1LO2H

Retro-diels-alderase catalytic antibody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFSFRNYGMSWVRQTPEKRLEWVASISYGGLIYYPDSIKGRFTISRDIAQNILYLQMSSLRSEDTAMYHCIRGDSFLVWFTFWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTQVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords If kappa light chain
publication title A structural basis for the activity of retro-Diels-Alder catalytic antibodies: evidence for a catalytic aromatic residue.
pubmed doi rcsb
total genus 41
structure length 220
sequence length 220
chains with identical sequence Y
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo2H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo2H01
4P23D 4PBVC 5B39A 4XP6H 3VH8A 3EZ8A 1R3LA 2IGFL 1F4XH 5GXBB 4R96B 3GJEA 3BKMH 1CU4L 3RVUC 3FT4A 3RVXC 5T5NF 5ILTL 2I26N 3DETC 1F42A 3TVMD 4TUKL 5FYJL 3TYFB 1KCVH 4ODXB 5CJOH 2E7HA 5M95B 4ELME 3PGFH 3H9SB 3VXNA 5F7LB 2HAZA 5KVFH 2X4UA 3R1GL 2AXGB 5CZVL 3K2UH 1CZ8L 5KAQG 4F15C 4J3VA 1QA9B 5HVHC 12E8H 4A2MA 4RBPH 2UYLB 5C09B 1A7QL 1CGWA 2GY7B 4F15B 3KJ6H 4JPWL 1MCJA 4Y4KC 3FQRA 1U8IA 3H42L 2WLYA 4F8TA 3SKJL 1G7MA 2YUWA 5CINH 3F7YB 4LOUD 2F54B 5D4QA 5GZNC 2RFXA 4FTVB 3ZMRA 1JHLH 1PG7L 2BOBB 1BBDL 3CLEH 4ZFZA 2BERA 1DN0A 3IKCA 4WY7L 4P5MA 3WE6B 5IR1A 1I4FA 4QKXB 1I1AC 2DQDL 4JDTH 2MMXA 1BM3H 2NY5L 3MBXL 3MLRH 5LQBL 1EUTA 2EIZA 5HHXH 1IGIH 1OAQL 3C08L 3D69B 4G43B 3GSUB 5ACMA 3I6LD 4PBXA 2JF1A 3LRGA 1MIEH 4MNQE 2PYEE 3P73B 2W0LA 1AJ7H 3BP5A 3BT2L 3FQXA 1EO8L 3HTLX 5CSZB 3QIUB 4F80A 5J13C 1BWWA 3J7HA 4OQTH 3WN5C 1A2YA 2A9MH 3O3DB 3MLSL 3V9FA 4NUJA 4OFPA 3QUZB 2J88H 3TH2T 2G60L 3GUTA 1HHGB 2CXKA 2BOCB 5GGSA 4LASH 5AYUH 5JHDA 1JFQH 3N1QC 1T22B 2VDPL 2XOTA 3C60A 2X4SA 1XF2B 1T0PB 3BQUB 3ILQC 3MRKB 4TQEL 2EDNA 1U9KA 4TSCH 1I9RH 4Y5VA 2C3XA 1JPGB 1JGDB 3HUJE 3PV6A 3EYFA 4Z7VA 1GSMA 3PNWA 5DRZB 3ZTNH 2OYPA 4HJJH 3JV5A 4PJ9C 2V2WA 3HNVL 1JGVL 1MCRA 4LPYA 1J0IA 1EX0A 1UZ6F 4YDVA 5FOBA 3OXSB 1OOAA 2FD6H 2D7OA 3I3DA 1GIGH 1GAFL 4HS8L 1INEH 2PO6B 1XH3B 4R97C 4Q2ZB 3STZB 3HKFA 4WI6A 1KJ2B 1OCWH 3DVIA 5K93A 1BIHA 1NC4B 3OSKA 1JNLH 5DJ0B 5JHDD 3FOMA 5FO7A 7FABH 3QDHA 1R5IA 1IAOA 4CMMA 4XNYL 1A02N 3C60D 4JQIH 3S35H 2I27N 4YLQT 2D03H 5H94B 3U6RA 3FL7A 4PREB 4Y4FA 4LGSB 4OD1H 2NW2B 4KKLD 5KSBE 4BA8A 2DKSA 4J1UB 2NY1B 4WV1C 1NFIA 1V3KA 2PXYC 3L5IA 2NY4D 1PD6A 4GMSH 1ZA3A 1MCQA 1YJDL 4LQFH 3JTSA 4WHDA 2PXYB 3TH3T 1E4WL 3DTXB 2DBLL 4PJGE 5TPWL 1HK6A 5I66A 2XKSA 1CL7L 4TN9A 1X6NA 2CKNA 2ORBH 1OM3L 3QH3A 4F9LC 5EBGA 4OCWH 4Y2DC 1XGQB 3L3DA 3VFSA 5LJYH 1PZ5B 3ESUF 3KPPA 4AT6A 1FGNH 1YC7A 3H0TB 4JO4L 4L3EB 1QSFE 4Y4FD 4NYLB 5C0DB 4JM4H 4G7YH 1G6VK 3CPLA 4WW2A 3ARDA 1DQDH 5I6XB 2FBOJ 4MX7A 1W0WB 1YEFL 3MUY1 4ZPTB 1FYTB 4KK6D 4LKCA 1CBVL 4OCSH 4H25B 1RURL 2A74A 4TSBL 3QJFB 1K3IA 4KJPD 4N0UA 3UAJD 4NCC2 3KG5A 1J87A 1B6DA 5EO0B 3ILPB 3PJSB 4KXZH 2FJGA 4HJ0C 4YHNA 3RZWA 2D9CA 1NEUA 3RQ3A 5C9JA 4WU7B 3D2UA 3DMMC 3EDKA 4D9LH 4F7PA 4P2QD 4MNGA 4NWTH 4Z0BL 1H3UA 1T7VA 3G5VA 3IDUA 1J0YA 3FONB 2AGJH 4RFOH 1DBAH 5J8OA 3LSOA 2EIDA 3QHFL 4WI2A 5C92A 1QBLH 5KVEH 3GNML 5DJDB 1P7QB 1D5BA 1CFTB 1KIRA 1X9QA 5JDSB 2P5WE 1CFVL 4UIKL 2ERJC 3HE7C 4M1GH 1X3DA 3MFFA 3HI1A 3VGEA 2A83B 3PDOB 5D5MF 5JO5B 4F7MA 2PYFB 5JOEA 4IHOA 2W91A 1NGXA 3NBNA 3HE7B 5IJVB 4Y5XB 4YHYC 3MLUH 1U8KB 4UNVA 3GI8H 4L29A 5FYLH 1EGJA 2EO9A 3A6CL 4AIZA 1K5NB 5CILH 3D2UD 2IALB 1F3RB 1HWHB 3V4VH 2Q86A 1S7XB 4NJ9L 1NDGB 2DM2A 5EOQH 3RHWF 2IQAB 5F1NB 2A6DB 4ZFOA 1FSKC 5FEBA 3WDIA 2V9QA 4QHUA 2NR6D 2XN9A 2CUMA 1S7VB 5FKPB 1N8ZB 4RWYL 1W72H 5ESAB 4HAFA 1LVEA 4M7KH 5IM7A 1S7WB 3CC5B 1S78D 2IANB 5IB3B 4R3SA 1AGCB 3ARTA 5DVOA 4M43H 4KDTC 5LXGL 3BPOB 2H2PC 3NIGE 2XQBH 4WGWB 4M5ZH 2R29L 3HPJB 1F4HA 1A0QH 2BVOB 3SE3A 3MRHB 4LVHC 1T1WB 5DTFA 3VJ6A 4XP5H 3KYKH 4O5LH 4FFVD 4ZXBC 5BMFH 2YN5A 4YHLL 4LVHB 3ARXA 5K9JH 5KS9A 1L7TH 5KBNC 2F54E 4MSWA 1ORSB 1KCUL 5JXEC 2YD3A 5BRZA 4ZOBA 4HCRA 4BSJA 3WKNA 4PJAA 4PB0L 2XN9D 2WIIA 3ME0A 3MLVH 3V6OA 4RBPK 1ZGLB 3FHQA 3CD4A 3Q6GH 4XHJC 1MI5B 1Q1JH 3C2AL 4CN6A 4BH7B 3HPLA 3VXTB 3RY6A 1SM3L 4GG6F 4HUXB 1XGYL 4NN5B 4Y4HC 4P46A 1CGSH 2ZPKH 3GSWA 1D9KD 4QRQA 3TO4A 4UOW1 2R0KH 5DMGC 4U1IA 4QRTB 4TPRL 5I16B 3QIWC 2FNBA 5HXMA 4JM2C 4GSDH 2H32H 1II4E 5L6YL 1WLHA 2B4CC 1FZKA 2AK1L 1PKQA 3OKMA 3S4SB 3HNTL 1A6PA 1MLBB 4FG6D 3TT3H 3ROLB 5ECJE 1A7NH 3U7YH 1P2CA 5BRZD 4C54A 4YBQC 4JDZA 4JFHE 5HVGB 3HC3L 1J0KA 1G7HB 3MRBA 2E7CA 3P0VL 1TTUA 3L3IB 1K4CA 2P8LB 2NXYD 5AUMB 4PRNB 4UQ2A 1KB9K 3O9WA 5A3ID 1LO5A 4DOHB 4A6YA 4YHPA 5LWYL 1UACH 4P46D 1LK3H 4QXWA 5CGYD 5HY9A 3S3SA 1T2XA 4KXZI 4PJFE 4PJHF 1JGUL 3TO4D 2VH5L 2DMCA 1CDIA 4HIHA 1W0VA 2ADFH 5C0EB 1KUMA 3M1BB 3I6GB 3BKCH 3RL1B 3QAZB 3QUKA 3WDJA 4F33A 2YR3A 2G9HB 4M6NL 1C1EL 5DRNA 2EDLA 4OFVA 1SY6H 2NNAB 3MGTA 2A77L 2BSTA 4M6AA 1N0LA 3HRZA 2FRGP 2OMBA 4N9GB 2DWEA 5FCUH 5T1KB 3A6BL 4RFEB 3TA3A 5FB8B 3PGCB 4H20H 3RWCB 5MEPB 3O9WD 4M6MH 5DUBB 4BFBD 5JUEH 2DKUA 5E8DL 3VI3E 4DN3L 5D2NC 4GXVH 3DXAB 3U9UA 3CK0L 4PPTA 3NMEA 3TWCH 3VI4F 2XKNA 4P4KA 4NQDE 4NQCB 3NFNA 5GRXG 3DROB 3OAYH 4HGWA 3HS0A 4JE4B 1EERB 1T0MA 