2D7NA

Solution structure of the 16th filamin domain from human filamin c
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
93
structure length
93
Chain Sequence
GSSGSSGLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 16th Filamin domain from human Filamin C
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-C
total genus 6
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d7nA01
1JRHI 3OGCA 4XWGL 5DGQA 5KJRL 1CT8B 1QNZH 4HG4K 4EI5A 2V5SA 4FQ1L 3RU8L 4QRSA 4EVNB 2J8UA 1F45A 1C5BL 1CXFA 3MRNA 3BN3B 4C57C 2VZ1A 5C86A 2ENSA 4X4YB 2K9UA 4LNVA 5CJXA 3NACH 5DMIL 1Q9LB 3IU3A 5TGBB 5A3IC 4K2UH 3NIGE 1PKQB 3HZVB 2EYTA 3B9EA 4PJAB 1KLGB 3MBEA 4MD4A 3QUZC 4W6WB 3FB7B 1TQBC 3CDYA 4FQQB 4MB5A 2Y1VA 5D96B 2OSLA 4XMLL 5I1GH 5JPNA 4Q6YA 4ZDHA 3BSZH 1RUPH 2HJLB 5I9QC 1BFVH 5F7HA 1NFIA 4MS8C 1K4DA 4NKOA 5D2LF 1NCUA 2IBGA 1JZ7A 4I0PC 1CLOH 3CLFH 1G7JB 4XXDB 4UDTB 3LMJH 4PB9H 2CMRH 4Y2DD 1AC6A 4BQ8A 3OKYA 5I2IB 3BRFA 4C54A 5F8QC 1G6RL 5HHPA 1X5HA 1EBAA 4PR5A 4ELMF 4OZFG 3HLAB 3QCUH 3UTSA 1VADB 1EERB 1GGBH 1QSEA 5IV2A 3WIHL 1MCNA 4RFOL 4ODWA 4C59B 4U7KA 1NJ9A 1Y6MR 1A7RL 2EO9A 5GS0D 4LEXL 2LU7A 4Z8FH 3L7EA 3RX7A 3QIBC 3CPLA 4M3KB 3DUSA 3FO9A 1FJ1B 4NQXB 3MV9B 3O2DH 5TF1L 3RWIA 2XQYK 4Z18A 1QACA 3FT2A 2ZUWA 3BX7C 1PAMA 5KN5B 5AYUL 1MFBL 3AMLA 4PGCA 1D6EA 3AROA 2NR6D 2YRPA 3OB0K 3QUXC 4XCNB 3WO3B 1K2DB 1MQ8A 1Q1JH 4GG6A 1ZGLA 1A3LL 2X05A 1KIQB 3MRIB 3ZHKA 3D18A 4YDLB 3HUJE 5ICYA 1I1AD 2E7MA 5CBAB 1JGVL 3DJ9A 5FDYA 2C3VA 4KJPD 1RZIA 3MJ8B 5GIRB 5C3TA 3GSNH 4OCXL 1JUFA 5DJCB 2PR4H 1BJ8A 2Q76B 5K9OA 1IGMH 5KOMC 2FX9L 4XTRD 4CVZB 5DUBB 3PXJA 4WO4A 4G8GB 5BVPL 5I1JL 2VLJB 1DVFD 4WCYL 4MA7H 1T1XA 5JUEL 1RSFA 1XGRB 1JHTA 4CW1A 2XKNA 4HH8A 4XVSH 1FNAA 3BP7A 4ESKA 4OD2A 4G8GE 4MA8L 1CYGA 3MJ9A 2IALB 3L5XH 3WJJC 4JO1L 4BQBA 2KUTA 1JYXA 5GXBB 1GCFA 4HUVA 4MXQC 1JWUA 1EA9C 1UH2A 1CR9L 2JCCE 4I3GA 1IAII 1XGQA 5DDHA 1T1WB 3QQ4A 3R0MA 4YXLH 5IQ7L 1X7QB 2NY0B 1NQBA 3BKYL 2VOTA 2BNQA 1GH7A 1FNHA 2X1OA 4WJ5A 3EYQD 3JVGC 5IK3B 5B3JF 3HUJF 2VLLA 4YHYC 1KENH 4G8EA 3UJIH 4BK5A 2VXTL 1G7MA 1XGYL 3VW3L 2VDNH 4N8VB 1ZS8B 1MOEA 4RFEA 1OOAA 1FLRL 4QRUA 4W4OA 2ZCHH 4HMCA 3KJ6L 5LBSL 1FRGH 2YKLH 3JV4B 3LKQA 2OXGA 1FVCB 2HTKC 3CVHB 3D85D 1AIFB 3GI8H 2H26B 3FRPG 2HTLD 4PJCE 4TVPH 3X11B 1HWGB 5D8JH 4HXAL 2RR3A 4Y8AA 3UTZA 3WLWC 1UA6L 3IAGC 1HINL 5TDNB 3D0LA 4UBDD 1SJHB 1P6FA 4JO4L 4WFGE 3TYFA 2D31B 4J6RL 2XZCH 4YDLC 2FD6H 2R2HB 3ZYJA 4MWFA 2X4TA 3QEHA 4HWZA 1E28A 2X4SA 1D9KD 5JZ7C 5ITBL 1G9EA 1FYTB 3KPOA 4XCEA 4RZCB 5IMLA 3GRWL 3A67H 4FQXC 5HVHC 2ZUSA 3BRGC 2Z0BA 1MNUL 3MMEB 2AV7A 3ROLB 3SKNB 2WUBH 4ZTOL 1U3YA 3N9GH 4PJAE 1KPVA 4OBSA 3MUGB 3RPIB 4RIRA 3P9LA 3DURA 1W0WB 3ILPA 5FA4A 4L4VB 5KSUB 1MREL 1N5AB 1ORQA 5J0BA 2DWDB 3GSOA 5DTFB 4DEPB 2DQHL 1TXKA 1WZKA 4EQ3A 1S9VA 4U6TA 5EULV 4KK5D 1D5MA 3BKMH 5IEKA 1JYNA 4N5UA 2QHLA 3HFMH 2WSKA 3ARDD 4XXDA 2PW2A 1CK0H 2VDOH 1FFNA 4QHLB 1MIMH 3AB0C 3MA9H 3AREB 5D2LA 3K80A 5CEZD 4WWKD 3ZDZF 2WWMD 1XIWB 4I0PB 3ZE2E 5D7IB 1YNTB 4RA3A 1D9KB 2LU3A 4X4YA 4GRWH 3TT3L 4LLWA 4PIRF 5CD3A 3VFPA 5BQ7A 1HYRC 3CFBA 2O61A 2RAMA 1PD6A 4WDIA 2OM5A 1LE9B 5K9JH 2Y06L 5E8EB 2VDLL 3MJ7B 1AJ7H 3LPFA 4X99B 3I3EA 4LSVH 4OIBA 1N6VA 1DEEA 1WSST 5DC4B 4E41D 3FOMA 1VCAA 3AXLA 1IEBA 1ZT7B 3QHFL 1LE5A 3CLEH 4LVEA 5GSVA 2VQUA 