2D7NA

Solution structure of the 16th filamin domain from human filamin c
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
93
structure length
93
Chain Sequence
GSSGSSGLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-C
publication title Solution structure of the 16th Filamin domain from human Filamin C
rcsb
source organism Homo sapiens
total genus 6
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d7nA01
4ZO7A 3FMGL 4WUUE 5GRZA 3O3EA 3IDIB 4WU7A 3ZYOA 3GMQA 4WCYH 4ZUUA 1QR1A 2XWJB 1RZKL 3FQTA 5FB8B 4PJFE 1YEKL 1T1ZB 4GLRI 4YHZL 1UA6H 3BN3B 2XXMB 1KNOA 2AW2A 3FHQA 4RISL 1A64A 2WBWB 2IBGA 3UTOA 4FQQB 3G04A 3EOBB 1AP2B 1RK1B 5ALBL 4LCIH 1A21A 1W0VA 5EUOA 3FO9A 2VXQH 2XACC 3KPOB 3LIZL 3QWOB 4LFHG 3P0GB 3FQUB 3LPFA 4O02L 1J1XL 1BF2A 3VXPB 4NKDB 4MS8C 4QRSB 2RR3A 3CFIC 1OF2A 4X6BB 2YEZB 4DZBA 1MRFL 4KK5C 4IMLB 3P11L 1P7QB 4K8RC 2YRZA 3NCFB 3AAZA 3U82B 3VXSB 3FB6B 1CXFA 1UM4H 2F53B 5KAQF 3CFKB 3HN3A 2R2EB 3AY4A 2JKXA 3ZTNH 3BIBX 3PWPA 1X44A 1OOAA 1S7XB 4R4BB 1IEBA 1SEBB 4WY7L 3LEXA 1RVFH 2BJML 4C56B 5FGCB 4U31A 4Z77B 4LLYB 3GMNA 1Q0XL 2OLDA 4OGZA 1HIMH 5AAWA 3CCHB 4N0RA 2NY3C 5KG9B 5I1JL 3ARGB 3KPLB 4W4OA 5D7IA 2BZDA 4JY5L 25C8H 2HJKB 4P23D 3SE4A 2OCFD 1FZKA 3U0WL 4NZRH 1T66C 1JHLH 3ULSA 1G0XA 5IJVB 4K55A 3L95B 3S4SB 4ETYA 3PG2A 1KPVA 4PJAA 5BS0A 1S7WB 1INQA 2JF1A 3LN5B 2H41A 3T8XA 3G9AB 2ZSWB 1FCCA 3BAEL 4Y1AA 3W11C 1JTPA 3EJZC 3KJ6H 3C5JB 2V9QA 5IBTH 3U7YH 2HJFB 4KJYA 4LSUH 3DBXA 3TCLB 2EC9U 1W2KT 3HS0B 5HTSA 5EWIL 1HHKA 1FG9C 4HBCL 3DX9B 4NZUH 3UO1L 1FZMB 5LCVH 5F7DB 4RMTA 3S96B 3D69A 3C2AH 2E9WA 2OTPA 1ONQA 1F3RB 3D2UB 5D7LD 2CDFB 3SKJH 5I76A 4MJ5A 2HT2C 3MV8D 2MWCA 4WI8A 4LSSH 3AC0A 4GLRH 1KN4H 2VLRB 1WT5C 3QPQD 4E5XA 1I8IA 4D8PA 4NN5B 3MLVL 2PXYB 1TQCB 2DQFA 5FF6A 2P43B 2X4RB 4FG6C 4UV4H 1YN6A 3RWIA 1PLGH 1PG7L 5ISZA 5K9JL 5LGJB 3FTGA 3VFNA 1MCPH 1HH6B 5SWSB 5L9DL 3A6OA 4OM1L 4PJBF 5IW1B 5CBEB 4MD5A 1SBSL 2CR3A 3QG6B 2BP3A 2BMKA 1U8MB 2E9BA 2MPAH 4LSVH 2R1WA 1D5ZB 4I1NB 3VW3H 1Q0YL 5JOPE 3V7AE 3QIWC 5D7JD 2VC2L 1BQLL 1PZ5B 4KXZI 5DJYB 2VMFA 1C5CL 4Y19E 3ARBB 5IVXB 5JDSB 5KVDL 4UQ2B 1HKLH 4K7FB 3ZYIA 2Y06H 3U9UA 4JFZH 5D71L 3NIFF 1Z3GL 4MGXA 1S8DA 3CLFL 4LLVB 2ED8A 2ICWB 2R29H 4L8DA 4L4VD 3VH8B 4AQ1B 3EYFB 2IAMC 5KVFH 3PL6C 4IHOB 2VWEC 4WI5A 1RZ7L 1OB1B 3T2OA 3IU3A 2OX5A 4Z5RB 5K9KB 2L7JA 3BISA 3SDYH 3ECBA 3T0EC 3FRUB 1U3YA 3QBTB 5A43C 3RZCD 4X4XA 3B2UD 3MUY1 3QFJA 4XVSH 2JCCE 4XNYL 3MOAL 1WK0A 4L29A 3GMRB 5C71A 2HN7A 3BIKB 4U1KB 3QRFM 2ZUXA 1NANH 3W81A 4Y5YC 3QJHA 3QDJA 4WFEE 3QDHA 4WWKA 5CJ8A 5L0QB 2J7LA 4G8GA 2EDOA 2IQ9H 4WU5B 5ETUB 3C60C 4ODTH 3VXOB 4FFWC 3U0PB 1KCUL 2RCSH 3P77B 3VD3A 2R2CA 5JPMA 5J1TC 1YPZE 1KCSL 4L4TB 1BZ7B 1AKJB 3EAKA 3H3PH 1NGQL 3PHQA 5I1HH 2Y6SD 5BJTB 3HMXH 3JV0A 3VFPB 3MV9E 1NCBL 2E8ZA 5F8QC 4UNUA 2X5PA 4OD1H 1OT2A 5GHWL 1HCVA 4GKNA 4JZOA 1V3LA 5T1MB 1R24B 4PRIA 4RGNB 3LKOB 2GIYA 3QG7L 4GXUM 4Z95H 1XF2A 4AENB 4UMGA 2HG5B 1FSKB 3MOBL 5IB1A 3WHE1 1OARL 3N85H 4LLWB 5D2LE 5DK0B 1KJ2H 2HRLA 4Q0XH 4CVXA 2R0KH 1BJ1J 4N8PA 3W2DL 4KU1A 3D48R 2ZCHH 4LEOB 2D4DA 4XPGH 3BKCH 4RAHA 1QG3A 3BDYH 2VDPH 3G6AB 3CXDH 4JPVH 5J3HC 1PGRB 1U8HA 4UU9A 3TZVD 3EUUA 4YHPB 1FDLH 2A77H 1I7UA 2Y23A 4JREC 4JCLA 4YWGL 4KZDH 1VHPA 2HKFH 4JR9H 3Q0HA 3TT3L 2EIZA 5MEPA 5IBLD 1GSMA 4Z78B 3ZHDA 3O4LD 3ULUF 1A3RL 3TN0C 1U8OA 3GUTA 1LP9A 4LL9A 4S1RH 1PX4A 1M05B 1JK8B 3MRJA 3SDXE 1XR8A 3D85B 5GGSY 3C08L 2YXMA 4UT9L 4Y4FA 3DI2B 4TNWF 1KLUB 4QO1A 4P9MH 4NQSB 1HEZA 1WGOA 2FGWH 5GZNC 3SDAD 2HJLB 4AM0A 3PV6B 4MD0B 1NLDL 3G6DH 1IEHA 3EIFA 3NZHL 3BZEB 3WSQH 3V4VL 3ISWA 5JW5A 5C0RL 3A6CL 1BGXL 5K59E 1BP3B 4L8SB 1RJCA 4ERSH 1IKFH 4KKBC 3ROOA 5ID1B 5BV7L 4X8JB 3G08A 1U42A 3IKCA 1KC5H 2NNAA 4M61A 5FYLH 3B2VH 1HHIA 4MXVE 2A6JB 2E7LC 3WXVH 2A9ML 3MV7E 2IQAB 4M93C 1JGEA 1A6ZB 3I6KA 5F7YC 4GRLC 4RWYH 4XNMA 5E6IA 2D7MA 1AGDA 3GM8A 1WZ1L 4C4KO 2ESVB 1LE5B 5JO5A 5HGHA 1HQ4B 1NAMA 1I1AA 5F1KC 4P2QA 5DJ2A 2MKLC 3QCVH 4Z76A 2BY2A 2X41A 4YHMH 4LARH 2FECL 3OF6D 1U95B 3V6OC 3S37H 2EIDA 1I9RL 5J1SC 4N8CL 2IPKA 3QIUD 1LO3H 4JQXC 1L6ZA 3ZKNC 4P2RE 3PNWB 4G5ZL 2X42A 5IW6A 1KEML 3W9DA 1VADA 4JAMB 3QNZB 1UKQA 5C0GB 5C7XH 3WUWA 3PQYA 4OLXH 3X11B 3RNQB 43CAB 4FQXD 4P23B 4OGXH 1ZSDB 1S9WA 5DJZA 5JW4N 1E27B 1S9VA 3MRGA 1A14H 1T1YA 4YE4H 5C6WH 3R06A 2GJZA 2W0PA 5JOFA 4FFYL 5LGHH 4JDVB 1DQLL 1U6AH 4OGYH 3TC9A 3EKCA 4I18B 1H3TA 3LDBB 4LPCA 5J6HB 3VMOA 3OKDB 1PAMA 4RIRB 2AJUH 2P8PB 2W65B 3PGDB 4MA1C 1KENH 3SE8H 2AXGB 3D39E 4TUKH 4RDQG 5ABDE 1R3HA 5DFVC 3U0TB 3OSKA 3NACH 4QHUA 4TULH 3P73B 3U9PL 3DOSA 5D7LB 4LLUB 4GS7C 1A9EA 4UDTA 3MJ6A 1IZKA 1EAPA 2FATL 4NDMB 1NFKA 1GZQA 4DK6A 5J12B 5DYOB 1A6TB 1RJLA 2DWEB 5FECA 1KIRA 4WNQB 2EDHA 5DGRA 1I7RA 1UENA 4JQIH 3VA6A 3ESUF 1MCHA 1BX2B 4F15B 1KTDB 4QRUB 4NOFA 5KS9F 1GGIL 3VMPA 3S98A 3BW9B 4X7FC 3VJ6A 2VWEE 3FO2A 3HZYB 1JV5A 3ILQD 5IQ9B 2BC4A 1VFAA 3L3GA 3VDBA 1NEZG 5AUMB 4X98B 5ICXA 3T0EE 3EO1B 4UNTA 5D7JB 3RHWF 1C16B 3MCKA 3X3FL 5CEZE 5ERWA 1G7HB 1P4BL 4TNVK 1FVCA 4PRHE 1M7IA 3K4DA 4I0PD 1GHFH 4LGRB 2CXGA 1LO4L 