1C08B

Crystal structure of hyhel-10 fv-hen lysozyme complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of anti-Hen egg white lysozyme antibody (HyHEL-10) Fv-antigen complex. Local structural changes in the protein antigen and water-mediated interactions of Fv-antigen and light chain-heavy chain interfaces.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10)
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c08B00
1U8LB 3DRTB 3LOWA 4P23B 3T1FA 3ARYA 2EDOA 4OKVA 5JXAH 4KJPD 4NO5A 5CINH 4BA8A 2APVA 4WFHD 2CPCA 2BHYA 3QFJE 3WNNA 3WO4C 5IT2H 3KDMA 1XR8A 3MR9A 2HP4A 3K4ZA 1A14L 4GQ9L 4U7SA 5D93B 2FD6H 4YE4H 5HVHB 1FRGH 3ARRA 4ZPTB 2XPGA 1NBQA 1NGYB 1UEYA 1UQSB 5ID0B 1ADQL 5CBEA 3TNNB 1MRDL 1NMCB 3SN6N 3GJFA 5KS9F 2NYYD 2EXWC 2MWCA 4LQFL 3UJJH 3QPQD 1HEZB 1ZWIA 1KLGA 5I9QC 3RGVB 4Y4KB 4JKLA 4XBGB 3RJDA 1J05A 4JFFE 1WFNA 1TJHL 4HHAA 5FHBH 4HWBA 4YR6A 2O5ZL 3RWHA 3GSVA 3QNXB 1L0QA 3RUGA 3RNKA 5D2LA 4RFEB 3VCLA 2IEPA 3MBXH 3KPQA 2HJFB 5CSBA 2WLZA 4MMZC 4BZ1L 4EI6A 1BBJB 2C3HA 2E6QA 1TCMA 3KDMB 2EECA 4R90H 3BXNA 1IGIL 2FYYB 1S7VB 5CIPA 5CBAA 3PHOB 3P73A 4LSRH 2VQUA 5DRZB 1KJMA 5DD1H 4KK9D 3EJYD 1IAMA 5HHMB 5GSRB 4HWZB 2EE2A 5IBUG 2M26A 2BNRB 4MQTB 2HWZL 2AEWA 1ONQA 4XHJD 1F4WL 1E6OH 3BWAA 4KJQD 4CDGC 2DYPA 3KXFB 1ZVSA 3QEGH 1UM4L 4GAFB 3GO1H 2PKDA 5JW5B 4YZFE 5EOCJ 1FZJA 4LRNH 4MXQD 4HS3B 2YA0A 1N7MH 3RNQA 1BM3H 4NHCL 1NL0L 5SWSA 1YMHA 1MCPL 4FQIH 3CFKB 4DK6A 2OTUB 3EFFA 3RZCA 4CW1A 4NWUH 2DJUA 4XCFH 4NRXB 3SE8H 2VLRA 5LQBH 4LVHC 1HZHL 4LVHB 3PL6A 4OAWA 1VGEH 4X4XA 3SCMD 1PYWA 1RUML 3RVVC 3H9SB 1M7DA 1JP5A 1OAXL 2OI9C 4M7KH 3UJTL 3BDYL 4FFZL 5F7YC 4P5TA 2PN5A 5DS8B 4K94L 2H41A 4ZFOB 2BHZA 4WV1C 4E41E 4IM8A 1WSST 4U1NB 3UAJC 4DFHA 2WBJD 5B21A 1MJ7L 2HJFA 4ZOAA 3UZVB 1J8HE 5HGBA 1NCCL 4NKIH 4IRJC 1J11A 2AAVA 4Q9RH 2XG5A 4KHTL 5KSAA 3RFZC 1LD9A 3KPLA 3DXAB 3ROLA 3B9EA 2IQAB 1U3JA 4KROC 1RJLB 2DOCA 1KELH 1IC7H 2G9HB 2YC1A 1UZ8A 1S7XA 4QHMB 3OKYA 4HK0B 4LASH 3V4VH 2IQ9H 4PJXE 1AKJB 2F53B 1UM6H 5E8EA 3TN0C 4LK4A 4M6NH 4XBPB 5C0NC 1X5XA 1ZT7B 4O02L 1JPTL 5T1KB 3HG1B 4TNWF 1V05A 2HVKA 2EYRB 1KT2B 3FAWA 4KDWA 5D6DA 3ZTJH 1UJ3B 1UA6L 2X6MA 4X6FB 5L8JB 2QADC 2XA8L 4QWWC 3MXVH 3HC4L 3MRDA 2EICA 5D7KE 3UTZB 1H3PH 4NNXB 3NZHL 3F62A 3QEUB 2JELH 4HBCL 2H9GB 3ZDXE 3WS6A 4ONOA 5E0QA 1KPUB 4PB9H 4Z77A 4ZNCD 1LNUB 3RZCB 1CDYA 4DKEH 1X7QB 2GYSA 5KVGH 2IFFH 1P7KB 5I30L 2GSGB 4KRMB 4Z78A 4KAQH 4YUEL 5MI0B 5DVKA 5I71B 3AB0B 2NQCA 1FP5A 4PBWD 1FNGA 3U0TB 5DMKB 4FQLL 5ISZB 3BZEB 2DWEB 4LSUH 1B88A 2OJZH 1HSAB 2GUOA 4EUPB 4NKMA 4FMKA 3BO8B 5I66B 1FGNL 4D9LH 1KLUA 3S35H 2L0DA 1TZHB 2XT1B 3Q0HA 5IEKB 3K1DA 1CFVH 4F7PB 4L3EA 5SWZE 2O61B 3AS0A 2VSCA 1EERB 3KPMA 3S34L 4U3CA 3UDWC 3IRZA 5ACZA 3HCVB 5EG6C 1KENL 1U8HB 2GKIA 2F5AH 3DX9A 4HIEA 4ZFZA 1NMBH 3EDFA 1UXWB 2KKQA 4JFOA 4JO4L 4APQA 3P4OA 1FFNA 4PREB 4MJ6A 1NLBL 1M4KA 4QRQB 2DDQH 1YPZB 2H9GA 4RMUA 1DDHA 4HUXA 4O4YH 2HFEA 5TF0A 5JMRA 1YEKH 4OZFA 4WUKH 1K8DB 9CGTA 1FAKT 3H9HA 3EJZD 3SDAC 1ZA3A 4JFDB 4X4YA 1T22A 5IVNA 5K59F 4R26H 3AMKA 4X0KB 3D25A 1DN0A 4QT5B 4JFHD 2ENYA 5JO5B 3WKMH 4IS6A 1IMHC 1MREH 2O5XL 4NN5B 5AAWA 1Q9OB 3MRJA 1VFUA 3VXRA 4KC3B 1DBMH 3HAEG 1D7FA 1BVLB 2P8PB 2H2SC 1UACL 4LSQL 4HWNA 5GJTH 2PYFB 3FT4A 1SYVA 1ZGLA 2IADB 4QOKB 4NNPH 3GK8H 2XWJA 1N5AB 3LKRA 1CFTB 3MLSH 2OQJB 1T5XA 4YK4B 4Z7NF 4P5MA 5F7WC 4N0YH 3QA3B 1W72B 4PRPB 1BOGA 3I6GB 4CVZA 3PGFH 3RA7L 4ZFOL 5FO9A 3BT2H 1QA9A 3ARDB 5DJAB 4NKIL 3FAXA 3TO4C 5MENA 4WO4D 3QIWC 2R0KH 1PBYA 4I3SL 2YS4A 4Y5YB 1MFDL 2EIZA 5EORL 4X9IA 3MMEA 1HH6B 5IVZB 3RHWF 3NPSC 3T0EC 3IJHA 2A83B 4JM2B 1IGFH 2GFBB 1KNOA 1BZ7B 3ZKMC 3QEQB 4BSWB 3G08A 5DO2D 3TZVA 3DRQB 1NSNH 4K7PX 5D96C 3EGSA 4NKOA 4OI9A 2FEDC 5E6ZA 3CU7A 4ZO9A 1B6UA 4FTVB 1CLZL 3PL6B 1MFNA 4OAWB 1N6VA 1RUKL 2P42B 1A4KA 4V2CB 5FA3A 4EIGB 5T5NF 1P1ZB 4ZUSA 1U8QA 3ZE1E 3ARZA 3O41B 1RV6X 4LF3A 3PWLA 5E2TL 2ERJC 4ZO6A 1TQBC 4JY4A 3G5XB 5DJ0A 1YDPA 1OD7A 3QO1A 4POZC 3Q3GB 5D2LE 5JNYB 2BJMH 5I19H 4AIOA 3L95B 4J3OC 1U6AH 3KVQA 4RFNC 3WLBB 1FAIL 4JRYA 3MOAH 1C8PA 4D8PA 3EHBC 2WP3O 3DV6B 4APQC 4LP4A 4G8GD 4OZFH 4TVSa 2HFFB 2CQVA 1NGWA 3EUUA 5BMFL 4S1QH 3SCMA 3GMNA 5KVFH 2J8UB 4OLWH 3UYRL 3A6CH 2W0PA 3IJYA 4TVPL 3H7BB 1M1SA 2ZZUT 3MV9D 5L8KB 4X7SL 4PJ8B 4JZJA 2V5YA 4G6KL 4HC1A 3O9WB 3AS2A 5F9DC 1FPTH 5J12C 1DFBL 1ITBB 5FKPA 5JW4M 3HFMH 1T5WA 4F7EA 4BSVA 4LSSH 1B6DA 2JIXB 5BOPA 1UG9A 4XNYL 1MCCA 4QXGH 4OUUB 1S9XB 3EFDH 3KYNA 5LBSL 3TWCL 3MODH 3QAZC 1T89A 4X5XB 5GGTA 4CN1A 5ENWA 4RGOH 2G5BB 2AK4B 4M93B 2A74B 4YAQB 5AAMA 3JWNC 4HJ0C 4NQVB 2CDGB 4NN6C 2HT4C 4K7FB 1JMXA 3SDXF 4NO3A 3E2HC 4I5BB 5J12B 5C8JA 5L8LB 3GSQA 3O8XC 2PW2B 3DX7B 3MRMB 3C2AH 3DV4B 5DMGC 3ABZA 5A2IH 3JTTB 1MHHA 4DEPB 2APTA 3P77B 4F15C 1XR9A 3QIUC 4Q2ZB 4WY7L 1ORQA 4Y1AE 1MCOH 2W60A 3QQ4B 1IT9L 4D9QD 5JPMB 1KJVA 3QO1B 3B9AA 5CEZE 1VEMA 4RAUB 5SWZD 4I3SH 5EBLB 1CXFA 3MLYH 5E00B 4PGEB 5HDBF 1MCOL 3HE7B 2QQLL 2C4FT 5INDA 4ZMAT 5IT2L 4FFVC 2EIEA 5H2BB 2PXYB 3DVGA 5CINL 1A3RL 4RAHA 4K3JH 3U9UA 3C5JB 2IG2L 3G9AB 4BFIA 5HVWA 2H32B 