2D7NA

Solution structure of the 16th filamin domain from human filamin c
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
93
structure length
93
Chain Sequence
GSSGSSGLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 16th Filamin domain from human Filamin C
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-C
total genus 6
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d7nA01
2J6EA 3ULVC 2KDGA 1J0IA 2ICWI 35C8H 2RCSH 5EZJA 5C0EB 4Z78B 5DWUL 1KCSH 1F6FB 1HHHB 3TN0B 4QRRA 3BRGC 2XA8H 2EYSA 1ND0A 2LABA 3MO1A 3PWLA 4HH9A 4I18B 1OGTB 5HGAB 3DUUB 3S98A 1UM4L 1FNEB 3MFGB 4OZIA 3BZEB 4QXWA 5DJ8B 3VG0L 2ED8A 2EZ0C 5HI4D 5LBSH 3GZKA 3C8KA 3RHWK 2PW2B 4XB7A 3S36L 4QHMA 2L7UA 3VWJA 4JLRA 1DFBL 3MRFB 3DX8A 2D9QB 1FNGA 2Z31C 4JFEA 4FP8L 1NKRA 5FO8B 4QTHB 4TUJA 1GXEA 3G6DH 1YJDL 2V5TA 5DT1H 3IDIB 2CDFB 4PJBA 5GRWA 4PY8I 1T21B 4RMVA 4BKLA 2SEBB 2NY3D 3PHOA 3IJSA 1FZJB 3GMNB 5CEXB 3H9SA 1FL3B 1L4IA 3RVTC 2H3NB 3SDDD 1A47A 1YJDC 4OGZA 1JGVH 3DIFB 4QHUB 2H8PA 1JN6A 3GGWB 3DVIA 3M8OH 1NL0H 1CF8L 1ZWIA 2DJ4A 4POZD 5GRJL 1MHEA 2JJUA 3QZWB 4K23H 4L3EE 1K6QH 3BWAB 4F3FB 4K71B 3PNWA 1T04A 2RHEA 2UZXB 2CDEA 4ODWB 3DYOA 3BN9D 2CJUH 4W70A 5IB3B 5EWIL 5GS0D 5CHNB 5FYLE 5HHNB 1IGTB 4L8SB 3SKOA 5LJYH 2D4DA 1IM9B 3DRQA 4JRYB 3NA9L 3MRNB 3K4AA 5D2LF 4UNVA 3G6JF 4WI7A 2RFXB 1IGYA 4S1RL 1PZ5B 1EAPA 4QOKE 3FZUC 4YNYA 3SO5A 1C5BL 5HDOA 2J8UB 1KIRA 4CL7A 3WXWL 2EDFA 3CK0H 4NIKB 2W60B 3EGSA 1LEGB 4LQ1A 4CNIA 4R3SB 3SGEI 3OR6B 3SDXE 4G6AC 3INUH 3GO1H 5IW1A 4N8VA 3VG9B 2AJ3B 3VGBA 1NBVH 4YHKL 4U6YB 2BSTB 1UCTA 4JFZL 3HUJA 3RWDB 3BYYA 4PJ8A 4JHZA 1V7ML 1T6WA 5IEKA 4ZNCD 1MEXL 2Q8BL 4I48A 3WHE1 4MHHG 3QQ9C 4I0PB 3TBWA 3VA6A 4KTYA 5F3HB 1U8MB 5IB2A 4XI5C 1QFWL 2BMKA 1RIVL 5ACZA 4HW6A 3JUYA 2ZOKA 1RUAL 1G7IA 1X44A 1IGIL 4PGCA 3O3EA 3BDXA 3QULA 5K9KA 1XR8A 5BXFB 5DEFB 2VR5A 2IBZY 1U8JA 2MSPA 1WZMA 2CUMA 4IJ3C 4J3TA 3PL6A 5HVHB 5EB9A 4KH2A 1B90A 4DCQB 2C1OB 4NZDA 5TGBB 4U6TA 1XCTA 4M3JA 4LPXA 2FX7H 4JGMA 3T4AA 1T22B 4GBXC 5LBSL 1BEYH 3RQ3A 1HHGA 3W81A 1AGDA 2F5AH 2H6PA 1MPAH 2V2XA 4OGYL 1UGNA 1NGQL 1XGQB 2YXMA 2HJKA 3LQAH 3QIWD 5H2BB 4U6XA 3VD3A 3WDIA 1U91B 5CINL 4EI5A 5CSZB 4LAQL 1ZHKA 5I1AA 1NFDF 2C3VB 3KS0H 1MWAH 2IALB 4JPWL 4HJ0C 1MHCB 4FMKA 4HMCA 2EDNA 3PWPE 5DEFA 3U4EA 1SQ2N 2BJML 5J9PB 2M2DA 3VH8B 5E6IB 4NUJB 1KLFA 3ZT5A 4OM0L 5ILTL 2ZOKB 1J11A 3LS5L 1JGVL 1F02I 4IS6B 1DBKL 4HFWA 2AXFB 3QEGL 1RFDL 1U8MA 4IRJA 2BZDA 2ERJC 3UJTH 4Z0BL 1YMMD 2KBGA 2YUXA 4EKXA 1ADQH 4X8JA 3TWCL 4X6DB 4CVUA 3HUJB 3RWDA 1W0YT 4U6YA 4L9DA 2EZ0D 3RGVD 1AJ7L 4JN1H 4YDJB 2WSKA 2R0ZL 2DQGH 1OSZA 3VI4E 4PY7A 1YNTB 4WI4A 4B7LA 1NUGA 1OAQL 4ELKA 2AJYH 1WBXB 2UUDK 2I25N 5GRYA 1VFBB 3RVWD 1AP2B 3HE6A 3IDXL 4G8EB 3U4BL 1FNSL 4JHAH 4KUCD 3PQYE 4DZ8A 1JHKH 1OQOA 3GMQA 2AK4E 1OSPL 4ODTH 5F8QC 1PZ5A 2JCCB 1UH4A 1W0VA 3G08B 5ITBH 5DC0A 4IIQB 3TIDA 5JIPA 4JM2C 1INQA 3VXPB 3GKWH 1KF9B 4LKXB 3WDHA 3DX9A 4PRIA 4LNRB 5EO0A 4LLWB 4KTEH 3HI5H 4JDVA 3B9VA 1TZHA 1UC6A 2DIAA 4KY1H 4WTXA 1JBJA 2AVGA 2KZ1B 4MAYD 5C07D 4APQC 2EXYD 2NY3B 2VITA 2FLRT 4K3GA 1CFBA 4P2RD 5J12C 3QZWA 4OFVA 3AXLA 3PQYA 1EEZB 3SGDI 5DMYA 2APXA 2YRZA 5GJSH 2AK4A 1U8HB 1P7KB 3HNSL 2HFFB 3N1QC 3Q5OA 4XNYH 4KUCF 5CSGA 2H8PB 1EA9C 2VE6A 4WI8A 4LCUB 1SYSA 2LAGB 4F7CB 4Q9CA 4TTDD 4ODVL 4LSRH 4NC1E 4ODSH 4YHZL 1QACA 4OZGF 5T1KD 5I1HL 1FE8H 1YEKL 4HC1H 4AM0A 3U0WL 4PJCE 3CUPB 3WUWG 3QJHB 4ESKA 1T21A 3I50H 1TVHB 1ITBB 5F72S 3WL9B 1RZKC 4TUKL 5F9WB 4K7PX 3O6KL 3P0VH 3WIFA 3BXNA 3QDMD 3UDWA 1HKLL 3ZLQC 3KHQA 1RU9L 4JLRB 5JNYB 1JZ4A 5EPMB 2F5AL 4LGSB 1TJGL 4KQ4L 2OTPA 2V7HA 5FYKD 3P77B 4WWKA 2C4XA 1G7LB 3ALWA 1IQWH 5DJ8A 2GCYA 3KYAA 2VN4A 2ZUYA 4S1QH 1RJZA 3LKOB 4HAFA 3PWLB 1Z3GH 4IMLA 5HYEA 3ECBA 1A9BB 3ARED 1XCQA 3K4DA 3LEXB 4EN3C 5C0EA 4NQSA 1F5WA 3WLWC 2LVEA 5AEAA 1VKXA 5IMLA 4ZUUA 7CGTA 5EUOF 4UILL 2P5ED 3O3AA 1NGZA 5SWSE 2RIKA 4M43L 5EU6A 1TQCB 3TIEB 4KTDH 4PRPE 4XCYA 5EO9B 3EZJB 1QSED 5IFAH 3VRIB 1FDLH 5IR1A 2XQYK 3C08H 2EYRB 1C5DB 3C6SB 1I9IH 3GHEL 5DJDA 2XN9D 3D18B 4JN2B 3WHXB 5E8EA 3IVKA 1U3ZA 3L3DB 3VFSA 1OWRM 4AEHH 5LCVH 1QNZL 5JLZB 3B2UC 4MSWB 1GZQB 4WHCA 5HPOA 1QP1A 1U3YA 2R0ZH 3TN0C 2BSRA 5GS0C 3MMEB 1FRGL 1NEUA 1SJHA 2D7QA 4GW1B 5F93C 5GRUH 4K2UH 1HIMH 3ARQA 1FZOB 2B4CL 3OB8A 3RX7A 5I1DA 1FNSH 4D9LH 3WFHA 1HKFA 2X42A 3QWOA 4OLXL 3WHE0 1LO4H 2AS5M 2NY2C 4LAJH 4FTVB 4LVEA 4OCYL 2J12B 1AGEB 1YUHB 3FQWA 4QOKD 5CILL 4QXGH 4PJEB 3SCMA 3PF2A 3BW9A 3L3OA 1HH9B 2ICEB 2IBZX 2Y36H 2FD6L 5AUMB 4C55A 1FLTX 3WKMH 3Q2CA 4MNQB 5DTFB 4NN7C 2XXCB 4I18C 3ULUE 1UEYA 2P5EE 3MUHL 1J88A 3ILPA 5SWZB 2Q1EA 1II4E 1E4KA 2ARWA 3QG6B 4U05A 3VFTA 3KPLB 3OGOE 2DMBA 4IM8A 1RZIA 5DRWB 1FL5B 2R1WA 3FQNB 1A3LL 5HDQL 1HDMA 1OGAB 3HNSH 3R4DA 3X13A 1CD8A 4NN7B 4KKCC 2YPKA 4HFUL 5BS0A 2UYLA 1A3RH 1MCNA 2ITCA 3WXVH 3I6KB 4QWWC 5ITFB 2NY5H 2DLEA 3Q5YA 4L1HA 4S1SL 2FJHB 5FDWB 3VH8G 4HPYL 4O02H 4F58L 5DJCB 3RGVB 5IIEB 1PQZB 5TJWK 4OUUA 1DQQA 5BJTB 5EZIH 4FQXA 3AU1B 3DUSA 2ZOLA 4PRBB 4R96A 3NAAH 4K3DH 3HE6C 5C9JA 3EAKA 4LDOB 1U8NB 5FKAB 1HQRA 1A7QL 