3N1MC

Crystal structure of ihhn bound to bocfn3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
ERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Indian hedgehog protein
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n1mC01
2EDHA 5KSAA 3QG6A 5I1CH 4JN2B 4UZGA 5FUCC 4JDTL 3EJYD 2NY6B 5FUOH 4R0LC 4MD0B 2G5BB 2Y9RT 4S10A 3A67H 2Q7NA 3G6AA 3N85L 3KPMA 1IM9A 1YY8A 1JGVH 3UEZA 2B20A 3RA7L 3QPXH 4UQ2A 3D39A 4GKZA 2GYSA 4K7PL 4KKCC 3NGBC 2UWEB 4M9OA 1PW3A 5CSBA 3QRFM 3QHZH 4WHTA 2WW8A 3EJZD 4R2GB 3WFBL 3WL9A 2YPVL 2JIXD 4J3WA 3V4PL 3BE1L 5KANG 3LQAL 3VFWA 3HUJE 3WSQL 1ZEAH 3SDDD 4P9MH 3WKMH 1U8OA 3W9DB 4DTGH 1TVDA 4M1DH 3VFPA 2DB8A 2Y1VA 1XF1A 43C9B 5IHLB 1EJOL 1IGIH 1NJ9A 1OF2A 1S5IH 3CFKB 1JNLL 1OCWL 1GGCL 3S3JA 3HS0B 3U82B 1QFWM 2J6EA 4QTIL 3OHXB 4NDMA 4XB8A 5C08D 3X12B 3VXTA 2VZSA 4XNUL 3WFEH 4HS3A 1YEGH 4IMKC 4KJPD 4PJ5A 5CHNA 3S7GA 1NDMA 1INQB 3E1F1 4JDZB 1OT2A 3VG9B 3P4OA 1BJ8A 4HIXH 1WLHA 4JFPA 3TT3H 4ODBD 4TUOB 4Z7VE 3MMEA 2XZZA 4WO4D 1ZXQA 4XWGH 3BISA 3P0VH 1R5IA 4MSWA 1IT9H 1T21B 2QQNL 5GRUL 4HIIA 2V2XB 4LAJH 3IDYC 3P0YH 1OGAB 4JQXA 1ZHKA 4NQDA 4F80A 4MAUH 5H2BB 1K4DA 3IVKB 2EE9A 4XP6H 1OAXH 3WHXA 5EWIH 5I8CB 5F9DC 4F8QA 5KVFH 1WZLA 4JHWH 2NY3D 1JGVL 2OZ4L 5F21B 1NCDL 3RAJL 2Z0BA 4HMEA 1Z3GL 3GMMA 3KYNA 4IRSD 3RIAK 3FFCA 4PD4K 4QRRA 1IAMA 4G9FE 4YIQB 2AJZA 3B9DA 1TPXB 3CFCL 3QUYB 2P7TB 3CVIH 4P9ML 1EZVX 4A6YB 1CLOL 4JKKA 1CD1A 2O5YH 4P4KB 1BF2A 7FABL 3PWNB 4QHUB 1MCEA 3FQTA 5EC1B 1CZ8L 8FABB 4D0BA 1AJ7H 3HRZA 4QGTA 3O2WH 4L8CB 1L0QA 4X7CC 2DQCH 3GSRA 2D7TH 1I9IH 3GBML 3EOBB 3MA9H 4E0RA 4ZAKD 1KPVB 4MJID 4PJ9A 2ZPKH 1UA6H 1MRFL 2J7LA 4DQOH 2YD5A 1X4ZA 3B9VA 4K7PH 3U0TB 5IT2L 1ULVA 5F9JB 1M7IA 3QHZL 2P5WD 2XA8H 1BQLL 3OV6A 4N68A 4NQSB 2P43B 4HS6B 3MV9A 4Y16B 2R8SH 4HIEB 2QJDA 1IQDA 4HG4J 3ILPA 1EUTA 2H26A 1A0QH 2VABB 2PW2B 1WTGT 3HB3D 2BP3A 2OI9C 2AEQL 4R4BB 1BVKA 5JPMA 1NMBH 3NTCL 4WFFE 3TBSB 4U1JB 2FO1A 4L3AA 2GITA 3VXQA 4DGYH 4N0FA 3SN6N 3FB6A 4DTGL 1A14L 3SGJC 2VE6A 4X5LA 4S1SL 4HXAH 4LNVA 2YPKA 4U7SA 4UIKL 4X6BA 2EIZA 1FNEA 1K8IB 4XZUB 4NFBA 3EOTL 3T2OA 5IW1B 1HKLH 4AIZB 4LGSB 3QBTB 2XKNA 2ZJSH 5D7SL 4HUXB 3EHBD 3I3BA 3T0BA 4OCYL 1IGTB 1NQBA 1RFDH 1XGQB 4HGWB 4KGJA 2ERJB 3S5LG 5FM8A 3BH8A 5DEZA 2V5MA 4BZ1H 1W0VA 4FZ8H 3I6GB 2ZUQB 3ETBF 5T1KD 3JV6A 2OTPA 4L4VB 4JFDB 3BP4B 4UOJA 2Q6WB 1FSKC 3GMQB 1QP1A 3QUML 5B21A 5C0IB 1M71B 4WUKH 3M17B 4XWOC 1IFHH 5JW3H 2B1HH 5I76A 2OBGA 1XH3B 2OQJA 3EO9L 4OZIA 2BOBB 1P84K 3VWJC 5FB8B 2QQKL 5EBGA 3DBXB 3CVHB 1UACL 4OD1L 3UTSA 5HDOA 2HLFD 5EU5B 4RMUA 1YEHL 1KELL 5FDWB 1ZGLP 4I2XE 4JDVB 4YXLL 4EDWH 1RV6X 3LS5L 3BPNB 3T0EC 5J0BA 1NGYB 4KTDH 5JIKA 3VH8A 4D2NA 1HHGB 1SBSL 1O7VA 1GCFA 5T3ZL 4ZQKB 5KJRH 2D7NA 4RGNE 5C09E 2HA1A 3G6JE 3JV4B 4MCZA 5C9KA 3FQWA 2C1PB 1I7TA 4G7YH 2PYEA 3IJYA 4QF1A 4PRHD 4M6NL 2WQ8A 3SDCC 3NABL 2PNDA 1QHPA 2JE8A 3ARYA 5J6HA 2XWBB 3PJSB 3CVIL 5KVEL 4NCDA 1D3CA 4Y2OA 3NA4A 3BZEA 3B8YA 5ETUB 2ID5A 3QEQA 1G7PB 4O9HL 4RFNC 3T04D 1ED3B 2E9BA 2AERT 2EZ0C 1YMMA 2B39A 3SQOL 3SE4C 2CKBH 1BECA 3RIAF 5DJXB 4K9EH 2D3VA 5T3XD 2DQGL 5T1LA 3VXNA 4LPWA 4XMKL 2CH8A 4LSTH 4X4ME 5LQBH 4FZ8L 1QR4A 4KVNL 2LAAA 5AEAA 2CK0L 3TYFB 4HKXB 2IBZY 3MLZL 1HIMH 1OQXA 1YMHA 4PJEB 5T5NF 2XA8L 4BH8B 4WI3A 4Q9BA 3TA3D 3C6LB 5F7LB 3WCYA 4G3YH 3MV8B 1NAMH 4EN3C 2DDQL 1EGJH 5DF0A 1SYSA 2X4NA 2VWEC 1A5FL 1J8HD 3EO0A 5C9JA 4UT7H 4NO3A 3ELAT 4CW1A 1U58A 4HKZB 4OSUH 5CMAA 1IEHA 5BV7H 1ZLWK 3GJFH 1CL7I 1WC7A 4WEUD 2W38A 3GO1H 1T7VA 3VG9C 4L3ED 4CADA 2C26A 2N7AA 4PJFA 4N8CL 2N56A 1CF8H 5CIPA 1ORSA 3E8UH 1MRCH 1I3GL 3KPTA 4HUNB 1HDMA 3EFDL 3DMMA 1P4BH 5FHAL 1YJDL 2FO4B 5E0QA 3QQ9C 3HE7D 3CVHL 1JWMA 4X4YA 1IM9D 3KAAA 2B2XL 4HCRH 5BMFH 2Q8BL 4LKXA 1RIHH 5BJTA 3VJ6A 5IUSA 4TTGA 1YEDA 4N5EC 4YDVB 1NCWL 3D2UD 4OM0L 3MBEC 1B0GA 2BVOB 4PRDA 2WWMD 3U2SA 4JPKH 3B9KD 2BHUA 1NC2D 2BSSB 3WN5A 2XKUA 1S8DA 4PGZA 3HG1D 1PG7X 2GJ6A 2JJTA 3TLRA 1G0YR 5KSBA 5J13B 3E3QC 1D5IL 1H15B 1FE8L 1IC7L 4NP4H 4WDIB 5L9DH 5KJRL 4RISH 1J8HA 1FORH 3OKOB 2NY5L 4R97B 4XPAL 4X6CE 4XAKD 4JR9L 3NIFE 1N7ML 3BKJH 2X4UB 4QRPA 5HVGB 1AE6L 3SCMB 2NY3B 1AKJB 2GUOA 3AM8C 3CXHK 4BK4A 5KAQG 2DDQH 4XGZA 3ZKSD 4O58H 5EZLB 4YPGA 3TFKC 3PV6B 4JFXA 5A2JH 1S9XB 5EU6B 4P57A 1KPUB 3SKNB 3FQRA 4G7YL 4L29B 3VRLF 4W81A 3CH8A 4LLMA 4Y5VB 1MFEL 4OQTA 4X80H 5KSBE 5J06A 1QBLL 3BKML 2IQ9H 1T0NB 3D39B 4GKZB 4P4KD 2FATL 3NVQA 1H8OA 2A73B 5GJSL 4KWUA 4RIRA 5DJZB 1FNHA 2FZ3A 4M61A 3HZKA 3T4AB 3VFUB 3VXOA 3B3IB 2D31A 4PTTA 3VXUD 5CWSA 3UPRA 1QOKA 3VFTA 1NGZB 4KXZH 3MSPA 3H7BA 2DBLH 1DFBH 3BSZH 4WTWA 5FHBL 1LD9B 1PG7L 1A4KA 4Y19B 4QRQB 2DLFL 1PKQA 3FB5A 1WWCA 5F1OB 3LAFA 1FDLL 4G8EA 4BYHA 3L5JA 3ZDXF 1IL1B 4TULL 4JZOB 2BMKA 5C0CA 4XNXL 5HGAA 1M71A 4PRNB 1K2DB 2VITB 1C1EL 2V7NB 2Y72A 4X6FB 4X4ZA 1KIRB 4XRCB 3RVXD 3ZTNH 1VHPA 3NCEB 3QJFA 1IC7H 3K1DA 4C59B 4KI1A 3ROOA 1E6OL 2XPGB 2HFGL 4JQVC 3KPQA 1A7QH 2R1YB 4GAYB 4G42B 4ZXBA 4JREB 4LAQL 3CMGA 3P9WB 5B3JE 1FZKB 4TUKL 3K80A 3IRPX 4KMTL 4AQ1B 5KZCB 5DA0B 4PLKC 5DDHA 1NC4B 2A83B 32C2B 2YWZA 