3N1MC

Crystal structure of ihhn bound to bocfn3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
ERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Indian hedgehog protein
publication title All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n1mC01
1OW0A 1SY6H 3VMOA 2LVCA 2R0KL 5F7KC 1YNKH 3CDFA 4WW2F 3GJFB 5DVNA 1NEZB 2ADGB 5CBAA 1T04B 1AHWA 3PHOA 3NCYS 2J8OA 1KPRA 3UBXA 5I1CL 1U8MA 3OPZH 2NW2B 5CJ8A 1DQQA 4DOHE 3BH9B 8CGTA 1U8NB 4UT6H 1YEKL 5FYKE 3UJIH 3X3FL 2FR4A 3FQUB 2BK8A 1SMAA 3V4UH 1RUQL 5E7BA 3ZO0A 3MJ9A 5ERWB 1INQB 4KKLC 3NPZB 4JPVL 3KHOA 4G7YL 5IB3B 3N1QC 5IB4B 3STLB 3W5NA 3X14B 1RZ8A 2APVA 1PX4A 4EQ3A 1BBJA 3OF6D 2H41A 4RNRB 3RWCB 4XPBL 2NY7H 3DUUA 5HHPB 4JFXB 4NM4L 3T04D 5C09B 1DVFD 4ISVA 5IF0B 4ONHA 5L9DH 1I9EA 5HHVH 3BP5B 5BS0D 1BLNA 5SWSB 2W0FB 4UUJB 4K8RL 1A7OL 1OAZL 5EOTB 4AYFA 2XOTA 3OG6B 4WV1B 1KBGL 1T21B 4ZFZB 1FZKB 4GJTB 4Y1AD 4U1KA 5D72H 4ZOEA 2RFXA 1GGBL 4UU9A 5J9PB 3ZE0E 1X4XA 1CWVA 4XBEL 1NMAL 3OAUL 1A6ZB 1C5CL 1KELH 4L8DB 4NBYB 3U7YL 2NLJA 5IW1B 3VGGA 2NW3A 4Z6AT 1TQBC 5D7IE 1FFPA 4BK4A 2VDRL 3QDJD 5T3XE 5F9AC 4HS8H 1FFNA 3U1SH 4U1MA 4ZO8A 1TETH 1BM3L 3M07A 5D8JH 3GI9L 1NC2D 5C0BA 4Q97A 1RIHH 3EUUA 1BJ8A 1NEZG 3QIWC 3S35X 3FOMB 3AMKA 4AQOA 3U30B 4JM2A 2PW1B 2HMID 1GH7A 3BP4A 3SGJC 3HC4H 4XPAH 1FO0L 3LD8C 1HN1A 1CICC 1Y6KR 3G6JE 4P99A 5J11B 1BIHA 1F4YL 4YHZH 3G5ZA 1CD9B 4U1NB 1U92A 1I7UB 2MHAB 3QUXB 3GIVA 3QUYC 3O6ML 1KIPB 2YPLA 4Z78B 4DQOL 4P2RA 2GSIA 2EE2A 3GNML 4PJDE 3WCYA 3IFOA 3LKRB 1WICA 4P2RE 1KLUA 1MH5B 1MREL 2EDBA 4X6DB 1BZ7B 5EU4B 1BBDH 4KJQD 5HI4D 2BSRB 2DQFB 4NUGL 2J8UA 3VFPA 1H3PL 4MMXC 1RURL 5GS1B 2DQUH 4N9OB 3TJHD 4NN5C 4AEIH 1NFDF 1WBXB 2RQ8A 3QO1B 3TA3D 1OOAA 1JNLL 3C8HA 3VG0L 5GS0H 3RL1A 3ULUH 4PJXA 4X6EA 3T3ME 4U6HA 4DGYH 3EDEA 1ZS8B 5DEGB 2UUDH 4O58L 2XKNB 4HIXH 2UWEB 4WFED 4JG0L 3QUKB 5EO9B 5FO7A 2QR0A 1IKNA 4IOSD 3C08H 5E99H 1EEUA 4OZGB 5FGSA 2ADJB 1FYHB 4QRTB 1QOKA 1I7RB 1PGRB 4GG6A 1IARB 2PXYA 4AEEA 4XP4L 1W72A 3HC0A 2I5YL 2IPUK 1CFQA 3WFEL 2VITA 3DVGB 1OARL 1PKQB 4LLDA 4JFEA 1RV6X 5JQ6H 3P40A 4WFGE 3QJFA 4YGVA 1SJEA 4G5ZH 1XGTB 4JFEE 4P46C 1VKXA 1OGTB 3CIQA 4Y4HA 4NO5B 1NMBH 4UDTB 2Y23A 3WNLA 3DRQB 1EPFA 3FQXA 3ARFD 5I9QC 1F13A 5KS9B 2EDEA 1BD2B 1NBZB 1JIBA 1S7RA 4MQ7A 5DJDA 1MHHB 3BWUC 4OI8A 5CSGA 4JQVA 5K9KB 1SJVA 5GIRB 2XA8H 3GBML 2R9HC 1NC4B 2HKFL 5E08H 1DR9A 4JCLA 5JHDA 1AP2B 1QVOB 2IMMA 3IDNA 2APBA 3RTQC 4Q6IB 4PB0L 4QY8A 3ZKMC 2Z92A 5D7LE 4HUUA 2WBJB 1ACYH 2J1KA 3LEVH 1W0WB 4CU6A 3TBTA 1BECA 3DMMC 3QO0A 1CLCA 4FQQB 3QEQB 1T03H 2E9WA 4Y4KA 2OL3L 3THML 2YBRB 4KK8D 1H3TA 1QFPA 3FQNB 3PIQA 4OAWA 4NO0D 2NXYB 4XXDA 1SEBA 4PR5A 2ZNXA 3CSGA 4IDJL 3OGCA 3V0VB 4DKAA 3QCTL 1ZXQA 5BRZE 1ROWA 3ROLA 5KSUB 1P9MA 4GMSH 4NSKB 3WIHH 1OAKL 1A1MA 2DD8H 3B5HA 1NCBL 4NDMB 2GSGA 3E3QE 5DHVA 2X4NB 4X9FA 4ZSOB 2ZOLB 1G9NL 4AG4H 4ZUUB 4KUZL 1EEYB 3BHBB 4M43L 5I8OL 1R3HB 4Z95H 1JF1A 4B50A 3EW3B 3S7GA 2IPTH 5F70A 1F58H 4K3DH 5FGBC 4QRRB 5BJTA 5I15L 1CXKA 1MFAH 3C8DA 2P1YA 3VXRD 2BNQB 1UWGH 2GJ6B 3KPMA 4ZPVA 1IM9A 5GGSB 4KZEL 5EPMA 3RVWD 2P4AB 4I18C 5KVGL 4NKMA 1P4LB 3GBNH 1DLHB 4XHJD 1XF4B 5HHME 3ZDYF 5SV4A 4L29A 2OK0L 4YK4B 1TJGH 3T8XA 4UNTA 1CL7L 3W0WD 3BDXA 4ODHH 4HUKB 4J1UA 5D7SL 1LEIA 1OWRM 4LLWA 5GISH 2HN7A 1MPAL 1A7BA 3ECBB 4RBPK 4NKDA 5HHQB 1MCSA 2Z93A 4M4PA 5F88A 4PD4K 3TV3L 1Z0NA 1C12B 1OT1A 1ZTXL 4NQSB 4K23H 4XTRD 5D93B 3MCLH 3VGEA 5T1DH 2NY3C 4G8GB 4P2YA 5F93C 4J6RH 4HLJA 2F74A 2OP4H 2AERT 1N3NB 2WWKO 4YHNA 3VFOB 5BVJB 2PYEB 4XZUB 4Z7UF 4JY6B 1FL5B 3LIZH 4ZUSB 5EU6E 3VFRA 2EDKA 5K9OB 3U9PH 4FXKB 1MQ8A 4LEXH 2VLMD 5CINH 3KYNB 1YEIL 4YHKL 5CP3H 1MCOH 1DP0A 2LFGA 5TQ0L 4OFYA 4YXKL 4LSUL 3MRRB 3R0MA 3WO4C 3VDCA 4GRLC 2HFTA 1JGUH 5B38A 2HT3D 3IB4A 3GMLB 1BGXL 2X7LB 2MCPH 3BH8A 3IS1X 1EFXD 3L3KA 5H37G 4OGXH 1TTFA 5DQDH 2Q87A 4C56A 3C09C 1LO4H 4GBXA 5JOFA 4O2EA 1V7NL 4C56E 1LDPH 3G04B 3P4OB 2FJGA 2VLRB 4Q2ZA 3DRTB 1WZMA 1UXSB 3DX9B 5I30H 1YMHB 4MX7B 3SCMB 3AREA 3ARGD 1VGKA 5IM7A 1CR9L 4LKXA 3RNQB 4NZTH 5CEXB 5DFVC 5GSRA 2FIKB 2Z8SA 3L3IB 1FZJB 4IOFD 5JXEC 3FO2A 4LLMB 3HE6B 3MV01 4LCCA 2YOCA 3IJYB 1VFMA 3AAZA 2DAVA 4U7SA 1FGNL 4M6OL 3C60C 1GOGA 3RZCA 3RVUD 5I71B 1UXWA 3BGMB 3ULVH 1HXYB 4PUBL 4Q9BA 3ZT5A 4OCMC 1QSVA 3KWWA 3Q5OA 4L8SA 5T1MA 2QJDA 5ADOH 4O2FA 1OSZA 2X1OA 4PG2A 5ABDE 1AO7A 5FM8A 2J5LC 2JJVA 3KVQA 3JSSA 1S5HA 3HE7D 4PP2B 4K94C 5IEKB 4TTGA 2C1PB 4WTZG 3DYPA 2EDDA 5L2KB 4JPKL 4WHYG 1CU4H 4DVBB 5DEFA 1U8IB 3KDMA 4M1GH 5L6YL 3BUTA 3C9NA 1GAFH 1P7KA 2B5IB 5F3HA 3GB7B 3L9RA 5E6YA 5GRZA 2EDFA 4WJ5B 4HUXB 1U2CA 3PJSB 3ARUA 4AIOA 1KLFA 5JIKA 1YEDA 6FABH 4N9GA 4HUWA 4QHKJ 5KAQF 3O2DH 3Q6FB 5FO8B 1WZ1H 2A6KB 3QFJA 3QZWA 2Q1EA 1Z2KA 1M6OA 5ETUB 2WWMC 3QFJE 4XNXH 3RL2B 4QT5A 1R5VB 3IFNH 3G5YB 5E8NA 1LP9F 5I0DA 4JRYA 1I85A 4RGOL 3B9KD 1VADB 5AZEH 1OP9A 4NRXB 3FRPA 2V2TA 4YX2H 4JRYE 4CW1A 4RAVA 4UQ2A 3S35H 4HIIB 2A73B 5IB2A 3ARBB 3P30H 3LEXB 4PGCB 4UOW0 4K2UH 2GAZB 3A67L 3LQAH 3OKDA 1H15A 2NZ9D 3MLTB 5DJCB 5B3NA 2Q8AH 1WEJL 4OLYH 3UAJC 1XGUB 4OGAC 3EO9H 4KI1A 