2D7NA

Solution structure of the 16th filamin domain from human filamin c
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
93
structure length
93
Chain Sequence
GSSGSSGLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-C
publication title Solution structure of the 16th Filamin domain from human Filamin C
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 6
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d7nA01
5DQDL 4XP1H 4ODVH 1EEZA 5EFIA 4MNQE 4WEMB 4KJQD 4U6VH 1GXEA 5EUKA 3QDGD 5TDOB 5C0CA 4PJ5E 5LQBL 3MMEA 1Q9LB 3EDKA 3GGWA 3LEYH 2I26N 2JLLA 1QHPA 3MOBL 1I4FB 4U1SB 4BSVA 3T3PF 4G43A 4M3JA 4HKBA 4PJXA 3W2DL 1WV7T 4IRZL 5KG9B 1LE5A 3TWCL 2VR4A 5DQJB 5TDNA 1MNUL 1ES0A 1H8OA 4XBEL 1LO5B 1TZIB 1Q94B 4HFUH 1B88A 4J3WA 4MZ2A 4PJIA 1BQSA 3Q6FA 4XBGA 5I8OH 1KPRB 3H7BB 4I2XA 1KFAL 4DEPC 5IB3A 4S1RL 4F7EA 4QRQA 5F8RC 3LKNA 1PAMA 4AIZB 4G8GD 5F9OH 5L2JB 1G9MH 1QBAA 5IOPA 4TTDD 4XNZC 3TZVD 4OLVH 2GJ6E 1JGEA 4N0CD 4F15B 3T4AA 3S36L 2NW3A 3MOQA 4XVUD 1Q9WA 3HE7B 4WW2C 5IBLC 4X8JA 5BRZE 2NY4D 1I9JH 1PYWB 1ZSDB 3OKOB 1KB5A 3QDHA 2YHGA 1MRFL 1PLGL 1DE4A 2AV7A 5BZWA 4X7SH 2FH8A 4XPFL 1KB5L 2NY2C 3IRPX 2PO6B 1JJUA 1JHLH 3HG1B 2E6PA 2F54E 1UJTA 3HUJF 4RWYL 4U1JA 4LARH 1T7YA 4Z0XA 3E0GA 4BH8A 1EGJH 4OM1H 4GRLB 3U30C 1KEMH 1QSFB 4LAQL 5DD3L 5IGXL 1G7MA 3ZKND 3KPRB 3LB6D 2B2XH 4LRIC 3TGXA 5HYIA 3C2AL 1C7SA 3M1BA 3E6HB 2XN9A 4JFYB 2DJ4A 3P4LA 3IDXL 5HGAA 25C8H 2R56H 4FA8A 2AJVH 3PDOA 4KZDH 2BRRH 3ARVA 4OIIL 3L3IA 3VGEA 1QFPA 1BQHB 5D2NE 2EIEA 1IJ9A 4GXVL 1OM3H 3S5LA 1HI6B 4ORGB 4PJ9B 4QCIA 3QEQA 2DYPA 1G7PA 3CFDA 5EZOH 3O0RL 5HI4C 4R90L 5ID1B 4D9QD 4GAJH 5FAAA 4Z7UF 1QO3B 3HNSL 4XAWH 5I75C 3S3SA 1A5FL 2Y36L 4WU7A 4KVNH 4U4BA 1RJYA 2WUCL 3H3BC 2D7PA 3HPLB 5TQ0L 1F42A 4GAGL 3EOYG 2GK0A 4Q6IA 1R0AH 2RB8A 4JKWA 2IH3A 3BN3B 1HZHL 5JLZA 3KPQB 1S7WB 2XQBH 1WZ1L 3MFGB 1MFDH 3C6LA 1KLGB 4JO4H 1BLNB 3D18B 4LCWA 3VGFA 3S97C 4NRXB 2HKFL 1IGCL 4LPUA 5JHLL 3QB7C 4KY1L 1DQQB 5E7BA 4BJLA 1A7RL 2NY3B 4MNQD 1KENH 2NY7L 1G0XA 4Z5RB 2IQAA 3KPOA 2PW1B 4PJ5D 1CGTA 5D7KD 1Q9KA 1B2WL 3UYRH 4M8QB 4NQDB 2O5YH 1DLFH 3GZKA 4MAYD 2BY3A 3MJ8A 4G7VL 4OQTA 2H32A 1ACYL 3BDYH 4S2SA 2CKBH 1NJ9A 4B41A 4FQLH 2V17H 3BT2H 4XPBH 2MQ0A 2DMKA 3IKCB 3MRJB 4OQTL 2C26A 4HAFA 2CRIA 3P4NB 3NZHH 1VGEL 5DC0A 1A3RL 3TJHC 4JFOA 3PIQA 2QHRL 2YD3A 1IAKB 3IU4H 4AYFA 4CMHC 3UPRB 4QXGH 5D5ME 3S36X 2VLLB 4JFFB 1EHAA 2VDOL 5DJXA 4HBCH 5BRZD 3NIDF 5FKPA 3VI3F 5SWSB 1QKZL 1M1SA 1ZA3B 3LQAL 5H35A 4GG6F 5F6IC 3F7PC 4MS8D 5IFJA 2YN5A 3BH9B 1HWGB 3ARGB 2EDNA 4IRSD 1CE6A 3HE6B 3AROA 1G9MC 4KROB 5EORH 5DR5L 4K9EH 1DZBA 4H5SA 2NNAA 4QKXB 4OCLC 1YPZE 3QPXH 1YEDB 1C12A 2BVQB 2HRLA 4I0CC 4NO0B 4Y19E 4L4TA 3UCRA 3NBNA 3GMMA 4MSWA 5CP7B 1BJ1H 1KEGL 3NIGF 1IGYB 2IG2L 5DA4A 1VEOA 5H37G 3L3DB 4N9OB 2OCFD 5DJCA 4M6AA 1OAKL 1K2DB 5T1MA 4PJBF 1WBYB 1RK1A 4CVXA 5E6ZA 2A74A 4RGNB 2FHCA 5DHXB 3D39E 3EFDH 3HC3L 2DBJA 4MCYB 2X9XA 3GB7A 1NQBA 3RWJB 1I1AD 4OM0H 1DQJA 4FQQB 2AK4A 2BNUB 1YMMB 3MLWH 1PKQB 3QFDA 3RBSA 3TH2T 2H9GA 4N0YH 4JG1L 3UBXI 4R7NB 3KNBB 2DQFA 4GKZA 4ELMB 4IOIA 1QR1B 2XZAL 4WCYL 3EOAB 4F8QA 3TO4A 2OMBA 1N5YH 5EOTA 2X70A 5ESQA 4CVWA 2EKSB 3EYVB 5ITFA 2GKIA 5FM8A 1NCBL 3C2SA 4P2QA 3QXUA 4WWKA 4X6CB 3L3OB 1N6UA 1T4KB 3FQUA 1OTUC 5DQ9B 1AXTL 3CFEA 5B8CA 4J3TA 4FXGA 4M1CC 4E0RA 1LD9B 4MYWB 3BPLB 4OLXL 3ZHLA 4KI5E 1FFNB 4YDLB 2D4DA 2F19H 3DURA 2B1AL 4P48A 3P77B 4PJGE 2YC1B 4P59L 5KTEH 4G7YL 1OLZA 1CE1H 2ZNWA 4JHWH 2HTLC 3FOMA 3V5DA 3DWTA 2O5XL 2OXGA 4ZFZB 4JAMB 3D3VE 3O4OB 2AEIT 2DM7A 4OLZH 3N1PC 3QP3A 4OCYL 4EUPB 1BD2A 2D31B 3GMNA 5D70L 1CQYA 5F7WC 1L9NA 2YD5A 3MRMA 3G6JE 1NGZA 3P11L 4LLYA 4U0RC 5IVXE 2HWZL 1RK0B 3QO1A 4NN7B 2ZPKH 4X9FA 4RMTA 4AY0A 2UVEA 3X3GH 3QUXD 3UTSA 2BSRB 3T1WA 4WFEE 4UINH 3UPCA 2ICWB 5FYLH 4PJDF 3V52H 2ITDA 4UTAH 3QQNA 3T65A 2Y5TA 3WHE0 3FKUS 4EKXA 1I7TA 5C0AE 5D7IE 1X6LA 5T1LB 3HI6L 2Y7QA 4POYA 1FZJB 3EYUH 2K7QA 3U48A 3AVEA 3F5WB 1AR1D 4WW2A 4DVRH 3CDGB 1LEKA 3NABH 7FABL 4CJ0A 5JIHA 3REVB 5DJDB 3D85A 3ULSA 4DN3H 5D7IF 4HKJA 2P8LB 5SWZD 5E6YA 4OGZA 4Y19D 5ISZE 4W4NA 1GYAA 2ID5A 3QRGL 1P7QB 1FL6A 3DV6B 5CZVL 3O6LL 3FTGA 3VGDA 1IAIM 4DCQB 5J0BA 5K9JH 4JPVL 5D1QD 4FFWD 4PGDB 5ADOL 5I0DA 1NKRA 4IJ3C 4DOHE 1OD9A 5JPMB 1BZ9A 5JQ6H 4N5EC 5D6DC 2WANA 2BSTB 8FABA 2VLRE 1K85A 4HC1H 5IB1A 4PRIE 3D39D 4K7PH 5IJVA 1JRHH 3MLZL 3DYPA 5CJXA 1FC2D 5EO1B 4UQ3B 2UWEF 2OX5A 3T2OA 3EUUA 2ZKHL 4JB9L 2AQ3A 3TEUA 4L3EE 2CDEA 3BZFA 3PWUA 3QJFB 4P2CG 3LS4L 2V6HA 4JRYE 5C0RL 3ARBD 5L6YL 2VH5L 5DK0A 3FT4B 3NH7L 2C1OA 5DEGB 4OZIE 3LVEA 3UJTL 4P23D 2V2TA 2CMRH 2OP4H 3O9WD 2A77L 1U8QB 4XVSL 3B6SB 2EYTB 32C2B 1LO4H 4X7CC 5IVZA 2E8YA 2JCCE 4CVZB 5I1CL 5C8JB 1TXKA 4WEBH 1HINL 3PQYE 2WAHA 1FYTB 4UI2A 4CL7A 1SM3H 2ATKB 4PY8J 4QY8B 1EZVY 4KI5D 5EUOF 2J8UE 3C6SB 4W6XB 3UZQA 4MXWL 4LLVB 5DHVB 4ZSOB 3D5OF 5E5RB 1BEYL 3FO9A 4BA8A 3O8XB 1A7NH 3BWAB 5LGHH 1ZXQA 3HTLX 3BP6A 1RUKL 3V95A 1WWCA 3D3VD 5AG9A 2AXHA 5DJAA 3S37H 3GRWH 3V7AE 1U8PA 4BFGA 2F5AL 2OR7A 4ZTPH 3L5HA 4N0UA 4TSCL 4JFEB 1PVHA 3KPSE 5DVNA 1TENA 