2AK4E 5HYIA 3G6DH 4CDHA 2I07B 2XQBH 4PJGE 3IJYB 1JHKL 5GGUA 4OBSA 5LXGH 3PDOA 5F6HJ 5F96L 1WZMA 3FZUD 1XMWA 4XVUC 3HC0A 2AS5M 2X41A 3F62A 4GW4B 4GXVL 1OWRM 4MJ6B 2HH0L 1TJGH 1CBVH 1H3PL 3V7AE 5L9DL 5J3HD 2EH7H 4XC1L 2YC1A 1CQKA 5EUOF 2J88H 1YEKL 4OIBA 5E5UB 5I15L 3DETD 2VZ1A 3A67L 3S98A 5FKAB 1K4CA 4Z7WB 5DVNA 5CZVH 3W2DL 4FNLL 1FN4B 3NACL 3H8NA 5C0DB 2NX5A 4MA1C 1FFRA 2DRUA 3RPKA 5ERWA 4LDEB 4UNTA 1WAAF 3BHBA 1RULL 3KLHD 2GSIA 4MJ2A 5TDPA 3FFCE 1VFAA 4DFIA 2D03L 4G8GE 3NPSB 2XN9E 2Q3ZA 4WUUE 1JNHB 3AREA 1Z9SA 2EDJA 3PE9A 5E2VL 1XIWA 4EI6B 3B6SA 4NNXB 4LDLB 4ZUVB 1MFBH 1UWEH 2I27N 4RFEA 1SYVA 3AY4C 4XMLL 1MCDA 2VABA 4WNQB 4XWGL 4JGJA 3RHWF 4H1LB 5HHXL 3NCJL 4QXTB 3ZE0E 2BVUA 4MCYA 3QXVA 4HF5L 5L0QC 1WBXB 2VOTA 1R5IB 4KHTH 3U36B 4KZEH 1CT8B 1EHAA 2A77L 3X13B 4G9DB 3UBXA 3NN8A 2QQLH 1CE6B 3IXTA 1DQMH 2HFTA 4F9LC 3AREC 5D1ZC 1R3LB 4YHPB 4UV7L 2CIKA 4XXCA 3QZWA 3DECA 4UT6L 1KSRA 1ZHLB 2ORBL 2DQEL 5C71A 1MLCB 1EJOH 1IGIL 4WO4A 3QO0B 4DCQA 5D93B 1IGMH 1RIHL 1KIUA 2EYRA 2CLZA 1RSFA 4Y4FD 5DJ0A 1JNNL 4MZ2A 3ARDC 1FFOA 4ELME 2C3XA 3UYOD 3GMQA 4NQDD 1MCJA 4FOMA 5GRXG 4BZYA 4S2SA 3QJHB 4XBEH 1TETH 2YS4A 1JZ6A 1XF5A 5EC1A 5DJAA 4KMTH 1OT1A 2C4FT 5BOPA 4QRTA 4IRZH 4JAMA 2BVQA 4XVTL 1UM6L 1AGCB 3G5VA 4LSPL 4H5SA 1I4FA 4K9EC 4NN5B 1I9EA 3HPJA 3QP3A 3LD8B 3UJTL 3PABA 1FORL 3R4DA 3KWWB 5JLZB 4JKMA 1AFVL 4PB0L 1BLNB 4QRSB 3O4LD 5I8EB 4FQ1H 4OD2A 4YWGH 3O11B 1BQHB 1RZ7H 1W0WA 5IG7A 1F3DJ 3L3DB 2Q8AH 5FCSH 1FNAA 5IEHB 2EE3A 2ZSVA 2YKLH 1A7RL 2BNUA 5CINH 2IH3B 5J11B 3BPNC 1JPGB 3OTTA 1Q9KB 1MQKL 1JWSA 4L5FH 4JM2D 1IQDB 3RWDB 1TITA 3IJSA 5IBLD 4J3XA 5C8JB 3NGBB 4P2CG 3WLWC 3PWPD 5FYJU 1VGKA 1CK0H 4HJGA 3KR3H 1U3JA 3C5ZC 5IB4B 2B0SL 3ARZA 4GQPH 4NN6C 4S0TD 3EOTH 4NRZB 1LDPL 1HH9B 2M2DA 3IDGB 2GT9A 4MAYA 5MENB 4OKVB 5CEXA 4YHNB 3DGGB 4JVWA 3GI8H 3BXNB 5HVFB 5GS0D 2VL5A 5FCUL 2IQAA 3FQXB 5F88B 4PV9B 1AI1H 1OTUC 2O5ZH 3ARWA 1ETZA 4ONOA 1OGAE 1P9MC 1M4KA 2UYLA 4CL7A 1G6RA 3N0PB 3RRQA 1AIFA 1UJ3A 4H0IA 4B41A 4L4VA 4YH6A 3V6FB 2VTFA 5E4IA 4GRMB 4NWUL 3W0WB 1GGTA 1ZOXA 2EDLA 2MKWA 3BZDA 3MRJB 5C0EA 4U6YA 4DWHA 4PRPB 4GRWB 3D3VB 1RZFH 4I0PB 4TQEH 2G5BA 1BBDH 4EUPG 1N59A 3FCTB 3GMOA 2XY2A 4KHXL 4XX1E 2X40A 1J9CT 4Y4KA 3R8BB 5ICYA 4FQIL 1JK8B 1PFCA 1Z9LA 1P5VA 3EGSA 5D7IA 3VRLE 2YD7A 1JHTA 2XQBL 3BUYB 4NKIH 3GRWL 2V5SA 2NX5E 1IAIM 4ZQKA 3G9AB 1EMTH 4W4OA 1OAYH 4JVPA 1L7TH 5C07A 4FHBD 5KVEH 2E9JA 5CGTA 2ZUTA 2Y36L 2L4OA 5D93C 5ICXB 3PWUB 3V4VL 3PGFH 3TH2T 4YK4B 5D2LB 5I9QB 1RU9H 5C0DA 4XBEL 1KB5L 3BWAA 5MERB 1DL7H 2H32B 4WWKA 43C9A 4IDLA 2EYSB 1YJDC 4XP5H 1IC4L 2BVYA 3OB8A 1ACYH 4ZDHA 3GRWA 2YPLB 1UM6H 4NKDB 2ICWB 4LRIA 5A2KH 2CKNA 4E5XA 2QR0A 5CINL 5AZ2L 1U8KB 5EBLB 4WU7A 2PTTA 3PWVB 1ZT4B 5AYUL 3H3KA 1HQ4A 4PRID 4FQJL 3SDYH 2VQUA 1YN7A 4QXUH 4M62L 5I8OH 1EO8H 1D5XB 1S3KH 4ESKA 1S7SB 3T0EE 1U41A 2V5TA 2AI0L 5F7DB 1M7IB 2CRZA 1XGRA 2DWEA 3S37X 1MAJA 2HMIC 2GTWA 1JN6B 2HJFB 4HKBA 3RVVD 1CE6A 1MFDH 5H35A 5HHPB 4WHDA 2ARJB 5I8CA 1LO3L 2IH1B 5JOEA 3H2WA 1PQZB 3QNZB 3NOIA 2YD8A 4LVNC 1N5AB 3D69B 1XF3A 4JFHE 3GMNA 3FB7A 5CILH 6FABH 1NLBH 1RUKL 3BEWA 1S7UB 1W8OA 2E7CA 1NAMA 4O2EA 3MGTB 3TO4D 1HKFA 1E0OB 1U92B 3AS2A 1K8DA 2VDPL 3FQTB 3QNXB 1D6EA 2VERN 3IGAB 1U8JA 3K81A 1RURL 3FMGL 4Z95H 4Z0BL 1C08A 1FAKT 4KRLB 5EZIL 1KGCE 1S9WB 2NY1B 1Y0LB 8FABA 1BBDL 1J0HA 1NLDH 1LO5A 2WWKO 4NHCH 2FEDC 3PL6A 2YUVA 4KY1H 4M9PA 3OKMB 3QHTC 4NQUA 2BX5A 4OLYH 4NWUH 1UFUA 4FN0A 4PRBA 1QLFB 2X4PB 4OLEA 5JORA 5JPNA 3C8DA 3CUPA 2IAND 3VE0B 3O3DA 4J4PC 1OW0A 5TE6H 2HFFA 2VDQH 4G8FA 4RWYL 4OSUL 4HIEA 1G9NC 5EO0B 4AY0A 1P5UA 2NMSA 2VWEE 2WUCH 3NZ8A 5I71B 1KCVH 4U1GC 3OKYA 4JREC 4Z0XA 3PP4L 3CXDH 1F13A 2HT3C 2P8MB 4KUCD 2XZQL 5IBUG 4JN1L 3CSYB 1A6TB 1KB5H 5T1KA 5EZLA 1JUFA 5MP6L 1IAKA 5JW4N 4RWHA 1YY8B 1EX0A 4HC1A 4WWKC 3UTTB 4P3WA 4YHOH 1MFCH 3ULSB 3BMWA 3QWOB 1NCWH 1WQVT 2PYFB 5D2NC 2HVKA 4HD9A 5IFAL 2IG2H 2NY4D 4QHMB 2Y06H 5IMLA 5JMOC 1HHJA 3WIHH 3B9KA 2GFBA 4FFVD 2QQQA 3ZYZA 3SE8L 3DNKA 4EI5D 4N90D 3S96B 3SKUD 4ERSH 3TH4T 2QKIB 5DSCB 3FQXA 2Q76A 3BPOB 2OJZL 4LARH 1A64A 3RA7H 3JWDH 1EA9C 3IDMB 5JW4R 3BFOA 3IF1A 5DVOA 5D1XB 4WFHD 1BFVH 2V5RA 1KJ2B 1V3JA 2DQFA 3HRZB 4ZS6C 5HJ3A 5JA8B 3L3OA 5HGAB 1B0RA 4JY5L 4PRAA 3RIFK 3VGAC 2CR6A 4XCFH 4OZFA 5H8DA 2H9GA 4GSDL 5CILL 1C7SA 2Z92A 6FABL 4Y19E 4PJBF 1IQWL 4Y5VA 5FV2A 2VXSH 1ZKAA 1MJ7H 4GXUN 3D85A 3WHE1 1WBXA 4ZXBC 1JYNA 2A73A 5T1LD 5BRZD 1RUPH 3VCLB 4R97C 1FAIH 1A7QL 1F02I 1GZQB 4NQDE 5F3BB 3NZHL 4I3SH 3UJIL 2R69H 1I1AC 1IAOA 1F00I 5BZDB 2W9EH 1RUQL 4U1JA 3AVEA 3UP1A 4BZ1L 1F8TL 1F4HA 4HQQH 4G6ML 2E27H 1CVRA 3UZEA 3W11D 1J1OL 4N5UA 4JPWH 4NZTL 3P3YA 4LPCA 1NCUA 4U1LB 5CP7B 5GGTH 3V5KA 1BEYL 5GRJL 5IOPA 5JUEL 4G6KL 3ZDXE 3ZKMD 3VXRD 2XPGA 2HVJB 4AL8H 4L8CA 4M4RA 1JV5A 2CGRH 1P4LB 3C2SA 5DD6B 1BFVL 4RBPH 5D71H 1B3JA 2NY2D 1S7QB 4P5MA 4ONHA 2WBJB 3DUUA 4D0CB 4L9LB 3EJJX 3CDYA 3LV3A 4LLWB 3ESVF 1NAKH 4M5YH 1MCPL 4LOUC 3BT2H 3B2VL 2AEWA 1U58B 4HKZA 5FO9B 2LQRA 1HQRA 2IGFH 1XIWB 2F5AL 3VGFA 1AO7B 5D1QC 4KKBC 4NQEA 1YEEH 