1B0GB 2GJJA 3WNMA 3TVMB 4Y1AD 2B7DT 4FNLL 4GG6A 4KJYB 4GKSA 4NNXA 4U1IB 5IHZA 1ZEAL 2NYYD 1OPGH 1A6WL 4GH7B 1MVUA 1A6AB 5I9QC 3OKMB 4NRYA 3VI3E 2H45A 1S9YA 4NPYB 5DFTA 1DBML 2VXUH 5AYQA 5E8OA 1LNUA 4WFED 2EIDA 4LOUC 4NYLB 1CU4H 5I8EA 1P2CB 1A6TA 4KK8D 5FM8A 3VDBA 1J05A 3MUGA 3SE3A 1LD9B 1JF5A 3SOBH 1DCLA 4O51A 1SJHB 2W0FA 2VZTA 4NHUB 3X12A 5IFAL 5F1IB 2MCG1 1XZ0A 2XWJB 1FAIH 2HRLA 1UACH 2NXZB 2XICA 3B2UD 3O8XB 4HDIA 4LARL 1E4KC 5D7IF 3VFSB 5GGSB 3GSXA 3GBLA 5D71H 5GISL 5HVGB 2HJLA 3RDTA 1DVFB 4XPAH 5T1KB 1ONQA 3IFLH 2AEIT 1I7RA 3FB8A 2PO6C 4K9EL 1TETH 2HH0L 5BZWB 4F8QA 15C8H 1TJIH 3BDBA 1DDHB 4BSWA 1MJ7H 1JL8A 1HNFA 3VGDA 2DM2A 1NLBH 3MNZA 1ZLVH 4UBDD 5MEPB 2CH8A 3HZKB 3ZL4L 5M95B 1EFXB 4RFEB 5CZXC 1XF5A 4NFBA 3ECBB 3IXAB 4Z7NE 3IU4H 1MIML 1N7ML 2WQ8A 4IRJC 5JZ7C 2VABB 3E3QE 1P4LA 1CI5A 2XTLA 2E6QA 5IVOA 4U1KA 1UWXH 3JV0A 4X9HA 3DV6A 4PJGB 3RL1A 2OR7A 5GZND 2D2OA 3WKML 5IB5B 3U79A 1K8DB 1A5FL 2PKDA 1C1EL 1F11B 3AREB 3GSWB 3BEWB 4MCZA 4TSAL 1EH9A 5JHLH 3V5DB 1PGRB 3VXTA 3DBXB 1F3RB 3RVUC 4F2MA 4XAKE 3BXNB 2DLHA 3H6JA 4HIEB 4LPTA 4RSVA 3EFDH 3C6LA 4C59B 5C09E 3WL9A 3GBML 3C5ZC 3P4OB 4P4KB 4JDTH 5E2TH 3FMGH 2KPNA 1YYLL 4P99A 3WJLC 4J23A 4PJFF 1PSKH 2DKUA 4ZS7H 1NCAH 4XNMA 3QUMH 3JBG7 2DS4A 4HUMB 4NNPH 2X4OB 3MJ7B 4O02L 1MHPL 1RD6A 5TDOB 4ODBD 5EO1B 5JO5B 3V9FA 1G9EA 5FOBA 1QBBA 3SPVB 2LQRA 1FNFA 2HFFA 1U8PB 4KMTH 3HE7D 4APQA 4O58L 2X4TA 3QQ4B 1PVHA 1UH3A 2VDKL 4L9LC 1HEZB 1LE9A 2XT1B 3RIAK 2X7LB 4GO6B 5D2NC 3VXUE 3HE7A 4APQD 1HH6A 1UJTA 4Z7QF 3C2SA 4JFDB 4HF5L 1UWEL 3QG7L 1AO7B 2ZPKL 4PJAB 3O9WB 5GGQH 4Q9RL 3VXMD 3SDCC 4GKNB 5BVPL 2EC9U 1N2RA 4U1SA 3MODL 1AR1C 3MA9H 1LEKA 1NBZB 3ARPA 1BREA 1ZE3C 4X7DC 4B7IA 3EOAA 4YBLC 4Z7OE 5F21B 3CMOH 4XAKD 1FJ1A 5EBLB 3GMLB 5L8JB 3U6RB 1NCDH 4I9WE 4PD4J 2F8OA 4ZXBA 3Q0HA 4YDIH 4M7ZC 1VFBA 3SOBL 3P0YH 5BVJA 4ELKB 4JZJC 3THML 4E41D 5D7LA 2DIJA 1KCVH 3RRQA 5DVLA 4LLDB 5HJ3B 3S5LA 2Y72A 3WFCH 3ZTJH 5D7LB 1UVQA 5FM4A 4NHCL 1L9MA 2QSCH 3AS3A 4YPGA 2Y06H 5D71L 5DJZB 4GW4A 5GIRA 1JHLH 5I1JL 2AV1A 4RGNE 1CFQA 3EKCA 4X80L 3S96A 2VDLL 2GSGA 1TETL 2HH0H 1S7SB 4R4BA 3VWJC 3B9KB 3U2SA 4PJHF 4Y8AA 3PV6A 3L5XH 5IF0B 4Z7VB 1I7UA 3HRPA 4RFOH 5TPWH 1GIGH 5IQ7L 1MREH 1K4CA 1AO7A 5ENWA 1I4FA 2DLTA 1K9TA 1B4JL 1I8MA 3MRGA 4LP5A 1ACZA 3QXDA 1XFPA 1MIMH 4S0SD 1U91A 2FZ3B 1ZTXH 4HT1L 5L8LB 1LEIB 3H3PH 3R1GH 2YUVA 2AEWA 4DKAA 1LHZA 1NC2D 1BBJA 4YDVA 1HI6A 4PRNA 4I5BA 2F5BH 3FFDB 3FRPG 5IHLB 5IJVB 3T08A 1C1EH 1T83A 4PBVC 1A6VH 3CFDA 4Z5RA 4GXUN 2CXGA 5C0CE 1ZANL 4Z7UE 2NY1C 2XI9A 2P24B 3L95A 5LAXB 1UKTA 5HHXL 5FYLL 1S9WB 2Z35A 2DL9A 1NJ9A 4U2YA 1HHIB 1S9VB 4JFXB 4PRIE 3TP4A 3LH2L 3JWOL 2JB6B 1AI1H 2D7TH 1UWXK 1KACB 3F12B 4Y4HD 3VWKD 3KLDA 1UT9A 5E2UL 3W9EB 1BFOB 5AYUH 2CDGA 3UC0H 4QRTA 3TNMA 2VXTL 5TQ0L 3LEYH 2BVQA 5IB2B 4OLZH 5CUSH 5ACMA 5DMKA 3RGHA 4MXQD 5IB5A 2V6HA 3VXRD 1YEJL 4GG8B 4HUVB 4I48B 4U1KB 4JM2F 2IQAB 1JFQH 1ZLVK 4GKZA 5KVFH 4PTTA 3RA7L 5ICXA 1MCOL 2CKBB 4WUKH 2IGFH 3HMXL 3LV3B 1D9KD 2HTLC 1XF1A 3KJ6H 3SQOL 1DTUA 4NWTH 5GGQL 3DMMD 1IM3A 1MCCA 3PWVB 1R3JB 4HS6B 4OD2B 5AZEH 2FHFA 2HFEB 1K6QL 2ORBL 3N1FC 3AVEA 4M1GH 2YR3A 3ARZA 4LOUD 1KPUB 3FFCB 4P5TB 2W0KA 2ATKB 3C5ZA 1HXMA 1IEAB 2R15A 4PFEA 3ARFD 1NANH 3PXJA 5L0QB 4OAWB 2JE8A 3C87A 3IDNB 4YHIA 2VC2H 5AZ2H 3DRQB 2EDXA 3UCRA 2JELL 3CD4A 4M7KH 1E4WH 3P0YL 2P5WA 4Q0XH 5I8CA 3WUZA 3BN9C 1S5IL 5T3XH 2E7BA 5J6HA 3S35L 1ZHLA 1JJUA 4TRPH 2IPUG 2UY6A 1F4XH 2WUCH 1UM5H 3I84A 4Z9KB 1BQHA 2YN3A 4PYGA 2WBJD 1OF2A 1MCFA 3A6BL 4U6HB 2X4PB 3MJ6A 3A67L 5CZVL 1LK2A 3QAZB 2GJ6E 4L3ED 1J86A 5TDPB 2F53B 3DIFA 1LNUB 4G6FD 5EUOB 1VESA 1BF8A 1KB5A 3RPKA 5KS9F 2OSLB 1INEL 5E5MB 2BFVL 1MAMH 3SDDC 1X5IA 3HZMB 5F9OL 3TJEH 5I66A 4NRYB 4UOW1 3GSNA 5D2NA 2N56A 1A14L 2D0FA 3FQUA 3UBXI 1OB1A 3VFUA 3Q6GH 3BGAA 4KPHL 2YD5A 3IKCB 3O9WD 4N9GB 3V0WL 2EC9T 2G2RA 1VGEL 3A6CL 1B0GA 1OW0A 4C56B 1H0DA 4PG2C 3FQTA 1DEEB 4WO4B 4X6BA 5L2KA 1FG2B 3VDCA 5FA4A 4V1DD 1KJ3L 3MGOB 3G9VA 3L5WB 5HHQB 2E6PA 2ZNWA 4ZFZA 4R7NB 1TENA 2QADB 2F54E 3T2NL 3UP1A 1CD9B 1JK8A 2IF7A 4LIQL 3P2TA 4I3RH 3IFNH 1HYSC 1BOGB 4HCRA 5F89A 1YDPB 2Z4QA 1ZHBA 3BGMB 4G43B 4KJQC 1ND0B 2YKLH 3MO1B 4HH9B 1VCAA 3HR5A 4TUOB 3JV4A 2FX8H 1BEYL 1GOHA 3BKYL 1F4YH 1MFDH 3W11C 4URTB 5JQHC 4D2NA 3N1MC 4YH6A 4OZHE 3HZYB 5JOEA 4BFBD 3EYOA 3F7VA 4JQVA 3HR6A 5GGTL 1S9KC 5IFJA 3MRKA 2Z8WC 3WEXB 1CLOH 4XMKH 4QXUH 3IF1A 3I9GH 5GRZA 1W72B 2N7BA 1O5DT 1T89C 4HUKB 3FOLB 1OB1B 2X4NB 3MRLA 2OTWA 4LCYB 4O5LH 4UDUA 3HAEG 3G5ZB 3K8MA 1SVZA 3VGAB 2VXVL 3MZTA 1JTOA 2VIRB 1DLFH 3HZMA 5FFLA 3WIHH 4LLMA 2R9HD 5E2VL 1MCOH 4WUKL 2OL3A 4PJ5B 5E9DB 3QDHA 1JYWA 1A8JH 3T77B 4UU9B 4NM4H 3D9AL 3HB3D 1P6FA 3MBED 4KZDH 2NXYC 4HJJL 4KRPC 4LF3A 5A1AA 1BQHB 4FG6C 4ODUB 2E27L 5FDYA 3L1OL 4H8WC 1ZLUK 3F58L 1R0AH 4JY4B 4Y5YA 1V7NH 5CSBA 3UZEA 4UV4L 2ZP0T 4JRXB 4R0LA 2IMNA 1XMWA 2ZUUA 1UB5B 5CEZD 5FGCE 1KG0A 2JELH 4QXTA 3DRTB 3VFOA 1KCKA 5C0IB 3HUJF 4HKBB 4ZFGH 1BP3B 4JJ5A 3ZKMD 1OSPH 1RHHB 1KJ2A 3LKPB 3RJDA 3S97C 4EBQL 1M05B 1FFQA 1ZT4B 2EDOA 4J3XA 5DD0L 3S35H 4KRMB 