ZA6B 1T1WB 1Q1JL 3O6MH 3GNMH 1YN6B 3EO1A 1G9NC 3IXTB 2X41A 4QKXB 3CNKA 4DKDC 4OQTH 4Y16A 1H3PH 4NCC1 4NFBA 4D0CA 1QZ1A 4V2BA 4YPJA 1MELA 1CS6A 4MJID 5C08E 5L9DH 1U8OA 3GSUA 5SWZD 5E6YA 2V7HB 2E6JA 2VL5A 1MHCB 3G5XB 1NFDF 2KBGA 1FL3B 4B41A 3DGGA 1QBMH 2W9LA 4JPIB 3P77B 1S7QB 3O6LH 3MACL 3PHQB 5EU5A 3FO0L 2BVPA 5HHVH 4MJIB 4UIKL 4PJ5E 3BOVA 3ZKNC 5I1LB 3MCKA 4JREB 4XP9H 4F2MA 3O9WC 1P7HL 4HH9A 5LGJA 1XF1A 3FO9B 3SKOA 4P9MH 1BWMA 2C3VB 3SDCC 1FL6B 2I24N 4Z76B 2P43B 1Q9OA 3QQ9D 3RWCA 1WQVT 5L2KA 3F7VA 3ZE0E 1NC2A 1ORQA 1QNZL 1JF1B 1P4LA 2XQBL 5C0ND 2WIIA 3IRZA 4MAUH 3RVVC 2J6EA 1M6OA 2JJUA 4FQHA 1OSPH 1BGXL 2APWA 2GT9A 2O5XH 2VRAA 3QG6A 5DLML 1SJEB 4Z7VE 3TBTA 2ZUWA 1A47A 3WFCL 1F3DJ 1E28B 3IGAA 4KGJA 2DRUA 2FEDC 1B6DA 4O2EA 4L29A 4LF3B 3C08L 5FHAL 1J8HE 4K71C 5E8PB 4C56A 5KTEL 2FR4B 1MNUL 4JM2C 3ZDZE 1R5IB 2IG2H 4TRPL 5A3ID 5I30H 2IBBA 4I3RL 4PJIE 2IBZY 1P84K 2JK5B 5ESQB 2NXZC 1QRNB 4WVRA 2AEIT 2WSKA 5IVXE 1T04B 4K9EC 2A6KA 2P5WB 5DJZA 4CAGA 2DLGA 3S36X 3MUHL 1REIA 1OT1A 1EHNA 3PWUB 3UX9B 4P5TC 3NBNA 4I2XE 2PW1B 4ENED 1FVEA 5D2NE 4H1LB 2H1PH 2JIXA 5JDSA 4JRYE 3RWJA 4HXBL 5ALBL 3RWGA 4N8VB 2HJLA 2EIZB 1UACH 5HGAA 3VXMB 4NN7C 2HT4D 3MRPB 4QOKA 5F9OH 4Q9QL 3SKNA 1FQ9C 4Z18A 3WL9B 2VOTA 2V7NA 4MQXD 5KG9A 1SY6L 2HH0H 3WJLA 4ERSL 4OKVA 3MZGB 3V7MA 4WI4A 4FP8L 1I9IH 1VEPA 1BF2A 3LDBC 5EU4A 1F4XL 1VCAA 4NP4L 5I0ZA 3P9MA 2OMBA 2QQLL 1JMXA 5D7IB 1JL8A 1MI5D 2FHFA 1PG7H 4P2OA 2HT3C 3MRGB 3Q6GL 3ES6A 1JGEA 1DDHA 4QWWD 4BFIA 1YPZF 3B4NA 1U58B 4PJDF 2VLKE 4NQEE 3WD5L 2BHYA 4UTBH 2IPUK 3P0VL 1HYRC 3BZDA 4GAYB 4I18A 4X4YB 2YBRB 4M03A 1MRDL 1FDLH 4U4BA 3RWFA 4NRXA 2VDML 1MFCH 4P99A 1N6VA 2ICES 1P7QA 4XX1G 2DLTA 2BXZA 2W60B 4HWBH 1ZKAA 3G5YB 5ERWB 5CBAA 1FH5H 3WFZA 2GTZA 4MA3B 3ETBF 2BNUA 4A2MA 4WCYL 2R69L 4HKJB 4PGDA 3TNMB 4NQDD 5MI0B 5I1CL 1NCDL 1KULA 5MERB 4P4KD 3RKDC 3QDGA 3LN4A 5F7YC 1NMCC 1AHWC 1J8HA 5BO1L 5FYKE 3LPFA 1RZGA 1T1YB 3BISA 