3IXAA 4JG1H 4OCNC 1OAKL 1JWMB 4X4YB 15C8H 3DXAE 4RFEB 2IG2L 3JWOH 4RDQG 4XPFL 1R0AH 1UZ6F 3SO3C 3GKZA 4XCNB 1HZHL 2C1PA 3RU8L 5D9SB 1XR8A 1GOHA 1LEKA 1P53A 2NTSP 4M8QA 5I1AB 2VDOL 1QEWB 1S9VB 4KJYA 4OGAC 3H9HB 3ROLB 5ABDE 4PP1D 3WNNA 4DUXA 4JY6A 2JJSA 4NFCA 1MWAA 3Q6GL 5FUZL 2IMMA 1JPTH 1NCCL 3KLAA 4TSAL 3FQUB 1K85A 3VXTB 3OKMA 5A2FA 1DCLA 4HK3J 3QFJA 5EIQA 1MCHA 3E6FB 4BKLA 5F1KC 1FFOB 5TPWL 4JZOA 2BZDA 1WIOA 4CMMA 1Q0YL 4OCWH 3VD3A 2N7BA 3LKSA 5KS9E 1A21A 1D6VH 2XWTB 5K93A 1LHZA 2RQ8A 3PWPE 1DE4A 1P7KA 5EG6C 3UJIH 4QXGL 4U1HA 4KTEH 1T6VN 3U9UB 4XPTL 1GYAA 4KDTA 3MRMA 4E41E 4KFZC 3ULUD 4GW1B 5IMMA 5DK2A 4JDTH 4X6DB 12E8L 1FZKA 4O4YH 1KCRH 3ORJA 4NQSA 2LFGA 4G9DA 1V05A 4PY7B 2EH8L 5E6ID 2Q8AL 2KDGA 3LDBB 4OZHB 1A6UH 1RUQH 3CX2A 1XGYL 4YHPA 1BQHA 5EOTB 1HYRC 3OKKB 3QQ4A 3GSVA 3RTQB 2HLAB 4ZO9A 5LJYH 2BNUB 3NFNB 4L3EB 3K4AA 3PHQB 4HWBH 4TSCH 4XC3H 4Y4FB 4X9FA 5D2LF 4X99B 2DQDL 4UNUA 4JZNA 4RA3A 4U1IB 1KLGB 3C5SB 5GGSY 1C5BH 1G7LA 2KUTA 4UOW1 4Y1AB 2OXGA 2HG5A 4ZDHB 4HJ0D 1CYGA 1JI1A 1QFPA 5C6TH 25C8H 3Q5TA 1QFWH 1W72A 3IF1B 3MLPA 1ND0B 5IW1A 4J8RA 2VL4A 1K2DA 4R2GD 4F57L 2AGJH 3WUWB 4IRJD 4X9GA 3MC0A 5CEZD 2P44B 5J1TC 1EVUA 3EYSL 2A38A 3X3FL 3T2NL 3OR7A 1W0VB 1A3RH 3IFLL 4Y8DC 3BN3B 3U30B 5ISZE 3O9WD 5I8KL 1P1ZB 1N5YH 3SO5A 2R0ZH 5D2NA 3RGVA 5MI0B 5IG7B 3I02A 4MHHG 1U2CA 2P24A 3BRGC 3MV9B 4XB7A 5B22A 4FTVA 2VISA 3FO2A 3KPRA 5CJXA 3HC0B 5D8JL 2ZUSA 2LU7A 4RRPA 4YHLL 4NWTH 3UTSB 2YD6A 1MUJB 3MMEB 2GAZB 1YPZF 1FGNL 3BDBA 1PY9A 5I30H 2VXQL 4OLZL 1YYLL 3HAEB 2PW1A 1ROWA 3MUY1 3ULUL 3FT3A 3ARDA 4MAYD 3BYYA 4OZHF 4TSCL 4XC3L 4BFEA 3ARSA 2FB4L 3HE6D 3SDXE 4HFWA 5LGHL 5J1AA 1T5XB 4G8GD 4XXDA 4UILH 4I18B 4IRSB 5A16B 5CP7A 2CMRH 4DGIH 3MRDB 4M5ZH 5IHZA 2XFXA 3BH9B 4PY8J 3OKEA 3IDXH 1S8DB 3U7WL 4DCQB 1CICD 1LD9A 3RZCC 1U93B 4WY7L 4XP5L 2BNRB 2X9WA 1JJUA 3MUGB 4MX7B 3M17A 3TNMB 3TWCL 1C5CL 4K8RD 2PO6A 4BUHA 3RKDD 4I0PD 4XPTH 5E24E 5F6IB 5F1IA 1BD2E 7CGTA 3S5LA 1A9BB 2XYCA 3QIBD 1G9ML 5L2JB 4M7LL 1HQRB 3GSNA 1JGDB 1I1CA 3L6FA 2O5XL 3VW3H 4NPYA 4Y4KD 3KPPB 4K3HA 3WIFA 3I6LE 3OJVC 3PABB 4YFLI 5AZ2H 4DQOL 1K4DB 5C7XL 1JHTB 5I1HL 3NA9L 1DQQB 1R5WA 1D5XA 4XPBL 3O6LL 4OD2B 4IBLT 3KPLB 2KZWA 1P9MA 3VD9A 3RY6C 3S35X 4YFEA 1V3MA 5IB1B 3C6LC 1NUDA 3G6JB 2M1KA 4UAOB 1RJLB 3KXFE 3NCYS 5IEKA 4XBPB 1NLBL 3BWAB 5MERA 4ISVA 5HY9A 4C56E 2WK2A 2PXYA 2K7PA 1MWAB 2Z8SA 4OZGB 1CD1B 3MOBL 3VA2C 1EEZA 1YN6B 2W1NA 5T1LB 5GS1C 1PSKH 2VXVH 4KPHH 3BJLA 2YOCA 2Q7YA 1WCBA 3D0VB 3FRPG 1RFDL 4HGWA 3UPCA 4P2QD 3QISA 4KY1L 3QA3A 4LCUA 3OXRA 4NRYA 5BOZG 4HK0A 2A6IA 5JXAH 5H37G 4ZOBA 4LLUB 5IVZB 5D1XD 4NC1C 2BDNH 4P46B 4YX2H 4R9HA 4OJFH 2VDQL 2Y7QA 3KWWA 2DWEB 2VLKE 1MAMH 1MFNA 4PRPE 2EDFA 3BKCL 4B53A 3IS1X 1G7HB 1T2QL 4M6MH 3DBXA 2VXQH 1FLRH 4MNGA 2X4QB 1RUAL 2P4AB 2V9QA 2EDNA 3E6HA 4YXLH 1OP3K 3OAYH 3OF6A 2ZJSL 3BGAA 3NIGF 4FFWD 4WI6A 5EU6A 4H8WH 2L0DA 4BELD 1IC5L 4P5TD 2DBJA 4PJXB 2HJLA 3KJ4B 1E4XL 3DVGB 2APBA 2IC2A 4UILL 1BQUA 1U8JB 4OKVA 1JGEB 2Y06L 4IMLB 5CEXB 4DKDC 2D7QA 5SWZA 1CLYH 1Z3GH 3KHQA 3PQYA 4YK4C 5I9QC 4GW5A 1EPFA 4UTAL 2C3VB 1QBML 3PG2A 2ZUYA 5IFHH 2UUDK 4KAQH 4MNQB 5ISZA 3W5NA 5KSBB 3UPRB 4PJCA 2R0LL 2X10A 2OZ4A 2ZG3A 2IPKA 5EOQH 3DV6A 2B1AH 2GSIB 5AWNH 5EU6E 5GIRA 5J12C 3FFDB 5TGBB 5TE4L 4NKOB 3ARVA 4RAUA 5DO2D 1MHEB 2NXZC 2XV6B 1MJJB 3R0MA 3IKCA 3RGHA 2WUBL 2J3SA 3MFFA 4N0CC 3T0XA 1ZV5A 1JGUH 1WICA 5E6ZA 4M7LT 5E2VH 1NFDF 2PTTB 3H42H 4P57B 4YDIL 1HSAA 3BP7A 1NANH 3RZWA 2NY2B 3O2VH 4B7LA 4XI5D 4K2UH 3NIGE 5FDYA 3C2AL 4QRRD 2I07A 4Y4KB 4Z7NE 4PJEE 3OGCA 4NZJA 4A2MA 2ED8A 3QUZD 1XFPA 5I1GL 5CZXC 5D7JC 5GGUB 5CMAB 3VCLA 5CAYB 4IOFC 5EU4B 3V7AG 3ZE1E 2BCKB 4MVBC 2R69L 3GEWB 1BHGA 3H9SE 1Y18A 1FPTH 2ATPA 2GTZB 1LMKA 4HBQA 5A3ID 1N6QH 4ZAKB 3MBXL 4F7PA 1TQCC 1MJUL 1I8IA 3B5GA 4HG4K 5ALCH 2J6EH 2MFNA 2KKQA 1OPGL 4ONGH 2H32A 1XIWC 2YPLA 2EC9T 4OCYH 4JO1H 3REWA 1D6EB 3MLRH 5MENA 4Z7WA 3S36X 3QQ3B 1IAIH 3Q1SH 1CQYA 1OAZL 1FL3B 1BVLA 3DUHA 4ZSOB 1YQVH 4I18C 5DK0A 4U3CA 1NH6A 2LAGB 1KTDA 1LO5B 2ZUVA 4YHZH 5AUMA 1A1NB 4G80B 1BWMA 2Y5TA 3MLWL 2FX7L 4PJ7F 2BNQA 1INEH 1T04A 4LPVA 5EOCL 2QSTA 3MRGB 4PJFE 2YPLD 5D1ZA 4JO4H 4W6WB 3ZT7A 3D25B 3QI9B 3LH2H 3C60A 3LZFH 2WZPD 4L9LA 1MHPH 2CXGA 4P46D 4DOHB 1JNHA 5L88L 4GUPA 1UXSA 3UTQB 2YK1H 3MV01 5ID1B 4HWEH 3D3VD 3HCVA 2FWOA 3TVMD 3PV6A 5GJTL 3VH8B 1WISA 5FO8B 4J3OC 1A6TA 5T1KB 1H5BA 2JK5A 4H1LA 3NA9H 2P48B 1KNOB 2X70A 4RAVB 3GNMH 3ZKNC 5D7JB 1R3IL 1J1OH 1QBLH 3CGTA 1WIUA 4U0RC 1ZT7A 4CN6A 4DKAA 1RZ7L 1ZLVH 4NZTH 5HYQB 4OI7A 2EC8A 3N1QC 1BBJA 5DRNA 3DGGA 2AW2A 1J1PL 2AXGB 5ALCL 2AV1A 4AL8L 1TTUA 1ZLVK 1DLFL 4PV9A 3Q6GH 4XNXH 3ROLA 3QUYA 4Q0XL 3BKJL 5DHXB 4A6YH 3H7BB 1VA9A 4NC2B 1AI1L 5DS8B 4UTBH 1I7ZA 2DLFH 3K8KA 5KSVA 5DR5L 5DURB 3TO2B 2MNUA 3BPLC 3HI1A 3GHEL 4N1EA 5INCB 5TPWH 3UTZA 1QSVA 1OM3H 1HH6A 5IMKB 3HUJB 3GUTA 4M6OH 3LPFA 4JRXD 4QCIA 4U4BA 5DMJB 3O2VL 3O6FA 4NQED 3GIZL 2G60H 2F54B 2W0FB 3GHBH 2J8OA 2BFVH 1I1AA 4ETQB 1AQKL 1RZJH 1CGXA 3WXWH 3MV7A 4OT1L 2VLJA 4YX2L 4PG2A 3HMWH 1S7SA 5DDHB 3NPSC 