3P4NB 3TIEA 1HWHB 1UM5L 2XN9E 3NZHL 4NC2B 4Y4HB 3SQBA 2NY2D 4F7TA 3AS1A 4YXHH 4JO2H 3GJFK 5IMLB 1E27B 1A4JA 2PXYA 4KTEL 1GVIA 4M8VA 5C92A 1XCQB 2ARJQ 3HNTL 3BUYA 4MA3B 1WLHA 3HC3H 1TQBB 1OD9A 3MNVA 2AXHA 3SE4A 1XAUA 3EOYG 4G6MH 5ISZB 2B8OT 25C8H 2FO4B 3MLSH 6FABL 2FBOJ 1BZ9A 5KVGH 1NMAL 5LWYH 1FIEA 4RGNB 4WFHD 4U7MA 5IEHB 3VU2A 2VLKD 3MLWL 2PNDA 5E0QA 1I1YA 4M4RA 2G60L 4GG8A 1CBVH 2QHLA 3QXAA 2DQUL 4OFPA 1MFBL 4JJHA 1DQJA 3OF6A 4ZOAA 5SX4H 5T1MB 3AGVA 4NQCB 4QRTB 3K2UL 3NTCL 1YECH 4D0CB 1CICB 4JPIA 4Y4KB 1EUTA 4QWWD 1CT8B 3WO4B 4NN6B 4QF1A 1EGJL 4P2QB 1G1YA 1JRHL 4M61B 2PTVA 3FFCD 4U49A 4OF7A 4LFHG 35C8L 1ITCA 4TUKH 1GGUA 1Z5LA 3QO1B 1CLZH 3PV7A 4KVCL 4AMKL 3OAZH 5C0AB 1WBYB 5L2KD 1TPXB 1S5HB 3LN4B 5E6ZA 1SYSB 1AD0A 1NGPL 1X4ZA 3T0BA 2VXQH 2QQKH 2J2ZA 1J0JA 1ERNA 2ADGA 2PYFA 4I77L 4QY8B 1A7OL 4U2ZA 2Y25A 2X4QB 4YO0B 3HTLX 1KTRL 5EOCL 1ZKAA 2A9ML 1EEZA 4ZQKA 1LEIA 3X11B 4HWBL 4PV8A 4Q6IC 5HGDB 4E41A 2F53D 4JZOB 5DT1L 1I8MB 4FFWD 1MWAA 5EU3A 3KPRD 4NFCA 3FT3B 4LCWD 5F96L 5BV7H 2X4SB 5DJAB 2QBWA 4Y19B 3X3FL 8FABB 2Q7YB 5CLWA 4JDZA 2FR4B 5IB1A 2QQLH 5IF0A 3ARBB 5IMOB 2E3VA 4KTDL 1RUPL 1J18A 1MFAL 1PG7W 1QSFA 2PW1A 4ZODA 1S7SA 2AJSL 3OHXB 4WGVB 4MNHA 1QVOA 3UTSB 4HHAB 4M48H 2NR6D 5ETUA 1MRFL 4POZC 3NIFE 1ACYH 3MACH 2OS7A 2MQ0A 5EDXA 2QSTA 5DYOB 5MENA 1NFDE 2Z93A 4L9LA 3TCLA 5GRJH 2Q3ZA 3KGRA 5LCVL 3L7EA 3UYRL 1PJ9A 1IILE 1E4XI 4NO3A 4Q6IA 4TVPE 4WIQA 4PJXA 1VFAA 1ZLWK 1UKQA 1CQKA 4M5YL 3N50A 3V6FB 1FL6B 2JIXD 3MV8B 1BLNB 1R3LB 3J8F7 4N1CA 3QEQD 4I3SL 4B50A 1QHPA 1WZLA 4IRJB 4Q2ZA 3O6FD 4ZFGL 2Q6WB 1A1OA 4AIXA 1T20B 4KK5C 1Q72L 4S1RH 1QLRB 3OHXA 4ZTOL 4F7PA 5EA0H 3H0TA 4N90E 4X83A 4J2XA 4HULB 4M7JH 5D1ZC 4JFOA 1M7DB 3FO1B 1MHCA 3VXUD 1AKJD 4O4YL 5FYJU 3FT3A 4J3VA 2XWBB 4PV9B 5ELIA 5EU5B 2BC4A 1UADC 4JFDA 4G42A 5MEQA 2OJEA 3ARSA 1JNHB 2R2BB 5A2IH 4PUBL 5KVGL 4X6CA 2EEBA 1PEZA 2BVOA 5DVKA 1FGNH 5DK3A 4CDHA 3OZ9H 2AJXL 2J3SA 1U95A 5D2LB 1U8PA 3SPVA 3U9PL 3E8UH 1HHGB 2XKUA 1A3RL 1XF2B 3ZDZE 2I60H 5INCA 5B21A 3GBNH 1UXSA 2X4OA 3MJ7A 4MJ6A 1IJ9A 4F37K 2NY4D 3FB6B 1MIEH 3TO4D 3BE1L 4XNMB 3BO8B 3Q6FB 5KSAD 4H1LB 4D9RD 1JRHH 4LSQH 3EBAA 3V95A 5A40E 3QDGE 1OTSC 3ETBF 5F7UA 5L8KB 3TZVD 4X5XB 4FQJL 4JRXD 4P2QA 5EBWB 4A6YH 4PJCB 4P23A 3T3MF 3GIVA 4XCEB 9CGTA 4PGCB 1KCUL 1S7XA 2VAAB 3WBDA 3TJHC 1ZGLB 3CZFA 1T7YA 1DVFC 3WIIL 1YN7B 4G8FB 4IBLT 2C1PA 2FDBP 4LDLB 4U7SA 4WW2B 5F3HA 1F00I 1FZKA 2D4FA 2BNRA 1OM3H 5IMMB 4YHMH 3RL1B 4ZTPL 1ZVYA 3P73A 3BEVB 4IOFD 4WU7A 3RL2A 3ZE0E 5C0BB 4P49A 1KLGB 1KENH 1AQDA 1ADQA 2AJ3A 1UWGL 4HGKC 1CD1A 2L0DA 5E1AA 3BP4A 5EIIA 3N9GL 3V4PH 2IPTH 5ISZD 1CU4L 5ICZB 4RGNC 2X1OA 1I8IB 3D85A 4NO0D 4HMDA 5DHYA 3RWIB 2HTKD 2FL5B 4ONGL 4Z8FL 2VLKB 1J0KA 5KS9B 1J7VR 3NGBC 3MBEC 1CGWA 2JK5B 3ZDXF 2HVJA 1FAIL 3NCYP 5J1AA 2LU4A 3HCVB 2W65B 4NJAL 3OGCA 4ORGB 1X5YA 2XIDA 3SDCA 2H2SD 4LU5L 5IG7B 3FRPA 1KPRA 4ELMB 2HT3C 4Y4FB 1IM9A 4UV7H 2VDNL 3TWCH 3SKOB 3RWJA 5CHNA 4ONHB 5HHNA 1BVLA 4XPAL 1WWWX 4JRXA 2IADB 1U3JA 1MJ8H 3FN0L 3GSRB 4P2QD 1DE4B 4JN1L 3QDJB 4MXQC 4JY4A 5F1IA 5DC4B 3B5TA 2D0HA 2NY0D 15C8L 2W0FB 4TQEH 4DWHA 2OP4H 4R6UA 4XHJC 2AXGA 1X5JA 1LD9A 4MVBD 5FGRA 4GW5A 4WHTB 2R56L 4MQSB 3V4VH 2DYPA 4HX1A 3CH1B 1JWMA 4KKLD 4NZUL 3IU4L 4NKDA 1A02N 3ARUA 3CX2A 4XVUD 1WFNA 1I9RH 2VRAA 4PP1D 3BQUB 4LLVB 4Y16A 1FZJA 4WU5B 1F2XK 5J0BA 2VXSL 1CE1H 4LPVA 5GRXG 2VDQL 2CRMA 5J3HC 2V7NB 2F58H 5EUKA 3S34H 2V2TB 5CZKA 4JFQA 4LCWB 1GPOH 1Q0XL 1U6AH 2E7CA 3MCKA 1IQDB 2ZSVB 1NSNH 2ZG2A 1P7QD 4BZ2H 4F57H 1NGXB 1HWGB 4RAVB 3AU1A 2IANA 4FQXB 1X5AA 1KELL 1JYVA 4HQQH 4LSUL 3S37L 3SJVE 4F33B 5F7HA 4ZS7L 1NCAL 4Y89A 1DZBA 4KK5D 4ZYKA 3BE1H 3PWJB 1WC7A 2FEDD 3O6FC 1JMZA 3W2DL 1D5IL 2R0WH 1I1AD 4JR9H 4LSSH 4OQTL 3GM0A 1YPZE 3FQNA 4TPRH 1H15A 4H25B 3QDMA 3FQTB 4NJ9H 4X6BB 3ALXA 4HSQA 4D9RE 2A74B 5EOTA 4ZUSA 3WUWB 4JM2A 4PJ8C 2OQJA 3RVXD 3EO9L 3ZE2F 5C86A 1H9VA 2NX5A 2MFNA 1OP3H 5C0AE 3ZT6A 5IVXE 2Y5EA 2CRZA 1OM3L 4X4XA 1Y0LB 4L8BA 4UDTA 1QLEL 3IFOB 4P48A 3SDXB 1X6NA 1N64H 4G80A 5EC1A 1I8KB 1KUMA 2F54A 2XG4A 3BUTA 4GXUM 1L0YA 2FLBT 3OKLA 1P5UA 2ICWB 2V17L 5F1OB 5D96B 3CMOL 5ANMA 4PRDB 3WS3B 2B20A 3MBXL 1MNUH 5DEZA 2FWOA 1CL7I 3P9LA 5GHWH 2Z8SA 1QEWB 5DHVH 2CKBH 4IOIB 2UVEA 4W6XB 3RUGB 4RMWA 4RX4A 3MMEA 5GGRA 2L7JA 3WFCL 2BNUA 5D8JH 1RIHL 1RSFA 1IL1A 1A1MB 4LU5H 5DHVA 3X3GH 4CU8A 2DN7A 2ITDB 2XQBH 1NCCL 5LG1A 1T6VN 2VDNH 3IVKB 5EFIB 3TYGH 3WHXA 2H1PH 1HCVA 5HYJB 3QEQE 2A6KA 3QWQB 1MHHA 4OGXL 1RZKH 1SBBA 5F1KC 1K5NB 1NCWH 5IR1B 3T4YB 1F58L 3TZVB 5GSRA 2HP4A 1Z9OA 3JZ7A 3K2MC 3P4LA 1Q38A 2DQFB 1A7RH 1ZVHA 2HFEA 4YE4H 5ACLA 3WD5H 3P30H 4HS6A 4XPBL 4TVPD 2Y6SD 1HIML 3DYMA 3NN8B 5TPWL 2UWEA 1RULH 2DM4A 4KKAC 3KDMA 3QUZC 1T1XB 3UTZB 1B4JH 5FYKH 1P6AB 1U8LB 4MJ2A 3SGDH 2RQ8A 2FNBA 2ZKHH 1CXKA 2NNAA 1QYGH 3QXWA 5IBTH 4I2XE 5HTSA 5C0BD 4UT6L 4F7EB 3DX7B 3QPXL 1G7LA 3PGCA 4PB0H 2OL3L 2V7HB 2YWZA 3BN3B 1DN0A 4MQTB 1AD9B 3AB0C 3RUGA 4RISL 5D7JD 4OLWH 3C5JB 3S34L 5CEZL 4HAGA 1IKFH 1JUFB 3V8OA 3TNMB 1FSKC 4UB0L 3CFBB 4FQQB 4AG4L 5ID1A 2HG5B 5GS0L 3MLTA 3M17B 4MA7L 