3KYKL 1XGUB 4UINH 3I6GA 4NQDB 1XZ0B 5GS3A 1LO2L 2A73A 4OCRL 1OTUC 3LN5B 4LSVL 5IFAH 2D4FA 2VDQH 2UUDK 1SHMA 3O3DB 4QHNA 1S7TA 4W81A 4GKNB 1TPXC 4R3SB 2QQNL 1K4CA 4LLWA 4GG6F 5C6TH 3X11A 1T6WA 1LO0L 2X42A 4RGNC 5EZIL 2VLRA 1RIUL 1ITBB 3QXAB 4WWID 1I3GL 3V5KB 3U4AA 1IGFL 4BUHA 3O6FA 3AS1A 4JRYA 2ATKA 4PJ8A 4YJZL 5HGDA 4LPWA 4YLQT 3F12A 3NIGE 4BZ1L 3P4MB 3VXSA 3M17B 1VESA 3CU7A 3HTLX 1YNTA 1FYTA 4ODSH 4F7PB 2XA8H 3DX9A 5DD6A 4Z0BL 3T09A 3BH9B 5EA0H 1DVFD 4ELMA 1AE6L 1S7XA 1KXTB 1QBAA 1KPVA 4HUMB 4KGLA 5LQBL 3BN9C 4N0UA 4NNXA 4X8JB 3O81A 8FABB 3VGBA 1QKZL 4UB0H 4JVUA 2VLKA 3DVGB 3ZYZA 4X99B 2CLZB 2J4WH 3E2HB 3GM8A 5D1QB 5CGYD 2EYTB 4OGXH 6FABL 1NEZA 5IB3B 2AJXH 1LDPL 1NDGB 4KPHH 3CSYB 1M4KA 3PWNB 3IYLW 3TH4T 3SDYL 2BVQA 1T4KA 1EERB 1U8NB 4GAJH 5ITBH 1HXMB 4XP5H 1J1PH 1JWUB 5MEND 4Z78B 1T7XA 1ZA3A 1UM5H 1OGAE 1E6JH 3C9NA 4S1QL 5CIPH 4J8RA 3HUJF 5IIEA 1F6AA 5DQDH 5A2KH 3QUMB 1A7RL 1D7FA 4OF6A 3LS4L 3CZFA 5L8KB 1MCWM 2FJGA 3D69B 4LGPB 4NWUL 3O3AA 4AQOA 4JCMA 3MQIA 3H9SB 2FHBA 3I6KB 4G43A 4UBDD 1QPXA 1F3JA 1IM9A 5C3LD 2ERJC 2A6IB 1SYSA 1CL7H 4QY8B 5E1AB 4POZD 4KTEH 2R0LL 1MVFA 2Y06L 4ZODA 4ZMAT 2BY0A 2XKNB 2AABH 1KB9J 1PG7X 3EUUA 5TDPA 3VXUA 5IVNA 3MREB 2IMNA 5KSAC 2HAZA 1R3JB 3QP3A 3F5WB 1MFBL 1PYWB 4PRNA 4KK9C 4ZUVA 5C0AB 2W38A 4HV8B 3FQNA 1GAFH 2FJHA 5DRNB 3L7FA 4HIHA 2Q7NA 3P73A 4Y19B 4C4KT 3C6LD 3O11B 4JKKA 2AJ3A 3UBXI 4KHTL 3FRUA 2BOCA 1PW3A 4DGVH 1X4ZA 3W2DH 5D1XC 1PBYA 3JV5A 4WW2F 4Y8AA 5DA4A 2D7QA 4Z7WE 2DMBA 1GOGA 1XCQA 2OLDA 5T1KA 3AROA 5GGRY 1CG9B 1JK8A 5E9DE 3MLSH 1NCTA 1WISA 4XBPA 3U48A 1N0XL 5J6GB 3VRLE 5I1GH 3H7LA 2AKRB 1NGXB 3OQ3B 2R2EA 4KK8D 3FN3A 1U8HA 2F53A 3PABA 4PJ7A 2CDFB 4HMCA 5F97E 2NNAB 5IBUG 5DEGB 1TZGL 3BKYL 3EOTL 2OJEA 4JZNB 1RIHH 3PL6D 4K7PL 4Z7UF 5GRUL 3MUZ1 4G7YH 1BVKA 4RMSA 1C7SA 1OP3K 1IC7H 4P9HL 5EOQL 2LVCA 1IGML 5F1IB 1MRCH 4JKMA 1NJ9B 4KQ3L 1QFWI 3EJZD 4YHNA 3MFFB 3CFEA 1DFBH 5E00B 3IXAB 1WSST 