2MPAH 4JFZH 4MMZC 4NO3B 3SDCD 5C2BL 3Q0HA 2AK4A 5FA3B 3MCLL 1M7DA 4I3RH 4WW2C 4CADB 2CIIA 1RIVH 2ADIA 1NEZA 3HLAA 3L3IB 4HFWB 4CAGA 1GVIA 5T1DL 1JHKH 4TPRH 1EJ6A 3CAFA 4I48A 3UAJD 2J8UA 2DQDH 3PGDB 2W60B 4GMTH 3PL6D 1FZMA 3WS6C 5DQJA 2IAMC 3QUKB 1IL1A 3TNNB 1HI6A 1U3HA 5D1XA 1JMZA 3QJHA 3BXNA 3ZE2E 1I9RH 4U1LA 5MENE 1DVFD 35C8H 1T5WB 4NKMB 5EZOL 3E0GA 4BJLA 1J0KA 2IF7A 2M8XA 4LEXL 3UDWA 2O61A 4HWBA 3KLDA 4FQXD 3BAEL 3QI9C 4KZDL 5E99L 5L88H 3CD4A 5C0NC 5I8EA 1SM3H 4POZC 5IJKA 2VQ1A 2ICWI 1Q1JL 4MNHA 3ZHKA 3PDOB 3FCTA 1JZ5A 1QR1A 2H2SD 4NWTL 5H35B 4MNQD 4JPIA 3D3VA 5HYJB 1X5HA 2HKHL 1R3HA 3MLUH 4KUZL 5LCVL 5FYLH 3WMSA 2A74B 1A2YB 4Y5XA 5E8OA 5GJSH 5LBSH 1A14H 3MOAL 3QXDA 5I1KH 1GGUA 1S3KL 2ADJB 4UT6H 4ZPVA 4WI2A 1C12A 1KOAA 2WBJD 2CD0A 4Y1AD 1EEZB 3MBED 2PO6D 1FIEA 5FOBA 3C5JA 3TPUB 2B5IC 5KVDL 5HHVH 2QQLL 5E9DA 3L1OH 1FGNH 1RHFA 4QRUB 1FN4A 2BHZA 2DMKA 4LF3B 4JRXE 3N1MC 4J8RB 5B39B 3BI9X 4TN9A 3DVIA 1DBKH 1VPOH 2CMRL 4FQ2H 2VXUH 3QQ3A 1I3VA 4JQIH 4EI5A 2DIBA 1J8HE 1P6FA 2NXYC 3QPQC 5A16A 1ES0B 1YEIL 2FEEL 3FQNA 4FQLL 4LLQB 4OD3H 4MQSB 3VD4A 1EEYB 4MXQD 1A7PH 2VDPH 1JNNH 3MCKB 4EN3B 4MD4A 2EYSA 1FO0A 5ACZB 4GG6B 1OAZH 3LDBC 3F7YB 3MUHL 2P8LB 4JFHD 1Y6NR 3EDEA 4KJQC 3O3EA 4I0PA 2COQA 3HPLB 4U3HA 3WDIA 4YBLB 4WU7B 1GIGL 4NQEB 2Z8VC 3R8QA 4X98B 3MODL 1JGDA 2J12B 1ZLSL 1CICA 1VADB 5I1HH 2FR4B 4IHOB 1XGRB 2VZVA 5DJ2A 1U8NB 32C2A 4WW2B 1DEDA 3EYOB 4WI9A 3VXSE 3ARGB 1OY3B 4UV4H 2ZOLA 2V17L 1CD9B 3F58L 3ARBC 4G43A 3L5IA 1FGVL 4DGIL 5J1SC 4GQ9L 2B4CL 3S37L 1Z0NA 1AGEA 1LVEA 1JBJA 1DQDL 5E2WL 5ISZB 3ARPA 2C3WA 2D7PA 1KB9K 3L1OL 5DSCA 3CFJA 1A3LL 2X9YA 3C5SA 4C58B 4M7JH 4OZ4B 3TNMA 1X4XA 3OXSB 3MRKA 3HA0A 5E6IA 4OFYA 1DUYA 3TYGL 3UMTA 1GOGA 3IFOB 5B38G 3O4OB 4YZFE 2FJFB 3ULVD 3B4NA 2BSSA 1ZWIB 2HT4D 3WE6A 4R0LA 3TZVC 1E28B 3MA7A 5E99H 3B43A 5CJXC 1TQBB 4ZPTA 4TVPH 1OQOA 4FQHB 3HZMB 2JCCE 5D70L 3EYQC 2NTFA 1KC5H 4YDKH 3KXFB 3S9DB 2DYPD 4OGXL 4GG6F 3LV3B 4XP9L 4U1MB 3VFOA 4MQ7A 1WITA 3MYJA 3OB0H 1WZ1H 3OKKA 2H45A 3I02B 1JN6A 3MLUL 4KRPB 1RK1B 4WWID 2R2HB 3MOAH 2AEIT 4JPVL 4TQEL 4X6CA 1EXUB 3KDMA 3EFDH 3NZ8B 4QRPE 5KZCD 4HBCL 2OL3B 3B2UC 4XNYL 5HD8C 3QO1B 1AD9A 1DN0A 4ZFZB 2XKSA 2Z31C 3FOMB 3EJZC 2IANB 5DQJB 4FQ2L 3GMLB 2VZOA 3SCMC 5JA9A 4I3GA 4PP2A 1F8TH 4ODSL 1I8MA 3AAZA 5KVMC 4YHYB 1OGAD 1C08B 2VR9A 2VL5B 4UAOC 5SWSA 4LRNH 3ZTJH 1XF4A 4OD3L 2VLKB 1WTLA 1T0MA 5DK0B 4KROD 2PR4L 1YPZA 5I1DB 4RGNC 3QNYA 1WFTA 1CFSB 1SEBA 1SVZA 4DW2H 5HGBA 4K7PX 2YEZB 1E4JA 4GAJH 5D7LA 3L7EB 2I9LA 4HW6A 2YD9A 2P46B 2QEJA 2YSSA 4WW1B 4GMSL 1S9KC 1DLHB 3B9EA 1YEJL 3TESA 4U1NA 5F89B 3C5ZA 4ZUTB 5ACMA 3DPBA 3SHSA 3N50A 4LASH 1LEGA 2RHEA 4X9BA 5C0CD 1RMFL 3VXPA 2VQ1B 4RA0C 5I73C 4O02H 2E9WA 4LCIH 2R9HD 5IFJA 1QQDB 2ARWA 2WQRA 5CGMA 1YYMH 4L8SC 1WEJL 4Z6AT 1FO0L 3I50H 3BRFA 4ODWA 1U3HC 1A8JH 3B9AA 4OZGF 5ANMA 2XRAL 1NUNB 7FABH 4CN4A 5SWQA 2VDLH 3Q6FB 5CP3A 2YXMA 3TT3L 2GFBB 2IGFL 4XVJH 5FUOL 3MFGB 1JTTA 3D39E 4JRYA 3P4NB 5DRXB 5B4MC 3GSUB 5J6GB 1NBZA 2CPCA 1JPFA 4K3JH 1EH9A 5F72S 5IHZB 2ZCHL 4EEEA 2AXHA 4LP5A 2DM2A 2VLME 4AIOA 1OF2B 4UQ3A 1T7ZA 4OGXH 3MXVL 4F15C 1RUML 3F5WB 5LG1A 2Z91A 4NDMB 4ALAH 1SQ2N 1X5ZA 1FHGA 3OWEA 4FG6D 3QXAA 5ENWB 5DQ9A 4ODXA 1OAQL 1UQSB 1KN4H 3SKOB 2RFXB 3ARQA 4C56A 2AXFB 1C1EH 3MRNB 4HULB 3JWDC 3MV7B 2EIBA 1P4IH 3SEPA 1YQVL 1FSKB 2J8HA 1U8MB 4TTDD 5EIVA 3RBGA 1N8ZA 1QRNA 5LXGL 4JM2C 3EZ8A 1OTTC 5IBLC 2EEBA 2E8ZA 2ADGB 5T3ZH 4DZ8B 5C0RL 3P0VL 4JHWL 2FH6A 4BFGA 3DGCR 1UA6L 4Z0BH 4D0DA 2UVFA 1D5BB 4I13B 5I66A 2HWZH 1U92A 1ZTXL 2FYYB 4PJ7A 4B5EA 1X5LA 5F97E 5IROC 4Q6IB 4UU9A 1Z6JT 3F7VA 5DHVA 3TJHC 4LCWB 4I5BA 4D9RD 3FN9A 3CPLB 3D5OF 4UDUB 5EWIL 5KVFL 1WCBB 4M7KL 3IRZA 6CGTA 1C5DB 3T2PA 3IU4H 1Y0LA 3MLVL 1W72B 3H3PH 3QIUD 1SY6L 2XFXB 1CFTB 1ZAGA 2XACC 3OKEB 1A7BA 4Q0XH 4PJBA 4WCYH 3V6OC 4RAHA 1UVQA 2BNQE 1CTNA 3MO1B 3VFSB 3PWJB 4AT6B 3JWDL 1J1PH 4U1SB 5E5MA 4L8SA 1DBJH 4V2CB 1CZ8H 2E9IA 2X4OB 3I9GL 2DMBA 5HI5D 4GUPB 1N0LA 3BJ91 3RI5F 2XICA 3D0LA 3MGOA 4YHML 4FTVE 2AJUL 4LU5H 4XTRD 3A6BL 1ZT4A 5JIPA 2NW2A 3HAEG 3EYSH 3OKDB 3NCMA 1DSFH 3L95A 5CSZA 1B6UA 1MCWM 3MLXH 4URTB 2FECL 4GW1A 2H8PB 4M7ZB 5L2KD 3QEUA 2R4RH 5JQ6H 4NGHH 1JTPA 3MCLH 3QEGH 1IEAA 5A43C 2A0LD 1MNUH 4S1SH 4MYWB 4WVRA 3L3KA 4ELKB 3S3PA 3CFDB 1FBIL 4PJIB 1F4XH 4GRWH 5DLML 2HLAA 2NZIA 4GBXA 2BXZA 2M26A 4ISVB 2JB5H 4OFIA 1B2WH 1NJ9B 4K3GA 5GGSB 5C0AD 1JPST 4F7PB 1N0XH 3JVGA 2IWGA 3L7FA 4WFGD 5HYSB 3GKWH 5A2LH 5F7FA 4KK9C 3OAZH 3BD4A 1CLCA 3ESUF 3JTSA 4XHQA 1MHCA 4X8JB 4NZUH 4OB5H 4JANB 3QDGB 4P2OA 4BK5A 1UXWA 4YBQC 1EFQA 3VXSD 1GSMA 5GISL 2DQHL 4YQXH 5J89A 4R4FH 2W0PA 4M6AA 3BVNB 1RZJL 1S78D 4XX1G 2VZ3A 3GSNB 2BRRL 4YC2B 2X1XR 3AXLA 2DM3A 1S7QA 3WBDA 4MWFB 5EC2A 1CGUA 1HHGA 4BQ9A 1FVCA 1GGBL 3RNKB 3MLSL 4PGCA 4RGMC 4UUJA 1W72H 3W0WE 3O8XC 1HIML 1MCOL 1TTFA 2X1WL 4JN2A 3MRLB 3KPRB 1T66C 1S7WA 2V2WA 3Q3GB 4AG4H 1H0DB 3DX9B 3SDAC 1UWGL 2E7HA 4G9FD 3K74B 5F8QC 2VLMD 3RY4A 3TCLA 3TNNA 4N0RA 1TJHH 3MPCA 5TDOB 5DJCB 5DMGC 2F9BT 1IBGH 5E1HB 5I18L 1IZJA 1TVHB 1EEQA 