4XNUH 4MMXC 3SE8H 5FO9A 1R24B 1CI5A 4XP9L 1RZIA 5EFIB 4LNRB 3TPUA 3IDYC 2YPVH 4UTAL 1PZUB 4I0CC 4UDUA 4PJBA 3UZEA 4HFWA 2IH1B 4YXHL 3IDYB 2DIAA 5FCSH 4KUZH 4JY4A 3MNZB 4ZPVA 5J4MA 3OKKB 4L4TE 3N9GL 3QB7C 3TA3D 1P6FA 4QNPE 3VRLF 3LKPA 4MB4A 1DVFA 2NY6C 3QFJE 3FFCB 2B0SL 1VFBB 4C56B 4L3AA 1VACB 3DVGB 3PHSA 1VCAA 2I9LB 4MD4B 5IP4A 4XVTH 4LHUG 2NXZC 1E28B 5CEZE 1RUKL 3EYVA 2R1YA 5IEHA 5E00B 3U0WH 5CUSH 1EDQA 4FMFA 4HIJB 4P4KD 3VFUB 1F8TL 1JGEB 1OWWA 5GGTH 5HYSG 2FR4B 1J88A 1WVZA 5LGJA 5FA3A 3BWAA 4AL8H 4KI1A 4X7TB 3TBWA 2AV7A 5HYJA 1DL7L 1IZJA 4CVWA 3P4LA 3BAEL 3KPOB 4X8XA 4PJEF 4X7EC 4CKVX 4L8SB 3QP3A 4OI9A 3LV3A 4G8FA 4ZYKB 1CE1L 2OTUA 3S88H 4RGOH 3G04A 4OD2B 4I18C 5DJ6A 4LSRL 1Q94B 2BNRA 4JKLA 3IS0X 1DVFD 1Y0LB 1R3KB 2K1MA 5CWSA 2OQJA 4IOFD 4Z76B 1E6OL 1ZT1A 4I18B 1J0JA 2NY3C 2OCFD 4KGLA 4L3CA 5DRWA 1EBAA 1B4JH 2VDKH 5ANME 5DD1H 3NPSC 3E2HB 1C5BH 4U7KA 2RCSH 2JB5L 2NY3B 1QPPA 3QG6B 2R1XB 1EGJL 2DQCH 5KSUB 4OZFG 1JIBA 1KT2B 3GSXA 3RWFA 2VAJA 2GUOA 3O11A 5HYJD 3G9AB 3GO1H 1S9WB 1SVZA 2EXWD 1J10A 2HTKD 4LCCB 5EU6A 1IL1B 4YC2B 1YNTA 4ZFOL 5C0BB 4OLUL 3WIIH 5HHQA 5IESH 4QY8A 4QXGL 3QUMA 1NFDB 2NW3A 1S9KC 4N5ED 2PTVA 2C1PB 4NHUB 1YY9C 1T6VN 2AERT 3GRWA 3HC4L 1AHWB 1KPVB 1KPRB 4X6CE 2BNRD 4PLJD 1HILB 1IC4L 1U91A 3T08A 5JLZB 1I1CA 5C0JB 5CJQL 2IANE 1RHHA 1DDHB 3GB7B 3T2QA 4UOJA 1CXFA 3PQYB 1TQBC 3K4DA 3GSQB 3QWOB 2X6MA 3T3PF 1CE6B 4JG1H 5GGUB 5GHWL 3NGBC 3ULSB 2R2CA 1A7RL 5HGDB 1FFQA 3IU4L 3BKJL 5T3XD 3SDXB 3E0GA 5EU6D 2VLRB 4DZBA 2I9TA 4HCRL 3QDME 3VXOB 2NY7H 4IM8A 2OP4H 2O5YH 3NTCL 3VFGH 5FUCC 3RUGF 4M3JA 3OPZH 1K6QL 4R96A 4KKCC 5KJRH 2W9DH 1MI5E 1RULH 2BHZA 1N5YL 4ODXA 4S1DC 3NA9H 3MFGB 4NBYB 5IB2B 1RZ7H 3H9SA 4FQ2L 5IVNA 1MJ8L 5E2TH 5K59E 2AXGA 5EA0H 3DRTB 4OZIF 3GSOB 1C12B 1QA9A 1VB9A 2UYLA 4OZHB 5C09A 4DFIA 1JI2A 4WHYH 3UO1L 1MF2L 3CSGA 2DQIL 2ADIB 5KG9B 3MUZ1 2IG2H 3HAEG 2OJEB 3ZKSD 3C5ZC 3O2WH 2FCBA 5E56A 3F7YA 2F54A 3K3QA 4FTVA 1DBJH 4LIQE 3IAPA 3L95B 1RFDL 2BOBA 3VA6A 3QIBC 3WE6A 3DO7B 3MLYL 4PGCB 4PJIE 4A6YL 2VDLL 2D3VA 1JYVA 5ID0B 1NGPH 3ES6B 3RVXD 3D69A 4C58B 3GSUA 1TDQA 3H9SD 3LMJL 4B41A 1NC2B 1T89C 2OK0H 1FNFA 3P73A 4YGVB 1U6AH 1PSKL 3HFML 5CSZA 4NQXB 3QIUA 3MRFB 5C09D 2FX7H 2BNQB 4M7ZB 4FZEL 4UB0L 4H0IA 3W11D 3QUZA 4OF8A 1HHGA 2FLBT 2BOCA 4O4YL 1ZKAA 4UT7L 5FYKH 5K9OB 1ERNA 5T1DL 4X4XB 1T22A 2F54D 4WUKL 1RU9H 4FTVD 4P2OB 5KSAB 1XF2A 1IFHH 3BQUA 3MRKA 1O7SA 1JPGA 1JGDA 2WK2A 4EI6B 5DRZA 1IGCH 5GRVL 2B1AH 5E94B 3LDBC 1FQ9C 4U1GB 3RIFF 4HW6A 4EXPX 3RI5F 3QISA 5HHME 1DQLL 4K3HA 3QPXH 4JVWA 4QRRB 3DXAE 3OXSA 1FO0B 3U4BL 2CDFB 4EXKA 5D2NE 1HWGB 5SWZB 2A1WL 3Q3GA 4EN3C 2PO6A 1XH3A 3QIUD 3B8SA 4Q2ZA 3CVHB 2DS4A 2R1WB 1KJ2A 4JZJB 1J86A 3QUZD 4AYFA 1UKSA 3KPMB 1NC4A 2V2XA 5DJ0A 1A3QA 2VXSH 3SGJC 4WHCA 5DJ2B 5DEGB 1T66D 1T2QH 4BJLA 3BQUD 4NZTL 3CU1A 2KZ1B 4KV5F 4PRDB 1KCSL 1I1FB 5H94A 1FLRL 3G6DH 4PREA 4H8WL 4IRZL 2V5TA 2YA0A 4J1UA 1NANI 2QBWA 1IT9H 3OAYK 3WFBH 2HT3D 1KN2H 1T80A 1OAKL 3RHWK 1V7NL 3PV7A 4F58L 2CKBB 2PXYA 3AM8A 3AS1A 1EIBA 2MOVA 3S9DB 2DQHL 3DTXA 2P49B 1NBVH 5CFHA 3I3EA 1QUNA 2E27L 2J4WL 2PO6D 5E70A 4N8PA 3HG1B 1ED3B 3D39E 4UMGA 3TFKD 4CADB 3A6OA 1NC4D 2R0LH 2YBRB 5D7IB 2B5IB 3VXRB 1PZ5A 2DQGH 3SJVE 4QHMB 3H0TA 1DBBH 1OL0A 2WBWB 2VKXA 1H5BB 5B3JF 4XXDB 2BNUB 4L3EA 3U0TB 5MP6L 4NYLA 5C0DA 3AS0A 5D7JC 2RR3A 4U2YA 4MJ4A 4HJGB 1KB5B 2NY1D 3RX8A 4ENEC 3KLHD 5JA9A 4BELD 4O58H 4LVNC 1W0WA 2AXHA 1WBXB 4ZPTA 5DT1H 4MA8H 1FYTA 2PXYD 4K7PL 4H25A 4NZUH 5DRXB 3G6JF 3SE4C 1SEQL 3QJFA 3ZE0F 1U3JA 1I1YB 2KL6A 4M7JH 1EUUA 4X99B 3FB6B 3F62A 4YUEL 5EO0A 5L2KB 3ILPA 1EEYB 3QUML 2VWEC 4BH8B 4JRYB 4DN4H 1H9VA 2A73B 4XCCL 4MJIE 4Z77B 4WU7A 4IMKA 5HHVH 3GRWL 4QEGA 2ZG3A 4UTBH 3U4AA 3FONA 4L3ED 3K2MC 2QL1A 5EB9A 1BF2A 2X4PB 3L1OL 3B43A 4NP4H 4FQCH 1MHCB 1SJEB 4KVNL 5DJDA 3QRGH 1FL5B 2VR5A 1I8LA 1P7QA 4PJ8B 1CFTA 1RZJL 2FB4L 1EK3A 1FYTD 3BPNB 5FKAB 1BGXL 4IIQB 3QDJB 1PQZB 2A83A 3PDOA 5JO5A 2PYFA 3ULUD 1RJYB 3HE7A 1WK0A 4S1RH 4Y5XA 1AI1L 5I2IB 3LEXB 3SDXE 1U8KA 5BS0B 4QWWC 4R0LB 5T5FL 5TE7L 1K5NA 1YA5A 2IALA 3VG9C 4MMZC 1JCKA 5L9DL 2Z8WC 3FQTB 1S7XA 2B1HH 1NDGA 2YC1B 2IQAA 5F1NA 1FNGB 2A6DA 4WWKC 3D0LB 1UEMA 2W59A 3VG9B 3DYPA 2VDNH 4Y19A 2D7TL 1S7VA 5FKPA 1N8ZA 2DL9A 4QOKB 5FUCE 1P7QD 3QULB 4J3OC 5ESAA 3EJZC 1JVKA 1UJ3B 3CDGB 5C0RH 2A2QT 1T83A 1S7WA 4S1SH 2BVYA 3CC5A 3MRIA 1CGYA 4NZJA 4TYUA 1A7PL 1U93B 5IB3A 2WBKA 1AGCA 3ESVF 2EH7H 3LB6D 4O00A 1XF1A 5EU4B 3HE7D 4P3CH 3CVIL 1ZLUH 2BVOA 3ARYA 2AI0H 3ZKXC 1WT5C 3JV6B 4KZEL 3H7BB 4JY6B 4KTEL 4OZHE 3MRHA 1T1WA 4FZ8L 2AAVA 2IFGA 1MLCB 4ELKB 3ZKXB 4J4PC 2FEEL 1ZVSA 2NYYD 4LLMB 5EUOB 4ONFL 4OZGB 4KAQL 3D6GA 1QR1B 3DUHA 1OT2A 1ORSA 3BMWA 3GI9H 1RZFH 2O61B 1XF5A 4LDEB 1UC6A 2BP3A 5E4EC 1FAIL 4JRXE 5E2UL 4PGJA 2Z0BA 1ZGLA 4EVNB 4JHAL 3S37X 1V7ML 1MI5A 4JGMA 4MHHI 4BH7A 2IAND 4YHIB 3VXTA 3UTQB 4HUXA 4ODUB 4KROC 1IAIM 3IXTB 4Z8FL 3LS4H 4KZDL 3M8OH 4OI7A 3NFPB 3HHRB 1JPTH 1J9CT 1MFNA 1YEHL 5JQHC 4FQLL 4QRTA 1T0NB 5I16A 4BZ2L 3UX9B 5JW5B 3BPLB 1OQXA 3ZZ1A 4JCLA 5GRJH 1YEKH 3C6LA 4X9IA 5I15L 1MLBA 3ROLA 3R8BB 4Z78B 