1IC1A 3BPLB 5GS0C 2FJHA 3AUVA 2NTSP 4LOUC 3DMMB 5AG8A 2AGJH 3REWA 1MUJA 4PP2A 5A16B 2ZUQB 4O51A 1KIRA 4IMLB 2WBKA 1ACZA 4DW2H 3FTGA 3QA3A 5LXGH 1D5ZA 3IDMA 3O6LH 1HN1A 5CCKL 4TUOB 3QB7C 1N4XL 5IQ7L 5CWSA 3TWCH 3GSQB 4EZMA 3GKWL 3SDAA 1BGXL 3NABH 3TBSB 5C0JB 4LCWA 2RFXA 3MJ9H 4H8WH 3C8KA 5IVXA 1KV3A 4S0SD 2CUMA 5FB8A 3DNKA 4UIMA 5E2UH 1NCNA 2QLVB 5LCVL 4NQDE 3VA6A 4X7FC 4CN6A 4U1MB 1TQCB 2PTVA 2PYEE 1IQWL 4JJ5A 1ZXQA 1LE9A 2E9BA 2WUBL 2AXFB 1ND0A 5F44A 3RIFF 1WCQA 2X40A 4TTDC 3ZTJG 1NGPL 4GSDH 4ETQB 4PD4J 5KANG 4L8BA 4HX1A 3X3FL 3HG1E 1MHCB 4MNHB 1UC6A 1YEGH 3V4UL 5E5MB 3LQAC 2IQAA 4FXKA 1NMBL 4QKXB 1I8IA 5J57B 2DM4A 3BP7A 4NC1E 5J3HD 4XCNA 1XCTB 1JGVL 1G0DA 1TNNA 1OGTB 3K4DA 4X8XA 1OSZB 1FL6B 1Z9SA 2XYCA 5C0BA 4LKCA 3TP4A 4QRRA 4Z6AT 4J8RA 5DMYA 1HE7A 4DUXA 4S1RL 4IIQB 5FYLE 4UOW0 5HHQA 2D7TH 4ZQKB 3FB7B 5ADOL 3CZFB 4XVUD 5I74C 3QRFM 1CGSH 3LPGA 5I1AB 4YDVA 2A9NL 2VMFA 4V1DE 2Z4QB 1H3UA 5MEOB 4OIIH 1U93A 4WW1A 4ONHB 2OL3H 4JFYB 4MVBD 1PG7H 5EUOF 7FABL 1RQ5A 1OAUL 5JOPE 4DGYL 1BVKA 2EZ0C 4XCYB 4G6FD 3D25B 2HTKC 2IGFH 5HSFA 4U2ZA 4OIAA 3BGAA 3FOLB 3SGDH 4P5TD 4XP9L 3VGGA 5ISZE 3S4SG 1DL7L 2JLLA 3UO1L 1J8HB 2BJML 5I19L 5JIPA 4JZJB 1JGDB 5I1HH 2BVOA 4F7MA 2ZP0T 3MGTA 4LCIL 3O6FC 3MRLB 3S3JA 4LCWB 2DM2A 4UT9L 2WIMA 4MS8D 5D72L 1MF2L 4HUNB 1R0AL 4XP4L 3EYOA 1G1YA 1JF1A 1N2RB 2B4CL 3HMWL 3QG6A 5I1LA 4JRYB 3SKOB 1U8NA 2ESVB 4DOHB 5EU3B 2P5ED 1X5AA 4JZOA 3H2WA 4PJ5E 2MHAA 4X6BA 2O61A 3LPWA 3LMJH 4BUGA 1I7ZA 32C2A 4NNPL 4OZGB 1X7QA 1K4CA 2NY5L 4PRHA 4JM2C 3RTQC 4DFIA 4EN3A 4MD5B 4JM2A 3BJ91 1P7QA 2R8SH 4WEUD 2BNQB 4S11A 1AIFB 4PP1C 1I4FB 1IEHA 2EDBA 1U8IB 3PGFL 4J3SA 1I85C 5D2LB 5GS3A 3QQ4A 4PJXF 3EOBB 4D2NA 2IBZY 5E8DH 1T66D 1KULA 5I1AA 4L9LA 1OAZL 3DGGB 1WBZA 2BZDA 4JN2B 4YX2H 1UWXK 2NW2A 5KVDL 3FO0H 2HRPH 5GGVY 4QHNB 5C9JB 3P0VL 5IFJA 5FAAA 1UM5L 4XP9H 3IETB 2JTDA 5JO5A 1DCLA 4D3CL 4JFEA 3P73B 4PRAA 4CJ0A 4ZXBD 4LLWA 5D96B 5FK9A 5AWNL 4DCQA 4R96A 5HYQA 5K9KA 2FZ3A 3DX8B 4OV5B 3HHRB 3HZMB 1JZ8A 3ZL4H 1B2WH 4UT9H 5LJYH 3FRPA 3SBWC 2YD6A 3TO2A 3G5YA 5CUSL 1A6UH 4GT7A 4QOKA 4Y5YC 2HTKD 3NN8B 2IALB 4RZCA 3WFDL 1GC1C 5DD0L 1D9KB 1CDCA 1EO5A 1NEZG 4XI5C 5IGXL 1CQYA 2XQYG 2R56L 4FQQB 3OL2A 2FX9L 1K4DA 3S35L 4NOFA 3U7WL 4W6WB 1XGPB 1U3HB 2VXUH 5FUOL 1JGVH 3PQYB 4IRSB 1UH2A 4KRPD 4K8RD 4UIMB 2OJZL 2WANA 3T3PE 1JI1A 2HH0H 3D39D 5ETUA 1S5IL 2UVFA 4PJGF 2N1KA 2BY2A 4NQDB 5HD8C 5HHOE 5A2KH 3CFBA 1IGMH 4U1SA 4G8GE 5FUOH 4NO0B 2HT2C 2AJVL 4R4BA 2DIJA 1A64A 4PP2B 4L8BB 1UCTA 3CSPA 2ICEB 5E99H 5E9DE 4U49A 4DKEL 3MZGB 4J7RA 5SV3A 2ADGA 1FGNH 3CZJA 3H7LA 1KIQB 1AXIB 2VLJB 4W4OC 1I4FA 2OMNA 2UZYB 3W9EA 2R4SH 2CMRL 2DI8A 1HHIA 1TZIB 4HCRH 3HAEA 5DJCA 5DURB 3TA3C 4NO2B 4Z7VB 3OR6A 3KYOA 4L3CA 4PRPE 2EDJA 5BQ7B 1B4RA 3H3PH 2B4CC 1JK8A 5FKAB 1MRCH 1B0WA 4N0UB 1LO4H 2HAZA 3OXRA 4V2BA 4PLNC 3BN3B 4XNZB 1EZVX 2WM0A 3T0ED 2DI7A 4WTZA 1IBGL 1PEZA 4GS7C 4UB0H 2JELL 4BM7A 1OPGL 1TFHA 2WINA 2AABL 3U4EB 4FZ8L 5H8DA 3WKNA 1ZVHA 3QUKA 1QG3A 3FRUA 3M8OL 3I75B 4HV8B 2FSEB 2IALA 3F58L 4RZCB 1INDH 2HLAB 4WU7B 3GI8H 1QR1A 5HHVH 3MGTB 4X7TB 4CU7A 3DARA 5IM7A 2IH1A 1S7VA 4F8QA 1IC5H 4NN7C 1S7RA 2NLJB 3W0WD 4AT6A 5EU4B 4Z77B 5F7EL 1CXEA 1H8OA 4QEGA 4M61B 3LMJL 1MI5D 1U8PB 4PGDA 5JW4R 3ARXA 4NJ9H 1A3RH 3NCEB 4QOKD 4P46B 4WUUB 3HE6C 5J9PA 5ENWB 4YO0B 4U3XA 1N0XH 2YPKA 2DL9A 2F58H 4TSBL 3RWGB 5LWYL 4XP4H 3DECA 1HQRB 3HKFA 3QHZH 2DQHH 4JQVA 2VDLL 5EU5A 4A2LA 5C8JB 1TXKA 3FT2B 5IIEA 1SY6A 4JFDD 3PGDB 4J1UB 1I9IL 1PKOA 1XIWB 3BDYH 4NQVA 4OCRH 1QFUL 1UJ3C 3AS1A 4NRXA 5EPMB 3SEPA 2FJFA 1TVBA 4GMSH 5F89A 1E4XL 3MV9A 4ZSOB 3VXMD 1N3NB 4HH9A 2NY4B 4NGHH 2KH2B 4E0RB 3HE6B 4KKAC 4RNRA 2FGZA 2C1OA 2A1WH 1M7DB 3WO4B 1DDHB 2ZOKB 1T2QL 1J0YA 3U30C 4RGOL 4FQHB 1RSFA 2JCCA 2YUZA 2VISB 2DJSA 3UYRH 3S88L 1DQDH 5IK3A 4ALAH 1VKXA 1QFOA 2C3VB 3MV01 3O3EB 3MLWH 4S1RH 3GM8A 3G5VA 3QI9C 1LP9A 5DF0A 2I5YH 2VB5A 3QG7H 3N06B 1G7PA 3SDXB 2EIDA 1MEXH 4XP1H 3S36X 1T1YA 3GMMA 7CGTA 2VE6A 2H2PC 5C0EB 2OXHA 3OKMA 2C3XA 3KPSD 4G43A 4X7SH 1C1EL 1FJ1A 4NQED 4H0IA 1XFPA 4M1CD 5DUBB 5DZOA 5TDOB 4GKNB 4M48L 3IJHB 2J6EL 3PXJA 2FJHB 4DTGL 4PV8B 3W11D 5JHDA 3DROA 3SO3B 3LN9A 3NFPA 1SYSA 2FECL 4X99B 2HMIC 1QA9B 3ARDA 5GRVL 4L8SC 5ALCL 3MV9B 5E2UL 5BZWB 5GS2D 4OCRL 2GJZB 2V9QA 3WJJA 1NKOA 2X2YA 4P2QE 3GKWH 5B4MC 3U2SA 1MH5A 3O6FB 2Z35B 5ISZD 2P8LB 1QFWM 3P4MA 4HLZH 1LHZA 1UZ6F 3QEQA 4BSWA 1I1AB 1F97A 1N0XL 5DO2C 5EBMB 2BOBA 1UWEL 5ITBH 3KPPA 3G9VA 1FZMA 1FVDA 1U95B 5AYQA 1FCCA 3TCLB 1QHPA 3RUGB 2A6IB 1UKQA 5HHOD 3WS3A 5C08A 4LHUD 3RWFA 1SBSH 2DQCH 5FOBB 2J4WL 1ADQH 3LQAH 1DTUA 4OF5A 1NLDH 3UTTD 3NGBC 3TBYB 3TGXA 1TVDA 1MFDH 4RGND 5EORH 3MRBB 1KB5L 2A77H 4YE4L 1FCGA 1XF4A 4OCYH 4OUOA 1MCLA 1CGVA 4I0KA 3NVQA 2P5WE 4P4KD 3VFPB 3ECBA 1RUAL 1IZKA 3FRUB 5F71A 2OSLA 4HC1L 1ZA3B 3GHBL 5HJ3B 5ABDE 3RL1A 4X7TA 2AEPH 3CMOL 4CVXA 4ELMB 2QQNL 4LDLB 3RWIA 2GIYA 4M5YL 2FCBA 5HD8D 4WUKL 1NCWL 1G9NH 3IRPX 1YY9C 2CRIA 3H3PL 4Y2DD 3CFDB 4M6OL 1BP3B 1WAAA 3ALPA 2Y72A 1N5YH 3LN5A 3TV3L 2NXYC 1EFQA 2ZG2A 1T20B 5F7NC 4MJID 3WFEL 