1FL3A 3PWPB 3UTOA 2WWMC 2APVA 2UWEA 2HKHH 5FYKU 1OP3H 4GW5B 1S7XA 3CLEH 1DVFB 2VXUL 3BZ4B 4TNWK 3T0WA 1QNZH 5EU7C 2AXGA 4KVNH 4MNQA 2AVGA 3KPRD 3T4YB 4FQXA 5J56B 2Q76B 5CD5C 3O81A 3MJ7A 3QIUB 4PJCE 5AD0B 4M1CD 2NXZB 4HHAA 5ALBL 3VFRA 4YEEA 1H9VA 2P49B 4C4KT 4JRWA 4OM0H 1IJ9A 5LWYH 1AXSA 1F2QA 5BZWA 3TBTA 3IKCB 5JHDB 3ULVL 2PXYC 1BJMA 1G7QA 3D1MC 2FH8A 2HT3D 1MF2L 2KBGA 3ALXA 1AC0A 3PWVA 3VGEA 3FRUB 4TSBL 5GXBB 5JHLH 5EUOE 1FP5A 4UINH 4KK8D 1OAXL 4MNGB 5J8OA 1D5IH 3UTPD 3P73A 2BNRE 3UC0L 3ARFD 1AXIB 4GBXC 1FV1A 4J6RH 4Z9KB 3RWFB 4HKJB 2VLRB 4KHXH 1MAML 5KVDH 4NQVA 4LMQI 3X11B 2JB5L 2F8OA 1JRHI 1A6ZB 2H6PB 5J1AB 3BGMA 4JRXB 3MODH 1ZLSH 4WUUA 4TNVK 1CG9B 1PKOA 4WV1C 3ZT5A 1A6VH 4LP4A 2VDKH 3BEWB 2LV4A 5FM5O 5GQBA 3EYVB 3KLAB 4Z77B 5CCKH 3SKMB 5D7KE 4Z78A 4KK6D 3QUKA 2OTWB 3CLEL 5IGXL 1G7LB 5EOCH 1CLOH 1FGVH 2Q6WA 4KVCH 1BZ9B 1JGLL 4JFFA 4NO0A 4Q9QH 3MACH 2YBRB 5E00A 3O2DL 5DEGA 4XCEB 1HH6B 4M7JL 3GJEA 2D7TL 5KSAD 5I71C 2PTVA 4YGAB 4XBGB 1TJIH 1FNSL 3O8XA 1SMAA 3BPCB 3ECBA 4C83B 2VKWA 5IMMB 4G6AC 1CGTA 1NEUA 1I1YA 3CUPB 4ZXBD 1ZHNA 3VE0A 3RI5K 1FFNB 3S36H 5SV4A 2IPUG 3G04A 4Q2ZA 1CWVA 4GRLB 1G7HA 5D2NB 2PF6A 5I30L 4HUUB 5L6YH 3EJYC 4AG4L 5DFTA 4WJ5B 3QIWD 3WIHA 3HZVB 4HFUL 2Y7QB 4LGPB 3SO3B 43CAA 1SJEA 5M7QA 4KMQA 1HOCB 3SGKA 4PB9L 2HFEA 4LVEA 5JW4M 3KJ6L 5FOJA 5D6CA 1DQDH 3RWCA 4DN4H 25C8L 1DQML 1K6QL 3B9KC 1ZGLB 2FIKA 1CDCA 1GPOL 1QD0A 2PN5A 4LSDA 4D9LL 1I8IB 4AYFA 4EOWL 3QG7H 5CSGA 1QSEE 3F65A 1F6FB 3QWRD 2IANA 3D18A 1QFUH 3GMLA 1J05A 2EKJA 1MELA 2ZP0T 4KJWD 1N3NA 3DTXA 1HILA 5DRNB 2QADB 1A3RL 2YPLE 5HDBF 4LBEA 2XKNB 1UWEL 3DSFH 3KYAA 3PQYB 5DZLA 3MRDA 1GZPA 2CRMA 3JTTA 4XAKE 4CMHC 3IDXL 4JY4A 5JR1L 3DRQB 4NUJB 1LWRA 3KJ4C 1Q9LB 3IT8D 2GW5A 2JCCB 2MCPH 4CN1A 3DROA 4KDVA 1FZJA 3UBXG 1NC4D 4HMDA 4MNHB 4N0YH 4OLWL 2GKIA 4MWFA 5EC2B 1NC4A 4K55A 4GKSA 4Q6IC 4OLZH 2W9LA 2F53D 1MUJA 5F9OL 5BO1L 1PVHA 2A6KB 2HT2D 2BRQA 5HSFA 1ZANH 2YUWA 1JVKA 4RSVA 2C3GA 3ZKQD 5ITBH 4U1GB 2P45B 3L6FB 4Q9RH 2NY6C 3EFFB 5B8CC 2BVPB 2VUOA 1MHHA 4I1NB 1D9KB 1KIQB 3MROA 3ARED 1FG2A 1LE5B 3T65A 4F7EA 1J5OH 2Q86B 1JGLH 4W4NA 5B39G 4M02A 5C0CE 2ESVE 2FGZA 4HMCA 1G1CA 5KBNC 4X83A 4ORGA 4FFZH 3KHOA 2XQYK 1CK0L 3GMPA 2D7OA 3FQNB 1X5KA 1AGEB 1MCLA 2X5PA 2VDLL 3X3GL 4EI5B 3JV6B 5D7LE 3GSUA 5J6GA 4U0RB 1G7PA 2W91A 4U0QB 2AJZB 3CNKA 4ZAKA 5JMRA 4NO5B 3WS3A 3IETA 3O4OC 3PQYE 1RULH 2QADC 4ZFFA 4LCCC 1U6AL 5TH2B 4TNWF 4MQTB 1BOGB 5F7UA 4LSTL 2HN7B 4QGYA 3HHRB 1HSBA 2E7LA 5C0JA 1CDUA 4KDTC 3DO7B 1XAUA 2DLEA 4XCFL 1T1XA 3AY4A 1SHMA 3X3FH 2JJSC 2SEBB 3HRPA 4DGVH 4ZUSA 3HPLA 4J1UA 4TUOA 4KUZH 1KBGH 4ODHL 4PJ9B 3TF7C 4XCCH 2EE2A 1QLRB 3I50L 4MSWB 4JLRA 3RDTA 1NPUA 5DQDH 1LDPH 4AM0A 4XHJC 3BGFB 5E95B 2DWDB 3NZHH 4I3SL 4Y4HD 4P2RB 4NRXA 1P4IL 4PGEA 3MYZA 1FYHB 4JZJA 3P11H 2CDGA 3RPIB 2WBKA 3GSQB 4OZIE 4I48B 3MNVA 3LEVH 2P7TA 2EIEA 1QFUL 4P23B 4M00A 4UQ3B 1L0XA 5E6IB 1D5BA 4OCRL 5FOBB 5C2BH 1A6WL 2ZKHL 4P2OC 1T4KA 3VMPA 4G6MH 3TJEH 3H9HA 5IB2A 3PWNA 2R1WA 3DX6B 1LEIA 1VFBB 5BO1H 2XN9D 4KJPC 1UCBL 3BN9C 4HV8B 2AV7B 3BGFC 4CJ0A 1JRHH 4OUUB 1HXYA 3WO3B 4XNMA 2VUYA 5BS0A 4UDTB 2GQHA 2I9LB 3CDGB 4L8DB 4KQ3H 3I6LD 5B8CA 5IMKA 3QWRA 4FXLA 1QA9B 4ODUB 2WSKA 1RK1A 5F7EL 2I5YH 2XWTA 1UJ3C 3M1BA 4K94H 4KV5E 5DJ8A 4QRSA 4JDZA 3O6FB 3RY5A 4K2UL 5FO7A 5E9DD 5IBUB 4YDLC 3N85H 3C8HA 3RL1B 4PBVC 3JWOL 3N06B 3SE3A 3QRGL 5T1MA 5I1CL 1T1YB 4Y2DA 3KXFD 3X3GH 5MHSE 2W0FA 4KTYA 3ARGD 4R4BA 5IF0B 5IW6A 2R23A 4QNPE 1KPUA 3SKNA 4UTAH 5CUSH 3ARBB 3RWGB 5L7XH 4WHYG 4FFZL 3QCUL 5GS0L 3SGDI 4HJGB 3KPOA 4P5KB 3P0YL 3O41A 2AP2A 1R3JA 2APXA 4JFED 2PETA 5TQ2L 2CQVA 1KXQE 1CFTA 2W60A 1RJLA 1KJ2L 4KK5C 1KCLA 5GGQL 1IILE 3MQIA 2IPKB 2IQAB 2A9ML 2OZ4H 2DQUH 1L6ZA 3CFKA 1NGZA 1YDPA 5EO1B 1YMMB 1XT5A 3G5YA 4L4TA 2D4DA 2IADB 5TJWK 5I0DA 5KN5A 3MLRL 2P1YA 1U9KA 4L8BB 5GZND 4BA8A 2O5YL 1T89C 1ZS8B 1H8SA 4HWZA 3C2AH 1RHHA 5J9PA 1QQDA 1MCQA 4M48L 4ZS7H 5K33A 4GKSB 4ODXB 3WD5H 3O3AA 3BP7B 4ZFGL 4FQHA 5FXCH 1N2RB 4H0GA 4WNQA 3FQRB 1UWXH 1NMAL 5I19H 3MRNA 1T1ZA 4OAWA 5F96H 3C6LA 5DXWA 2P5EB 4QXGH 3QUXC 1NGYA 1P2CB 5GSVA 2NY5C 5F3HA 4LHUB 1AO7E 3MJGX 3KPNB 2Y4SA 3C60B 1HK6A 4P0DA 4CVZA 1FG2B 5KS9B 4JHBA 2EH7L 2F19L 4L9LC 4XC1H 1G7IB 2Z35A 4NSKA 4JM2F 2KPNA 1UB6A 4NIKB 2Z31B 5EO9B 1NBZB 5HPMA 3THML 4OCRH 4NJ9L 3LKNB 1DBMH 4DUVA 4PFEA 2Y6SC 4EVNB 4GBXB 3RTQD 1PX4A 5D7KD 4FNLH 4X6DE 1QPPA 1KT2B 4GQ9H 3HG1A 4BSVB 3DX9A 1U3HB 3TIEA 4MJ6A 4WWKB 4LKXB 1A7NL 5I15H 1QKZH 4PRNA 2DF3A 2HJKA 4HKXA 3VWKC 1JF1A 3D2UA 4WHTB 1XGQA 2H1PL 1NCNA 4DVBB 4X7TB 3FB8A 5IM7A 3RVWC 2OSLA 3U2SB 2R0LH 3VXSB 1NCTA 3QDGD 3MRCB 1KJMA 1OM3L 5F7EH 3MRGA 5FFLA 3AXLB 2RFXA 3LKPA 4Z76B 2KQNA 1N5YL 1XF2A 3AUVA 3EO0B 4J1UB 4OF5A 1N26A 1YNLH 2XXCB 4NUGH 2WIIB 3QQNA 5AAMA 2BY3A 5KSVB 5GS1A 1MHEA 2ESVD 4K3EH 3CSGA 1AQKH 4NOFA 3V5HA 5HGGS 5F9JA 2EXWC 1JHLL 5KSAB 4KI5C 1UXSB 2XQYG 1I7RB 3MJ9A 3SE4A 3I2CL 5K59F 2MMXA 2CDFB 1WWAX 4Y16A 4JHAH 5DUBA 5E70A 3RNQB 1OAUL 1NBVL 1EO7A 4NQCD 3V7MA 4FFWC 1T0PB 5E2JA 3NCCB 1VKXB 5E7FA 4PRHE 4LPYA 5D6CB 