3S88H 3MRLB 4TQEL 4M7KL 1T5WA 1N3NA 3J8F7 1QTYT 1VDGA 3L7EB 4TVPL 1VENA 2RQ8A 3BXNA 1JHKH 4XP5H 1XR9A 3ILPB 2E9IA 2HVJB 3VXTB 5DDHB 4KKCC 3MV9A 2VLKB 5F70A 1T6WA 4L4VB 1X5LA 3O2WH 1FAKT 4XVUC 4QHKI 1CFNA 3S8WA 3QUZC 1K8IA 5I9QC 1XGPB 1J86A 3O6MH 2FL5A 2A1WH 1S7SA 2NW2B 4XPAL 3K8KA 1T1XB 1XMWA 3HI6L 4I9WE 2LAAA 3RZCB 3T04D 4GRWE 5D5MB 3T09A 3O2DL 5CCKL 1SJHA 5DMYA 3SGEI 2EYRB 1BFVL 3SKNA 4FABL 3FT4B 4NHUB 3RKPA 5HI4C 3A6BL 4QCIB 4QLRA 3T77A 1U8IB 5C0AA 3O41A 1FC2D 3UYRH 2BSRA 2Y5TB 3S36X 4FNLL 1FPTH 5EO9A 4PS4L 3RVUD 3FKUS 4L1HA 1JWMA 4DEPB 2NXZC 4APQB 1EHLH 3SJVA 2V17H 1IC7H 1VGKB 4B5EA 3RVXD 4JGUA 3RL1A 5F1IA 4PJCF 5IG7A 1QR4A 3GMOA 3BDBA 3KHOA 2WLZA 5H37G 1IAIM 4M6ML 3TT1H 4QXGL 2R23A 1CGYA 2K1MA 1IGFL 3ARED 3BVNA 1P1ZA 1YEEH 3GB7B 3MRIB 1HHGB 4XMLL 1CGXA 4UZGA 4NQXA 3GFUA 4Z7UF 2EDTA 1DQTA 2AV7B 5DFWH 1CT8B 4R7DB 3LKPA 1ERNA 4G6AD 4MNHB 4RMVA 4WFHD 5DRXA 3QXAA 1UACL 1IGYB 1WAAE 1EH9A 4OD3H 2CRMA 4KI5F 2DLEA 4LSQH 3V6BR 3H0TB 4JN1H 5ITFA 5ILTH 5DMIH 4UOJA 1OSPH 4M1DL 4MHHG 4HKZB 2YD6A 3O3UN 1YEDA 4NYLB 4Z7VA 5FYLD 3MV7A 5HDLA 4YQXH 1CL7I 4R2GD 2CUIA 1KF9B 1JHTA 3O4LB 1BD2E 4K3EL 5F9WB 2PW2A 3UTZB 1CXIA 4QRRA 5IW3A 2R0WL 2B0SH 3P9MA 1JL8A 4QY8A 4PRDA 5DWUL 4K3GA 2K3TA 5I1GH 3FQXA 4A6YL 1GJIA 4PPTA 3WHE0 1O0VA 2OJZL 1SY6L 1DBMH 1J10A 4I5BA 4QHLA 4ZQKB 3SDAB 3A67L 1OAUH 1SEQH 4R97B 2ZUUA 3UCRA 3SE9L 4JB9H 1T03H 3O6KL 5DD1L 2R8SH 3V6OE 4HJGB 2JJTC 1NDMA 3BPNB 2FX8H 3FFDB 1YJDH 2YRLA 5HBBA 1RFDL 5D7SL 2PYEA 3IF1A 1BBDH 3GO1L 3ETBF 4PJ8C 1Y18B 4JFDD 3PDGA 3SGEH 1CGWA 3TO2A 1WT5A 1MHCA 5HPMB 4L1DA 5AWNL 4NO3A 4K2UL 3P4NB 2VDML 1K4DA 1Y6MR 3SPVB 5BOPA 3D3VE 4QYOB 3LS4L 1CGSL 4OLVH 4HUNB 1QEWA 1QO3A 3QP3A 3GSQA 3ZKXC 5DK3A 3SBWC 3C6SA 3WFEL 1E28A 3C5ZA 3GIVA 4MVBD 5BVPL 1SYSA 1J8HA 1WIUA 2I26N 2C5DC 4LRNH 4OTXL 3L3JA 3UYPA 3ARFC 1K3IA 5FV2A 3QIUB 3EO9L 2IBZY 1RAMA 2WSKA 4KDWA 1KIPB 4PYGA 3QIWA 4YXLL 4N90D 1QLFB 5TDOB 2B5IB 5EG6C 1X6LA 2N4IA 4OQTH 4Q2ZA 4FQXB 1CFTA 1JJUA 4UIKL 2Z91A 2X4SB 3EOYG 2Y36H 3LPWA 3REVA 3VWJD 5KJRH 5J57B 3MO1A 3V0WH 4F2MA 5D7KE 1UJ3B 3ARQA 3IS1X 4FXLA 4MD4B 3O8XD 3H42L 1AJ7H 3MGTB 1CU4H 2HVKA 1HXYA 3P0YH 4X5LA 1WIOA 3TNMA 2R15A 3U36A 2FB4H 3CPLB 1OP9A 5C09D 1NEUA 4NKMA 4Y5VC 4JM4L 1FGNH 4NQDE 3U4EA 4J3OC 1IAIH 4JFHD 5F72S 3WLWD 1K3ZA 3D1MC 3PP4L 3HE7D 3SO3B 2F9BT 3HZMB 3VDCA 3EOTL 1H5BB 4S10A 4V2CB 2YD3A 4YNYB 3AS0A 3LQZA 1CZ8L 1N2RA 4O51B 4GSDH 5JTWA 4HEPG 1FV1A 4OCWL 4DCQA 1KEGL 1WWBX 5CWSA 1K85A 2EDXA 1CK0H 1HE7A 2X4OB 3WO4C 2X1OA 1F58H 4WRLA 2KDGA 1A9BA 4FQCL 4Y0GA 43C9A 3C60A 3QZWB 1I9JH 3E2HB 2C1PB 3P30H 4P9HL 2AEIT 2RJMA 2PO6D 5JXAL 2AXHA 3FN9A 1FVEA 2GK2A 1U58A 2VZSA 1B4JL 2VXSL 2CSPA 5C07E 5DD3H 1J1OL 4PJBA 5HI3D 4AT6B 4F9PA 2ITDB 2GY7B 4LRIC 3PGCB 1T6VN 1DQQA 4FFZL 1NGWA 4JVWA 3IKKA 4DGVL 4ZXBB 5E2UH 3VGDA 4MCYB 4TSBH 3SCMD 1HZHH 1D6EA 1JCKA 4WFFE 4PUBH 3RAJH 4PG9A 5DHYB 5FHBL 1SBBA 3CFCL 4XAKE 5D96C 3HC4L 4LGPB 4YDIH 5GJSH 5E8NB 3DRTB 4RFEA 5FCSH 4BH7B 1T22A 3QUXD 3IGAA 3OAUL 3SE3A 2ZCLL 4G43B 2HFEB 5SX5H 1YDPB 4Z0XB 1BM3L 5GRJL 1Q9WA 4HHAA 1QLEL 3UMTA 3GMLB 5DHVA 2IH1A 1RUAL 1A1NA 1P9MC 4I48A 3X14A 1B2WL 1I85C 1KIUA 4GAYA 3V5HB 4EI6A 2AXFB 4KY1H 5DJ8B 3TPKA 4X7SH 4WHYG 4YZFE 1ZHNB 1RZFL 4HIJB 1QRNE 3MBEA 2O5YH 4Y7MA 3SOBH 3VXME 1PG7X 5E8OB 1DQJA 3VG0L 4U1GC 4MMZC 1KPUA 2OTUB 3E8UL 4P5TA 1JNHA 4XNZC 5EU6D 2QQKL 4E41B 2XRAL 2XZQH 1CDJA 3LZFH 1YNLH 2IPUG 5C9KA 4FQJL 3RWCB 4XX1G 2VZTA 5IFAL 4NRXB 5HYQA 3JWOC 4DKFL 1IE5A 2VDQH 3QUKB 1AC6A 5DSCB 1KGCE 4MQXD 5EZLA 1L9NA 2ICCA 5D8JL 2IGFL 3LQAL 3AREB 3I9GL 3IJYA 5I8OL 2NY6C 1RY7B 4AEHH 3RVVD 3ET9F 1QACA 4GKZB 3AXLA 1A5FL 3VFRB 5BO1L 5DVLA 3PGFL 1BFOB 4R7NA 4BK5A 4ISVA 3SDCA 4W81A 3MV11 4HUWB 4YDJB 5F1OB 2G75A 3CVHH 3EDDA 5GS1C 4FTVA 4GBXC 3PWLB 3QNYB 1EFQA 3V52H 5GIRB 3BQUD 4TYUA 4Y4HA 3ULVL 3LD8B 3A0OA 5F93C 4NJAH 1N6UA 5H94A 2EKSB 1JUFB 5DRNB 5J13C 1RPQA 3FOLB 3NIDE 4HWBH 3MV01 1YEFL 2IALA 2A9NH 1IM3A 4RZCB 3ARPA 2A73B 4X5XB 4GOSA 4LVOB 5KSBF 4WFGE 1G6RH 1WITA 5ACZB 5LQBH 1ED3A 1J5OL 3IFOB 1MVUB 5E1HB 5C0CB 4OLYH 4OCRL 4OFVA 3ARDD 4K9EC 1HHJB 2G9HB 3R8QA 1YMMA 1XH3A 4QHNB 2XNAA 3BH8B 2WWKT 1MQ8A 4CADA 4LOUD 5CSBA 4YHZH 3F7YA 4LDOB 4RISH 3D5OF 4NQUA 4IDLA 1W0WB 5ALBH 3MRRA 2IANB 2NYYD 4X5WA 3OB8A 4RAUB 1KB5A 4ONOA 3LIZH 2P45B 1WLHA 4O02H 1J1XH 2YA2A 2VH5L 3IU4H 1OAKL 3KAAA 2BDNL 4XRCB 2X1QA 4Q6IB 4YHNB 5B39G 1MRFH 2B1AL 4HS3A 2KKQA 4XC3L 1AHWC 3ROLB 1H15B 4H5SB 1YPZF 3OKKB 5IB4A 1T7WA 2P8MB 3MRCA 4F57L 4BQ9A 3BD3A 4F7MB 1D7FA 3P9LA 3UJTL 1ZVHA 4NUJB 4OM0L 2D3VA 2WUBH 5JW4R 5T1DH 4JFEE 1OVZA 3Q5TA 2OZ4A 15C8L 1JN6A 5C0IB 1T1WA 4D0DA 1NMAH 5D2LF 4NWTL 1DUZA 1T83C 4N9GB 4CW1B 3UBXA 3VWJB 4D0BA 1Q0XH 4NRYA 4G9FB 4P4RB 3UTTE 5EBLB 2YN5A 2BOCB 1JGVL 5I1JH 3GSXA 5C3TA 3O8XB 2OQJB 3VFOB 4U3HA 5BW7A 4XNUL 3EYOA 1AD0A 3RKDD 4KVCL 5F9DC 5C09B 3L5IA 4WV1B 4ONFH 5FCUH 3LB6C 4JKKA 5CGYD 3GMMA 4Y16D 3TBTB 1WBYB 5FYKH 1XGRA 1VGEH 3H2WA 1DBKH 3HE7B 4LFHD 5AZ2L 3GM0A 1NGPL 5ISZD 3UTSE 3BAEH 2J4WL 3X13B 2DYPA 3QULA 2PF6A 1ETZB 5J56B 4NFBA 4X8XA 2JJVA 1EEYA 3NPSB 