2VDMH 1E4KC 1OCWH 3QIWA 1BOGB 2YN5A 2Q6WB 2FZ3A 1JWSA 4JN1H 3V4UH 1UXWA 1KCUL 1INEH 1XGPB 1A9EA 4KK9C 2APTA 3UZEA 4CNIB 4HMDA 1LK2A 3SEPA 3H3PH 3BE1L 2DIAA 5T1LB 4D0CA 1NLDL 3QNXB 2HAZA 4BA8A 3FMGH 3ARBD 3B3IA 2LVEA 2HT4D 4OKVB 2A83A 4X4ME 1MJ7L 3MRCB 5ENWA 3RWCA 3DXAD 3VFTB 5E03A 4WW2B 4U1GC 5L8KB 5K33A 4GKZA 1KB5H 3LPWA 2EO1A 3IDGB 1I1FB 1JHKH 3P40A 5TDPB 1Z9MA 3EDEA 5AZEL 2CLVB 4QXTA 1TJGL 3MRHB 4CMHC 1BZ7A 2WUCH 3GIVA 4J3XA 2NXZC 4K3DL 3D2UB 2VUYA 3NCYP 4HC1A 4OGXL 4G8GD 4J3SA 4HKBB 1KXQE 4Q9CA 4PJEF 1U95B 8CGTA 1J9CT 2IPKA 3IS0X 4H8WC 3BJLA 5C2BL 1QOKA 3QXDA 2VXQL 3W2DL 1OTTD 4P2OB 4TULL 2DQFA 4YO0A 1LGVA 3G6DH 1AP2A 2YK1L 5B3JE 1HKLL 4DKAA 5A2FA 4YIQB 2WINA 2EIZA 4F15B 4N8CH 5HHXH 2PN5A 3WXWL 2F53B 4GBXC 2V7HA 3Q48A 4PD4K 3STLA 2NXYB 2PTTB 1RUAL 3VXME 2VZ3A 3HAEG 5HYJE 2Z35A 3ROOA 1T83A 4R4FH 2H32B 3E2HB 4MX7A 1AKJB 3IFNH 1I7UA 4OCSH 3MOAL 4UV4L 3CDCA 3F6IA 3D3VD 1AGCB 1I4FB 4JB9H 1OD9A 5ID0A 5JXAH 3KPSE 4HUXA 1I7RB 2BC4B 5L6YH 3MUJA 1IE5A 4PP2B 4KV5F 4WVRA 1A6WH 4NC0B 4XXCC 1RUKL 3RGVC 4G6ML 2O5XL 4JRYB 1J87A 1FFQA 3T0EB 3N1QC 5GRXG 1LEGA 3RNQB 5FIEA 1T6WA 4WU5B 4XAWH 3H9SB 5SWSE 3G5YB 3C8KB 4HQQL 5BV7H 5HHQA 3MLVH 4NZTL 4M5YH 1VFMA 2VDKL 1C08A 4PG9A 3L5IA 2R23A 2NYYC 1RZ7L 4LLDB 3QXVA 1T0PB 2PXYB 3HUJB 2IG2L 5LCVH 4QRTA 1EXUB 5FCUH 5I8OH 1L7IL 3QG6B 2N56A 4RMUA 3TLRA 1PYWB 4YPGA 3V4PH 3D87B 3FQNA 1QSEE 1TVHA 5D6CA 3QDJB 1S78C 2HRLA 1ES0A 4DAGL 3O3DB 1YMHB 5DR5H 2GT9B 1BMGA 8FABB 5IJKC 4M48L 4CU8A 1G1YA 1I1RA 2XYCA 4N9OB 3MRBA 3C6SA 4X7SL 1DDHA 2V5RA 1EXUA 4BFBD 4L1DA 2V2WB 3VD4A 3DBXA 4J3UA 3QIBD 3VD3A 1HXMB 4OD1H 2AK1H 3QQ9C 4JQIH 3L3OA 5DK2B 5DEGB 2V17L 3U0TB 1PY9A 1IGJB 2VR5A 5LXGL 5GS1C 3PWPE 3T4AA 3ZDZE 3ZSTA 2A6IA 1NGZA 4F7MB 3HZVA 4OCRH 1G7QA 1G9NC 3RVTD 3T2OA 5D2LB 1CTNA 1FNSL 5I30L 1FCCA 4I2XE 5DHVH 4UTBH 5JZ7D 2YA1A 4B5EA 2F19H 4HPYH 3P4NA 2PYFA 4HUUA 2R1YA 4M93B 4ZPTB 2H3NA 2FSEA 2A6IB 3AREC 4NZRH 2HJKA 1S5HB 4NJ9H 1NUGA 2D3VA 2XKUA 2EE3A 1KNOA 2FJHB 5J4MA 4N9GB 1A6VL 2YN3A 1M7IA 3VFNB 4KY1L 4WI2A 2Y07H 3VXPA 5KG9A 3E3QE 3QSKB 2A9NH 4WUUD 3QUML 4JCLA 2MTPA 2CD0A 5D6DA 1DBJL 1QHPA 2FSEB 2YD5A 5DUMH 1JZ6A 5GZNC 3IJSA 4EUPH 4JG1H 3BKJL 2DI8A 3MV7A 3OXRB 3ARBA 3BKJH 1G9MC 4HZLB 1A64A 1ZT4A 1NCWH 3UEZA 3LCYA 3FB8A 1E6JL 1Y0LB 4JDZA 3CPLB 3L3IA 1QEWB 1T3FA 4DKEH 2JCCF 1OAQL 1RJLA 5L2KB 1UXWB 7CGTA 2ZUVA 4F7TA 1TJHL 1FGVH 1HCVA 2QQLL 2M1KA 1EHLH 4XMKL 1X4YA 3E6FA 2J7LA 1R3HB 1MJ8H 4G8IA 1AXSA 2EYRB 5BXFB 2CGRL 4FQXB 1AD0A 5E2VL 5IHLB 3SE8H 1LNUB 1KCRL 5A2IH 5D7KE 1LE9A 4XPGH 4PJFF 1IBGL 2YPKB 4NHUB 4S1DD 2A74B 1MCBA 5T3XE 1CICA 4NNYA 4LRIA 4FFYL 1N59A 1PEZA 4RGNE 5IIEA 4JM2B 4LARL 5E1AA 2FEEI 1NCDH 3IT8D 3QCTH 5FYKH 1UB6A 1M7DB 4Z0BH 3S3PA 3VXNB 4JQVA 3EYUL 2HMIC 5DFTA 3PHOB 1LD9A 2GQHA 5KAQG 1TVDA 1MI5A 1NCBL 3EOBA 3UTSD 2BJML 4P99A 1YJDC 2XXMB 5CGTA 4D9LH 2ICEB 2A6JA 4M6OL 1INDL 1S7WA 2HTKD 5EC2B 2FEDC 3L3GA 4X0KB 1SY6L 5E95B 3WJLA 4POZC 4XPAL 3HG1D 2EDWA 3F58H 2AJZA 3LKSB 3R1GL 1EFXD 4P2QD 1GC1H 1IC5L 4EUPG 5IR1B 4YHPA 2B4CH 2XPGA 3R8QA 4MCYA 5IBUB 3GSWB 4HUVB 4GO6B 2HKHL 1D5XB 4WUUB 1F90L 4MS8D 4XBGB 4ZS7L 4OIAA 3BD4A 1FYTD 5GQBA 4ODSH 4LEOB 3KPRE 2G5RA 1K9TA 2QKIB 2Q7YA 5DD6A 1AR1C 1G6VK 4DN3L 3ORJA 3VRJB 1P84K 4Q2ZB 1NL0H 1T2QH 5B8CC 5JW4R 3BZFA 3IF1A 2E8ZA 3ARXA 2E27L 3O4LA 3Q0HA 