3RWJB 3TBWA 2NZ9C 3K7UA 3SDCB 4KHTL 1MF2H 5I74C 3FO9A 2NY4C 4AJ0A 3FKUS 1ZHBB 4N9GA 4F15B 4Z7VF 4ALAL 4V1DB 5IHUL 1HWGB 3ZYOA 1I9JL 4F9PA 3V6OA 5T1DH 1VDGA 3RY6A 4HPYL 2CIKB 4PJIA 1RQ5A 5D7SH 3KPSE 3VFTB 3NFSL 1ED3A 4OLXH 4YFLF 1IRAY 2H1PH 4FQQB 1VFMA 4L4TD 1A7OH 3SPVB 1CN4A 4UDTA 3MRQB 3BIAX 2NNAA 3HI6H 3DXAD 1G6VK 3ULVH 3D0LB 3MGOB 3C5ZB 3BP6B 1UH2A 3BPLB 5BRZA 2XOTA 3SQOH 2KH2B 5FECA 2HFFB 1UG9A 4G8FB 3S6CA 4CRPA 2X4OA 3BIKB 4YNYB 5JHDD 1IAII 3SCMA 1JIBA 4KTDL 4LCUB 4CU6A 4D9RE 3PDGA 2F54D 4DW2L 3GMOB 4PJ8C 4I77H 4I0CC 4ACPA 3HZMA 4L4VE 4LHJB 3O2DH 3VI4E 5ICYB 1UM5H 4G8IA 2R0KH 1LK3H 5CZXD 5D7JD 3L3GA 2GK0A 4BFIA 2HTLD 2Z4QA 3QQ9D 2FD6L 5J13C 3U0TA 2BC4B 3ILPB 1LK2B 5I1LA 5SX5H 5JUEH 1TZHA 3HZYB 5KVGH 4JFQB 3H3PL 3GMPB 3PHOB 3LQZA 3WFBH 4APQD 3QEQB 3FB5B 3CFJB 2VN4A 1HI6B 2ZUUA 1NGWB 1A2YA 4Y5XB 2KZ1B 3T3PE 1CFVL 5BS0E 3S34L 3ZMRA 3U4AA 3EZJB 1VEOA 3CPLA 1MH5A 4CVXA 4HUXA 1IGTA 1KCSH 1OCWH 1RJZB 3EDDA 2AJXL 4LF3A 1A7PL 2ZUWA 1KJ2H 1J18A 2F5AH 1CFBA 1JMXA 5JOFB 3HNTH 1UQSA 2OR7A 4APQA 1QSFB 4HUWA 4EDXA 1NC2B 1YEIH 3RQ3A 1R3KB 4JPWL 4OFYD 3IDUA 3HAEH 3MUJA 5E2TH 4NO2A 2O26U 2W92A 4QHNA 2BY1A 4PJ8A 4JJHA 5C92A 3WJLC 5KANI 5HHQB 3FN3A 4Y5VC 4J3SA 4F3FA 4PGDA 4ZODA 3CVHH 5FEBA 2HKFL 3MZGB 5DJ6B 4NHUA 5GGRA 5HI3D 4I9WE 4JDVA 2Y36H 3LRSA 1T21A 1AGDA 4WW2F 4OCMC 1GOFA 4PJDE 4M4PA 4PLNC 1I9JH 2R56H 1JNJA 4HZLA 4FABL 3CU1A 3T8XB 1N3NB 3DTXB 5ITBL 2ADIB 3HLAB 4YHNA 1C5DA 2VR4A 5HHMD 1B0GB 3VDCA 4PJ9C 5T3ZE 3Q6FA 1BGXH 5C86A 1MFAH 1KCKA 4Y5YB 5ISZD 1QSEB 3F7PC 1OD7A 1X6NA 4ORGB 3UO1L 4Y19D 2C5DC 5EU7E 4BSJA 1MLCA 5E2WH 2AXJA 4DFHA 3SGEH 2QSQA 1YY9C 3AU1B 3DSNA 1OTSC 4HDIB 2ICES 2R2EA 5C08E 4G8EB 1AXSB 5BZWB 4HSQA 5INDB 2BSTB 2X4SA 4NQCE 5ICZB 1XF2B 3LIZH 1FLTX 3TO4B 1WF5A 1A6UL 3HR6A 4EXPX 3MRJA 2C4FU 2CKBB 4O58L 1JGUL 4LCCA 1BQSA 2WINA 4ZAKC 4ENED 3BD5A 4P3CL 3O8XB 1JZ3A 5DQ9B 5LGKA 1R24B 2P8MA 3SKJL 3QR2A 3IDIB 5I75C 3U36A 4ELMA 4LU5L 1A0QL 1Q0XH 4WFGE 4JO3L 4NM4L 1QO3A 3F6IA 4XPFH 1BLNA 1RUKH 1F4YH 3D6GA 4JRXA 3P9LB 2ADFH 3RBSA 1KN2L 3LEYH 3QUMA 4JM4L 1JZ4A 2YN5A 4NKQB 1HHJB 4JRYD 5K9JL 1IT9L 1YYLH 3PL6C 3GJFB 5I1KL 3U83A 4WUUB 4QO1A 1CG9A 3QDHA 2X05A 3MV7E 2X70B 4RAVA 3TCLB 4K7FA 2UY6A 5DT1L 4YDVA 4QRQA 2NY4B 5HYQA 2WWKT 3BE1H 4Q6IA 1TVHA 3PWPA 2YA0A 4IIQB 1IZKA 3TJEL 5GS0C 3U7WH 3VFWB 2AV1B 3IDGA 5LGJB 1OPGH 4PYHA 3LN4A 5EBWA 3VFPB 1QSFD 1EV2E 4NQCB 3KYMB 5T3XE 5DEGB 5DJDB 1S5HA 5FUZH 4L4JA 5HI4C 5ANME 3U7AA 2ARJQ 2JCCF 3EUUA 5I17A 3KXFA 3N1FC 3GBNL 3NACH 1NFDA 2DIJA 2OL3L 1B4JH 1AGCA 2DQHH 4LVOB 4Q2ZB 3N9GL 1LP9F 3FHAA 4MQ7B 4PJXF 2YSSB 4WW1A 2BERA 2I5YL 5F7DA 3CDGA 2A83A 4MA7H 2H26B 4L1HA 1JE6A 5EO0A 1HHHB 1NKOA 4GXVH 1AKJA 2QQNH 5IVXF 2CDEA 3KGRA 4D0DB 4JFQA 1BF8A 1I8LC 4OGAD 4S1RL 1A4JB 5GS3A 4XMLH 3IKKA 2YK1L 1FNFA 1BREA 3SE3C 4LHUG 4JZNB 4U1IA 2EIZB 2FIKB 5IGXH 2I9TA 3T0DA 3ARGA 5E8PB 4GRLC 5IFAH 5EZJA 3M45A 4Y1AA 3VXOB 5BW7A 4KZEL 4FXKB 4NZRL 4Z7UA 3BH8B 3LN5B 4WGWB 1IE5A 1B6DA 1QRKA 4WFEE 4DGYL 3SKJH 2NPLX 4PTUA 3CFDA 4LDOB 1S9YA 3GI9H 3ULUH 3ES6B 3T77A 4LNRA 1U42A 4NUJA 4ZUUA 3ZE0F 3S36L 2EKSB 4RBPK 5GS1B 3HC4H 3M1BB 1GAFH 2XI9A 1FZJB 2X89A 4P2OB 5DJ8B 3DWTA 1JF6A 2LVCA 1HSBB 1CXFA 4QHNB 2OI9B 3QXAB 3BVNA 3N9GH 2D7MA 3FRUA 4KUCF 5D4QA 3L3OB 4Y1AE 5DZNA 2VISB 3FO2B 3IXAB 3ZO0A 4NM8H 4Y2DC 1AR2A 2NTFB 4QXTA 1DUZB 3V0VA 5I1EH 1MCFA 2UZXB 2HRLA 1PZ5A 3MV8A 4V2BA 4OBRA 3FTGB 1DJSA 4AIXA 4RNRB 1MIEH 2VXVL 1NBYA 2FSEA 3WXWL 4HZLB 1KJVA 2JJTC 1J0JA 3SY0A 4TPRL 1VCAA 2A77H 3BGMB 4FFYL 4AMKH 1A6PA 2EDYA 4KRMB 3T1FB 4QLRA 2I60H 5FYJL 1MCRA 4OGYL 3MNVB 2VSDA 1EVTC 5HHNA 2VN7A 4FZEH 2FYYA 4PJ7B 3DV4B 3RDTD 1T2XA 2YPVH 3WL9B 1X5YA 4JQXC 5JXED 2MJWA 2UY7A 8CGTA 3WJLA 4IRZL 2YMXH 4MHHI 4GG8A 5ESAA 4LQFH 2B1AL 2H3NA 4WRLA 5AWNL 4F58H 4GAJL 5HHOD 4QHKJ 5JZ7C 4Q6YA 1WV7T 3ECBB 5IHBA 2BVQB 4OF8A 3BP5B 1Q9LA 3TA3B 1G6RB 2Y25A 2SEBA 4ODTL 3MO1A 1VEMA 4ZUSB 3MV8D 3BESR 3VDBA 3DXAB 3KPPA 4LASL 5JORB 5JPNB 4RGOH 1KG0B 3MLYH 4L8SB 1JHLH 2F53B 4K23H 2WBJA 3P4OB 4JFPB 1TIUA 4NOBA 3QT2A 3BRDA 4K07A 2IPUK 1SYVB 1B88A 1Z0MA 1YNTB 3BKMH 5IB3A 1D9KC 1OAUH 1ZA6A 1AGBB 5BW7C 1BFTA 2VAJA 1WBYB 4K94C 2X09A 4NNXA 2XN9B 5F9WC 2X4RB 5H37H 3VW3L 4XGZB 5MEPB 3ARUA 1YECH 3NFPA 3A0OA 4M7KH 5K9QG 2Z31D 1MIEL 3LQZB 3HC3L 4UU9B 2E6JA 1KT2A 4P4KC 4UT7L 4OV5A 3VGBA 3L5XH 1WCQA 4UDUA 4LLDB 3SOBL 1QLEH 5IB4A 4N90E 1MRDL 5DTFA 5LBSL 3X13A 3IGAA 3MJ6A 3TGXA 4EI5C 1ZHLA 3O41B 3BQUC 1IM3A 1D5ZA 3X11A 1F90H 3H3BC 1ODAA 3PWUA 4JM2A 2D31B 3K1KC 1VGEL 3NFSH 3GK8H 3MLTB 3F8UB 4K9EL 1I7UB 2V9RA 1WWBX 4P4KA 2GJZB 4X4XA 4XNMB 5LQBL 3VXMB 2XTJC 2FJFA 4ZS6D 3TBYB 2RBLA 3C08H 2HN7A 1V8HA 4LLUA 5IVZA 1ZVYA 3ULVF 1I8KA 5DJAB 4NM8L 5C0EB 2AKRA 5HJ3B 3GBMH 3VU2A 4JFXB 5I1EL 3G5VB 5CBAB 1AO7A 2CLRA 5J9PB 1DDHA 4PJIF 2OMNA 4O00A 3QEGL 4LLMB 1OP9A 3P2TA 3LZFL 3ZDYE 2P5EE 4IDJH 3U9UA 3FT2B 1AH1A 4RMQA 4Q9CA 1Q94A 3TBVA 4ONGL 4MAUL 5E2UL 1MHHB 1QVOB 3MV11 4HX1B 3NIDE 3X14A 3RWEB 1MOEA 3LKOB 5IESH 3ARBA 1N64H 1UWGH 1Y6MR 4F7EB 1R3JB 3S88H 2MCG1 3GMRA 4JFEE 1N0XL 