4K3JL 2BNUA 1L6XA 1CXEA 4ZS6C 3QHFL 2CIKA 4K07A 3W39B 3H9YA 3BMVA 3CUPA 3KLHD 2ZG1A 4EN3C 5DJAA 3WDJA 4LCYB 4EEEA 4V1DD 3PIQB 4HUVB 3ES6A 2VZ1A 3VXNB 3RNKA 1OM3L 4NPYB 1UM6H 5D72L 4JFPA 4TNVF 2PO6B 5K59F 4NQCE 1I7TA 1HQRA 5C08D 2DJ4A 4O00A 2OBGA 4RSVA 1A1MA 4RMSA 4KTEL 5E70A 2R1YA 4MXVF 2YUZA 3MLVH 4IDJH 3VWKD 2GEEA 1YNKH 1J1PL 3B6SA 2C1OB 5JMOC 4HIHA 3AM8C 2F54B 5K9JH 1V7ML 1MFCL 2HH0L 4Y4KD 1J11A 4HGWB 2MJWA 2Q3ZA 2G5BA 1ACYL 3BFOA 4OM1H 2ZG3A 3SCMB 3E3QE 5A3ID 3RWJA 1K6QL 1HHHA 2P7TA 1RK0A 3VG9B 1KLGA 2W0FA 1Q94A 3E6FA 1K2DB 4M8VA 3OJDA 4D9LL 1IQDB 2VC2H 5HYJB 1DE4B 3BE1L 1KJVB 1WBXB 3U46B 3K81A 4KJWC 1C5CH 4WWKD 5CP3H 4CL7A 2Z31A 1OAXL 3ARYA 4YHLL 2P24B 5HY9A 4ZPVA 3HUJE 4JM2C 3PHOA 1Z3GH 2EDKA 4P3WA 4RA3A 4ODBD 1HILB 2IADB 3CLFH 3WS3A 1XF5B 3T1WA 4ZSOE 3LRGA 3OKNB 4PGCB 1MNUL 1NH6A 5EZIL 3MROA 1N6QH 4BK4A 1RZ7H 2LU7A 3PWNB 4JG0L 3TGXA 4CDHA 5BXFA 3B3IA 5JIPA 2XTJB 4EVNA 1QSFA 3K0WA 3CFDA 4HZAA 2NR6D 1QFWI 5EU6B 2CKBL 4LMQI 4XNYH 3O6LH 1NAML 3ARVA 4D3CH 4E0RA 3WIIL 5C0NC 2KH2B 3C5SA 4ZD3L 5EO0B 3CZFA 5I73C 4MJ6B 4QHKJ 3OAZH 1XFPA 1F97A 4MNQD 5CLWA 3GGWB 4Z7WB 1OWWA 3SDDD 1KCUH 3STLB 5E08L 2Q76B 2FECI 3QDGE 1KCSH 3RGVD 3MA7A 5EIIA 1A6VL 4KGJA 5F6IB 3O3EB 3TFKD 1NGQH 1MUJB 3GRWA 1QZ1A 2CMRL 4Z7UA 5C2UB 2ADIB 4ZUUB 2C26A 1QR1B 5GHWH 3RU8H 3RY4A 1N59B 4LCWA 4MAYA 5C2BL 2UY6A 3SBWA 3I2CL 3QG7H 1YN7A 2P5ED 3MOBH 5IEKA 3VRIA 1KNOB 1OARH 1MREL 1HNFA 4Y4FD 3G04B 5IFHH 1IL1A 2W9DL 4ODHL 4PJ7F 5JORA 3R0MA 3FO9B 3M8OL 2BSTA 5D1QD 4AEFA 2H9GA 3MLRL 1IJ9A 1QKZH 4MHHI 1QA9A 5A2JH 3U2SB 2ZUQB 1OF2B 4NN5C 4J4PC 2PXYC 5JDJA 1TQCC 3IDJB 4DZBB 4TSCL 5GS0D 1UT9A 4YWGH 3LY6A 3EJYD 5DO2C 1BLNA 5TE7L 3WL9A 4PY7B 1NC4A 1T2XA 1NFDE 1TIUA 1A3RH 4I3RL 1NJ9A 2D4FA 4JDZB 4KRMB 4ZAKA 3ZE1E 1RZJL 2AEPL 5IIEB 1QPPA 4Z18A 5DLMH 1ORSA 3UPRA 2YN3A 1WICA 4P2QD 3C08H 3HRZA 4UT9H 2VLJE 1MJUL 1YEHL 3LEXB 3MJ7A 4JKLA 2P5WD 3ARBC 4N0CD 1F4WL 4R90L 3WEXB 1PDKA 3GMNB 1EBAA 1EHNA 3NZHH 4OZGF 3V4VH 3M17A 5C0RH 3A6CH 1A7NL 1M7DB 5LXGL 2KQMA 1K5NA 3PQYD 1HK6A 4H26B 2FEDD 3HC3H 3SHSA 3TBYA 2V9RA 1FZKB 2A9MH 5JW4Q 3MUHL 4XP6L 1UZ8A 5FYKD 2J6EA 1PX3A 1KPVB 4NC2B 3ZE2E 4PJAB 2DM7A 3B9AA 5BS0B 2IFFL 3D0LA 5DVNA 1MI5E 1AIFB 4PREA 3T8XB 1WZ1H 3V4UL 1IEAA 1U41A 5TQ2H 2DQEL 3NOIA 1A2YB 1OWRM 4KK8D 3OR6A 4OCSH 4PRPA 5L0QC 3Q1SL 1IM9A 3VFGL 2AEWA 5H37H 4EUPA 3HAEA 1I9RH 1FYTA 2BX5A 4N8CH 1I8KB 3F6LA 3KYNB 5CZXD 5FGRA 3D69B 1YYLH 1U8KA 4XPBL 1ONQB 3JWDL 4G5ZH 4BSWA 1KEMH 1WAAF 1A7PL 5I76B 2H45A 5EA0L 3W5NA 3NA9L 3L3HA 3W82A 1QSEA 3Q6GL 4G6ML 5JHDE 1T4KB 1A3LL 4YO0A 1I8IB 4Y16B 4RGNC 3ZMRA 1NUFA 4WO4C 5DD6A 4C55A 1YEIL 4F7PA 5EPMB 5BRZA 3EDEA 1FSKC 2DQFB 3V6ZA 3I6GB 4TRPL 3T0WA 3RWIB 2YXFA 2EDNA 5ISZB 4FFYH 4QTIH 2AVGA 4YPGA 1WFUA 5I8EA 1D5IL 1B90A 1QVOA 4K8RL 3UTPE 1ZLUH 1DSFL 3WKNA 4HK0A 1U36A 2GUOB 2ZSVB 2BMKB 1ZHKA 1DZBA 2R1WB 3PXHA 5EC1A 1J0HA 3BRDA 1CWVA 1RHHA 2I27N 1QNZL 5T3ZE 5GS2H 3H3BC 3HKFA 3KHQA 3U9PH 3UAJC 2B8OT 4G7VL 1EMTL 1KIQA 1G7LB 2VXTL 2FATH 4Y5XA 3RRQA 1AQDA 3U9UB 4JKPL 4UQ3A 2QTEA 1S8DB 4ZSOA 4U2YA 3VXSE 1MWAL 3VWKB 4NP4L 1OPGL 2WBJA 2QQNL 4M1CD 1JZ4A 4PG2C 2Y1VA 5B8CB 3V7AG 3IU3B 3BO8A 2YZ1A 1GGIH 4PJGB 3GDBA 3BP7A 3ECBB 2VDNL 2HT3C 4MQSB 4M7ZB 1ND0A 1AGEA 4X4XB 3HNTL 4XI5D 5B38A 4GKSA 5HVFB 3T2NL 4C56E 5GS1A 4L29B 3QPXL 5FGCE 4R96B 5IROA 4L8SC 1UM5L 4JO3H 4PBWD 4UBDC 3X3FH 1XGUB 1P4BH 3QJHB 3MODL 3QDJB 2FLRT 5C0AD 4WWKB 3DXAD 1HI6A 1LO4H 1T7YA 4G8GB 3WUZA 4TQEH 4KK6D 1D5MA 5DI8A 2EO1A 1MFNA 1P7KA 1KJ3L 4TVPH 1LEKB 5LGKA 1W72A 4RMWA 4GG8B 3GBNL 1MJJA 5IKCA 4MXWL 5MENA 1I7ZA 2CUMA 5DVOA 4JPWL 4G7YL 5HDOA 4KAQL 1WZKA 2FJGA 1WWAX 1RZIB 1D9KA 4OKVA 4GKNB 4JZOB 4QOKE 3V6FA 4IMKA 4PRIB 3BUYB 1A6AB 3HC0A 4PGZA 3VGHA 3MSPA 4XPAH 1IGTA 1F13A 4I0KA 3BH9A 1X4ZA 3HI6H 1DBJL 4YBQD 4MB5A 4U1IA 3O2DH 3LVEA 5CCKH 2HKHL 2B1HH 4FABH 5KW9L 1G9NC 3HR6A 4CVXB 2LVCA 4DUWA 5IB5A 1U3JA 4H8WL 5JR1H 2KZ1B 2OL3A 1ULVA 2CRYA 3SGDH 2DQUL 2Z93A 4U1JA 4AMKL 4CUCA 1R3JA 4K71B 1RZKC 1ZS8A 2BY3A 1U8HB 3QRGL 2EDJA 2VLRE 1GAFL 4BZ2L 5I16B 2DTSA 4MWFB 5ID0A 1I7UB 1T2QL 5DZNA 4I0CC 2EIZB 5MEPB 3GSNB 3ALWA 4M6MH 4I18C 2ZUSA 4QXGH 2AKRB 4QRRD 3GUTB 3LDBC 1LP9B 5SWSE 4Q9QL 1IGFH 4Q74A 3MRJB 2P5EB 4JY4A 4LGSB 4XMLH 5JLZA 5HSFA 4Y4FB 3QFDA 2OR9L 4OGAD 5JUEH 1HEZB 1Z6JT 1BIHA 4WGWB 4AM0B 3QPQC 4HIXL 5J12C 5TF1L 2N7BA 2A2QT 3DGGA 3O45A 5JW5B 5IVXE 3ALXA 3CGTA 4M1DH 5HHOD 3ROOB 4MNGA 3K8LA 4YH6A 1UJTA 3G08B 2NNAB 4M61B 2EYTA 2EKJA 2EECA 4NKIL 4AIXA 1J05B 1HHIB 2HP4A 4OZHF 2I25N 2PYED 3RDTD 3MGOA 4X9HA 2I07B 5J06A 2E8YA 4PY8I 4K3EH 1JGEB 1JTOA 3I6KB 3MRHB 3OAYH 2R0WH 4XNMB 4DVBA 1T89C 1AGDB 4KMLB 3DYMA 5JO5B 5DWUH 4G42A 5LKNA 1E6OL 4NHCL 5D7JC 1I1AB 4P2QB 2A38A 4A6YH 4Z76B 1CICA 2QLVB 1JPTL 2OJZH 1SY6H 5J9PA 5BZDB 3A67H 1A6UL 4YZFF 3KLDA 4B7IA 1GGCL 3SE9H 5TH2A 3O6KH 5DRWB 3M1BA 4BELD 5CSZB 1MJ7L 3W9DB 5F7WC 3X17A 2BFVL 3NIGE 4FZ8H 1NBYB 1T80A 3PQYB 3WUWB 5D4QA 4FA8A 2JIXA 4WHYH 1EGJL 1RFDH 4BKLA 5F6HI 5I0ZA 1WV7T 5HGDA 3GO1H 3WHXA 1S9WB 5DJZB 4WEUD 4KJPC 4EDWL 3MRGB 3RPIA 1T1YB 2XWJA 1MHEB 5AWNH 