5JXAH 1RZ7H 2HJFA 4ZFFA 4GAYB 3G6AA 3CH8A 4LVHB 1AJ7H 3VWJC 5EU3A 1CE1L 4M5ZL 3MBEC 2E7MA 4P57A 1D7FA 2ADIB 2FX9L 1R24B 5DMYA 1K8DB 3NABH 5LJYH 3VWKA 1P4BL 2V5RA 5JLZA 5D1QB 1MUJB 3VFTB 2KUTA 4XBPB 3B6SB 3LB6C 4L8BA 4XPFH 1CTOA 3ZKNC 4P9HC 3O3EA 2NY0B 3MRMB 1HWHB 1TZIB 1XGRA 2Z35A 3QRGL 5KTEL 1U3HD 4PRAA 5EBMB 3SHSA 4QCIA 5FB8A 4R7DB 3IVKA 3VXOA 1N0LA 3PGDB 5DUML 1N5YL 3CFKA 1M4KA 3MOQA 3RJQB 2X4SB 1WTLA 3EYFA 3SDCD 4F7MA 3DX8B 2WAHA 3D69B 2P5WB 5BV7C 1H5BC 5HGBB 3D85B 1BFSA 1IC1A 2DI8A 4E41A 4ZDHA 5DD1L 4RWYL 4BQCA 1D5IH 4E41E 3FQWB 2MJWA 4RMUA 5C7XH 4JFDA 3BT2H 2X4PB 3KLSA 2QQKH 1ED3A 4GH7B 2F54B 1B2WL 2D31B 3OB0K 1UKTA 3QYCA 3JTTA 3Q6GL 3SQBA 4LAJH 2FEDC 4IIQB 4P5TA 1MHPH 1MAMH 1S7XA 4Q9QL 5AWNL 4Y2OA 1F4XL 2FECI 3G5XA 1FLRL 1ZVYA 1N59B 3JVGC 4PYHA 4L3CB 4RX4D 2CR3A 3QDGA 2YD2A 2K3TA 1XIWD 4RFOL 4X99A 4U4BA 2KBGA 4I0CC 4GLRH 2CK0H 4KK9C 1KCUH 3OAYH 1I8IA 1NAKH 1R5WB 2NY1B 2XXCB 3K2UL 3QNZB 3ZKXB 4V1DA 2R2HA 4KQ4L 1MJ7H 1FVCA 4V1DE 1OAUL 3VXMA 1IJ9A 4NWTH 4U1GC 3VXME 15C8H 4NHUA 3FB8A 4RA0C 5E9DA 5KZCB 1QSFD 2DIJA 2CGRH 4EN3A 3QH3B 2DKMA 5J1TC 7FABH 2DQEL 4JVUA 3HNVH 1N2RA 3P73B 4FFVD 2D7OA 4KI5E 1KPVB 1G9ML 5IB5B 2EH7L 5FYLL 2VLJA 3D0LB 1RMFH 5F1IA 3HFML 4I9WD 1AGCB 1QPXA 3MGAA 2QADB 2VLJE 1A64A 3L7EB 4U1SB 4A6YA 1JYVA 4HQQL 3SE9L 1E6JL 4CMMA 4Y2DA 5C08B 1KEML 2Z8RA 1TCMA 5DGRA 1DE4B 5ILTL 3VGAB 3LMJH 1VGEL 4L4VD 3DYOA 3DSNA 2K7PA 2H2PD 1A6TA 1XT5A 1IGYA 3I2CH 3D2UD 3RWGB 1DBKH 2CIIA 4U1IA 4JKPH 1YYMH 5C0AB 3RI5F 3A6CL 5D7JC 3GMNA 1MWAH 4MNQB 5FA3B 2VDLL 4EIGB 1MCJA 4JJ5A 2IBBA 3O3UN 1TNMA 4G6JH 2FRGP 1ZHLB 3GSNH 4PLJD 2FH8A 1BJ1H 2XTJD 4YQXL 1FDLH 4JKWA 4OB5L 5IBUB 1FAKT 3P11H 1WT5C 3V0AC 4X80H 3RIFF 1G7MB 3OKKA 5HVWA 2CRMA 3LH2H 4LCIH 3BN9C 3D39D 2VDQL 1QFWH 2BERA 5GGVL 4PV9B 2JB5L 4PJBF 2GQHA 2BVQB 3QCVH 1A14H 1WITA 5KG9B 4RSVA 4XPTH 1XF2A 1FGVL 3SE4A 5IFJB 4X6CE 4ZUVA 1ORQB 4XAWL 1OAYL 2DYPD 2FL5A 1HYSC 4IHOB 1WF5A 4LCUB 1F4HA 4QHMA 1MCBA 2OM5A 2P5ED 1KCVL 1K4CB 5BRZB 4MVBC 4QRQB 4KPHL 4QYOA 4F15C 1TTGA 1J10A 3SY0A 5E94A 3RY5A 3G6DL 1IQDA 1UB6A 1ZHNA 3O4OB 5D1ZA 4R8WL 1JNJA 4UINL 1IT9L 1UENA 1N6VA 2A83B 1TTUA 2DJSA 1JK8A 2P8PA 3OKOA 5IQ7H 5KBNC 5JO5B 1TVBA 1HSBB 1PYWB 3L3HB 4Z0XA 5FUOL 1PSKL 1PZ5B 4XXCC 5T3ZE 4AEFA 1JYXA 5EU5B 1N0XH 3FT2B 4P2CG 1I75A 4IDLA 2R0KH 3BP6B 2AJXH 1TNNA 1CDHA 3QB7C 1FNAA 4OF7A 2KQNA 1QYGH 1TCRA 4PJFF 4L8CA 3TM6A 1KTDB 3ZDZE 4IMLA 4Y16B 5IVXE 2UWEF 4Q0XH 3TZVB 5I1CH 1FVEB 1DVFC 2E9IA 4S1SH 1V7ML 5DJ8A 4ZD3H 4JGJA 1RJZA 1KJMB 4OZGF 5DMGD 2B2XL 4NZDA 1I1FB 5E2UL 5TE7L 3X3FH 1DQTA 4QOKA 5I1HH 1RUQH 3HZMB 4HUVB 2ZCLL 4JPVH 5JUEL 1Q9OB 3T2NH 4QOKE 4OSUL 5D5MB 2O61B 3ORJA 1OP3K 3L1OH 3UDWC 3H9ZA 1LMKA 5C09D 1G7IA 4XPBH 3HB3D 3JWOC 2ESVA 3CLFL 5EC2B 5IOPA 4EEEA 3GO1L 4JHZA 3HZYB 5C0CB 5F7UA 5HVFB 3BGFC 2GY7B 3MJ7A 2NZIA 2SEBB 2CLRB 4EVNB 5KS9F 4FTVA 4RGNE 4B7IA 1ZSDB 3UO1L 1NBQA 1GGIL 4K8RH 1UA6H 4FTVE 2MPAL 3MGOA 1MNUH 1KXTB 4YUEL 35C8L 1IGJB 1I9RL 2AI0H 1IM3B 1QSEA 5IQ9B 3OJ2C 3TO2A 3VXSB 3CVIL 4W4OA 3NIDE 3E8UL 5JW5A 3CSYA 4XBEH 3HI5H 4Z7WE 4I3SL 1K5NB 5HYEA 5FECA 5D96B 4R4FL 4HMCA 2JELH 2Q6WA 2E7HA 5C07D 4U7MA 4XP9H 4BELD 5GRJH 2HMIC 2H8PA 4AT6A 4LPCA 3UC0L 3DPBA 1H3VA 5D1XD 1T0MA 2EDOA 2O5ZH 4M6ML 5M94B 1L0XA 1NLBL 1JN6A 5AD0A 2VL5A 4N5ED 2QKIA 4AY0A 1VFAA 4WI5A 1IGTB 3CU1A 4RMQA 4TNVF 2BY1A 4LDLB 5KW9H 3ZYZA 4B41A 3BX7C 4B7LA 6CGTA 2WK2A 1ZV5A 1FRGL 4OJFL 2OZ4L 2D9CA 3QXAA 4CUCA 1FC2D 5HVHB 4KDTC 5DR5H 1WGOA 2J88L 4TNVK 3CXHJ 4L5FL 3RY6C 4YHMH 1UQSA 4BKLA 1BVLA 1A6AA 4L3EE 4KXZH 3VD5A 4FG6D 1NCAL 2FWOB 1A1NA 4UT7H 3LEYL 3TYGH 1T1YB 3KS0J 3O6FB 4ZUTA 1YDPB 1VB9A 2AJVH 2FGZA 4KJQC 4MA3A 5HI4C 2HT2D 1ERNA 2VRAA 5CIPA 3WSQH 4KK6D 1OTSD 4MXWL 3RDTB 1OB1B 2X4OB 1FQ9C 4LIQH 3TJHC 2F53B 3FQRA 1RK0B 1CDIA 1TQCC 4WU5A 1DQDH 3TA3C 2IALA 5EZIL 5BZWB 5EUOA 3JWNC 4E5XA 5IESL 5KJRL 5HGAB 5EUOE 4KVNL 5BOZG 3L3JA 3QG6A 3DLQR 1MI5D 5CEZL 3BZEA 4MNHB 4GSDH 4X7FC 4MJID 4GG8A 1IAOA 4JO2L 1EX0A 1P7QA 5JTWA 4OLVL 3CX2A 1A2YA 5BOPA 1IEAB 3NN8A 4UILL 3CSPA 3PWPB 1KIRB 3MROA 4JB9H 3H9HA 1VDGA 4U6YB 1AGFA 1M1SA 4MJ5B 1BQUA 1UZ8B 5EZJA 3U0WH 4F57L 5DD6A 4BZ2L 3OR7A 4PP1D 4UTAL 3RVVD 4OZ4A 3MO1A 5F6IB 3WFCH 2FO4B 5SWQA 2X1PA 4OIBA 4JFFB 1MEXL 4BFIB 3QFDA 3UYOD 5BQ7B 3ARFC 4K3JH 4L4TE 4Y7MA 3CCHB 4RCAA 3F5WA 3RNKA 5DQJB 2AXJA 3GHEL 1NKOA 2AS5M 1OARH 4KTEH 5E8PA 2C3VB 4X4XB 5IGXH 1OTUC 3QIWA 4GUPA 2X70B 2C26A 1AGBA 43CAA 1BD2D 1G7QB 1BREA 3CAFA 3MPCA 3QHZL 2AJ3B 5DJXA 4NQEE 3SGJA 2A9NL 4U6VL 4X4YB 1EGJL 2PF6A 3MRLB 3U36B 1NC4D 3KYOA 1CICA 3H6JA 4FRWA 5TE4L 1FL3B 1F11B 5A43C 2EXWD 3TT1H 4Y4FB 3MOBH 3S3JA 3QUYA 2HFEB 4U0QB 2JJWA 4QGYA 2WBJD 5I17A 5TDPB 2DQIL 3O3AA 1MHEB 3O4LD 1JFQH 2JK5A 3IT8D 1A22B 4GRWE 1KJVA 2KZ1B 4RFEA 4EI6A 3MLPA 4LLUB 5JW4Q 5BMFL 3B3IA 3I6KA 4HWNA 2NXYD 2IQ9L 3ZL4H 4AIZA 2DMCA 3I85A 4OD2A 4XCEA 3X11A 2CXGA 4OF0A 4Y5XC 1BIIA 3LAFA 2PYFB 2R1YB 4O4YL 3V9FA 5EA0L 1W0VA 1T1XA 4OIIL 2IF7A 2E27H 5DRZA 1P2CA 1QNZL 3CSBA 5IMLA 3QCTH 2XXMB 2H3NB 5JW3L 3O6LH 5D7KD 3EYQD 2DWDA 5FM4A 4X9IA 