3KPOB 1OW0C 4DZ8A 1MCOH 1UM5L 2QKIA 3VRIB 3CC5A 3LPGA 2VB5A 5D2LA 1NGQH 3FAWA 5KG9B 3RWCB 5DGQA 2MTPA 4TYUA 3PHSA 4PLJD 4WIQA 3V4VH 2PTUA 4MA3A 2ZPKL 3OKNA 4F7MA 4QOKA 4LHQB 3KPSB 4Y16C 5AAWA 1KIPA 3T2NH 3TZVA 5C3LD 3QXTA 3LEXB 3D3VE 1CXEA 5E03A 5C70A 1AR1D 2DQCL 1HH9A 3L3JA 2FL5B 1EAJA 4MXVF 1OGTB 3U30C 3PV7A 4OZFB 5CBEA 5L8LB 3GI9L 2FBJL 1YECL 4ONFH 5F44A 3MRCA 4POYA 5BS0B 1N2RA 1Y6KR 4NPYB 2H9GB 4EDXB 4EQ3A 4U1SA 3GNML 1PDKA 5F89A 4NQEE 2AABH 1MREL 4BQCA 3VXPB 2P8PB 4QKXB 4LLWA 4A2LA 4KRPD 2A6DA 4X6EA 1F3DH 4EI6A 3MRHB 2L7JA 5AZEH 4PJAB 5FK9A 1NMBL 3PHOA 1WZ1L 5CJQL 3VXRB 4JFDE 2OS7A 3WUWG 1OSZB 2FATH 4JO4L 5DGRA 2VRAA 3QUYD 2E6QA 5DR5H 3QDMB 2HG5B 4RIRB 2NY3C 1ZK9A 3QNXA 1UH3A 5D9SA 4LGRB 1LILA 1CGSH 3VFUA 1MFAL 4R8WL 4XXCC 1T7WA 1F3JA 1FVEA 1QG3A 3GGWB 4GLRH 5DJDA 4ZFGH 3K8LA 1R3KA 1KELH 1YEKH 2NW3B 5C0AA 5E2UH 4JRYE 1G7MB 3V5HB 3EO9H 5KN5B 4NO5A 3WS3B 2APTA 1J0YA 3RVUD 2WIIA 5ESVA 1H3UA 3G9VA 2F53A 1DLFH 4LVNB 5EU3A 3C6SA 3EOYG 1DBAH 4MJ5A 1YC7A 3VFVA 1U8PB 1U95A 2O5XH 4Z7NF 1BZQK 2P5WE 3C60C 3DYMA 3ZDYF 1XGTA 4IOIA 5C08B 4W70A 4LHUD 4DK3A 3RVTD 1XCTB 4NM4H 1NSNL 2ZOKB 1LO0H 4OM1H 4LHUA 1IQWH 1SJHA 4MQXD 2D9QB 4G6JH 4I8DA 4TOYL 4XT1C 1Q9OA 1JFQL 5DFWH 4ERSL 5HDBE 1J0ZA 1DR9A 2RCSL 3KS0H 4EVNA 2APFA 5ADPL 1RVFL 1BZ7B 1HHIA 3U0WH 4JKPH 4WHYH 1CVSC 2DLGA 3KG5A 1C16B 4DVRL 1N5AA 1X5JA 3FFCD 4NT6B 4XPGH 5K9JH 1TVBB 4KKNA 4HC1H 1NAMB 1EEUA 5A1AA 5D96C 5JR1H 2E27L 4PGBB 2XNAB 4BZ2L 1KEML 4N8VA 4LCCB 5CKAA 3LN9A 3MXVH 3JWOC 2VSCA 4L8BA 1IGCH 1N6UA 5FECB 4IOSD 3BKCH 3MJ7B 5CJQH 1P7KB 4PJDB 3O3AB 5L6YL 5DK2B 4UBDD 4IMKA 3UX9B 3GIZH 4HH8A 3O9WC 5LWYL 2F8XC 1IVLA 5JLZA 4POZD 2UYLB 3DMMD 4WV1B 1UENA 4NRYB 3WYRA 5BS0D 4ZNEA 1A22B 1I9RL 5DVKA 2B2XH 2FHFA 3S97C 3O3BA 5E8EA 1ONQA 3MRBA 1NCAL 3MNZA 2Q20A 3BQUA 4OQ1A 3EAKA 2VXTL 2DKUA 2EC9U 1HYSC 4TRPL 2ATKA 1G9MC 4Y2DB 3T0ED 3E2HB 3LKNA 1CDJA 1TZGL 2AJSL 3QDAA 4QNPF 3T1FA 5B3JF 4WI4A 1KJ3L 4WEBL 3DLQR 1AC6A 4PP1C 3INUL 1F58L 4NRZA 4Y5XC 2XWJA 4I3RL 1IGYA 3ARDD 4OF6A 4M8QB 2VDKL 2ESVA 3SDDA 4L3CA 1AY1L 4ZD3H 2NXYD 2FLRT 1J1XL 3U9PH 5GS2D 1AE6H 1NC2A 3DRTA 3DHJA 1NGQL 3BUTA 1PLGL 3L5WA 5ICXA 4Z7OF 1T6WA 3IU3A 3P9MB 3TYGH 1Z5LA 1CGVA 1EFXB 2YZ1A 3QZWG 3ARFB 2CGRL 4FQQA 4GH7B 1A7NH 2KL6A 1VERA 5E8DH 1G84A 4CNIB 3W81A 2DLIA 4L4TB 3QI9A 4PRPA 2FD6H 4P49A 2EKSA 2VLKD 2O5ZL 3LHPL 1P7QD 1Q9WA 4RAUB 5F1IB 1KJ2A 4YDKL 2AQ3A 1J8KA 3BPCA 1UJTA 5DMIH 3A6OA 4OFPA 4K71C 4QT5B 1S5IL 3UJTH 4OI9A 4PJDF 5DD3H 1NDGA 4WUUD 1RHHB 1XGUA 4YHYC 4AEHL 3HC4L 1GHFL 1WFUA 3D85B 1CFQA 3C09C 2PCPB 5E1AA 3GSXB 5ILTL 1OLLA 5C0BE 1TLKA 3C8KB 4PRHA 2H41A 1U2HA 2HMID 2VDOH 5EZJB 1G7IA 5DRZB 2AJSH 4LIQL 3OGCB 3B9KB 4CU7A 2FGWH 3HZYA 3DX8A 3T8XA 4JHAL 4XH2B 3H9SD 3QEQD 2EDRA 1KJVB 4AMKL 3RWDA 1JPTL 4X5XB 1XGYH 5B39A 1U8OB 1UCTA 3W9DA 5F3BA 4LKCA 4IRSA 5TDOA 2CRIA 2HFGH 1UKSA 4NKIL 4GXUM 4IIQC 5TF1L 2F54E 4G9FA 3ULVC 4FQLH 3CU7A 1DN2A 3BOVA 3FOLA 3TZVD 5EUKB 1EUUA 1I8KB 1U8KA 3WFEL 3GUTB 3WNOA 1F3RB 2VXTH 4AQOA 1AJ7L 4OTXL 1Q0YH 4JY4B 4WTZG 3DRQA 3RX7A 3V8OA 2JLLA 1MCWW 1R24A 3ZL4H 1RMFH 4TUJB 4G80A 4X6DA 4LQFL 5JO5B 3AREB 2P42B 1MRFH 1ADQL 1AXTH 3LKPB 4Z76A 3F12A 2AK1L 5B8CB 4JFOA 4N1HB 1DEEB 3WO4C 3W0WA 1BM3L 2BRRH 4OIIH 4Z7VA 4M1GH 5HVHC 3MV9D 5GS2H 3TFKD 3GJFA 4HWBL 1UB6B 3WN5C 4YR6A 3FRPA 1TZIB 3QUMB 2B4CC 3VXUB 3I75A 5IW3A 3HE6C 3OJDB 3MLSH 2R4SH 3HE7A 2DICA 4LLYB 4M43L 4OGYH 5IR1B 5BV7C 5JQHC 4KGLA 2LU4A 3MGTA 5HHNB 2DI7A 5HYFA 5D7IB 3RWJA 3ARDB 3O4LA 3RWGA 2XA3A 1LEKB 2PXYB 4OZGA 4U7KA 3REWB 3UTTA 3GB7A 2A9MH 3V0WH 2G75A 5J57B 5EBWB 1ZVSB 5FKPA 2RCSH 3HFML 2F53E 1AD0B 1U8QA 4WO4B 2GCYB 1OVZA 1A9EB 1S7VA 5FGBC 3OXRB 5C6TL 2BNRD 5LGHH 4P5TB 3BP5A 4NQCA 3TA3A 4U2ZA 4LSVL 4EUPB 2GSGB 1UB5B 1GGIH 4LK4A 1QNZL 1TFHA 2R2EB 3WKNA 4ODUA 3WNPA 3BDYH 2EEAA 5I1IL 4WY7H 4LRNL 4OT1H 1J12A 5GZOD 2Q1EA 1E4XI 3WFCH 2ENSA 5CS7A 4XBGA 5HHME 5FO9A 1ZS8A 4HWZB 4OLYL 5F1SA 3H9ZA 2Y07H 4Q58C 3RVVC 4F37F 4WENB 2F15A 5LAXB 1FL5B 2HRPL 4POUB 4PB0H 1Z2KA 4TSBH 5E8OB 5JW3L 1AGDB 1JGEA 4HUUA 5DT1H 1HHKB 3FO1A 1DN0B 3HNSH 3H0TA 5LKNA 3S88L 5A40E 3LOWA 4Z7UB 4K8RH 2DQUL 1YNKL 43CAB 5I1AA 1JTOA 2YHGA 4ODSH 1I8MB 1QEWA 1S9VA 4QRUA 3C9NA 4MS8C 4U6VH 2CDGB 2Z8WC 5A3IC 5J11C 1OOAA 3NBNA 1T5XA 4XXDB 1PQZA 2CIIB 4JY6B 3DYPA 3OB0K 3V4PH 5C8JA 4WEBH 1HINH 1NGWA 5I6XC 4QXWA 1G1YA 3NCYP 3V9FA 1A6WH 1XZ0A 2IEPA 3AU1A 2FEDD 5I74B 2JB6A 3CX5K 3OG4B 3TN0B 1N6VA 4WUKL 1WFOA 3NCBB 1JF1B 2AKRB 4S1DC 3DI3B 1LEIB 1SM3L 5K59E 2VDNH 1Z9OA 5K9QI 3CVHA 2YKLL 1VESA 4ETQA 1NAKL 5T5FL 4PLOB 1UJ3B 3MLZH 4GAFB 5JOFA 1OD9A 3I9GH 1CDIA 3I85A 3RJQB 3QCVH 4FQ1L 3THMH 2C4XA 4R7NA 5DUPH 3OR7B 4U7MA 3TPKA 4UB0H 1FO0H 4K3EL 1OTTD 1K3ZA 1VEPA 4ODVL 3IB4A 4IM8A 5K9OA 1FFPB 1T20B 3OKLB 3CDCA 3QRGH 5D1QD 4J3TA 2ATPB 5DRZA 4LMQE 3JV5A 3VRIA 3CX5J 4XP6L 3CJJA 5LCVH 1RZKL 2BVPA 4WCYL 4AZ8A 3G6JA 4BSVA 3UPAA 1KLGA 3GSNH 4CJ1A 3WXVL 4H0HB 4YBLC 1MRCL 5IW6B 1ZLUK 5I73B 1Q0XL 5AD0A 1O5DT 1X6LA 4G5ZL 3D87B 1JPSH 4WTXA 4LIQH 3BO8A 1WWWX 2VIRB 1HINL 4HH9B 4FQCH 3WNKA 1CIUA 