4KKNA 1INQB 2D03H 3WJLA 4K7PL 5HHNA 4LLVA 5EB9A 5GZOD 5D5MA 4Z5RB 4I9WD 2CLVB 5EU3A 4G8IA 1P2CB 1KNOB 2AJVH 2D7QA 5IESH 5DK0B 2HFGL 1JRHI 2CGRH 1Z9MA 3RU8H 3V5DA 3GMQA 5EZJA 2EIZB 1CF8L 5EO0B 3DX7A 3OKDB 4Y5VA 4XPAH 1UH4A 4K3DH 1RU9L 3GM0A 2CKBH 2XWBB 5C70A 4E0RA 1LDSA 3KPRA 1LEIB 3GIVB 5IB5B 5JA8B 3G08B 1IVLA 5T3ZH 1XCQB 3FT3A 3BGFC 1A21A 2G60L 4LLAA 2VISA 4CUCA 3WS3B 3VD7A 2DMKA 3OPZH 5EU5B 1QFWL 3BYTA 5SX5K 2WNGA 1WIPA 1VDGA 3ARUA 3MRBA 1NUGA 1CFSA 1DN2A 5JMOC 2E7CA 5J13B 5CP3A 1I85A 2X4RA 5CJ8A 4JY5H 5J6GA 4KJYB 2LAGB 1J0KA 3GIZH 1RUKH 1JNNH 4GAGL 5HXMA 3RY5A 5FIEA 2CJUH 4LGSB 3QUYA 3Q6GL 1HINH 4I1NB 4YHIA 2NX5B 2VDQL 4G6FB 4PPTA 4I3GA 1WBZB 3QJHA 1JHKH 2X4PA 5E56A 1T1ZB 2PCPA 3TA3D 5DTFB 1G7IA 5BXFB 1KIUA 4X6EB 1OAKH 2EDHA 2J8UF 5I74B 5D8JL 5GS1A 4OD2A 4CAGA 2XPGB 2W92A 2VITB 1W0WA 4K71B 2ZKHH 1A1NA 1XF5A 5F7LB 5BV7C 2APBA 4QXUL 4ACPA 2WW8A 5H94B 1WBYA 4Z0XA 4LARH 5L0QB 4U1MA 5I17B 4NJ9L 2DN7A 4WUUA 4DN4L 4PJIB 1QBAA 3UBXA 4NKDA 2LQRA 4NIKB 4LIQE 4XH2B 1F3JA 1QSFB 2EDFA 3C6SA 5HI5D 2Q8AL 3BMWA 3CK0H 3TYGH 3B9KB 5GJTL 4XMLL 5HHME 5T1MB 1CYGA 1AO7E 4PREA 5HHVL 5TQ2H 4NO2A 4RBPH 4O58H 3QIBC 5IMKA 3VFOB 1CZ8H 1NEUA 8FABA 1JWUB 4P2OB 4NWUL 4LHJB 4JM4H 4L8DA 1ZS8A 4I18C 4NQDD 1IEAB 4UB0L 3QDHA 2VDKL 4ZUTA 4K94H 1A6AB 3JV6B 3VFGL 5JW3L 3MGOA 3I3DA 5F9AC 2EH7L 2XTJB 2M1KA 5CBAB 2CH8A 1MRCL 5J3HC 3SDXE 4H25B 1X5FA 3V0VA 5INDB 4H0GA 4U6XB 2NNAA 3IU3B 3SE4A 3H0TA 2V7HB 2IGFL 4OZ4B 3FN0H 5E7FA 2YD7A 5TDNA 4QCIB 1PX3A 2FLRT 3W0WA 1HXYB 1V7MH 4UTAH 3W39B 2ORBH 1I8MA 1BVKB 1GGIL 5FGCE 5CFHA 2BMKB 2ZCLH 5F7FA 3PP4L 1A9BB 5E1HB 4G8GA 4JO1L 2NY4C 4GAYA 2YUVA 1H5BC 5I17A 2DB8A 3PIQA 2Y25A 1NC4D 2FL5A 2BRRH 5ACLA 2Q8BL 4LAQL 1YUHA 4MNGA 4R2GB 4R90L 1E4XI 3VWJD 1Q72H 1WZKA 1MCIA 4I4WB 4B0MM 1Q1JL 3DLQR 5MEQA 3PNWB 5DTFA 5BW7C 2V17H 3KPLB 1X5JA 3L3GA 1K6QH 2X44D 3UZQA 3MO1A 3GBML 2ZJSL 1AKJD 1JN6A 2F53D 3VGAB 1KCRH 1TJHH 5FOJA 4U0QB 3VI3F 4BH7B 3BWUC 3LEVH 4I2XB 1ZOXA 1DP0A 4N90D 2IFFL 1AGDB 1MWAB 3BUYB 4UT6H 3QCVL 3VXQA 3QWOB 3RUGE 3ARGB 4LBEA 4OZIF 4OLVH 4JFHE 5IJVA 3MRHB 4ZTPH 4MQ7A 1YPZF 1LK3H 3NZHH 3GI9L 4TN9A 2X4SB 1T21B 5ADPH 3O6FD 1FZMB 4HKJB 3AU1B 5L2JA 2XKNB 3QIUD 1KACB 1CFQB 3VXRE 1GGBL 2R0LH 2YZ8A 3MUZ1 2B1HL 3KG5A 2Q87A 4PJGA 5FA4A 5D1XC 3JVGA 2ED8A 4Z18A 1I1YB 2R1XB 4OF7A 1R5IA 4WI7A 4MCYA 3KYKH 3DI3B 4Z7UF 4EDXB 2B1AL 3KXFA 3GHEH 1HKLH 2XA3A 2DLIA 1YMMA 1T4KA 2NY2B 3HE6D 3PWVA 4XNUH 3BE1L 2WQ8A 4G7VH 3QUYC 1BQHA 3CU1A 4M6MH 4NQUA 1KB5H 3MRLA 1G7HB 3C5SB 4M1DH 5IW3A 1FZJB 3O9WC 2DIAA 5EUOB 2XN9E 5T1LD 2QSVA 1IEBB 1FSKC 2W9DL 1H3VA 4O2FA 5EBWA 3O3DA 1JGUH 1OB1B 2G2RB 4OCSL 4MJ5A 3LKSB 5D1QC 2DIBA 3RBGA 4HUKB 3BRFA 5DJCB 3C09B 1NBVH 3L3KB 4HGWB 1F3DJ 3X3GL 1NFDB 4R0LC 2AJYL 3N50A 1FL5B 3CGTA 1GOFA 3MUGB 3MC0A 3TPKA 2ESVD 2ESVA 1A8JH 1EV2E 3U4BL 4U1IB 2QQKH 2EKSA 2PW2A 5IKCB 4YHLH 2QSQA 3O3AA 1GPOL 5GGQH 4Y5VC 2X4SA 2QQQA 2G5RA 1JZ5A 4U1JA 3TIDA 2E9WA 4ODVH 1T5WB 2F19H 5KTEL 4PJBA 3LKNB 2Z92B 2N56A 3EO1B 5H94A 3JV5A 3OB0K 5C0BE 3AVEA 1I8KB 3K8MA 3EDJA 4AEFA 1T0NA 3IETA 3G6JB 5HVGB 4HSQA 4LSRL 2BXZA 1UZ8B 5BMFH 2ZUVA 1MEXL 4ZTOH 4EN3B 4OLUH 3LKSA 3DX8A 4OV5A 3CDCA 2D0GA 1RZ7H 3L3OB 4QRTA 3ES6A 2HT2D 5F3BB 1OF2A 5HYSB 5CGYD 4U6VL 5KAQG 3MLWL 2EH8H 5KSBE 4KQ4L 3T65B 4K07A 4XWOD 1P9MC 2XG4A 3V8OA 1T04A 1IEAA 4TSAL 3BQUD 1JV5B 2ADJA 1ERNA 2Y9RT 3TH2T 2NY1C 1YYML 1U36A 4MJ5B 2X4OB 5TPWL 1HXMA 3IYLW 4ODXB 3DMMA 1VGKB 1RZIB 1A4JB 2XZCL 4BYHA 3D3VA 3QEQE 4HWEH 2W65A 3EO9L 3OXSB 1UGNA 4MJIB 5D7JC 1QLFA 1RZJL 3DRTA 1Z0MA 3CLFH 5CKGA 3T3ME 1GVIA 5CWSB 4XXDA 3WFCL 3K1KC 3QUXA 2H2SD 3MJGX 3QUZD 1U8QB 4GKSA 3IXTB 5DD5H 1BJ1H 4R8WH 3U0TA 1L9MA 1NGXA 1X5GA 5EC1A 1FV1B 1OTUC 1G7QB 1RFDL 4YHNA 1N5YL 5ESQB 4U33A 2VLRE 4NKDB 4RFEA 3BIKA 3T1WA 4JKWA 1JPFB 5GGSY 5BJTB 3DYMA 1H15B 3S5LB 5J7CC 5T3XD 3MPCA 4BH8A 2ED7A 4GS7B 5DA0B 2X4QB 3VFTB 1HDMB 3PWNA 4XWOC 2NY1D 4UNTA 2QQLH 3D6GA 4AIXA 2HN7A 4KTEH 4IOSD 4PLJC 5IB2B 5L7XL 3J7HA 5DR5L 5CGYC 2Q20A 2M2DA 4P9HH 1T3FA 3EHBD 1AY1H 1EJOH 4HX1B 4MA7H 1KB9J 4Z8FH 2I27N 1J0IA 4P9MH 2Q86A 4OB5L 4ONHA 1II4E 4X0KA 3F7QA 4LNRA 5F7DA 3MJ7A 4RGNE 4G6AD 3NACH 2DQEH 1F45A 1ZVYA 1KTKE 3QXDA 3VXRB 3REVA 4GUPB 4JY6A 1PY4A 5FF6A 1MCFA 3LV3B 4DQOL 2VZ1A 5KSAD 4I5BA 5D1QB 1AI1L 3VI4E 1U8KB 4OCNC 3VFSB 4AK1A 3IDNA 1NGQL 2FHFA 4NZRL 2PXYC 3E0GA 3VFUA 3WIHL 2GJZA 5ANME 5T3ZE 3CXHJ 3BEVB 5J6GB 4BH8B 3GMOB 3SDDB 4XNYH 2HLFC 2DBJA 1NC4B 4UV7H 3SDYH 3V2AR 1I3RA 4NT6B 1CK0H 1CD0A 1HSBB 3V0AC 1R3IH 3ISWA 2WZPD 5FM8A 2EXWD 1NANI 5TE4H 3GBMH 3MCG1 4FQLH 3O9WD 2A6JA 5CMAA 1LO5A 1HHKB 1I7RA 2NX5E 5DA4A 4RAVA 1NCUA 3BP5B 3OHXB 1KCUH 5IV2B 4L8SA 5EU6B 3QUMA 5DQJB 4EXPX 3DRQA 5EH1A 1EA9C 4LCYB 3EGSB 4NKOB 3U4AA 4Y1AD 3OAZH 5IHZB 2QEJA 3OGCB 3P77A 3GSUB 5IK3B 1D5XA 3LDBB 3JV6A 4KTDH 2VOTA 1B2WL 2E27L 4L4VB 1CICB 2Z31B 3NA4A 1MJ8H 4LCUB 1L7TL 4PRIE 5D7KD 1UA6H 1TJGH 5AWNH 2XTJE 5D70L 2RAMA 3HUJB 3X11A 2C9AA 3NCJH 3TT3H 2D0FA 1OTSD 3FN0L 2YN3A 4S1SH 1C12A 5FA3B 5KVDH 2NY2C 5KS9E 4RIRA 2P5EB 1WF5A 4JREC 4GLRI 3QEUA 5DJYA 3PP3H 1F3DH 