3O6MH 1KIQB 1MFEL 3QEGL 2YPKB 4OFIA 2UVFA 3OG6B 1NCBL 1G7HA 3BZ4B 4KK8D 3V7MA 2D7QA 4BZYA 1A4KB 3DECA 1D6VL 3L3IA 4XX1G 1MI5D 5AUMA 5TH2A 4PRNA 2WWMC 2R15A 4P2RB 1A6WL 2ADJB 4WHYG 2J3SA 4PGBB 4OBRA 1JYNA 5ESQB 3CX2A 1INDL 4NRXB 5BXFB 1KJ2L 2FECL 1HOCB 3V4PL 4LVOC 2E8YA 3KXFE 5JOPD 1F90L 3LQAC 4OCYL 3UPRB 2ZCLL 3TJEH 3E8UH 5C0EA 3M1BA 4LVOB 1WGOA 3I6GA 1B4RA 1IGMH 3RL1A 3TGXA 3MR9B 3NZ8B 2G9HA 4XCNB 1GZPB 2AJVL 4ZD3L 5AAWA 3E3QC 1LMKA 2DDQH 4LSDA 3PWNB 4LU5L 5CJXC 5KOMC 5IMMB 2HTLD 1SYSB 4R2GC 1ZT7B 3BP6B 4N9GA 15C8H 1NUNB 3VFVA 2MKWA 5T1KA 4XVJL 2ZUXA 4RFEA 3FCTB 5DFWH 1C16B 1KBGL 3KJ4C 3PGCA 3RWCA 5MEPA 3SKMB 3B2UD 5DUBA 4ODSL 2HJKB 1D5IH 3K4ZA 5EC2B 1I8IB 2J8UB 3DXAA 4WI9A 1MAKA 4H0HB 5E99H 3HG1E 3QUYC 4H1LA 1CFQB 5IOPB 2VSCA 4PJCF 3FTGA 4NQCA 1MIMH 2D31B 1NLDL 3DROA 4G6AD 2R0ZH 2KBGA 1KV3A 2XZAH 1R24A 2Y36L 1K9TA 2VZTA 4XBGB 3CSBA 3MROB 5EFIA 4LNRA 4RIRB 4JHWL 4FQXC 1XF4B 1BP3B 3X3GH 2IH1A 5B4MD 5D9SB 1FE8H 4RAUB 3ARSA 3MNZA 3OKKA 1UWEH 5T1KD 5HYSB 3OHXB 2X05A 2VL4A 2R2EB 3FFCA 3L3GB 4C56A 1VACA 5DK3A 3DVGA 5CBEB 1IC5L 3IFPB 2I9LA 3T2OA 4MD4A 5CEZL 3ULUL 3BEWB 3EO1B 2F53B 4PRPE 4MAYC 4ODTL 3DXAD 4L4VB 1E28A 5J1TC 5MI0B 5DJZA 1AGFB 3QA3B 5E00A 4RRPA 2YSSB 3RDTB 5D1ZC 4DVRL 1X5KA 2DICA 4HIJA 3VFUA 4NQCD 1JGEA 5L2KE 4NWUH 3WXWL 4V2CB 4ZS6D 3CJJA 4X7TA 5IBLD 2ICES 4OLWL 5IB5B 2VWEE 2E9BA 5I8CB 3MV8B 1E4KA 3PG2A 4L8SA 3GGWB 5HYIA 4ZYKA 1WBZB 1UQSA 1XIWC 6FABH 1HNFA 4OD2A 2GK0B 1Q94A 2H8PB 1Y0LA 3FFCD 1R3KA 1RIVL 5L7XL 4C56D 5C08E 4Z76A 1NCDL 1YEIH 2YN3A 3ARGB 4I18A 3WS3B 3DBXB 4OJFH 4X7DC 2APFA 3WIFB 4PLKC 4GQPH 1D5XB 1JGLL 5F9AC 1JZ6A 3QG6A 2R1XA 3RA7H 5KSUA 4HXBH 5J1AB 2JELL 5DS8B 2CRIA 3EYQD 2P5EE 4ISVB 3AS3A 1TVBB 1C5DB 3SGDH 2DL2A 3GHBH 4LL9A 3BRGC 4LCCA 1F45A 1IL1A 2YD5A 2M2DA 5C0BA 3U36B 3IVKB 3ARBC 1NFDA 1CGTA 4C4KO 2C1PA 3ZL4H 3GIVB 3JTTB 1AHWA 3DSFL 2X44D 3S36X 1KPRA 5C3LD 3C6SB 3MJ9A 3KYMB 3TT1L 5JLZA 4WUUA 5C0JA 5TQ2H 3D3VE 1L7IL 2QQLH 1DDHA 3GB7A 2IPKB 4GT7A 2NY3D 3PQYA 4PP1D 2DQFB 3MA9H 3GSQA 3B3IB 3QWOA 4GAJL 5L88L 1CE6A 2E6JA 2E6PA 5GGUA 3TP4A 3RIFK 2EDBA 3ULSA 3RI5K 5HGDA 1ZVYA 3BP4B 2HT4C 3MLZL 5EULV 5EUOE 2VLRA 4C83B 5C0BD 1NCCL 3GFUA 4NN6C 3UZVB 2VSDA 3TYGH 4U6VH 1FIGH 1J7VR 1NH6A 3WLBB 1CD9B 2PKDA 4NN6B 3RZCC 1ZLUK 5GJSH 1KEGH 2WIMA 3FN3A 4H88L 3SQOL 2QV2A 4WUUD 1P7HL 3MRPB 3HAEB 1W72B 5FUOL 1T7ZA 3TM6A 3EO9L 1DBKL 4FFYH 1ZHBB 2RIKA 5IB2A 3PQYD 1MCDA 5GRYA 3WXVL 1J5OH 2WWKT 3DRTA 3MV7A 4KH2A 4LFHD 3GSOA 4NT6B 1C12A 3OKNA 1C08B 5DF0A 4LLUB 4HWBH 3BVNB 5DLMH 4YPGB 2D9QB 2DQJH 2ADIA 2B4CL 2VLRD 5KG9A 1R5WB 4WTXA 2OJEA 2XWJB 2H2SC 3MRMB 4LIQL 4PYGA 5LBSH 2GKIA 1CD8A 3L95A 3IYLW 3BKYH 1A64A 5ISZB 3LVEA 3DO7A 3GKWH 3KWWB 3DV4B 4U1HB 3S6CA 5ID0A 1UA6L 4Y5YC 3ES6A 3MV11 1F58L 3O81A 1NC2A 3WLWC 2NZ9C 3MREB 4Y5YB 1HIML 3UBXG 5MENE 4YGVA 3VGGA 4NQXA 3MRFA 3QUXB 3UJJH 2BNQA 1OP5H 5DC9B 2ATKB 4LAQL 3BN9D 2QQNL 4ZS7H 4HWZB 2E9IA 3FHAA 5K9OA 4X4XA 2IFFH 4P2OA 5KSAA 3D9AH 4L9LC 3MLTB 3O6FC 3E3QE 2C7UB 2W9EH 3UDWC 2GW5A 1MJ7L 3WNNA 3LZFL 4YPJA 1Q8MA 4PV8B 5E94A 3F12B 3LEYL 4Q9BA 5F6IC 5I1CL 3VG0L 4ZTPH 4QRRA 3MODH 1NC2D 3X12B 3GM0A 4FP8H 5GS0H 1OTUC 2CDFA 1T03H 3SGDI 1RZKC 5CMAB 5SWZA 3RNQB 4DUXA 3PP4L 3UJIL 1FDLH 3MRCB 2Q7YB 3ZE2F 4R4ND 1U2HA 2BNQD 3CVHA 2R1WA 4XPAH 4JZJA 4LCWE 2DLTA 1OD7A 5A2FA 3KPMA 1R0AH 1QTYT 3BYYA 3T0BA 4WCYH 5LKNA 5DJ2A 5FK9B 5DEGA 5T3ZE 1U3HA 4P2OD 5KSAD 2CPCA 2O5XL 5TE4L 1A6ZB 1MEXL 1JZ5A 4PRDA 1Q0XH 1I1FA 1S9VB 1VPOL 5EZOH 1U41A 3NZHL 4FQIL 4G6JH 1XCQB 4Y89A 5IUSA 1JHTB 2F53E 1JPFB 4YDLC 3UPAA 4QRRD 1SJVA 2ITDB 2CKBA 5D5MB 4MXWL 3TZVB 5JW4N 3S3PA 3O3EB 2AXJA 2OS7A 1MSPA 1VESA 5SWZD 5JDJA 1I85A 3QWRA 4TSAL 4BZ1H 1ED3A 2CIKB 1UM6L 4CADA 3ZDXF 2YBRA 5D7IA 1SBSH 4HIXL 4JZOB 3VXRA 5J7CC 3OKOB 3QSKB 2E8ZA 2Y4SA 4ZFGH 4QHMA 4OI8A 2P44B 1H5BA 1M05B 5TJWK 1QSVA 1TQCB 4LLQA 4XXDA 4PJCE 4XWGL 2BNUA 2ARJB 3X13B 1PFCA 4JPKH 5DD3L 1A6UH 3U0TA 2HA1A 2X4QB 2XTJB 3TV3L 2DB8A 4HJGA 1KB5A 1FRGL 1FNAA 3A0OA 2ZG2A 2Y06L 2IJ0C 2OZ4A 1J1PH 2WLZA 2DQUH 5DRXA 3AS2A 3WUWG 2WP3T 1I1YA 4I48B 3WNMA 4YXKL 1J8KA 3B9KC 1EEYA 4BFEA 4J6RH 1KJVB 3VXRD 3B9EA 4BH8A 3K81A 4JRYA 2A73A 3PDGA 2FEDD 5B8CC 1EEZB 1XF3B 2OJZH 4PUBH 2F58H 5IVXE 4TRPL 2ZJSL 1B2WH 4R9HA 2AEQL 3QDAA 3NCYS 4X6DF 5FA4B 5EBMB 2H45A 2XACC 2X4PA 3T0EC 4LF3B 2DAVA 2FIKB 2JJUA 4K3JH 1MHCA 2VIRB 1SJEA 1T7XA 4W6YB 1FL5A 2XA8H 5I76B 1NCWH 1QRKA 4PJ8A 1VKXB 4AQ1B 4KJYB 4R6UA 4XMKL 4GG6B 5FKAA 3WFHB 1QNZH 3V4UL 3WD5H 4IIQA 2EDEA 1PQZA 2OSLB 1P5UA 3QDJA 5E95B 1OARH 2VXTH 3MV9B 2WBJC 1RJYA 1G7JB 5DFTA 3DIFB 4N0CD 3ZKMC 1E4XL 1ZLSL 3LEXA 3WJJC 5I2IA 5D6CB 3VH8G 2DRUA 4MS8C 1YPZE 1JK8B 1HHIB 2IMNA 1XAUA 4ODWA 5BS0A 5L2KD 3BOVA 4R0LA 4JRYD 1Q0YH 2P45B 2PR4L 5HVWA 4P3WA 5M7QA 3MXWL 4JFDB 3X3FH 3PWVB 4BYHA 3FQTA 4XXCC 2BMKB 1CD1B 2YC1A 1FNGA 4LRNH 3D0LA 5C2UB 2XFXB 3BIKB 3DO3A 2DKMA 4QHNB 5E6ZA 3BRFA 4HF5H 3DYOA 4QOKA 2EDYA 1FNEA 5J1SC 2X1WL 4ZNCD 1UJ3A 3CDGA 4PJ8D 1LP9F 5GS1C 1WCBA 3MYZA 3MLWH 4DKAA 1U93A 3F7PC 1VDGA 3GMLB 3QDJD 1EJOH 4N0YH 1BQLL 3BGMB 1KJ3L 4LPUA 4PJHB 2GIYA 3WIHH 3T4AA 