2AJSL 3IJSA 1QG3A 2X09A 5GJTH 1NCDH 4IHOA 2ARWA 1DN0A 2BOBA 4B0MM 3MXWL 2R0LH 2B20A 1II4E 3QXVA 1MPAL 4WFED 1LK2A 2DJSA 2VZ1A 3FT2A 2DL9A 1R5IB 4UUJB 3JV6B 3VXPA 4NHUA 4ODVL 3TBVB 1EERB 1GVIA 4JZJC 5EBMA 1S8DB 5A3ID 4U6VL 3W0WA 4K71B 5DEZA 1UB6A 5C0AD 2BFVH 4LLWB 5GQBA 5BJTA 5HXMA 1HN1A 3LEYL 1HQ4B 3CD4A 5KZCB 2BNRB 1QRNE 1A1MB 3HZVA 1VSCA 5TE7L 1ZHBB 4POZD 3B9AA 1A7PL 4MD5B 1P7KB 3D2UA 1QNZL 4EI5C 4G9DB 2WK2A 5KSAD 4J6RH 5GS0D 2O93L 1VFAA 3HLAB 1W72B 3CLFL 5B39A 2V5SA 1VGKA 5ISZD 3Q6GH 4ZODA 1B4JH 1E4KA 1C5DA 4NQSA 4X5WA 3N1FC 3UJIL 4I48B 4WHDA 5F9JB 4RFOH 4Y4HD 1G9ML 3X11A 1LEGB 5C0NC 2ZWLT 1PEWA 4U49A 3AREA 3V6OE 3TBYA 3FQWA 2X10A 5DD1H 4HBQA 1H3PH 2VLRD 3SDXE 1HILB 4PJ8C 1XIWA 3QXTA 1I9JL 4U6YA 1S7QA 4PRID 3MRHB 3QWRD 1P53A 4KRPB 5HY9B 3MRQA 5A16A 3NFNA 3PL6B 1CFTA 5GGSB 4HH8A 2BHYA 1R5VB 4QYOA 2ZOLA 3SDXF 4L3ED 5IFAL 4I0PB 4LSSL 4MZ3A 5DI8B 1JYNA 1FE8H 2BHZA 4JRYD 1RMFH 1EGJL 1AC0A 3RGVB 5ERWA 3GO1H 1WC7B 4R7DA 2B2XL 1RAMA 4HWUA 4ZAKC 4K94H 1KTDA 3MNVA 3CCHB 3AC0A 4E41A 4TNWF 3VG9B 3PQYD 4JQIL 2D9CA 3VD7A 4NUJB 1OF2A 5BS0A 3HRZB 1EUUA 4N1CA 3IT8D 1IGJA 4HD9A 1PG7L 4JJ5A 1F6LL 3IGAB 4P2OC 3CPLB 3WKNA 4OZHB 1U3HC 1UXWA 2A6DB 4GAJL 1N5AB 4JY5L 4XAWL 4FQ1H 3C8HA 4U2YA 3V5KB 4HXBH 4N8CH 4HV8B 5ETUA 5C0CE 3RQ3A 3LKOB 3KWWB 3SQBA 4OTXH 1L0QA 1MREL 2DTML 2EDQA 3T8XB 2XACC 4TUOB 4PJXE 1C5CH 3RTQD 1IBGL 5GRUH 5IB4A 4UTBH 1U8MB 1ACZA 4PJIE 1YN6A 4TVPH 4AMKL 3H3PL 2XIDA 3RVWC 5E7FA 3WFBH 5ICZB 4I2XE 2FJGB 5ALCL 5DVMA 4PJAF 1IC5H 1NGQH 2BRQA 4JDZA 1YN7A 1JPSH 3VXNB 1ZT1A 5D7JD 1QRND 2EIBA 3HFML 1CF8H 2CIIB 2O5YL 3M17B 3SBWA 3TVMD 5IFHH 3PWLB 1T5WB 4QXUL 5TPWH 4M7JH 3PP3H 3I9GH 3QI9C 1IQWL 3C9NB 3RI5F 5CEXA 3U9PH 2W0FA 5HI3C 3B8SA 4HK0A 4XPBL 5HI5D 4DGYH 1GZPB 2WWMD 3D6GA 4LLQA 3M8OL 4JKLA 5SX4I 3EJZD 4NBXB 1AE6L 3HS0A 4M7ZB 1YC7A 1D5BB 1NC2A 2MQCA 3CSPA 4WI8A 1TVBA 3PDDA 5IB2A 4I77L 1TVHA 4QF1A 4YDKH 4B53A 2XN9E 1NL0H 6FABH 3PXJA 4K7FB 1S9XA 1Y18B 1PG7W 4LQ1A 5HHNB 3MZTA 1X7QA 5IB5B 2XA3A 5D6DA 1MF2L 5J11B 1K8DA 5KW9L 1UKQA 2QADD 1NBVH 3QEQE 4ODHH 4P0DA 3MPCA 1JWSB 1T2QH 3CIQA 3T77B 2BY0A 5EB9A 3V5HA 4TPRH 5GRXG 2V5MA 4O2EA 1HIMH 2VLME 4B7IA 2BVEA 1G7LA 3IXAA 4HHAA 2GT9A 4KVCH 4RFNB 2AKRA 3QUMA 5C07B 1A7BA 1UXSB 3G08A 2HG5A 4KUCD 3QUKB 3O45B 1RD6A 2ED7A 3QUML 5F71A 1I1RA 3QEHA 3ULUH 4WO4D 4MX7B 4PBXA 3O81A 4AH2A 2Y5EA 3BMWA 3HE7C 4UB0H 1KOAA 2W65A 3IYLW 5FYKU 4KJYA 2WBWB 4UNTA 1NAKL 1Q1JH 4NKOA 3SE9H 5C0CD 1R3IH 4X99A 1X5FA 2VSDA 3LH2L 4DZ8A 3B3IA 4PJEA 1YNLL 1MJJB 2PO6C 3DV4A 2X9YA 3HMXA 3RZCC 1N5YL 2K7PA 3PABB 1T0NB 4YR6B 3DO7A 5FB8A 4NZDA 4ZXBA 2WUBH 4WV1A 4GRLC 1EHNA 3VW3H 3HMXL 4G5ZH 3WLBB 4CAGA 5KSBE 1E4JA 1HWHB 4J3XA 4R4ND 1U8KA 4KMLB 4OZFG 1LO3H 3OJDA 1B0GB 4JFPA 5DJZB 4C57C 5K9OB 1IAOB 5EBLB 5E8EA 4XWOC 5HD8D 3BD4A 3ALWA 1JWMA 4EDWH 3MRRB 3S4SG 5F7KC 4KKBD 2OSLB 1CG9A 1X5IA 1BGXL 1OQXA 4UIMA 3LN4A 1BMGA 5IVOA 4XHJC 4Z77A 4MD4B 2XY1A 4PJ9C 5DFTA 4JHWL 1FJ1B 3DRTA 3GMPA 4F7MA 4M1DL 3FN0H 5I2IA 3EYSH 4IS6B 4KMQA 3MTRA 4Y5VB 2X1PA 4NZRL 2ORBL 2DIBA 1MHCB 4W4OC 3V0VB 1U8LB 3CK0H 2H8PA 1I1YA 4TRPH 1NMAL 4ISVA 3IDYB 4EI5A 2VO5A 2ZPKL 2AEWA 4PJFA 3MLUL 2YSSA 3B43A 1WWBX 4L4TE 3X3GL 3CSBA 4QHLA 4AEIL 4LSTH 2XN9D 3EDEA 2YUZA 1F11B 5FGCB 4XXDB 5FK9B 1G0DA 4JZOB 2SEBB 4KK5C 3JWDH 3TBTA 4FFYL 1XF5A 3DIFB 5C0BA 1IGFH 4UT6L 2DLTA 1AD9B 3I3BA 4HIXH 3GMQB 2ITCA 3GSVA 2NY3C 4NKDA 1HCFX 3NABL 5DMIL 3QEQD 3OKLB 2DYPD 4KUZL 3WXVL 5CAYB 2NW2A 3MLXL 1V7ML 2XXCB 4NO5A 1FLTX 1YEFH 4PJ7F 1ZV5A 1AGEA 3SE3C 3RKPA 3DNKA 2YPLB 4JFDA 4OCMC 4BQ9A 3MRFA 5DFVC 2IMMA 4OCNC 4YHNA 5D71H 2PYEE 3RWFB 4TQEL 1HHJA 1MJUL 2Z31A 1CBVL 3SGEH 3UBXG 4G6ML 2FLRT 4ZAKA 1EIBA 3ULVH 4MXVF 3DX7A 5JQ6L 3C6LD 3HZKA 4P2QE 3DPBA 3DXAB 4NPYA 1P6FA 2OTWB 1VADB 3D0LB 2F74B 5LCVL 4RISH 4K7PL 1LHZA 3UTZA 1AP2A 2JTDA 5E5UB 1KN4H 3SPVB 2IFFH 4CUCA 3MUY1 1I3GH 3MREB 2GSIA 3H0TA 1ZT4A 3CZFA 3EYOA 4U6XA 2P48B 2P5EB 1YZZA 1DCLA 2G75A 4V1DA 5IMLB 4I3GA 1QBMH 3C5SB 2BCKB 4LEOB 5CBEA 1FNAA 2BVOB 2IBZY 5AZ2L 4LGSB 1WIPA 3DVNB 3ARGC 4GQ9H 1EEQA 43C9A 3HE6C 2OP4L 5FA3A 5C70A 1ZKAA 2FIKA 2IBBA 2ZOKA 4KROC 3VFMA 1NMBL 5C0EB 3ULUC 4XXCA 2DQEH 3A6CH 4C56A 4XI5C 2EICA 1XZ0A 5FV2A 2Y6SD 1T0PB 4MQ7B 1E4XI 4WEBL 3S96A 3OPZH 1FO0B 1U42A 3HI5L 1P4BH 4BFBD 1BOGA 5B38B 1EHXA 1XGQB 1OAYH 1MHHA 2AV1A 4HJGA 2L4OA 3PWNB 4HLJA 4Z7WF 4X6DF 2DQGH 3VXOB 1J05B 4RGNC 1YEJH 1MCEA 2LAGB 1BPVA 1CLCA 3QULB 1GOHA 3EO0A 1EBPA 1MAKA 1IGIH 2YRPA 2GTWB 1QUNA 2IPKA 3Q48A 1NDMB 4PRAA 2Q6WA 2JIXB 4WRLA 4KHXH 2VXVL 2P49B 1GH7A 4JDTL 1IEAB 3O41B 1VCAA 3IJHA 3QI9A 3STBA 3OR6B 1U6AH 2R0LL 3AU1A 5EA0H 3P0YL 5CLTA 4WW2F 4L4TD 3BZ4A 4ZOCA 5KJRH 1YEIH 4UNVA 2R23A 4YX2H 1T83C 1WIUA 1G7JA 3MGTA 5E6IB 1HH6A 4X80H 4LPYA 4JM2A 4XCNB 2AP2A 1DEDA 2P5WB 4U1MB 1TZHA 1U41A 3QDME 5E70A 1T1YA 2A73B 2VRAA 3BPLC 4S0TD 1UWEH 4P4RB 2NR6C 4M02A 4YDLC 2PYFB 1I7RA 5FYKE 4U05A 4JY6A 5IUSA 5I1JL 1HNGA 1OTSD 2FBJH 4GRWF 4R8WH 4NDMA 1A9EB 4KK9D 4XNUL 5JXEC 5DZNA 1KT2B 3SGKA 1JNLH 5DRZA 2VDLL 3DTXB 4IOFC 3O4OC 1DBJL 2VZOA 5C6WH 2PYED 3Q6GL 1Q9LA 1RURL 