1XGYH 1RIHL 1FL3A 1HHGA 2AK1H 4O5LH 4JZNB 3GBNH 2QQKL 4YHML 4KKLC 4NFDA 2A6JB 3B3IB 3V7AE 1P7HL 4J23A 4LCWD 5JORB 3HI1B 4PV9B 5J13C 2XN9A 5C09B 3CVHH 4E5XB 1HOCA 3RDTC 2P1YA 4A6YH 3EYUL 3VMOA 3TFKC 2Y1VA 1EZVY 5DJDB 2ERJB 4TOYH 2AQ1A 5IB4B 4TOYL 2EYTB 3RWCB 4XHJC 6CGTA 4GH7B 4M8QB 1WIOA 1LEIA 1ZK9A 4A6YL 3VG0H 3GMLB 2WAHA 1CLYL 4G7VL 4P48A 1DBBL 1VADB 1DR9A 4NPYA 2XZQH 2Z8SA 2DQIH 4F57H 4JPIA 3DGCR 2ZG1A 3BISA 4R7NA 1ZHKA 3L7FA 5BZWA 3KPPB 4FFYH 4X6CF 4HT1L 4FXKB 4PTUA 1MF2H 1EHXA 2IBGA 4NHUA 2Z92A 4FQIL 5T5NG 3EYVA 4LPYA 1FH5H 4LEOB 4PGBA 3P3YA 3L1OH 2NR6D 4Y4FC 4YQXH 5KSBB 1P6FA 4HWBL 1DQQA 2CJUL 2CRYA 4X6DB 4OLYL 5D70H 5CD3B 1ITCA 5I1IH 2DQFB 1PZ5B 4LSPL 4WEBL 5GRYA 2J5LC 3BKCL 1DLFL 4R4ND 3I2CH 5JW5A 4Z7WF 4GRMB 3GSRA 3SE3C 3BRDA 4ZNEE 2H1PL 4WGWB 2X89D 3FTGB 4AIZA 1FDLL 5E1AA 2GAZA 4W6XB 3QZWA 2JB6A 1OB1A 3NPZB 2EDWA 3OF6D 3V5HA 1EGJH 2XIDA 1IGML 5KG9A 4EUPH 4L4VD 2EYSA 4MXWH 1HWHB 3B9VA 4X6FA 5CJQL 3U9UB 2W65B 3HPJA 4JPWH 5HI5C 1OLLA 3VI3E 3DYOA 2V5SA 3ZKXB 1N64L 1NGPH 3FMGH 1EVTC 1EGJL 1ZHLB 3QUXB 2OYPA 4J1UA 1UT9A 1AD0A 3MLXL 4MAUH 3O6MH 2BCKB 5BV7H 5GRJH 3BMVA 1OSPH 3H3BC 4PJFE 1V7NH 4PR5B 5GGTH 4JGJA 4KKBD 4P4KA 1J18A 3HPLA 3QO0A 3AROA 5IJKC 4HXBH 4CVZB 2VDNH 4XAWL 4Q6YA 3ZL4L 4DN3H 4YFLI 5JIHA 1KN4L 5L2KB 2VABB 1AD9B 4P2CG 3WE6A 2EDDA 3PHQB 5DHVB 4PJDF 3MLTB 4OGXH 5CGTA 1CN4A 4Z7VF 4KZDH 3BAEL 3L3DB 4LSVH 4XTRC 2VLJD 5FGCB 5E2WL 3OAUL 5FYLD 4LPXA 3MSPA 2E8ZA 3ARGC 2QSCH 1KJ2B 4Q6IB 5A40E 1K4DB 2IANA 4JFED 5T1KA 1JWSA 3OAYK 3GUTA 3IU4L 5GS1C 3SPVA 3HCVA 3W11C 1ZT7A 5IB1A 1DZBA 3ZZ1A 5I1DA 1P69B 5MI0C 1J1OH 4U1JB 3TIDB 2CUHA 3TNMB 5E94B 2AXGB 1JGLL 1P5UA 1RZKL 5JHLH 3MO1B 2DQIL 4F57L 1CFNA 1IAII 3F7VB 4MMXC 4PJ5A 3T8XB 4I0PA 1G7JB 3C9NB 5I15L 4YXLL 3MV8D 2BNRE 3DX6A 4IDJL 4IIQC 1R24B 3PNWA 2F54B 1Y18B 2VLJA 1QP1A 1GGCH 1QSFD 4PV8A 4QRSA 1PDKA 4YHOL 1AGBB 4H5SB 2UZXB 4WFHE 1MHPH 3SE9H 4XTRD 3MNWB 1JV5A 4M7LL 1RFDH 1C5BH 4C56E 4MAYC 3ARFB 5IEKA 3L5IA 4XPBL 4FNLH 5IOPA 3BO8A 1RIHH 1DLHA 1F42A 4N0UE 5CHNB 2GITA 1FZOB 1YY8B 3D0LB 2JCCF 2H3NB 5HGAB 4HKBB 2CR6A 2R29H 4X4MA 3ZTNL 3ZYJA 1MRFH 2HT4D 4Z7NE 2OR9H 4P2OC 1TJGL 1OTUD 5FECA 4HK0A 3OKEB 5CILH 2HWZH 1S7WA 1VFAB 4CDHA 1FN4A 1KJ2A 4Q6IA 1ETZA 2VDRH 3PL6D 3KPSB 5D93C 4KVCL 2Z91B 1S7UA 4X6DF 1TTGA 5EULV 4EVNA 1W8NA 2B8OT 1Y18A 2CIKA 2YRPA 4Z7OF 3V52H 2R69H 3PF2A 5T3ZD 4QHNA 5C9JA 2QL1A 2Y6SD 2W91A 4M9OA 2W1NA 4U6HB 5D6CA 1MLCB 3SPVB 4K94C 1G6RA 2I24N 4JDTH 3UTQA 4QOKE 5KSUB 3C08H 3ROLB 1KCUL 4G8FA 4L3ED 4YNYA 1MQKL 2D31A 4G80B 5I76B 5FOBA 1WWWX 2DQDH 1DQTA 1U8MA 4XCCH 5JTWA 1AKJA 2F53A 4FN0A 1SYVB 2J2ZA 3MV7B 4UQ3A 5E2TH 4CRPA 4GXVL 2FHCA 1KJ3H 4X6CA 1NAMA 4NDMA 1VERA 1UCBH 4WHCA 4JGUA 3BUTA 4KK6D 4P59H 1BMGA 4LAJH 4DCQB 1J8HD 4NUGL 5ID0A 4I2XA 4P2RD 3UP1A 5T3XE 4RISL 2CKBB 4WWKB 3U0PA 2V2TB 1BGXH 3NABL 4NZRH 1HH9B 5FV2A 4K3HA 5EZJB 2QBWA 2VDLH 3RPIB 5CHNA 5ACMA 2GAZB 1SMAA 1ZANH 3N1GC 1T7XA 1FORH 4KKBC 1U8HA 1BBDH 3SKJL 3PWPB 2AGJL 3EOAA 3ARFA 3HAEB 4PRHE 1DUZA 1IAKA 3HR5B 3RUGF 4MQSB 2IANE 4HKZB 5D2NC 3LHPH 2BXYA 3QXAB 4P57A 3D0LA 4CU8A 1TLKA 2HKFL 5SWZB 3DX9B 4HIEB 4ZFZB 5CGMA 1U41A 1NEZB 3CX5K 4MD0A 5KS9B 1A4KB 3O0RL 2JIXD 1DQJA 3N1QC 1YMMD 5FYJD 1BAFL 2IAMA 3X13B 5CEZD 1X4XA 4N0FB 5BQ7A 5M94B 1U58B 2VKXA 2ADGB 4K55A 1CE6A 3OKKB 4LVOC 2OK0L 3EAKA 4ONFL 4YHYC 5HY9B 4YDVB 5CP7A 3WKML 3UBXI 5IMOA 3FOLA 3LEXA 2DLHA 3QDAA 4PJXA 1CFNB 5DRWA 4ZYKB 4UNUA 3V6ZA 5DFWH 5I8EA 2BNRA 4R26L 1FBIH 5J1TC 1MCNA 2Z0BA 4JB9L 1ULVA 4M5ZL 3T2PA 4LKCB 1IGJA 2HG5B 5DI8B 5GGRY 2PNDA 1GZQA 4YBQC 4WHYG 4H8WC 2FYYA 3INUL 4BQ8A 3SKJH 4MAYB 5IB3A 3FB6B 3B2UC 3X12A 2FWOB 5F7HA 4GW1B 1TJIL 5DHVH 2AJSH 3BZ4B 5A43C 4J6RH 5C6TH 2XQBL 2ITDB 2AK4E 4TQEL 2NR6C 2XKSA 5C0RH 3RZCD 2JIXA 4WIQA 1KENH 1A5FH 1MCRA 1OQXA 4L29A 5KZCD 1AHWB 1IAOB 4P46A 4ETYA 4PRIB 4GG8A 1S9WA 1QLRA 3P9MA 5IBTH 1FL3B 4HCRA 4U6YB 4S2SB 3UC0H 4HF5L 1FFQA 3DXAE 4M48H 5SV4A 5HVHC 2BFVH 3IFLL 4XNZC 1U8PA 3VRIA 3D3VE 1W8OA 4U1NA 3NCFB 5D1XA 1CDHA 4MXWL 4OJFH 4WVRA 2KQNA 1AGCB 4PJ9B 5KSAB 5KW9H 4KMTH 3PABB 1WLHA 3QQ3A 3P30H 2BP3A 4L4JA 3ME0A 3TCLA 3T09A 5HYEA 1K2DA 4LLDA 1H8SA 5EO9A 3MOBL 4YFLF 4PB9L 4NQCB 4W4NA 4L9LB 5CP7B 3MFFA 3ZKQD 3OQ3B 4JO1H 5F9JB 3PP4H 1FC2D 1NCAH 3MLVH 3ULVF 4IRJB 4FTVA 1PJ9A 3QIWD 4QCIA 4GKNA 4J12A 5B4MD 5KVEL 5IMMA 4NQXA 5IFHL 4EQ3A 2AEQH 3MZTA 3HNSL 2X4OA 5CEZL 3E1F1 5MEPA 3KPSE 4FQJH 2W0FA 1X5HA 2IQ9L 4HIHA 3REWB 2NY4D 3SDCA 1ZLWK 1LGVA 5C0CE 1V3KA 3OMZA 1IC7L 4J3TA 1VENA 3EJJX 3KHQA 1U3HC 3VWKA 5C0DA 3ULVL 4YXHH 2A0LD 4WW1B 3DOSA 5DD3H 5B39G 3S3PA 1HXMB 2AJYH 4Q9RL 4HJJL 5GJSH 1L9NA 3SDDA 3FQRB 4UILH 3NH7L 4OKDA 4EI5A 3RWDB 5SX4I 3CK0L 4MZ3A 3TYGL 4DKAA 3RZCC 3MA7A 3CXDL 5F8QC 1TZGL 4JRYD 5CEXB 4HQQH 4NUJA 5KAQF 3V6OE 2KPNA 3VRLF 1LO5B 2BNRD 5FEBA 4MQ7B 1SJHB 4U3HA 3B2UD 2QTEA 3ULUC 4HHAB 5D1XD 1CWVA 1RK0B 1MI5E 2ATPA 1WZ1L 1ZHNB 3KPQB 3QR2A 3S36L 1S3KH 1K2DB 3C09C 5DHVA 1RIUH 2WLYA 3RHWK 1D5MA 4I18A 4FG6D 3U9PH 3PABA 1D6EB 4DVBB 3DURA 2VR9A 2VXQH 1P84K 3P0YL 3WUWG 5LAXA 3FB7A 1K8DA 1BF8A 3PDOA 