4PY8I 3GO1H 3T2QA 4JY5L 5KAQG 1IE5A 1T22B 3CH8A 3W0WA 2E27H 1FVDB 5EU3A 2YMXL 2VLJD 1JRHI 3KVQA 4NRZA 2XIDA 2AEPL 2E8ZA 4PJBA 3TH2T 3RDTC 3MGTB 3B3IA 2X4TB 3AGVA 4K94H 5T1LB 1VGKA 4WFGD 4EDWH 5J6HB 5HGHA 2XNAA 4NN6C 4WW2B 2MQ3A 1I85C 3EJYD 4U1LB 5C0JB 1OAUL 4HF5H 1JGVL 1A21A 1C16B 2MQCA 1VENA 4ETQB 4UILL 1MAKA 3DSFH 5LXGL 4X7TB 4XP1L 5HPMB 3TVMB 3C8HA 4LLUB 5EC2A 1AQDA 2EICA 4JPVH 3RZCD 4L3EE 3V0VA 4FABL 4ZNEA 4PR5A 2HFFB 5FM5O 3L3GA 2VQTA 1WUNT 1WFOA 5KOVC 1DBJH 1BQSA 3ARXA 4J1UB 5AD0A 4A6YH 1U0QA 4WI5A 3H42L 4OZHE 4ZOCA 2SEBB 2VXUH 3S98A 5FDWA 1XF2A 2JCCE 4Z7UB 3RZCB 1MJUL 3T0EC 1OD9A 1Y6NR 3REVB 4NHCH 2AJVH 3MYJA 4FN0A 1ZGLA 4FQCL 3IDYB 1OPGL 1TVHA 2Z31D 4MS8C 3EKCA 4WEMB 2FECL 5AYUL 2A6JA 1H5BA 4OLUH 2NY2D 5HD8D 4G8GB 4KDTC 1JGLL 1U42A 3GMPB 4XNXL 4YHLL 1ED3B 1UG9A 2VIRA 4JDZA 4G80A 3HA0A 1TQCC 2B39A 5SV3A 2ZCKH 2DM2A 2AK1H 2Z31B 4KAQL 4BSWA 4MSWA 4Q2ZB 1MRFH 1KCKA 4GAFB 3SE4C 4X9HA 4B5EA 3LKNB 3I9GL 5CBEB 3BPNC 5EORL 4LLVA 2B8OT 4HCRH 4ZAKD 4LCWA 4OUUA 4PJHB 4E9LA 5GGTA 4GRMB 2DQUL 5BJTB 3BIKB 4OLYL 3HPLA 1YEIL 2FX9L 3KPLB 3H0TB 3NIDE 4Y1AD 5DD5H 4C4KO 2G5BA 1S9WA 5GRZA 5IVZA 4U6HA 4ZAKB 1IQDA 3U7YL 2V2TA 2MKWA 4HK0A 1YEEH 5GZNC 2P5ED 1YQ2A 3HS0B 3QUYB 4JFQB 3VI3E 3KYOB 1C12B 2P48B 4TSBL 1PZUB 3WDIA 1OB1B 2P8MA 3QHFH 3IDMA 4M5ZH 4PG2C 4BQBA 2R1YA 3OKOB 1R3KA 3S5LA 5B4MC 1XIWB 4MD5A 2P5EB 3WUZA 3ULVF 1WBYA 5HHPB 1H15B 2A2QT 3QZWG 4DCQA 1A7PL 3MOQA 1BD2A 1OTSD 3MRKA 1CXLA 1ZK9A 4WRLA 4FG6C 1U2CA 3MXWL 4MJIE 3N50A 2AJZB 5F9AC 4EOWL 3ARUA 2Q6WB 3VG0L 1CDHA 1A14L 1N59B 3AY4A 4H5SB 1U91A 3FO2B 4QRPD 3L3DB 3PWJA 1EFXB 2R4RL 3RWHB 5JOEA 3VMOA 2DWDB 3RVUC 4NN5C 1SYVA 4RQQB 2XZQH 2Q76B 2YSSB 5TE6L 1QLEL 4NKDA 4OIBA 1QSVA 3M8OL 4P2QD 1TTFA 3VE0B 1JNJA 4ZFFA 4P2CG 4XB7A 5B21A 3PF2A 3MNWB 1IGTA 2YPLD 3OKDB 1UWXH 3U83A 4X6BB 3VH8A 1NPUA 1UXWB 5DXWA 5CZVH 3ZYOA 4Z77B 5DD3L 3LV3B 5HHMD 4HKZA 4OFYD 4P2QB 1MIMH 3KR3H 1QR4A 2E6QA 