4M43L 4ZUTB 3U4BL 1NBYB 2NY5C 1I4FA 4KV5E 3TO4D 2H1PH 1T7WA 3QDGB 1UA6H 4NWUL 5KG9A 2YWZA 4NN7C 2C5DC 5DQJA 1J0YA 4P2QD 5DD1L 1N6VA 1NCCL 2FCBA 1LO5A 1TZIA 3F58L 3DX9B 5I15L 5LVEA 4K7PX 3B83A 5ABDE 1D9KD 3BPNB 1I75A 1KPRA 3H7BA 3QA3B 4OCRL 1RZGB 2FGZA 2DN7A 4AIZA 4YEEA 5GGVL 2C4FT 1FLRL 4R96B 2GQHA 5L2JA 1EO8H 1CYGA 1I9RH 1AD0B 2I5YH 4J3UA 3HE7A 1F5WA 2PF6A 3WS6A 2DWEA 4G8GB 1DQDH 5I16B 1PYWA 1ZSDA 3OKOA 2A9NL 4GW5B 4N90E 4QHNB 2X4TB 3FO0H 5F9DC 4JFQB 1TQBB 3INUH 4HS6B 3VH8A 4M7LT 4N0UE 1PSKH 3TYGH 2PO6A 3HG1A 4LSPH 2NY4B 1QLRB 4NYLB 2VXSL 2LABA 3IDIA 5BV7B 1EXUA 3VD5A 3NPSC 1A6ZB 4HFWB 4AENA 5KSUB 2FD6L 4HK3J 1MQKL 2VDRL 1R3LB 2R2HA 2CDFA 3GI8H 5F3HB 1P9MC 3E6HA 5CEZL 4JFYA 4WI2A 4OAWB 1L4IA 1KN2H 1U8JB 2CDGB 4PBVC 3W0WE 2VJXA 4BELD 1BQHA 1HI6A 4ORGA 4FP8H 1A1NA 3UEZA 1JFQL 3ZDZE 3D85D 1C5CL 4UV7L 2W07A 5ID1A 1QP1A 4YQXL 5H37H 2J6EA 4UTBL 4TNVK 4PP2A 3V0WL 4LSRH 2MHAB 4P99A 5DO2C 3HPLA 1I9IH 2OL3B 2VZUA 1E4WH 3TESA 1IC5L 4LVNB 1RUQL 1P4IH 5E94A 3KPQA 3QDMD 1JPSL 1S7WA 3N85H 2ZCHH 4HKZA 3A6OA 2W9EL 1N4XL 3D18A 1BLNA 1N7ML 3WS3B 1I7ZB 4NRXA 5FYKD 5IQ7H 2JJSC 5D8JH 3PHOB 5BXFB 3O8XC 5EPMB 1A02N 3S4SB 1CIDA 4K3GA 4Z5RA 4W70A 5C2UB 5KAQG 5DD6B 4PB9H 4JFZH 2YZ8A 4JPWH 4M8QA 4NQDA 1QYGH 1TFHA 3L3JA 4MNQB 1CXHA 2Y06H 1YQVH 3RGHA 2CUHA 3KYAA 4QGYA 2AEPH 2CGRH 3PNWB 1S78D 3G9VA 1RZKC 2A1WH 4PLOB 2R15A 3IKCA 1UWXK 4YO0A 3RVVD 5A43C 4KDTC 1QFWL 1IC4H 3P4NA 4MAYB 3V4VH 3C5JB 4HIIB 4L8DA 2FB4H 3T3MF 1E27B 3GUTB 3ZL4L 5BS0E 2PTTB 4JO3L 4L8CB 1RZIB 3RJQB 3UPRA 3VG0L 4NJ9H 4A6YA 2NPLX 4ODHL 1KIRB 1RZFL 4RGOL 1P7HL 2VLLA 2E5EA 4DWHA 4TSBL 4YHZL 4TPRL 3JV0A 3SE8H 3LDBB 4N90D 1SMOA 4IIQB 1ZA3A 3O6MH 1Y6KR 5I1IL 3CVHB 1EV2E 2EZ0D 5BRZB 3FO2B 5HYSG 4KVCL 5JTWA 3QCTL 3B2UD 2W9DH 3GSUB 5IBTH 4EJ1C 2GJJA 1YEDA 4YFDB 4NO0A 5E08L 4H20H 4ENED 3ULUL 2YA2A 4WU5A 1MEXH 4KKAC 2D7NA 5CP7A 3UBXB 4MWFA 1E28B 4UB0L 1IGYA 3HC4H 1OP3K 3L3DA 3GMLA 3QXAA 3ARFC 4PLKD 3W0WD 4KRPC 2DICA 1WBYA 4YDIH 3PL6C 5DJYB 3BRGC 2VUYA 4LIQE 3MRDB 1RUPH 1KXQE 2NTFB 2YMXH 4HG4J 5E99L 4MCYA 3D2UD 2DQDH 5D2LA 2WUBL 1PY4A 1HH9B 4FQQA 5D2NB 2BNUA 4HCRA 3VW3L 3RGVC 1YMMA 1PKQA 3B9KD 1GGBL 4MJIA 5D93B 1I3UA 3V7AG 1U95A 4HCRL 5IR1B 3KNBA 4ELMA 2VXTH 4N9GB 1QR1A 4KTDL 3EOAA 4JO2H 3RVXC 1S9WB 4ZFGH 3VG9C 4JPKL 3EHBD 3FAWA 3U6RB 3EYVA 1X3DA 3ARED 4RMUA 2MNUA 3L7EB 2ICCA 3L3OA 2ARJB 1XIWD 1T4KA 3WLWD 4XPAH 5DQ9A 3FN0L 1KJMB 4PR5B 2WIMA 2NCMA 1FH5L 5KS9F 3UROR 4Z7NE 2Z4QA 1X4YA 1QFUH 1FFNA 2PN5A 3MRGA 3ZKMD 2XZQH 5C0IB 4WFFD 3P77A 4TRPL 3TFKC 4M48H 1V3LA 5EOQH 3EOTH 4PRPB 1G6RH 5JXEA 3ZMRA 1DP0A 2AQ1A 1M7IB 4N0RA 1ROWA 1CT8B 1BFOB 1QACA 4EUPA 1B9ZA 4CW1B 1K3IA 1CXEA 3QG7L 4QRTB 5CCKL 2D31A 4JHAH 2NXZB 3I2CH 1W2KT 5ACLA 2C4XA 2NY5L 3RX7A 1RK0A 4HUVB 5BS0D 1WIOA 2A9MH 1JPFA 2CLVB 3MC0A 1A1OB 1DFBH 2BSRA 5IIEB 3GIZH 1MY5A 1ETZB 1JTPA 2ICWA 4HIJB 1BM3H 3MLYH 2AW2A 2K3TA 4FZEH 4TUJB 3TH4T 4LCYB 3T0WA 3QUXB 4IMKA 5CIPB 5T1LA 1F2QA 4TSAL 2HFGL 2JB6B 5CGYD 3F5WA 3EW3B 4WI6A 1OAUL 5C09B 3WJLC 3REVA 5DJDA 5IKCA 5KVGH 4ZFOA 1D7FA 3ARUA 4NQTA 1A14L 1INDL 5JR1H 4M7ZC 4W68A 3RVTD 4NRYB 1NUFA 3RWCB 3MYJB 4PJEF 3LPWA 1YQ2A 1F13A 1NC4B 4X9IA 5GGQH 5AAMA 5HBBA 4UQ2B 3DVGA 3AM8A 1KN4L 4QT5B 1CLZL 3ZDXE 4LNRB 2NYYD 4U1LB 3FFDB 2EH8L 4DCQA 4FABH 5SWZB 3KR3L 1YPZB 4PGDA 3D9AH 1KTKE 5F72S 2VQUA 4XCYB 4PV8B 3KHOA 3ZTNH 4YBQD 2BSTA 4P5TB 4QHKI 3AGVA 3EZ8A 3CC5A 5ALBH 4NQEE 4U33A 3AY4C 5E2TH 2Q7YB 2PTVA 5EO1A 4NGHH 2DQEL 4UQ3A 3A6CL 5ENWB 3ARRA 5DJ0B 1BX2B 3D39B 2R39A 1FRGH 5DEGA 2VKWA 5I1HH 1CL7H 3WO4B 4PJFE 2EYRB 1NC2D 2DQGL 1R24B 2VABA 1FL3A 4RFNC 3OXRB 1J12A 3B6SA 1A4KB 32C2A 5L0QB 3FT3A 3BESR 4KPHL 5KSVB 2VR5A 1WZLA 4P23B 5C8JA 2UUDK 4DW2H 1ADQH 1FCCA 2ATKA 1RZ7H 4N5ED 3ZSSA 2AJ3B 3BHBB 2E6JA 4TN9A 4YIQB 2XICA 3DOSA 2JJSA 4LLVA 5DHVA 3RNKB 1DQMH 3MCKB 3S88L 1EVTC 3VCLA 5L9DL 5CP3H 3BWAA 3QBTB 4JFDE 1MHEB 1REIA 3CMOH 4G8FB 4UIKH 5KJRL 1DQTA 1KXTB 4PJGB 1HYSC 1QR4A 3CDFA 4LL9A 2I60L 2HTKC 1IMHC 4LVEA 3P4OB 1KGCE 3D3VB 5HDQH 3TV3H 4KDTA 3HZMA 1IL1B 5BVPH 3G6JB 2B1HH 3D1MC 4OD3L 1RZKL 3RKDD 3S3JA 1R5IA 9CGTA 5IVXB 3JV6A 3TBVA 1U9KA 1D5IL 2G2RA 5FECB 1FZKB 1S8DA 4WTZA 1JNLL 2GFBA 5JPNA 3MBEB 3BJLA 4LLWA 1UFUA 4V1DE 4Y5VC 2W0LA 3S5LG 5INDB 1SBSL 2BNRA 4FS0A 4R26H 1A1MA 1CVRA 1ZHBA 3BE1L 3BX7C 1XGUB 4MD5A 1P7KA 2EYSB 4QRRD 5ELIA 4ZXBD 1FFOA 3IDYC 4OB5H 4PYGA 5C0AB 1UA6L 4G9DA 1B6UA 3V0AC 3ESVF 1CGVA 2Z8SA 2OYPA 4JKPH 3HLAA 1W72A 3SKMB 2X44D 5FDWB 4FOMA 4PTUA 2F9BT 3LY6A 3P9LB 1W72L 3MR9A 4ONFH 2R0ZL 2DQHH 5KSAB 3QO0B 3P9WB 4F3FB 4DZBB 1LEGA 1I9RL 2RBLA 5ISZB 2I5YL 3OTTA 5E56A 2DQIL 1HILA 3BO8B 3MRHA 4Y4HB 4NQED 2BSED 2EDKA 5HY9A 2DD8H 4HUXB 1H3WM 4BQ8A 3CFIC 3PL6A 3INUL 5GGSA 1BAFL 1JGVL 3VXSA 5F9AC 2F5BH 4ERSH 5T3XD 1R5VA 4EVNB 2VLRB 4LSPL 4K3HA 4URTB 3I85A 4PRIB 4I0PA 5ILTH 5DI8A 3EO1B 1QVOA 4WI9A 5EWIH 4Q97A 3RGVA 4X83A 4LLUB 1X5KA 1BQUA 1WC7A 3DGCR 1NSNL 3J8F7 4NZJA 1OSZB 3CCHA 5HYSB 3L95B 4CU7A 1NGXB 2Q76B 1DUZA 1HDMB 1KN2L 3ARZA 4OCWL 4HW6A 5FV1L 5TDPB 4PJHB 4NUJA 1FFQA 3I6LE 4OD2B 2VE6A 5GS2D 3HRZA 5BV7H 