1T3FA 3R06B 4K2UH 4NN7B 1TMCB 2VDMH 3QEUB 3MYJA 4RGNE 1T1ZA 3MCG1 3VFTB 1JGUH 2D9CA 3LS4H 2Q8AH 4FQQA 1MAMH 3CLEL 3M07A 5BVPH 1DLHA 1E0OB 1BOYA 3WKML 5BQ7B 4ZPTB 3NVQA 4OTXH 4KMQA 4DEPC 4ZYKB 4APQC 3EO9H 5DJXB 1VACA 4QHUB 3VXPA 4QRSA 1OSZA 1X5JA 2WP3T 3HFML 4MB3A 4YFLF 4YXLH 1B0WA 4X6BA 1U8JA 1EAPB 4U6HA 2EDYA 4UIKH 1GZQB 3RIFK 1RJLB 4TUJB 5FECB 3EYUL 3L3KA 1KIRB 1VPOL 4H20H 3FB6A 1I7RB 2VDRH 1F6AA 4OZFA 2F53A 3H42H 4PLKC 1URLA 3QXDB 5B4MC 1FO0L 2R2EA 4LLAA 4XMPL 1S7XA 5C0DA 2EEAA 4JM4H 3VJ6B 5DQJA 3M45A 3PP4H 1I75A 3L3GB 1YC7A 5ICXB 4J3TA 4OJFL 3MCKB 5IESL 5ERWB 2P49B 1CZ8H 1MRDL 1FVCB 3CCHA 1M7IB 2X7LB 4IRJC 4NNPL 4XHJC 3ARGA 4OCWH 3MLZL 1KEGH 5DUPH 4L8CB 5C0BA 1K8DB 1LNUA 4PJ5D 5CEYA 1BJ8A 1N3NB 4X6CF 5F9WC 3BXNB 5IJVA 1XR9B 4WTZA 4YXKL 2CRIA 2ZJSL 3L95A 2C4FT 3OB0H 1S7WA 4P9HH 3QEQD 5IMKB 3DX8B 1K8IB 2WZPD 2FRGP 3BRGC 1RZ8A 3WIFB 1B4JH 2ESVE 4B41A 5DJ6B 3DETD 2FL5B 1S7SB 1J1OH 3V2AR 1WCQA 3TCLA 4R97C 3GK8L 3N1GC 1FHGA 1ZLSL 1SJHB 4FFZH 1WZMA 4KC3B 4JFXA 2IMMA 4LEXH 5TDPA 3BPNC 1QHPA 5F7DA 3T77B 5E8EA 5C0AB 1MIMH 3HI5H 4IIQC 4G8EA 5C0EA 2BSRB 3DXAB 4P5TD 5EO9B 3BP6B 5SX4I 4P5MA 4XCEB 2AK4D 3GSVA 3CFCH 4MZ3A 5FHBH 2QV2A 2FR4A 3HC4H 1X4YA 2O93L 4MDJA 1JF5A 3SJVB 4UB0H 4X83A 3OAUH 4GKOA 4OLZL 5F1IB 5DGQA 4J4PA 2ZCLH 2PXYA 2C3VB 1JYNA 5IG7B 3GMOB 3NFPB 2X4RA 1BPVA 1RUQH 1P4IL 1QYGL 1S7QA 4JRXD 3T1FA 3QI9D 1BM3H 3I85A 2R23B 1HH6A 4LLQB 1ZANL 1QLEH 1CD1A 4L9DA 5KN5A 3BVNB 5CBEA 4AG4L 1B2WH 1WTGT 3QIUC 3V7MA 1HYSD 2ZNXA 4LSPL 5E9DA 3BZ4A 1RZFH 2IH3B 3LKPB 5CUSL 3O4OB 5SX5K 4HCRH 5DRXB 2APWA 2B5IC 5DJYA 3E8UH 3QXAB 4FQXC 2EH7L 4FTVD 5I0DA 2D0GA 5D7LE 1LO5A 5JDSA 5HHMD 2A6IA 5ITFB 4P2CG 5MP6L 1QBML 5FYJH 1RSFA 1ADQA 3ARSA 3G5ZB 1YEDB 4Z7VB 5EB9A 1X5GA 4Y2OA 1NEZB 1IAOA 3BWUC 3VH8A 1SQ2N 5AD0B 1JHTB 4DKFH 4R26L 4HGKC 5FAAA 3OBAA 4PV9B 3QUYC 1OB1A 5CIPB 1YECL 3CZJA 3GJEA 1IBGL 4QRRB 5D8JH 2IGFH 3ULUD 4RX4A 1FN4B 3P9MB 3I9GH 3F8UB 4PRDB 2QQLL 2VXVH 3WFDL 1H5BC 2FWOA 3KXFD 1X7QB 1MCWW 5JXEA 1A5FH 5BV7C 3IETB 5BO1H 1YMMD 4IS6A 3BIKA 4U1KA 4I5BB 4QHLB 4YFEA 4ONGL 4PJ7A 4OZIF 4NIKB 4P3DA 4OFYD 4HIIA 4PD4K 2Z8SA 2H3NA 4MJID 1A7OL 3LV3A 1TJHL 4U4BA 3FB5B 4LHUA 1NDMB 5HHOB 1FP5A 3E2HC 1JFQL 3WJJA 1PKOA 3NH7H 3EFDL 4L4TA 4YK4B 3UJIL 4EXKA 1G0DA 5GRXG 2PYEB 3IF1B 2X44D 5BJTA 3RDTB 2IEPA 2VLKE 4L4VE 1YEFH 3TO2B 4I77H 1IGCL 4NO3B 5EO1B 1R24A 3H7BA 1K4DB 3DHJA 2DLGA 5IMMA 5M95B 3DGCR 1JPFB 2HG5A 4UIMA 3HUJF 4NGHL 3SGJA 1QEWB 1KYOK 1QO3B 1WISA 4ZXBC 4OCRH 3GSQB 1OLZA 5I66A 3C6SB 3PWJA 3ZT6A 1E28B 4PJEF 5DK0A 3GIVB 4YDVA 1TZIA 1SYSB 1W8OA 2GITB 3L3JB 4XBEL 2OMBA 4LEOA 2X09A 5D6DC 3BPCA 3K7UA 4WI2A 4OZGA 2VDOL 1NMCB 2C3WA 4DVRL 4U0QB 1KG0A 1HWGB 2BSSA 5INDB 1PD6A 4JKMA 4O2EA 4Q2ZB 1U0QA 5IJKA 3REVB 3MO1B 4F2MB 4QRPD 4Z78A 2VH5H 1XIWA 2EZ0C 5JIIA 1XCTB 2BY1A 2HVKB 1HXYB 2J88H 3FAXA 3TNMB 2B1AH 3D9AL 2FBJL 4JJHA 4XC3H 2V5TA 2ERJB 2DAVA 1HDMA 1UZ6E 3BYTA 1UEMA 1Y6NR 4G6KL 1UCBL 4F57H 5HYSG 5HVHB 3PV6A 4MD0A 2QSQA 4OM0H 2EXYD 1N2RB 4N9OB 4PRNA 1FV1B 5CWSB 3ZT7A 2PW1B 3ZYZA 32C2B 4PB0L 3WV0A 5HHPB 2UY7A 2FZ3B 2FGZA 4NWTH 4YIQA 4ALAL 4BZYA 3UJJH 1PY9A 2W07A 5F1NA 3U6RA 4YGVA 1JGVH 3O4LE 4KPHL 5D2NB 5GGTA 1B9ZA 2MCPL 4CN4A 4XNUH 4Q9BA 5CILL 4R4FL 1U58B 4G6AC 2AAVA 1TTGA 2Q87A 1Z9SA 3L5XL 4ZO9A 3BMWA 5IB3A 4PJBB 4H0IA 1S3KL 4GW1A 5AZ2H 4IRSD 2D7TL 1I4FA 1DQQB 1NFDF 1NGPH 1S7VB 1NGWB 3GRWL 3BIAX 1MPAL 3ZE1F 3D87B 3LD8C 3PNWA 1B0RB 3DI3B 3QNZA 2D7NA 2NZ9C 4NN6B 2KPNA 4K3JH 4DN4L 2R9HD 1JNNL 4PG9B 5CBAA 2CGRH 4MB4A 3QHFH 3RNQA 3X11A 43CAA 4P23A 1D6VL 4LIQE 1CLCA 2E6QA 3LKSA 4RFEB 2VRAA 4LVOC 4YC2C 1E27A 3IGAB 5BVJB 3B9DA 5KVMC 1GC1C 2YOCA 1OM3H 4OI9A 2GTWA 3EFFA 2R1XB 3QEQB 3DUHA 2VLLB 1DDHB 1VEMA 4JDVA 1Q9WB 3MLTA 2HMID 4HHAB 5I17A 5EOCH 1S78D 5DHVB 2IH1B 2UZXB 1A1NB 4UAOB 4KTEH 4HDIA 1BQHG 3CDYA 4EI6B 5IK3A 2NY5C 1FE8H 5E95B 4HC1H 3OKDA 2J8UF 1MFEH 2W65A 2ATPA 3PGDA 3MBEB 1EEZA 2HH0H 4LSTL 2Q7YB 3SKMA 4YX2H 4FOMA 4NZTL 1DQJB 4XBGA 1WBZA 2LAGB 5IB2B 1KPUB 1G7JA 1JNHB 1K6QH 1QSFD 4P5TB 1U9KA 4NQED 1WFOA 2AK4B 3MV8A 2VE6B 1D5XA 2PETA 1QLRB 4NDMA 5FYJD 4D9LH 3TV3L 2OMNA 2NTFA 4P46A 1A6TA 5DT1H 4ELMA 1U92A 2NX5A 4WNQA 4HZLA 2YPVH 1S7TB 4Q6IC 1FG2B 4HMDA 4OCLC 3VFSA 5DMJB 4Z7NF 5HYQB 3DO7B 2J12B 4PJHA 4HWEH 1JIBA 1OAXH 1BX2A 4YXHL 1UXWB 1M6OA 1I1CA 4YHLH 2X2YA 1KTDA 4QRUA 3RUGA 4K3HA 4HBQA 4NZJA 3WFHB 4S0TD 5EOQH 3MLSL 3BW9A 4GT7A 2IBBA 5I75B 1DL7L 5FUOL 1MNUH 5EZIH 4PJIF 3AXLB 5MEQA 4X98A 4HQQL 1G9MH 4RMRA 4OLWH 4JG0H 1C16A 3Q48A 1G7HA 4MAYD 3SDCB 5FIEA 3CXHJ 2G75B 5FA3B 4FTVB 5IHZA 4RFOH 5DF0A 1TJIL 4ZO8A 2NY0D 2CKBH 3MRLA 5HHMB 3VWJC 3TBSB 4KI5D 4LMQE 3FL7A 3MACH 3S6CA 3L7EA 2FLBT 3O8XC 4XT1C 1UG9A 1H3WM 2HTLC 4ZD3H 4LVEA 4N0UA 5DVKA 2NXYD 3P0VH 5H94B 2B39A 4L4VA 3U30C 2YMXL 1A6WH 4L4JA 3BN9C 1IM3B 4HF5H 5TFSL 4EQ2A 4KQ4L 1CDBA 5E08H 3HE7C 1E4XL 3CK0L 5L7XL 2BNQD 5I1IL 4ORGA 1A6VH 3RZCA 5D5MA 3KXFB 2Z8RA 3WCYA 1PJ9A 2EYRA 2NQCA 1YMMB 1XH3B 1DN2A 3NPSC 5HI5D 2Y5EA 3OAZK 3JTSB 4JM2F 2XNAB 4U6XA 5C2BH 3T0VA 3I2CH 6FABL 1INEL 2Y5TA 1OD7A 3DO3A 1MREH 1Q72H 