2ESVD 3HG1B 4HC1H 4EEEA 3ULVD 2UVFA 4LCYA 1CGSH 1GOHA 3OB0H 4C54A 3VXTB 1LEGA 3HAEH 5A16B 2HVKB 2W65B 4NNPH 5TE4L 1PY9A 2NTSP 1J0ZA 1CYGA 4OCMC 3HAEG 2FRGP 1JWSB 1JUFB 2ADIA 4OD3L 5F9WC 3DVFA 4OFDA 5J13B 3D3VD 1QRNE 4S1SL 4PY8J 2ESVB 1FNGA 1FNEB 2P5WE 2RGSA 3NCMA 1HHIB 3DHMA 2IQ9H 1CICD 1S8DB 1T1WA 5DK0B 1G7PB 1VADA 4XCFL 2MNUA 3IXTA 1YEFL 3PIQB 5E5MA 3D3VB 2Z92B 4N1HB 4KMTL 5F6IC 2WWMC 1WBXB 3VXME 4FFZH 1XR8B 5F7LB 1X6NA 3BAEL 2D0GA 1KIQB 4RNRB 4Z5RB 2ZJSH 3IJYA 3UPCA 3FQXB 3GRWH 1SJXA 2V7HA 3SPVA 1G9MH 4F57L 5KN5B 3G5XA 5E2TH 1FL3A 3MLVH 4I3SL 4CDHA 3A67L 5D8JH 4POYA 1S7QA 2VXQL 5F88B 5EZLA 1IARB 3UMTA 5JORB 2ADJB 2QHRL 2K7QA 4MJIA 1QRKA 3DI3B 1RZ8B 1UA6L 5CP3H 5D7IE 3WS3B 1J9CT 1A7OL 5SWZA 1P84J 1KLGA 1MFEH 4H88L 3KXFB 1UB6B 1WTGT 5CHNA 4WNQB 1A2YB 5D72L 5CIPB 4WFFD 3OR7B 1N6UA 4XWGL 1AP2B 1CLZH 1C1EH 3S4SA 4R26L 4PTTB 1IEHA 4L8CB 4K3HA 3Q5TA 4X6DF 2IALA 3QEHA 4MCZA 1HKLH 2PCPB 4LSSL 1JF1A 2DM7A 3LKQA 2QSCH 5DRXA 2OZ4A 1BFOA 1A6UH 3TA3C 3DV4B 4KZDH 1B0GB 3QULB 2VWEC 4HUXB 4Y5XA 4LMQE 3WIHH 1RUMH 1J0IA 1A02N 5TH2B 4TVPD 5DJYA 3MOAL 1G7JB 3SE3C 4Q6IA 4JG0L 2EE2A 2QL1A 3JTSB 1KN2H 3IAPA 3WEXB 5IROC 3SQBA 1KELL 3MV01 3HE7C 2Q8AH 1BX2B 3TIEB 5BXFA 4OM0L 2FR4A 1HDMA 4OCLC 3QRGH 2K1MA 2VO5A 1FAIL 4NQDE 2AAVA 2YD2A 3B8SA 5T1DH 3AB0C 5CUSL 1E4KC 4X5XB 4I48A 3P30H 1HZHL 1T04A 5T5FH 4JN2B 4H0GA 4ZSOB 1NFDA 4LSPL 3WSQL 2RR3A 2MJWA 3FZUD 2VDOH 1I8IA 2E9WA 3CH1A 1I7ZB 5ICXA 3V6ZA 3NABL 5DJXA 3STZA 1AGDB 1CLCA 3TP4A 4L8SC 1S9XB 4HUUB 2P44B 4HUWA 4PRBB 1Z9OA 2CMRL 2NXYC 4PP1D 3RTQD 5D96B 4BKLB 3RQ3A 2WINB 5E8DL 3Q3GB 2NY4B 1YMHA 4K9EH 4NRYA 5T33H 2R0WL 3D39B 1A1OA 1M7IA 1YYML 5IQ7L 4X6DB 3MXVH 3SDDA 4I0PB 3MUJA 1JZ6A 4TSCH 1MHEA 7FABH 2NY5C 1GGBL 3MV11 1K6QH 3GKWL 4HZAA 1KENH 5DD0L 3BP4A 4U1HA 2X4NA 3WS6C 2D7OA 3FQRB 1I9JL 5D7KE 2B2XL 2DYPD 4NZRL 4UNTA 2R0KL 4MQ7B 3D18B 4GRLD 4UNVA 3TBYB 5D9SA 3KPNA 4LVEA 3SCMC 1MI5A 3F7QA 5GZOC 3ARGB 