2R4RH 1GIGH 1XMWA 4FP8L 2JCCB 2APWA 3RJDA 3IGAA 1S9YA 3CPLA 2E9JA 4WUKH 3C08L 4OZHA 1KCLA 2WBJC 4ZO8A 5F7LB 4HS3B 1OL0A 4JFDD 3V5KA 1X44A 1ORQB 1JUFB 2J8UB 5CHNB 3STZB 2X4QB 3LKOA 4F33B 4NJAH 4V2CB 1WEJL 5DGQA 1CDHA 2Z31D 4BQBA 1E4WL 3T8XA 3TPKA 1LILA 3MRIB 1X5YA 5TE4L 1KGCD 1P4IL 4AG4H 4NO2A 1WFNA 3SGDI 1F4XH 3WXWH 2F8XC 1F4AA 3VI4E 1U8MA 5IQ7L 4EBQH 2CJUH 1AGDB 3QUZD 2AAVA 4TYUA 4LHUB 5HHXL 5ICZA 5MEPB 1XF1A 2D7TL 2DKMA 4L8SB 3RTQB 4FHBD 3MXVL 3ROLA 2Y25A 3VE0B 2OL3H 2QR0B 3JXAA 4V1DD 3VXNA 4GUPB 2P4AB 2ENSA 4RNRA 4JFZL 3PWJB 4FN0A 2CIIA 3QWOB 1A7QH 5CBAB 2O5ZL 1S7RB 3PWLA 2Y06L 5KANI 1MFAH 4HGWB 4OZFH 5L88L 4N1EA 1RI8A 4NZTL 2J2ZA 1C16B 3NIFF 4NKIH 5D7JB 1QRNB 1ULVA 3C5ZA 3HG1E 4N0FB 3WJLA 3TVMB 5EH1A 2WIIB 4G6AC 4XVJL 3UDWA 3H9HB 3V4VL 2AVGA 1H15B 5E6IC 5CEZE 1D5BA 3GMOA 4RCAA 4DGVL 5CWSB 5KN5A 1DSFL 5C9JA 1NAMB 4K7FA 3O4LB 4RIRA 3L3GB 2YKLL 2E7HA 5TE6L 4XCCL 3V6FA 4LU5H 2XNAA 2EO9A 2VZSA 3DETD 1FZMB 1MCSA 1I8MB 5GIRB 3NFPB 4J3VA 2VR9A 3NACH 3AY4A 4KKCD 3DGGB 1JWSA 4ZDHB 4F57H 4NBYB 1Z3GL 4KJQC 2QADB 4Z95L 2YD4A 1QZ1A 3Q5OA 2KQNA 2DM2A 2XTJE 3I50L 4YXLH 3BKJH 1P1ZB 3IXTB 1BJ8A 5J12C 2R0KL 1INEH 4Q0XL 4JM2D 3BPNC 1C5BH 2OJZL 3BJ91 1A6WL 1HSAB 2C3XA 3EYFB 3F8UB 3IDGB 4MB5A 3I6LD 1UXSA 2DI7A 3MGAA 2LVEA 3QUKA 3O45A 1FG2B 5HVGB 4MX7A 4FMFA 3MBXH 4JGMA 1VDGA 3EJJX 1QFWM 2X4OA 3CFBB 3CU7A 4KGJA 4WNQB 4QTHA 1N6QL 2ADFH 1J86A 4TTDC 3RX5A 1JYWA 3TZVC 1VFMA 4N5UA 3BYTA 4WO4B 4N0CC 1TQBC 4S0SD 1RFDH 4XVUC 5CD5D 1EEZB 1F4YH 4NQDE 4Z7QF 2NY6D 1A6AB 2NY4C 3PABA 4YR6A 5BV7C 1W0VB 5C0CB 1XT5A 1UM6H 3MACL 2N7AA 1ZVSB 3GGWB 3WLBA 1WBXA 5DYOB 2NLJA 2QSQA 4S10A 2WBKA 1B0GA 4HKBB 4PJXB 5K9OA 5EBLA 1LE5B 1U8NA 3FOLA 1ZTXL 1J0HA 3ZKNC 5F97E 3MRRA 3LB6C 3UZEA 2AJUH 4LLDB 1LQSR 4PJIB 1NEUA 3Q6FB 5FYJU 1J8HA 1HHGA 2OSLA 3HNTH 4CADB 1V3MA 1CGUA 3SE4A 3QYCA 5IB3B 1M05B 3U7YH 1AY1H 1FJ1A 2W9LA 3LRGA 4K3DH 5IOPB 5CS7A 1OP5K 5DLMH 4IS6A 1CIUA 5GZOC 1FFPB 5IMOB 1MHCA 3B5GA 4L1DA 2PO6D 1OB1B 4X5LA 4X8JB 2E27L 3HG1D 3V0VA 1U8LA 1CQKA 2GUOA 4IM8A 2EECA 1H0DB 3IFLH 4L29B 3MJGX 1ZGLB 3FZUC 5BZWB 4G80B 2VZVA 5CEZD 4X6FB 2W59A 4LPVA 3ZTJH 4LVNC 1DFBL 3FB5A 3SDYL 4LSQL 3THML 1F11A 1CICD 4XXDA 4CBPA 5FK9A 4JZOA 3ULUF 2SEBA 4P4KD 4EIGB 4AEHL 1NBQA 3W5NA 5BMFL 3WSQL 2XN9B 1P69B 2BVTA 3S34H 3GMQA 1MCCA 2DQUH 1MVUA 5HGAB 4F7CB 5DJ8B 3SY0A 3OKLA 1MIML 3QDJB 4RFEA 2I9TB 5F89B 3TNMB 1FAIH 3O3AB 3PDOB 4NC0B 5D2LE 3DYMA 3MA9H 2OQJB 2COQA 4D8PB 2APFA 2YPLA 5JR1L 3DUSB 1PKQE 5GISL 2X1OA 4MJIE 2R0WL 4QCIB 5DWUH 3QEQB 1G7PB 2XTJD 3CFDB 1AIFB 4ELME 5GSVB 2Q8BH 1MWAH 4P57B 5D7LB 1KLUB 2A83A 4FABL 4QHKJ 2DQTL 4MCZA 4MAYC 3NN8B 3D9AL 1JZ7A 5I1GH 1J18A 5H94A 3ZTNL 3DXAA 1K6QL 1ZLSH 4ELMF 3D0LA 2GK0B 2XKSA 2F74A 4NCC2 4G6FB 3CVIH 5JA8B 1ZVYA 2XZCH 5JLZB 4WY7H 3SPVA 5KOVC 3GSOB 4UILH 3PGDA 4U7MA 1JGUH 4M03A 4X6CF 1IFHL 1WAAF 2P5EA 5T3ZE 1QA9B 1J1PH 3LDBC 5MENB 3IDNB 4ZUUB 4NM8H 5IMLA 1FRGL 2BCKA 2IGFL 1HSBA 2XKNB 2BVOA 1GAFH 4RRPA 2BVPB 1DBBH 3TNNB 2IQAB 5DFVD 5I71B 5BQ7B 3VXRE 4MJ2A 3KPOB 3U82B 5C0EA 4KRNA 1Q9KB 1W0WB 2AJXH 2G60H 4MS8C 5B39G 3WFDL 4P3CH 3L7FB 4IRSC 1JK8B 1FO0A 1KPUA 2AJYL 1AC6A 3V9FA 1KUMA 5B38A 1ORSA 1XGQA 2Q8AH 5SV3A 4UOJA 1FO0L 3PWNA 5KSBB 3VXOA 5J6HB 3IAPA 1RJLA 4BFEA 1UVQB 4L5FH 2ZCKH 4JFOB 1RU9H 4CU8A 2B0SH 5JZ7D 1N0XH 1IC7H 2QQLH 2HYMA 3QULA 4J8RB 3DX8A 3X3FL 1SQ2N 4R3SB 1NDMA 4AEFA 2PTUA 2JIXA 2AEQL 1YECL 5D2NC 4AJ0A 3MRNB 5IESL 5DJXB 5D93C 4LSUL 1Z9OA 4LHQB 1UM4L 2DBLH 4YPGA 5GZND 3O41A 4LF3A 4QXTB 1S5HA 4FQ2H 3W82A 4XB7A 3OR6A 4OGAD 1I3VA 4PUBH 3ZE1E 2GHWB 2I07B 5ACZA 4NO0D 5IFJB 2WQ8A 3GJFH 2BHUA 1CE6B 2B1HL 4KK8D 3PJSB 3GBNH 5E6IA 5JMOC 2NNAB 4XCNA 4U1MA 2P5WA 5HGBA 1C12B 3UYPA 5IF0A 1NANI 1RHHA 3K3QA 4PV9B 5DUPH 3OAUH 4WEUD 1LO0H 2A73A 3GMMB 3O2VL 5F93C 1FDLL 4KTEH 4P4RA 5CINL 2PYFA 3OL2A 1U8OA 1DTUA 3VXUE 4BSWA 5DA0B 4WFHE 5T33H 1PY9A 1SEQH 5DMGD 1Q0XL 1SVCP 1Q72L 1WUNT 4CVXB 3WHXB 4JKPL 1FBIL 1FGVL 4F9PC 5E8DH 1G84A 4HH9B 4MJ5B 1KCUH 5DDHB 1RZJC 3DTXA 4MJID 2XWBB 4G6KL 4APQD 4ZUTA 3A6BH 3IU3B 3KLHD 1NBYA 2QKIB 4ONFL 4OLWL 1FGNH 2NXZC 1HK6A 3O3DB 4YK4B 3T0XA 3QDGA 1GGIL 3L9RB 1QPXA 2PYEB 2DQJH 3RZWA 1CR9L 4HWZA 3DX9A 3TO4B 2BERA 1UENA 5ESQB 4JPIA 4GSDH 1RZGA 4Y5YB 2MKWA 5FYJE 3QH3A 4MVBD 4P2QB 3KYKH 5T3ZD 4WI5A 5IWLC 1D9KB 3QUXC 3HAEB 5FGBC 3CFEB 5B8CB 4IEFB 5GS0H 4FXGB 4XPTH 5F1OB 1OLLA 5HHVL 3VFNB 2KUTA 1G7IB 1F97A 5JORB 1H9VA 1HE7A 1DANT 5HHOB 1FORH 2X4TA 3NFSL 3VXRD 2BXYA 1AR1C 1CD9B 1UG9A 3ZSTA 4LFHD 1QLRA 4YAQB 4RDQG 1JVKA 3VMNA 3BP4A 2OTUB 2RCSH 1C08A 1TNNA 4FFZL 5JW4Q 1A6ZA 4HFWA 2KQMA 3RY4A 5KSUA 1BFTA 5JNYB 1G9EA 3MQIA 5BV7L 1GIGL 3GMNB 5I66A 4TVSa 2ZUTA 3GSWB 4Q9RH 3WNKA 3MRMB 2R8SH 1NGZB 4LLYB 1IAIH 3QO1B 1JYXA 2IADB 4ZS6D 3LPGA 5HDLA 2CDGA 3LRHA 4RQQB 3V2AR 5D1QC 4FFWC 4JFXB 5T1LD 1GHFH 3M07A 1BQLL 2R4SH 3SGJC 2AK1H 3U0PA 2ZZUT 5DXWA 2A6KB 4ALAH 1V3KA 1MRDL 3J7HA 4DGIH 4I3RH 3OG4B 3WO4C 1F4XL 2ICES 3WXWL 3ISWA 4M5ZH 5FHBL 4AIXA 5DVOA 4Z7OF 5JOPE 1KBGL 3ARBC 4GKSB 4XNYL 5JQHC 5F7MC 3PV7A 2FX8H 1C1EH 1F6AA 1G6VK 2EO1A 3C09B 4P23C 