3L5JA 4I2XB 1NCBH 4XHJC 3RGVB 3WIIL 4QTHA 3MJ9H 3HZVA 3EYVB 3HZKA 3KPTA 3IKKA 5F9JA 1MELA 3IGAA 4JHWL 4M43H 4QRRD 1GPOL 4TULL 2V5SA 1DBAL 5DQ9B 1LWRA 5I1JL 2VR5A 2BNQD 1UZ6F 2GJ6D 1PLGH 4ZAKB 3HUJB 4ORZC 4H26B 4HULB 1L7TL 4M02A 2BSED 5IK3A 2J7LA 4HWZB 3MOAL 5I15H 2DLIA 1XGQA 4KVCL 2IADA 1JWUA 4P3CL 4TSAH 3QPQD 4KZEH 1Z9SA 5KVGH 1CLZH 1IAII 4P46A 3FOLA 4XTRC 4J3OC 4GS7C 5C9KA 5GRUL 1YYLH 2JCCE 4K7PL 3WN5C 3LRGA 1C16B 5GGVY 3D48R 3HR5A 4YR6A 2WZPD 5D7SH 5K9JH 3NFSH 1DL7L 1I7ZB 1BOGA 2YD5A 3MRCB 4HW6A 1E6OH 2HG5B 4PJAE 4KHTL 4G6KL 4P49A 3ZKQD 5CEYA 4M61B 1K3ZA 4G8GD 3SJVA 5I1AA 5F1NA 2EZ0D 4PJ7A 1JGEA 4PJGB 4YHYC 5T3XH 4X98A 5C0RH 3DO7A 2OLDA 4EBQH 3CFDB 3O81A 3TVMD 1AQDB 5E4EC 2HT3C 1RHFA 5KSVA 3DMMA 5H35B 3KLDA 5CFHA 4K3GA 4GW5B 4Y19A 1EZVX 3EYSL 3KYKH 3MRQB 5A2JH 2IAMD 1C08A 3VCLA 3TP4A 4X9HA 4YHKH 2R0LL 5TQ0H 4P9ML 3U6RA 4YXKH 3GI8L 2WV3A 4R0LC 1CIUA 4WIQA 4IOFC 1CXHA 2DBLL 1BGXH 2D03L 2ZPKH 2EEAA 4P4RB 1YEGL 1UM6H 1IGCL 1N4XH 2VLRD 4QXUH 1T1ZB 3ARDA 1HHKB 1T7YA 3SCMD 1MOEA 3P77B 1VEMA 3N85L 2Z8VC 1QEWB 2H26A 4N8CH 5DK0A 5FGBA 3QDMD 4UTBL 2ITCB 1NFIA 3S3PA 1NGQL 3FO0L 4FHBD 3HE6D 1RZJL 3AS0A 4I18A 3BDBA 3LZFL 4Y5YB 4URTB 5GXBB 1XZ0A 5HHXL 1BHGA 3MLWH 3HI6L 1S7QA 3SDDD 4NO2A 1F6AA 4S0TD 5DJZB 4FFZH 4UMGA 3VD3A 4EDWH 2FX8H 5I19H 2AQ1A 2P48B 4NQXA 1GGTA 1MRCH 5IEHA 4MAYD 2XN9A 3CZFB 4ZTPH 4PRID 4XC1L 1CDCA 4LF3A 4R97C 2PETA 1J1XL 5I1IH 3PWNB 1X9QA 5CJ5A 3PV6B 5I1EH 1XCQB 2DI9A 4FQXD 1J0YA 4JAMA 4P59L 2IQAB 2VL4A 5GGRB 1IKFL 4MD4A 1KFAL 4JREC 1AXSB 4JPKH 5FK9B 1FYTA 3ZMRA 1YPZB 1W72H 5HD8C 1FYTE 4WENB 1XGPA 5FKAA 2OTUA 3LHPH 1FCGA 3RWDB 2AK4B 2VXSL 3VI3E 3QCUL 5C8JB 2Q7NA 1HEZB 2H32A 1GSMA 2DIBA 3E6HB 5FYKD 3T0EB 2YPVL 4D8PB 3BFOA 4DTGL 1FE8L 1YNTB 3RX7A 3FMGH 2P24A 4FQ1L 4ZO6A 4F2MA 1EO8L 2XICA 1MF2L 2O5YL 2VN4A 1UJTA 4GRLA 4F7CB 2D0FA 5KVDH 3ARBD 2APFA 2Q76B 2OSLA 1RIUL 1VPOL 3BISA 5DJAB 5DA0B 1S7WB 4MA8H 2AXGB 3Q3GB 5J1AB 3T2QA 1DUYA 1U3YA 1NCDL 3F7VB 3SPVB 3S88L 3GSXA 4BK5A 2Y36L 1U8OA 3C5ZB 1M7DA 4PS4L 1BX2A 4GRMB 5F89B 4ONOA 1OP5H 1GRWA 3IDGB 3ARQA 4WDIA 5JXEA 2ITDA 4LHUB 5KANG 3ROOB 4N1HB 4ENED 3WFZA 3VFVA 3WLWC 1U3HC 2HWZH 2XZQL 1CI5A 1EEZB 2ZUTA 5I75C 3H9SE 4ZMAT 4X83A 3P0YH 2DI7A 1NLDL 1GC1C 2W92A 5D1QD 3IJHA 3GHBL 5FCSH 5IFHH 1FNSH 4TTDD 3DETD 5EBGA 5CP7B 3IXAA 1KGCD 1UH3A 5E8OA 2HVJB 3CFCL 1N8ZB 3PNWA 5ISZB 4PBXA 4JJHA 5DHVH 4BH8A 4ELKB 3QRGH 4IMKC 2V5YA 5KTEH 3W9EA 2X4QA 3ULUF 3AS1A 1Q38A 1J8HB 1UM5L 1HQRB 4D9QE 4KY1L 4ZNCD 4G6MH 4EUPA 2P5WD 1D6EA 4KDWA 4O02L 5I1KH 1DZBA 3D18A 3I50H 4R96A 2B4CL 4YXHL 4D2NA 5JIHA 3V6ZA 2YUZA 1RD6A 1EMTH 2GK2A 1XIWC 2F54D 4GMTH 4YFDB 3AB0C 2FO1A 1MSPA 3NCEB 4XCYA 1CFVL 5ACZB 3H0TB 2FDBP 3NGBC 2ZKHL 5DRXA 2CO6B 1KIQB 1WCQA 5CCKL 1MQKL 5AWNH 3RPKA 5K9QI 1F4XH 4HWBL 4PJCB 4UIKL 4NM8H 3WMSA 2C9AA 4P23B 3KJ4C 2NY1D 3MRJA 1G7HA 3P4NB 1INDL 4ZXBD 2W0KA 3MXVL 4M6AA 4BYHA 3UPRB 1U58A 4LHUG 5BXFA 1Y18B 4M1CD 4HGWB 3VWJA 3CPLB 1DSFH 4IJ3C 4YNYB 4JPIA 5IKCB 1NGXA 5KZCD 3ZE1E 2KH2B 4HS6B 1JWMA 4LMQI 4N8VA 3T65A 3WFBL 5HYQB 1A7PL 5D5MF 4KH2A 1T3FB 2O5XH 2XRAL 1BF8A 4NJAH 4XP5L 3P9LB 4YPJA 5T1LA 1S9YB 1PFCA 1FIGH 3O45B 5LGJA 1G9MH 1KPUB 3E6FB 1MCWM 1UEYA 3TPUA 5C08D 1L9NA 3QXWA 2P8LA 3QULA 4HQQH 4ODXB 4WFGD 3SE9H 5CBEA 1OSPH 4WU7B 3KXFE 4F33A 1NCWH 1V3JA 4LDOB 3VRJB 2ZOKB 1DDHB 5DHYA 3OGOE 4NJ9L 1QBLL 4GKOA 3DUHA 4N0UE 1H5BA 1IAIM 4K55A 2OCFD 1PJ9A 2CDGA 3LRSA 4LSTH 5DK2A 1MRDH 1D3CA 3P4LA 3SN6N 3VFGH 1A7QL 3LKOB 5I74C 5T1KA 3SKJH 1XGYL 1AY1L 2JJSA 2ZUWA 5DHXB 4TVSa 4UV7H 4MNGA 3QXUA 4MSWB 4U2YA 2WINA 4H8WL 4PRHE 1TPXC 4PY7B 3DBXA 5D7LD 1P53A 3GDBA 1EHXA 1JTOA 1B6DA 5J4MA 1EFQA 4K7PY 3JVGA 2VDQH 2VQ1A 5DRNA 3MV7B 4M7JL 2AEPH 4KRPB 3SDXA 3VG9B 1YEJL 3ULUD 3D0VB 1WSST 3WFDL 2AV7B 1KLGA 2J6EA 3O8XA 2GUOA 2R23B 3SDXE 2EIDA 3DUSA 4CKVX 4KROB 1EAPB 2W9DH 1IAIL 1DQLL 3WHXB 4Y88A 4ZFOA 1I9JL 5IMMB 1UWEH 5BRZD 3ESUF 3SKOA 1JPGA 1X6NA 2F58L 1PBYA 5KVFL 4Z77B 1IFHL 2AGJL 4KPHH 5HGHB 3BXNA 5IMKB 4OD3H 3BVNA 2VAJA 3IKCB 5FYLE 5K33A 4E42B 3DROB 3TBYA 4KJPD 4JGUA 3WS3B 4UINH 4LCWE 3V52L 3WDIA 1AXTL 1I3UA 1RFDL 4XNUL 3QUZB 4QNPE 1U8QA 1NCNA 1QZ1A 5F7WC 3MJ8B 1PW3A 2JLLA 1IC4L 3PWUA 4YHLL 3STZB 1I9IH 1JI1A 3HNTL 4FQLH 1FBIL 5J13B 1OAXL 5HHMD 2YPKA 3BD3A 1UM4H 4ELMA 1QLRA 4AM0A 2Z91B 4OM1H 2Q86B 4ELME 2J8HA 3WIFA 1FSKC 1DQMH 1CFTB 3K74B 1RZIA 5D7JA 4JO1L 3NBNA 4Y16D 4DAGH 3TZVD 3UTTA 2EYSA 2ATKB 2DM2A 3UTTE 4P4KB 3HB3C 3NACH 4UT9H 2XNAB 4HKZA 4ODVL 3LV3B 4PJHB 2BDNL 4M7LT 3GKWL 4W70A 5DS8B 4HZLA 5E2UH 2E7CA 1A3RH 5JDSA 5EB9A 4XRCB 3BEWB 2DB8A 4FQCH 1WT5A 4OLZL 2VZ1A 3MGTA 1KC5L 3F7YA 4HJGA 5HYIA 5JUEH 2BSTA 4W6WB 3X12A 3BW9A 2M1KA 3RAJL 3QHTC 5TH2B 2YRPA 5E00A 3REWA 2OL3B 1BVZA 5HGDA 4LSVH 5C0CD 1K85A 1KEGH 3PHOB 5C0FA 1UACL 4O00A 3UBXB 1L0YA 5D70L 1U8MB 1UKQA 1DQQB 3LY6A 2M8XA 3I6LE 1QBMH 3F8UB 2X4RB 5IP4A 4Z8FL 3LPGA 4BZ1H 4D9LL 4K7FA 2EDQA 3S5LA 5E1AA 3UJJH 5D1XC 1T66C 5TJWK 4N5EC 1RJYA 1RZ8B 5DD0H 4LGRB 4G3YL 2EKSA 2WLYA 4J3UA 3L7FA 2AXFA 4UDUA 3DUUB 1H0DA 1ZOXA 5D2NE 4HZAA 5DDHA 4GAFB 