2EEBA 1UJ3C 4NM4H 5JW3L 3IXAB 5HI5C 3RA7L 3SE3A 4ZO8A 2DQFB 3K2UL 3LS5H 4IMLA 3V6ZA 4APQB 2EIZB 2G75A 1QLEL 5DMJB 3VRJA 3ULUL 1YY9C 1NCCH 1F6AB 2FGZA 3E0GA 3T2NL 2R1WA 3SKOA 5L2KE 2YEZB 5JXAL 3Q6FA 3SBWC 5EU7C 3T65B 5SWZD 3MOAH 2JB6A 1N2RB 4LVOC 2GCYA 3KPTA 5CZXD 5DHYA 5IJKA 2AAVA 1JMXA 2DQUL 5F7UA 3NIDF 1CGWA 2AEIT 4M7ZC 1T04A 3WL9A 3KDMB 2R1WB 3SKOB 5I74C 3FFCD 4IOIB 4Y1AE 5T33H 3T0DA 5EOTB 5EBGA 2GITA 2UZYB 4AEIH 3GM8A 3ECBA 1KIRB 4QRPD 3EKCA 5IBLC 4GRLB 4K55A 1CD9B 1RY7B 2FECL 5CZVL 5IFJB 1I3RB 4G9FA 4R3SA 4L29A 1JUFB 5DJCA 4I18C 1HZHH 2I07B 2B4CL 4OV6F 1XGUB 3DRTB 2ADIA 1FIGL 3WN5B 4X6CF 4IOIA 3RVUD 3UC0H 3OAZK 3RDTB 1TJGH 3U4BL 3NA9H 5D2LE 5KVMC 5GRJH 1RIHH 4QNPF 4P5MB 4D0BB 3DVGB 3I2CH 3OF6D 4UQ2A 4JANA 2YPVL 1KB9J 3OKMB 4IDJH 3AS3A 1QFWM 5ELIA 1PX4A 3CFEA 1F4YL 4FTVD 4JR9L 3QNYA 3VWJA 3OKEB 3CFKA 5JW4M 4P2CG 3RP1A 2G60H 3EBAA 2EKSB 2CLRA 4GS7C 2H3NB 3NZHL 3P4MA 4KJYB 1YN6A 1HQRB 2JK5A 2DQJH 1NCDL 3GJEB 3PWUA 1F4XL 4N90E 3SDCD 4RNRB 1O5DT 2IQ9H 5JXEC 2NY5L 3ZZ1A 1KJ2B 1N6UA 5LGJA 1JJUA 2NW2B 5FO8A 4OZGA 1RULH 1YPZB 4NKMB 4XPGL 1D9KA 1WWBX 4X7EC 5HDOA 3W9DB 4EOWL 3S35H 2OR9H 3GMOB 5TDOB 3TT1H 3LDBC 4NQDA 3M07A 3KLHC 3OKNA 3SGEH 4R0LC 1QZ1A 3SOBH 4P57A 2XNAB 1M71B 1V5JA 1NKRA 2GUOA 4HSQA 4D94A 5EU7E 4U0QB 1VEOA 1D3CA 5C0EA 3MV7D 3DROA 2Q1EA 4Z0XA 5FGCB 2VYRE 2JB5L 3TN0D 3PV7A 1R3HA 2VKXA 4G8IB 1UWGH 1XF3A 4G6JH 3MJ9L 4EQ2A 3UTZB 1OAZH 2N7AA 2HTLC 5ALCH 5I1IH 5LQBL 3D0LB 1D6VH 1DQDH 2J8UE 2P42B 5C6PB 1DEDA 1FPTH 5EDXA 3PWPA 1R3IL 3D69B 4ZXBC 1MRCH 4XC3L 3W39A 5C9JB 4KUZL 3JTTA 1JZ2A 3WO4C 3IJSB 5CJQL 1KEGL 2EDYA 1PKQA 2NPLX 3OZ9H 3ARBB 2KDGA 3DBXB 4GKNB 1Z5LB 3RWGB 4C4KT 1IGJA 3I2CL 3DNKA 1JGUL 1TJIL 2V9TA 4KRMB 4PJIF 1KG0B 4LLVA 5CEYB 1BECA 2HFFA 1NDMB 5HDQH 4LOUC 4KVNL 1CT8A 1ADQL 5BRZD 3TCXA 1J8HA 3VFUA 1LNUA 3V6BR 1WBYB 3M17A 3O3BA 4V1DD 3AS2A 4NWTH 1OP9A 2WUBL 3BO8A 1R5WB 4PUBL 4QOKB 1U2HA 4AEHL 5FHBH 4PS4H 3SGKC 4LASH 2XXCB 3QZWA 4JY6B 5EUOB 3L7FB 3O3EB 4YZFE 2EXWC 5H37H 3MLRL 5IG7B 4HIIA 1V3MA 4YXHH 2ZKHL 2Z4QB 4Q7DA 2X4PA 5I8EA 1WZ1H 4OLVL 4P2RD 4OFVA 3ZTJH 4HXAH 1PSKH 3H42H 1NMCB 3D3VB 2VDRH 3QI9B 3NPSC 3QDGB 1WBXA 1SM3L 2YKLL 1YQVH 5K9KA 4X6BA 4TSBH 2H2SD 4H88L 3BHBA 2D0FA 1OAKH 4LHJB 3NCMA 4JHBA 5DRNB 3KPMA 1FLRH 5HYJA 1EEYA 4R7NB 2A9MH 3GM0A 1GSMA 1CFVL 3V8CA 4JAMA 5IB1A 4XCFL 4NN7B 2XOTA 3MGTA 5FYJE 3G6AB 3HTLX 2ARJA 1TCRB 2OTWB 3CZFB 1UQSB 4LFHD 2I26N 3RNQA 2EDQA 1RUKH 3GSUA 2OL3B 1U8PA 3WV0A 4DN3H 5JORA 2NCMA 3NFNB 4GKSB 4AT6B 4YXKH 5GRWA 1PG7X 5DUBA 5C0GA 4P5TC 2QQKH 5FKPB 2CUHA 1B0GA 4XNXH 1IQDB 3H42L 4YXLL 5CMAB 3GB7B 1F90H 4MXVF 5EU4A 2P46B 2J88H 1JV5A 4PJDE 5D1ZD 4IHOA 1T89C 1HDMB 1QLFB 4L8CA 1S7UB 4R7DA 5C0JA 4DGIL 4I0CC 1MCQA 5FM4A 3IAQA 3W0WB 1DLHB 1FGNL 4AEHH 1CE1H 2GCYB 4WI5A 2R2EB 5JUEH 1T1WA 1JV5B 5MEND 3BEVB 3REWA 2BJMH 2C1PB 1NCBH 2K3TA 3LKSA 3BAEH 1KTRL 1U8HB 4MNGA 3FN0L 4QY8A 1K6QH 3ZO0A 1IT9H 3LEVL 1YNKL 2EDNA 5ECJE 5DMKB 3IKKA 5FYKL 3EDKA 4CRPA 4KVNH 5MEPB 4ONHA 3SKUD 1RZGB 2CRZA 1KN2H 2A6KB 2Q3ZA 2CIKB 1EEUA 3F7YA 3HE6B 1NFDE 4P2OA 4UAOC 4XPBL 3UPRA 4WU5A 4TOYL 1SBSH 1V7NH 2V7NB 5IVZB 3OPZL 4LMQI 4S1DC 4EN3B 5FOBB 2Y72A 3QO0A 1GOFA 1S7QB 2DQTH 3ARYA 3S36L 4RAHA 5DQ9A 5A3ID 4HFWB 3B9KC 3LEXB 3QDJD 4OD3H 5E08L 1AD9A 1CQKA 1U92A 4XC3H 4ZTPL 1CDIA 1NCWL 3GJFH 