1AIFB 2WBJC 3KPOA 1AXIB 4IMKC 3IDUA 2VLMD 3QXVA 1QFOA 5D2LE 3W39B 2IC2A 4JZJB 1ZMYA 4J6RL 4PGBA 4PJHB 5ERWB 5TDNA 3P4MA 3RTQC 5E2UH 1YNKH 3RWGA 5E8PA 3IJYB 4L8SC 1HHKA 5I30H 5D6CA 3W2DH 2ED9A 3RAJL 4L4VA 2NZIA 1KN2L 4P2RE 1Q0YH 4KGLA 4LSSL 1AQKL 2OXHA 1NCBL 3BAEL 2AK4B 3GSNH 2WUBH 1J5OL 2VQ1A 3C60B 2MQCA 1ZLSH 1YZZA 3M07A 1D5XB 5DDHB 1INDH 5IGXH 4FNLH 2R9HC 1UG9A 2XV6B 3SQOH 1T83C 3OJVC 1G9ML 2PCPB 2NY7L 2DQTL 2B5IC 4O2CB 2GQHA 3OKOB 2Z31A 4QLRA 4LEXL 2E7LC 4ZAKB 2QEJA 3CSPA 1W0VB 4P3CL 4QNPE 4OI9A 3LKRA 2V17H 3H9YA 4GSDH 2XY1A 3TVMC 4IDLA 4MX7B 3CX5K 4PR5B 1IQDA 3CC5B 1DUYA 3ILQD 2VC2L 5AZ2L 2F8VA 1MY5A 2C3GA 1P7QB 4YPGB 3S37X 1FFPA 2H26B 5EUKB 1OCWH 1WBXA 4XTRC 1XF3B 3I3BA 3G6JB 5JPMB 4FQXD 2YPLE 1JZ5A 1IC5L 1OSZB 5DJYA 3D1MC 1ZV5A 1NDMB 2ZUQC 2W91A 1SJVA 2XQBL 5D7LE 3D69B 5GISH 4U3XA 2FHCA 3DVFA 5CGYD 2NYYC 4PPTA 2DYPB 3ARGA 3CH1A 3TLRA 4KJPC 2DJUA 3DXAD 1EVUA 1B0RA 1TCRB 3H9ZA 1MAML 5EU7C 4DGVH 1LEKB 4HXAH 1GZPA 4PRHB 4R26L 2DI7A 4BH7B 1NMBH 2IFFL 2ADJB 5GS1B 1JYXA 1JPFB 2DWDA 2CLZB 4JANB 3MREB 5BZDA 1YQVH 4YK4B 3O11B 1KT2A 3EYVA 5T3ZL 1WT5C 2R23B 1JNNL 1ZHKB 5I1AB 2WAHA 1L0XA 4DOHB 1RVFH 4OLVL 4KJWC 4MXWL 3SDCB 2J6EL 4JFFA 3O9WC 2X2YA 2XKNB 3LHPH 2X4TB 4P46D 1IGFH 4JGJA 2RGSA 5EH1A 2J4WL 3JTTA 4YC2C 5L2JA 5EBGA 2EDBA 3A0OA 2FL5A 4NGHH 1KCSL 5I74B 1D3CA 1OAUH 3MRPB 3RY6C 3SJVD 2C1OA 1BZQK 2PF6A 1MRDL 1U3HB 3ARDA 3BPCB 2DQEL 3RL2B 4DN3H 1WF5A 4P5KB 3EZ8A 4L8DA 3VGFA 5I2IA 5FB8A 1CQYA 4MJIB 3L9RA 3DTXB 3RNKB 3BIAX 5BCAA 1CFVL 4ZO8A 3F7YA 3VXTB 5BMFH 4X5WA 2FRGP 2BMKB 1KN2H 1TNMA 3MXWL 3VXRE 1K8DA 3GSWA 1Q9OA 4GAYB 2HMIC 3P40A 1CN4A 3QPQC 4ZDHA 5HGHA 3KPTA 1XF4B 3GI9L 1JPTH 1P4LB 1QFUH 1U3HA 2C7UB 1WK0A 1INDL 5DZLA 1KIPB 3SE4C 1UJ3C 2CO7B 4OCRL 3BESR 1LEGA 1BQLL 1RJLA 2FX9L 1XF2A 2R2HA 4ZS6D 2J8UA 4RRPG 5MHSE 3LB6C 2KQMA 4FQCL 1KTDA 1NH6A 1RJYB 3DO7A 5TE6H 1EO7A 1U0QA 5D2LA 5D4QA 4BSWB 4P3CH 4M6NH 4M6ML 2XKNA 3OKNA 4NRZB 2RFXA 1B2WL 3VXSB 1QRNB 4FFVD 4X6CB 5FHAL 2IAMD 1QQDA 2C9AA 1OGAE 3AROA 4TULL 1AHWC 2OJEB 2HVKA 4NCC1 3NFPA 3VMOA 1YPZA 4G42B 4Y4KC 2YPVH 3MFFB 5E8NB 5C1MB 5HYSG 1JPFA 5E5RB 1YEIL 3LD8C 3BFOA 2CDEB 4N0FA 4ODWA 5FO9B 4C54A 3RUGE 4M1CD 4DN4L 5DURD 4O51B 2XNAB 1A7NH 3MRJA 3ZYJA 2GTZB 5I1LB 3KPSD 2BOCA 2BSSB 2XWTA 3BPLC 3CLEL 5FF6B 3ZKMC 1NAMB 1TIUA 4HWEH 1EBAA 2N1KA 5I17B 3GB7B 2C26A 1JHLL 4K7FB 3B43A 4XNZC 1FIGL 1CFNA 4MD4A 5MI0B 1N0LA 4XBEH 1YEEL 2VAJA 4FOMA 25C8L 5JXEC 2F53E 5D70H 4YHKH 1G6RH 1XIWB 4O2FB 4OD1H 5INDB 3IJSB 4PGJA 1NMBL 4PBXA 2HRPL 3I3DA 2SEBA 5IQ7H 1VFAB 5C0FB 1OTTC 3QIWA 2NTSP 1CBVL 1SMAA 4Q6IB 5LKNA 1JRHI 3KYMB 1KB5H 1KJVA 4Y2DA 3S4SA 1CDUA 3VMPA 2OXGA 1UXWA 5T3ZH 5HYSA 5DYOA 4NWUL 5EOQL 3TVMA 1AXTH 2P5EA 2X4UA 2Z91A 2YD6A 1L7TH 1OAZL 4LASH 1MI5D 2HKFH 1U3HC 5KW9L 3MRFA 1QFWI 2I26N 2PW1B 4TSCL 4BELD 1JWUB 3C8KB 3OAZK 5JW5A 3IGAB 3OKOA 3QUYA 5KANG 2ARJB 3GSVA 4JDZB 1QBLH 5CGYC 4YXKH 4JG1L 1KXQE 4ZO9A 5CP3A 1DANT 4WEUD 4PLKD 1X3DA 3MRCB 5D7KD 2H32H 4P46A 3QIWC 4KAQH 3RTQD 3QUZA 2OK0H 4U6VH 3V52H 4DW2H 1RUQL 2I5YH 4WHYG 5I73B 2HFGH 1T0MB 1HINL 4MA1C 1A7OH 3OJDA 1GGYA 2X4QA 4YO0A 3TT1H 2YD2A 3L3JB 1S7WA 3QHZL 5AG8A 5T1DH 1YMHB 2EKSA 3WYRA 4RFNC 5EBMB 3M1BB 3TEUA 1H3GA 2WV3A 2P42B 4PRAA 3ZHLA 5E03A 3VFTB 1D5MB 2DYPD 2WWKT 4MB5A 3SEPA 1B0WA 3U48A 1HHJB 1KNOA 5I76B 2EIZA 3ARDD 2GHWB 1S8DB 3ES6B 1WBYA 2O5XL 1S78D 3TPUA 4Z76A 5TDNB 3B6SA 3U7YL 3STZB 4RA3A 1PZUB 1W72H 3RWCA 3TH2T 1AXSB 1I7TA 1MCWW 4X9IA 4NSKA 4WHDA 4E9LA 1WGOA 4ERSH 1AIFA 5SX5K 1RUPH 3L3GB 3SKUD 4M61A 3M17A 1QBML 1KEGH 3R8BB 1CT8A 3PHQA 4TTDC 5GGUA 1RFDH 1X5LA 1FVEB 2ZUQB 3CFBA 2P46B 4NWTL 3T0EA 4L8CA 5BW7A 5DMIL 2HWZL 2K9UA 2EO9A 1H8SA 3QI9C 5FM5O 3UYRH 3JVGA 4CJ1A 2I9LB 1I1AC 2X89D 3VFNA 1ZT7B 5LGHH 5L6YL 2DM3A 2B1AL 1OAQH 3HE6D 4KKBC 4YGVA 3L3DA 4OIIL 5A2JH 3V0VB 5HD8D 3VFPA 3BUYB 4LFHD 2YPVL 1HZHL 4PJAF 5FGCB 1YEIH 3IETB 4HPOL 4GAJH 1R3HA 4F7TB 1I1FA 3FT4B 2NPLX 5DUMH 1EHLL 4YK4C 3T3ME 4YX2H 1NC4A 3N1GC 4L29A 5CKAA 4ZOBA 1MFCL 5B38A 1I7ZB 2DRUA 2XYCA 1HSBA 1WZ1L 4P59L 3LKPA 2AABH 5ABDE 3EFFA 3CCHB 5B3JF 1VKXB 1D9KA 5KTEH 1DUZB 4Q7DA 3B5HA 1FO0H 1MELA 4Y16D 4HWUA 3CGTA 1G7HB 1KEMH 3VFPB 3O2VL 2F74B 3QJFB 3I6GA 2XZCL 5DHVB 1VFOA 3BD3A 5T1LA 3HRZB 1RJZB 1J8HA 3K3QA 5D70L 5I19H 1AO7E 1H3WM 2CMRL 1UQSA 3DNKA 1RZJL 1P5VA 4OZIE 4GRLB 5F7EH 4NN6C 3QFJE 4XMPH 4JREB 1NFKA 1YY8A 1U58B 3WFDH 4Z7NF 5EPMA 3C2AL 1C5CL 4WW1A 1KGCE 3MRRB 1IAOA 2G5RA 4UU9A 1IAIL 4JVWA 4OCXL 3ZDYE 1L7TL 4HBCL 4LASL 3V5HA 5IJKA 4PRDA 4G6KL 5GS1C 1L7IL 5ANMB 1M7IA 4DOHE 4IOSD 4D0DA 3TESA 3L3IA 4KUZL 3KJ4B 2FIRT 4G80B 3QJHA 3VXSD 4F80A 4WV1C 2NY3C 5J11C 4X0KA 4AIZB 2C4FU 3B6SB 4N0YH 1CGVA 4G9DB 4J4PA 1NGYB 1W72A 5D1ZA 1T2XA 2Y9RT 2RBLA 3LSOA 2YKLL 3LD8B 4JPKL 2J8UE 4LQFL 5IQ9A 3WIIH 3FAXA 2FX8L 2OQJB 3KYKH 5HHMD 3TO2B 1QZ1A 2A6JB 4XWGH 1YMHA 1KOAA 5DURB 1H5BB 2HT4D 1RIUL 2NCMA 5DD6A 4X6FB 4IHOB 1WCBA 2E9WA 2G9HB 1ED3B 3PQYB 3QNXA 4X98A 5SV3A 4AEIL 3BIKB 2GAZA 1V3JA 3OAYH 3ARXA 4X7SH 3CVIH 4ZO6A 3HR5B 4TUOA 1XGUB 2XZQL 3QIBD 3OXRB 3I9GL 1CFTB 2QR0B 4LNRA 