3WNNA 1N4XL 1HCFX 2H2SD 3OKOA 2W9DH 4ODHH 3SQOH 1TZGH 1VGKA 4X5WB 1UKSA 1V3JA 1KB5B 5AZEL 1X5XA 4GW5B 4PJXE 1R3IL 4OZHA 3MLRH 5FDYA 4HXBL 1O5DT 2MQ3A 4PLJD 5CJQL 5HI3C 2X4PA 4UT7L 2Q6WB 4EIZC 4GMTL 1F3DH 5LAXA 1OAZL 4XAWL 3GB7A 3MRIA 1HHGA 4KTDH 4EXPX 5TE7H 1AE6L 3JWOL 5IB4B 5F3BA 4YHKL 3IVKA 1CBVL 2W91A 3T0AA 3FRPA 4MA8L 4P3CL 2UVFA 4DKEH 3VG9C 3TM6A 4RMUA 3P9LB 3UROR 4P4KA 4H88H 1UGNA 4E41E 4G6JH 1MJUH 3JTTA 4KWUA 5SV3A 3RX7A 2YD2A 1JN6B 1YEHH 4D0DB 1IAMA 3TZVA 2YZ8A 4PRPD 4HKZA 5DC0A 1ZWIA 5DK2B 4EOWL 3B8SA 3UBXB 4YUEL 4D0BB 4QRPB 4PY8J 4NRYB 3HNSL 1YY9D 2CH8A 3GSXB 4MAUH 2E7CA 3EJJX 2VDLL 5ANMA 3UX9B 3ZHLA 5LXGH 4LKXA 2FJHA 3EYOB 3TBWA 2XG5A 3KPMA 2XTJC 5DUBA 3GMMB 4XP6H 4DGIL 4YHYC 1T7VA 3MBXL 5BRZD 3SDAA 4WUUD 2IFFH 4WFHE 5EORL 2OSLA 2DYPB 3QULB 1IAKA 4NQVA 4BQCA 3MJ9L 5D1ZD 1FNSL 2DQEH 1KBGL 2V5RA 4K9EL 2BNUB 5FGBC 3FFDA 5E5UB 3Q1SH 3VFGH 2OK0L 5F6HJ 4QNPF 1F90L 3CUPB 2VISA 4MQXC 4K94C 5DJAB 1SJVA 1FFNB 3Q5OA 1MH5A 3ES6B 3NCMA 2ZOLA 3PDOA 4XPBH 3RNKB 1A7PH 1DBAL 1AGBA 3RVVC 1CFVL 5EA0H 3FN0H 1KTKE 1I7TB 2OL3L 1HQRB 4QYOA 4JHZA 3Q6GH 4G6MH 1A3LH 3KPRA 5KS9B 1A1MB 5TDNB 4YJZL 4D0CB 5C0CE 3U48A 4RCAA 3O3DB 5FYKU 1YEIH 3OF6A 4PTUA 1PFCA 2EXWD 2WBJD 3BPLC 4TRPH 2CJUH 3B6SB 4AZ8A 5TE4L 4GG6A 3S3SA 1ZXQA 5DR5L 2ADJA 4K8RH 3HAEG 2G5BB 3CFBA 1QFUL 4QXWA 4KZEH 1KIPA 4JFYB 1DSFH 1HHHB 3ARXA 3C6LD 1RK0B 3GI9L 5TQ0L 4AJ0A 3MZGB 3E6FB 2ZG2A 3OJDB 1DN0B 5I1LB 2IANE 1WEJL 2IJ0C 4YDLB 3EZ8A 5MI0B 1CGUA 4DFIA 1UJ3A 4PJDF 2A0LD 1IC1A 1EMTH 3MGTA 2VXTH 2AXJA 1RD6A 3KLAA 3MXWL 5HY9B 4JKPH 3CPLA 2L4OA 1XCQB 3PHOB 3O81A 1P4LA 1XZ0B 1R5IA 3RZWA 1MWAH 5MEND 2R0LL 1FRGH 4NP4H 1XF3B 2QQNH 2O5XL 1MCOL 4XVJL 4DN3L 4L8BA 3HZMA 5I19L 4KROD 1D9KD 3B3IB 4CDGC 4QF1B 4HK3N 3DARA 2Z9TA 4O51A 2NYYC 2VTFA 1X5IA 4JFFD 5EU7C 2R56L 1QSFB 3I02A 2LABA 1FBIL 4X6DA 3HNTH 1BF8A 1E4WL 4QGYA 2HT4D 3LQAC 3QPXH 1J0JA 5DEFB 1UM5H 5JOEA 4E0RB 2OR8A 3C5SB 4F58L 4OQ1A 4BUHA 3QZWA 2YPLA 3MODH 4W4OC 1WWWX 3CZFB 4G9FE 3SE4C 3ZDZF 1U93A 3EYQD 1KJ3H 2H2PC 2CLRB 3HE6A 5C09E 5E5RB 2ICEB 5EIIB 3MA7B 1YY8B 3DTXB 4F3FA 4HKJA 3GBNH 1GCFA 2AK1L 2ITDA 4JFHE 2DKUA 4LPWA 4G7YH 2E9JA 5MHSD 4KAQH 3VGAB 4Z7UB 4OCMC 3L6FA 4LCWB 1L7TL 2ZUWA 3GSOA 3QAZB 4MAYB 5D1XA 2AJZA 4I0PA 3OXRA 4R6UA 3E1F1 2ATKB 2AJ3A 2NY0B 5IEKB 3LSOB 4ODWA 5DHYA 1DBJH 5CMAA 2DQJH 3VRIB 2F5AL 3I6LE 2I9LA 1MIEH 5E8NA 4OI8A 4X4ME 3U7WL 2V5YA 4BH7A 5IMOA 2NXYB 1DANT 3MX0A 2BSTB 2X70B 3QCUH 4NFCA 2FHFA 1FJ1B 4FQHB 4PV8A 4G43A 3W0WA 3HMXA 1YDPA 5CGYC 2DQUH 2NY7L 4AMKH 3WJLA 4U3XA 2UWEA 2GAZB 3QRGH 1GAFH 2GYSA 4TPRH 2BNQB 1MFAL 3LEYL 2AXFA 4OCYL 1KTLA 1KPRA 4KKAC 4HLZG 3NCYS 3THML 4J8RA 2AGJH 2YSSB 1KJ2A 1BEYL 2F54E 2DL9A 1I9IH 4CRPA 5E8OA 4ZAKB 3C9NB 3S35H 4Q9QH 3SEPA 1ORSB 4U2ZA 1KN2L 4OZIA 3UPRB 3S97C 4BQBA 4LPUA 1AQKH 3CMOL 3HRZB 4KFZC 1CICD 1UADC 4ZS7H 3MJ7B 4RWHA 4XHQA 4OIIL 4XWOC 2LE9A 1BVKA 3VFWB 4H1LH 4JANA 1ZKAA 5HYJE 4MCZA 2AJVL 2YC1A 5TF1H 3QUKA 4JN2B 5CEZH 4XPTL 3M17B 5DSCA 1NFIB 3RY6A 5I1AB 3AREA 3QQ9C 1K5NB 4NKIH 2HRPL 3JV4A 4XZUA 3L5WA 2V2WA 5ADPL 3WS6A 3WNKA 3KPSA 3VFRA 4U7SA 1UZ8B 1YC8A 1BFOA 2GSIA 2D0HA 4M7ZC 3D0LB 3MOQA 1XGYL 2XTJE 4PREB 4HUWA 3MA9L 1NKOA 4H25A 5L2JB 5CINL 2CPCA 3QNYA 1NBVL 1MVFA 1E6OH 5GIRA 5C3LD 5EU6E 3LS5L 3KYMA 2YK1L 1YZZA 1JPTH 2PUQT 3OR6B 4WWKC 4PRPB 1IM9B 1MCDA 4GRWH 1IGJA 4EUPB 1A6UH 1FYTB 1GGCH 1JUFA 5DRNA 3OAYK 4KMTL 3IDUA 5CJXA 1E4KA 1U8KB 1MJ7H 5DMKA 2AEQL 4Z7WE 4YGAB 3L3HB 1OTSD 5EBMA 1IGIH 4TNWK 1QSEB 1EGJH 2AQ2A 4YO0B 4DW2H 2X4QB 3KPQA 3MRBB 3OX8A 5FKPA 1B0GA 2JB6A 1ZLWH 1UWGL 5BRZB 4WUUB 4GMSL 3BH8A 5CD5C 1BJ1H 1RI8A 1CFQA 1H3UA 4KK5D 2H8PA 1LWRA 3OQ3B 4M43L 4ZFGL 3CLEH 1ZHKB 4I3SL 1M7XA 5JQ6L 1FZOB 5EUOE 3LN9A 5D93C 5SV4A 4K71C 4JFDA 1C1EL 1VEOA 1RHHB 1A1OA 2H32H 3VI4E 1G84A 2FH8A 7FABL 3HFMH 3LEVL 1KIQB 1WJ3A 4K23L 5C0BD 3WIHH 4Y5XB 1G9EA 3DHMA 4JJ5A 3TYFB 1AQDB 4UQ3B 5I6XB 4Y8DC 4H5SA 1ADQL 1VPOH 4D94A 2MSPA 3L9RB 3G6JF 2NY3D 4NSKA 2WBJB 3JV6A 1W8NA 3C2SA 4U0RB 5I1EL 4F7MA 4Y4FC 2C3XA 1FO0H 4DAGL 3DSFL 4F7CB 3H9SD 5C0IA 1T66D 3C6LB 3FO1A 1NUNB 2VUOA 1R3LA 1ND0B 1AGEB 1N8ZB 3NPZB 4GKSB 3KPNB 1JPST 3HPJA 4N9GA 4PBVC 5EU7E 4CW1A 1C12A 1A7RL 5DQDL 5I74B 2FH6A 5IESH 4F37F 5EBLA 3W11D 3EJZD 5GS0C 3RWHA 3EJYC 3MLZH 2OQJA 3LKRB 1SHMA 3LMJL 3VFOA 4N8VA 4XPHL 1QOKA 3QXUA 4CGTA 2XQBL 1P7KB 4P2RD 4ZOBA 1ZVYA 2X4NA 4WV1A 4AH2B 4KRPD 1W72B 3G9VA 1WBYA 5E6IC 5IKCB 4Q9CA 2ZJSH 5MENB 2XN9A 1I7ZB 3WXWH 1I1AC 2JJWA 3KYAA 4PJAE 5BS0E 2FJGB 1D9KB 4OKVB 4HFWB 3V6FB 4Y1AE 2Y07L 2X40A 1QP1A 3S36L 3SY0B 4U6VL 4JFFB 4ESKA 3HC0B 3DIFA 4CJ1A 4OUOA 5DXWA 6CGTA 3AS3A 3CSGA 1NDGA 2VIRB 4U1IB 3WDIA 3W39A 1ZLSH 5E9DD 4FG6D 3OB0K 4HS8H 5JNYB 8FABA 1OGTA 2BVYA 2ZOKB 3VXNA 1Q9KA 2QL1A 1NBZB 4KK9D 1QD0A 2PO6A 3S4SG 2Z93B 4NC0B 3TO4A 5I15H 1JF6A 1R3JB 3LH2L 1ZS8B 5J8OA 2D7PA 4NN7C 4OLZH 5DMGC 4M3KB 2DQHL 3DYPA 3RHWK 1EUTA 3MRFA 2C1OA 4LPVA 2X6MA 2VITA 4PJIA 4OB5L 4KK8C 5ISZE 3B9KA 1ZANH 4HGMA 4Q58C 3SCMA 1A6PA 1HH9A 3CSBA 3HMWL 5HHVL 4AG4H 1CD0A 2EDFA 4JY4B 2IF7A 2NY4D 4HG4K 5DJ0B 5AG8A 4LSPH 1F00I 