2XZZA 1OAZL 1ZLSH 2KKQA 5FAAA 1BZ9B 1HNGA 1CGYA 3Q1SH 2VDML 4EUPB 2J8UF 4LEXH 2FEDD 2EDFA 1AFVL 5FDWB 4D0DA 4POZD 3X14A 4AIZA 2B5IB 4HZLA 2GJ6E 1OGAE 4BKLB 3VXOA 1PKOA 3QI9D 4OZGB 1N5YL 3GGWB 4J8RA 1YEDA 1A6ZA 2W9DL 4C58B 4JPWL 3EOTH 4PTUB 5B39A 4Y4KB 5K9QG 3P77B 4F7MA 2OMNA 5DVLA 4BFEA 2R8SL 4JFOA 4TUKL 5GZOC 4K9EL 2BOCA 2WP3T 3PF2A 2PO6D 2Y36L 3ZLQC 4UTBL 3HS0B 2GUOB 1L9MA 4IIQA 1KJMB 5EU5A 3S37L 4G42B 1J0YA 2DQJL 1SJEA 4OF7A 1KG0A 1NC4D 2ZNWA 4XNYL 3NCJL 5B21A 4LVHB 3V6OA 1U9KA 4K2UL 4CVUA 1BVLB 2IFFL 2J5LB 4QRPB 5HPMB 3I02A 4N1CA 2IPUG 2NQCA 3S5LB 5F89A 1S7RB 1F4YH 3CNKA 2OSLB 5BRZE 3QPXL 4PRNB 2IC2A 5CGMA 4PJBA 5F21B 3FO1A 1EGJA 3P4MB 1FAIH 1DQLL 4L3CA 4ZFOL 7FABH 1ED3A 1GL4B 3MODL 1BX2A 1D5BB 3U4AA 1CFNA 5DTFA 3C5ZC 5DJZB 3VFOA 1JL8A 4YBHA 4TVSa 2J8UB 5IJVB 3ZKMD 1L7IH 4X7TB 3THML 5DS8B 4KK6D 2AXJA 1YYLL 1RAMA 2XWJA 3H7BA 5KS9F 1AO7B 1F2XK 1QPXA 3TBYA 4QTIH 3ARGB 3BDXA 3MLTA 4XB7A 4P49A 3S3SA 2E3VA 4P2RE 1TQCC 4LQFH 3SGJA 5T5NF 4AQOA 1QRNE 5E2TL 3VE0B 2JJTC 2B2XL 3GMLA 2CXKA 1FIEA 1QVOA 2X4OA 1KJ3H 2RCSL 5E8OA 3LKPA 4B50A 1NGWB 1G7IA 1PG7L 1KN4H 2DLHA 3A6BL 2YS4A 2B8OT 3IRZA 3T1WA 1EHNA 1T22B 3C87A 4J3OC 5D2NE 2FHBA 3ARFA 3OKOB 1NFDA 5EZJB 2J4WH 1T0NB 2IPUK 4DZ8B 4FQCL 1HEZB 1GXEA 1J18A 2FEEL 1BQLL 2J8OA 3KJ6H 1FFOB 1Q9OA 1C1EH 4GKSA 2F58L 3HE6D 2IFGA 1OW0C 2MKWA 4HK3N 5ISZE 5T5FH 5JDJA 3ULVC 3PGCA 3OKDB 5I6XC 3S88L 1N2RA 3MV8E 3HI5H 3NFSH 3LEYH 4KTYA 3WS3B 1X5GA 5F72S 4H8WH 4JPVL 3UYPA 1T7YA 1W0VA 3U6RA 3BHBB 1KTLA 2DJUA 5CEZH 4LL9A 5FM5O 3SKMB 1A4JA 4FFVC 3RL1B 5FO9A 4MMXC 2VC2L 1FG2A 4QHMB 1WFUA 4J12A 4CW1B 3O6FC 1OLZA 1AP2B 1OAUH 3A6CL 1QSFE 2IBZY 2UWEE 3MLYH 4K71B 3WNLA 4JM2D 5IBTL 1X5JA 2DL2A 1RJYA 3MTRA 2AV1A 3WNPA 3O4LD 2QEJA 3ULSA 3D18B 4ZNCD 2IGFL 4Q58C 3AU1A 4HS8H 1Z0MA 2HJFB 5CBAA 4NQEE 5EUOA 2BRQA 5F88A 3EYFB 1LDSA 3U83A 2ZOKB 1CDBA 2J6EL 1C5DB 1JTPA 5C1MB 3REVA 3D2UA 2CIIA 1T1ZA 4UIMA 1FVDA 2B1AH 4MCYB 4K07A 4KHTL 3W0WA 3T65A 2SEBA 1D5XA 3BYTA 3MRRB 1XCTB 3G9VA 5EOCL 2ZNXA 1DLFH 1T20A 4NYLB 1RJZA 4Z7VA 1INEL 2AW2A 3L7EB 2EC8A 4RWHA 4DWHA 2JJWA 4KQ4H 2IQAB 1OCWL 2IWGA 1DBBL 4P5TA 3RDTD 4N90D 2BY0A 5E5MB 5A43C 4M02A 1VFAA 3JTSA 2UUDH 1GVIA 4WHDA 2JIXA 5DQDH 2CRMA 4Y5VC 5C0AD 2R29H 2YPVH 2FX8L 5GJSH 3ZKND 2IGFH 3QNZA 3IDNB 3V6FA 3GKZA 5F3BB 3QFJD 1E6JH 1RIHL 1MLBB 4GT7A 1JZ4A 1MY7A 2YD4A 5C08E 1KV3A 3QEHB 4KI5E 3UTPD 1F00I 1NSNL 5E4EC 4QRRA 3QWRA 2XQBL 5FYLD 4YZFF 5D7JB 4MA1B 3QBTB 3U4EA 4JFHD 4BZ1H 4RFOH 5DJYB 4CDGC 3MV7E 4NFCA 4MNQB 3ARFD 4R4NC 4LKXB 4L3AA 5EO9A 5CS7A 1FVEA 5F3BA 1S7TB 5D5ME 4Z7UA 4XGZB 3BPOC 1ZXQA 2AP2A 2F8VA 3MLPA 4JFEB 3O81A 4OLYL 3QULB 4IRJB 3P4LA 3BP4B 1MCSA 4EUPA 5BJTA 2Y25A 3BGAA 5CIPA 5F9JA 4F9PC 1F4WL 3KAAA 1R3LB 4PJGF 4Y2OA 4E41A 5DXWA 3I02B 3ZDYF 1KJ2A 4S0TD 4P23D 3STBA 4TUOA 4HPYL 4PJGB 2YD6A 5EO9B 1RZ8A 5L0QC 1QQDA 4OTXH 3W9DA 5DLML 2X4TB 3WFDL 3JWNC 5GGTH 5IFHL 5H37G 4OZ4A 4JREB 5IB4B 1PJ9A 5HYEA 4ZG1A 2D7TL 4AL8H 2ATKA 2GI7A 3S9DB 2NW3A 2V7NA 1QR4A 2GHWB 4MB3A 2IAMA 1U8OB 2AK1L 3Q5YA 3VWJB 4MXVE 5AAWA 4Z7WE 4TRPH 2CLRB 2ENYA 2JJTA 4PJDF 1K4DB 3T4AB 4NQVB 1KPVB 4NZUH 4UIKH 3PQYD 4NWUH 1VFUA 3T0ED 4ONFH 3WNMA 5BW7A 3O9WD 4P4RB 4GW1B 4J6RH 1ZS8A 5EZOH 3SDCC 4MJ4A 1JPFA 3EDJA 4NBYB 1HINH 4U1HA 3ZL4H 4XHQA 4LCWA 3UTSB 1G7IB 4FHBD 3GI8L 2DLFH 4KRPD 4OZGE 