1A4KB 1ZAGA 5EO0B 4TOYH 3CDCA 3GJFA 3MNWA 4Y16C 1BFVH 1BVKB 1S7VB 5F88B 4OCLC 1UYWH 1OW0C 5HYQA 3O41B 1P9MA 2NXYD 1QO3B 4UT9L 1FG2A 4I13B 2IJ0C 2NTFB 5E99L 4GG6E 1YMMB 1KJMB 2EH7H 1SJXA 4JB9H 4N5EC 3ARVA 1CR9H 2ZSVA 1R5IB 4LHUB 1IC4L 4WFFE 3PWPA 4UV7L 3IKCA 1ZHNB 1MI5B 5IMKA 3QFDB 2OBGA 5C0CB 2O26U 3NZ8A 5K9QG 1MJ8L 3R06B 4OZHF 3VFUB 1SEBA 2ZZUT 2G5BB 3IXTA 4KKBD 4OCSH 1DQMH 4IJ3B 1V7NL 1MCJA 2PO6D 4CUCA 3F65A 5E7BA 2B4CH 5CJOL 2ICCA 5IROA 2R56H 1VEPA 2IPUK 4HX1B 4K7FA 4XP5H 1B4RA 3RTQB 2AXFA 4HFWB 2NZ9D 5CJXC 2APWA 4GAJL 2BSSA 3MGTB 5T3ZE 3DSFL 1EHLH 1IAII 4F15B 4JFPB 1SJEB 4WENB 2XNAA 4YHOH 4KGJA 4QRSB 1CTNA 1MFNA 3ZZ1A 5HGBB 5KG9B 5IKCB 1BQSA 3B2VH 3KPSE 3H9HA 1Q1JH 2F58L 2IADA 4M9PA 1FO0L 3S7GA 4HIXL 1G9NL 1ZA3B 5SWQA 5GGVL 4DQOH 5GZNC 4ODXA 4ZUVB 3WNOA 3NCCB 4EI5B 3U7WH 5IG7A 5J11B 4ZPTB 4JO1L 4RNRA 5EN2A 6FABH 4XCCH 1NSNL 3MOQA 4ORGA 4ZNEA 3GJEB 7FABL 5ICYA 2CMRH 1HQ4A 3MLRL 5EORL 4PJIE 4ZD3L 4NDMA 5BRZA 3GRWA 2GI7A 3PWPD 3QEQA 2VWEC 1XGRB 4LSUH 3T8XB 5IW6B 1MFBH 2DI8A 1C5CH 3MRDA 5KVEL 4MS8D 1JTTA 4NC0B 1QG3A 4CRPA 5C09D 4N8CH 1HYSD 4XGZB 1JYNA 2NY0C 3RZCB 4HIHA 3Q3GB 5KOMC 3E1F1 4ZUWB 3LY6A 4LLUB 4YZFE 2FCBA 5KN5B 2VN7A 1Z0NA 2BRQA 4TPRL 4CJ0A 4G7VL 2NW2B 2A1WL 5JXEA 3SDDA 2JCCE 4W4NA 3O3EB 5DMKB 2YN5A 1MFEL 5ADPH 4EVNB 1SY6L 4XAWH 5DSCB 1DLHA 3JWNC 2QQKL 4B5EA 5FB8B 3QNYB 4Y2DC 3F12A 4KDTC 1VENA 3T3PE 1MF2L 1RIUH 1WITA 2FJFB 4PJ9A 4LLUA 5J1SC 3N1PC 1F13A 1FGVH 5C6TH 2GEEA 2DQDH 4D94A 2OJZH 4JQXC 3FHAA 4MJ6B 3TBVB 4G8IB 5IESL 1G9NC 1T7WA 4YBLB 2HLFD 3LQZA 5SV4A 3PABB 1MFAH 2ZSWA 4I0PD 4YDVB 1IGYB 1NUNB 2ICES 5FYLD 4M7LL 1YY9D 4FQXC 4WV1A 3I3EA 3VGAC 2R2BA 1N8ZA 3BKCH 3CAFA 3RNQB 5K93A 4NQEB 3PDOA 1OARH 4U1LA 1X4YA 1EHXA 1I4FB 2JCCF 4RMTA 5DUPH 1IC1A 4NQXB 1RZKL 4AIOA 1SMOA 3FO1A 1F58H 4LBEB 2P5WE 1I7UB 5K9JH 1DQML 5EG6C 5HVHC 3U2SB 3BWAA 4HKZA 5DD5H 4J4PC 2PUQT 1B0RB 1TCRA 1MLCA 2DD8H 4OV5A 1MCPL 1RULL 1IGJB 4U1JB 5KSBB 4FTVD 1NBQA 1FVDA 5JDSB 5C8JA 4ODTL 5C71A 1O7SA 5DZOA 1TZIB 1R5WA 3V4UH 4FQIL 4I3GA 2EDWA 1BBDL 4M7ZB 1NC2A 4Q6YA 1M71A 5DJYB 4M7JL 3RKPA 3X14B 4P3DB 3B2VL 4LLDA 1S9XA 4NKOB 3D0VB 2N4IA 2OL3H 5JW4N 3R06A 5C0JA 4NP4H 3QHFL 4Y5XA 2APBA 1G9NH 1P7QA 2FSEA 1CGSH 4IRSA 4KY1L 3IDIA 2ED7A 5TF1H 2GY5A 4TYUA 1R5IA 4PJ5E 4BSVA 5FO8A 1FNGB 1Y6NR 3U7AA 3DSNA 5GJSL 4O00A 2CK0L 4ZD3H 3L5IA 2AXJA 3IS1X 4Y5VA 5GS2D 1K2DA 5E2TL 3FMGL 3RI5F 3ARBA 5IMOA 4XNUL 3E8UL 3RWFA 3O3DB 4M5ZH 3QFJB 1F8TH 2FR4A 3MLYL 3TGXA 1YEDA 3CSYA 4QT5B 1K85A 1J12A 4UIKL 3RVWC 1MH5A 4XPTH 4JKPL 4J8RA 1WTLA 1RUMH 4PJEF 1FQ9C 4NNPL 3AY4A 2HN7B 2D0GA 5DD1L 3T65A 4LSRL 4ODSL 4JG0H 5FECB 4P4RA 5C2UB 2B4CC 3CSGA 3ZKNC 4HC1L 5F1NA 2ADIA 1HEZA 3VI4F 4X99B 3BI9X 4HMEA 3T0ED 4X6FA 4GMTH 2PO6B 1U8OA 3RUGF 4DGIH 4Y1AB 2DQIH 3MRIA 1WAAA 4JFFE 1PLGL 5IGXL 5EZLA 5AD0A 5I15H 5IQ9B 4GUPB 3DROB 2IQ9H 4D0BA 1DBAH 3U1SH 4N0UE 4PJHA 5ERWA 4R97C 4YHML 2R69L 5IVXB 3CFJB 4HWZA 1QA9B 1UZ8A 4HGWB 4UTBH 5C6TL 1PG7X 5KVMC 4PJFA 4GSDL 3MLTB 4FFZL 3N9GH 2EEAA 5C07B 4H8WL 1JGUH 2IPTL 1A9EA 1FZMB 1RZGA 4OKDA 5FK9B 3CDGA 3D39B 2FGWL 1WBZA 4BFIB 4FMFA 2FEDC 2VWEE 4OGAD 1AFVH 5JA9A 3CX5J 3QEUA 3QNZA 2YZ1A 4GBXA 1CLYL 2ZCHH 3DX7A 3GI8H 2V9TA 1KULA 1NFDA 4HKJA 4BQCA 4NJAH 1K3ZA 5BO1H 4QHNB 2XA3A 1I9IL 3C9NB 2IBBA 3V6OA 3GJFH 4YHLL 1OD7A 1W0WB 1DVFD 5IK3B 2FO4A 3VXQB 3CFKB 3MLPA 5C09B 5DR5H 1D7FA 3LKQB 5DUBB 5I8KH 3D25B 3ARTA 3RZCD 1KTKE 4GAFB 4YQXH 5E00A 3REWA 3HE7C 4PJIA 3RIAF 4P9ML 4U0RC 4X80H 3MSPA 3QCVL 4CN1A 3CZJA 4RMRA 4DGVL 2M8XA 1B6DA 5ESVA 5GRUL 3DWTA 3PGDB 5HY9B 4NNYA 5DQDL 1KCRH 5CIPB 5JTWA 1R3HB 4LSDA 3B3IB 1P9MC 4JREC 3V4VL 3ULVD 1YQVL 1X7QA 2BRRH 3FONB 1JV5B 3V0VA 2YA0A 2DL2A 2AV7A 4FFYH 1WWCA 3REVB 5I1GL 1EZVX 4PJ9C 4ZFFB 4AT6B 3H3PL 3R1GL 2WW8A 3OR7B 1OVZA 4OFDA 3QIUA 4PS4L 4OD3L 3FO9B 4JFDE 3MJ9H 4R9HA 2FD6H 4LSTH 3NABL 1TTUA 5A3IC 5DHXB 4G6JH 1LP9B 2IAMC 4X5LA 4R7DA 5MP6L 3DURB 3HAEA 4EEEA 3EO0B 4FQ2L 4E41E 5FV2A 2NLJA 1WFUA 2QQQA 3OKDB 3S8WA 4BZ2L 4RWYH 4Y4HC 1A3LH 4GRMA 4HLZG 4LLMB 2ICWJ 2AQ2A 2O5ZL 2ZUTA 5C2BL 4XNUH 4K3HA 1DQLH 3WFEL 5JA8B 5DQ9A 3HAEH 4M5ZL 1UCBH 3VRLF 3MQIA 1FPTH 3VFWA 1Y0LA 5JOFA 4O9HH 5F9DC 4UBDC 4NNXB 1T03L 3ARGD 3EYFB 3KPNB 3V5KA 1WV7T 2VXTH 2A2QT 3HPLA 4KRLB 1D5MA 1UKSA 4U3CA 3UZQA 3FTGA 4GRWE 1G7JA 3ZTNH 5I0ZA 2A74A 2Q3AA 2VDRH 4RX4D 1CZ8L 2AI0H 3ZKSD 3L3JA 5C9JB 1D5BA 1IKNC 5I8OH 1EZVY 1LP9A 4PLNC 4NJ9L 1JPTL 2VLRA 3CFCH 2PXYD 3U30C 4ZFOB 4OUUB 4R90H 4G5ZH 2FBJL 3VXMB 1AY1H 4KJWD 2GYSA 4XBGA 2JF1A 4LPUA 1BOGA 1BQLH 1A6ZB 1J8HD 4U33A 4PGEA 1KYOK 3GSVB 3I6KA 4OB5L 2FX9H 2ZUXA 4CMMA 1VB9A 5M7QA 2Y7QB 3X13B 1D9KC 3W0WD 1DJSA 5GSVA 5F9WC 2V2WB 3P11L 2NW3B 2VLLA 4M8QA 3U0TB 1F90H 4IRSC 5DRWA 1B2WH 3O6LH 1NEZB 4XPHH 3LPGA 3GMOA 1P84K 3QWRD 2JJTA 4N9GA 3SHSA 1G0XA 1NFIA 3KNBB 1WWAX 1J9CT 1DQDL 4POUB 5FGBC 1FG9C 1S7QB 2IEPA 1KXTB 1CD0A 2X9WA 2R0LL 1YPZF 1OGAD 1TVBB 4JO3H 5F7WC 3MV7D 1R3IL 4KDVA 5INDA 5D2NB 4Z7UB 5IK3A 3VXQA 4A6YA 4FRWA 3VWKC 6CGTA 3KYOA 5DD3H 2E9IA 2YPLB 3FQWB 2OR9L 1C08B 1BJMA 2OSLA 1N5YH 3QEUB 1M6OA 2DQJL 4WFHE 3MLZH 