2MFNA 3CD4A 1IQDA 3PL6D 3I3EA 3QUXA 2EC8A 4G8IA 1KJVA 2H6PB 2EH7H 3HA0A 3T3MF 3H9ZA 2P24A 1QBMH 5CEZD 1UH3A 4PRHD 4LHUD 1RZJC 4MNGB 4JRYD 2EDBA 5KSBB 3NN8A 2EYTB 4FN0A 2GCYA 4J1UB 3PWVA 2JE8A 4LASH 3MGOB 5T33L 4R26H 1I8LA 1CE1L 1DVFA 1IBGH 2DN7A 2I24N 3WFCH 5GGRA 4PJGE 4TTDC 1G1CA 3WFDH 4G42B 1Q8MA 1NMBH 1N5AB 4G9DA 4RGOL 1CICB 2P42B 2BSED 2D9QB 3GBLA 3IFPA 5F88A 5J9PB 3VI3F 1CYGA 2V7NB 4ZTPH 2GSGA 2UZYB 4O58L 3QDJE 5EZOL 4POYA 4TVSa 2CK0L 1GYAA 4GXVH 5AYUL 4NUGL 5IGXL 3BD5A 1A7OH 4N5EC 4A2LA 4G8GE 1TJHH 4CVWA 2WIMA 3TBVB 2NPLX 1JFQH 2JTDA 3S5LA 3WBDA 3ARRA 2JIXB 3UJIH 4BKLB 2LVEA 1MUJA 4ODUB 12E8H 5HGDB 3WHXB 1WVZA 2ADIA 1ZOXA 4YEEA 1T2JA 1XIWD 1YPZB 4IOSD 3RPIB 1IGCH 1I3GL 1TITA 3V8OA 3MJ8B 5SWZA 1N59A 3KWWA 1T3FB 1L0XA 4UT6L 2DLFL 3MYJB 4PRIE 5KSVB 4G3YL 4O9HL 4NGHH 5KVGL 3BQUA 5E2TL 3W9EB 5DJCB 4OF3A 3FFCA 3JWDC 4Z7QF 2EDQA 4WW2F 1CCZA 3AB0B 1DLHB 2MMXA 2XZAH 5JW4M 2GT9B 1VACB 3U2SA 4QTHA 1OSZB 2VDOH 3SGKA 4DVRH 3IDJA 3LKQB 1U8JB 3MXVH 4U6HB 2BVEA 5GZND 3ZSTA 4ZODA 2DM3A 2QHRL 4ZUVA 4PY7A 3L3KB 1FNGA 3ARDA 4KV5E 3K1KC 2FX7L 4WTXA 1F6AB 3MFFA 4OZFB 1Z0MA 1JPGA 4JDZA 5IIEA 1NC2D 4KKBD 1LP9E 3D9AH 3C87A 4PBXA 2FBJH 1BD2D 1NQBA 3QDAA 3O4OC 2W60A 2X9XA 5C0DB 4OFPA 2YRPA 4JEGB 5DQJB 2BNRA 4G6KH 4JVUA 3DSNA 4MA7L 3WEXA 1RQ5A 1I3RB 4OQTA 2YKLH 1NGXA 1PVHA 3H3KA 4GRLD 5F71A 1DJSA 3CX5K 3PWUA 5DVMA 3KJ4B 5DQ9A 4PRAA 5C0BB 1M7DA 4LAJH 4H26A 1LNUB 4HKBA 5CEYB 3DPBA 4ALAH 3V9FA 1NAKH 4JO1L 1T7XA 3ZKND 4KPHH 1KFAL 2NY3B 4PJXF 4ZNCD 4HJ0D 4U1HA 4D9QD 4UINH 1AIFA 2MCPH 2BHZA 5HHXL 4F7EA 1RZ8B 1C5DB 3H9SB 2E6PA 3L5XH 4P2QE 2OM5A 1A2YA 1S5IL 3KGRA 1S3KH 3D3VD 3FZUD 2NLJA 4M6AA 4RNRA 5I8CA 1ZT7A 4JFXB 5TDPB 1UH4A 1I8KA 1MPAH 3KYNA 4DTGL 4M1GL 2C9AA 4K7PH 4C59B 5E8EB 1BOGA 1E4XI 3HZVB 4G8EB 5C0EB 4OF0A 4YK4C 1NL0H 2ID5A 4PJDA 4P5MB 1JNNH 1GPOL 3GSVB 4XCYB 2FR4B 3PQYE 4P2RB 1T4KA 1D6VH 4OCNC 2X4UA 3CSPA 1MY5A 4P46D 3TIEB 4MDJB 2VL4A 2F19L 4KRPB 4Y16A 2NX5D 1EJOH 5DFVD 5C92A 5EPMA 5BMFL 1MFBL 4ENED 3I6GA 5IHBA 1CN4A 1KT2A 1S7QB 3T1FB 5D7KD 1YMHB 3C5ZC 1CXKA 4U49A 3EW3B 1CD1B 1OTUC 3MJGX 4WCYL 5KN5B 1D3CA 2GUOA 2HAZA 4H8WC 2ZSVA 4G80B 2ADGA 3MRPA 1M4KA 2VAAB 3OKMB 5E9DB 3BZ4B 4NQDD 3MPCA 1NMCC 1U8NA 4LSTH 3AMLA 4HWZA 4MLSA 3IXAA 4NZTH 4V1DA 2AERT 2P4AB 3QT2A 2FBOJ 1G7LA 1LO5B 2A6IB 4HIEA 2JB5L 4KRNA 5C08A 3TV3H 3UDWA 1XT5A 4QXTB 2WUCL 3FOMA 2X4TB 2FEEL 1T0NA 3TP4A 1IAOB 3VWKA 1A4JA 5T1KD 4UV7H 4JLRA 2ERJC 1ITBB 5B8CA 3O3BA 4R9HA 1SYVB 4Y4KA 3NABL 5EZJA 1P53A 3GJEB 1ZHBA 4PJGA 4BQ8A 3VD4A 1MEXL 3MLSH 3CDGA 5HVHC 2RHEA 1DL7H 3HG1A 4OBSA 2FWOB 4KUCF 4M62L 2NY4B 4MJ2A 1PY4A 4NNXA 4FZEH 5HGGS 3ZTNL 5CLTA 4R96A 4TOYL 3AGVA 4XVUD 4IS6B 2A6DA 2IBZX 1XGUA 4PJ7B 4D2NA 4P3DB 4H1LB 4HIIB 5C86A 3OZ9H 4GW4A 2XIDA 2H3NB 4GRMB 4UTBL 1PZUB 1P84K 3LV3B 3WFZA 2P8LA 4DKDC 4LHUB 5FYJU 4DZ8A 4JRYB 2XG4A 5GRUL 1LEKA 4IOFD 4GG8A 1LD9B 1MY7A 5HI4D 4XAKD 4Y5YB 3DX7A 3JXAA 4LIQL 2VLMD 1JZ3A 2YMXH 3QDMA 5H8DA 1FNLA 2G60L 3MYZA 1RZIA 1T7ZA 2M8XA 1CDHA 4JQVA 5E0QA 1YA5A 4F9PC 4PB9L 3H7BB 3F65A 2NXZD 3BUYA 3KLSA 1E4XH 1A6AA 3CK0H 5IMMB 1RIUL 3B5GA 3CVHA 1MQKH 3IS0X 5DD5L 5I1IH 4UIMB 3ZLQC 5GGQL 2D31B 4M48H 5I66B 3BP5B 3PWJB 4M7JH 4OBRA 1AO7A 4YDVB 1TZIB 3K80A 1KULA 3V0AC 4UI2A 1FQ9C 6FABH 1P5VA 1INEH 3CH8A 5C0AE 3OXSA 3KYOA 4PJ9A 4WI6A 3BPCB 1KELL 4MNQA 4HWBA 4YPJA 4NZUL 3FO0L 3VXMD 4OZGB 4P4KD 4ZOCA 1ZV5A 3SE3C 1N4XH 3SDDA 1KG0B 5I16A 4WUKL 1G6RA 4MWFA 2BSSB 3RGVA 2DQCL 3SJVE 4O2EB 3EDFA 3QO1B 1F6LL 4X9IA 2ZCKL 2F8OA 3GSNA 3DETC 1R3IH 1XIWB 4HXBH 5ESQB 4UAOC 5HHQA 4LSRL 5CJQH 2AKRA 2FO4A 4UT7H 3TWCH 4KXZH 1F2XK 4GMTH 4ZDHB 1OGAA 1TZHA 4XAWH 1NCDH 4UV4L 2P5EA 4M5YH 3MBEC 1KGCD 1AE6H 1YEJH 1HDMB 3JWOH 1LK3H 1INDL 1SMOA 5LJYH 4YHKH 4BJLA 4P5TC 2XZCH 4M02A 5DZOA 4MA8H 4YDKL 5D1QA 5E4EC 4Z8FL 1FFOB 3INUH 5IHUH 5DFTA 2EICA 3HCVA 2H32B 4PRNB 1KV3A 1AR1D 4U6YA 2QADC 4XCFL 1KB9K 5HDBE 3GJFH 2C7UA 3QUMH 1J05A 1QFWL 4YIQB 4Z7VE 3C09C 1HKLL 4YUEH 2O5ZL 2I07A 3HNSH 5F1NB 3U6RB 4YGVB 5A1AA 5I75C 2LFGA 4XXCA 5E6YA 3MRHA 2VDKL 5CP7A 4QRRE 1HYSC 3BP4B 4XXDA 3NCJL 5KVFL 1BD2B 3CU7A 4NC1C 5HJ3A 3KPRD 1FL5A 5GGVL 5IB3B 1GOFA 4WFGD 3IDXH 3SDCC 1FLRH 3GEWB 4DGIH 2P5WA 4PLNC 2YA1A 4JG1L 3MBXH 2FNBA 4GW1B 5E2WL 1I4FB 5BZDA 3QCTL 5EORH 2L0DA 2DLIA 4M8QA 1G7MA 2QEJA 3STZB 5DRWA 4HUXB 4Y4HC 1GIGH 3MJ9H 3NCYP 5CSZA 4NT6B 3B83A 1FNSH 4OV6F 5KBNC 3MUZ1 1KBGH 4XVTL 3VGEA 4K9EH 1NBYA 5B3JE 3AVEA 3RIAF 2ED7A 5CBAB 2QKIB 2OK0H 3QQNA 4HLZH 3LKSB 1CFSB 2APTA 3ULUC 3ARFD 2PYEE 4FQPA 2V2XA 3ZDYF 1FL3A 3HNVL 1VKXA 1MHEA 1QBAA 1DBAH 1F6FB 3ZTJG 5T3XE 2GTWB 3EFFB 3SKOA 4IRZL 3QEUA 4BM7A 3G6JA 1RHFA 2XY2A 3MLTB 3VFTA 3IJHA 5I17B 5GS3A 3EOAA 1HXMA 4HDIB 5IK3B 3D3VB 5E8DL 2WLYA 4Z95L 1DQML 4CAGA 1FFRA 3PP3K 5BQ7A 4ZPTA 5F8RC 1J8HE 2ATPB 4RBPH 5TE4H 4ZYKA 1EEZB 3SKMB 5DR5H 2J8OA 4X7CC 4XBGB 5DJXA 1WBZB 4NM8H 1QFUH 5K93A 1IC4H 1G7JB 2R0KL 2VYRE 3RY5A 5F7NC 3MV8B 1D5XB 4TUOA 1FL6A 4JFED 2NTFB 1WEJH 3BDYL 2Z4QB 4P46B 4X4YA 4TUJA 4ELMB 1U92B 3MRDB 2NX5B 5HYSB 4HZLB 3VFSB 2YPLD 2WWMD 3FCTA 3CMGA 4PJHB 2A77L 2EDDA 