4I3SH 2CO7B 1LNUB 3VW3L 2Y25A 5DZLA 4X7TA 5C92A 4Z9KB 2ZP0T 1VCAA 4FG6C 3BDYL 4HK3N 4XXCA 3L95A 1AIFB 5J11C 2VXUH 4JO4L 1U41A 2HT2C 2X89D 4M7LH 4XC3L 2RFXB 4UU9B 5JHLH 2I24N 4I13B 3QQ4A 4JFPA 3VFWA 5FDYA 2BVPA 2NW3B 4OCYL 4P5KA 1MCKA 1LE5A 1DVFA 4R2GD 3O6FD 5F6HJ 5GGTL 1FV1A 1S9XB 1MIMH 4LFHD 4KKCC 5BS0E 5MI0B 5HPMB 1FFNB 2CKBL 5EIIA 2NY6B 2F53D 3BPNB 4U1MB 3I02A 4XVSH 3HUJF 4MS8D 5D2LA 3RGHA 3WHE0 5C6TH 3UDWA 2EDTA 5FKPA 2VXQL 1JGVL 3Q1SH 4Y1AE 5EUKA 2G9HA 4A6YH 2CRIA 1MCNA 2AVGA 4PP1C 1UG9A 5DTFA 3RRQA 3UBXG 2D7QA 1VACA 2OI9C 4IOIB 2KL6A 2QSCH 3MRPB 4HXAH 2HFFA 1M7IA 2BSSA 5ID0B 5I18H 1WFTA 2R0ZH 1MCRA 2FH6A 1EJ6A 4P5MB 3PWPD 4NNYA 3M17B 2QQLL 3FO1A 3QDJA 5ICYA 3DECA 1XAUA 3CMOL 2CSPA 5B21A 1JE6A 3QDJE 5F21B 3IFLL 5ACMA 3V8OA 1U92B 3TNMB 3GIVB 1NC2A 3INUH 2YPLB 4YHOH 2I07A 5KN5A 1K4DB 4F57H 4LLAA 2A77H 3VFSA 1CBVH 4JFFD 4FNLL 4PJGF 4F58H 2F8XC 1R0AH 3DO3A 5SX4H 1KLUB 2FX7L 2OTPA 1FJ1A 1Q9WB 4S1RH 4P2QE 1U6AL 1LDSA 4JO3L 3HPJA 5LG1A 5H94A 3NTCL 3PL6D 4N1CA 4KV5F 5FCUL 5HDLA 3EIFA 3MFFB 1HINL 2EXWC 4CAGA 4FZ8L 2BY2A 5GS2H 2G60L 4X6EB 4KDTA 1T6VN 4U6HB 2HH0L 1KCSL 3RY6A 2GEEA 1CDJA 2D7TH 2QR0B 3VH8B 1WIPA 3PP4L 5BO1H 1VFBB 5FM5O 4OKVB 5I1GH 4BZYA 4GG6B 3I6GB 1W72B 3LCYA 2DQDH 4P3WA 4UQ3B 4Y4FD 2GCYB 3UTZB 1O5DT 2NXYC 5IJKC 4QRPB 1YY8B 2AJSL 2CRZA 1HCVA 3DGGB 2ZUQB 1UVQA 4HPOL 1G0XA 2BOBA 2XG5A 3TA3A 1ES0A 1S7VA 3QJFB 3QPXH 5CEZE 1SJEB 1RJCA 2AW2A 4MD0A 1VKXB 5T3ZH 1L7IH 1T7VA 2YXFA 5DUBA 3H3KA 4PIRF 4HKJA 4MA7L 3RKDC 1H8OA 1MHCA 43C9B 1JRHH 5DJDB 1IZKA 1JPTL 2BY0A 4HUNB 4KDVA 4CRPA 4TNWK 5DI8B 4CADB 4MDIB 3U4AA 3L3OA 3VXQA 3P2TA 8FABA 2VJXA 5FYKU 1HHGA 5DYOA 3HAEA 3MYJA 5JHDB 1D9KD 1Q72L 1LO3L 4OFKA 3IDNB 3KPSB 3MLXL 3RGVD 3FRUA 3VGHA 1CD1B 4QY8B 2Q8BL 2IPKA 1A3QA 4HUUB 1NCUA 2R2CA 3TO4B 4S11A 4ZOBA 2JJTA 3ZTJH 2J12B 3ARFA 4WNQA 4AEHH 4FQHA 4ZAKD 4TULH 1GPOH 4Y4KB 4XVUC 3ZLQC 5IVNA 5I1JH 2H2SD 4OAWB 3HLAA 3ZT6A 3WDJA 2BVOA 4XXDB 3TH3T 4PR5B 5ADPH 3AXLB 4HKBB 3OGCB 2HT4D 3G08A 1U8PA 3KJ6L 5CMAA 2EZ0C 3LKPB 2BFVL 4OLXL 1A1MB 5GRUH 3VH8G 1Q9KA 4Z0BL 5DHVB 4FA8A 3VFNA 3TVMC 1BFOA 2VN7A 1NANI 5CHNB 1SYVB 1CK0L 1X5XA 3V6OC 1DQJB 4KKNA 2ERJC 1RUAH 3IDJA 2HAZA 3NOIA 4G6KH 5CZXD 5BJTB 2UY6A 2AEQH 3O9WB 3JV4A 2IAMC 3V2AR 3KPMB 4YDVA 5F71A 1AFVL 5J56B 4R3SA 4TRPH 5L2JA 2A1WH 3DTXA 1A0QH 4RDQF 3ES6B 3GJEB 2PN5A 5I76A 5EWIL 3FN0L 1JMXA 5AUMA 1MCHA 3IFPA 5LCVH 3NCYP 4MYWB 1HH6A 2GK0A 2HN7B 2YZ1A 2EYTA 3EYSH 4NKDB 1HK6A 3SCMC 4WI7A 4Y5XA 1KXVC 5HY9A 3JTSA 3UZQA 1ETZB 4G8EB 1QQDB 3VXRE 3HE6C 4QHUB 4JLRB 1F8TH 2F74B 5EO1A 2X44D 2DBLH 3MXWH 4LPVA 2CK2A 4AENA 4OD1H 1KYOK 5GHWL 2D03H 5KSBB 1MCWW 3SDDC 5E24E 3GM0A 3GSQB 2J4WH 4L9LB 1UJ3B 1F90H 3W0WE 4MAYC 3GMQA 5TDNA 4UTBH 3ZYOA 1NFDE 2ILLA 4HJJH 2PTUA 4YDIL 3BSZL 5JMRA 4TVPL 1GGYA 1KULA 4FQXC 1KIUA 3QWRD 5B38B 3JWDC 3S4SB 3HI6H 3BH8B 1KSRA 3L3KB 3WN5A 3TIEA 2B39A 4PD4J 3WUWA 5FF6A 3WFHA 5JOFB 3QEUA 4LCWB 4RIRB 4O2EB 1AHWC 1ADQL 4PJCF 4FQIL 4Q2ZB 2CUHA 1FLTX 4MJ4A 4U7KA 4ZTOH 4U33A 1J1XH 3AREB 4MJ6A 1JMZA 4GKSA 4U6XA 5DUPL 3V5HA 1YQVL 1VGKB 3CFEB 2YN3A 4N90D 2KQMA 1HSAA 5IR1A 1EVUA 3OAZK 5GSRB 3CU7A 2MQ0A 1PQZB 3GKZA 2GHWB 4V2CB 4Y8AA 1R3IL 1U93A 4PLKD 2AK4D 3DNKA 4F7EA 1EFXA 2GJZA 4LARL 2HKHH 2GITB 5CZVL 3BPCA 3ZE2F 3RZCB 4FABL 3DVFA 2CDEB 3T0ED 4WI8A 2VXSH 2EEDA 1EK3A 1S3KH 5T1MB 1OSZB 1WWAX 4DTGH 1AO7B 5JIIA 4AH2A 3T0AA 1D5BA 4R0LA 3WDHA 2YC1A 3WYRA 3IU4H 4JQIH 5DEFB 1FNLA 3KDMB 1ZGLP 4ORGB 3C9NB 1P7KB 1VPOH 4LRNH 2VB5A 4OFVA 5F3HB 4OGYL 1QA9B 5F7DA 5DFTA 4J8RA 5DT1L 1WIOA 1YEDB 1MJUH 4N9GB 4PRBA 5ALCH 3C5ZD 1MCDA 4TTDC 1FPTL 2FGWL 3J8F7 3DETC 4NQUA 5ECJE 2Y36H 3GSVA 1M6OB 4PLNC 4OIAA 1RZKC 1QP1A 1TZHA 5SWZE 2GJJA 1QD0A 3TJEH 1GVIA 2C1OA 3KS0H 2DBJA 1A3LH 2XKUA 3VE0A 5B38G 4UQ2B 5F97E 3RVTD 3K81A 3MRBB 3V6BR 1SY6L 2X9WA 3LKSA 3S3SA 4X5WB 1ZLWH 3BZFA 2Q7YA 3OKDB 4Z76A 3ARRA 4JM2C 5ANME 3OPZL 2ZSVB 4QF1A 4UT6L 3CFCH 2VXVH 3UJIL 3AC0A 5D71H 1G7JA 1J8HD 3V4UL 3G6AB 3TBWA 3CLEH 3IRPX 3B9KA 4DEPC 3ZDYE 4QRSA 5EU3B 1UM5H 4KY1H 2NY7L 4L3ED 5B8CC 5TF0A 5JLZB 4JZNB 3U48A 4L8BB 4WO4B 3WD5H 5C0ND 2AEIT 3UTOA 2VQTA 3O3EB 1BZ9A 3DWTA 2XWBA 5A2IH 5EFIA 2IBZY 5EBLA 3VFUA 1XGRB 3ZKXC 2XZZA 2Z35B 3RHWF 4PRAB 4ZXBC 4X9GA 1YEHH 3X13A 4QCIB 1NMCC 5FB8B 2F9BT 4NC1C 1LO5A 2X4TA 4XMLH 5FM5M 3CMGA 4HAGA 4Z7UE 3RHWK 4NQCE 1KELL 4K8RD 4M3KB 1MQKH 3QR2A 4P23D 4XCFL 4HS3A 1B4JL 3KPQA 2JCCF 1ZGLM 3QZWG 4LRIA 2RB8A 2FZ3A 4CBPA 1FC1A 5AAMA 5C0GA 4FMFA 5LVEA 1CGSL 4HS8L 1ZT1B 4H1LA 1ED3B 4NZJA 1U3HA 2I26N 3U1SL 4ETQA 1TETL 5SV3A 1QR1B 5D8JL 4QXTB 4KK5D 1RIHL 4P5TB 1S7XB 5DZOA 3NPSB 3C2AH 1FFOA 5DVMA 3G5XB 1A7PH 2E3VA 3GMMB 2VE6B 3QDGB 4TPRL 3ZZ1A 4P2QB 4X99B 4LSSH 4XPAL 1KCKA 1OCWL 4IMKA 3Q5TA 1G7PB 4F37K 4OI9A 3KPNA 2R2HB 1J0HA 3EOAA 2R0WH 4YDLC 5J12B 5CJXC 1BVKB 5ICZA 4OTXH 1IQWH 3GSWA 1TITA 3SDAB 4RMTA 1RZGB 3FB8B 4HG4K 5E9DB 4NQED 5GGSY 4CNIA 3OX8B 5JOPD 2OMBA 5E6IB 1BBDL 1A1OB 4RX4A 1ZWIA 4YBLC 1XR8A 1XIWA 3FN9A 4KGLA 5F1IB 2CIKB 3U46A 4DW2H 2DQUL 1SHMA 2EE6A 4M4RA 3HMXA 3O2WH 4AEIL 1V3KA 4LVOC 