2YC1A 3QUXB 1FZOA 5B39B 1S78C 2WLZA 1U36A 2AXGB 4PJFE 5ALCH 3F5WA 1RAMA 3SDAD 1T1WA 5I18H 2YOCA 4NUGH 3BHBB 1UA6L 1CDCA 2XXMB 3GSRA 1CICC 2W07A 4ONHA 5CBAB 4XZUB 4KPHH 4LLQB 2HKHL 3MLVH 5DRNA 2OZ4H 4AEEA 5IV2A 3TFKC 4JN2A 3DROA 3I6LD 4OD3H 5GZOC 1KPUA 3FFCA 3QPXH 1JF1B 1M4KA 3MRIB 3FO0L 2MJWA 3WNNA 3BPLB 4OD2A 4LEOA 1JNLH 1A3QA 4DK3A 4KXZH 5I16A 5BQ7A 3BP6B 3Q1SL 4ZUUB 5C7XL 1I8IA 4I3RL 4QRRD 4L4TD 5DS8A 3G6AA 4FQ2H 3DGCR 4NQSB 4X6EA 5ECJE 2DDQH 3V6OC 3LEXA 3SDXF 5I1KL 2AEPL 1IC7H 5ICXB 5D1QB 2Z31D 2OK0L 1AQDB 3T3PF 1KLGA 1Q9LB 3O4OC 5HHPB 3QBTB 4KHTL 1WZKA 3BT2L 1FPTL 3O3DA 4CADB 3BD4A 5DC9B 2PYEE 4HUVA 4U1MB 4MWFA 1FZKB 1Q9OB 4GAYA 4WW2A 1K2DB 1CLOL 1IT9H 2W1NA 3I75A 4X5WB 3B83A 4U0RB 1LMKA 5F3BB 1YEFL 1HOCA 3QDGD 1TTFA 4IMKA 3UPAA 5F6HI 4L5FH 4HK3N 3U7YH 3TBTB 5DGQA 3BAEH 1B3JA 4MD5B 3LS4H 1EERB 1FN4B 2D31A 4PG2A 3N85L 1QBMH 3QIUC 3P9MB 1I85C 4DVBA 5D1XB 43C9B 5L7XL 5I1EH 4R8WH 3BO8A 3QH3A 4EZMA 2P24A 1NAML 2BVPB 1YC7A 4OLUH 5INCB 1R5WB 5CBEA 2ID5A 2VLJB 1G84A 1T5XA 4PGDB 1NANI 4G9FE 5KSBA 4UAOB 4LSVL 4BFGA 2IH1A 5DO2D 1A22B 1CDGA 1RZ7H 3ARFB 5IBUB 3F58H 4EXPX 1IE5A 5TFSL 3H9SD 4P2YA 1NCDL 4YHNB 5LGKA 1BD2B 2WBJA 3QQ3A 2BDNH 4YUEH 3WJLA 4MD0B 1U92B 4PG9B 4X4YA 1BJ1J 1JVKA 3GSOA 5F9JA 3TA3D 3S88H 4P2OD 1J1XL 1EPFA 3DX9B 12E8L 1ZOXA 5F70A 1GHFH 4JO3L 1KCVL 1GZPB 3PV6B 4EN3A 5D5ME 1BD2A 2WBJB 4FXKA 5CJBA 3QH3B 3H0TB 2DBLH 4NHCH 1A64A 4P59H 3IJHA 2Y06L 1T20A 1MCQA 4MCYB 3SJVA 4G6FB 1I75A 4GAGH 4JAMB 5IBUG 3GO1L 1NC4D 4PY8J 4G6ML 1JHTA 3DI3B 5FYKE 5ID0A 2AJVH 1NDMA 3AB0B 5E94A 3V6FA 2Z92A 5J13B 1N59A 2H9GB 3TM6A 4V1DA 4PLOB 5D1XA 5EZOH 43C9A 4MJ5A 4OZ4B 4NKIL 5F9AC 1XF3A 1U8KA 3FRUB 3GM8A 4WHYH 4G9FD 5H35B 4C56D 4WEBL 1WICA 4PR5A 1RVFL 4WO4D 5EU4B 4UIMA 1KC5H 4WJ5A 4G6KH 5F3BA 3W0WB 4XTRD 3MC0A 3BPOB 3QQNA 2QADD 1H3XA 2BY0A 4KUZH 3UTPD 4NUJA 1QPXA 3VH8A 1T2JA 5I16B 3B9KC 4DKFL 3SDDB 4JY6B 4CDGC 3LZFH 2NW2A 4BZ1L 2BERA 2CD0A 3Q1SH 4Y19A 5KSBF 3O9WA 1AGBB 4EUPB 1HSAB 3BWUC 3L6FA 2W9EL 2WLYA 3CLFH 4OJFH 3IAQA 3JTSB 4Y4FC 4G3YH 4E41B 3JWDL 3MV7B 2BK8A 4ZQKB 4U1HA 4GRWF 1KIQB 4C83B 2R29H 3WNLA 2ADFH 1XGRA 3PDDA 2GW5A 1ZS8A 3V6ZA 2E5EA 1OAYL 4ZNEE 2EXYC 5BMFL 3GJEA 5JHDB 4YXLL 5BV7L 4ZPTA 2EDEA 4DCQA 5A43C 1B88A 5DGRA 5CD5C 2DAVA 1ZA3A 2AK1H 1CG9A 3FO2A 1KN4L 3ULVL 2ZG1A 2UWEF 4PJ5D 5E9DD 1DSFL 5HHVH 1C7TA 4K3EL 5FA3B 1WT5A 4LMQE 1T1WB 5K9KB 2EH7L 5FIEA 1G7PA 1TQCC 5F44A 1JPSH 3HZVB 3C09C 3KJ6L 1CDIA 1ACYL 4HBQA 5B39A 2HT2C 1XGTA 3QO0B 4PJ7A 1F2QA 1U41A 4M5YH 2YSSA 2A0LD 3RU8H 4WW2F 3FQRB 4YWGL 4JRYE 1BZ9B 2EDTA 4TULH 4A6YB 2EDDA 4KI1A 5ISZA 4DGYH 4E5XB 2OLDA 1XR9A 4LVHC 3OR6A 2X5PA 1FFOB 3WN5A 1T1XA 1E4WL 5F8RC 3ZYOA 1E27A 4ZSOA 5CJ8A 3QUMB 4N0CD 3D2UB 3S88L 3HZKA 4QRPE 3BRDA 2VYRE 3IDYC 2UZIL 1JZ7A 1DN2A 3FCTA 3ZDYF 1I7RB 2GUOA 2VSDA 5GSVB 4KJPD 1MHHB 1T1YB 1MCKA 5SWSA 4HKBA 2A6KB 5J1TC 3GSUB 2VISA 1QR1B 1TJHL 3VW3L 4GAGL 4KC3B 4JRYA 4XP1L 2D7OA 3BSZH 4EN3D 1A6ZA 4RGND 1A4KA 2H32B 2X89A 5KVDL 1CFTA 5F9OH 7FABH 3O6MH 1G6RL 1A1NB 4Y5YB 4DKDC 3OZ9L 4WDIB 2MCPL 1EEYA 3WN5C 5B8CA 5K9QI 4I2XA 4NKIH 4JQXA 4ODUA 5EC2B 3FB7B 4JKWA 4YDLC 3LRHA 1H3VA 1IEBA 4PRPA 5FYJL 4Y4KD 3VWKA 1ZWIB 1A6TB 2X1XR 1YN6A 1CXFA 5GPRA 1U93A 5HD8C 3T77A 3FTGB 3LKNA 4JZNA 2VDPH 5I1CH 4HS3B 1IGCH 4PJDF 5I1HH 5DJ2B 4XNXL 3HS0B 1XH3B 1QFWM 3NOIA 4OCWL 5IP4A 3H9SB 5F7LB 1IEBB 1IZJA 3G6JE 3ULVF 3IDJB 2OTWB 4LCYA 5ESAB 2DLFH 4QRRE 2ESVD 4OLYL 1Q94B 4DAGL 1MFEH 3BKJL 3PL6D 5F7FA 3QIUB 1BFSA 4TVPL 4AQOA 5IWLA 3OKDA 4O2EB 3JWDH 2EE9A 1RPQA 3C5SB 1RUQH 2I5YL 1MFDL 1TJGH 3U46A 3WKNA 3DURA 3DMMC 3NPSB 3TA3C 4N0CC 1MF2H 3EYOB 3F7VB 4ZTPH 4P57A 3TT1L 3GSUA 1QR1A 5GGTH 2DTMH 2PW2A 3ARRA 1T1YA 2E6JA 3QPQD 1OAYH 1UWGH 3G6DL 3JV4B 1YJDH 3OV6A 3DYPA 3KYNB 5ESVB 2OJZL 1ZK9A 2FJHA 2O5XH 5FDWA 2X10A 3WJJC 1XGYL 4LDEB 4NQVA 4UQ3A 3ARBD 3IDMB 4MDJA 2XZZA 4HCRH 4NQCE 3BH8B 2VXVH 3S36X 4Z8FH 1MJUH 4J1UA 3KVQA 3S9DB 1DLFL 4JPVL 4E5XA 2GUOB 4K3EH 4DKEL 4M7LH 2DBJA 3TA3A 4OZFB 2K7QA 1RK1B 3QG6A 3MCKB 3KPRA 1LDPH 3OAUH 1NL0L 4KZDL 4MAYB 2V2TA 4BFIA 4NKMB 1B6UA 2VLRE 3D3VA 4H0IA 5JDJA 32C2B 1FRGH 3HZVA 4YWGH 1ORSB 1WQVT 4P2OA 3QWRA 1T7VA 2XZAL 4V2BA 3QNZB 4AENB 4D9LL 3FO2B 2H2PD 2J8UF 3TBYA 2PR4L 1XGTB 3KLAA 4KVNH 3BZFA 3UYPA 1WBZB 4NCDA 1U8IB 4TVSa 4OBRA 4U6HA 3KPRE 2IH3B 5DUML 5DVMA 1UM6L 3ULUH 5DD0H 1MSPA 2UZIH 4HLJA 3BGFB 1ZHLB 3VXUB 1J1OH 4Y19E 4GQ9H 2AABL 1GZQA 4HXBH 4HWZB 1CG9B 3R0NA 5JHDD 1IMHC 4Z77B 1BWWA 4XP1H 3MUJA 5F97E 5ADOH 1LE5B 5MERB 4X9FA 3CVHH 4OAWA 2XZCH 1V3LA 1C5DA 5JHDA 1S8DA 4NBYB 4PD4K 3QUKB 3LQAL 2F8XC 1KNOB 4P5TA 2HN7A 1KGCD 2X1PA 2ZG3A 3HI1A 3EDFA 4J8RB 1UJ3B 2G60H 3MRMB 4XMLL 1YEDB 4QT5A 1SM3H 2P47B 2DQUH 3QFJA 3RPIA 5DHYB 2D7NA 1U2HA 3D85B 2NY5L 3QI9A 4Y5VB 1DEDA 5KSAB 3D3VD 4R0LC 3JV6B 3LV3A 1I1AA 2XPGA 1EGJH 3L6FB 3KR3H 4EUPA 2CIIA 1MH5B 3UTPE 4OCWH 3CSYB 1P4IH 3GHBH 4AYFA 2OI9C 3NAAL 4K3DL 3LRSA 1JZ6A 3PP3K 4AK1A 1BQHG 2OTUA 4QHLB 3DVGA 5BS0D 2BVQB 4G8FA 3BKJH 3X14A 1N59B 5D7SL 1JGLH 2JJSC 2VAAA 4P9HL 5E70A 3HMXA 1ZGLA 5EU4A 2KH2B 3U9UB 3NFNA 2FYYB 