3MJ6A 5EU4A 3RL2B 3R06B 5AWNH 1YNKL 3OL2A 1X5IA 3JV6A 1G9NC 3H7BA 4EBQL 5E08L 3EO0B 5BS0D 1TCRB 1MLCA 4ELKA 4TOYL 1Z3GH 4W68A 2KH2B 3GHEH 3NIDF 1NAMH 4LLMA 4I2XB 5EUOA 4QWWD 2J5LB 4Z7OE 4OZGA 5KVDL 1TITA 3V6FB 1QR1A 4RISL 2CGRL 2FJHB 2O61A 3WNOA 4LLYB 1WWCA 4I77H 2DYPB 5ISZE 3LKSB 4QOKD 4EVNA 1KEMH 3OR7B 3WFCL 4EOWL 1PW3A 4NIKB 4YHIA 3UTQA 4ODUA 2BJMH 1XGPB 3JV4B 4KHTH 4JFEB 3IXTA 1MY5A 3OB8A 1BIIB 1FCGA 1N2RB 1NMBH 1P5VA 3NFPA 2WQ8A 5EH1A 3VFNA 5DD0H 2WM0A 1ADQL 2I25N 1T0NA 4Z7QE 5JW5A 3QO1B 1ZHKB 1HCFX 4ZUVB 4HS3B 4JY5L 1C5CL 2FH6A 5FGSA 1IGTB 5F3BB 2YPKA 2R69L 3MNWB 3BZ4A 1DSFH 3TBVB 1EVUA 5D72L 3J8F7 1FNSH 2UZIH 1A4KA 3EGSA 4OCRH 4F57H 1JZ2A 3UYOD 1OP5K 4R4FH 1FO0L 4P2RA 1V3MA 1I9IL 3GMPA 2ED8A 4DGVL 3INUH 4PGBA 1VHPA 3LN4B 4JEGB 5ESQA 1JZ7A 5FUZL 4NRXA 5D7KE 5BXFA 3CVHL 1WFNA 4HUWB 5DD5H 3ARWA 4GRWF 5KTEL 1HOCA 5GGRB 2GSIB 5I1AB 1FC2D 3Q48A 2YD4A 3A67H 2HN7B 2GTZB 3UPRA 1H3PH 2CJUH 1MCPL 1V8HA 5DO2D 4K3DL 1GGCL 4PJEB 2BXYA 4OQTA 1G6RH 3MR9A 3NZ8A 2VC2L 3NCJL 5DHVH 4ZUUB 4XCNA 3LRHA 1YMMB 1GZPA 4QHLA 5JW3H 3C09B 2C1OB 2AEPL 3ARPA 2G2RB 5IMMA 4M02A 1SYSA 4UBDC 1N59B 1ZT7A 1I7RB 3P40A 5KVGH 5DUML 2IQ9H 2GJ6B 1Z0MA 5ICZB 3TCXA 1X5XA 3FCTA 1C16A 5FDWB 3AMKA 4OCXL 4P2RD 4DFHA 3SKMA 1CDUA 5LGHH 1BZ7B 2HJKA 4G9FE 4JO1H 4MCYB 1ZV5A 2CK0H 5EC2A 2J8UA 5GS2H 3UMTA 1R3JB 4CUCA 4PRIE 1HSAB 1CLZL 1XMWA 5CJBA 5IOPA 5E2JA 2C4FT 1BPVA 2D31A 2D7NA 3KYOB 5I1EH 1N64L 1N0XH 3I50H 4LPXA 3CFBB 4GS7C 4POZD 4WWID 1PAMA 4HT1L 5MERB 4XBGA 1OD9A 2EKSB 3MROA 1CG9B 3WFEH 4GS7B 3WV0A 5ETUB 4PJXE 1XF4A 5DMIL 2XPGA 3L5XH 1J12A 1KB5L 1OWRM 4WW1B 1YNLH 4PRHE 5D9SA 4RAUA 1P9MC 1SJXA 5HYSA 4Z18A 1RK0B 2OZ4L 5ELIA 1RUML 5HI3D 2R2EA 1N7MH 3L3GA 1LO3H 1IQWH 1U8PB 3ZDZE 1DQTA 2D0GA 3IFPA 2Q8BL 3BEWA 4M1DH 4YDIH 2F53A 4WHTA 3H3KA 4L4VA 5GJTL 1AGFA 1BQHB 3QA3A 3MV01 1OW0A 2YSSA 4XPFL 5C07B 3RDTA 1BX2B 4L8BB 5FYJU 1GGBL 3O6LH 4FNLL 3L3KB 1AFVL 1V3LA 1CGUA 3NAAH 4HMCA 4X80L 1N5AA 3G9VA 4XRCB 4CDGC 2RBLA 4ZUSA 1SMOA 4JQXA 5IB5A 4XWOC 2EE2A 2J6EH 3P3YA 1V3JA 5I8CA 3MV8A 2X9XA 2C3GA 4TULL 1RMFH 3GGWA 4K2UH 5T3ZD 5DQDH 5BV7H 4C4KT 3RUGB 1WBZA 2W1NA 5I9QC 2BVPB 4RDQG 1MWAB 1VA9A 5F1IB 5EWIL 4LLWB 5DYOA 2GK0A 1HDMB 1EO7A 2H8PA 3VGAB 1MRFH 6CGTA 4K23L 1OLZA 3ARGA 3T0AA 1RI8A 4M3KB 3WS3A 2F53D 3DBXA 4FFZL 5FIEA 1TZIB 2ZUWA 4L4VD 4NKIL 4JN2B 3WIFA 4AMKL 1FG2B 5DJCB 1F97A 4H5SA 4IRJC 3RDTD 3JWOH 4OZIB 1MFCL 4XC1H 5J1AA 4Y7MA 5DS8A 1Z5LA 3BO8B 5BVJA 2ARWA 4ISVA 1TVBA 5IHUH 2FATH 5C1MB 4NPYB 4R90H 1NBYB 4OIAA 3AY4C 4JFDE 4X7SL 3K0WA 2APVA 3U36A 4WTZA 3IVKA 3MV8D 3S34L 2MTPA 2X09A 3N85L 4AK1A 3HMXH 1WWAX 4IJ3C 2H1PL 3P4OA 5HPMB 3UTPE 3GIVA 3JTTA 4XVUC 3LQMA 4OBSA 3C6SA 1U58B 1QBMH 1R3IL 3PWPE 5D2LF 3KYMA 3QDGB 2X1PA 4TTDC 4IOIB 3ARGD 4N8CL 1AC6A 2X4RB 4GRWH 4N0FB 3ELAT 3K80A 5GGSY 2IPKA 1ZMYA 1FL6B 5TE6L 2VDQL 1W8NA 5AZEL 2DQFA 4OB5L 3QCTH 3B3IA 5F7DB 3U46B 3B2VL 4PLKD 1DTUA 3BP4A 5F9DC 5TDOB 4I2XE 4KPHL 4Q9QH 2Z8VC 4C83A 2LFGA 5BJTB 1E6JH 2UWEF 4NJAH 3FB8B 1YQVL 3CXHJ 3WLBA 4WI4A 4BSWB 4LSSL 2X7LA 2R8SL 3ZT5A 3U30C 1OGTB 3G6AA 2ZG1A 3P0YL 3QQ3B 4XNXH 4G7VL 1F4XL 4UV7L 3BKML 1A1MB 1J8HE 1I7ZB 1UZ8B 3BZFA 4XPHH 3U1SH 1S5IH 1OAYH 1TJIL 1AD9A 1MRCH 1BAFH 1U8LB 3MRPA 5CJOL 1FGVL 1W72A 2NY5C 1ZHBA 4DW2H 4L4JA 2IEPA 4OUOA 1T1XB 4YHMH 4M7LT 3M17B 3U7AA 4XC3H 1RPQA 12E8L 4Q58C 1JV5B 1C08A 4NFBA 3MOBH 4LLUA 5GGVH 2R0WH 3BVNA 1GYAA 4YPGA 4KJQC 1R5WA 3SDCC 4DQOL 4R8WL 2XWJA 4M62H 2WAHA 4UNTA 3MRMA 4LGRB 3UC0L 5DD6B 2EE3A 3H7LA 4JFOB 3W39B 2R2BB 1JHLL 1VFAB 3P30H 3U7WH 1ROWA 4FS0A 2ZCKL 2JCCF 3OXRB 3KWWA 4JDTL 4LEXH 3DV4A 4U1HA 1BOGB 1BM3L 4HUVB 3ARFC 3OJ2C 3KS0J 4JPVH 2VXQL 1IC7L 5HHXL 4Y88A 3VD5A 1IGIL 1CVRA 4OGYL 3UTSB 2YUVA 4GQ9H 4KI5C 3KPQB 1CS6A 4U6HB 1OGAB 1WZ1L 4X4YB 4M6OL 2DF3A 3AVEA 2XZQH 3NFSL 1QD0A 3MREA 4Y5YA 1T6WA 4EUPG 5EN2B 1MREH 4ZAKA 5DVNA 4Z95L 3QUXA 3IJHB 2IGFH 2J88L 2NZIA 4GAFB 2APWA 3DX8B 2ATKA 4C59B 1CU4H 2VDRL 4HWZA 5ILTH 4MXQC 1LEGA 1JFQL 3QPQC 4OF0A 3S35X 4TUKH 1T2JA 5FYJH 1FZMA 1H3XA 3I02B 1OTSC 3MLTA 4WFGE 1T20B 4TSCL 2C7UA 1P1ZB 5ISZD 2GJ6E 5CZVH 1CZ8H 1KCRL 2VZ1A 4X5XB 1JYXA 4PV8A 4K71C 3F12A 1A7QH 3VA2C 1SEBB 2AJSH 4JPWH 4OIIL 3QEHB 2AEIT 2ARJQ 2FD6L 3H42H 1YJDC 4DEPC 3MJ8B 3T2NL 2A6IB 1FVEB 1MCNA 5CMAA 4ZAKD 3RNQA 4JFYB 1WFOA 3MRCA 3QUXD 4KWUA 1Z2KA 1S7TB 1PG7H 4TUOB 3OGOE 4XNMB 4WY7H 4MZ2A 4CL7A 1CIUA 5ITFB 3W0WE 3TEUA 4I9WD 5T3ZL 7FABL 3MBXH 5LQBH 2MHAB 1UADC 4JQIL 1LE9A 1OAQH 3C5JB 5F88B 2EDTA 1A6ZA 4APQB 1S9VA 3NABL 4OD1L 1HYSC 3BD3A 3IGAA 3W9DA 3TF7C 3BT2H 1EO8H 1XCQA 1UXSB 4D3CL 2HFGL 4G80B 2I5YL 4HEPG 3MLSH 4QLRA 1UVQB 1JHTA 1JPFA 2G60H 4BQ6A 2ITDA 1JP5A 2BFVH 5D5MA 3SBWA 1TNNA 3BSZL 3TZVA 5C07E 1Z9SA 3O3EA 5E5UB 2ORBL 4WI7A 2VDPH 4TQEH 2G5BB 1RJLA 3U48A 2CIKA 4M5YH 5D1QB 5J11B 2YRZA 4LNVA 4JZOA 1FGNL 4WNQB 1F4WL 3OKOA 4UAOC 4LPCA 3O3UN 3BE1L 4PJ7F 3HNVH 1JGVH 2RGSA 1JF6A 4MJ2A 4DKEH 4P23C 3WUWB 5A2KH 1MHEA 2ARJA 3X13A 2DLGA 1FFOB 2X4QA 4JM4L 4HH9B 4EQ3A 1B9ZA 2Q6WB 3VW3H 1DQMH 3S97C 1N26A 2UUDH 1XGTB 3IDIB 3TVMC 5FV1L 3O8XA 3PHOB 1YEEL 1KJMB 5EBWB 1BQUA 3TZVD 1I8KB 