3VWKC 4IOFD 4WFGD 3SDXA 2EZ0D 1ZVHA 2VRAA 5JLZA 3MODH 1Y6KR 1KCKA 4PJGE 3MLVL 4HJ0C 1H3PH 1KNOB 3HMXL 4X6BB 2D31A 4P4KB 4EDWH 2N1KA 3EFFA 4NQDD 5DJAA 4D9LL 5JO5B 1IEAB 1NFDF 2ZWLT 4XH2B 4HT1H 2CPCA 3H7BB 4JFQB 1CGUA 1ACYH 4PP1C 1IMHC 5SV4A 3HCVA 3FN3A 3MRJA 1WJ3A 4UB0H 1T2JA 4Y88A 3B6SB 2AQ2A 4Z0BL 1YNLH 2C3GA 3CFDA 5T1KB 4DQOH 3IFOB 3T0WA 3S4SB 2UWEF 2MMXA 3KYAA 4NUGH 3TNMB 2MPAH 1A4JB 1NGWA 3QJHB 1TLKA 5EC2A 3EZ8A 1IBGH 3MRJB 1REIA 1LVEA 4X6EA 3H2WA 1U2CA 2IADA 3BWUC 1KT2A 4YHOH 4YFEA 3GMRA 1DVFA 4JPWH 2CGRH 4YDVA 4LRIC 3DXAB 4TNVF 1PQZA 1QA9B 4AZ8A 4OCWH 1N59B 25C8L 4H25A 4CN4A 4HDIA 3RJDA 1OAQH 4YUEL 4JFDA 2QQNH 1LO2L 4LCUB 3MCLL 3SJVB 2QKIA 2IADB 1NAKL 1JWMA 1YPZE 3DPBA 2PKDA 4K3JH 3SDDC 3GSNB 3AY4C 1FN4A 4DKFL 1CCZA 1AHWC 4JY4B 1ZWIA 5DMKA 5EFIA 2CR3A 1M6OB 1AGBB 2DTMH 2R69H 4UV7H 3O6MH 4MJ2A 4LSRL 4R2GB 1A6VH 3WIFB 3MA7A 5T1DH 2YHGA 5F93C 5DHXB 3V6ZB 2VLKA 3MRHA 2DM4A 3QT2A 3ZSSA 4F3FA 5DC0A 2X4OB 5E8OB 5J12C 4P46C 3U46B 5D2NC 3NZ8B 2GIYA 2BNQB 2YD2A 3UJTH 4KU1A 4R8WL 2X4PB 5I8EB 3B8SA 3D25A 1UJTA 4UOW1 4LNRA 1S3KL 2W9LA 4JFEE 1I8IB 4BM7A 4LGSB 4I1NB 2FECI 2W92A 2CRYA 3O9WA 4MLSA 2UWEB 5I17A 5JPMB 3EHBC 3VI4F 1LP9F 4MCZB 1AXIB 5EB9A 5F9AC 1CS6A 3N06B 1EZVX 5DWUH 2X70A 1INQA 2R23B 4P3CH 4XC1H 1B0WA 5FGBC 2DIBA 1XGRA 1ZK9A 3GO1L 4JFFD 1RZKC 1UM4H 3QCUL 4HJJL 1OAXL 1TMCB 2BCKA 2NY3D 2KZ1B 3BI9X 1I8MB 1YPZF 4LSUH 4D8PA 5C0BD 5K9JL 4JLRB 1EJ6A 1OGAD 3LMJL 5MEPA 3U48A 1F11B 4KKAC 3U9PH 3KS0H 4CJ1A 4K3EL 5FHAH 3TPUB 3D9AH 3TBWA 1J0JA 4YHKL 1BZ7B 5E7BA 4H0GA 4JRXE 2R2CA 4LRNH 2IG2H 1YEJL 4PJGA 4OUUA 3J7HA 1IM9B 5CEXB 3UTOA 4DKFH 4DGYH 1HHGA 1HHIB 3HB3D 1BREA 4DZBB 2BSTB 2FWOA 1HSAB 4XVJH 3OWEA 1AI1H 4ZOEA 4XAWL 5EIQA 1I8LC 4HKXB 3BUYB 3LPGA 5GGSY 2J8HA 1R5IB 4M43L 4L29B 1RI8A 1IL1A 4LHUB 2A9ML 4F9LA 2WK2A 1S7TA 5F6IC 4Y5YA 1X5XA 1FG9C 4Y19E 3FO1B 5KJRH 4L8BA 2ATPA 4P48A 3BP4A 2DBJA 3UPCA 4HFUH 2VDRL 3VD5A 1EFQA 4NYLA 4Y2DB 3JUYA 3VWKA 4MJIB 1RZJL 3KHQA 4U1IA 3MBED 1MFDH 3GHBL 3MRLA 4N9GA 1HXMA 3PQYE 1XCQB 1OL0A 4P9MH 4KH2A 1EGJH 1TNMA 3VXPB 1RZ8B 5KG9B 3PGDA 4WV1A 4EZMA 3QIWC 4R6UA 3GRWH 2ED9A 5SWSD 4UB0L 4JFOB 1U92B 2AABH 2A1WH 5BQ7B 3DO7A 5DT1L 3KWWB 4JZJA 5EUOF 5EU6A 4PUBH 4QRUB 3VGAB 4EDWL 5DFVD 2E6QA 5IMKA 1VENA 4RX4A 1MLCA 3HMXH 3MUGA 3HN3A 5E8DL 4MVBC 1YC8A 4FXGB 5FECB 3OTTA 2DKUA 1HOCA 1BVKA 2D4FA 4GW4B 4KUCD 4NQDE 1MCDA 2R4SL 4QXGL 5ILTH 1QRNA 4PGBB 1VGKA 5D7IE 3W0WE 1JGUH 2MJWA 3EOAA 2MNUA 4FQPA 5I1DB 2E8YA 2VXTH 5C0EB 2CDFA 32C2B 4H26A 1CDGA 1UENA 5EBMB 2ICWA 3BQUA 5GISH 5J6HA 1OQOA 3MRBB 4OGYL 1F5WA 3DGGA 4NWUL 3OZ9L 4P5TD 1GYAA 1P4BH 1CTOA 4M3JA 4Z6AT 1W2KT 1IAKB 2FYYA 3H9HA 3RHWF 4ACPA 5BS0B 4HUKB 2M2DA 1JPSH 4LLWB 4GBXA 4PYHA 4M8QB 3HR6A 2HT3D 4F7PB 2ZSVA 5DVOA 2VLKD 2XTJC 3RAJL 4MJ5A 5GGUA 3ZKNC 2VNCA 5CBEA 4LSTL 5EIIA 3E6HA 3CFJA 3L5XL 2FO1A 1G84A 3TESA 3SO5A 4J2XA 1CD1A 2B4CC 1Q9KA 1KUMA 1QBML 1UWXH 5C71A 2NLJB 2BHZA 1XAUA 3OB0H 4X7DC 3VI3E 1YEKL 4WUUA 2ADJB 1U3JA 1AY1H 2KH2B 1F4WH 4NQCA 5BVPH 4X4XB 1JHLL 1U8MA 3FFCE 4ELME 1IGML 3WNNA 3L5JA 3I6LE 2QSCL 3WD5L 4QRPE 4R96B 1HXYA 3IDIB 5C7XL 4XBEH 1CDHA 3BPCA 1KF9B 3ROOB 3SCMD 2W59A 4YBLC 3L3GB 3UYOD 2YSSB 1CXHA 1ITBB 1J5OH 2JELL 1IAOB 3MCKB 2D0HA 3CH1A 1MCEA 2A83B 1PVHA 5GSRA 4LGRB 4ZUUB 1R3JA 3S3JA 3WS6C 4K7PY 2VL5A 4NRZB 1CLYL 1ZVSB 