1UADC 4YBHA 4BQ6A 4CMMB 1BMGA 1MJJB 3W39A 2G5BA 5GS0L 3ULUL 4UI2A 3ILPB 1BQHB 4DGYL 3MV7D 2BJMH 4M5YH 1A6TB 3EJYD 4NOFA 1IGYB 4KRPD 4TUOA 5H8DA 1P84K 2CIIB 4U1IB 2R8SH 1HILB 1QSFA 3C08L 5IB1A 1CG9A 1LP9A 1N5AA 1YEJH 3LKQA 1P4IH 3BO8B 4KJPC 1LP9E 1A6WH 1H9VA 4YDKH 1A4KA 3E1F1 4GLRI 2PTVA 3DARA 3C8KA 4XBGB 1I9JH 2G75B 4E0RA 2H32H 1T0PB 4WHTB 5JQ6L 4BQ9A 3PQYB 5I1LA 4DN3H 4DN4H 3ARTA 3OKKB 4L4VA 1NMBL 2VZVA 1CFSA 4DZBB 2DWEB 1LVEA 3EFDL 3D2UA 5DK3A 2H45A 4BUGA 2V7HB 2UZXB 3QUZD 5J06A 3V52H 4MAUH 3LPWA 1LEGA 5KANI 2XA8L 4LPUA 4U31A 1EXUA 1XF2B 2DQJH 5EOCJ 4X6BA 1JZ4A 1HOCA 5F9WB 4WEBH 4KRLB 2ICWB 5E08L 3UXFA 3CDGB 4QKXB 1FBIH 2Y07L 1OAXH 2XTJE 2XWTA 3C5JA 2ARJA 1G84A 4QYOB 5I73C 4XH2B 1ZHKA 1ACYL 1Z0MA 3LEVL 3GK8H 1IQDB 2F5AH 5MEOB 2YEZA 3KG5A 4U0RB 4NKQB 2L4OA 5IWLC 3WNMA 5A16B 2V9QA 3D39E 1T03L 1I7TA 2R2BA 4KMTL 5H2BA 3LN9A 1JK8B 3DV4B 3T77A 4ODVH 3OKOB 2BY3A 2XI9A 1RULH 5IT2L 5K59E 2FD6L 2EIBA 2DYPA 3PXHA 2NY5C 2HVKA 3RX5A 4UAOC 2P5EA 4GMSL 3RAJH 1YUHA 3ALWA 4K94H 3SDYL 3WIHL 4R7NA 2ZZUT 5CD5D 2DD8L 5IW6A 3RY4A 3AS2A 4PGDB 3EO0B 4L8CB 4M8QA 25C8L 1TZGH 2YA0A 1NAMA 4Z95L 2VZ3A 1QFWI 2IPTL 1FFQA 2IGFL 4EUPH 1B0RA 5DJ8B 1OL0A 1RZFH 4I5BB 4K3DL 5INCB 1MFAL 4OCRH 4LASL 4GG6F 4HIEA 5ICXB 3GBNL 1J5OH 5T5NG 4HX1A 4OZFA 4M93B 1NEZA 2VO5A 1TJGL 2ADGA 2VUYA 3MRNA 4BQBA 1RUPH 3FKUS 2ESVB 4ODHL 2YN5A 3CD4A 1UWXH 4YE4H 2NW2A 5GISL 4YIQA 4C58B 3MJ7B 3BPOC 1Z5LB 3HPLB 4R2GC 4L8SC 1J18A 2Y5EA 3B43A 4CGTA 4I4WA 4PG2C 4N0YH 5ERWA 1INQA 5J1SC 1TXKA 3MCLL 5IB3A 1LQSR 2BC4B 3ZHLA 1F3DJ 5IB4A 3STLA 4KU1A 1JUFB 1QSEB 3X14A 5T1DL 4NCC1 3TO2B 4J6RL 4DKEH 4MS8C 2OP4L 4RNRA 3RWCA 5HHPA 4HC1L 4JR9L 1WK0A 5JW5B 4FS0A 5FYJL 3AM8A 2YK1H 1JNNH 3LIZL 1CGTA 5C09E 1EDQA 3BP5A 5EIVA 5INDA 3TYFB 5LGKA 5J3HD 2W0FA 2A6IA 4UUJA 1E28B 5AZ2H 4CU7A 3IJSA 4LEXL 5CINL 2NY6D 5SWSE 1MCOL 4GAJL 5EOTA 5FUZH 4WV1A 1T21A 1JN6B 4ZFZA 2VL5B 4P9HH 1I85C 3U9UB 1JGUL 3ZHDA 2A74B 1XCTB 1LO2H 4NCC2 2MCPL 4L8DA 3FFDB 3QXVA 3HR6A 4OGXL 1PKOA 5DQDL 1S9WB 2WP3T 1TFHA 2VKXA 1LO4L 1LDPL 1UH4A 3U2SB 1BVLB 5BW7A 3VFMB 5I30L 4M48L 5C07A 4JRXA 3VXUA 1A1NB 3P9MA 4ZUTB 5BV7H 3QJHB 4MA3B 1HIMH 4NZTL 5D1XA 1GGUA 3ZTJG 2OBGA 2AAVA 2A0LD 3PL6C 2EE9A 1FCCA 5HYJB 1CE6B 3FQRB 2P44B 3FOMA 2ENYA 5E7FA 1Q9LB 4NFDA 5F1KC 2YZ8A 3OKNB 3O11A 4PJBA 5CILH 1EA9C 3QUMA 1H3GA 1QPPA 2PW1A 1HKFA 3BRFA 3ULVL 2C3WA 3IF1B 1CDBA 3EO1A 3DYMA 2FX7H 4D9RD 3QG6B 3QWOB 5ADOL 1REIA 4GG8B 4JO3H 2VC2H 5SWZB 1P7QB 4FXGA 1J7VR 3W5MA 2BHUA 4WTWA 5JIPA 4Y4FC 3MROB 5DJ2A 2YA2A 1I7UA 2MHAA 1CU4L 1AGFB 1KIPA 4Z78A 4FZ8H 4WTXA 1GAFL 3MRIB 5DD6B 2G60H 3OR7B 2FYYB 3LKRA 4O2CA 2HH0H 4BFEA 2CLVA 3PF2A 4OZ4B 3MO1B 3EOYG 1BZ7A 1TQBB 1GCFA 5SWQB 6FABL 4X6DE 1WZLA 2BSRA 3O2DL 4P0DA 1YA5A 2DIAA 3QFDB 5KSBF 4LLVA 1MI5A 4HCRA 4OV5B 4QRPD 4XNXL 5TQ2L 5GS1A 4MJIA 4KXZI 3MUHL 4ZS7H 3IFNL 3QA3A 3MODH 1ZANH 4MWFB 5F7MC 5L0QB 1WBXA 1N6UA 5AZEL 3QO1A 4ZOCA 3IAPA 3S35L 2Z4QB 5F8QC 1MCPH 2I60L 4PJFA 3QIWB 3P30L 4PGBB 5CWSA 1D9KC 2P45B 5EO9A 2CMRH 5DWUH 3QIBD 1CXFA 2UWEE 3LQAL 4MA7H 4FMKA 1I7RA 4OZGE 5I6XB 2Q8AL 3OHXA 2ZCHL 3LD8B 4OLYL 4HUMB 1DBJH 3KYOB 1CICB 2Y9RT 5F3BB 5B22A 1KOAA 1DFBH 3EO9L 5JXAL 1P5UA 1RSFA 1RZ7L 3CX5K 3DVGA 5JHDD 1PKQA 2H2SC 2ZSWB 3SKUD 4Q9RH 3ARYA 1AJ7L 3KPSD 1PKQE 4OQTA 2WWKT 3WXVH 3DX6B 1MVFA 1OGTA 4P48A 3TO4D 3NABL 1CS6A 2HT4C 4KRNA 3IU3A 4JDZB 3NAAH 3UZVB 5KS9A 1BD2A 2E7LA 4EI6B 1MHHA 4QHLA 1U42A 5KS9E 1BD2E 4EN3C 3B3IB 3I6KB 3TESA 3KPPB 1BJMA 5KSAD 1NC4A 3PGCB 4AIZB 4OD2B 4XCEB 4NN5B 1MCQA 1BIIB 5LQBH 5CZXC 1AP2A 1QVOA 1T1XB 2WIIA 4Y2DC 5DRZB 4GO6B 1LK2A 3EHBD 4ODUA 3SGEH 3KJ6H 2WBJA 2DWDB 3RWFA 4R90H 5F7LB 3MACH 3O4LA 4Z0BH 1QR4A 4FQQA 4FFYH 3EZ8A 1D5IL 2R29L 3QEQE 3W81A 12E8H 3O9WD 1NCCH 4EDXB 5C7XL 4H0IA 5IJKA 3TLRA 3BT2L 5C0IB 5IK3B 5IBLD 3KXFD 2QQKL 4LOUC 3MA9H 3V0VA 1JWUB 3GM8A 3AY4C 2AP2A 3EDFA 1AD9B 1AFVH 4K9EC 4G6AD 1MHPL 1MAML 4NSKA 4UOW1 3T08A 2W59A 4NDMA 2X4NA 3U0TA 4DUXA 4ZUUA 4ZSOE 1EAJA 1EEYA 3BHBA 2XA3A 4BJLA 1R3HA 1FN4A 3H2WA 1BOGB 3S8WA 4LMQE 2CK0L 4OUUA 4U1LA 1KCUL 4QRRA 1NAKL 2BNQA 1MCIA 3PDOA 5CJOH 4QRRE 4M62H 5CEYB 4PRHD 5MEPB 5CGYC 1T80A 3ZYJA 2VLLB 1JF6A 2BNQE 2W60A 2GJ6E 3WUZA 5TF1H 3SJVB 3PWVA 5F1NB 4PJ7B 4NZRH 4NWTL 4HGMA 4APQC 5C9JA 1YMMB 3RTQB 2DQTH 3P0VH 5M7QA 3DO7B 15C8L 4X5LA 5IHBA 3UBXI 2DL9A 5LGHH 5KSVB 3DMMB 1HXMB 2CGRL 3DX7B 2EO9A 7FABL 3HNVL 3L5WA 2EXYD 5TPWH 4Y19B 3ECBA 5F7HA 1AGEB 1IC5H 4G8FB 3FT4A 4FXLA 1RMFL 3JWOH 5ID1B 1JVKA 1QFWM 2B1AH 3WV0A 3U6RB 4WHDA 2ICES 3GMOA 3BSZH 4F9LA 1Z9LA 4G8GA 3TFKD 4WCYH 1PEZA 5D4QA 3OJMB 5FYLD 1CDUA 4G8GE 2CR6A 1N3NA 4R9HA 3IS0X 5FOJA 3VFOA 3I2CL 3SBWC 3TVMA 4LCWD 1DBKL 2L7UA 1FL5A 1YYML 4JKPL 2PYEE 3PP3H 4JZOB 1L6XA 5K9OA 1MWAL 2DN7A 3LKNA 2VERN 4FXKA 4OCSH 3BJLA 1JP5A 3V6OA 2VDPH 1RU9H 4PV8B 3T0EC 2FSEA 3GSNL 2IAMA 3QUML 5DMKA 1NFIB 3S36X 2DQHH 3MRRA 4MZ3A 3VMPA 1ZA6B 3OG4B 4XP1H 3NA9L 2HTKC 3GMLA 2X7LA 1XZ0B 3MNZB 4QWWC 3AVEA 1S7QB 4X80L 4NO2B 1R3IH 3LH2L 4LCIL 4PTTA 3VGDA 3NFNB 1QFWL 1A5FL 4CMHB 1F02I 4NQXB 5IEHB 3P4OA 2KPNA 