1TZIA 3LN5B 4LIQE 3JSSA 4XXDB 2R69H 1J0ZA 2QV2A 4NO5A 2A9MH 1QLFB 5K9OA 2XTJD 4KK8C 3MROB 4CVZB 2MNUA 1S9XB 4NKOA 4N90D 1CLCA 1T0NA 4LAQH 3EHBC 2Z92B 1F3JA 3FB6A 1JGUL 4EN3B 4QRPA 4OF6A 5ID0B 4YPJA 1JHTB 2CGRL 2FGWH 4NQXA 5CEYB 5JORA 4KI5F 4OIAA 4QOKB 4EIZC 1PG7L 2Q76B 3PWNA 4OM0H 5ILTH 1ZA6B 3P0GB 3QQ3B 3AAZB 1MLCB 4CMHC 5SX5H 4NQCD 4KJQD 2XKSA 1EHAA 2OI9B 4LBEA 1YNLL 5FKPA 4OZHA 3FHQA 3JXAA 2YBRA 3HI6H 5SWZD 2XWBA 4PV9A 4NQUA 3MFFA 5E8NA 4YQXL 4GBXD 4LL9A 4AJ0A 4PRIB 4LRNL 4J12A 4BZYA 2P5WD 4LKCA 3NFPB 4K9EH 3DGGA 1FH5L 4AZ8A 2P45B 1KFAL 1JMXA 2APFA 4K94L 5IT2H 3X17A 5EIQA 3VD9A 4LVOC 3TV3L 5L9DH 3K7UA 3P30L 1RURL 1VEOA 2XZAH 4IOFC 1KCRL 3P9MA 2W0LA 4ALAL 5FGBA 1T3FA 4XX1E 5I75C 1LO3L 1FN4A 1D5ZA 2F19H 2BRRL 1I3GH 1CVSC 4XXDA 2FATH 1MAKA 5KSBE 1R3LA 1I1CA 4LSPL 1N4XL 3WCYA 4BQ8A 2BVPA 4GXVL 2VDOL 4KROB 4UUJB 1KB9J 4QRPB 4G8GB 1EUUA 3MRHB 2Z8VC 4JHWH 4P2RA 3O6KH 3DVGB 5IFHH 4E42A 4JCMA 4LSTL 4S1DC 1QUNA 4NO5B 3TZVC 1C7SA 2A6DB 4G6JL 1ZGLM 3TCLB 4X6DA 1BAFL 4MD5A 4PJDB 3TVMD 4ZXBB 5DRZB 1GGCL 2VERN 4ZUWA 3EHBD 1KJ2L 3KAAA 4U1NA 4DZBB 5ETUB 2EXWC 4YC2B 1WFOA 5KANI 3GMMB 3JV6A 4MDIB 3SE9L 1QSFB 1PKQB 1IFHL 2O5ZH 1Z3GL 1KYOJ 4XNYL 3RPIB 2E8YA 2ZCLL 4L8DB 5F6IC 4ELMF 2X4SA 5BRZB 4OFYD 4L3EA 2CR3A 2C3VA 5JOPE 1GGIL 1MWAB 1I1AB 1V3KA 4M43H 5I30L 1HCFX 2JJVA 5IV2B 3ARGC 4U6XB 5KSAA 3U0WH 4RBPH 5DS8B 3UBXG 1LE5A 5CJXA 1PAMA 4HGMA 4K8RH 4XVSL 3MV8D 5GGRY 1I9JL 4S11A 2GJ6B 5HYJE 3O8XD 3QEQB 2X40A 2FB4H 3W9DA 1AGDB 4H88H 4BM7A 1HKLH 1BZ7B 3HI1B 4Y2DD 1KLUB 4R90L 5HGBA 5C0ND 5KG9A 4JFFB 3B5GA 3N0PB 1XCTB 5LXGH 5DQJA 3C09B 5EN2B 4XWOC 4P23C 5M94B 1IAKB 3DXAA 1IQWL 4XZUA 4DUWA 3RWHB 43CAB 4X7CC 4XPFL 3BHBA 5GS1A 3ZDXE 3OX8B 4P46C 1CDYA 4NN5C 1XR8B 2NY4C 4D0CA 1G7IB 1N26A 3LB6D 1EFXD 2G5BA 3IXTB 5IESH 3K80A 3F7PC 5CILH 1P1ZA 1QHOA 2QTEA 2I27N 4M9OA 3KLAB 3RTQA 4MCZB 5C0CA 4I0PA 3TBWB 4BH8A 2H2SC 3UX9B 2JB5L 3O3UN 2R8SH 4UT7L 2EDJA 5HI5C 2VZUA 3TYFB 5JXAH 5F7NC 5KZCD 5A2KH 1Z0MA 3QZWG 1NBYB 3BKCL 1X5HA 3HHRB 4N8VB 3D3VB 3TNNA 2V2WA 2B2XH 3L5HA 3MNVB 3MV9D 1OARL 4YJZL 2IWGA 1XF5B 1OTTD 4MHHI 1T5WA 5HYQB 3AS2A 4NKMA 3EO1B 3BH8A 3QFDA 4NQVB 1ZHNA 3AMKA 3GMOB 3O2DL 4HK3J 4MX7A 3F7QA 1DDHA 2F15A 4N0UA 2DD8L 2NTFA 4IEFB 2VKWA 3FB8B 1KJ2B 2GAZB 1VFMA 2LU7A 4KKLC 1E6JH 1X9QA 4J1UB 1BGXL 5F88A 3K4ZA 4ORZC 1D5BB 1BVKA 1S7VA 3RDTB 3SBWA 5JW3H 1XIWC 3U46B 3MLVL 1TZGL 4ETQA 2N7AA 4I8DA 3TO2A 4K55A 2E9JA 4KI5D 1LO2H 4N8PA 1R5VA 4XCNB 2DM7A 3B9EA 4WEMB 2IFGA 3HG1B 2XTJB 1UB6A 5D7JB 1NGYA 2WIIA 4F3FA 4HS8L 3L7FA 1IRAY 3VFWB 1CK0L 4UMGA 2QJDA 4HUUA 3ROOB 2BCKB 4E0RA 3G9AB 3OJ2C 1GOGA 3BDYH 1FV1A 2DIBA 3IFPB 5GRVK 3SKMA 1Q0XH 4JFDD 2DKSA 3BP7A 3GFUA 3H42L 1JPGB 2QADC 1AO7D 3EYQD 1KXVC 4PJ5A 2EDRA 2Q20A 4DJMA 5FYLH 2O5YH 3EO0A 2EE3A 1O0VA 4R7DB 2BCKA 2DB8A 3IDJA 1UH2A 5DQ9B 4CBPA 1AI1L 1A0QH 1YY8B 4Y4FD 5CMAA 1XH3A 4S1SH 4ZOEA 3SGKC 1EEYB 5B8CB 4GKSB 1LWRA 5AYUL 4D0DB 4BSJA 4PRID 3LKNB 1YEFH 3WNPA 1R5VB 3LEYL 4XCNA 2AV7B 3I6GB 1IAOB 1YN6B 1U8NA 2NY6D 2QQNH 2XACC 3OTTA 4K8RL 4PRPB 3DUSB 5CLTA 2AJZB 1BM3L 1I9JH 2PTTB 1JFQL 3VXNB 4TNWF 5D7LD 3UJIL 2FB4L 5I1IL 3DUHA 4JGUA 1PY9A 1PLGH 4I2XB 2ZJSH 3PGCB 1HSBB 3KXFE 1PQZA 4F7EA 1A1NA 3GUTA 3BGMA 4ZFFA 1ZHBB 2AQ3A 2NNAB 2W9LA 3ZE1F 4I18A 4PRHE 3EDJA 2BNRD 3K81A 1A6WH 4ZAKD 3SDAA 2ENYA 3BQUD 3UPRA 1QFPA 2R2CA 1FFOA 1T5WB 2WP3T 3EYUL 4WCYH 5HHQA 1JGEA 2W9DH 4UTBL 5BV7B 1CS6A 1NBYA 3QI9D 4YGVB 3ZL4H 2NY1D 2J88L 2VXUL 3GRWL 3MV01 5FHAH 1H0DB 3MZGB 3GNMH 3KPLA 4FQLH 2YSSB 4OF8A 1ZT7A 4P2QE 3CVHB 4ACPA 4BH8B 5GS2H 3QA3B 4WNQA 4KK6C 2VO5A 3ROLB 3BW9B 1A1MA 1W0WA 4AEFA 5C07A 5IBLC 5I75B 1G7PB 3PHQB 4QHNA 5FHBL 4QGYA 2VKXA 4YHLH 5FA3A 3UJJH 1OQXA 2VR4A 3OX8A 3V6OE 3JVGC 2AKRA 2K3TA 1QA9A 1UZ8B 3EFDL 2VZ3A 3QO0A 1IAKA 1AXSA 3DXAB 3MR9A 5D9SA 5FAAA 1GYAA 2HLAB 3BKMH 3MV9E 2BFVH 3T04D 4GUPA 1MJ7L 4MJIE 4H26B 2DOCA 3QXTA 4BYHA 4EI6B 3ULUC 5E95B 3O45A 1FLRH 2C4FT 4IDJL 4JM4L 4PJFB 5CWSB 1ZS8B 4C58B 3NACL 4PJ7E 3L3HA 2QLVB 5FUOH 2Y1VA 1PW3A 3QDGA 4NO2B 3CFJA 4N5ED 3CSBA 3HKFA 4RCAA 3NCBB 4X99A 1N7MH 2W0PA 3S3PA 3ES6A 2HKFL 4P46B 2NX5B 3KLHC 3GIZL 4P2CG 3MRCA 5I0DA 2VDKH 1HSAA 1RZFL 1A6PA 2GSIB 2WIMA 3TT3H 4HS8H 5EU6B 4U31A 3M1BA 5DWUH 3O2WH 4H20L 4P3WA 3BYTA 3FB5A 3OJDB 2ZPKH 1KIQA 4YR6A 5BVPH 4L4TE 1UM4H 5JPNB 1SVCP 1WC7B 2CKBA 3VD5A 4X7TB 4PTTB 4DZBA 5HSFA 3LKOA 3PXHA 4JDTL 5C2BH 3S36H 4NZTL 4ODHH 4JKMA 1KJVB 4Y5XB 2PYED 3O3BB 4MJID 5T1DL 1A0QL 4OZ4A 4JCLA 3D0VA 2IANB 4FP8H 4XMKL 2WZPD 5JNYA 2P8PA 2H9GA 1M71B 3F62A 4QXUL 4HIIB 2CDGB 2VLME 4ONOA 4OCMC 3RAJH 4S2SB 4N1HB 2FH6A 2KL6A 4BSVB 3K74B 2FIKB 5H35A 4JAMA 4O58H 4IRSB 4UQ2B 1C5BH 2Y23A 1NAMA 4MJ5B 2D3VA 3UTTA 1VSCA 1QKZL 3IRPX 5E94B 5F71A 5I1JH 3VA2C 2VDLH 4Q9RH 4NKDB 1CF8H 1P4BH 4JE4B 4K7PL 4XP9H 3W11D 3VRJA 4LP4A 5EULV 2P8LA 4JFZH 3E3QC 4L4VD 4M93C 3TH3T 2FJGB 4H0HB 2E27H 4UTAH 3GB7A 1V7MH 5IJVA 3MX0A 4PG9A 5FKPB 3ZSTA 4PRNB 3RNQA 2IAMB 1BBJB 3EDDA 4BK5A 1RIVH 4JFYB 3D6GA 1S3KH 4NQDE 1RUAH 1YQ2A 3PABA 4JQVC 5KSVA 3BISA 5HVWA 1BD2E 1EMTL 4MA8L 4HZLA 1DQDH 1X5KA 