5JXAH 1VPOL 3VJ6A 2Y6SC 3HC0B 1HEZA 4XC1L 5FHBH 3G04B 5KSBB 4MAYC 3IAGC 3CMOH 5ERWA 4JKPL 1LO5B 4I3GA 3CDGB 4ELKA 2FBOJ 4YIQA 5EO9A 5C2UB 1NLBL 1LEKB 3R8QA 1HK6A 3BZFA 2UYLA 4P3CH 1ORSB 3KGRA 4WJ5A 3OKKA 2FBJH 5F7DA 4PY7A 5IK3A 3DETD 3HZKB 1DBAL 1AGBA 4MD0A 5KVFH 3GSXB 5AZEH 1R5VB 3H9SE 1J11A 4NQDA 3MJ9A 1T1XB 2ZNXA 3AS3A 4P4KA 3VDBA 1KFAH 3T4YA 2A9MH 2WUCL 4FMKA 3P9LB 3U4BL 1UQSA 3MJ6A 1ZS8B 2DQFA 4A6YB 4M48L 4PJAB 3HNTL 4M7KH 1K8IA 4OZFH 1BP3B 3VD7A 3V5KA 4KKAD 3INUH 4ODVH 1XGTA 4PLJC 5T3XD 3T77B 5D5MB 3CFDA 2P1YA 1JYVA 2HLFD 1O7VA 5AWNH 3U46A 3I50H 1YPZA 1MREH 4F8QA 3B2VH 4PJDA 3W9DA 3D5OF 5SX5H 4JO2H 5EULV 2IPTL 1X5HA 1I8KB 2AXHA 4Y19E 4GW4A 4F7PA 4XVUC 3UJIH 1SEQL 3VXRB 2GK0A 3ILPA 1MWAH 2EYRB 4EBQH 3QEGH 3I75B 1LE5A 5T3ZE 4HWEL 1F4HA 3JVGC 4NM4H 1U8PB 2XTJD 4X8JA 2BCKB 3QXUA 4G6ML 1DVFA 4G6JL 4IMKC 4UOJA 1L9MA 4G6KH 2BRRH 2W0FA 1OAYL 5ISZB 3GJEA 1DCLA 1P4IH 5ALCL 4Y16C 2DD8H 1WFNA 2CO6B 2IAMA 4EUPA 3PDGA 5EPMA 5HI4C 3PV7A 4FMFA 2UV3A 3S96B 5C8JA 1CDUA 4XPGL 2BERA 3D85B 3CFCL 1LILA 3GHEL 4OIIL 4N8CL 1U8NA 4C55A 5FYLD 2X4RB 1HXMA 3VG9C 5IHBA 5EBWB 4ALAH 4Z78A 4K3GA 4GG6A 2GTWA 3NCCB 1AQKH 2XZAH 1D5BB 2P8PB 4DGYL 4XP6H 5DMKB 2VB5A 5AYQA 4DZ8A 4OLXL 3QZWB 4LLQB 4X7FC 5MENA 4HBCH 1EAPA 4M43L 1FNAA 2F5AL 2FWOA 3UC0H 3OAUL 3BI9X 4CVXB 5ESVB 1KPUB 3JUZA 4U7KA 1PKOA 1E4WL 1EPFA 1AO7D 3K1KC 1FN4B 2OXGA 2IGFL 3OGCB 4GQ9H 5ABDE 5GJTH 4NQCD 3GMRB 3C60B 2ARWA 1XF4A 1IZJA 4P2YA 3BZ4A 4GMTH 4O58H 3UTQA 3BQUB 5E99H 1J10A 4PJEB 5I73B 4FFWC 5IEKB 1PYWA 1AO7B 1KTLA 1X5JA 2NY3D 4NPYB 1FNSH 3RWDA 1R3HB 2ZKHL 3OJ2C 3A0OA 1FFNB 5C9JA 3MBXL 4JQIL 4Y4KD 5MHSD 4ZO7A 4OFPA 3Q1SH 3EYVB 2ZOKA 5D7JB 1MCNA 4DAGH 1Q9KB 4JB9L 1YY8B 5GSVA 1TQBB 2AI0L 4HIEB 3BEVB 4Z95L 1ZTXH 1IM3A 2W59A 1KN4H 5DSCA 4M00A 3G5ZB 1TCRA 3OKEA 2IADB 4Y4KB 3MRRB 1KIUA 4ZFOA 4Z7UE 5JIKA 3MRMA 4W4OC 3BDYH 1XR9B 3C6LA 5JHDD 1PG7W 4PJCB 3H8NA 1ZVSB 3HAEB 2WBJD 2B0SH 3QCUL 4JR9H