4U3HA 2XN9B 5JPNA 2VLRA 3S96A 3T4YB 3HCVB 4LF3B 3DX9A 1UXSA 3SCMA 3QCVL 1XMWA 2VLRE 1A14L 2P7TB 4XPTL 4RGNC 3AU1B 3QDMA 4ONGH 1KB5A 3RNQA 2DLFL 5CEXA 4Y5VC 4NHCH 4JAMB 2YRZA 4F7PA 1JHTA 3HE6A 1B9ZA 2NY3B 3F7RA 4MD4B 3IJYA 2VAAA 4WEUD 4JDVB 2WUBH 1ZLVK 5HVGB 4WI4A 3GRWA 3SDDA 3BKJL 5FKAB 3RVTC 2OTUB 4LL9A 3BGMA 5HBBA 1CQKA 4MAYA 3I6LD 4KUCF 4PRIA 4TVPE 1A7RH 2CJUL 2BNRA 2ARJQ 1FPTH 3PUCA 5IQ7L 5DMIH 4F2MB 2P24B 3E0GA 3WO4B 4FQXA 4GRLB 2VISA 5L2KE 4FQJH 2BRRH 3LN5B 5GZOD 4B5EA 1N0XL 3SGDH 4K71B 4JG1H 4GW4B 2AJXL 5ACLA 2NY4D 3HNSH 3HAEH 4PFEA 2GTWA 1UC6A 1QYGL 1AR1D 1OTTC 4U1HA 5FO8A 1UZ6E 2A6KA 2X4UA 4Q0XL 1DBBH 1TVHB 4OT1H 4S1SL 3TT3H 1RUKH 3RL2A 3TH2T 4ZD3L 4ALAH 1M7DB 1LO0H 1R5VA 1BX2B 3G5YA 5E56A 1FZOB 2VH5H 5C0NC 4OGZA 4PRDB 1YC8A 4WDIB 4X0KA 1ULVA 5I1HL 2YUVA 2A73A 3T2NL 1KT2A 3ARBA 4PPTA 3GUTA 4WGVB 5L8KB 1GGCH 3L1OL 3LEXA 3R8BB 3N1PC 3C60B 3IJHB 2AJZB 4NN6C 2H1PH 3UCRA 4WO4D 2LTQB 5T5NF 1BQLH 4JY5H 4P23C 5C3LD 2E9JA 5E8OB 1XGUA 5L8JB 3BD5A 1T4KA 3PNWB 3VGFA 4BH8B 1UA6L 3MNVB 1UGNA 3D6GA 1MNUL 3W9EB 1T6WA 2IH3B 2AI0L 3V95A 3Q48A 3QNYB 2ADIA 3QI9D 2I25N 1PG7L 4KK5C 1RJLA 3HI5L 3P0GB 2V17H 1I3RA 4JKLA 5D1QA 4NNPH 4Q58C 1MUJA 5D7IA 4R26H 4XCFH 3LSOB 1T7XA 3D18B 4R96B 2JELL 1B4JH 4JFOB 4XP9L 5ITBH 3V6ZB 5GRJL 4AK1A 1T1WB 3MRMA 4WFHE 3EJZD 5EBMA 3WS6C 1ZE3C 2O5ZL 1CGSH 1KGCE 2Z31D 3JUZA 1YEFH 4P5TD 5AYUH 3PGDA 1IC7H 4YLQT 4JY4A 5KW9L 3CJJA 2X4SA 4HH9A 3V6FB 1SYSA 1MY5A 2WSKA 2XFXA 3DX8A 3D69A 5GSVB 5T33H 5DR5L 1V5JA 5HGBA 1KTLB 4P2QD 2P5WE 4YHML 2V5MA 4TPRH 4BH7B 3WJLA 3MRJB 1G7HB 4JFQB 3UPAA 3U0PB 5HI5D 4UT7L 3TYGL 4NN7C 1OCWH 3G6JA 2X4PA 2XQBH 2AJVL 3A6BH 2F54A 3C6SB 3WSQL 3B2VH 2D31A 5BXFB 3GGWA 2QEJA 1EV2E 5BZDA 1FVDA 1B6UA 4NWUL 3VWJB 1I1AB 2F54E 4LIQL 3SDAD 1DUZA 4LCYB 4JPIB 2DQGL 3RPIB 1J9CT 1EVTC 3MBEB 2XPGB 4OLWL 3KPRB 4KUCD 1NGXB 4C4KT 3TN0B 1INEH 4PJDA 2VTFA 4X7SH 1DQDL 1JWMB 4GKNA 3T65B 5B8CA 5E6ID 2OS7A 1QLFB 4YHPA 5MENB 3DI2B 2EDNA 2AJUH 4L3CA 5E8DH 3EJYC 2CKBB 3QEHB 1PVHA 1JHLH 1IGMH 4GSDL 1XEDA 3RZWA 1R5WA 4KJWD 3QNZA 4ZXBA 4OM0L 3KPOB 2GT9B 4JB9L 3I9GH 3QULB 5CEZD 4NC1E 4G7VH 4G9FB 3FB6A 4F33B 3U0WL 4EUPG 3UPCA 2IANB 1F45A 1U8KA 2IFGA 5BV7B 1H5BB 3QH3A 1IILE 3T0DA 3WFCL 3P73A 1GOFA 4P3DB 2CDGB 3LRSB 4UIMA 1YQ2A 2W1NA 5IB5A 4RWHA 4D0DB 3GSRB 4K3JL 1T5XB 3D0LA 5T1KB 3QUZC 1AGCA 1E4WH 1FHGA 3L7EA 4U1SA 5E5UB 4MCZB 3VD7A 1MLBB 4MNGB 5FEBA 5C08A 2RCSH 1DE4A 3PQYD 4KTEL 5J13C 1MVUB 5C08E 4YBQC 5IGXL 5CUSH 3S97C 4N8PA 3ULSA 2FLRT 4OI7A 1FZMA 1K2DB 4U2ZA 5DRNB 4ODBD 3EFDH 1W8OA 5C0AE 5ELIA 5E03A 4MNQE 3OZ9H 1KLGB 2GUOB 3N9GH 1ZHLA 1NKRA 1SBBA 3DUSB 5TDOB 5CJXA 3TT1L 1Y6MR 1MFCH 3FONA 3MOBL 3PDGA 3SKOB 1JPGB 1YEEL 4U1GB 4FFWD 3NH7H 2Y07H 4J3XA 4D0BB 3PV7A 1EBPA 1SQ2N 5D7LA 4N8VG 1JFQL 2GFBA 3BXNB 2HA1A 1S7SA 3JWDL 3MLVL 4PV9A 2B0SH 2BVQA 3SO3C 4WUKH 5KG9A 2ATPB 2X10A 3CK0H 4TQEH 4KMTH 3ZL4L 3T4AA 5IFJA 3PDDA 3ULUE 1RAMA 3E2HC 5HYSA 5DSCB 3SQOL 5JDJA 2JIXB 4IHOA 4LCUA 5IT2H 2FD6H 2WM0A 1G9NC 5BRZA 3RWIA 2E27L 2YPKB 4FOMA 1VENA 4AM0B 3O6LL 3SDYH 2ZUXA 5GGRY 1RZIB 3MJ9L 4RBPH 5D7JB 4XWOC 3DV6A 3BPLC 2A83A 3ALPA 4LGPB 3FJTA 25C8H 4NRZB 4YDJB 3S36H 2X1XR 3ARDC 2V2WA 1U8JA 2XKSA 2IGFH 3V7AG 1PLGL 3S98A 3QG7L 4U05A 1HSBA 1PYWA 4MXQD 4BSVA 1AI1H 1PZ5A 4LASH 4P2OB 4HZLB 4TSAL 5JDSB 2P43B 1CLZL 2C3XA 3MGTB 1WC7A 4HJGB 3FT2A 1IAKB 2HLFD 3BW9B 3LQZA 3BP6A 5E00B 3REWB 4Z7OF 1YYLL 4TSBL 1EUTA 3BESR 3R8QA 1KTDA 4K07A 4Y16A 3S37X 3TZVA 5K9JL 3NFSL 2VABB 3CVHA 5IMOB 4LPTA 4XNYH 4HIHB 1E6OL 2GYSA 2PTTB 4I0PB 3SGKA 1I1FA 5J3HC 5MI0C 3JV5A 4LPYA 2N7BA 2NY6C 1CCZA 2EYRA 3WXWL 1IE5A 5E1AB 5D5MA 5T3XL 5CKAA 5JZ7D 4Z7VE 5C0RL 5D5ME 1RJYB 4EBQL 4XNMA 1X6LA 3TBVA 4F15B 1XR9A 3NCJL 3L7FB 4HC1H 3ABZA 4JR9H 4UDUB 4H1LH 1IGIH 1OD9A 3O0RH 5EC2A 5FYJH 5IWLA 5EU6A 3VMNA 1CFBA 5C0CA 1QLEH 4ETYA 1J11A 1GC1H 3QIUB 2CLRA 3FQTB 3KYKL 5C0CE 5EOQH 5IV2B 4NOBA 1NGYB 2Y72A 1WUNT 1TENA 4YFLF 1TVDA 4ZPTB 5CD3A 4GAJH 3L95B 1NSNH 3KLHD 2EECA 1DEDA 3HMWL 5IQ9A 5I1DA 3BWAB 4QTIL 3B9DA 1ZEAL 3VXSE 5GJSH 2A0LC 3QQ4B 3VXTB 4JFPB 2ZPKL 5E5RB 2ADFH 3VFWB 5F7EH 4DUWA 5A2KH 1UM6L 1N4XL 4QXUL 4EXPX 4P5KB 5JMOC 3VRIA 3BIKA 1NEUA 1DVFB 1V8HA 3ET9F 4F8QA 4K3HA 4N8CL 2YR3A 2KZWA 3R4DA 4M48H 4KKLD 2P47B 4F7TB 3MZGB 2VDKL 4JE4B 1N64H 4ZYKB 5HYJD 4M7KH 5D2LB 2EC9T 4QO1A 3MLWL 1IAMA 2X89A 2WMPA 4DFIA 4FFZL 2LV4A 5EUKB 4EDWL 1RVFH 4PJIB 2FX8L 5I19L 3HMXH 4ZQKB 1MRCL 3R06B 3DIFB 3I3DA 4ZTPL 5DTFB 5C2UB 5SWZD 1P7QD 2Y6SD 5I1IL 3O6FA 1M7IB 1YDPA 1T7ZA 4X7EC 1JPST 1QRNB 5I1EL 3FO1B 3PXJA 4JHAH 1OB1A 4HT1H 2X4OA 4AZ8A 3S5LG 3HRZB 5FOBB 4HIJA 2A6JA 1T22B 2F53A 4QHKI 1W72L 2F53E 1G7LA 1NC2B 5KN5B 1JBJA 3PWJA 1X5ZA 4PJ7F 3LHPL 3VFSB 3WLBB 1T83C 1OGAB 3V7MA 5HGAA 3MUGB 1JZ2A 1FJ1B 1PG7X 3QIBC 4MNHA 1G6RA 4YZFE 5D6CB 1KF9B 3Q5YA 4G43A 3K2MC 5E6ZA 3HPJB 3FMGL 3KAAA 5TQ2H 5H94B 3PWPA 1KIRA 1WVZA 4NPYA 1HE7A 3PWPE 1WBZA 4MJ5A 5KVDL 3MRGB 5MEQA 1L4IA 2A38A 2BRQA 5FHAH 3D1MC 4WWKD 3RUGE 2I60H 2CUMA 2F5BH 3D9AH 2FO4A 1C1EL 4JFFA 4MA8L 3IYLW 1J05B 3I84A 4M7ZB 3TO4C 3TH4T 