1AR1D 3L3OB 3REWB 3JSSA 1T7WA 5TDNB 1Q9OB 4JKMA 4YEFA 1GC1L 4I48A 1ZE3C 2VXUH 1GPOH 3O45B 1KJVA 1F2XK 5GGTA 4ZDHB 1JZ3A 3RPIB 1S9YB 1XF3A 3TNNB 4LOUC 3C8KB 4B0MM 4YDKL 2LAAA 2R4SL 5FA4A 1E4WH 5EBMA 2DBLH 5TPWH 1DQQB 2XTJD 4WENB 4LF3A 2FIKA 1WFUA 3PABB 1BVLB 2VIRA 4NM8H 1OM3H 3QDGE 3SOBH 4RGNB 5I76A 4YBLC 4R7NB 1CDCA 2W60B 3S36H 1VKXA 1XGUB 3FT4B 4GG6A 2P4AB 3IXAB 3WFHA 1UWGL 5HI4D 2OSLA 1EEUA 3MV9A 3VXSB 3KPRB 1G7JA 3DIFA 5A2IH 1PGRB 4L1DA 5D6CA 1JK8A 1HHIA 3GI8L 3WHE0 4ZNEA 5A40E 4JFFB 1KLUB 4EDWH 3RP1A 4TVPE 2LQRA 5GSVB 4Z7VF 2HRPH 5CILL 1FH5L 4G8GE 5C0ND 4P48A 3PWVA 3OBAA 1FL3B 1YEFH 1WITA 3FQRB 1CBVH 2Y1VA 5EOQL 4H26B 2UZYB 4Z7UF 4PR5B 4NKQB 2N7BA 5BZDB 3BIKA 4QHNA 4TSBH 2RFXB 1XZ0B 1BJ1J 1W72L 1CXEA 1BVKB 1TTGA 4M7KL 2WINB 5DUPL 3IKKA 4XH2B 5DI8B 3GMLA 5E2VH 4M43L 1CICB 3BGMA 2F15A 1PYWB 4PJHA 1LO4L 3MV9D 2FBJL 3RL2A 1A0QL 1CLOL 2IMMA 5DURB 4XP5L 2RHEA 4O5LL 3EO0A 1TCRA 4XMPL 2X4OB 3QHFH 4OTXL 4Z5RA 1KTLA 4PJDF 2B8OT 1WAAE 4XAWL 4GJTB 5GZOD 5I73B 4BFGA 4JFDD 4NNYB 3C60C 3V6FA 1FZOB 1VEPA 3WMSA 1YN7B 2VABB 2FJHA 2VR9A 4K7FB 3JVGA 4LLYA 1AQDB 4Y5VC 2HRLA 3KHOA 1U8MB 1RJZA 2N56A 4KKLC 4F7CB 1G0DA 3LKSA 4GKOA 4WO4A 3CFDB 3UBXI 5A16B 4G9DB 5E6IA 2NY4C 4OT1H 4U1KB 3UTSE 4DTGL 4Q97A 3OR7A 4ODVL 1XGPA 3JV4A 4KI5E 4JFEA 2EDKA 1N2RA 3ZHKA 5DWUL 4NJ9H 2ZPKL 3GZKA 4UDTB 2R0KL 4TUJA 3VXUE 4XCEB 2QSQA 2YA1A 4GSDL 4M1CD 3U9PH 4P5TB 3QO1A 4KKAD 1EAJA 1WBYA 1ZHKA 2WUCH 5E4IA 4ZUVA 4HS3A 1A7NL 3U7YL 2WANA 1ZHNB 4RCAA 5F3BA 4Y4FC 2DYPD 5FM5M 3MNWA 2NX5A 2ADGB 2IBBA 2R29H 2N7AA 3TBVA 3DPBA 4OGXL 3WNKA 3ETBF 1MQKL 3MBEB 4KK6C 3SDYL 3UTTE 3LN4A 4W70A 4JFED 1UACL 1BF8A 1T5XA 3HB3D 2A9NL 1LK3L 4HUWA 1RZKL 3LN9A 5GGRA 2GSIA 1Q9WB 1XT5A 3UAJC 1RUPL 5I1AA 2HN7A 2GTZA 1RZ8B 3OX8B 4PB0H 1ZT4B 4Z7WF 2VLKB 3P4MA 4GLRH 4PJEA 2LTQC 1CL7I 4ZUUA 5H35B 1YMMA 2MPAL 5I1IL 1SM3H 3BD4A 2C1OA 4EIGB 2CK2A 2G2RA 2MCG1 4WW2C 3ARDC 1N59A 1I7RA 5FCUL 2ZWLT 2GJ6A 5ICZA 5DMYA 5CIPB 3T09A 5FDWA 3ARDB 4TPRH 1U92A 2HVJB 5DDHB 3KPLA 3KPSE 1BZ7A 5L6YH 5JUEL 4K94L 1WIPA 4MCYA 1J05B 3B6SB 2AK1H 4GXVL 5ICYA 3HNTH 1R3JA 1HSAA 2QQKL 1IEBB 5E8PB 5DZLA 3SGKA 4AG4L 4AM0B 4HMEA 3HC3H 4P49A 4CMHC 5J12C 3CZFB 3KYOA 3VGDA 3AU1B 5FGCB 3CFBA 1MCBA 4PTTB 3P0VH 5J12B 1BHGA 1IAIL 2EKSA 1JNNH 1CG9A 1YMMD 4J3WA 5ETUA 3SGEH 3VFPB 4WW1A 5LWYH 2NR6C 3G5VB 2OTPA 1I3RB 4X9FA 1JGUH 2GJ6D 5F9WC 2VH5H 2HFTA 2HLFD 4Z0XB 1RK0A 5H37H 1FFPB 4X6EB 2FGWL 5HSFA 5J0BA 1S78C 4QT5A 2YXFA 1U8PA 2KZWA 3HN3A 4DK6A 3WO4C 3L7FB 4NC1C 5KS9F 4M6NH 1C1EH 1BQHA 5C07A 5CUSL 1BX2A 1RK1B 4XT1C 4L8BA 4YE4H 4RMRA 3L3KA 2FX9H 4AL8L 4FFVC 4PJAF 2VR4A 1S7UA 1YN6B 4HC1L 2CLRB 4L29B 2UUDK 4ZTOL 4S1QL 5CGMA 5F93C 1RUAL 2DLFH 1Q72L 5I1KH 3V5DA 3RUGA 2L0DA 2BVPA 1QZ1A 5F89B 4PY8I 1MWAA 4XVSL 8CGTA 4ELMF 1WIOA 5CKAA 5F1IA 4LLWA 4RGNE 3RFZC 1DEEB 1HDMA 3CK0H 4ERSL 4AIOA 3RWEB 2X40A 4JCMA 2VN4A 2EDFA 3C2SA 2VDKL 1TZIA 4GW1B 4JN2A 2OXHA 2RCSL 4XP9H 5IW1B 1FG2A 1JL8A 3I6LE 5DJCA 5BO1L 2R4RL 5C07D 3SE3C 4OZIA 1D5ZB 4V1DB 5HDQH 3BO8A 2AW2A 4JFFE 4YXHH 5D1XC 1P4LB 4FFWD 1HHJB 1HZHL 3MA7B 4NPYA 3GO1L 4GRMA 5HDLA 2PETA 1NBYA 5D1XB 4FG6C 3QNZB 5IKCA 1DEDA 3AY4A 4Q0XL 5HPMA 2VISA 4XAKD 1RUKH 2M1KA 1U8HA 1S3KL 3V6OC 4LHJB 1F8TH 1VFMA 5TF1H 3QNXB 4IOIA 2FHBA 5A3IC 3O4OC 2V7HA 2X4RA 3RY6C 3PXHA 4LSVL 2K7QA 2IAMB 4N0FA 2JJTA 1DL7H 2ZUVA 5JMRA 2DQTH 1FL6A 4P46C 5CGYC 3MO1B 2FO1A 3TO4C 2CUHA 5F7DA 3IDGA 4GLRI 4JG1L 1JWMB 3U46A 1G9NL 1CE1H 4ZUWB 1QHPA 4WU5B 2AJXH 1SBBA 1B0GB 5TDOA 4LSRH 1B90A 3CH8A 4XI5D 2NPLX 4MD5A 1TFHA 3HR5B 3HUJF 1UCBL 3IB4A 5TQ0L 5SWSB 3FB8A 1E6OH 5ENWB 1L9NA 4I8DA 4ZUTB 3ZDYE 4LLDB 4BSWA 2OP4L 2BY0A 5E5RB 3JWDL 1OGTA 5CLTA 1YEJL 2JB5H 3QQ3A 5A2JH 1U95B 3OPZL 4LARL 3GIZH 1A1MA 2W9DL 1I7ZA 1UZ8A 1IMHC 4PLOB 5E9DA 2ED9A 5EU5B 3O9WC 2YOCA 2KQNA 1U8LA 2EZ0C 1LE5B 3NA9L 1U36A 4MWFB 4M48L 1RZ7L 4TTDD 5I1JL 3CXDH 1JWUB 4OLUH 5CAYB 1P4IL 3T3ME 3ZYOA 1I8MB 1TENA 4Y16B 1T1XA 3M17A 4C57C 4JN1L 1AE6H 1JV5A 4F7EB 4I3SL 3SGEI 4M03A 4P5KB 1IC4H 4HUUB 5KSBF 3O2WL 1QRNB 4ALAL 4P0DA 5CJQH 2YD2A 4EEEA 4NKMB 4EI5B 2A6JA 4J23A 2YS4A 1DBJL 4EUPB 4JFOA 3W39A 2R2BA 4QRPB 1VFAA 3DGCR 1I3GL 43CAB 4JREC 3PDDA 3RPKA 2BSTB 4PJGF 3TA3C 3OXRA 5E9DD 5GHWH 1MCHA 4HUVA 1A7RH 3IU4H 2CQVA 2BHUA 2YKLL 2Q3ZA 1ZANL 4BQCA 4U6HA 1OGAA 4X4YA 5LCVL 1SMAA 2LV4A 4CVUA 2XWBB 4CU7A 4P4KC 1L4IA 4LAJH 3H3BC 1A1OB 3NTCH 2FX7L 5T33H 3IJHA 4GXUM 5E8EA 3LKNB 3QI9B 1K6QH 3DX8A 1IAKB 3ZKND 2R2HB 2AJYL 4FQPA 1MJJA 2DI9A 3O2VL 1UCTA 3EYSL 3I02A 3ARZA 3V79C 1T20A 4FQ2H 3SO5A 1MJ8H 1P1ZA 5IV2A 1JJUA 4HFWB 2GY5A 3RGVB 1GHFL 1IGCL 2C4FU 1H3TA 1NGZB 4H1LG 2B1AL 1DVFC 4HPYL 4H8WC 4ZPVB 1MPAH 3BUTA 4IOFC 2H9GA 3UTSD 1SEBA 3UO1H 1NMCC 1MF2H 1OGAD 5EOCJ 3QEHA 2FSEB 2JTDA 3VD7A 3HZVB 4KI5D 3MJ8A 4JPIB 2A6IA 2VE6B 1FVEA 4PV9B 1KTDB 4N0UE 4G3YH 1SJHA 1RFDH 1S7TA 2E3VA 2GITB 1O0VA 4TUOA 3LKRB 2EXWC 2HTKC 4XNMA 4DGIL 3WEXA 5ITFA 3MLYH 4M8VA 3GMQB 2VDLH 3TBWB 4KDWA 1QSZA 2MHAA 1UB6B 5C2BL 4RMSA 1UGNA 5FAAA 3C5JA 4X6DB 2D4DA 3MRNB 4N5EC 5F88A 3V8OA 3LMJH 1T1ZB 2FX8H 4APQA 4PLJC 3I85A 3HFMH 1UXSA 4M93C 3EFDH 