2OR8A 4PPTA 3JV4B 3QAZB 1G1YA 2OL3L 5IMKA 1YNTB 4WI4A 3O9WC 1GPOL 1UEMA 5IQ9B 3LMJH 3IF1B 5DJ2B 1I7ZA 3IDMA 3VXUD 4WFHD 2XRAH 5GGVY 1MFAL 3KLSA 3PHOA 4KAQL 1NCUA 3PDGA 5BXFA 3QDMB 1BZ9B 2BK8A 3BSZL 5EPMA 5GRWA 3VXSE 4W6YB 4UAOB 3S4SA 1F4WH 4NKIL 4KI5C 3O3EB 4YHIA 8FABB 3PF2A 1A7OL 4YHOH 3QDAA 5DD6A 2DMCA 5LWYH 4JCMA 1DN2A 2EH7L 5DT1L 2FSEB 3MJ9H 2VNCA 3O2DH 4BSJA 1SBBA 4OGYL 4O58H 1URLA 4RAUB 1IKFL 2CDEB 4LHJB 5EZLB 5DO2D 3PNWA 3U9UB 1T03H 5DK0B 1EVUA 1OAQL 4HX1B 1U8HA 1GC1H 1ZLUH 4M6ML 1E6JH 1YMHB 3NCYP 3SKNB 3C5JA 4HIIA 3GBMH 1E27A 3GUTA 1UH2A 5FYJD 2OZ4A 4OLUH 1RZIA 1KV3A 5LXGH 5CZKA 3G6AB 4YHMH 1KIRA 3MBEC 3OZ9H 3KJ6L 2Y9RT 4OZHE 2OK0H 4F57L 1MCOL 2KBGA 4PGZA 5DUMH 5MEOB 3ECBB 3PXHA 4L3CB 5TF1H 3R8BB 2WLZA 3DROB 4IIQA 4I4WA 5D72H 4D94A 5A2IH 3FO9B 4YXLL 3CVHA 1OGTB 4OZHF 2FWOB 3ARPA 4MA1B 3BP6B 2ZG2A 5BRZA 3CMGA 4POZC 3RWDB 3BAEL 1GJIA 3H9ZA 4JG0H 3CVHL 4DKFL 2CK0L 4OGXL 3GSUA 1S7VA 4XC1L 1QHOA 5KSAC 3PHQB 5GS0C 3B8YA 4R97B 4XPHL 3IJSB 5GJSH 5JW5B 4IHOB 4O4YH 3UBXA 1E28A 5ITBL 4HLZG 2BOBB 4EQ2A 4M61A 2IPUK 4QEGA 4G6JH 3TC9A 4Y4HC 1T04B 1YEKL 4K23L 4Q9BA 4LDOB 4POUB 4MJ4A 1VEMA 5KZCD 1ZEAL 4FNLH 5DJYA 3VXPB 1F4YL 3MRDA 4YDVA 4KU1A 2NTFA 5EBMB 3W0WB 2P1YA 4M4RA 2X05A 2OBGA 4C83A 4QO1A 4YBHA 4UMGA 3WDJA 5ECJE 1DQLH 2BDNH 4XC3H 4CMMA 3QHFH 3ZE2F 2AI0H 1CD0A 3RUGF 5IR1A 5JOPD 4ZO9A 4XH2B 1OPGL 3VWKD 3BDXA 2PCPA 2HLAA 1I85A 3B9KB 1FNFA 3U6RA 5B39B 1VGKB 2E9IA 5LQBH 1TTFA 4YZFE 3L7EA 5FGRA 4NQSB 3MOBH 4X5WB 1IZJA 3B5HA 3DHJA 3DVFA 1AY1L 5JUEH 4KRPD 4PRNB 1MHPL 3H9SE 1CGSH 1KJMA 2A2QT 2YD6A 4PR5A 5FM5M 2D0HA 5AD0B 2AJZB 3NGBB 3PL6D 1EEUA 2ZSWA 3VXSD 1PZ5B 1IEBA 3FQWB 1MNUH 3RWGB 4LOUD 3K81A 5HVHB 1XIWB 4U6YB 5C0IA 1S7QB 4I0PD 3HUJB 2YD9A 1WICA 3QPQC 3RAJL 1KFAH 3UTQB 4S1RH 4HG4K 1D5XB 1P2CA 4PRPA 1CFTB 4NWTL 2FEDD 2Y07L 5ESAB 2BMKA 3H2WA 1FHGA 4QYOB 1QSZA 3B4NA 2HJKA 3S36H 1S3KL 1RZJL 1YY8A 3RVXD 3VRJB 3QUYA 1M7DA 4I1NB 1MRFH 1PLGH 1CD1B 4L8SC 3RTQC 3S34L 4XPFH 1EEYA 1KB5H 3FB7B 3QFJA 3SOBL 3UZVB 5K9QI 3IKKA 1KG0B 3BXNB 2BX5A 4FQCL 3ROOB 1UWGL 4HIJA 4Z7UB 4LP4A 1OF2B 4HIHB 5DD3H 5IGXH 4LAQH 4D9LL 4MGXA 4TUJA 4HGKC 4HJ0D 4LCYA 3KAAA 5BOZG 5DWUL 2G9HB 5CGMA 2OI9B 5CIPA 5FGBA 1EUTA 2FEEI 3SDDD 4XVTH 4YHKL 3S35L 2HH0L 5D7JC 1EHLH 3IDXH 4ODXB 5C09A 4YE4L 2KL6A 3TVMC 4H1LA 3FCTA 1H3XA 1OAXL 5I1GL 2Q1EA 4OIIH 5ETUB 4WW1B 4NRYA 4GXVH 3RWCA 2OXHA 3MYJA 5HI5C 3CDYA 1I8LC 4PFEA 2WWMC 3GNML 1NC4A 5FM4A 1TJGL 4UQ2A 1FNGB 3EJZC 3NTCL 4QT5A 4R90H 4UILL 4U1LA 1OAZL 5SWZA 1A5FH 1YPZA 4NN6C 1H8NA 1YN6B 2WUCH 4WWID 3WUWG 4NM8L 4BUHA 5IHBA 1J8HE 4XCYA 3V6OC 3P40A 3WIFB 4IDLA 1B3JA 4GAGH 4P5TA 2EEDA 5KVFL 2GITA 4YHLL 5F88B 1HZHH 5I8KH 2C3GA 1WZ1H 4OFVA 4D0CA 4Z7VF 3SGJA 3TPUB 1E4XH 3C5ZD 2VAAA 1RIUL 2J88H 2QADC 4CRPA 2HKFH 1IGCH 3OJVC 3DLQR 5JHLH 3I6KB 4M7LL 4GMTL 3ZE0E 2EDXA 3Q0HA 5CEXB 4HK0B 1A7RH 4M3KB 2NY7H 3WDIA 3OXRA 4LLQB 1B2WH 2ZCKL 4RBPK 3OKMA 3ELAT 5E1AB 3WFHB 2ZUYA 5IHLB 1V5JA 2VYRE 1NC2B 2YBRA 3H9SD 1MCBA 4NCC1 4XCFL 1TVBB 4G7VH 5DSCB 1ACYH 1U91B 4GG6B 3CZJA 2VAJA 4YIQA 4OF6A 4PGBA 4OQTH 2H32H 1X7QB 2DBLL 3RNKA 4WO4C 3CSYB 1VGEH 5DURD 4KK6D 4FQ2L 2YPLE 2QHRH 5J1AA 2ESVB 4CN6A 2HRPH 3SO3B 3WJJA 4G8FA 1Y6NR 2DQCH 3LAFA 3VH8G 4PJGA 5HTSA 1YEEL 1S7TB 3KS0J 3GBNL 1CDYA 5F7EL 3ZDYF 2VDOH 2EDYA 3MODL 1JMXA 3P4OA 3V5HB 4U1NB 1QKZH 2NZIA 1NGPL 2FZ3B 4ODTH 2NZ9D 3EJYC 4NM4H 5T33L 4JVPA 4HS8L 5L7XL 2AKRB 4LSVH 4KJPC 5DR5H 3MCG1 5HD8C 2HG5B 4M00A 3MA7B 1BVLB 4XX1E 2P5EE 1BQHG 3MBEA 4KKBC 3BVNB 3S35X 5INDA 3Q1SL 1KEGH 5FOJA 2IG2H 5FYLE 3UTTB 5EIVA 2QV2A 2W65B 4KJYB 4XMKH 4M1GH 2VDPL 1XGUA 1OAKH 2EYSA 3GBLA 3E8UH 4NKOB 1JPTL 1UT9A 1TNMA 4JQVC 3SKMA 5FDWA 1OWRM 1D6EB 1Z2KA 2Z8VC 4Y7MA 1KPVA 3HC3H 3TH3T 5JW3L 4HK3N 3P9LA 4QRRB 4ZXBB 3QIWD 1UB5A 2P44B 3ARXA 3QO0A 5KSAA 3KYKL 4F7TB 3LPFA 4B50A 1JF1B 3VD3A 4EXKA 4FQXD 5ISZA 1J8HD 3D48R 5GS0L 2FX7L 5E8EB 3ZKQD 2XZAH 3TT1L 1RV6X 5K59E 3BO8A 4Y4HA 4WTXA 4KQ4L 3DJ9A 5C86A 4AEEA 4HUXA 3LN9A 2HT4D 1CG9B 4MDIB 1CLYL 5IHUL 4OFYD 4EVNA 3O2WH 5IP4A 1JZ6A 3DRTB 4PRIA 4F7MB 1ZT7B 3EO1A 3MV9B 1AXTH 4NQEB 2RCSL 4LLUA 1AXSB 4OLXH 1J1XL 4LEXH 4OIBA 4Q9RL 1CLOL 5E4EB 4ELKA 4M7KH 4ZUWB 1OARL 1TPXB 1MAML 1OSZA 2MPAH 3BGMB 3L95A 3TT3L 4NFBA 4P59H 1IVLA 1HDMA 1YEHL 2XV6B 2ZUXA 4PJFB 2FHBA 1M71A 4HZLB 2J4WH 2P5WE 4QNPE 4AK1A 4PJHA 2C1PB 3ZO0A 4OD2A 4UBDD 1RSFA 4OCYH 2R4SL 5D70H 2VXQL 4ALAL 3BGFB 5ADPH 3TBTB 5IV2B 2FECI 3E6FB 3P11H 4DGIL 3QR2A 2HWZH 1FNSH 4YHPB 4YEFA 4HS3A 4OQ1A 5FUZL 1JNJA 1A6TB 1EBAA 2ITCB 1ORQA 1JUFA 2F58H 5I71C 1ONQA 3STZA 4F33A 4NO5B 1C1EL 1RQ5A 3W5MA 4GH7B 4EN3B 4QHUA 3BUYB 5EOCJ 2KDGA 3MRFB 4HWBA 4KGLA 1AO7E 3HI6H 3UAJD 1N64L 3WE6B 4JRXB 2DLHA 5E8NA 1JN6B 2Y6SC 7FABH 1TIUA 5DC4B 4LHUA 2CRMA 4XWGL 4L8SA 3RTQA 2UWEB 3CU1A 1HNFA 3FMGL 5I1DB 4GKOA 3OB0H 1WCQA 2IC2A 3VE0A 2P5ED 2EDJA 2QR0A 1ZHKB 5DC9B 3QUZB 2XZZA 4GUPA 3UTZB 1AP2B 3QRGH 4N8PA 5HPOA 4U1KB 1W0YT 5CZVH 3MV8A 5FYLD 3O6LH 5K93A 4P3WA 1S7RA 1ZT4B 3H0TB 2HLFD 1CWVA 3CZFB 4JPVH 4U6XB 4O58L 5ADOH 1OSPL 2AXJA 1YJDC 5GGSY 4GRWH 1QRNA 5JMRA 5L8KB 3CNKA 