4OLUL 3LRSA 1N7MH 4JO4L 4GS7B 1ZMYA 1M6OB 3QXDA 3RA7H 3MXWH 3UTTD 3LN4A 1Z9MA 4L3AA 1BZ9A 3RUGB 4Z7WF 1F4HA 4DGYL 1EZVX 5IWLA 3HE6D 4ZUSA 1JPSL 4KH2A 1WSST 4BSVB 2DQDL 3GNMH 4S1RL 2R0LH 5A2IH 2EO9A 4ZNEA 2O5XH 4XVJH 4DN3H 2J5LB 5I19H 3FB7A 5MEQB 1L4IA 5D1XD 2X7LA 1UEYA 3MRQA 2XPGA 1TENA 4BFGA 2R56H 1UH2A 2N56A 5IHZB 5CP3A 4U1SA 4L8CA 1FBIH 3WD5H 2APXA 3TLRA 1HN1A 1K8DA 4L5FL 1E4WH 3WSQL 4HMEA 5IUSA 1OP3H 3B9EA 3RVWC 3H9HA 4F58H 1IKFL 4N0UB 5BW7C 5EUOF 4B7LA 5T1KB 3B2VL 3W0WD 2VR5A 2PTVA 5IMKA 3DX8A 3UEZA 3VI4F 1FORL 5J89A 4M7LT 3WIFA 4LK4A 5DJ6A 3BT2H 1ZE3C 1PKQA 4CKVX 2WK2A 4ORGB 5GISH 4HV8B 4ZTOL 4NQCD 4KI1A 2M2DA 4PJBE 3F5WA 3BEVA 1GC1L 2EXYC 2CD0A 1VFBB 2BRQA 1F8TH 3IJSB 5EC2A 1VFMA 2E7HA 1L7TH 4U6XB 4J3WA 4WJ5A 3UZEA 4X6FB 1KCVL 3DXAA 3TEUA 3E0GA 3BP6A 3IDGA 4XCEA 2NY5L 2F5AH 1LO3L 3WYRA 1NKRA 3BKJL 4U1NA 3OKOB 2XTLA 4XP9H 3VD5A 3HPLA 1QPXA 3NIFE 5C7XL 2C3VA 3BPOB 4OLXL 2B20A 3NFPA 3DURA 4OZHB 3DVNB 4OGXL 4C83A 3CFJA 4BH8A 5C8JA 5T3ZH 3ZE0E 2X4PB 1JWUB 2HFGL 4LLQA 4Q9RH 1GVIA 5LAXB 3RWEA 2RB8A 2K7PA 1OAYL 4O4YH 5IEHA 1MFAH 4M4PA 5D7IF 3LEYH 4LPYA 3IDNB 4NO5A 1EJ6A 3N1MC 2HLAB 1AXSB 5F3HA 5T5FH 5HD8C 3KPSD 5F3BB 3IVKB 3DROA 1LDSA 2IH3A 3BJLA 1Y6KR 4Z0BH 1BEYH 3MRKA 5EULV 2R9HC 1TJGL 2XQYG 1I1YA 2AJUL 1KN2H 5MI0C 4P4KB 3VA2C 4TUKL 2AK4E 3JTTB 1A7BA 3ULVF 4O5LH 1JYXA 3TZVB 1X5FA 3G5ZA 5D70L 4NJ9H 2Z31C 1JZ6A 1ZWIB 4X9GA 4P0DA 2QBWA 1EEQA 2H1PL 2ICWI 1NEZA 5GPRA 2HMIC 2AJVH 5AD0A 3ZKSD 4JDTL 1S78C 4GBXD 4PV9A 5CIPA 3S3PA 3L3OB 3DV6A 3I75B 1FN4A 1MCCA 5ANMB 2CK2A 5I18L 4LKXB 2FJHB 2HRPH 3TBWB 3KPMB 3AUVA 5DUBB 1X7QA 2XZZA 3QDGD 2YD5A 3IETA 1MJ8H 3I84A 2WP3O 5ELIA 3LKNA 3CSYB 4WW2A 5ITBH 4NC1E 3MA9H 1RIVL 2OSLB 4NZDA 5CINH 2Z92B 4RRPG 1BQUA 1NBVH 4NQVB 1IAKB 2V2TB 4FTVE 3V0VB 2DQGL 1RMFL 1R5WA 3LS5H 5DA0B 2YK1H 3FB5A 4X9FA 5HHME 4GFTB 5HHOA 1GHFL 2D0FA 4QGTA 3QR2A 3S88L 2VISB 4NQTA 3RDTA 2MQ0A 4PP2B 3IAGC 1ZA3A 4HPOL 1MH5B 3PDOB 2ZOLB 1TVHA 2AEQH 4DOHB 1AGBB 5EO1A 2PR4L 5L8LB 3ULUE 1CIUA 3VGAC 1JPFA 3O2WL 4CVZB 3NCEB 4ZUTB 4GQ9H 3KPRB 4UOW1 3QAZC 4MAYC 1CF8L 2GJ6A 2A1WL 3NTCL 4PTUB 1YMME 2NY0C 5IP4A 4GMSH 3PXJA 4URTB 4GG6B 2GITA 3RWDA 3JBG7 2ADJB 3CFBB 1T20B 3UXFA 4M43H 1FIGL 1WUNT 4EBQL 5CKAA 3FN3A 2EEBA 5SWQB 3K2UL 2AQ1A 1LE9A 5INDA 5JQ6H 1FPTL 1ZLWK 3KG5A 2ZKHL 2V7HB 2VLJD 4U7MA 2Q20A 4X6CB 1C1EH 2F58H 5C1MB 3KNBA 2V17L 2YWYA 1IC7L 7FABH 3VFMB 5FO7A 3L3DB 1T0PB 4XTRD 1K4CA 1FZJA 1XCTA 3LEVH 4XCCL 2FIRT 5F7LB 2XA3A 1JYWA 4K23H 3KLAB 1OW0A 2RFXB 3BSZL 4W6WB 1P4LB 4ZAKC 2EH8L 1R5IB 4KHXH 2VQ1B 5J11C 1NCNA 3O0RL 5FUZH 2XN9D 1YEEL 5DTFB 3GHEL 4PR5B 4L8BB 4EI5A 3VRLE 5I1EH 1CL7H 2LQRA 5E5MB 1X5AA 3E6HA 1QHOA 4YR6A 1WIPA 5E99L 4DAGH 3DSFH 1KXTB 4PJFF 3MUJA 3I02B 3LB6D 1AXTL 2PW1A 32C2A 4X6DB 5HHPA 2FZ3A 4OT1L 2AI0H 5L88L 4JFEB 4LSQL 5ILTL 5DQDH 1A7RH 1H3PH 1H3VA 2YPLB 3BHBB 4H0GA 3QO0A 4QRPE 5CZVL 2Q7NA 5D2NA 4TTGA 3LMJH 5IV2A 4YQXL 5E94B 3T0DA 2LU4A 3DUSA 4KTYA 5JIKA 2ZPKL 1U93B 4XPHH 3TO4D 2XQBH 4ZS6D 4YHIB 4K94L 3HE6B 3MLUH 4EN3D 4F3FB 4HKJB 1U91B 4YBLB 4KV5F 3CVIL 1S7VA 5I1GL 1B3JA 1QFPA 3GI8L 3DLQR 3L6FB 2WMPA 3GSOB 3B9KD 1DBML 3DYOA 5D1XB 3S36H 3PE9A 2AJZB 1B0RA 1ZT1A 2DM4A 3OXRB 4I0PB 4U6VH 1ITCA 2P44B 2AJ3B 3VGGA 4ODWB 1X6NA 4ZFFA 5CMAB 5F7KC 1GGBH 1E4JA 1T03L 2MQCA 2FO1A 2I9LB 4J3VA 4PJ5A 3UTPD 1YY9C 4O2CB 4WEBL 5KSAD 4LU5H 5IMOB 5BVJA 4WI9A 4PV8B 3QJFA 4X0KA 3W0WB 3QEQA 2R1XA 2VLLA 1DDHA 5T3ZD 5D96B 1UKTA 2UWEB 2XI9A 4UUJB 1YEGL 2BRRL 1LO2L 1KTLB 1CDUA 1U8LA 1KPRB 3E3QC 4KJWD 5FO8B 1G7IB 3O2DA 3O2VL 4J8RB 3VMNA 3O6FA 2Q7YA 3VXSD 1DVFD 1KJ2B 4R4NC 5C6TL 3JUZA 5IB2A 3BKYH 4JM2D 4OZIB 3JVGA 2AK4A 2COQA 2VE6A 5EFIA 1QLRA 5CAYB 1MRCL 1KUMA 2WBKA 2XYCA 5MEOA 2GJJA 4AEIL 4BQ6A 1BVKB 2DDQH 1S7TA 1FG2A 3I50L 1JMXA 4JANB 4N5UA 4Y5XC 1OAQH 4HXAH 3DO7A 4MCZB 4N68A 4U1GB 2YC1B 4W4NA 5I6XC 4JRXA 1UXWA 3QI9A 2Y36L 1WWCA 4LCCA 1QFHA 2HTKC 3WFHA 4J2XA 2WBJC 4U0RC 5C0ND 3JV4B 1CU4L 1V3KA 4XZUB 2F8VA 3P4OB 4XCNA 1UQSA 3L5WB 2V2WB 3KPSB 4J6RL 2ARWA 2Q3AA 2WNGA 1FGNL 2GSIB 4B53A 5SWZD 2RAMA 4PJEB 1FIEA 1IAIL 2A83A 5EBGA 5ICZA 4H25B 3O3AA 5FA3A 4MA3B 5IROC 4JZNB 1QSFE 1JGDA 2AABL 2WQRA 4OAWA 5I1KH 1QFOA 3TBSA 4QOKD 5I74C 1LQSR 1ZA6B 3FFCD 1F02I 3KYMB 1A02N 3EHBC 5HXMA 4DK3A 3QUMB 1IGJB 4R2GB 1TDQA 2HWZH 4WIQA 1KCLA 5EZOH 3FT3B 3U1SL 5AYUH 4NUGH 4LF3B 4M9OA 5DMKB 2UV3A 4P59L 4QRTA 1IQWL 2VZOA 2LTQB 1I9JL 1G9NH 4HH9B 5EBMB 2NY1D 3P30L 3FMGH 1D9KC 1EZVY 3PABA 4F7TA 1ZT4A 3KXFA 4A6YA 3IRZA 3RBGA 4IMKC 3KPQB 5J13B 3OX8B 3QDGB 3DMMA 5FKPB 1B0GB 1SY6A 2JB6B 3P4LA 4Z7UE 1I3GH 1LMKA 3JTSA 1RZKH 4FP8L 2XT1B 4LCWE 4OFYA 3OKEA 1CFQB 2DLFH 2HT4C 3LCYA 1YEKH 4UT6H 4G3YH 4LPTA 5ACMA 3V5DA 1XF1A 4MJIA 5KVGH 5J6GA 5E2TH 5DO2D 2H8PB 4P99A 1MFDL 4KI5E 1N26A 2CIIA 2BNRD 2JCCF 4U1LA 3VXUD 1ORQB 4GW5A 3EYQC 2Q1EA 5JQHC 4JFDB 1A1OB 3KVQA 1IKNA 5IOPB 2Q6WA 4F8QA 3P11H 4JJ5B 3IDMA 3ARBD 4HS6A 2QHRH 3ALPA 1X5KA 1UCTA 1OHQA 2FX7H 4MXQD 3HRPA 4NSKB 2XKUA 2R4SL 1SJEB 3DVGA 3JV6B 2QQQA 1RJYB 2AV1B 1FH5L 1H8NA 3LPGA 4OIAA 3CC5A 4QHMA 1LDPL 4CMHB 2X10A 4YAQB 1AHWB 