1KN2L 4RAHA 4G80A 4FZEH 4UB0H 4XPTL 5DMJB 4O4YH 4UT7H 2DIBA 2JJSA 4G42A 5DGQA 5T1DH 3KR3L 3OJMB 5CJ5A 5DEFB 3GK8L 4WUKH 3F58H 3DI3B 4NC1E 4S0SD 2ZP0T 2G5BA 5D1QA 1JMXA 2R0LL 1PG7W 5KANG 2Y07L 1KXTB 2KKQA 4MVBD 4WNQA 1DBBL 2IADB 3MOAH 1MWAL 4KHXH 1DQLH 2VITB 4QY8B 3RRQA 3S5LG 5BQ7B 3SPVA 3WUWA 4EZMA 4APQD 1H8OA 5EG6C 3U4BH 5IQ9B 4HH9A 1E0OB 3WFZA 1G9MH 2Q6WA 3EOTL 2A1WH 2XN9E 3NIGF 1YDPB 1LP9B 1GOGA 4O58L 1XGTA 3IDIA 5EZIH 3C8DA 3GSNL 3PHOA 2LU7A 2OL3H 1KJMA 2XQYG 3V0AC 5EBWA 5T1LB 5AAMA 1I8KA 3L3OA 2H26B 3REWA 5F3HB 3FN9A 1KENL 2QR0A 5TDNA 1Q9OA 4M7JL 2XNAB 4NZTH 3N06B 4WJ5B 1BEYH 5D1QD 3BFOA 2ID5A 1FIEA 3O45A 5JR1H 4H8WH 4IRZH 4ZDHA 3RPIA 3RY5A 1S9YA 5KS9E 5HHVL 5GRWA 1OAKH 4HQQL 5GQBA 3TNNA 1QYGL 1VFOA 4F58H 3C8KA 3BPCB 5BRZE 5IROA 2Y5TB 1DQQA 5I75B 4HBCL 1F00I 4OFYA 2J4WH 1BVLA 3PABA 5BV7B 4LFHG 5BW7A 5E5MB 3V6OE 4HFUL 4R7NA 5EU7C 2W60A 4GAGL 1CQKA 1XGUA 1I9JL 4BK4A 2N4IA 3GM8A 1AQKL 3IXAA 1OHQA 5IW6B 1S7SB 4HWEL 3VXSA 3C5SB 1ZOXA 3KPRA 5C0FB 2X9YA 4XNZB 4TVPL 4P99A 5MP6H 3W11C 4JFFA 1NEZA 5IK3B 1KLUA 5GSVA 1Q38A 3QO0A 1EHXA 4PD4K 1I3VA 3DVNA 1BFOB 1QFUL 2VJXA 4QHKJ 4MJ5B 1PKQE 5F71A 1FL3A 4K7PH 3LEVL 4H26A 1WJ3A 4PR5A 3B9VA 4UT6H 3QXVA 2A38A 1LWRA 5BZDA 4JO3L 4OFYD 1XZ0A 4MB3A 4UOW0 4RGND 4YXLH 1BVKA 2EH8L 2WINA 3Q5TA 4PJFF 4YUEH 4OF6A 4EJ1C 3QUMH 4PYHA 4NO5B 4XH2A 2AABH 5DI8A 4Y1AB 4YHZL 4EKXA 1CICA 3HR6A 4GRLB 4LPWA 1PYWA 2F9BT 1OQOA 3VXSD 3KPRD 4P3CL 2AI0L 5SX5H 1F3DH 3QIUC 3QZWG 5DZOA 2FL5B 5C7XH 5FM5O 3D87B 1GOHA 3QUZC 4JFFD 2X4OA 4XBEH 4KVNH 1BLNB 2WQRA 2V5SA 1MCWW 3T2PA 4LCIL 1QO3B 1T66C 1RZJH 2FB4H 4NNYA 1CCZA 1FZOA 3GI9L 3BQUC 1RZFL 2EC9U 1YN7A 2VABA 5IVOA 3HE6B 4K7FA 3TBYB 5JPNB 1CD0A 2V17L 2XT1B 1AQDA 3WJLA 4DJMA 1U8MA 3VI3F 1JRHI 4F7CA 2F74B 3GBML 4BM7A 1MFDL 3CFDA 5A16A 4OKVB 4G9DA 5HGBB 3VDBA 1AI1H 2HT3C 1WZLA 2ZUTA 4U1KA 3T65B 4IBLT 5T5FH 1N4XH 5TE7H 5JMOC 1CICD 2XY2A 3BZEB 5I17B 5L9DH 2PO6C 4D0BB 3M8OL 1JPTL 2WUBL 4UDTA 5DURD 1EHLH 3B9DA 3TFKC 3OKEB 4HK3N 3Q3GB 4XCEA 1KELH 1IZKA 1ONQA 4P5TA 2D7TH 4DZ8B 3LIZL 3U0PB 5BOPA 1AY1H 4HWBA 1R5VB 2V2XB 1WZKA 2Z91B 4QNPF 1A7PH 1X5GA 2XRAL 1ZHNA 5C9KA 1CFSB 3RJQB 5HD8D 2VDOL 3BN3B 2ZOKA 4ETYA 3RTQB 4PJBE 1TNMA 2ADGA 2AJUH 3VDAA 3MJGX 2NY1C 4XCYB 2ZNWA 4KZEH 3KLHC 4KTEH 3O41B 1CN4A 4FZ8H 2GI7A 2V6HA 4XPBL 2P43B 4HHAB 2NY0B 3EYUL 1XFPA 3MBEA 3AM8C 5E2WH 5ACZB 4HBQA 4OGZA 3VWKB 2I24N 3VRIB 4ONFH 1IGFL 4KAQH 1EZVX 2ZUQB 4HKBB 2HKFL 2ZOLB 1Q9WA 3Q6FB 1IKNA 1SYVB 5AG9A 1RZ8A 3OX8A 4P5TD 1ZT4A 4NO0B 3WS6A 1IGML 4ZO8A 1FAIH 2VLKA 2AKRB 4GO6B 5HYJE 1KB9J 5CJ8A 4JG0L 4JHAH 5H35A 4KRPB 2DDQL 3QEQB 4P59H 2QQQA 1GGYA 1PY4A 3VWJB 4Z8FH 4P9HC 4KFZC 4KZDH 15C8L 3HMWL 5AZ2L 5I6XC 2O93L 3O4LA 5IHBA 2BNRE 1YEHH 4F3FB 4FQLH 1MOEA 5CIPA 3MBED 2HVJA 4BZ2H 7CGTA 5DDHA 5JIIA 1D5IL 1J05A 3B6SA 3N1GC 3ULUC 2C3VB 5D93B 3ALXA 5E8PA 1IEBA 4ZSOB 4ZQKB 2Z35A 5IF0B 4AM0A 5I30L 3QEGH 1MFEH 3NH7L 3RVVD 3CZFA 4X7FC 1ZTXL 3AU1A 5CD5D 2VLKD 3TBSA 1HI6B 1FCCA 5T3XE 25C8L 4PTTA 4YK4C 4IMKC 4X6CF 5EU6E 4YAQA 5CEXB 4WI5A 2K3TA 1A6WH 3B5GA 3D18B 5JQ6H 4YK4B 2W0PA 4HK0B 4PRAB 4NKDB 3VFPA 1S5HB 3MXVL 1I3RA 1FE8L 1KJ2H 5D2LB 1I8LC 3V4PH 4Z0XA 4BSVB 3EJYD 3WL9B 1FFPA 2W07A 1CLYL 3ARDD 4X6EA 1F90H 5MHSD 4OCYH 5HYEA 3N1MC 2ZCLH 5KSVB 5IHZB 3NCFB 4OV5B 3LB6C 4I1NB 2YZ8A 3L7FA 4M7LH 2FZ3B 4OIBA 4ZD3H 4Y5XC 2CRZA 1RK1A 3VGFA 1W0YT 5GS0D 5A43C 5IHLB 1IRAY 4G6KH 2ZUUA 3RKDD 3FB5A 2NYYC 3IAGC 1YN6A 4XHQA 2CLRA 4XVJH 5I8OL 2UWEB 4FQHB 1QLRB 4ODSH 3VGBA 3SCMB 4M4PA 4YNYA 3TJHC 3HI5L 2YMXL 1EO5A 5F89A 6FABL 2IPTH 1DEEA 2LU4A 1T83C 5K59F 4Y19B 2CH8A 3RWEA 5IFJB 4OLXL 4GKNB 5SWQB 3IDMB 3ZYIA 3CGTA 5EU7E 3BPOC 5IB1B 1QFWM 3MRIB 4GW1A 1G1YA 2Y36H 2B2XL 1P84K 5IW1A 3H9SE 1SVCP 2V5RA 4JHWH 3H8NA 4JM2F 1D5ZA 4CW1B 1PX4A 4RSVA 3V6ZB 4V1DA 3BHBB 4I0PB 3NCBB 1BVZA 1P4LA 5C09E 1HHJA 2AQ1A 3MA7A 4HIEB 1LILA 5D1XA 3QNZA 1ZVSB 1CR9L 2FDBP 4PJIF 5CEZH 1U42A 1TETL 1AD0B 4ODTH 4FTVE 4KK8C 3MX0A 1XF5B 2JCCB 3KHQA 4UINL 4ETQA 2FEEI 4DVRH 3RIAF 1ZLWH 3ZT7A 3KYNB 1N3NB 1BD2A 4HLZG 4NSKB 3QNXA 1MNUH 1UEYA 2IAMA 4NN5C 3BGAA 3BUYB 4OLWH 4URTB 5F97E 3MO1A 4D9RD 2EIEA 4KVCL 4V1DD 1WCQA 5ESVB 2QADB 1GCFA 1JWMA 3LKOB 4ZUWA 5J06A 4WU5A 4LVEA 5F96L 3C6LC 1B0GA 3HNSL 4RMWA 5D1XD 3HR5A 1GOFA 5L7XH 5HBBA 5SWSA 3C6LB 4U6VL 1FIGL 1NCDH 4I3RL 5ENWA 4ZUTA 4LLDA 1NCUA 4ZMAT 3NACL 4L9DA 2HTLC 4NOFA 4CN1A 3UYRL 5CP3A 5SX5K 1U95A 2HG5B 5FHAL 2EDWA 3QYCA 5EU5A 3B2UC 4K55A 1TTFA 2EE6A 2IAMD 4KKNA 1LE5A 5TH2B 3V5KB 2UVEA 4MWFA 1IGJB 4OM0L 5JZ7D 4N1HB 1JWUA 5JHLL 3D1MC 5F1SA 1I8MA 4Y16A 5C0CB 1A7BA 1NUDA 3TO2B 4JGJA 4G6AC 4F7EA 3DSFH 3QAZC 5DLML 4EIZC 1QSEA 2O5ZH 3DNKA 3K8MA 3RWJB 4XCFH 4K3EL 4P5KA 4NQUA 1J1XL 3TT1H 4HUUA 5SWSD 1QRNA 3IF1B 2IH3A 2FECI 1NAMA 3AMLA 4NKMA 4EI5A 1L7IH 1HXYB 2KDGA 3RNKB 4EUPA 5B4MC 3FFDB 1YYML 5FGBA 4KMLB 2MWCA 4QRPA 4JANB 43CAA 1G7LA 5L88H 4WFHD 1X7QB 3VFVB 4U2ZA 3MLZH 2VQUA 4XMLL 4QTIH 3EDJA 1NCCH 2EZ0D 3FO9B 4Y16D 1Z6JT 2XWBA 2Z92A 2X1OA 5I74B 3QNYA 4PBWD 1A1OA 4I5BB 4U05A 4ZS6C 4H1LB 2IBZX 1NL0L 5IBLC 3FTGB 3LKNA 1CYGA 2VLJB 3QI9A 4XP1H 3ZE1E 