4U6HA 4CU7A 2XN9D 4WFHD 4NJAL 2BNQD 2D9QB 1FDLH 3K8KA 2G9HB 3RGHA 3OR6B 2BNRB 3BPCB 3VXUD 1E6OH 4YH6A 1U8LB 1IZJA 4H0HB 2DQHH 3ILQC 3UZQA 3D39E 3O2DL 1C8PA 4ZQKB 4RQQA 4ODUB 2DIJA 1DANT 1BOGA 5HJ3A 3RI5K 4FQLH 3M1BA 3KPMB 4P23B 4U1SA 2XZAL 3I84A 4W68A 1J1OH 4IJ3C 3SDYL 3FT2B 5CZVH 3Q6GL 5HDBE 2O5ZL 5D7JA 2RFXB 1GGBL 2NY2D 4I48B 3QUYB 3GMRB 4KI5D 3OR7A 4YFDB 4BQ6A 4KZDH 4APQA 3IDYC 2FJFA 3HI1B 3G5XA 4TVPD 1P53A 3MFGB 4OZGF 3DYMA 4XCYB 4GAYB 4PJ8C 5AD0A 6FABH 5D70L 1ZAGA 5I8CB 3C6LC 2CMRL 2Z8SA 3K3QA 2ICEA 5E5RB 3QULA 4IRJA 4KRPC 3QIBA 3VWKD 3TN0C 3B2UC 2FWOB 4UZGA 3SY0B 4FNLH 4HZAA 3D48R 2P44B 4E41B 1MRDL 2EH8L 4TVPL 3LKRB 4YC2C 1U3HB 1X5ZA 5HHNB 2Q86B 4HWBH 4LKCB 5BVJB 3WFCL 4IIQC 5I1EL 2R0ZL 2XACC 3S4SG 2DL9A 2I9TA 2VC2H 1D5ZA 3CUPB 3UO1H 4NM4L 3DYPA 3VU2A 4M00A 2ATKB 1NAMH 1UWEH 4BSJA 4NQEA 1MLBA 4Y4FC 5F1KC 5ID1B 4L8DA 3LRSA 5GGTA 1T2QL 3K2MC 4JZJC 5C8JA 1WC7A 3AMKA 1OHQA 3LKOA 4KI5F 2R1YB 2VLRD 1I1AB 2NZ9D 2Z31C 2CK0H 3OKLA 1RZGA 2X9YA 4JRYD 5H35B 3ARDB 3QRGH 1MHCA 2XFXA 5HDBF 1I7TB 4D0BA 1B9ZA 3BGMB 4OFIA 4ZS7H 3IJYB 4P57B 5ADOH 4HF5L 4JKPL 3ALWA 3VXOB 2HKHH 3IB4A 1N6QH 2YXFA 4PRBA 1E28B 2X4SB 2EKSA 2J4WL 4HCRH 1I1AA 2GJZB 3VMOA 3GK8L 3F58L 3U7WL 2R9HD 3HZKA 1HIMH 3SCMA 1QTYT 3MV9D 4UT6L 3FQWB 4YFLF 2BOCB 4CMMA 1KIUA 2CKBL 2NY6B 1JGEB 1G9NL 3MRLB 4O4YL 4CU6A 2DMCA 1KELH 4LPTA 4KGLA 4ETQA 3PWVB 5D70H 1HH9B 2ZSWA 3TVMC 5AWNL 4NUJA 1G7LA 1QRND 4KVCL 4Q9RH 4LF3B 4QTIL 1G7QB 2FJGB 2DWDA 4O02H 2EIEA 1JF1B 3JVGA 4NDMB 1VPOH 4LPCA 5IVOA 1SBBA 1KLUB 2LQRA 5DD0H 1XGUA 4X80H 1IGTB 2QADC 3FQTA 3RY4A 4OFYA 2XZAH 1OP5H 1HSAA 2HLFC 3MV8B 4HFUL 4QNPE 4NRYB 5KVEL 4PRIB 1LP9E 1BBDH 4TSCL 3H3BC 3X13A 1AGFA 3KXFA 3WXVL 3PWPD 1BLNA 1HHHA 2H2PC 4ZOAA 4L8SB 5AYUH 4HUMB 2VE6B 2VSCA 4WV1C 4PJ9C 3QPXH 4CAGA 1OF2A 3DXAA 3AS0A 4NJAH 4RAVB 1A0QH 4XVJL 4P9HH 1U8IB 1U91B 1B4JH 4P2QA 3O6LL 1KCSH 1TTFA 4PJEA 1TETL 5D1ZC 1FFRA 5JIPA 4XNYH 3WHXA 1B6UA 4OAWA 4PBXA 5EC1B 3GSNA 4HLJA 2PYED 4KUCF 4O51B 3JZ7A 1BIIB 5J89A 2Y07L 2E9IA 1F6LL 1M6OA 1F02I 5TQ0L 4L3CB 1AQDA 1U91A 4P2QB 1KSRA 4NIKB 1PX3A 2YSSA 4NJ9L 1P7HL 3VFSA 5CWSA 4NZRL 4RSVA 4PB9L 1AY1L 3M17B 3O3BB 4RMVA 1FZOB 1N5YH 2YMXL 3IVKA 3P73A 3HB3C 4YDKL 1QBMH 5IW6B 1FNSH 3NIFE 1KFAH 5I30H 5TE7H 4G5ZL 2LV4A 4IRSD 4XC1L 1AFVH 2HP4A 2AJSH 2P43B 3WFHA 3BN9C 1HCFX 4HXBL 1TDQA 4QGTA 4XCNA 3O6LH 5C0BB 5DRWB 3BWAA 3NFNA 1ZGLB 4L5FH 5D72L 5F9WC 2V17H 2HLAA 1GAFL 1JPSL 1CDJA 4ZUTA 1KC5L 3QH3B 4OD1L 4POUB 4KQ3L 1H3TA 3NGBB 5CZXC 4X5LA 3KYMB 3X12B 3BFOA 2IEPA 5HYQB 3VH8G 4ZUVA 4MD5A 1OD7A 3GIVB 2UV3A 2KL6A 1R0AL 1RIVL 1IRAY 2PNDA 2VLME 3D0VB 1J0IA 3HRZB 3QAZC 5IW1B 4JN2B 4PRAA 2HFFB 4KMLB 3CU7A 2P5WA 5EUOE 4IRZL 3FN9A 3BH8B 2G5BA 4QXGH 3FQXB 3HMWH 4K8RC 3P9MA 5GS0H 4F2MB 4GG6B 3VDBA 1RHFA 1K6QL 2EIBA 4WW2A 3RY5A 3MRIA 4WW2F 3CX5K 4MVBD 3V8OA 4Z7WF 3DMMB 1G7JA 1I8KA 4OGAC 4RGNC 3QZWB 3G08B 3VWJD 5H2BB 4JDTH 4ZUWA 2LFGA 3GMQB 4PGDB 3STZB 5I2IA 1SYVA 4P2YA 2AABL 5IG7A 4LP4A 5SWQB 4BSWB 2CK2A 4O2FA 5D5MA 1MQKH 2A2QT 3PXHA 3VMNA 2HFTA 2ITCB 1GZPA 2DQDL 2BDNH 4NO0A 4EI6B 4CADA 2PETA 1H8SA 1ROWA 4E42B 4FQIL 4KJYA 4PY7B 1ZSDA 2J88L 4MAYD 4F37F 2O26U 3L3HA 3IFNL 2NX5B 4KPHL 2DYPA 3BW9B 3VXTB 1HI6A 1V05A 4M03A 1XZ0A 2AEWA 2QQKL 3QRGL 3EOYG 4YXKL 5INDB 1T4KA 1YNLL 4LCYA 3BZEA 2P5EA 5T3XH 5HGAA 