2WIMA 3HA0A 4JFFE 3ILQC 5FO9B 1E27A 1HH9A 4ZFGH 2ZCHH 1BZQK 5CJBA 3T2PA 3MLZH 4WWID 1OLZA 5KSAC 4HMDA 3L5HA 3KPLA 1KCRH 3PL6A 2C3VA 1JPSH 4XGZB 1TJHH 2HWZL 3ULVE 3MA7B 4NQCD 4OF6A 1WQVT 2X70A 4CVZB 1TQCB 1FG2A 1J1OH 3P0YL 4LNRB 1ES0B 1S7VB 1P5VA 4JN2A 3T0VA 4YC2B 5DUBB 3BOVA 2J2ZA 4HKJB 1MCLA 1PG7W 1FNSL 5IFHL 1RHHB 1GZQB 3MRLA 4LKCB 5J7CC 5C0EA 3U36A 2RR3A 4LU5H 2V6HA 1QO3A 5SX4I 3FTGB 4HWEH 3X3GL 2DKUA 3MV9B 3KYAA 3VXQB 3WE6A 3O9WC 4Y4FA 1HHGB 5DYOB 2Y5TB 2HFEA 3HAEB 3MYJB 2VZUA 3FCTB 5M95B 1MFBH 1NAMH 1PY9A 5TDPA 5K59F 1KJ2A 4G6ML 5C70A 3FRUB 1RK1A 5I1KL 2OR8A 4LLUA 2H6PA 3I50L 4QXGL 3ARFB 2MFNA 2ICWI 1CLYL 2ZNWA 4OZFH 2R29H 1EMTL 4GMTL 5C6WH 3HLAB 4J3WA 4TSCH 2R1YA 5ITFB 2JJSC 1P6AB 1Q0XH 2NY2C 2H3NA 1GJIA 3NIFE 1S8DB 3G08B 3RA7L 2NMSA 1D9KA 5DJ0B 3FL7A 5CMAB 1R3LB 1CYGA 3RGVA 4HHAA 1R3KB 1Q9KB 4XPGL 1U9KA 2HLAB 4I2XE 1BFOB 4NM8L 4L9LC 4HXBL 1UJ3C 5DQ9A 2R9HD 4NQDB 4LEOB 4NBXB 1VESA 3HUJA 2EXYC 4LSRH 1GYAA 3O8XC 2IG2L 4IRJD 4HWZA 1MAJA 3SJVD 3HUJE 1X5AA 2RBLA 1YMMD 3GJFK 3RTQD 1DSFL 4LVEA 4NUJB 2XTLA 5EOCH 2DQCH 3L3GA 3HC3L 4UB0L 1BPVA 3CH1A 5JPMA 1C16A 1LILA 4Y19D 5B4MD 4NO3B 5A40E 3DXAB 2O5XL 1KCLA 3UYPA 4NJAL 1J0KA 1I7ZA 3IFPB 3WBDA 1BOYA 2GK0B 1FIGL 2I9TA 2EYTB 1JL8A 1JJUA 4H25A 4M61A 3LS4H 4Y5XB 5IBTH 5HHOB 5HY9B 3HAEG 3JTSB 3BIBX 2ARWA 3F65A 2ZJSH 5IIEB 4I3RH 5I16B 1OSPL 3IDUA 5DLMH 1NCWL 4ZODA 1O0VA 4PJGE 1AQDA 4OZHB 5H35A 1K8IB 2VXTH 4GW5A 5IJVB 1I8MB 4OZIB 5GQBA 4LP4A 4LSTL 2EH8H 1MRDL 3VFGL 1ZGLB 3FB7A 3CC5B 3SKJL 3GMQB 2YMXH 4KV5E 4UV7L 3JBG7 3QUMH 1MJ8L 3AY4A 3RI5K 1U36A 2Q3AA 2PO6D 1NQBA 4BFGA 1DN0A 4HK0A 3NA9H 4HBCH 2CPCA 5F7YC 3HG1E 4GS7B 2DM7A 4PJEB 1A9EB 1YN7B 3S37H 3WL9A 3PE9A 4J12A 4LVNB 3T3PF 1T1ZA 3MZTA 5E2TH 3U7WH 4ERSH 1A5FH 5C1MB 5FF6B 2AEPL 3WFHB 3QEUB 1U3ZA 1QEWA 3LDBB 5CS7A 3RIFK 3H3PH 4ACPA 4XPHL 4X6CA 4OCXH 4U6XB 1KYOJ 1T5WB 2UYLA 2W9DL 4NQVB 2NY3D 1HSAB 2DLFH 3PABB 5JW4M 1UWEL 3V4PH 1G6RL 3MV8B 4APQA 4YHYB 2DMBA 3FZUD 4HCRH 4HEPG 3QWRA 2PW2A 5E4EB 3UTPD 1F3DH 1U93B 4OD3L 4R4ND 2GJZB 3BKJH 4EOWL 3PGFH 5D2NC 1QHOA 3O3BB 2C4FT 2NY4C 3S6CA 5DD5H 3SE3C 4N0FA 2AJYL 2NR6D 1AR1C 2CJUH 2VSDA 5F7FA 2OR9H 1XCQA 4X6DF 1Y0LB 2FLBT 2CD0A 3BRDA 5GGRA 1D5BB 5EDXA 4LQFH 4R0LB 2MKWA 1OP3H 1I9IL 4FQLL 1AXSA 2XYCA 5FK9A 3CFBA 4N90E 1UM4L 3LS5L 1NBVH 1YPZE 3SBWA 4OM1L 1DQML 4KJYB 2NTFA 3RWDA 2IWGA 4WVRA 2AK4A 4DAGL 2RIKA 3AGVA 5F7DB 1WTGT 4OQTH 4J8RB 5IVXA 2AK4E 4PRBB 1HEZA 3KYMB 3NACL 3T0EA 2DKSA 4UT9L 5F1OB 4WO4C 1YNTA 1BFTA 5DFVD 3T0EE 1ZKAA 2R56H 1BAFL 1TZHB 1GL4B 1FNEB 5DD3H 4LP5A 3K3QA 1A3RL 1QFHA 2FB4H 4FQCL 2IPUG 3VE0B 2Q76A 4Z7VB 2AKRA 3C60D 5IUSA 2DRUA 5DJAA 4KAQH 1FG9C 5I8EB 2F8VA 4OF8A 1QFOA 3WUWG 2VZSA 5IHLB 2AXGA 3QI9C 5J1AA 4LSVL 4XX1G 5EZOH 1KEGL 5FUCC 2Q7YB 4MD5A 4R97B 3W9DA 1ZT7A 5SWSD 3DGCR 4HKXB 4GRMA 1QBML 3C2SA 4MCYA 4Y5VA 1D5ZA 2E6PA 3IDGA 3MR9A 3ROOA 4BZ1L 3SE8H 4NGHL 1G7JB 3EJZC 5F44A 3UJJL 3TBWB 1EEZA 2EIZA 1C5DB 1Q94A 3EFFB 2Z31C 1QHPA 1SJHB 4QRSB 3NPSC 3OKLB 5DD0L 1H8SA 5GRWA 3PWLA 4Z7WA 2HFGL 3MNWA 5E2VH 3UTQA 3MRHA 1PG7H 4QXWA 3SOBH 1R3JB 5FDWB 2MQCA 2X9YA 3AROA 3TWCH 5BVPH 1ORSB 4ZUWB 1D6VH 1SBSH 4PJ9B 4ELKA 1BZ9B 2XWBB 2FJFB 5ISZE 3VFUB 1XF3A 5HI5C 1E4XH 2VXUL 3X13B 4C57C 1Y6NR 4JVPA 1CTNA 1HQRA 2X4TB 4M7LL 1QG3A 1Z3GL 1J8HE 4YFLI 5JHLL 3H8NA 4PJ8B 1CZ8H 3ALXA 4DVRH 2MKLC 5ESAA 2E8YA 3GSUB 4L3EA 1OT2A 3K7UA 3DURA 4OGAD 3KPQB 3NZ8A 2NNAB 2FZ3B 1MIML 4Q74A 5C0GB 2BVUA 3VWJD 1I1AD 3JV6A 4YPGA 1IVLA 5DXWA 4H1LB 3MBED 1U3HB 4XVSL 5ACZA 3KPRD 3QUXD 4NWUH 3TN0D 1LK3H 4XNZC 5I75B 5C6TL 2DQGH 3JUYA 4WW2C 3BP7A 4OLWH 5DC9B 5MEND 3Q1SL 3C6LB 1FFOB 4XMPH 2HJKB 4PJCA 3TPKA 4A6YL 3N1MC 5T5FH 5CSZB 4PJCE 4D0CB 4Z5RB 4P23A 1YNLH 2QSCL 4HXAL 3WEXA 5I18L 2R2EA 2R0ZL 3UPRA 2NXZB 4OM0H 3CPLA 3EOAB 4G9FD 4YNYA 4HV8A 2EDLA 5GJTH 2IAND 5ICZB 1FH5L 1GHFH 4UV4H 1W0YT 4PTUA 4RZCA 3INUL 3RUGB 3ZE2E 4YHOL 3WKMH 5HYQA 5HJ3B 3V79C 3BZ4A 3EOBB 2A77L 3DVNA 1CBVL 4F58L 3S34H 5MP6L 1T3FA 1R0AL 4I77H 1S9YA 3CNKA 3KNBB 3O45A 3QHFH 4L4TA 4S1RL 3V5KA 1KPUA 1ZWIB 2JJTC 4HF5H 4W4NA 3E6FA 1XR8B 3EDKA 4BM7A 1XIWB 7CGTA 3WS6A 2XV6B 4ODSH 5CLTA 3AB0B 4PY8J 4YAQB 1FAIL 1X7QA 4LAQH 3U46B 3B8YA 2FEDD 1G1CA 2VIRB 5F9WC 4ODXA 5MERA 4WU7A 3DSFL 3NGBB 2F8OA 4XCNB 4PGJA 4NT6A 3W39B 2G5BB 1S7TB 1DDHA 4FZEH 2B20A 4FFWC 1KB5H 3IDMB 2GKIA 1FO0A 4GW1A 4H88H 4KQ3L 1K6QH 2D7TL 1QSFB 4NQEA 4ONFL 4FQ2L 4G42A 4YWGH 5GPRA 5BO1L 1CG9B 3VXNB 3LKOA 1S5IH 4LIQE 3LKQB 1EIBA 5I1GL 5JOPE 4XWGH 4X8JA 3GRWH 2DQDL 3BYYA 5DVLA 4MSWA 1A4KB 2FBOJ 4HG4J 4H1LG 4WI3A 3SKMA 4IJ3B 3WHE1 1AKJB 3G9VA 4A2LA 1D5XA 2BCKA 4KK8C 2APWA 5L7XH 3J7HA 3L3DA 3QP3A 4MDJA 3BE1H 1YEEH 2LU3A 1PX3A 3QPXL 5T3ZL 1F3JB 5D2LF 4L4VB 1L7IL 2OYPA 2A9MH 4X7DC 5I8CA 4MMZC 4RAUB 1NGPH 3QEQD 3D0VA 3JWDH 3MV7E 3MLVH 2RHEA 1JRHL 2R23A 4NC0B 3OMZA 4PJIF 5IROA 1LEGB 3MRFA 2MMXA 1N7MH 1NGZA 1EAPA 2JIXD 1EXUB 1MIEH 5EH1A 4X6BB 1P84J 3SQOH 3D3VB 1LE9A 1HQ4B 3BKMH 4MXQC 2MCG1 3C5SB 5FYKH 5I66B 3RVWC 4HMEA 4M93C 4Y89A 5E1HB 1ZHKB 3DROA 2HLFC 1SM3H 5DA4A 3P4MA 2JB6B 3WS3A 1OWWA 