3FONB 5F1NA 5HHQB 1XAUA 3MQIA 2R0ZL 2A2QT 3FKUS 1CXHA 5AG9A 1JHLL 2MCPH 3VWKB 5JOEA 1A1OA 1CICA 2Q86B 3HMXH 3M17B 5D7SH 4ODSL 1PKQB 4X9HA 2BSRB 2DTSA 2YBRA 5GRWA 3QULB 5GS0D 4M7LT 5FUZH 3MRNB 2FX8H 1ORSB 1H5BA 1Q9OA 1UENA 4OF8A 4R4FL 3LPFA 2F9BT 2E8YA 2HN7B 1YQVL 1PVHA 1E28B 4JRYE 2R0WH 4RIRB 4HUUB 4PP1D 5HHPB 4YBLC 4QRUA 3G6AA 4OLXL 4R4FH 1KIRB 4IMLA 3MRPA 4OFKA 3OJDA 4Y19A 1A6VL 3CSYB 4QHLA 2CDFB 1FC1A 1JF6A 1ZSDA 5IJKA 4OFYA 2BFVL 2ZPKH 4IOIB 5AUMB 3TBSA 1ZMYA 2VSDA 1A7PH 4Z7UE 3S35X 2WWKO 3S9DB 1JIBA 1QSVA 5DJAA 3L3IB 4XPTH 1FVEA 5FYLL 4HJGB 4B53A 4MSWB 5J56B 5FO7A 1EH9A 3GJFH 3RPIA 5DD0H 5A2JH 2FO1A 4OT1L 2BRRL 2OQJA 2VXQL 5EU6A 3BOVA 3BH8A 2C1OB 1S7QB 5CD5D 3WYRA 4MNQD 1AI1H 4LLUB 5C71A 3ZYZA 2B2XL 5I1IL 2Q7YB 2PETA 1Z3GH 4ODSH 5ISZA 3BZEA 3B2VL 4NQCA 3NOIA 1MCEA 3WBDA 1KXQE 1A0QL 1HH6A 5IVZA 5ICZB 1G1CA 3V9FA 3DXAD 3MRCB 4U6YA 4KVNH 1UFUA 2PTTB 1T0NB 1AGEA 3V4VL 2OJEA 3PDOB 1VEPA 5IW1B 5D4QA 1QYGH 4AEHL 4GFTB 2YRLA 1KELL 3KNBB 4HC1H 2R2EB 3MTRA 4MA7L 3LKNA 1EJOL 3A6BL 1CZ8L 5JW4Q 4O58L 3H9SD 4P2OD 2D7MA 5TQ2L 1QPXA 1VESA 3UPAA 4QRRB 2H45A 1QSEE 3QAZB 2Y7QB 4MB4A 1U2HA 1XMWA 1IT9H 4KQ3L 1MJJA 5BVJA 5JLZA 1UWGH 4XVTH 1MOEA 2W59A 1X5KA 3BEWB 1WICA 5MEQB 1AO7A 3G6DH 3PUCA 1HYRC 2FJGA 2AEQL 4HBQA 1NMAL 5BZDB 4HXAH 4LCCB 5CZKA 1WITA 4F7EB 1YEDB 5K9OB 5KN5B 2VLRB 2XN9B 4P5KB 3LAFA 5IW6A 2ILLA 5E24E 1HSAA 2GUOB 3WDIA 4NQEB 3F8UB 1GAFL 4RGMB 1E4KC 4QY8B 4QNPE 2FEDD 3SGEH 1PX4A 4CMMB 3BH8B 2F5BL 2VZVA 1KPRA 5DEGB 1P7QB 3UCRA 4F9PC 1L4IA 1AJ7H 2QHRL 2A9ML 3HZYA 2NX5D 4J4PA 1HDMA 3GDBA 5LGHH 2WWKT 2EEBA 3GGWB 3KPOA 4JFOB 2VDPL 3FFCE 1OTTD 3ARVA 5DGRA 4PRID 1IE5A 5EUKA 5GIRB 4W6YB 4WO4C 2V2TA 4OF6A 3L3JA 5HGHB 4N0FA 2YD5A 4F15B 5TJWK 3DI2B 1QFWH 1C1EH 2X1PA 5EUOE 4OCWH 1U0QA 5GXBB 3BW9A 5E00A 4PJAE 1UXSA 4PGEA 4PLJD 4N0UA 4XNXL 1MFCH 1WFTA 5A3IC 4O2CB 3JV4B 1JZ7A 3GFUA 4YWGH 4UU9B 2YEZA 2R69L 3OKLA 1UJ3A 2H8PB 2XQBH 3QPQC 2CK2A 4RMSA 1NCTA 3FJTA 3VXMB 1YECL 4D9RE 3BGMB 1JFQL 3O45B 4LKXB 1CLOL 4EN3D 5MERA 2IF7A 1K9TA 1KPRB 1N5AA 4OI7A 2YXMA 3AREC 2F54A 1GC1H 3FHAA 3VFWB 1MY5A 4XBEL 5FO8A 1EUUA 3DPBA 2FZ3B 1R5WB 4H26A 1KCLA 5B8CC 5E7BA 2FIRT 2ZNWA 5F7UA 3MFGB 3QHTC 4FNLL 4B7IA 4BQ9A 3U4BH 4I0CC 1EMTL 3VD5A 3NN8A 4K3GA 4WW2C 1LDPH 2AXFA 4ODWB 3PXHA 1HQRA 4NFBA 5HGAA 4D0CA 1WISA 3AREB 4ZUVA 4G3YL 3NACL 1MHCA 4NCC1 5CJXA 3EZ8A 1T0MA 1DLHB 1CL7L 4DGVL 3BD5A 2I25N 3CMOH 3WD5L 3OKEA 4JCMA 2XOTA 3CAFA 4U2YA 5JXAL 4UU9A 4J8RB 3B5HA 1T89C 3AM8A 3LHPL 1IGTB 1LEKB 2WV3A 2E7BA 4JHWL 1WBXB 4N1EA 4JVPA 4G3YH 3BP4B 3MRGA 4FRWA 3GSOA 3NA9L 1FIEA 4PJ7B 2CK0H 1T1WB 1OL0A 3H8NA 3Q48A 1JYNA 4APQD 2HFEB 4LCUA 2DMBA 4EDXA 4F3FA 3HI5H 1P7QD 2WUCL 1PG7X 2FB4H 5ESVB 3FZUD 4QYOB 3KYKL 3MV7E 4H1LG 1YPZE 2R1YB 2VXTH 1B0RA 4G43B 5CLTA 1L6ZA 2BNUB 3QFJA 4XGZB 2YPLB 4U1LB 4WDIB 5KANI 4WWID 3U7YL 4ZXBA 1DE4B 4R8WL 3MUHL 3WCYA 5C7XH 1O0VA 3MCKA 3FQNA 1N2RA 3QG6B 4M1CC 5DZLA 1WAAE 2F5AL 4Z7WA 3WFCH 5BO1H 1HH9A 2Q76A 3EYSH 4LOUD 4ZNEA 3HFML 4WFGE 3MACL 3RDTD 1I1RA 3PP3K 2DMCA 3C6SB 3O6ML 1WWCA 3F7YB 4CMMA 3PWPA 3MBEA 5FHAL 4XPTL 1IZJA 5C07E 4D9LL 4PJ7A 4RQQA 4G6KH 3OZ9H 2IPTL 3O6KL 2X4PB 2VXSH 4DTGH 5IUSA 4PJ9D 1UB5A 2V5MA 3HZYB 5EPMA 4NN6B 2DAVA 3IKCA 1KPVA 3A6CL 3LKRB 4A6YA 4JPWL 4GOSA 3OB8A 4Y16A 1F4XH 1YN7A 3V6FA 3HNVL 4MQXC 3O4LB 3VGDA 1JZ3A 1T0MB 4DEPC 3X14A 4LHUA 3DGGA 3KPSA 3QDMA 5JPNB 5DLML 3L7FB 1F8TH 3BSZL 5TH2B 1PFCA 3PE9A 3RL2A 1A9EA 3KJ4B 4KK5C 5J1AB 2ATKA 1KUMA 1A1OB 2GK0A 1XGRA 5DJXA 3K81A 3BKCH 4O2CA 3WV0A 1DJSA 4O9HL 4M9PA 1BD2E 1GXEA 1S7UB 3RAJH 4GKOA 4HIXH 2VLKE 3OKNB 5KJRH 3KLHC 2MMXA 1WZ1H 1V7ML 5C0GA 4UTAL 1K85A 4JQXA 4OD3H 5B3JE 4DAGL 2XXCB 4NGHL 4GQPH 1KJ2H 3QI9A 1G9MH 2F19L 5D7LB 4ZFFB 1JRHL 1CQKA 1I8MB 5D71H 1FL6A 4YBQD 3NBNA 1AR2A 3L3JB 4FQPA 5I1EH 4PJAF 2V6HA 4CU6A 1F5WA 4P49A 3VWKD 1AGFB 3B8YA 3NH7H 3T2QA 1U8OB 3UTTA 3FRPG 5TF1L 4L8SB 5J6HB 2F8VA 3A6BH 3CH1B 3VG0L 5B22A 4TSCL 5HHNB 3NIGF 2GCYA 1W72H 1M6OB 4RGNC 2DJ4A 2DQJL 2GJJA 4NRZB 1JGUL 4OCSH 5EC2B 1CGWA 1SVCP 3O2WH 1ZHBB 3GSWA 2N7BA 4FFZH 3UJIH 4ZO7A 2VLLB 1IC5L 3WIIH 4N8CL 3VWJC 2GSGA 4YXLH 4W4OA 3UTSA 3GMQB 3AAZB 3IFPA 3CSYA 4QHLB 2BRQA 1CDBA 2B2XH 1YN6B 1MCKA 1UB6B 4G6AC 5CZXC 4LFHG 4FZ8H 3W9DA 4HLZG 2XV6B 4C56D 3RVUD 3IU4H 5FYKH 2AK1L 2AI0L 3I6KA 4P2YA 1BZ9A 1CU4H 4NSKA 5CEZH 2UYLA 3C6LB 1A6WL 4LNVA 1ORQB 3CFCL 4I3RL 4M1GL 2CO7B 1CFQA 4LVEA 4NKQB 1DBJH 3QBTB 3S8WA 3C8HA 5IJVB 4JAMB 2AV7B 2LU7A 2XNAB 4P3CH 2OZ4A 5JUEH 4NNYA 3GMRB 1U95A 5HYJE 2V5TA 3DO3A 1CS6A 2OP4H 4NQSB 4OIIL 2YSSB 5CJQH 1EHLL 3SKNB 1EJ6A 1QHOA 2P8MA 3P4NB 1XR9B 4Q2ZA 2R23A 2G9HA 2YC1B 3E6FB 5CLWA 4KJPC 4P2RE 1OWRM 5EU4A 3OZ9L 5IVXF 2NX5A 4J4PD 1BX2B 2BY0A 4OZFB 3S34H 4POYA 4KROD 1EO7A 1S7TA 1AR1C 2WQRA 4MAUL 2Y7QA 4YHIB 4L4TA 1YA5A 3FO2A 3C8KB 5IVXB 1BREA 1B0GA 5BRZA 3U1SH 5FDYA 5FF6B 4U1KB 4XC3L 4YC2B 3CSBA 2ATPB 5T5FL 3X12B 3OKOB 2DBLH 4ZOEA 5BS0A 5T3XL 1Q0XL 1AC0A 1BFOB 1XR8B 1QRNE 3HI1A 4X8JB 1P2CA 2D7NA 4LNRB 1OD9A 4WTWA 2YPVH 1Z9OA 1J1PH 2GHWB 3OKDA 1OP9A 4BJLA 3MXWL 3H9YA 5F96L 2J3SA 1ZEAH 