4H88H 1J1OL 1IAKA 4QCIB 3DHJA 1QRND 2FO4B 2R2HA 3D0VB 1JNHB 1R3HA 4MJ6B 5FUOH 4EI5D 2AK4B 1DBKH 5C70A 4QRPD 4QGTA 5IFHL 2DTSA 2W9EL 4L3EE 4E0RB 4JJHA 3MCLL 3C87A 3PUCA 3RGVA 1NGZA 2ZCHL 2ZUYA 3B5TA 1NSNL 2VDML 2ESVB 1Y6KR 1QEWA 4K8RD 5LAXB 4RGMC 4HGKC 2RAMA 2B4CH 5D6DA 1FYTE 3ZTJH 5EO9B 2FSEA 5ITBL 2QSVA 3HZVA 1UB5B 4RGMB 4JPIA 2VE6A 4LIQH 3F6IA 3ULUE 3EBAA 4PV9A 1CXHA 5DJZB 5FYKU 3EYQC 1KTDA 4DGYH 3V52L 2GITA 3LKRA 3QI9D 3OMZA 1F6FB 3DYMA 3UCRA 1R0AL 5HDBE 1RSFA 4WCYL 3H9ZA 3GMQA 5I8KL 1E4KC 1UA6H 3KAAA 4L8SC 1LO2L 3IRPX 3PP3H 1UB6A 1DUZA 4J2XA 4X6DA 3MRNA 1F58H 2V7NB 1PY9A 3WDHA 2AXFB 1T1ZA 5DHVA 3CLFL 5BCAA 1TJHL 5EZOL 1F3JB 3OF6A 1HIMH 3RGVD 1X5ZA 1UQSB 1YYLL 4FQJL 4G6JL 4YHOH 5CBAB 4NUGL 5FXCH 5IMKB 3E2HC 1A6TA 3SDXF 4LAQH 2XA3A 2H3NB 4PP1C 5DEFA 3S5LB 3F5WB 3NCMA 4BZ1L 1FAKT 2AQ3A 3ZSSA 1MJ7H 2I07B 3K1KC 4GW4B 4LCCC 5KAQF 4YC2C 1IILE 3LZFH 5T5NG 4Z7NF 5HHOB 4MA7L 4OCNC 2IADA 2OMNA 2R56L 4Y8DC 4LPVA 5I1CH 4Z7UB 2VITA 3VG0H 4L1HA 3FO0L 1FBIL 5GSRB 5BQ7A 1AHWC 2HWZL 1Z0NA 3OF6D 5IQ9A 2AS5M 2CDGB 4Y19E 4KQ3L 3RU8L 3UJIH 1YDPA 2IPUK 1LP9A 4AIXA 4QXUL 1IGYB 4FRWA 4OZHF 5SX4I 4MAUL 4YGAB 5T1LA 1UM4H 1J1PL 4WUUB 1T04B 1S9XB 4WTZG 4U7MA 2Q8AH 35C8H 2H26A 4FQQB 5F3HA 3P9MB 1X5HA 3P11H 1NANH 3NN8B 4D9QD 5IQ7L 4X5LA 3UROR 2CR6A 2MSPA 5EORL 2O5XH 5TE4H 2XNAA 4R26L 1MEXH 3CX5K 4JQVC 4N0RA 1JPSL 4WJ5A 4PJDB 3L3HB 1VPOH 4ESKA 3NZHH 4FQIH 5ICXB 1F4YH 1UM5H 2Y7QB 1MRDH 5DR5H 2QEJA 3AFLA 4OD3L 1O5DT 3BPCA 1RUQL 4MXWH 4MXVE 4O51B 2Y5TA 1C7TA 3U4EB 3BW9B 4LDOB 4AH2B 2XA8L 1KXVC 4N5UA 2YD6A 5E5MA 3GMRB 1YY8B 5HPOA 1UM6H 1MCKA 4D0DA 5T1LD 4HIXH 4OFDA 5I19H 2HKHL 4IRSB 5IW6A 1S7SA 2VXTL 5M94B 1VERA 1RIUL 4WIQA 5ADPL 4K9EC 3C5SA 3SKOB 5C0FA 1EHNA 1FC1A 1BZ9A 4OF7A 3MV7B 5I71B 5IT2L 5JOPE 4M9OA 2MJWA 1ZLWK 5I1LB 5IK3A 3OKNB 4G5ZL 3TV3H 3ZO0A 3BN9C 3FN0H 1FRGH 2OLDA 1BFOA 3X3FL 5ADOL 4MJ5A 2Y06H 3VXMB 1H15A 3E6FB 4LRNL 1DCLA 2BVQB 3V2AR 1OAUL 1H8NA 3QZWB 5IWLA 5I1DB 4OFKA 3HMXA 3IFLH 4YXKH 3PWLB 5MEQB 4NM4L 4N90D 2COQA 4BKLB 2VRAA 2DD8L 2CRYA 2C26A 3MLWL 4NO5A 1EJOL 4Y1AA 4DOHE 3JUYA 3PGDB 4GRLA 5C0CE 4HMDA 2VZOA 4B50A 2PN5A 4AJ0A 3X11B 4FABL 1A5FH 4LSUH 4TRPH 2ZJSH 2AEQH 2WWKO 2FL5A 4R4NC 5TFSL 4M7ZC 4OLYL 4W4OA 5C6TL 4Z7WB 4W6XB 4LP4A 1A47A 1ZAGA 3SKNB 1BLNA 4MQSB 1JRHL 1ORQB 3CU7A 1QO3A 4P2OC 4XMKH 3CDCA 5KSAC 5EIQA 5EO1B 3HE6A 3TBYA 5JPNA 1OPGL 3SDAB 3RAJH 3AUVA 1A4JB 2F74A 1JE6A 4K8RL 4E41B 3SE9H 4OKVA 2BZDA 4U0QB 4U1GC 5HGBA 2HLAB 1ZLSH 2YZ1A 1L6XA 1W8OA 4OM1L 3T65A 4Y1AD 2ICWB 1X5LA 1A3LL 4KHTL 3BZEA 4GRLD 4P2CG 5I17A 4NQEB 4D0BA 1CF8L 1MHPL 3FT3A 3TC9A 4JZJC 5DD0L 4LSQH 3OKEA 1FORH 2Z31B 3NIFE 2B39A 4NQCE 2PW2B 5T1MB 4DZ8A 1TIUA 3AREB 3U0PA 2W65B 1Z9OA 1B0WA 4WFFD 3VXPB 2C9AA 1U3HC 1R5VA 5B21A 2Z91A 3MSPA 3D85B 3HE6D 1CFSA 2D0FA 3V7AE 1BQLH 1DUYB 1U3HB 2EYTB 4ODHH 1DSFL 3RTQA 4KMTL 1DLFL 1MCOH 4XCYA 4RMTA 3O41A 4EBQH 5E08H 2RQ8A 2BRRH 4HHAA 4NN7B 1V05A 3FFCE 5ACZA 4Q6YA 4C56E 5DFVD 3VWKA 1CXLA 5B38B 5HI5D 4OCMC 3VRIA 5KVDH 1I85C 4HKBA 1MCFA 2ZOLA 3FO2B 3Q6FA 1SYVA 1H3PL 3O2DA 4NO0A 2B5IC 3AB0B 3WHE1 2FEDC 2AKRA 3U2SB 1H5BC 3QQ4B 4LSPL 3WFCH 4EOWH 4ONGH 3QEQA 3RTQD 1HINL 3MACL 4HDIB 1I7TB 4ELMB 4LLQB 3MGOB 3VWJA 1FFNB 4ODBD 3CMOH 4WI8A 4F3FA 3ZHLA 1A1NB 1ADQH 2NY0D 2Q76B 3VWKD 4JO1L 4GBXB 1QKZL 4NDMB 5KANI 2Z8SA 1QQDB 1DZBA 5DJ8B 3PP3K 1VENA 3VFRB 4JY5H 1SQ2N 1G7QB 3RIAK 2C3VA 1C5CH 2F5BH 3ALWA 4ZQKA 4ZSOA 5AYQA 5IF0A 4N0CC 5DJXB 2R69H 2JKXA 4NO0D 5T3XL 5DJAB 3BESR 1HI6A 5J9PB 4X6BB 5CEXA 1JTPA 4XTRD 3H9HB 4KRPD 5C0BE 1LHZA 4LRIA 1FO0H 1IEHA 3D18A 1I9IH 3QEQD 4OLVH 1NFDE 4LPTA 1XCTB 1HYRC 3L3JB 4HK0A 4NKDA 3LCYA 4PRAA 5ABDE 1S5HA 5FUZH 1DANT 3VWJD 5IJKA 5FYJD 3CVHH 1A9EB 5D2LA 3TIDB 3RWIB 5KTEH 3IDNB 4MNQB 1QG3A 2PYEB 4BSVA 3WL9A 1F02I 4PJ8C 5C0GB 3BPNC 5KSVA 1MCPH 5IHZA 1IQWL 4WUUE 4IIQC 2E7BA 1GGCH 4K3DH 4LBEB 4M1DL 4OV5A 3ET9F 5CSBA 1NDMB 3IDXL 1S7QB 5EUOF 4JR9L 2FZ3A 3PQYE 3EAKA 1AP2A 2OM5A 2WP3O 5F7WC 1MCEA 1VADB 5L8JB 1BBJB 4R0LC 1JMZA 3RKPA 4FN0A 2RB8A 4ODWB 5DUMH 3HUJB 4G8EB 1U8NB 4KY1L 2UWEA 4FQHA 5IG7B 2VLRE 2VMFA 2C4XA 1QLRA 2FHFA 1A7OL 4K2UL 1L9MA 1RVFL 3SCMA 3FQUB 1E4XI 1HEZA 1LGVA 3T1FB 4NO2A 4Q6IB 3BH9A 5FHBL 1CLZH 4Z7NE 1UJ3C 1JZ8A 4I4WB 3ULVD 3BH8B 5IFJA 4GKNA 2ZNXA 5SWQA 1FNEB 1N64H 1OY3B 3I9GL 3IDMA 4NC0B 5IB1A 1PLGL 4HT1H 2Q87A 1WCBB 2OL3B 1MAMH 5FDYA 4CW1A 5F7MC 3V6ZA 5ALCL 3MV7E 3T4AB 3BHBA 2BVTA 4I0PA 3KNBB 3NA4A 1DJSA 5HYFA 4HS6B 1IKFL 2X1XR 5KSBB 4HIEA 2OZ4H 2GHWB 2DJUA 1UFUA 3WKML 2P24B 2EYSB 3SCMD 5TF0A 2EICA 3HMXL 1G7PB 1AD0A 1H3VA 5GJTH 1FPTL 4PJGB 4XPFH 2JCCA 3STBA 1V5JA 1KG0A 3TJHD 1GGBH 3KYNA 1CFBA 2OR8A 1N3NA 4Y19D 3CFIC 1AFVH 1KIUA 1NQBA 4NSKA 4X80H 1IE5A 3X14A 3BUYA 3BDXA 3OB0H 3TIEB 3QCTL 4TULH 3KVQA 3P4NB 4WTWA 5ESVA 4I0PD 3LKOA 4PTUB 3BPLC 3VFNB 1X4YA 4PJ5A 4X4MA 1QSFB 2BNQE 5DO2C 3UYPA 4KU1A 5DEZA 1ULVA 3BDBA 4AEIL 4EQ2A 2FH8A 1J11A 1WWWX 1CTNA 4AMKH 2J8UF 1MFCH 1HSBB 4NBXB 2EDQA 2HG5A 3WNLA 5BVPL 1OB1A 4LSTL 1OAYL 5CCKL 3DX6B 3IDJB 5HDOA 3EGSB 4CVZB 1EV2E 3V5KA 4X7SH 1IGJA 4QRRE 3L6FB 4NQEE 3S37L 2DLIA 2BVUA 3BIAX 