43C9B 1E6JL 3H9HA 5FOBA 5FA3B 1TQCC 3MLZH 3LRSA 3WIIL 1H15A 2CQVA 5FYKH 4OLUL 3ZT5A 1HXYB 2ZKHH 1MRCL 2DLFH 1ZMYA 1BF2A 2W60B 1FIGL 3B2VL 3LS4H 5L6YH 5CWSA 4RA0C 1UYWL 3I3DA 1BOGB 3NH7H 1NAMA 4MHHI 1NFKA 1GOFA 3O4LA 3UJTH 2AV1B 4HJGB 5TF1L 1NAML 1WSST 2W92A 5T5NG 3VXQB 2A77H 3D0VB 1WISA 2JIXD 2RQ8A 3DI3B 3V6OA 5GGTA 1FZMA 1I8MA 1Z0MA 4LP5A 4OV5B 5D1ZB 4WUUA 5I1CH 2IBZX 4UOW0 3BRDA 1HINH 3DGGA 4K8RD 1OTSC 3WUZA 4ZDHA 1JF6A 3LS5H 4PRAB 4KK9C 2FATL 1MLCA 4YK4C 4RWHA 1CTOA 4MXWH 4EUPG 4LMQI 3X13A 1OQOA 1MFEH 1BEYH 2BP3A 3EFFB 1U58B 1P1ZA 4XMPL 5DD0L 4LFHG 1Q9OB 3RWHB 1RUKH 4G6JL 3TO4C 2P5WD 3ES6B 1HSAA 3EYFA 3IDGA 3U36B 4MXQD 2R23B 3OGOE 4Y5YC 2F5AH 1N3NB 2C4FU 3MGTB 4CJ1A 5I6XB 4GAYA 4RSVA 1FG2A 4J4PA 1D9KC 3T0ED 1R5WB 2AJSH 1TZHB 5B8CC 3ME0A 2JE8A 1NFDE 4M9PA 3CFBA 2HA1A 3WUWB 3W9DB 4WNQA 2OMNA 3MXWH 1DQLL 2BDNL 4XC3L 1CFVL 3WD5L 3ARDB 2VWEE 1MPAH 5DRXB 4WO4A 1T89C 4MMXC 5E00A 4NDMB 4DKDC 1JRHI 3GSNA 1A6AA 2PR4L 3FFCB 4GMSL 5MI0B 5DRZB 1L7IH 1DBML 2NY1B 1W0VA 1CFNB 4YC2B 1JHKL 5D7KE 1AO7D 1ZVSA 5A2LH 1A8JH 2IANB 1JNNL 5DYOA 2NY6B 5TE7H 5EO9B 5JUEL 2FO4B 1WGOA 1A7PH 3LD8B 1CGSL 1QNZH 3CUPB 1ND0B 3JBG7 4DQOL 3WIHA 3OR7B 4DAGL 4I18B 1I3RB 3CLFH 4LLDA 1XF3B 2FIRT 5LBSL 4CADA 5B3NA 3OV6A 4TVPE 1X4XA 1M05A 2QHLA 2HAZA 3UJIH 2MJWA 4LBEA 4LK4A 1QPPA 4AM0B 1FFPA 1NBZA 5IMOA 1DLHB 3B9EA 1BREA 1OB1A 3FQXB 2DWEB 5CJOL 1H0DA 1WT5A 3G5VA 4Y4KD 4NKMB 4L29A 1FPTL 1EMTL 1ZGLA 4G80A 2DMBA 3VH8B 4JQVA 3C09C 4X6FA 5C6TL 1FN4A 5IFAH 4LSSH 3IDIB 1EXUB 3EYQD 4ETYA 4AENB 4G3YL 2MCPH 3HNVL 5T1DL 4PY7B 4LQFL 2R2HB 3ARYA 2CDFB 5F1NB 4PIRF 4UAOC 4XVTL 5I8EB 4UOW1 3OAYK 2RFXA 4GO6B 3KPMA 1CICB 1EHLL 4F7CA 5EU5A 5DJ8A 4P4KB 3QDJA 5GS1B 2I9TA 5F89A 3TNMA 4FG6D 4JQIH 3O3AA 15C8L 1K9TA 5GZOD 4CDGC 4Y2OA 2OQJA 4D8PA 5CJXC 3DUSA 2B4CC 3U2SA 2IMNA 4MAUH 1YEGL 1A3QA 5IEKB 1PG7H 1A1NB 4NC1C 3BN9D 4K07A 3RU8L 3O6FB 5A1AA 1AIFA 3IFOA 3E3QE 5GSVA 4P57A 5D7LA 3FZUD 4JY5H 1KLUA 2PETA 1OY3B 4D0DB 5INCA 5I19L 3V79C 4PP2B 5T5FL 1G6RA 3NN8A 1OW0C 4S1QL 4IBLT 1VFBB 3LKQB 3QIBB 2XTJB 1S78C 1MREH 1VPOL 2DTMH 4J2XA 5FKAA 3RVVC 4ZNEA 4JGJA 3P9MA 5E94B 5F1IB 5I8KL 1IBGH 4LVHB 3GSOA 4HKZB 4WTZG 3BDBA 3TCLB 3VGAB 1E4XL 3WFCL 4RA3A 2J88L 5MENA 1QA9A 4NN5B 3GK8H 2BNQA 3IDNA 2QQKL 3ORJA 4ZUUA 3H3PH 4AMKH 3CGTA 4YGAB 2XKNA 4HWNA 4PRPE 5ALCH 1XGPB 3N1MC 4MA1C 2BVPA 4HT1H 3TNNA 1K5NB 5BQ7A 3DSFL 1EH9A 1W0WA 4P46B 3HFMH 2F53E 4R97C 2EZ0C 3FQTA 2P43B 1WK0A 3L7FA 3K2UL 3L3JB 1JK8A 4QXUH 4LIQH 1IQWH 3B2UC 2EDOA 5KSBA 4OLYL 3QFJE 4NFDA 3MLRL 5J6HA 4YO0B 4ENEC 4BZ1L 3MNWA 1UVQA 1MIEL 3F7RA 3M8OH 5FIEA 2GCYB 4L8DB 2EDDA 1JV5B 1RUMH 2VL5A 4TVPD 1AE6H 3MV7D 1NLDH 3LIZL 5K9QG 1LP9E 2HRPL 4J8RA 5DRNA 4PLKC 4R3SA 4A6YB 3ILQD 2DQCL 4I77H 3MRNA 5L2KB 1BBDL 5E9DE 2J5LB 4PBWD 3BOVA 5C09E 3Q3GB 3SKOB 2HN7A 5IMMB 4QXTA 1J0KA 1ZLVK 3HR5B 2WZPD 3OKDB 5D5MF 3CX5J 4F2MB 1MF2H 2AQ2A 2EDEA 5KW9H 2I07A 4ODTL 1IGML 2EDRA 2GEEA 3B9KC 4NM4L 3ZYZA 4QRSB 1TZGL 1YJDL 4JRWA 5FF6A 3SDAA 4BFIB 1E4KC 3PJSA 4LSVL 4FQHB 1IE5A 3H42L 4J7RA 5CZXD 2EE2A 5SWZE 4PV9A 2ADJB 3EHBC 1KTLA 4QHMB 3NGBC 4GFTB 4WU5B 3AREC 4MWFB 1Q8MA 5HVHC 3GMLB 3AS3A 1XIWC 3QXAB 4XMKL 4M1GL 1NGYB 3WLWC 3X12B 3E8UL 4GG8B 1YPZF 4UT9L 3HC0A 2EXWC 3WHXA 4HH9A 4IOSD 4MJ5A 3TF7C 4RMSA 3FB8B 5DDHA 2XWBA 4JZNA 3ZKMC 1HHKB 3QUMH 3WNOA 3GKWH 3IU3A 1G1CA 5D2LB 2QKIA 4Q6YA 4DTGL 3SKJL 5EC2A 1K3ZA 2ZJSL 3O3DA 4M8VA 4OF3A 4I13B 1A0QL 4MJIB 4PS4L 3LSOB 1NAKH 3L9RA 1U95B 4APQB 2PYEA 3LH2H 1XEDA 1RIHH 3C8DA 3TJEL 1YNLH 1DUYA 1KCRL 2GW5A 4V2BA 2EDLA 3REWB 3FRPA 4Y5YA 5CJ5A 3G5YA 3HMXH 4LGPB 1FG9C 3ULVE 3O2WL 2HT3D 4P2YA 3U7WH 5EBWB 1D9KA 2OI9C 1LDSA 3HAEA 2H2PD 5D1XA 4PRPD 3UO1L 4MA3A 3VFNA 2Z4QB 1G7IA 1N26A 2FJFB 2IAMA 4LEXL 5JORA 3MRGB 3EOBB 4M7KL 5HHOA 5C2BH 1F3JB 4X5XA 1T89A 2MPAL 4GW1A 3UX9B 1BGXH 2DTSA 2DI9A 5CGYC 2F53D 3RL2A 2G5RA 2NXZD 1BJ1J 4KXZI 4YAQA 2J4WL 2P7TB 3L5XL 4M1DH 4KI5F 3QUYD 2OTUA 3IS1X 1QBLL 3VXRB 1J5OL 4NZRH 2ORBH 3TBSA 3KPNB 3RVTC 4PJGF 5JNYA 1YYLL 3QFJD 4ZPTB 3GSWA 3MLTA 1KJ2B 5ADPL 1BWMA 4PJ7B 1NMAH 4U31A 1KB9J 1FNSL 1HHHA 4ORZC 4PJCA 4PGEA 2IADA 4IRJB 2NYYC 3MLUH 1JPFB 4L9LA 5DVLA 4RQQA 2F58L 4JFXA 3KLDA 4AEIH 5HHQB 3G6JF 1A4JA 5E9DD 4YBQC 5IVXF 1MCKA 2A6KA 4ODUA 5C09D 3SBWC 4FFYH 4ONGL 1T20B 3DUUB 4UT6H 5A2JH 3AB0B 4HLZH 5CSBA 2CR6A 1NLBL 3U4EB 5DMIH 1NC4D 2F8VA 4KUZH 3WXVH 5IKCB 3MLXH 4ZFOB 4GKSA 1V7MH 4J3SA 4LLMB 2YPKA 5KAQF 2RR3A 3JV4A 4CU6A 1JTTA 1EO5A 1YNTA 5EDXA 4TQEH 4OJFL 5IQ9A 3DVGB 4X9GA 1MJUH 5DD5L 2E9WA 3LQZA 2X4UB 3IF1A 5DJ2A 1CBVH 1F2XK 4P5TD 5DJ6A 4DK3A 1F8TL 4UT7H 5B4MD 1KTRL 4G6MH 5F1KC 3QDMA 1EAPB 4X7EC 4WVRA 5EZJB 3O3EA 1X5GA 1TJIL 3EZJB 3WL9A 3SDCD 3QXWA 3VXUB 5LCVH 3CC5B 4I5BB 4FZ8L 2BJML 4N68A 1YY9D 2FSEA 4XPGH 1RPQA 5E8OA 5FYKL 4Z7WB 4X6DB 3N9GL 2Z35B 2DLFL 3TCXA 4RAUA 1RIVH 5EZLA 2B4CL 3KYNB 3LEXB 4PGCB 3U9UA 2VZTA 1MCQA 5AZ2H 2MKLC 4HX1A 1S9KC 1FL5B 1MVFA 5CSGA 3WCYA 1YMHA 2N1KA 4PJHE 2VABB 1MJ7H 1FL3B 1KJ3L 3SKNA 1OW0A 4GW4A 3NCFB 3UPAA 1NMBH 4GLRH 1QEWB 2WWKT 4P5KA 3FT3B 3WN5B 3ULVD 1ED3B 4M6OL 3G6AA 4OZIF 