4JAMA 3RJQB 4EN3C 1A6UL 3VD9A 3BD4A 3WUWB 4PJEB 1FLTX 4FHBD 2Y4SA 4G9FA 3QCUH 4M3KB 1F4YL 3RVUC 4I77L 2NXZD 1T2XA 1EO8H 1I3VA 2XZZA 3QZWB 4TRPH 4KI5F 5C0CD 1V5JA 3F65A 3EJYC 5L2KE 2BK8A 4JFZH 2NY3B 2AKRA 4XNQA 5I8CB 5AZ2L 3UTPD 5L9DH 3IFOB 3I3BA 2F54D 3VWJA 2UZIL 4X6DE 2HYMA 2ICCA 1LK2A 1KJMB 3LY6A 4XVSH 1W72L 5D7LA 2OM5A 4TSCH 4ZSOA 2VLME 4ORGA 1AGCA 4K2UL 4YHZH 1FNSH 1G7PB 3JWDH 1QR4A 3HS0B 5F6IC 2FECI 1F4HA 3DWTA 3ELAT 3UX9B 1S7SA 2EDXA 4XMLH 2DQGH 4XNMA 4KTEL 5EU6D 1E28A 2OL3A 2ICWA 3AXLB 2BX5A 1ZKAA 2C3VA 3A6OA 5F9JA 1XGPA 5FM5M 3TJHD 5DC9B 1Q38A 4QTIH 3WFHA 2NTFB 3LRSB 5IR1B 4WCYH 4X6CB 3OKNA 4PG2C 1D9KD 2ZSWB 2UWEF 1MNUL 5T1LA 3CVHL 1H3XA 1QSED 1W0WB 2Z35A 5CEXA 2OZ4H 3IDUA 3QUYB 5TE7H 1NCAL 5GZOC 2Y06H 1BFTA 4LP5A 4OFDA 1RHHA 1R3HA 3FO9B 3R8BB 5D72H 4O9HH 5F9WB 1JFQH 4EI5B 3BGMA 1KB9K 3TIEA 2R2BA 5DJDA 3GJEA 4NRYA 4JFEE 1NGYA 1AE6H 1GL4B 1V3LA 3PQYD 1QLEL 2K3TA 3S3SA 5C09A 5F70A 3BPCB 3SKMA 2VLMD 1MIEH 4PRNA 4HJ0D 4R2GD 1RULL 3S37L 4OJFL 5GS0L 4Z7UA 1T7WA 4LLUA 3O2VH 1TDQA 1N26A 1A47A 2PO6A 3BZDA 4NUJB 4LFHD 1JK8B 5FKAA 2VXSL 4ELKB 2F54E 2VH5H 5ADOH 4DZBA 5DQDH 2B7DT 1RULH 4C83B 3DHMA 4LVOB 3IAQA 3MREA 4NZUH 3SKUD 2WWMC 1JJUA 4MXVF 1MRFL 3V0VB 2NY6C 1YEFL 4FP8L 3WXVL 1KGCE 5JHDE 2IAND 3GSNL 5I1GL 2LU4A 2Y23A 2Y5TB 4P46C 2NY5C 1NDGA 1XF3B 2FX7L 4OQTL 5CJBA 5ESVA 4AIZB 1RZ8B 2BDNH 2BC4A 1KCSH 4QLRA 2NXZB 2EO9A 4P2RB 1TJIH 4XB7A 4ZFFA 4I2XE 4N0RA 4AY0A 1GAFH 1R24A 1OT1A 2HJLB 1INQA 2E6JA 2HFGH 3R1GH 3B5GA 3OG4B 4PY8J 3FB5B 4LGPB 4F2MB 5IESL 5HI3C 4N9GA 1BZQK 1IQWH 5EUOA 5J89A 3LN5B 5KN5A 4HUUA 5DK3A 5EIQA 4NYLA 4LLVB 3UJJL 1HSBA 1U8OA 4NKMB 1FO0L 4XVJL 4UZGA 4F7TA 5GISL 2HKHH 4IOFC 2LFGA 1KTLA 5FYKU 2YA1A 5DDHA 4WFED 4XZUA 5C0FA 4ZS6D 3RVTC 1P84J 5I15H 1CTOA 4UTBH 4JKKA 3W9EB 1EBAA 1KXVC 1WIUA 43CAB 3QNZB 3KYMA 4YR6B 1MHPL 4YHZL 4M5YH 3TYFB 2EKSB 3GJEB 4OD1H 5L2KA 1TVBB 5ITFA 5ECJE 1EIBA 3DVFA 3D48R 3GMOA 5B8CB 4U4BA 1LEGA 2H2PD 4EOWL 3CPLB 2DD8L 4P9ML 2YD2A 4ODHL 1RUAH 1OW0A 5ICXA 5IBUB 1RVFH 2J7LA 1YPZA 3BPOB 4OGXL 1H3TA 5MERB 5GQBA 3V5KB 1F4YH 1RZKH 2VLJE 3M8OH 3A0OA 2PTTA 2QKIA 3TBWB 5C0AE 1IM9B 1FO0H 4JQXC 4CMHC 2BSSB 4Y89A 4XC1L 2Z8WC 2EIBA 4F37K 5EFIB 2WINB 4JKPH 3MNZB 4LKXA 3KYOB 1P4LB 5EZOL 4HK3J 3QUXC 5C0IA 3BPOC 2NY2D 3KPRD 1RJCA 2C4FU 4O2FB 4RA3A 4ODTH 4UINL 4AG4H 1CIDA 3R1GL 4X4ME 1QKZL 5D7JA 5EN2A 4LCWE 3ARED 1PQZB 1N64H 5KSVB 1RZFH 4ZAKB 1SM3L 5GRUL 2VJXA 3ILQD 5J8OA 3GRWA 1DQMH 3OXSA 1REIA 4LHUG 4TSAH 5E8OB 4DVRH 2DBLL 4NCC2 2CMRH 2YXFA 3EJZC 3V7MA 4OLXH 4H5SA 5ALCH 4E42B 3FOMA 1C16A 4OLUL 2XZCH 1UKTA 3DTXB 2IAMB 2A0LC 1FV1A 2EDNA 2MHAB 3TZVB 4POZD 4PRHB 1YC7A 1I9RH 3TT1L 1F6AB 2DTMH 4XHQA 4Y16D 4R9HA 3CUPA 5EOTB 5K9JH 5BV7B 5J6HA 2P7TA 4UDUB 4ZUTB 3ARDC 3E6HB 3U7WH 1BFSA 3ZTNH 2LTQC 5C2BL 1I3RB 5MENB 3TBVA 3IDIA 3LVEA 3TO4A 3ZE0E 5DRXA 3NGBB 1A6WH 3WEXA 3GSOB 3IS1X 4PRBA 4HLJA 3S88H 2LVEA 4LIQH 3BP4A 4FQHA 4R6UA 3ARBA 4GG6B 3BYYA 1JGEB 1EK3A 3UTSD 2ZCLL 4JN1L 1TITA 4LLYA 3GZKA 2BSSA 2Y06L 5TE7L 3RY6C 3ORJA 5HDLA 5KSAC 3WDHA 1FHGA 4B50A 2FL5B 3K7UA 1QOKA 5HYQB 1EFXD 1MAMH 3MJ7B 5D7IA 3EO0B 5HHOB 3F5WA 3QFJD 3IGAB 3KJ4C 4AEIH 4G8GB 5FCUH 4Z7OE 4I4WA 5C08E 5C9KA 2W9DH 4WI2A 1D9KA 1ED3B 1BD2D 2J8UA 4RBPK 3HG1D 2DLTA 4QWWD 4XNMB 1ZT1B 1K8IB 1YUHB 4A6YB 2Z4QA 1DVFA 5KOMC 4GW1A 4OZ4A 1IAIM 1T22B 2E9IA 3L6FA 4BKLB 1F6AA 3CX2A 3L3GB 3FB6A 4M4RA 2K7PA 3O9WA 5I0DA 3I9GH 5GJSL 1XGQA 4F7TB 1FNSL 3PL6C 4YXKH 5DVMA 2BMKA 5D5MF 3OX8B 1JGLH 5C0ND 3GB7B 5E6IC 3CFJB 3RGVA 4YIQB 1INEL 3SCMB 3SHSA 2UZIH 4M43L 3P11H 1XZ0A 4E41D 1ZA6B 4PRPD 1A6TB 1FNHA 1PG7W 5I1JL 4E42A 4K8RC 4FQCL 5D7LD 2JB6B 4EEEA 4KXZI 3HPLB 3QO0B 3S5LA 1FVEB 3CSGA 3DROB 2F74A 2MSPA 2X4NB 1WT5A 2VNCA 2V7NA 2Z31C 5LQBL 1ES0A 1F11B 5KJRL 1MJ8L 3RAJL 1KB5A 4JN1H 1WCBB 2DLGA 5HDBE 4QTHB 1KG0B 2PW1A 4FQ2H 4LPCA 3FQTB 5D2LF 3GJFK 1RZGB 3U36B 3C6LC 1GIGL 4NZDA 5DQ9B 1JTTA 4Y4HD 4Q9QL 2R1XA 2VDML 1JNNL 4GAGH 3LEVL 5FA4B 4KMTL 1T4KB 4J3UA 5EZLB 2MQ0A 2RBLA 1NUFA 3DV4A 4R7NB 3C5ZB 2OSLB 3AU1A 5T5FH 3CFJA 3ZT6A 4KTDL 2R4SL 5GRVK 3PHQA 1GZPA 2BVUA 4KJQC 2AW2A 3C9NA 3I50L 4G6ML 3RTQD 2QR0B 3LRSA 2EDKA 3V5KA 2ZOLA 2HVJA 1W0VA 1X44A 4ZS7H 4JR9L 3RWEA 3WFBH 1ZT1A 2NW3B 1Z5LB 3WXWH 4ZDHA 1S78C 4HPYL 4J6RL 1FIGL 1KF9B 3V6BR 4B7LA 2O5ZH 3ARWA 4QRPD 3M45A 1XEDA 4Y4KD 5A2LH 3SE3A 3BKML 4QRRE 3R8QA 4LHQB 2BHUA 1XGTB 2V2XA 3HA0A 3LH2H 1I3GH 2WUBH 3IVKA 1KTLB 1FYTE 3KYAA 3H7BA 3H9ZA 5KVGL 5I75B 5SWQA 1KEMH 4ZFGL 4NBXB 4JHAH 3U0WH 4L4VE 5I18H 1UB5B 5IKCA 1EEUA 3W9DB 1RK0A 5K33A 1MFEL 3NFSL 4HKXA 2IFGA 4P5TC 1WZLA 5M7QA 5B38B 3SKNA 5F8RC 6FABH 3U30B 1S9XA 2VN7A 2ZNXA 3LQZA 2EZ0D 2GSIB 5L7XH 1G9NL 1LE9B 1QO3B 2Q3ZA 2I07A 1Z6JT 4YX2L 1NFIB 2AEPL 4HQQL 1I7TB 4EOWH 3CXDH 4WTXA 2IH3B 1HHJA 4K3JL 4IRSC 4OZIE 3MV8B 2W0KA 3O11B 4IOIA 2EE3A 3AY4A 1WQVT 2X1XR 1NCBH 3I9GL 1NGWB 1H5BB 1ACYH 2Y5TA 5J11B 2AXHA 3VW3H 5J1SC 4EKXA 4AJ0A 1JYXA 5D8JH 5E1AB 2NY5H 3GBNL 4OBSA 1JHKL 1QFHA 1U3HD 4RISH 4TTDD 4AMKH 5I1EL 5H37H 3VG9B 5D7JB 5EN2B 2MOVA 4KKCD 3RWJB 5IFHH 3MYJA 3L5HA 4XBEH 5TDPA 