3D25B 2BP3A 1EVUA 5C07D 1CDYA 2DDQH 1T1YB 4Y16C 1ACYL 5C0CA 5IQ9A 3WUWB 3HNSL 4Y5XA 3VI3F 3KLAA 3RUGE 2JF1A 4XGZA 1BF8A 3QDJA 1OAKL 1YEDB 3TH4T 4KKBD 3BUTA 1IQDA 4RMTA 5GS0L 3IJHA 3QFJB 4ZAKB 5HTSA 1KJVB 4NUJB 4I4WA 3DX6A 4NN6C 5FYJU 3BUYA 2BCKB 2B1HH 1JHKL 4FQJH 3D9AL 4Y1AD 4KJPC 3LVEA 3OJVC 5MI0B 4FNLL 4I9WE 3U1SL 5AAMA 5EZOL 3OKEA 1XGTA 3WSQL 1WFOA 4OM1L 5FUZL 2MQ0A 5KSAC 3N50A 1R0AH 3F7PC 1BWMA 3IETA 1CFSA 2BVPA 1W0WA 1VFBA 1NLDH 5LVEA 2OCFD 3WBDA 1Z0NA 3TBWB 3UCRA 3BE1H 2YWYA 4KTDL 2ID5A 3C60D 2Z8VC 4X83A 3EO9L 3Q6GH 2WBJD 2PYFB 4PRPD 2I9LB 2DM2A 4P3CL 1BD2A 3MXVL 5IHUL 3O3DA 1CG9A 4ZD3H 1W72B 3QHZH 2D2OA 4FQLL 5EA0H 4OLXL 5D93B 2PO6B 2P8MA 5FM8A 3CIQA 4OZHB 4QGYA 2X4UB 2I5YL 1ZHBB 2AV7B 5AG9A 2ERJB 3RIAF 4UTAL 3QNYB 2YMXH 4R8WH 1R24B 4A2MA 2C4XA 3AM8C 1UWXK 2FL5B 2Y9RT 3N1FC 5F7YC 2MQCA 4N5ED 5ICXA 2BMKB 4X6FB 3NCYS 1QD0A 4X4XA 1GPOL 2P45B 4L4VA 3TBSB 3QXTA 3WE6B 4I5BA 4XNZC 4NNXB 2JKXA 2HFEA 4KUZH 4P2OD 5D7IF 1CGSL 4WFED 4L8SA 1R3IH 4AM0A 3TC9A 5IMMB 3C5JB 4P4KA 3VI4E 1YUHB 4LPXA 4NQSA 1H3XA 1D6VL 1DQDL 3SKJH 5E24E 1HYSC 3IXTA 1MHHA 3LKQB 3QQNA 3BZDA 3GMOA 1EMTL 1JN6A 3QWOB 4IMKA 1UT9A 1MIML 4QOKE 3U30C 4ZFGL 4P46D 4K3JL 4GLRH 5JW5B 1KCSL 4JFYB 3MZTA 2X4QB 1PW3A 5GJTL 1IAOA 1WT5A 4XNQB 3MBXL 1S9XB 3BGFB 4RISL 2AEQL 2DJ4A 5IMMA 1HH6A 2GTWA 5GJSL 4Z7WB 4LCWB 4K7PL 4O9HH 2IH1B 4HULB 2J2ZA 4LPWA 5IEHB 1UM6L 3PGCB 1NC2A 1LDPL 4LFHG 1Z3GH 3C09C 3GMNB 1ZLVH 1J1XL 4JZNB 2ZCKH 4OLXH 2FIKB 2X1QA 1I85A 3U82B 1WBYA 5KVEH 3VJ6B 3QPQD 5IVXB 1W0VB 3U6RB 5LKNA 3LQZA 1Q9KB 5D2NA 3BO8B 3BISA 1IEAA 1KIQA 2NX5D 3UP1A 4EI5C 5DJ2A 2ICWB 3BQUB 2IH1A 1MHEA 2IQ9L 5C0IB 3E6FB 4O02L 3N85L 3BDYL 4Z5RA 3ZT5A 3BPNB 1T22A 1Z2KA 1T0MB 2C7UA 2B1AL 5FGBA 4BSVA 2P8LB 4JQXC 4NM8L 1WCQA 2H8PB 3OV6A 1VKXB 4NQCE 1CU4H 1CL7I 4PJBB 5D1QB 4X6DA 4IRSC 3MBEC 4S1QH 1W8OA 2GYSA 2DYPD 4HS8L 1HN1A 3QFJE 4UT6H 4XRCB 3WKML 4KTEL 4IEFB 3GIZL 5CJBA 3PE9A 3KYOB 4HJGA 1MCCA 1A7PH 1Q0YH 4G9FD 4I0PA 4I3SH 1A3RL 1X5AA 3GKWL 2DLFL 1BJ1H 5D1XB 1SEBB 4JFHE 4GQ9H 3JBG7 1N6QL 3DV4A 1JWUB 4QHKI 4YR6A 1XCTA 4NP4H 1IGYA 2BHYA 3FT4A 1S8DB 1XH3A 3G5VB 3UJIL 4PY7A 5A1AA 1SY6A 3EJYD 2BNRE 3T0BA 1D5ZB 2VN7A 1CFQB 2CLVA 3FB5A 5DT1H 4X99A 1DEEB 4XB8A 3MSPA 3O41A 4K94L 3S88H 2X1XR 3BXNA 4LDLB 3D1MC 1NJ9B 2HRPL 5HGGS 3CCHA 5HD8C 1FO0A 1ADQA 2BVTA 2NY4B 4U1LA 2GTZB 1CR9H 4X7CC 1RK1B 4ZUUA 4J3VA 3ZTJG 2WIMA 1NEZB 3PG2A 4X5XA 3KLAB 4FQCH 5IB5A 3LS4L 4XP1L 1DQJA 3VDCA 5DK0B 5DLMH 5J56B 4HH9B 3X3GL 1S7XA 4WI7A 1PG7H 4GXVL 3WUZA 4RGMC 5HGHB 2R0WH 2IMNA 2RCSH 4MA7L 4ZS6D 2AEPL 5HJ3B 1QSFA 1MUJB 3S96A 3VXUA 4LQFL 3ZKXB 4KK8C 1TVHB 2DI9A 3B83A 4PLKC 5IW1A 5BVJA 1U3ZA 4GRLD 3B4NA 4X6DE 3T77B 4F33B 4NOBA 5CP3A 2A6KA 4KZDL 2NY4C 5HYFA 3OXSB 3DVGA 2O5ZH 5CLWA 1ZANL 4BZ1L 2QSQA 4YBQC 3AGVA 1NAMB 3BP6A 4BQCA 4K3EH 3NIFF 4D8PB 2GY7B 2AI0L 5HYSG 4MD0A 1A3LH 2HWZH 4G42A 4HPOH 2VLJA 4PJ8D 1OTUD 3MPCA 4XPAH 4HFWA 3WJJA 1KGCD 2BY1A 1H9VA 3G08A 3W0WD 1FAIL 2PF6A 4OZFA 2R2EA 2OP4H 1A7OL 2B7DT 4KQ3H 1XCQA 3B43A 3TZVA 4JFED 1HHKA 4GSDH 1EAPB 4PB0L 3UTTB 4OFDA 1V3LA 2LAGB 4JVWA 4XBPB 1NEZG 2NNAB 1BFSA 1ZSDB 4BFIA 3NCJH 5EBLA 2GSIB 4YHIA 2AJSL 5EU3A 4X4MA 5TE7L 1NCNA 3OKMA 4DVBB 1DLFL 4K9EC 5DJZA 1IL1B 5JA8B 4LK4A 5ANMB 3QDJE 4LPYA 4MJID 3HI6H 2WWKT 4JFXA 5DEGA 1U8QA 5E5MA 3RFZC 3KPLA 3TA3A 