1JYVA 5I1EH 2XFXA 4KZEH 3HI5H 3RKDC 4PJHF 3LS5L 5HGDB 2NTSP 4NP4L 2XYCA 5MEOA 3ECBA 3QG6B 3BRFA 1Q0YL 4L3CA 1CD8A 5EZIH 4UDTB 3DROA 3K74B 2JCCF 1JZ5A 1MFEL 2YRLA 3VCLB 1JE6A 1OGTA 2FWOA 1XF4B 3B5TA 4MMZC 2V2XA 3RWDA 1B90A 2J8UF 4LASL 4ZXBC 4RAVA 4WV1C 5D7SL 2VXVH 3PHQA 2BSSB 4JDTH 1CXLA 3R0MA 4DKAA 4EOWL 2N56A 2CXGA 4LKXB 5JW5A 1HOCA 1PX4A 4Y5XB 3P0YH 3MBED 3HZMB 1T04A 2H6PA 1DJSA 2VL4A 4XP6L 4H88L 2GSGB 3ZKSD 3S3PA 3MV8E 2G2RB 4OZGB 1L7IL 2GFBB 5JPNB 2H3NA 5I73B 5KVDL 1HHIB 1PBYA 1Z9MA 1XGYL 3VRLE 1U92B 5E4EC 4FFVD 3RIAK 5I1JH 1TPXC 5A40E 1FFOB 4XH2A 2HJFA 4XNUH 3BW9A 4Y16A 5GHWH 1J0ZA 2VDLH 3B9KA 3VRLF 5JXAH 3ESUF 1DBJH 4PTUB 3K1KC 4AT6B 1RURH 2XXMB 3O6KL 4M43H 3U4BH 3BP7B 3OGCA 3O4LE 3MR9B 3VWKB 4LVOB 3BKCL 3C87A 2EIDA 3BGFC 1KSRA 4PRNA 4MHHG 1NFIA 5AD0A 3V4PL 3B9DA 2AJZA 4NWUH 4U1GB 1PZ5A 3T0VA 4TUKL 3RWGA 4XX1G 1NCCH 3F58H 4HEME 3K8KA 5I15H 4WUUE 4MNGB 1GL4B 3HUJA 1UGNA 2FR4B 4RRPG 4OCRH 3UTQA 2KZ1B 1NPUA 1D5XA 1J9CT 3VXSB 5GGVH 5ESAA 1FLRH 3NA9L 1LVEA 2EC9T 4EN3C 4OUOA 4O2FB 1QVOB 3UJJL 3OG6B 3MOAL 1T1WA 2Z31C 1FYHB 2MCPL 3VRJA 5EU4B 5B38G 2A9NH 4C54A 3S7GA 1CD1A 5JIKA 5CFHA 3ET9F 1UACL 2D2OA 2HVKB 3FB7A 4LRNH 1DUZB 4P9HC 1AI1L 1MQ8A 4WGVB 4ZUSB 3T09A 2HFEB 1KJVA 2VXSH 3QUZC 1KG0A 3BXNA 3EO9H 3ROOA 3F6LA 4Z7UA 4HIHA 2VE6B 2FD6H 1MQKH 4OKDA 4MAUL 3OKYA 2MMXA 3HR6A 5EO0A 2VDRH 4PRHA 4KFZC 1R3HA 2G9HA 1YC8A 1S9YB 4NOBA 1ZA6B 3QPQD 5CEZH 2L7UA 3PWPA 3P73B 5IT2L 4ODXA 3SHSA 2VISB 3QCUH 4YNYA 2I9LA 4KUCF 3CXDL 4WW1A 3JWOC 5CJBA 3U0TA 4XXCC 3SDDB 2E7LA 1S9VB 5D9SB 5F9WB 1RJZB 4LHUD 1JFQH 3BIKA 1FNGA 4NO2B 4TNWK 4UV7H 4YQXH 3CH1B 1BZ7B 3HKFA 1JZ4A 2V5YA 4KI1A 1AQDB 3GK8L 3V0WH 2OR9L 2DI8A 3Q5TA 4PJXF 1ZGLM 4UU9A 3WIFA 1D6VL 4PRBA 3MV8D 5D1ZC 3SCMD 3U1SL 4F58L 3ROLB 4HT1L 4X9HA 3BIBX 1RUQH 4O51A 4LCCA 5F88A 5F44A 3QIUA 3U79A 2DDQL 4PJIF 4WENB 2Z93A 4RNRB 1MCHA 3BEWB 3TPUA 3DETC 2W9EH 1N4XH 4LCIL 1N7MH 4M4PA 1AFVL 4JN1L 3I6KA 3QCVL 2MFNA 4KKCC 2W1NA 4LIQL 2QL1A 5DMYA 4A2LA 3F62A 2YD7A 3C5ZB 4HUMB 3EBAA 3T1FB 3GKZA 1TCMA 3WFZA 8CGTA 1RUML 1EJOL 2ATPA 3O4LD 4IDJL 1XR9B 1Y0LB 1NLDL 1QTYT 1A6PA 5E1AA 3WFHA 4JM2C 3JUYA 4OT1L 3G04B 3LZFL 2X4SB 5DSCA 4DN4H 2X4PB 3GMOB 1U91A 4GG6A 4NT6A 4MQXD 5KN5B 3DHMA 3DYOA 5C9JB 1KIQB 4RIRB 4WUUD 1ZWIB 3QDJE 1QFWH 4JY4A 4K2UL 1S7XB 3CSYA 3H9SB 4MDJB 3V6FB 2XNAB 1T22A 3ZL4H 4JO3H 2ESVA 3GSRB 3SGKC 3RI5K 3VG0H 5MI0C 2APVA 1M7XA 4X4XB 2NY1C 1RZFH 1X9QA 1LE9A 4YC2C 5SX5K 4RGOH 5DURB 4O5LL 1S7TA 5D7LE 5CUSL 1VHPA 5CD5C 2NY6C 4TSBH 3LD8C 4X6BA 4YHZH 4PJBA 4U1NA 4ZTOL 2XPGB 1XCQB 5F96L 1O7SA 2E3VA 5I1IH 3IVKB 5C6PB 1H3GA 3MZGB 2FZ3A 1CVSC 1T66D 4BQCA 4I18C 1I1FA 4J4PD 4ZNEE 3LN5B 3QCTH 2GJZA 3CAFA 3MA7A 1BVLA 1PG7X 5E08H 5MENE 2CKBB 2BNQE 3QNXB 3GKWL 4F15C 3BVNA 4OKVB 4GBXD 1KULA 1LDPL 2VQ1B 4GS7B 2X4OB 3UTTA 3WS6C 1N2RA 3T2NL 4QTHB 1N8ZB 4XTRD 5AYUL 2FJHA 3AMLA 4OD1L 5TH2B 4WHYG 1RIHL 2D0GA 4OV6F 3EKCA 2M26A 1D6EA 5E99H 1G7HA 5GXBB 4HWEL 4QRRA 1CU4L 4M5YH 4U1IB 3AXLB 4XB8A 3OAZK 4AL8L 1WBXB 4JKMA 4F7TA 1GGBH 2NLJB 1JF1A 3EJYD 3U7WL 1G9NC 2KH2B 4HCRH 3VFRB 4ONHB 2M8XA 3RA7H 4KJPD 3QIWB 1CICC 1ZLWK 1U8NB 4KTDH 4F7PB 3FOLB 4P4KC 5KSBF 3ABZA 4JPKH 4QOKA 5IJKA 4FQXB 5C2BL 4ZNCD 2CK2A 1J8HB 1HHGB 4P9MH 4MDIA 2QSCL 3RHWK 3VXMA 1T7ZA 1ZT7A 3MV9A 1VACA 4NQEA 4F37F 1EA9C 1FH5H 4EXPX 1X6NA 3RFZC 1AXSA 1TDQA 2DOCA 3WEXA 1SJHA 3MRLB 2V7HB 3MCLL 4ZUWA 4Q74A 2GUOB 4PJDA 4HMDA 4PGJA 5T3XL 3BGMA 2XTJC 4ZOAA 1LO2L 1Z5LB 5I8CA 3TA3A 1V8HA 3VU2A 4HZLA 5EU6A 2C1PA 2YD2A 2ZCLL 3FB5B 4XNMA 4G9FB 4LVHC 4XZUB 5CKAA 4EI6A 3VGAC 3QG7H 5CCKH 4QRUB 4NN5C 1L6XA 3QDJD 2JELH 5IV2A 3G5ZB 3E6FA 4EUPH 2NY5H 2CLZB 4ZS7L 2E8ZA 3VA6A 3SKUD 4YHPA 7CGTA 1A6TA 5F7YC 5J6GB 1KCVL 1MVUB 2VXUL 3BEVB 3SY0B 3HPJB 1BIHA 4RFEB 5E8PB 4P46C 4ZOBA 1M6OB 5D7LD 1QD0A 1BFSA 3ALXA 4TOYL 5C7XL 4EN3A 1F6FB 2J12B 1RY7B 2H45A 3BUYA 5F8QC 1SYVB 3SQOL 4TSAH 2HFGH 1JPST 3WE6A 4JRXA 4YH6A 3NCJH 1JN6A 1DVFB 1OAUH 1CZ8L 4G6FD 2A83B 4UT7L 4MCZB 1MELA 5H94B 1A14H 2UWEA 1INDH 5I1DA 4H8WC 5A2FA 5MEND 4LSDA 1ZHKA 2BNQD 4DVBB 3QUZA 1XGRB 2EKJA 4I3SH 4P9HL 3UP1A 35C8L 4U1KA 1CLZH 2D7MA 2J5LC 4XPGL 1OCWL 2VDQH 5C0DB 2EH8H 5JZ7C 3PGDB 3HCVA 4OCSH 1JGDB 3KR3H 1IM3A 5HHOE 1RIVL 2AXGB 5E0QA 4QWWD 1WZMA 1HSBB 3GMRB 5AWNL 1MJ7L 5GZNC 4XMLL 2BXZA 1E6OL 1P6AB 5AYQA 3U46B 3V6ZA 5BZDB 4OGAC 1ZANL 1HXYA 4HPOL 5I1EL 2W60A 3JWOL 4KZEL 4MJ6B 1KPUB 5J13B 1NDGB 3FB6B 3QZWB 4KK8C 4PJCE 1ORSB 5EZIL 1SEBB 3VXQA 4XBPB 1RJLB 4X6EB 1EFXA 3D0VA 2P8MB 3OXSB 5FUCC 2E6QA 4KPHH 3BKML 3GHBL 4H0HB 4K3JL 1S7UB 4OV5A 5D1ZA 3DX8B 3TIDA 2JJUA 2XWTB 5DMGC 1O5DT 3F7VA 1UH4A 3C60D 1MFNA 5FYJH 4APQC 1VERA 4E9LA 4YPGB 3SDAD 3S88H 5L9DH 5EC1B 3KLHC 4LF3B 3EFFA 1S5HB 1U58A 2O61B 1Q9OA 3RWHA 5DHVH 4P2RD 5ACZB 2YK1L 3MJ9A 3ES6A 4HUWB 3T04D 3U36A 2X2YA 1KCKA 1N3NA 4YHYB 3CJJA 4J1UA 1BFVH 2I60H 2LQRA 5C92A 1KIPA 1R5WA 5HGBB 3QQ9C 5IF0B 1RHHB 2AXFB 4P2OB 1X5AA 1TLKA 3WUWA 3W9DA 4MVBC 1U8OB 3DI2B 3STLA 3ARDA 1DANU 3T0EB 4BSWB 5DRXA 4OD3H 5M94B 1L0XA 1RZKH 2VKXA 1D5IH 4H1LG 3FFCA 5GHWL 4A2MA 3BP5B 1T21B 5JXAL 4NC1E 