4QXTA 4GKSB 1KJ2L 4PBVC 5DUMH 4LLMB 3H6JA 3BDXA 5IB4A 4HIXL 3F7VA 4XXDB 4R7DA 2ADJB 4Y5XC 4M62H 1QBLH 5I1KL 2E7MA 4KI5D 1QO3A 4OGAD 3K2UH 1YNKH 4RFOL 2F74B 4L8CB 3WHE0 4XAKD 4ODXA 5MP6L 3SJVA 2AK4A 4YAQA 3MRHA 3GKZA 1U8JB 4N8VG 4HS6B 3C08L 3QDJE 4D0CB 2C1PA 4KI1A 4GO6B 4JDZB 3VDAA 2GTZB 4HDIB 5F3HA 4GRLC 2VLKD 1E6OL 1VADA 4XX1G 3V52L 3ZE0F 4DGYH 3PJSA 3GB7A 2LAAA 1OAUH 3DHJA 2X1OA 1KLGB 2VH5L 1LEGB 1RJLA 2XRAL 4MYWB 5C09E 3RWCA 2MJWA 5BVJB 5JLZB 3WNKA 2AJZA 1I1AA 1D6EA 1HNGA 4LPVA 3D39B 4AENA 1YYLH 1LO0L 3PGDA 5FHAH 3QQ9C 5AZEL 1HYSC 3ARPA 2AKRB 4GXUM 4OV6F 2YPLE 1QLEH 4LQ1A 1GSMA 3WMSA 1ODAA 1YN6A 3LS5L 3GNMH 3H9SE 3LEXB 2CKBL 4DVRL 5C86A 1RURH 4K3DL 5DMGD 2D03L 3X3FH 1IGCL 1OTSC 2ICWB 4GSDL 1JPGB 1TCRA 1BZ9B 5C0AB 1A1MB 4RDQG 3MRRB 4Z0BH 4M7JH 4RMTA 4TUKH 1HCVA 1MCQA 4MDIA 4LLMA 3BZFB 2J8UE 2AV1B 2J1KA 2DWEA 3RVWC 5IFAL 5FB8B 4P3DA 1NJ9A 5ALBL 4AMKL 1NCDH 4XMKL 1BFVH 1NH6A 2NZIA 3CC5A 1I1CA 3PHSA 2Q76B 3NIDF 2CUIA 1KFAH 1P7KA 2DQGL 1DANT 4N8PA 2RQ8A 3BE1H 1A6TA 5I75C 4UV4H 4FXLA 3DIFB 2O5YL 4PGCA 4ZAKD 3FQWA 3V4PL 4XPGL 3MROB 3MV7D 1EEYA 4GXUN 5H35B 4XVSL 3PWPD 2DLFL 3V7AG 5DRNB 3K4AA 1ZLUH 3GK8L 1KTRL 1QVOB 4Z7UB 4XPGH 4PRNB 2FR4B 1JNLH 1HIML 2HLFD 5DD6B 5GGRA 4LSQH 1AGDA 3RVVD 1R5IB 2W38A 1FO0B 3U83A 4D0BA 4OZIA 5I1DB 1RJZA 5J1AA 1N59A 2CRMA 1BIIB 3MRIB 3WNPA 4ZAKC 4PJGB 5ADPL 3QI9B 1OPGH 2UV3A 3NFNA 5DC4B 1R5WA 2CLZA 2MFNA 4ZUWB 5I18L 5KSUA 3UTQB 3O4LA 4K9EC 4LSTH 3NCBB 4UBDD 3HC0A 1KEML 1RJYB 4D9RD 3CLEL 4JM2F 1VSCA 3E8UH 1U8MB 2YN5A 3TCXA 3FT4B 3LH2L 4FFVD 4JN2A 5E4EC 1SQ2N 1QQDB 1MAKA 1JZ2A 1A7PL 3AREA 2ZJSH 2EC8A 4CL7A 3B3IA 1IGCH 3ET9F 3FQUA 1FYTB 4JFFA 2FSEA 3RIFK 1WUNT 4KDTC 4PLOB 1O7SA 3RWEB 4PLKD 4FA8A 3LKOB 2ARWA 4Y5XB 3GSWB 1MFCL 5D7IB 4H26B 3VRLE 1YZZA 4NZUL 4J2XA 1SJHA 3ILPA 1M6OA 3EYQD 5IM7B 4WNQB 2YR3A 5A3ID 43CAA 2GK2A 4X5WA 4TUOA 1J5OL 1MVUA 3FCTB 3SGKC 2VUYA 2JJUA 3D69A 5C07B 5JXEA 3LKQA 4JCLA 3MYZA 3FQRA 4K23L 4OLYH 1Z2KA 4LF3B 3MOAL 2WIIA 5CSZB 2LTQB 2JCCB 5HDOA 4F7CA 2GQHA 1QFUH 4KKAD 1J8KA 3EYFB 3HRZA 1AJ7L 4NQEE 3TPUB 4ZODA 2EH7H 4XGZA 1F3JB 3R0NA 2DYPD 1DQDL 1HK6A 5E9DD 1DQJB 2VAAB 1YNKL 1IM3B 3ES6B 4OLZL 2FJFB 5L88L 5I2IB 3ULUD 1UYWL 5EZIL 4M7LH 3KLDA 4GMTL 1H9VA 5EFIA 1QSFE 2CXKA 5DJ6B 3WNLA 3T0WA 2ZOKA 3T4YA 4G42B 4ELMA 3N85H 3TO2B 3D9AH 1TQCC 1I9IH 3MJ8B 1OAZH 4L1DA 1JUFA 1WC7A 1GGTA 3PWUA 1K5NA 3P11L 3WN5A 2VDKH 5DGQA 4M1DL 2DQJH 1WEJH 5D7LE 3VFSA 4Y16B 2R0KL 1DBAH 3FO2B 4HIIB 4YHPB 1T1XA 4MA8H 4YGVA 3FN3A 3FFDA 1HILA 4S10A 4ZOCA 1CBVH 1KBGH 3LN4A 5D2NA 2DM7A 3KWWA 4X5XA 1J87A 3VFVA 5E2VL 1WJ3A 1SVZA 2PYEB 4JFXA 2IBBA 1TQBB 3LKOA 4YEEA 4WW2A 2CR3A 1ND0B 1AD0B 4XP5H 2B5IC 1PZUB 4LSVL 1S9WB 2Q7NA 1EVUA 3H3KA 4I13B 5BXFA 1MI5A 1R5VB 2ITCB 4OTXH 5DMIL 3ETBF 1GOGA 4QXUH 4GAJL 5EU7E 3HB3D 1VGEL 5B8CA 1SEQL 3ARGA 1NMCC 4FQXA 4R3SA 3IB4A 3P9LA 4OD3L 4XCEA 5FO8B 3Q2CA 1JTOA 5MEND 4C58B 3WHXB 3QPXL 2N7AA 2GJ6D 5EWIH 3PWNB 4XP6L 2FNBA 1ZAGA 1L7IL 5DS8A 1CE1L 3TN0B 4F9LA 4UI2A 2DF3A 3IFNH 3RP1A 2DKMA 3NIDE 4AH2A 3KS0J 4CADB 2G60H 1UM4H 3BP6B 4QYOA 4B5EA 3ULVE 3L3HA 1SEBB 4HUVA 1AQKL 1OGAB 2H32A 5EOQL 4YHYB 1WV7T 2BNQA 1OT2A 2C4XA 5H2BA 5IMMB 4NRZA 4XC3H 4O2EB 1NAMH 4ORGB 3T8XA 3WDJA 2IPTH 3O6KH 1NDMA 1OP3H 3HZVB 1QNZH 2PO6C 3X13A 2FH6A 2C7UB 5KSBA 3C60B 4YDIH 5FDWB 1EEQA 3VJ6B 4F58L 5CUSH 1C7TA 3NTCH 2RR3A 4K7PH 3ULVD 1YEHH 3WIHH 2CLVA 2BSRA 4QRSB 1RZFL 4RRPG 5GRUH 2ORBL 5F97E 5L0QC 3K8KA 1A22B 5D7IE 1NJ9B 4TVPD 5I30H 1JHLH 5IF0A 1CDJA 4FQXB 1E4KA 3BKJH 5E5MA 4JKPL 1VEOA 5D1XB 1ZLVK 3G04B 1XIWA 5EWIL 1NGZB 2JKXA 3W5MA 4H1LB 3BPCA 4LQFH 3BHBA 2FBJH 3PJSB 4L1HA 4H8WL 3TH4T 4YDKH 3QJFA 3HC4H 3C6LD 3RWHB 4ONFH 2CD0A 4JJHA 5DEFA 1QZ1A 4DGIH 3P9LB 1QSZA 1OW0C 1AY1L 4H20H 4P9HL 2GT9B 3MGAA 3QDJB 4GQ9H 4QRPB 1T83A 4ISVA 1J05B 3V0WL 1B4JL 3ARSA 3FO0L 4KPHH 2UYLB 4WI8A 4TVPE 1CXKA 4ZUUA 4IIQA 1UM6L 4Z7VE 1O7VA 4Z95H 5GGRB 3DO7B 3ESVF 2UWEB 5TDNB 4XMPL 1INEH 2W9EL 3T2NH 4G8FB 2BY1A 1XCQA 3FT3B 1G9NC 3BW9B 4GBXC 3UMTA 3WD5H 3I02A 4OZHF 1OWWA 4WTZG 4U0RC 3MX0A 3QIWB 4QO1A 1J1XL 1LDPL 1G6VK 1MAJA 4MNGB 3MJ9A 5ICZA 1NLDL 2D0HA 5EA0L 3LDBC 1J86A 3VXMA 1BPVA 5MEPB 2AV1A 2LU3A 1TPXB 3HNTH 4F33A 1L0XA 4QRUB 3UJTH 4C55A 3KPNB 4JZNA 5IFAH 5HHPA 5D71L 1AO7D 3LB6D 1Q9WA 4GW4A 5JHDB 1U8LA 2Z8VC 4P23A 2ZCKL 4IRJA 5F93C 3D18B 4DAGH 2B4CH 1JWMB 2VN4A 3CD4A 1TTUA 3BPNB 1C12B 2BVOB 1A2YB 1Y6MR 4HMEA 4AL8H 4MLSA 4OQTA 1LP9F 4MCZA 2J88H 2BNQE 3B6SB 2XN9D 4Q7DA 3LZFH 3MRRA 3H42L 3RNQB 4CNIB 5E03A 2VRAA 3AMLA 1EHAA 3D3VB 1UEMA 3UO1H 5DLMH 4U6VH 4F8TA 1G9EA 4PY7A 3WXVH 3QEGL 3P30L 5FGBA 1XGQB 4MB5A 3T0AA 2HFTA 1MCSA 2X4TB 4ERSH 3CXHK 4EI5D 4JPIB 2MQCA 4P5KA 2BVTA 3NIFE 1B9ZA 3P9WB 2L4OA 3O2VL 4ONGL 2XACC 4ZD3H 3MRFB 1JNHA 1DEEB 4M00A 4AM0A 4F33B 1N8ZB 3RGHA 3QSKB 1U3YA 3HG1A 1KCKA 3WFHB 3QEHB 4RWYL 5IW1A 2R29L 4JFQA 1E4XH 4X6CE 3PV6B 1BECA 5LGHL 4UV7L 3JBG7 4DZ8A 2GTWB 1IC4L 4DKDC 5AD0A 4QRRD 5CJOH 3RKDD 3QZWG 3ULUH 2X9XA 1S7TB 1PLGH 1ZLWH 1I75A 5IROC 3I6LE 5IB2A 5HTSA 4M62L 3C6LA 5I1KH 4G9FE 5LWYH 2OZ4L 3VGEA 4KK8C 1UH3A 