5T5NF 3FONB 4BFIB 2O5YL 3SOBL 4WY7H 4C54A 4OZ4A 3FO1B 2FEEI 3TJHC 2BJMH 1R3LB 3UZVB 3K74B 4ZFZA 4MA7H 3MRMA 2Q86B 3HPJB 5DK2A 2H26A 1C12B 2XZQL 2FIKA 4QRPA 3RWHB 4AIZA 3AS2A 4N8VB 3GSUA 2APFA 1TXKA 3DRQB 5KANG 4JY5H 2VDQL 2K9UA 3OGOE 2X4NB 3U0WH 1AGCA 4UDUB 4GJTB 3IDYB 5KOVC 4UOW0 3PJSB 1EVTC 1KFAH 2XN9B 1AKJD 1T0MA 2XICA 5AAMA 4AEHL 2J8UB 1CICC 4PGEB 4EZMA 3EGSA 3W5MA 1FNEA 2VOTA 3IXTB 3DIFB 3VGBA 5JMRA 3SDXF 4QWWD 1NDGB 4WO4D 4PRPE 5EWIH 4HBCH 3UO1H 3R4DA 1FYTE 4DTGH 4M1GH 8FABB 1OGTB 1FFNA 1I3UA 2YUVA 4W6XB 2HFTA 4PP1C 2E5EA 1Q9KB 5GGUA 1NGYA 4BFEA 1JZ8A 2MHAB 1GPOH 4PTTA 3TO4B 1MHHA 4ODSL 4ODVL 4S1DD 2M1KA 5HDBF 1QSEE 2FHBA 3F62A 5KS9A 2F19H 5TDNA 4D0CA 5M94B 4Z7VF 2BVOB 3O3DA 1MFBH 1BIIB 4IRSA 3MRFB 5BRZE 1CLOL 3UAJD 4Y89A 2VITB 1PG7H 1VA9A 1U2CA 2PCPA 3GSNL 4PJIB 4OLYL 1VCAA 3B9KB 5L9DH 3AB0C 1TFHA 5JIHA 4JFYA 1HH9B 3S9DB 2HFFA 5B39A 1GL4B 1SBSH 3WN5A 1T21B 3HG1D 1BJMA 4OF8A 5I1LA 1DN0A 1Q0YH 4NNYA 3DV4A 3D85D 5KSAB 3QUXB 2SEBB 1QFWM 4G8IB 1BQLH 1OTSC 3LRHA 2YD1A 4F9LA 1FNHA 5KVDH 2HT3D 5CKGA 2JB5H 2HA1A 1BWWA 4Y88A 3BWAB 4W6YB 1S7RA 3T4YA 1ZGLM 5B3JF 2DI9A 1CI5A 5D71H 1XCQA 3IU4L 1HOCA 2WUCH 1XZ0A 3NN8B 4HWUA 4UBDD 2GCYB 1JBJA 1BECA 3PWVB 1FC1A 5GS0L 4JE4B 1XF3A 1F2QA 3QDMD 2EYSA 1DVFB 3NABH 3QQ4B 4HJJL 4QF1A 4HCRA 1GOHA 3UC0L 1J0YA 5GGRB 4JM2B 1MEXH 3EYVA 3BGMB 4NQEA 4M62H 4G9DB 2ESVD 1MCBA 3CNKA 3MOAH 2WUBL 3KJ4C 3ARGC 1BREA 3IFPB 5DEFA 5F88B 5T1DL 4TOYH 1AO7D 3ZTJH 2GSGB 4BZ1L 1NMAL 3SKUD 4PJCA 4LNVA 2EC9T 4PJ9D 4M7LL 4UTBH 3DX6B 3QNXB 2FHCA 3MR9B 2BERA 3ZT5A 2DOCA 1EPFA 2X89A 5GRUH 1KXQE 2CLRA 4NWUL 2DIBA 3S5LB 2ICEA 1YY8A 3DTXA 5HYIA 3OGCA 1I1RA 4LIQH 5I73B 5MENE 1NCBH 3Q3GB 1Z0NA 3CAFA 2G60H 4LHJB 5E4IA 2E7MA 5FCUL 4ONFL 5SWZB 3KWWB 3HI1A 1NANI 4PB9H 5FYKL 3BDXA 5E24E 1R6VA 5LBSL 1VGEL 1DBKL 1UWEL 1OGAD 1MCRA 1RIUH 1AI1L 2ATKA 2IC2A 4JFFE 5DD5H 2BVPA 5CGTA 3LSOA 3BQUB 4QOKB 3FFCB 5GGQH 1NCWL 1R0AL 1V8HA 3NGBB 1AGFB 4AY0A 2CR6A 4ZFOB 2R2HB 3W2DH 2BVTA 3QH3A 3H7LA 2X70A 1FJ1A 4FQHA 3MREA 1KELH 2P46B 2VABA 3FO0H 4KRPC 4QTHB 3S37X 4AEEA 2GAZA 5GJTL 4WUKH 1F11B 2BNQA 1EV2E 2DQCH 2NY1B 1UM6L 1UB5A 2ZCKH 3TT3H 1AC0A 4ZUVB 1FNGB 2J8HA 3ARDB 5MHSE 3MFFB 1S9YB 4LSRH 1JPGB 1MF2L 2YSSA 4I2XA 1CVSC 3C9NA 4JZJA 4IDJL 3CX2A 4KKNA 3N50A 1YNKL 3V4PL 2W60B 5IQ7L 1INDH 4S1QL 2BNRB 3NCCB 4GRWF 4KK9C 2ICWJ 3VFWA 3VXUB 4YDKH 1J18A 4Z8FH 1NGXB 1NLDH 2ADFL 4L3EA 3PWUB 5TGBB 4JN2A 4XPFL 5L2KA 5I1DB 1BGXH 1NFIA 5DQ9B 4PRAB 4XCFH 5BV7H 3KPTA 5I1AA 1S5HA 5IVNA 1ZTXL 5GRVK 4MNGE 4ONHB 5KSBE 1QFWH 1IILE 2HYMA 2W1NA 3KYKL 4HKBB 1N64L 4PIRF 4XB8A 2OR7A 2O5ZH 2CDEA 4CN6A 1U3HA 5FK9A 1Q9OA 4U1HB 2VDKH 3B5HA 2NY4C 1BQSA 3ZE0F 5L2JA 5CJ5A 4F7EB 2VLKD 4MQ7A 5JXEC 4GH7B 3NCJH 1N6QL 3GJFK 2R4RL 3MLYL 5KSUA 1CVRA 3B5TA 5GGVH 4KJPD 4LBEA 4JG1H 2NLJB 5E2WH 4BA8A 3QCTH 4RNRB 5I8CB 1UB6A 5IBUG 1ZT7B 4EDXB 4ODXA 3ME0A 3VXRA 3O6LL 3WJJC 5E2VL 4D3CL 1BOGB 4N0YL 2HLFC 1A7QL 4XVTH 4PJDB 1MHPL 2VKXA 3QHTC 1ES0A 1GRWA 2X4UB 1IRAY 4J3UA 2X4QA 4WGVB 4APQD 3MRBA 4FHBD 3TYGL 3HNVH 4WUUA 3SGJC 4IRZH 1KT2B 1H8SA 1DQLH 4LVHB 5D1ZA 3RU8L 4LP5A 2P48B 4PJFA 2ADGB 1P2CA 2B4CC 5E8DH 3MRPB 4WO4B 1DQMH 1FZOA 3VU2A 3WUWG 4DFHA 4PLKD 1U8NB 4KJQD 5B4MD 4HWZB 4V1DB 3IXAB 4X9BA 4KDVA 5IFHL 3D18A 1P5UA 5IJKC 1IC5L 3FB8B 2XV6B 1WCBA 4HIEB 3TYFA 5C08B 1XIWC 4PGDA 1QKZL 3UYOD 4E42A 2ZUYA 3FOMB 4RBPK 4RFNB 1JZ5A 1T0NB 3QWRA 3L9RA 3ZHKA 1A4JB 4IRJD 1IGML 1I3VA 4OLUH 4HC1A 4XHJD 4ZUWB 4JLRB 2F53E 4JO4H 1JVKA 3O3BB 4Y4KB 5EZJB 3AU1A 1MCLA 1ZHBB 4DGYH 4F7CA 3ARTA 1JPSH 3CDGB 2VB5A 3C6LA 3HG1B 5BZWB 2DQDH 5DLML 3F7VA 1N8ZA 4NNXB 3TVMA 1YUHA 3KPNA 3CFEA 5E8PA 3N1QC 2A6DB 3HLAA 1A8JH 2X9WA 4GW4B 3LKRA 5I2IA 1S9XA 3N06B 1V7NL 1Q38A 4DQOL 5M7QA 2P8LB 5C0BE 4L5FH 4M7KH 5A16B 4DZ8B 5EUKB 4AH2A 4HUKB 4K7PY 2EDEA 2J3SA 3DX7B 3I3DA 3HC3L 1H0DA 5DA4A 3QDMB 2Q8BL 3P40A 1OY3B 2BCKA 1FORH 4HFWA 5FM8A 4FMFA 5T3XL 3SY0A 4JFFA 1SJXA 3H9SE 1OP3K 3CVHB 4ZTOH 3ZYJA 2CKBA 1GC1H 1EEUA 2FSEA 2JELL 2VIRA 1FFQA 3ABZA 2IG2L 5CGMA 1BFVH 4GAGL 3ZKMD 5TQ2L 1AO7B 5JNYA 4KDTC 3A6BH 2ZOKA 4OCSL 3VRLF 4W68A 2BOBA 1UXSA 1KCVH 3OXSB 3KYOB 4P23C 4PJ9B 4FNLH 1NBZA 4PS4H 1PBYA 4MNQB 4OSUL 3WNPA 5GZOD 1Q9LB 2NY5H 1ZHLA 1TETL 2DLHA 3BKJH 3SDDB 1YYLL 3MUGA 4HJ0C 1OLLA 4JFQA 1G6RB 2CQVA 3F6IA 3RGVB 5T5NG 4BUGA 5AYQA 3GKWL 1XGTA 1BHGA 2V9TA 5HHQB 1I8MA 2DLTA 2DIAA 4ACPA 2FO4B 2HFGH 3TF7C 3FZUC 3H8NA 1XGQA 1OAYH 1OGAB 1TZHB 1CG9B 5H35B 1MAKA 5FA4A 3MNZA 1NCUA 4QTIL 5DJ0A 4UILL 3VRJB 4XBPA 3MNWB 4DKAA 1H9VA 1AY1L 3TA3A 3HB3D 5E9DE 4LAQL 3QUYD 2WV3A 1S7UB 4NBYB 5D1QB 2H6PA 1CR9L 2GKIA 1TJGH 1KLFA 2VL5A 1UACH 5EU3A 4P46C 1EAJA 5FV1L 3HCVB 2BVUA 4U6YB 4CU7A 1VERA 2ARJQ 4ENEC 4Y19A 5D70H 5KSBA 2C7UB 3T4AB 4J1UA 2VZVA 2XWBA 2XWTA 2H1PH 4L9LA 4F15C 1PYWA 3IFNL 4RQQB 2MTPA 4MDIB 5GQBA 4JDTH 1GZPA 2VKWA 5CP7B 2F15A 5I18H 5EOTB 1EX0A 4XXDB 2J5LC 4HH8A 4X7DC 3MZTA 1N5AA 4BSJA 5HJ3B 1EXUB 1FL5B 3D0VB 4S0SD 5F96L 2GJ6D 2P5WB 3O9WA 2V7NA 4OFDA 4MYWB 2JCCA 3L1OL 3O11B 4M8QB 1IT9L 4PJ7E 1FCGA 5C70A 1RIVH 3NAAL 1G7MB 1QSZA 1DEEA 2DQGH 1RMFH