2EEAA 1CFNA 1NCAL 2K9UA 3SN6N 1SBSH 3ZLQC 1OWWA 4Y2DD 2IANA 2X4RA 1OGAB 5EO9A 3BE1H 2FO4A 2KZWA 1CL7I 1BWWA 4ZYKB 3MLVL 3CUPA 2IPTH 1I8KB 1ND0A 5IHZA 3I6GB 1AO7B 3OR7A 3P4MB 4HWZB 4I18A 1I3RA 1XF3A 4D3CH 3VGBA 4S1DD 4KV5F 4JPIB 1W72H 4FRWA 5D1XD 1QSED 3QH3B 2R0ZH 2IAMD 4ZS6C 2QQNL 1K8IB 5HHOD 4X4MA 4AM0A 4IMKC 2ZUSA 4LKCB 2AS5M 1DLHA 2MTPA 5FDYA 5E24E 2YN3A 2R69L 1KELL 2DQIH 3FL7A 3FQXA 4XP4L 1XF2B 2R1WA 2F15A 4NKMA 5HDBE 1EAJA 2PXYA 4L4JA 1BAFH 1JGVH 1ZGLP 4LRNL 5HYJE 5JHDA 4DUXA 3KXFB 5DZOA 1MCJA 2QSVA 3BP4B 3EO9L 1U36A 4Y4KB 3AM8C 1C08B 2WP3O 1BBJA 3IFNH 5J3HD 2VDML 1DBAH 4PY7A 1CFSB 5I66B 3RDTD 4MA8L 1NSNH 5F1NA 2XA8L 5I8EA 4GKNB 3DMMB 1CICA 3T3PE 1G9NL 1RHFA 3QCUL 4P4KA 5DTFB 4KC3B 5GS1A 4OCWH 2EEBA 1LMKA 4KQ3L 4XRCB 2AGJL 1GGCL 4FXKB 4NQVB 3U0PB 5IEKA 1MFBH 5CSZA 4Q7DA 1CCZA 4D0BB 4R4FH 3O6FA 3C08H 2EXYD 4PJAA 3T4YA 4D0DA 1M4KA 5B22A 4DUVA 1SJEB 3DRQB 1VFBA 3LKQA 3QIBA 4FQIL 5HVWA 1WEJH 1INQA 1X5ZA 2DJUA 3FHQA 2J6EL 4RAHA 3ZDZF 3IETA 2EC8A 3WN5C 1H5BA 1F6AB 1UWXH 2FGWH 2DKUA 2HMID 3VDCA 5TE4H 4HUKB 5IMKB 1IILE 12E8L 5F1IA 4GJTB 4R6UA 3TCLA 4BZ2L 2CR3A 4Y8AA 3WO3B 2IWGA 3IDMB 3HUJE 1JF5A 5HHXH 1YYML 1J7VR 2D7TH 1JMZA 2EE6A 1NFDB 5TGBB 2EIZA 1XGPA 3MXVH 3UC0L 5F21B 4YHIB 1K5NA 1GOGA 3RZCB 3DSNA 2HT2D 4WFFE 1N59A 4P46A 3JWNC 5EBGA 5BW7A 3GI9L 2Q3ZA 3MFFA 2O5ZH 2A6JA 3RVUD 5JOFB 5L88H 4Y5XC 4DN4L 4NZTH 2FNBA 1FVDA 5CMAB 1JGLL 5ACMA 3VJ6B 4ZG1A 1U8HB 1WTGT 2HKHL 4XVJH 3IFPA 2GCYA 1JV5A 5H2BB 4Z7UE 5MERA 4KMTH 1OP3H 1W8NA 4PRHE 4K71C 3VFGL 5I73C 1IQDA 4DGVH 4H8WL 5L2KA 4H25B 1DSFH 3PWPE 4NQUA 4A6YL 1XGTA 3MV7B 4X98B 2YKLH 3Q3GA 5TE6H 3SKOA 4XCCH 1WVZA 3RY6C 5IMMA 5C0JA 3HR5A 3OKDA 1MLBB 4I4WB 4F2MA 4C4KO 3F65A 5C08A 5HYJD 5C0FB 3QJHB 5AEAA 4QRSA 3D25A 2F8OA 3PGFL 4BFIA 2JK5B 2UZYB 4FQHA 1S5IL 2VIRB 1S7VB 3VWKC 4LVOC 1Z3GH 4BH7B 3IAGC 2DRUA 2ADJA 4Z95H 4K3EH 5LJYH 4QHMA 4U1GC 3I50H 4YFLI 5CJQL 4M61B 3WNPA 2R0KH 4Q0XH 5I18L 1NGYA 1AXIB 2OJZH 5B3JE 3MRCB 3X12A 4GG8A 1A6WH 3RX8A 1HYRC 5FGSA 3MLPA 5GGRA 4LOUC 3FB8A 4O2CB 4YDVB 5FUOL 1HHKA 4OBSA 1KACB 5I76B 4I0PC 4Y1AB 1HXMA 5H8DA 5B3JF 1C8PA 4C83B 4M5YL 3KYOA 4RX4A 4QRPE 3IAQA 5JO5A 3MJ6A 3TYFA 2XQYG 2FEDC 2Y4SA 4Y16D 4JHBA 4CMMB 1N6QH 4H0IA 3LSOA 1BIIB 4DKEH 4APQA 3CX5K 2EDHA 5GGUB 3RA7L 5KVEL 2IH1B 3NIDE 1CGXA 3A0OA 3VI3E 4LHUG 2PCPB 5FCUL 2HLAB 2YEZB 3REWA 3VFOB 3SO5A 5F7FA 2GJ6D 5TQ2L 3BD5A 3GEWB 3MACH 4GG6E 4P9ML 2ADIB 5LGJA 2QLVB 4RDQF 5EBWA 3OF6A 4OCXL 4PG9B 3LQMA 2EXWD 2ZSWB 2ESVE 1IEBB 2FJFA 1ZTXH 4Z18A 4HJ0C 4OSUL 4N8VB 2M2DA 3EOBA 1QQDA 2F54D 3CSGA 4QXWA 5ANMB 1F3JA 3NIGE 2D4FA 3SDDC 3DO3A 2X42A 1PFCA 1P2CB 1SVZA 2HFFB 2ZSVB 2IPUG 4H0GA 4NNPH 5T3ZL 4Z7NF 5F9WC 1HKLL 2BMKB 2P7TA 4M62L 4BKLB 4PJBE 3BD3A 4HAGA 3VXRA 2YA1A 3L1OL 3L6FB 1OTTD 3KPNA 2HJKB 2VDKL 4JVWA 2VDNL 4HPYH 4ZPTA 1IM9B 2F53B 1YY8B 2E27H 1KJ2A 2JELL 1RULL 4PJ7A 1B0RA 3MO1A 3QUYB 2WV3A 1M7DB 1AQKL 5F7DA 3K4DA 4Z6AT 1KJ2L 4IRJA 3PGCB 1QLFA 1EEYB 4NSKA 4PRHD 5KVMC 3QFJB 1XFPA 3SDYH 4X7TB 5DK2B 4LSQH 5HHQA 1R3KB 2V2WA 3THMH 1MCPL 3PWPD 3IJYB 3UTTE 1LP9B 4R0LB 1T20A 4AEHH 2BOCA 3DUUA 5BMFH 2GYSA 4WIQA 2XWJB 3WSQH 4Q9QH 1U3YA 1RVFH 5E9DB 5FHAL 4YUEL 1NEZB 4I9WE 5EOCL 3NCJL 3C5ZC 4HUUB 3U4EA 4JR9L 1MIMH 4H1LB 3FCTB 5I1LB 3UDWC 4QRRE 2LFGA 1X5XA 3MRBB 4ZQKA 5FO9A 4LLMA 5DHYA 3O3UN 4ZFOL 4H26A 5GISH 2R0WH 4XCEA 3BKYL 43CAB 1QLEL 1WBZA 2DAVA 4I3SL 4MA7H 3TBWB 1SJVA 3T2PA 4UV4L 2X4UA 2VDQL 3BQUD 1VKXB 4OCSL 2DQTH 2UUDH 1KB9K 1QBBA 3W11D 2YRZA 2H2SD 3QIUD 4QOKE 4U3HA 3VMPA 1EAPA 5BO1L 5EZJA 5I1KL 5J11C 1K6QH 3VXME 3BI9X 3ZDXF 3VXUA 5J06A 1TJHL 3MV9E 2FX9L 4I5BA 2GITB 1JNHB 2IQ9L 1U93B 3JZ7A 4KK6C 1N0LA 5D6CB 4QRPD 4D0CB 4Z7WA 4X6DA 5T3XE 3MSPA 4HQQH 2Z35A 2VAAB 1IFHH 1LNUB 5E5MB 3NAAL 3SDCB 4GAFB 3MLSL 4PGCA 3KYNA 3LEXA 4PJDE 3CX2A 3JVGC 3RRQA 3BPCA 3HMWL 2IGFH 3IDJB 5F6HI 1AKJD 4J12A 1T5XB 1LK3L 3GM8A 2APXA 4LPWA 1FL5A 5EU6E 1JHTA 1FVCB 3LHPL 1QEWA 3WN5A 1ED3A 4R2GD 3OKMB 3WFDH 2NZ9C 4PJFF 2YBRB 2AJYH 3CFJB 4M6NL 3WNMA 3QHTC 5HGDA 4GS7C 2ESVD 3QG6A 3RY5A 1FO0H 3CFCL 5EG6C 4PGBB 4UDTA 1H3VA 3RPKA 3V4UL 1A6UL 5FYJL 4PLJD 4OF0A 4ZD3H 2JKXA 1NGWB 1XF4A 2VUOA 3P0VL 3RIFK 5J1AB 4NQCA 5SV4A 3X3FH 2VLKB 3WKML 3K4ZA 4YXHL 2GK2A 1T1ZA 2MCG1 2AEQH 1YECH 3NPSB 1HEZB 1CFQA 5IESH 4JRXE 2BSSA 1BFVL 4PREA 5AUMA 2DKSA 5TF0A 4LSUH 4LRIA 4XT1C 1UM4H 4LKXA 4XP5L 4JO1H 4Y5XA 2UWEE 3QIWC 3AAZB 3B9VA 2CPCA 3PG2A 4K8RH 4K9EC 4FQXC 4KHTL 2GSGA 1SY6A 3SE4C 3PV6A 3UTTD 5I74B 4OZGA 2D03H 1SY6L 3MUZ1 2LVCA 3O2VH 4ETQB 2HT4C 1HHIA 1FDLH 1MCNA 4I9WD 5CINH 5GRJH 1U92A 1S7SB 1UM5L 2JB5L 3VD4A 3RY6A 5BVJB 1Q0XH 2IPTL 4DUWA 2EDWA 1Q72H 1IRAY 4ZOEA 5EUOE 1FBIH 1FGVH 3VWJD 3OWEA 5LG1A 4BYHA 5J56B 5SWQB 4G6KH 4U6HA 4D3CL 1KPVB 4AT6A 1J8KA 1NMCB 1WZKA 3BP7A 5J8OA 3VWKA 1UB5B 4OLWH 4HXAL 3R06B 4XGZB 3T0AA 4QOKD 2HVJA 1GGIH 1QRKA 4X4YB 3DVIA 4UBDC 1CR9H 3VXMD 5EIIB 1VB9A 4MNGA 2YD1A 5HJ3A 3MV9D 2FR4A 5MP6L 2FYYA 2YXFA 5FCSH 3R1GH 1KC5L 2QTEA 3PUCA 3VFVB 3UXFA 3RIAF 1WQVT 3V6BR 3IRZA 1RUAL 4O2FA 4WGWB 4XP9L 3OQ3B 2BZDA 4JM4L 1MY7A 1ZOXA 1QFOA 3IFNL