1JI2A 3IAQA 2VQTA 3MRPA 3BWUC 4LPTA 1G7JB 5TE7H 4MD5A 4YE4L 3W82A 3OSKA 4B50A 3QCTL 4FQPA 1S9YB 1UKTA 1RZGA 3L3HA 5DFVC 5I75B 1A6AA 4MB5A 5BVPL 1H8NA 1RUMH 4N0UE 4C56B 3LRHA 2AABL 3MTRA 2NW3A 3VXMA 1FRGH 4P46A 2WLYA 3KYOA 5T5FH 3MJ9H 5CJ5A 1A9BA 3D25A 4CMMB 1A5FH 2ITCB 4CW1B 4I0KA 3VFGL 1ORQB 2F74B 4IEFB 1GH7A 1SJXA 3EDKA 3AMLA 1ZA6B 4OZGE 1YUHB 4BSWB 4DKEH 1F11A 4K8RL 3FZUC 1WT5A 3RWHA 5E6IC 3QO1A 3V6OE 1LO0L 1XGTB 2H32H 5FO8A 3F6LA 1CE1H 2OJEB 2CJUL 2QV2A 2R0KL 3PWLB 1KULA 3PIQA 1NBYB 4J4PA 2N1KA 5E9DB 5J3HC 4PGEB 4KKCD 4KH2A 4JG1L 1LO3H 2BCKA 3SBWC 4W6XB 5JTWA 1TJHL 5KVGL 2C3VA 3FB7B 2RAMA 3Q5YA 1R0AL 1DL7L 1OWWA 4FG6C 1CLYL 3EYFA 1BX2A 1RZIB 1KPRA 2VDMH 5C0AE 1Z5LB 3VWKB 4F2MB 2B5IB 5EUOA 3ES6A 1ZEAL 2UVEA 4BQBA 5L8JB 1A1MA 5E94A 2HTKC 4JKWA 3KLHC 1DVFC 2GJZA 3IU4L 4X4XB 3F7YA 3IDJB 2VR5A 3M07A 4QCIB 2R1WB 4YBQD 2IALA 1GC1C 4U1HB 1IFHL 5FGRA 4IRJC 2VLRD 1DANU 4G6FB 1I8LA 1LDSA 3QCVL 4XAWL 4YHKH 4NBZB 1NFDB 3ZHDA 2VLJD 5FDWA 1QFWI 3NIDF 1LO4L 1QLFA 3NAAH 3S4SB 1S5HB 4PJXE 1T04B 3T1WA 1MLBA 3BDYL 5I1IH 4G5ZH 4MJIA 3VFGH 5L2KB 4LLVA 4HIXL 5E2TL 1FZOB 3OR6A 4YEFA 2AQ1A 2BSRB 1N4XL 3CH1B 1TZHB 2NR6D 3MBEA 3TJHD 3VDAA 3PP4H 5JQ6L 2ZNXA 2A6DB 4JPVH 1EERB 2I24N 3GMRB 4M61B 4F3FB 4ZTOL 1PKQE 4LAQH 4X99A 4WTZA 1VKXA 4M6NH 3L3IA 4PUBL 3U0WL 5IWLA 5EDXA 4ELKA 1KJ3H 4OFDA 3RWIA 4UMGA 3N1PC 3DVGA 4MAYC 3W9EB 4X6DF 3TBSA 5FIEA 1YN6A 5DJYA 4HPOH 3QXWA 1ZT7B 3O6FC 3CZFA 5SWZB 5ESQA 1T3FB 5F9AC 5EOCJ 4Y4FC 3FOLB 4RFNB 5CCKL 2ZUQC 5CBEB 1R3IH 1QUNA 1DQLH 3O6ML 5JOPD 1J1XH 4XP4L 1INDH 3TIDA 3LQMA 4PTUB 3U9PL 5CD5D 5JHLL 3G08B 5BVJA 1YEFH 2E3VA 4GS7B 2XG4A 2HH0H 3LN5A 1MEXH 4GFTB 4LFHD 3SKOA 1P84J 1QYGL 1M05B 3CXDL 5MEOA 2ZG1A 1I1RA 5KSBF 3RGVB 2A6JB 3MRQA 3ARFA 5DA4A 3E6FA 5JNYB 5D1ZB 1KYOK 3HUJA 4FTVB 3TN0C 2PYED 4BUGA 2YA1A 3U0PA 4U1NB 5GISH 5DYOA 4NYLA 1IARB 4TRPH 5FM5M 3VMOA 2BY2A 1KACB 2F5BH 4LSSL 3VRJB 4ZUWB 1U8LA 5GGRB 5BV7L 4R3SA 4N1CA 2QTEA 3NABH 4F7TA 1T83A 3NFPB 3SJVB 5C2UB 4ZPVB 1U91B 2GIYA 1Q94B 4PJHF 2V2WB 1PEZA 3JV0A 4YHOL 4LVOC 2UUDH 2AJ3A 2W65A 2DTML 1KGCD 1U0QA 4FA8A 4I5BB 3ARBD 1C12B 4Z7WF 2AEQH 2J88L 2YUXA 3O0RL 3HE6B 5KW9L 4DOHE 3MR9B 2OM5A 1MAKA 4XAWH 3QIBA 4NBYB 4H1LG 4K3JL 1TCMA 3IU3B 5DHYA 4LARL 3V6BR 2QHLA 1KCUH 1VACA 4UIKH 4MD5B 4QOKE 4R2GC 5JW5B 4PBXA 1E6JL 1HN1A 5BQ7A 5EA0H 2R39A 1OAQH 4KKAD 2CLVB 3IAGC 4FQXC 1A6AB 3TO4A 4HHAB 1C7TA 4GAGH 5DHVH 4HXBH 4CNIA 4NZDA 3QI9D 4A6YL 3HTLX 4X7TA 5TQ0H 2WINB 4HGKC 2G60L 2ORBH 5HGHA 5L2JA 2Q7YB 5C1MB 1KTDB 4P9HH 5C07E 4F33A 1KJMB 1TQCB 3QDJB 3GM0A 4C4KO 3UTPE 2V2XA 3HNVH 4RMTA 5DEFA 1LP9B 2XTJB 2R0ZL 1O0VA 3FN0L 2HTLC 1FLRL 1RIUL 1RD6A 1MPAL 2DJUA 2VLLB 1XGPA 2HWZL 1BM3H 4OIIL 1YJDH 4MMXC 3EDJA 3H9SB 1FYTB 3H0TB 2NY1D 4R6UA 2ZZUT 1F97A 3T08A 3JZ7A 4Z7WE 1YC8A 3MNZB 3J8F7 1I75A 3BQUB 4UINL 4DAGL 1Y18B 4XBPA 3L3KB 4PTTB 5DJ6A 1JPFB 5EH1A 3TBWB 2ADGA 1EBPA 1NL0H 5ID1A 3QXDB 4WWKD 4RFOH 3HE7B 2CJUH 1AD9B 4H20H 4CUCA 3R0NA 4ZYKA 3OGOE 4LCWD 2XNAA 3WSQH 5D71L 2HJLB 2B8OT 2X1PA 5EUOB 1MEXL 1K8IA 4O9HH 4YZFF 4PJ5D 1I3RA 5SWSD 3TVMB 4N8VB 3QUXB 5IVXA 1PGRB 3LQAH 1GAFL 2UWEE 3GJEB 3OF6D 4XNUH 4JQIL 2BNRA 1LP9E 2XTJE 4KK8C 2FBJH 2P5ED 3CXHJ 3H6JA 5F71A 5ICZA 3KPRE 3SGEI 3QULA 4PJHB 4Y4KC 5GIRB 3TA3C 4Q9QL 5C9JB 5BRZB 1J7VR 4WDIA 3VG0H 1DLHA 4EN3D 2N4IA 4M1GL 5H94B 4LQ1A 5E8EB 2VLRE 1BIIA 4YDJB 1RIUH 2OL3A 4PR5A 2NY6D 5MEPA 5DRWB 5IR1A 5I1GH 1KB5A 3VFMB 3ULUE 1BP3B 3MRRB 3RP1A 3RU8H 5DHVB 1FL5A 3QUZC 4LCWA 1ITBB 2GITB 1LK2A 5FGSA 1T2QH 4M6ML 1YNKH 4YUEL 4Y8AA 3FO1B 3QDGE 3LEVL 4HEPG 3WLBA 4Z7OE 5C6WH 2BVOA 3OAYK 1FDLH 3QB7C 1JWUA 4XVUD 5TDNA 5AZEL 3VI3F 3WN5B 3STBA 1OTSD 3FFCB 2A9NL 3MLTA 5KSAC 1QPXA 5IBTH 1URLA 2K9UA 2GY7B 4ZNCD 5EN2A 5DMKB 3ZYJA 4P9HL 4ZOEA 1L7TL 2FX7H 3ZKMC 1JCKA 1ACYL 3TBTB 5JHDA 4R0LB 2EICA 3PUCA 3WIIL 4W6YB 2VDNL 4ZSOA 3FN0H 4KTEL 1A7OL 3O3EB 1QSFA 4HUWB 1GIGH 1FE8H 4HJJL 5D5ME 4CVWA 4OLVH 2EDDA 4QYOA 1SBBA 5IIEB 5I1JL 5TE4H 4K94L 5HHOB 3DJ9A 2ERJC 4JFDD 3C8KA 1XEDA 2LABA 3WFHA 2WP3O 3INUH 2DQTL 4RQQB 5GJTH 1X5AA 1HXMA 1DEEA 5FA3A 3UJJL 1W8NA 4YAQB 2AI0H 4YDIH 1H3VA 4ZO7A 3P4NA 4U6VL 5DRXA 3RHWK 3LS4L 4OLUL 3VXRA 1AGBA 3QZWB 2A74A 4ZOAA 1JRHL 3S35H 4JGMA 5KTEH 3GMMB 1FZMB 4JPIB 5HYJA 2EXYD 5CGYD 4Z77A 5ITFB 1H5BB 3Q3GA 1WBZA 2AEPH 4MZ3A 4AENA 4QWWD 2VDRH 4U6HB 5DJXA 4KQ3L 1YZZA 5D1ZD 1KENH 5EB9A 2YPKB 4F8TA 5FF6A 4LFHG 3CMOH 3GK8L 5K9KB 3ARTA 5GRZA 4TVPL 4XPGL 2FL5A 1OGTA 1ZLUH 1BJ1H 2DN7A 1F90L 3I3EA 3MNWB 3KPQB 1KF9B 5DD5L 3P9MA 2K7QA 3KYKL 5I6XB 3VG0L 1GGYA 5E7BA 1I4FB 4H5SB 4G7VL 3X12A 1MFBL 2PO6B 3M8OL 3DYOA 4MDIA 1HQ4B 4D3CL 1X7QA 2W07A 2R8SL 3DX7B 5L8KB 2IBBA 4EN3A 3UYRL 3FT4A 2OR9L 4X7EC 4PJGA 5ECJE 1F6LL 3QUMH 2C7UB 2NQCA 4X0KA 3OJ2C 1T7YA 3MJ8B 4YHZL 5E9DE 3HZVA 4OCSH 4MLSA 1BFSA 4WHCA 2X2YA 4LLYA 4G8GA 1IKNA 4NRXB 2PUQT 5M94B 1TZIA 3SDAA 2V9TA 1F4WH 1NGXB 2A1WL 3P11L 3F7VB 1I1AD 5CSZB 4LLDA 3GSQA 3FT2A 1G0DA 5DZOA 4BSWA 1IGFL 2G9HA 4ZO8A 3C5JB 3TPUA 4NNPL 4O2EB 3X14B 5HXMA 4C57C 4Z7QE 2IPTH 1ERNA 1XIWD 3KR3L 5FKAA 2PR4H 1SJHB