3NA9H 5JORB 2R2HB 1GC1C 3DETD 3PJSA 5CBEB 1QSVA 4X4YB 5HI5D 4NQEA 4LPCA 3FT2B 4YX2L 3EJZD 1J0YA 5I73C 3RVXC 1T0NB 2MQ3A 2OR9H 1WZ1H 1GGBH 4K94C 5D5MB 2AV1B 4FQHA 4KQ3L 2CLVB 2JK5A 3STLB 5CD3B 1QLFA 4F9PA 4JRWA 1LO5B 5H8DA 2Q87A 1EJ6A 4R4FL 3RWIA 4GW4B 3HC3L 1E6OL 4G8EA 3O2VH 3TBTA 2FYYA 1KBGL 3HPJB 1N0XH 2MHAA 1OAXH 3CH8A 4OGYH 3O6ML 4HXAL 4WUUE 4D3CL 1KIPA 3SE3C 4R26H 3DTXA 3RNKA 1AE6H 1MEXH 2Q8BH 3RJQB 3MV11 4I0PC 2D31B 4U1MA 1XF4A 1QFWH 4KHXH 4V1DE 5JR1L 3K2UH 2BNRB 4JEGB 4HIHB 4OLVH 2P7TA 3U6RA 1HOCB 2BJMH 5I1CL 2GITA 3I75B 4X8XA 4X6EB 3QI9B 3SO3C 1IBGL 1AH1A 3TN0D 4JFHD 5E6IA 2Q8AH 5DFVD 5IW6A 4LEOB 2R1XA 2JJTC 3OBAA 5CD3A 5E2WH 5D5MA 4QO1A 2H2PC 5ICYB 2VQTA 3BOVA 1YEHL 2WINA 5IROC 2ZCKH 3EUUA 3FT2A 3G6AB 5DRXA 1MPAL 3L3KB 3BT2H 3MREA 2DTML 4OM1H 4C4KO 3U4BH 4X7SL 4DEPB 1FYTB 2F54D 3UC0L 3EJYC 3OKEB 3G5YA 3F5WB 3ULVE 4EQ3A 2GK0B 2AW2A 5J6GA 4WUUD 5F96H 1S7UB 5BOPA 4L5FL 2XOTA 3KLHD 4K07A 1FHGA 3QUXA 3UO1H 4EXKA 5F6HJ 1OP9A 3O11A 1EJOH 2LTQB 4N5UA 4QGTA 3GI9H 4U1GC 2CLRA 5GZOD 4P4KA 3GKWL 2YRLA 3D69A 3SY0A 5KVFL 2HLFC 2B5IB 1QKZH 2VTFA 5I71C 5IKCA 1NAMH 3UJTL 4Z0BH 1LDPL 3OAUL 1MCDA 1GOFA 1SEBB 5J57B 2NX5D 2Q6WA 1ZGLP 2RAMA 2OX5A 5HI3D 1OTUC 1BVZA 2XY2A 1VPOH 2YD9A 3IT8D 3V79C 1MI5A 3C60C 4NRXB 5IMKB 4M02A 4LSVH 3RY4A 2ZUVA 3FQXB 3O4LD 3PDGA 4OZFA 1FL6A 1N6UA 3KYOB 2JLLA 4JRYD 1S3KL 3MOAH 1MQKH 4N0RA 5H37G 4ODVH 5CJOH 5J3HD 4PJXB 1MLBA 4CMMB 2EDYA 2I07B 1OT1A 2Z93B 5HDBF 4PGEB 4LGRB 4HEME 3OSKA 2HJFA 3VXMA 3EJJX 1KTLA 4OZGB 3IFNL 4XNZB 2IAND 3P0VL 2EDHA 4MNGA 4YR6B 2G9HA 2AERT 5T1KA 4ZAKA 4HIJA 3FB5B 5IB1B 4NT6A 4JVUA 1HE7A 1CYGA 1EXUA 1E0OB 3BQUC 1UFUA 5GGSA 3WLWD 1KBGH 5CIPH 4X6DF 4XCCL 5H37H 1EV2E 3O8XA 3VGGA 5FCSH 4OF3A 5E8PB 1XGUA 5AG9A 5A16A 4WO4C 1J1PH 3P4MB 2VH5H 4JZJA 4MXVF 5ESAA 3RKDC 3W39A 3ZO0A 1NDGA 2HT3D 3IDYB 4IHOA 1J05B 3MUGB 5C9KA 2I60L 4NWUH 3V0WH 3L3HB 5TF0A 1BQUA 4Q9BA 5CWSA 4NYLA 4L4VB 4QHUA 1KC5L 3HPLB 5KW9H 3LSOB 4JKKA 1IBGH 4PREB 4UNTA 1FDLL 2HLAA 2Z8RA 3GHEH 3C08L 3C5JA 3MOBH 4BA8A 4A6YL 1PBYA 5L88L 1LQSR 5TH2A 4HUNB 5ALBL 1H3PH 1U58A 4LIQH 4PLJD 4HJJH 4HK0A 4PJBB 5ADPL 3S6CA 3DECA 1YEHH 5HHOD 5KJRL 4RBPK 5T1LB 1CICA 1URLA 1GAFL 3DX8B 1QOKA 2LE9A 3WFZA 1JUFA 1V8HA 1CL7L 3QA3A 4QHMB 5IHUH 3QXAB 3EFFB 1PYWB 1MCIA 4J3WA 3CVHA 1TFHA 2D7PA 1LO4L 5KSAC 4OZIB 4P23D 2EICA 3AMLA 2DQFA 4AT6A 2IANE 3HA0A 2JJWA 3HRZA 4M93B 4RDQG 4OCYH 3T4YA 5ITFA 3QRGH 4ZSOB 1HXYA 1XIWD 3LKSA 3UTZA 2YPKB 4ERSL 1WUNT 1L9NA 5IWLC 1KEGL 2UWEB 5HHVL 5E2VH 1H5BC 1KCLA 5HY9A 3W5MA 4LHUD 3C9NA 4L3AA 1X5ZA 5B38B 1JPSL 1NFDB 2WANA 4HKJB 4Q9QL 2GIYA 4ZG1A 3CDFA 1M05A 1YNLH 1JWSB 4QKXB 4PJIB 3HI6L 2V5MA 3IETA 1I3VA 2HWZH 4JFEE 2YK1L 5J12B 4LRIA 3VXNA 3D25A 1VPOL 4Z7QE 4IOIA 4LRNH 5EFIA 2J5LC 3VCLA 3OL2A 3BGFC 3CFKA 3GMPB 5JXED 4I1NB 1KFAH 4R0LB 2HT4C 4K94H 5C6WH 4PJEA 2QSVA 1T7ZA 4K2UL 4GMSL 3VFNB 2A6IB 4ALAH 4MB4A 4XVUC 5JW4R 3OPZL 1M7XA 1I8KA 1N6VA 1D6EB 3SKNB 1H8OA 3KS0J 2APVA 4PTUA 2VDMH 2VZOA 2XQYG 5I1DB 4HPOH 1NMCC 3RWCB 4MMZC 3B9DA 2YHGA 4EBQH 3VJ6B 3A6OA 1P53A 1GJIA 1YEGL 4PJGE 2EIZB 2XRAH 3FOMA 5T5NF 5E9DA 4P5MA 3NZHH 2ICWA 3WUWA 4YXHL 3KXFD 2F54B 3PIQB 2P8MA 4MGXA 3IFPA 1U8OB 1NGPH 1TJHH 3VW3H 3KPQB 4HWNA 1BAFH 1GH7A 3HB3C 5F1NB 4MAUL 3MLSL 4KMQA 4BQ6A 4MMXC 8CGTA 3MJ8A 5FM5M 4DUVA 4V2CB 2I9TB 3T65B 4F57L 1HHJA 3VRIA 2C3WA 2MCPH 3NMEA 3F6IA 5AWNH 4ETQB 3V7AG 2J8HA 2M1KA 4NT6B 5JUEL 3QUYB 1S7WB 3WXVL 3IAPA 3MLXL 4W6YB 3RWFB 1JZ2A 1F8TL 3VFRA 1EEQA 1WTGT 5F7MC 1JWUA 5JW5B 2HYMA 4RAVA 1IAIH 4XT1C 1NGXA 3QUZB 1BECA 2HA1A 4WJ5B 4FFWC 4XP6H 1A6UH 4UIMB 2X4UB 2HJFB 5C08A 2AJSH 5F89B 1UACL 5CJ5A 4JFQB 4LCWA 4R97B 3VXRA 5MEOB 3P77A 1NAKH 4K71C 4NFDA 4WWKB 3EO1A 5L88H 5J89A 1K8IB 5IJKC 4OLYH 3QHTC 3PP4H 2KKQA 4PJAE 3QCTL 2FECL 3H7BA 3CXHJ 2VXQL 4PB9H 5KJRH 2Z91B 4I77H 4LVNC 1GAFH 3QDJD 4PJCF 3KXFA 1MUJB 4HUWB 4Z7WF 5HYFA 1DP0A 2NY0B 4GW5B 1CDJA 5C0FA 2BOCB 2XWTB 3OWEA 5FF6A 3BX7C 5I1LA 4K7PY 1H3UA 3BQUA 1JHKL 4LLVA 4Y16B 4OF0A 3AM8C 1G7MA 4BQBA 4XPGH 1RZ8A 2CR6A 3OQ3B 2VE6B 1KB5B 1BFVL 1JWMB 3QRGL 1CIUA 5KSUA 4HCRL 5C8JB 2CLRB 2QQLL 5F9JB 1TMCB 1QSEB 3RWHA 3AY4C 4RMUA 4RFNB 4U1LB 3BVNB 4G7YH 1AFVL 4Y4FA 2X4PA 4YHYB 1U92A 2ZWLT 2XN9B 2ZCHL 5DQJB 3W0WE 3HI5L 1QQDB 3WJJA 4DKEH 3AFLA 1TLKA 3FZUD 2Z0BA 1VGKA 4KZEL 1CIDA 3PL6C 3OKEA 3SDAC 5J1AB 5CCKL 4Z95L 2IH1B 1G6VK 2B2XL 5KS9A 2P4AB 3LQZB 4IRZL 5I8KL 1BVLB 4A2LA 3L3KA 4OZFG 4MLSA 3RFZC 3VGHA 2HVKB 4F15C 2R0KH 4WV1B 3JUZA 3G5XB 4G6AD 5ESQB 1T66C 5DEGB 1QRNA 1IEAA 3V0AC 2W65A 4OFKA 3QUML 1IKNA 3GBNL 1V05A 1IVLA 4U4BA 4XXCC 2ZSWB 4FQPA 5C0BA 3GMQB 1FCCA 4YHZH 2ILLA 3AUVA 5IOPA 3DO3A 4XH2A 4CW1B 2R1XB 5E8DH 4XI5D 1WEJH 3HNVH 1BIIB 3NCJL 1IM3B 5E56A 1NCUA 2AGJL 1TZGH 1F4AA 1U9KA 3NIDF 3SE8H 4FFYL 4XC1H 4Y1AE 4MDIA 2BX5A 3GMMA 3F7YB 3ORJA 3S4SG 3FL7A 4O4YH 3R8QA 4XCEA 4P23B 4CADA 4PJCA 3QR2A 4PJDA 5CEZH 2UVFA 2A6DA 3CDYA 5KN5A 3OJMB 3CU1A 4J3SA 4E42B 1UEMA 3EDKA 3Q3GA 2F9BT 5T3XD 1MQ8A 3Q6FA 4G8GA 4X6CE 4UUJA 3QFJD 4RAUB 5JOPD 3ARYA 3U9PH 5DJ6B 3V4PL 5EBWA 4Q58C 3DHMA 1F3DH 4R2GB 2V5SA