1JGDA 4AEHL 5A2FA 4MA1C 3PP3K 3QUZA 1RUMH 1I7TB 5H2BB 3MJ8A 3P3YA 4Q7DA 2DLGA 3MREB 1CD0A 4NKOB 4CL7A 3EOTL 4P2OD 2PKDA 3QG7H 3MMEB 5E70A 4LLYB 1JHKL 1OAQH 1WZKA 2APTA 2X41A 3STZA 2GTZA 1KACB 3H7BA 5ADPL 3VDBA 1TPXB 3QAZB 2ICCA 3EYUL 1GZPB 4MZ2A 3BN9D 1HDMA 5E95B 1WBYB 2Q86A 2HVKB 1MFNA 2JCCA 2P5EB 4MGXA 1YUHB 5JZ7C 5IW6B 3ME0A 4TSBH 5DRWA 3T2OA 3W82A 1Z6JT 4KGJA 4M8QB 1JNHB 3VD4A 4LHJB 2XNAA 4I0PD 4PJAA 4I3GA 3K4ZA 5DJYB 3LV3A 5FFLA 1HYSD 1RUAL 4LPXA 3QEGH 3SO5A 4PJHE 3ZDXE 2AEQL 5DURB 4MVBD 4HIEB 1JZ3A 2XWJB 4IS6B 2D7PA 3WXWH 1OLLA 1T0NA 4R4BB 4S2SB 3T1FB 4TRPL 2A1WL 5TH2A 3KLHC 1RZKH 4JPWL 2OL3A 2HRPH 4XVTH 1A0QL 2PYED 4HX1B 4OZFB 3F62A 1EZVY 5FV1L 3MRNB 1AC6A 3NCJH 4XAKD 2X9XA 1X4ZA 3QIUD 3IDIB 1Q1JL 5LCVL 5TFSH 3ARZA 4YIQB 4H0HB 3VDAA 2GIYA 1JZ5A 2X4RA 3OTTA 2FJHA 4CVXB 1A9BA 5TGBB 4I4WB 1U91A 3U4EA 3ARGC 1I4FA 3HMWH 3QDAA 3TIDA 3QQ3A 5HSFA 4IRSB 3HG1B 4QTIH 1F8TL 4GKZB 2IC2A 1ZEAH 3BAEH 4NFBA 5GS3A 1FSKB 1X3DA 3MXWL 2R69L 4OD1L 4KMLB 3O6KL 2J4WL 2R15A 4JCMA 3TBSA 4JZJC 1FNGB 1F90L 1RZJC 1LNUA 3HS0A 2YSSB 5J6HA 2CKNA 2VZOA 5INDB 1OF2A 3RVUC 3IETA 2A6IB 2Z0BA 3IJSB 1MFEH 1ZA3A 4RAHA 5JA8B 4LNVA 1AIFA 2Y6SC 1T7WA 4EKXA 4O51A 4UNVA 4HJJL 2VDKH 2R1XB 3HE7C 3C87A 5ENWB 1GOHA 5GRVL 3S9DB 2KKQA 5C0DB 2NX5B 2OJEA 4MB5A 1WWBX 3UTSB 3L6FA 4TVPD 3I75B 2YWZA 1S9XA 1KG0B 2P46B 3CUPB 1QRND 4ZTOL 1JV5B 4JANB 4NYLA 4BSWA 5B39B 4QHNA 1TJIH 5C07B 3CXDH 4JRXB 3VXUB 2WBKA 5J6GB 3P9MB 1QKZH 2BVYA 5HPMA 2R4RH 5L2KD 4YXLL 5L0QC 4KZDL 5D1XB 4WUUB 5DJ6A 3VA6A 1MWAB 1Q8MA 3GMPB 1GXEA 3B9KC 4OZFG 5C0BE 1JPFB 1OGAD 1YECH 1NGWA 3IAGC 3HI1B 2HKHL 3O11B 1NBYA 4PJBB 4WWKC 5KVMC 3GSNB 3QUMB 4YHIA 5IFAH 4IOIA 1KN4H 3EO1B 2VDML 3MRPA 1CT8B 2O26U 5ID0A 2DM4A 4S1QH 5I6XC 1S3KL 4S10A 4P5MA 2NZ9C 3M17A 1ZT4B 5DGQA 5EG6C 2MWCA 5ESVA 2R1WA 1E4KA 4FXGB 3NFPB 1WJ3A 1B3JA 2CLZB 3CGTA 3B2UD 3VJ6A 5DJ2B 3TNMA 5JA9A 3IU4L 5ESQA 1CFNB 4JQIL 4PJ5B 4CN4A 3BMVA 1K4DA 1WAAF 3U83A 1UB5A 3X17A 2YPLE 4LRNL 1CGWA 5C2BH 4O2CB 2CLVB 1C1EH 5GRXG 1A7NH 1Q9WA 4OZHF 3QXDA 5JR1H 1MJUL 5ALCL 4LLVB 4H0GA 3M1BB 1MI5B 4OZIF 4LRIC 2ED9A 4NFCA 4D9RE 2J8UE 4MJIB 4TUJA 3QA3B 1CF8H 1ZHBB 4G6FB 3MFFA 2EDXA 3OJVC 3TJEL 3K46A 3MX0A 4QEGA 1JGLH 3FFCB 3VD9A 1A3LL 3H9SA 1NJ9A 1J87A 2WW8A 1OVZA 1HHHB 4PJFB 2NYYD 3MRDB 1V05A 4PJXE 5CWSB 2QSVA 3VH8A 1LEKB 1FORH 2W0LA 4PJEF 2OI9B 1VFBA 3SDCC 5HPOA 3VRLF 4OKVA 4WFHD 5EO0A 5B39G 1NUFA 3I6GA 3OHXB 2NY0D 3G5VA 3MV9D 4UQ3A 2XZCH 4QGTA 2GCYA 3UTZA 4GG6E 2VXVL 4M3JA 2X5PA 4QRPA 2DTMH 3X3GH 3NCCB 3VI4E 4YJZL 1YY8A 2ZUUA 5D71L 4NNXB 3DGGA 4QRPE 3MUZ1 1FP5A 2MNUA 2VDOH 3CLEL 3O41B 4PBVC 3QXTA 2B4CC 1NANH 4JKKA 3TNNB 1T83A 4LSPH 3IDYB 2ZG3A 4KMQA 5CGMA 3SKNB 3D85D 3OJDA 1J0IA 2W91A 43C9A 3IU3B 3QIBA 3QQ9D 2UUDK 4QXGH 4QHLB 1F4WH 3CDCA 5DI8A 4JM4H 3WD5L 2WP3O 4CADA 4MDIA 1CLYH 4PRPB 1YN6A 4WI9A 3DOSA 4JFHE 3OKEB 4LSDA 3R1GH 4DGVH 5EBWB 3FT3A 1P1ZA 1OTUD 1YEHL 2UZIH 4X4MA 4IRJC 4PG9A 3QISA 4X4ME 2VWEE 4XI5D 3CVHH 3T09A 4XMLL 5CJQL 2WIIB 2NTSP 5JHDE 3KPSA 3MLRH 1CD1A 1LK2B 3BKYH 3RA7H 1WCBB 4ODUB 3KPSE 3RWFB 5E2JA 3TO4A 2Y06H 3CX5J 1HHJB 3O4LB 2C7UA 4NQDD 4XPGH 1J1PH 4HFWA 4HXBH 3F58L 5B4MC 1NDGB 4GQ9H 2YD8A 4PREA 3TCLB 5KSAA 2YD1A 4D3CH 4FFVC 2BVEA 2IG2H 3GSOA 3GIZL 3AXLA 1X5FA 5DEZA 2QHRL 4HKBA 5EORH 2CDFA 2YA1A 4JDTH 3C2AL 3LKPA 4W68A 3HC3H 4UB0H 3DXAD 2BOCB 1MFDH 4Z7VF 4BFBD 1T2QL 3U0TB 5CHNA 1EHAA 4NZUL 5FGCB 2H2PC 2NY5H 1FN4B 1SYVA 2OTWB 2P8MB 4LSSL 4N0CD 1DQJA 5HHOD 4OUUB 4U1LB 2QADD 1BEYL 3O9WA 3BKCH 3PDOB 4M1DH 4U1JB 3P9WB 2CXKA 3MLSH 2R0WL 3OBAA 4XT1C 3KXFA 2W60B 4HH8A 3PWVB 4OTXL 4GQPH 4PLJC 1IQWL 1WWCA 1UCBL 2PO6C 3NCBB 2B1HL 2XTJC 2VQUA 5C9JB 2FATH 4NKIH 4ODWB 1ND0B 3ES6A 3GJEA 1NL0H 4N0UA 3MQIA 3FHQA 5DVOA 5C0AD 5DZNA 4DGIH 4MNQD 4CMHC 3SGEI 4BQ8A 4HD9A 3L5WB 4H8WC 4Q9CA 1UT9A 4EI5B 1JI2A 3FT4B 3RKPA 5D9SA 5F9OH 4DW2L 1ETZA 5BCAA 2YKLH 1MJ8H 3ZSTA 2VLKB 1L9MA 3O2WL 4PRHA 4DJMA 2AV1A 4G8EA 1QQDA 4XNQB 2HTLD 3GMOB 4QHUA 4CU8A 4JLRA 3BEVB 1NDMA 1ONQA 32C2A 4M9PA 4M5YL 2BJML 5KSBA 3FZUC 1JZ8A 3GSQA 3TVMB 4L9LA 2R8SL 1UJ3A 5KSBE 3OL2A 4R4NC 1WWWX 3LKNB 5K9QG 4G80B 5GS0D 1JZ6A 1P4IL 2YRLA 1AQKL 5E0QA 2ERJB 1A6WL 4XPHH 4YDKL 2FSEB 2IAMB 3VXPB 5DMKB 3NZHH 2NR6C 3MV8D 5C0JA 2DM3A 1DLFH 5DC4B 3RWHA 3B4NA 3RVXD 1G6RH 1EJOH 4KTDH 3S4SA 2AXHA 3ZTNH 1OPGH 5HHNB 4DN3L 3EDDA 4DN4L 2OQJA 4K71C 1UEMA 4DWHA 4PTTB 3RWJA 5A3ID 2H9GA 1KV3A 4EOWH 4RIRA 4LCWA 5JW4N 3MCG1 3BQUB 5JPNB 3S96B 4MAUL 3FAXA 2AJYH 4BSJA 3CFEA 2DQJL 3QDMB 1KB5B 4YZFF 3K8LA 4WEBL 1KB9K 3D25A 4F7PB 1JHTB 1PQZA 5DMGC 2V5TA 4M6NH 2VAAB 3W11D 3H42H 1M05B 3LS5H 2EDYA 2CQVA 2GITA 4NRYB 1FNFA 3SDDB 4AMKH 3GK8L 2CDEA 2F5AL 3RUGF 4J4PD 2DMKA 2LTQC 3AM8C 5GGUA 1JWSA 1I8KB 3IRZA 4MAYB 5GRYA 4PRIB 2JF1A 5FGRA 2BNRB 5L88H 1V3LA 2I27N 4FP8H 2IH1B 1AO7E 1BAFH 3RWEB 2W65A 2QQNH 1NPUA 1RULL 1B0GB 2BHYA 4FQXB 4WV1C 3CFJB 2VISB 1RIVL 5I2IA 4ORGA 4QRUA 4K94L 2BZDA 3ULVF 5EC1A 3U82B 1QA9A 4TYUA 5F96H 5CBAB 2GTWB 1AHWB 4U1HB 4OKDA 1I3VA 1TZGL 4DOHB 2X4UB 1KPRB 1A02N 1KJ2H 3A6OA 1RZFL 5BW7C 1KENL