5T1DH 4JFEB 3HC3H 4BK4A 3O8XB 2E3VA 3NZ8B 3U82B 1X9QA 2GTZA 4HDIA 2CLZB 1W0VB 4ZUWA 1IAOA 3DV6A 2NTFA 1ZHLA 3GHBH 1RIVL 5TDPB 4XVTL 2P8MB 3KHOA 3P4NA 5KBNC 1YMME 3MLRH 5JR1H 2NY0C 2ZUYA 1GZPB 2R2HB 4MNQA 5AEAA 4DW2L 5FM4A 4U1LA 4WDIA 1J1XH 1DVFD 3CUPB 1CD1A 3NA9H 3ZKNC 2EEAA 2RCSH 4PJEF 2EDRA 1WWAX 2OR7A 5K9QG 1TVHA 4H88H 4Z7VA 3GHEL 2DQUL 4WY7H 1QACA 4MNQE 4N8VB 4KZEH 2FGWL 3SDDC 4N5EC 4XMPH 4Y2OA 4KZEL 4MDJA 1JE6A 3RRQA 3C2AL 4RAVB 1YEIH 2YHGA 4HGMA 4MJ6B 3JSSA 1ZLVH 5FGSA 2WIIB 5CSZA 5E8NA 2B1HH 2ICEA 3WSQH 1NGXB 1GGBH 2R0LL 4OFYD 4MSWA 3WN5C 3RBSA 4D9QE 2FH8A 1DBML 4Y19D 4N0CC 3BIKB 2VZOA 1PLGL 1TPXC 3VXME 5CIPH 1I1YA 3BN9D 3D85A 5MHSD 3EZJB 4PJEA 5IV2A 1I8LA 2IH3A 4BZ2H 4OT1H 3L5XL 3GSXB 1EDQA 4WJ5A 5IQ9A 3HC3L 5D1ZA 2P5EE 3QCVH 3QIBD 4JGMA 4YZFF 3MV7A 5BCAA 4IHOA 2FJGB 4HUWA 1OQOA 1DN0B 1HNFA 1VCAA 4ONGH 1A7NL 5GS1B 2AEIT 2ZPKL 1G7IB 2LE9A 1J9CT 4S1QL 2BVPB 4HCRL 5K9KB 2I9TB 3FN9A 4XVUC 3QUZB 5LVEA 1FE8H 3DSFH 1FFPB 2AQ2A 3OX8A 1FPTL 1UKSA 1CD9B 5IGXH 3GMPA 3WLWC 4GUPA 3FO1B 4XZUB 4JY6B 2YOCA 1S7RB 1K5NB 1UVQB 1FQ9C 2NLJA 4OGYH 5HDQL 5DDHB 5GGVH 1OAQL 2NY6D 3AAZA 1IM9D 4PJFA 1CR9L 2NMSA 4ODWA 3KYMB 4PJBB 4OFIA 5SWSE 5GS0H 2HH0L 4QRPE 4RMQA 1NFDA 4HPOL 5D7SL 1OCWH 1OY3B 1ZHNA 1I8KA 5LGJB 1XGUB 4WUUE 2C1PB 2BSTB 3F12B 4GMSL 4WJ5B 4WI6A 4NM4H 2YWYA 2VC2L 5IQ9B 1QVOA 2MNUA 5GGQL 1IJ9A 1CE1H 4KWUA 5DRNA 3WFDH 1T03L 5TGBB 1EHNA 1PKQE 2IPKA 2C26A 1A6AA 2YD1A 4F7PA 3D85B 5IFJB 3IJSA 4QF1A 1RUQL 4S1DD 4JM4L 2YD8A 3G5XA 3C5ZA 1D5BB 3IDGA 5ILTH 4PJXB 1BZ7A 5DRWB 4ZYKA 3U6RA 2Y36L 2J6EA 4MJ2A 2E5EA 2UUDK 1JPTH 1IGYA 1AHWC 5HGHA 4IMKC 1QSEA 5I16B 4Q58C 3CDGA 3STBA 2H32H 3QYCA 2IAMC 3QFDA 3ULUE 3MRPB 3CCHA 5D1QD 5FYKD 4FMFA 1ADQA 2C3WA 3G6AB 3MREB 4PJCA 1KBGL 4YH6A 3TLRA 2VDOH 2ZKHL 3T65A 1Q9WB 1QLFB 4GW4B 1MREL 2O5XH 1FGVL 3MRNA 4G80A 1IBGH 2BOCB 3ARFC 3T0XA 5IWLA 1EEZA 1Q94B 4C54A 2HT3D 2W0LA 3BKJL 3VXQB 1NUNB 1MAML 4QF1B 2VERN 5BRZB 1SJVA 1G9ML 4LLYB 4QHKJ 1CT8A 4WHTA 3PV7A 1OCWL 5B38A 1KPVB 3P2TA 3G04A 4MX7B 4DGIL 3BP7B 3K74B 4YDJA 4KK5D 3ESUF 3TBYA 1CR9H 4XT1C 1D6VH 5L2JB 2OTPA 2A9NH 3KYNB 3TO4B 5C0BD 4OZIB 5GHWH 3FFCA 5C08D 3D5OF 3HUJE 3RIAK 5TH2A 3RL2B 4P4KC 1CFVL 1ZTXL 3QDJA 4NM4L 4UT6L 3KNBA 3LQMA 4Y16C 4GG6E 1UADC 5KW9L 3DXAA 1NFKA 3O2DA 1BIHA 3W5NA 1S7QA 2XTLA 4C57C 3TT1H 1AIFA 1YQ2A 4NQCD 4JANA 1LK2B 3IFLH 1G7MA 1YEHL 1BJMA 4X9FA 4E41B 1MVFA 1AD9A 4P2QD 1T7YA 1MFAH 3MLUL 4LEXH 5HDQH 4YUEH 4MD0B 3NCYP 5KS9A 1EUTA 2CXGA 1I1AC 1JUFB 2IH1B 3MV11 2X4UA 3SQOH 4Y19E 2BVQA 3RWJA 2EXYC 1RJZB 3L5XH 5C0DB 3IFOA 3VWJB 4ZPTA 4MD4A 2QV2A 5C6TL 3L3KA 4HGWA 4DK3A 2WK2A 3MR9B 4J4PC 3U7YH 2XTJD 2VXVH 2P48B 3WS6C 4GAYB 4WGVB 4ELME 3HMXL 1KPUA 3IDYB 4KFZC 3VGHA 5ELIA 2KZWA 1QSFA 5EZOH 1R3LA 2VXTL 3BP6A 4XCEB 4BZ2L 4LASL 5HGDA 1IKNA 4O51B 3QNYB 2X70A 5IMKB 4HH8A 1H3PL 1E6JH 4M4PA 5CS7A 1T6WA 4WO4B 5CCKH 1ES0B 5EO9B 3VCLB 1H3GA 1U9KA 4KJWD 5C92A 3KS0H 1DBBH 2CK0L 4X80L 3D39A 1RK1A 4QY8A 1BAFH 4GG6F 5HYJB 4R4BB 3UJIL 3HZKB 1D5BA 1SBSL 2DQCL 3O2DL 5C09D 4O00A 4GLRH 1TZGH 4LPWA 4LL9A 4PRAB 1XGRB 1OGTA 4WEMB 2X89A 4H88L 4KJYA 4KV5E 3F7PC 4XCNB 1CXIA 3GSVB 2O5YH 3ZE1F 3L3OA 1HZHH 1A7RH 3QDMB 3PIQB 3OWEA 3T0VA 3HLAA 5IEHB 1FNFA 1OAKL 1PD6A 3ULUL 5DJYB 1CD8A 2HKHL 2P5WA 2VDQH 3B9KD 4QT5A 1NCDL 2AJ3B 4YBLB 3UTPE 3ARBB 3MLPA 3V5HB 4GG6A 2Q3AA 4LRNL 4YFEA 2XWTA 1LO2L 3KWWB 3FB5A 2VC2H 2P47B 3N1FC 1MLCA 5DHXB 3RI5F 3X11B 1GC1L 3J8F7 3VFWA 4YLQT 4MXQC 2BVEA 4MXVE 3ZLQC 3ZDYF 1P4IL 3WL9A 4Z0BL 4XCFL 4E5XA 4X6BB 4JPKL 2F8OA 4PTTA 3RWDA 5DHYB 2Z8RA 1JBJA 3SDCB 1WC7B 2A6KA 3MJ6A 4RWHA 1I3UA 1AC6A 1FG9C 1C7SA 1BM3L 3W0WE 1R3KB 5B38G 3UPCA 2KDGA 4KQ4H 4KK9C 2Z31D 2P46B 1MLBB 2VWEC 3CNKA 4RMRA 5T1MA 4JDTL 3KAAA 3DSFL 4X4XB 3B9KA 4NYLB 2HJKA 1MWAL 4G9FB 8FABB 1F4WH 4LEOA 3WUWA 4PJIA 2XFXA 1F4XL 4OCWL 1NEZA 3AS3A 1K4CB 4DKFL 4G8IB 2XRAH 4C56B 3GRWH 1VFMA 2OS7A 5HBBA 4P23D 4OBRA 4UT7H 4XNQB 2QSTA 4UIKL 5BRZE 3GMLA 3P40A 4KRLB 3V8CA 1CK0L 1IRAY 1JWUA 2FO4B 3O81A 3ZHDA 5EO1B 1MCHA 4OZGE 1URLA 2GEEA 3IDGB 5C0IB 4G7YH 1NBYB 2FEEI 5B3JF 4Y2DB 4OZGF 4LCYA 2CO6B 4HMDA 4MLIA 1CGUA 2APWA 4LMQI 2FBOJ 3UTZA 5DYOB 4PJIE 4L4TB 4Q74A 3K2UL 1Q9LA 3S7GA 2ADFL 4Y4FA 4KRPB 4AL8L 3WIFA 4NWTH 2ZUTA 3HLAB 3WIHA 1KT2A 3QDGE 4LU5H 3REVB 3HE7D 1NCWH 1CDIA 3T4AB 2HRLA 3E2HB 5SWSD 4P5MB 3W2DL 2DQEL 4HS8H 4FQQA 3RIAF 3AXLA 3DUHA 2G75B 1U92B 2AJUH 1M05A 5E5UB 1J7VR 5T1LB 3QUYD 4N9OB 1CG9A 1HEZA 1ZWIB 1WT5C 5DK2B 1JN6B 4Z95L 3STLB 1MRDH 5F7EH 4MHHG 2ZUSA 5D1ZB 4KQ3H 3DBXA 5JIIA 3D87B 3V0WH 3VXTA 4IDJH 3MRFA 1UACH 1R3HB 3FO9A 2DL2A 3G5ZB 3KXFE 5IP4A 3VH8B 1INDL 3U7AA 3NMEA 5JW4N 3O3AB 4CVUA 3T0DA 1BLNB 3BZ4A 2BCKA 4MA3A 3IDXH 5IG7A 2X4TA 3PV6A 2WBJC 4OFVA 4JDZA 4XMKH 1FFNB 5D1ZD 2FLBT 4PY7B 4L29B 1RMFL 2VR4A 1VFAA 4FFWC 4QGYA 4HUXB 1JNHB 4R0LB 4HEPG 1I1FA 5T1DL 3BAEH 3O6FA 3L5WB 5ANMA 3SDCC 4M7JL 1ZGLP 2ARJB 1G7QA 3T4AA 5EBMA 3MOQA 3BZFA 1AFVH 1XH3A 2WBJB 3MUY1 2FBJL 4ODBD 2E7LC 4QXGL 4G7YL 2D4FA 3GNML 1YNTA 1JPST 3CDGB 1ZEAL 4J3WA 4L9DA 5J11C 5JPMA 1ZS8B 1X5YA 3ALXA 4IBLT 4UMGA