3GMPB 3R0MA 3S34H 2QADD 5C0CA 4JO2L 4XC3L 5SWZE 3N85H 3TO2A 1KYOJ 2H1PH 1EXUB 2R0WL 5CD3B 4POZC 3RWJA 1R3IH 4KKBD 1IC1A 2P1YA 4MCZB 3C6LD 3TPKA 3QJHB 3IF1A 4CNIB 2HP4A 2P5WB 1HXYA 3RNKA 3FFDA 4NZDA 4QHLB 3IFOB 5TE6H 2VDQH 4OV6F 4JANA 4OB5H 3MUHL 4DKFH 5L8LB 5IGXH 3B2VH 1X7QA 5HI3C 4AENB 2F5AH 4F7TB 4KPHH 3BP7A 5F6HJ 3FO9A 1YQVH 1IM3B 5GISL 1GGIL 3O2DL 5C0CD 1D6EB 4JHZA 5J3HD 4LSSH 2R8SH 1BREA 3UJTL 5JNYB 1PG7X 4I5BA 3P0YH 3M45A 4KK9D 4G7VH 3SDDB 4MDJB 2VLJA 4UV7H 5I8EB 5D7IE 3VXRE 2LAGB 4QCIA 4PJ7A 3MTRA 1L0QA 1TJIH 2FO4A 3D0VA 1JNHA 1FGVH 4MJ6A 2AK4A 4Q9CA 4S11A 2XPGB 4P9HL 4E0RA 1KPUB 4POYA 5FFLA 2GTWB 1EFQA 2ESVA 1JF5A 5LAXA 2AJSL 4DQOH 5HVHB 1I75A 4YZFE 5EO9A 5MI0C 4R8WH 3OGCB 1OW0C 3RDTC 1UB5A 1MHHB 3KDMB 4WHTB 4Y4KB 3UC0H 1QLFB 1F4AA 1G84A 3EFFB 1HKLL 5IVXF 1IM9B 2VLJD 4OKDA 2KPNA 4JQXC 1ODAA 4PB9L 4YJZL 2ZCKH 3G5XB 4ZFFB 4JRYE 5I18L 1N5AB 5F7EL 4ZUSB 2VXQH 1IC7H 4NRYB 3HC0B 1YEGL 4OGYH 1I1AB 2AK4D 2YXMA 2V7NA 1WZ1H 4M6OH 2AXFA 2GYSA 3NFSH 1UT9A 1BQHG 1MQ8A 3O0RL 1F3JA 5IBTL 3ULVL 4J12A 2VO5A 3N1FC 2ESVD 4G8IB 1JHKL 4Z95H 5DYOB 3FZUD 3ARGC 3LQAH 4MHHG 1U8OB 4KJWD 5CBAA 1CDJA 3DARA 3ORJA 5IMKA 4GAYB 5J13B 1YPZF 2BFVL 2VDRH 1WF5A 3WN5B 2H3NA 3QDJE 3O3BB 3VD9A 3S5LA 3F5WA 4H5SB 1QLEH 4QF1B 1ACYH 4CRPA 1NCTA 4M5YL 5EUKB 1GC1C 2GQHA 2I07A 4GW4A 5BS0E 1Z5LB 5BVJB 1KCRH 5HHOA 1FNLA 1TZGL 1AXSB 5EPMA 4WFEE 1M6OB 2BVEA 3MZGB 4Z7UA 2Y23A 2EKJA 3E1F1 4OIIH 4DKEL 4PJ9B 5GSRA 3QCUL 3T2NH 1CIDA 4MQTB 5D7LB 3P4OB 1PVHA 2CDGA 3VW3L 4GMTH 1IJ9A 4QHKI 4PJFB 1DQML 4QOKE 1IGYA 1WC7B 4Q9RH 1J18A 5KW9L 4YFEA 4R97B 3MYJA 1T04A 1S9XA 5T3ZH 4FQQA 3E6HB 3P9MA 3CFEB 4S2SB 4KRLB 3NN8A 1LD9B 4Z7OF 2VXUL 1NFKA 4AEEA 1GPOL 4M61A 3QQ9D 4UNUA 4PJDA 3L3HA 3NABH 1UKQA 1OTTC 4Y0GA 5HHOD 4DWHA 4CU8A 1OSPL 3SKUD 4JQVA 3MNVB 5ICXA 2XXCB 2HFGH 4D3CH 2I5YH 2Y7QA 4OZGE 5E8NB 4WV1B 1HNGA 3CFKB 1K8DA 1LO0L 2X1QA 3BSZH 4O51A 3U4EA 2X7LB 3MRRB 2Z9TA 3W9EA 4MLSA 3G6AB 4M8QB 3BW9A 4NM8L 4AH2A 3SOBL 1NMAL 1QHOA 1KYOK 3GMRA 1YY8A 2X89A 3S36L 4NQDB 1NGQL 3OZ9H 4KK5D 2VL5A 2EO1A 3BZFB 3RGHA 4IEFB 2PTTB 1AD9B 4JB9L 4Z7QF 5IFAL 1F4WH 3DI2B 4IRSA 4Y2DB 1P4BL 4YX2L 5I1GH 3BE1H 2JB6B 2ZSVB 2GSGB 2YHGA 4P2QA 4OZFH 3SKOA 3IFNH 1LEIB 4PG2A 2BY3A 2AJZB 5I1LA 4AEHL 4EDWL 1F6AB 2HRPL 4L4TB 2XI9A 3KLDA 3FAWA 2VUYA 1FN4A 1M1SA 1YEEH 1Q9LB 2H6PA 3QFJB 3VXMA 4X98B 3OB0K 4U1LA 3E6FA 4WRLA 2BVQA 2AJ3B 3AC0A 3HI6L 5GGRY 3QZWA 3GJFH 2C3HA 5I1DA 3S7GA 1GC1H 3PWLA 5MEQA 2X89D 4BKLA 4GXUN 4P2RE 1WTGT 5E2VL 2VAAB 3PIQA 4IRSD 2V9TA 3PGDA 2CDEB 4ZAKC 3X11A 2A0LD 4P9ML 3QUXC 3D25B 3DMMB 3MV7D 2R4SH 4YDKH 1OAXH 3OKDB 4Z7WA 4ZAKB 8FABB 1DP0A 2EXYD 2I60H 3SKNA 1ORQA 3I84A 3TH4T 3VXMD 1OF2B 2F19L 3LS5L 2GJJA 3ECBB 2BDNL 1LEGB 5EO1A 3CH1B 4U31A 2H32B 3GBNL 1UWGH 3SDAA 1UJTA 5ANMB 1FZMB 2AVGA 1A4JA 2R9HC 1HCVA 1P69B 5E1AB 2ERJB 4E41A 2XKUA 1OAZL 1RY7B 4OT1L 2HLAA 2FLRT 4D0CB 4X8JB 3S98A 4L8CB 4RNRB 5FM8A 2ICWA 4YHYB 5AD0B 1FH5H 3TNMB 3OTTA 2C3WA 2D2OA 4E9LA 2J8UE 1VGEL 4NQEA 3RX7A 5DZNA 4U1NB 4CJ0A 4F9PA 2XTLA 2Z31A 4PJXF 5IVZB 3U9PL 2PW2A 5T1MA 4D8PB 1FSKB 4GW5B 4JAMB 2WUCL 3HAEH 3LY6A 3AREA 2B20A 4X6CB 2W65A 4ONOA 3VXPA 1FG9C 2BC4A 4L5FL 4OLZH 5DUPH 2BRQA 3CNKA 4BUGA 3D85A 4YH6A 3SDAD 3ARQA 3MZTA 1LE9B 1DUYA 2EYTA 3VCLB 3VMOA 3ZDZF 2ZKHL 1LO4H 2FBJH 4E41D 2EEBA 1CLOH 1NGWB 1D9KA 3JV0A 3IGAB 3W9DB 3REVB 4XMPH 3RY4A 4OTXH 4HZLB 1IEAA 3SBWC 3TZVC 1AR1C 4XAWH 5B38A 1MVUA 4K94C 4NQED 1G1CA 4L4VE 4LLAA 3QDMB 4ZXBB 4NKOA 1DBML 3FO2A 5K9KA 2Z31D 3I6KB 1AR2A 4A2LA 3ARED 3WSQL 1RJLB 4HX1A 4YWGL 3U2SA 4PGZA 3AGVA 1TQCC 4DTGH 1GH7A 3QQ4A 5HGAB 1NAKL 3D85D 1I9EA 3MV8E 4ODVH 4NNXB 1U3HD 2MQ0A 4HDIA 2XTJC 1I7TA 4ELMA 3MGOA 3KPNB 1IVLA 5DWUH 1FFNA 1MHEB 4G6MH 4Y4HB 3O8XC 2P8PB 1A1NA 5D8JH 2E7LA 4OSUL 1LNUA 1JPST 2Q76A 3QHZL 4GBXA 4NDMA 3O8XB 4PGEB 5HI4C 5DJ8A 1QQDA 3QIWB 3VFRA 4JM2B 1NLBL 3WFDL 1G7QA 1XR8B 4P2YA 1T7YA 5DJXA 1GL4B 4OF3A 2CMRH 2J8HA 4NFCA 3ZSTA 3QWRD 4YDJB 1ZEAH 5DJAA 4OGXH 4E42B 4NZRL 4J3UA 4AZ8A 5J9PA 1N6QL 4OGAD 3I2CH 5C0NC 4X6BA 1KN4L 1MQKH 4HPOL 1JNNL 4PJIB 3H9HA 5E7BA 2D0HA 5D70H 5A2LH 3SDYH 3IRZA 1XCTA 3L3JA 4M00A 3WNPA 4JVPA 5D7LE 2A9NH 3MJ9L 3HA0A 1A9EA 1XR9B 3TIDA 1RZKH 3RWIA 3IDNA 4MNQA 3IT8D 5DC4B 1MJUL 2PYEA 3TCLA 1KIPB 1RUPH 2YPLB 3NVQA 4JFZL 5C0GA 3MLXL 3EOBB 1KLGB 4XP4H 4GBXD 5CZXD 4LBEA 2XZCL 5CGTA 4Z9KB 3VFWB 3DLQR 1NDMA 3B5HA 5JPMB 1S7QA 3Q1SL 2MPAH 5I1IH 4YE4L 1REIA 1KC5H 1MCCA 2FX9L 1VADA 1BBJA 2DMKA 2BK8A 5SV3A 3NCEB 3FMGL 1CQYA 4ZO9A 5E8OB 4B7LA 5GZOC 3HUJA 4G8EA 1U8NA 5IG7A 4BFIB 4M4RA 5HTSA 2DLFL 5FYLE 5IBUG 4OCLC 4UT9H 4K94H 5HHMB 3FQUA 5I1KL 4MD0B 1A14L 4UILL 2VXVL 1A8JH 1CDHA 3T1FA 4N68A 2QQKH 3QWQB 4MNQD 4P57A 4Q6IA 2PYED 4AG4H 2YD9A 5D2NB 4QYOB 4I4WA 3QXUA 3KPTA 3LRSA 3RVTC 4J3SA 3BH8A 3OQ3B 3U83A 1NEZG 3QCVL 1UZ6E 4JFPB 4GKSB 2HT2D 3L9RB 1IAIH 4Q74A 1M7IB 2OL3A 4PS4L 4K9EL 2PCPB 4RQQB 5HDQL 5CEYA 1A6VL 3T77B 3O6KH 3KNBA 4M1CC 4KKAC 4KTDL 4NNPH 4HS6A 2J5LC 1XGRA 5KSBA 4Z5RB 1KTLB 3QXWA 5D7SL 5DSCB 2FGWH 4WFED 2P24A 2CSPA 2EYSA 2GFBA 4O02H 3JVGC 1UXWB 2NY6B 2L7UA 1G7PA 4WO4C 2CUIA