2W0FA 3F12B 2R2BB 3FT3A 5CSBA 5FECA 1JN6B 3QWOA 5KVGL 1X5FA 1WTLA 4WUUE 1AGDB 1HNFA 4UNUA 5K9QI 3IRPX 3CLFL 4N0CD 4OZHA 1EHLL 1YEKH 4TTDC 2OK0H 3VE0A 4YHNB 3O6ML 1G6RA 1FH5L 3HC3H 3ARZA 2APVA 5J6HB 2QJDA 5I1AB 4XPHL 3SCMB 4F8QA 1OT2A 1TETH 1OARL 1VACB 1AGFB 1T5WB 3KXFB 3MLYL 4JG1L 5F7KC 5CFHA 4YHML 2E7LA 4D3CL 4YWGL 4ZNEA 3R06B 5E00A 1EIBA 1T0NA 1IAKA 2FYYB 4ONGH 1MCOL 3QUMH 2JJSC 3X3FH 5DSCA 5JXEA 3WS6A 4N0FB 5LJYH 1CE6A 5E6ZA 4YGVA 5IFAH 5D7KD 5I15L 3O8XA 4FXGA 3FQUA 1LK2B 1EO8L 4MAYC 1FORL 5HXMA 3KYMA 4PJXB 2QSTA 2ZCLL 3ZDYE 2AXGB 2DBLL 4OGYH 5HVWA 1M05A 5E00B 3ESUF 5A40E 1V7NL 4XHJD 3L3IB 3LKNA 1A9BB 2DQIL 4ORGA 1F2QA 1M1SA 1BQHA 5DD0L 1CG9B 1MPAL 1WLHA 1MFNA 4PGEB 5JW4N 1VPOL 4OCRL 5E6ID 2BY3A 2CUIA 2W0LA 4HIJA 1JNHB 2AKRA 2DKSA 1EV2E 2HT2D 4P3DA 2WANA 4Z7VF 4YE4L 5E8PB 4Y4HC 3WIHA 4XP4L 5ABDE 5GGVL 4Q0XH 5C0FB 5JHDD 2H9GB 3T0AA 3SO3C 1CICB 4NNYB 2OS7A 3ETBF 3HG1E 4JHWH 2BFVL 2Z4QA 1LO5A 3MR9B 1IC4H 4PRHE 3UTTE 1KJ3L 3TNMA 1G9NH 2GFBB 5JQHC 1T21A 1KPUA 4GG8A 4JPIB 4PTTA 3ARFB 5HHME 1HEZA 5JA9A 4UBDC 1I9IL 5F96L 5I0DA 4PRDB 4NQXA 5D7LA 5JNYB 1YYMH 5L2JA 4W4OC 3WFZA 5KSAD 4JE4B 4OKDA 3QWRD 5B4MC 4HKZB 2ZUQC 1RZJH 1KPUB 3C60A 1K4CA 3LQAH 2AJXH 1D5IH 2W65B 5KVFH 3B8YA 1RZ7H 3P3YA 2CK0L 1AGCA 2CR6A 4M5YL 3UXFA 5ENWB 3M1BB 4NKDB 4OLEA 2MQ3A 2X09A 4OJFL 4HWBA 3JWDH 4OQTL 1QYGH 3GSVB 1YEIL 4ODHH 5IUSA 3PJSB 4EDXB 1E4KA 3O4OC 3MYJB 1IKNC 3HNTL 1WFTA 4Z7VE 1EFXA 3L5WB 4G6MH 2V2TB 4UDUB 4B7LA 3IFOA 1LILA 1FL3A 4NRZA 1YQVL 4IRSA 4HGMA 4F3FB 4DGYL 5IFHH 1F4AA 3BOVA 2C5DC 3I85A 4L4TB 4UV4H 3T0VA 4N8VG 1EO7A 4RMWA 5AYQA 1IILE 3KG5A 5F7LB 4NCDA 1NGPL 1J0HA 2CLZB 4WUKH 1P5UA 5E6IB 2NMSA 5ALBL 4RDQF 4Y16B 4K9EH 2YD8A 4OLUH 2A73B 4JG0L 3REVB 4R97B 1WCBA 4D9RE 1RFDH 3WXWH 1DQJB 4AH2A 43C9A 4E0RB 3FTGA 4DZBA 1S7SB 4LLQA 1R3LA 3TVMA 4WO4D 5ID0B 1XF2B 4V2BA 3NN8B 1HDMA 1QLFA 4NWTL 4I0PD 3BJ91 1CGXA 1IM9D 4L9LC 3H9SE 3PL6C 4PJ8A 3LRHA 1U42A 2EDLA 3MV11 4R26L 4A6YB 3QO0B 1F3DH 3JTSB 4N68A 2WV3A 3DRQB 2VLLB 4LIQE 3IAPA 4S1RH 4H1LB 1QLRB 2WBJB 1V7MH 1KIRA 2FHCA 5L8LB 4O2FB 5E08H 2FO4B 3KPSB 4OCNC 1C08B 1DFBL 4PG9B 3QUZD 3V5DB 5KSBB 4XP6H 1IGCL 4L4TD 3WIIH 5I71C 3MFFB 4MJIE 1DTUA 2X1PA 3QDGE 4KQ4L 2EDTA 3TP4A 5KS9A 3UZVB 3H3PL 2DLGA 4RMRA 1MCWM 1SYSB 3RGVA 1H5BB 2DTML 4YPGB 4PJHF 3NMEA 3CSYA 4PV9A 3RZCB 4MNGE 2QSCH 3WD5H 5CEZE 1YNKH 3QUXD 5FGSA 4RAUA 4NKQB 1QFWI 2EDJA 3FN0H 1VESA 9CGTA 5I16A 3SDXB 2DQGH 3MRDB 3O2WL 3FRUB 1G0DA 5F8RC 5B38B 1ZV5A 5FKAA 4KRNA 3TEUA 1LK3L 5HHOD 3D39B 4LLUA 1ETZA 5FK9B 3T8XA 5D4QA 3QDMD 5ACLA 2ITDB 3SCMC 2HFGH 2YC1A 1RUML 2F9BT 3RWFA 5F7MC 4ODVH 3LZFL 1U41A 4OV5A 2XG4A 1FFPA 1U8OA 3VJ6A 1SEQH 2V9RA 5INCA 3TYGL 1NGQL 2AXFB 1OF2B 1ETZB 1OAYH 3IFPA 4YHNA 1KXTB 1CBVL 2NR6C 3T04D 1MRFL 5T3ZE 1KBGL 1DANU 3HNVL 1ED3B 3OMZA 2C4FT 2VISA 3GBMH 1OP5K 3QIUC 5IKCA 4KXZH 3HI5L 4GRWE 2NY5C 3TZVB 3PHOA 1ZOXA 4XCFH 2OX5A 4U1HB 3IKCB 4XMPH 2IH3A 3TIEA 1BZQK 1K8DA 1WGOA 3EFDL 1XT5A 1HSBA 3GFUA 3OL2A 3JTTB 3MV7B 3RIAK 3ARGA 3VG9B 1CIDA 2VXUL 5MEQB 1OT1A 3NH7L 5HPMA 1ZHLB 3KXFE 2GW5A 2IAMB 2EDKA 5E8DH 4X8XA 1U58A 5FGCE 4HIEA 1UB5A 5DRXB 1NGXA 1MCWW 1UKSA 1SVCP 2X4RB 4F7CA 4LLVB 5CEYA 2CJUL 4I9WD 1WUNT 5BXFA 1S5HA 4ZODA 2Z8RA 5ACZA 1NDMA 4KKLC 2AJUH 1D5BA 1J8HB 3CFIC 4KKBC 5D6DC 5EZJA 5HY9A 4NZUL 4QYOB 4NOFA 4FQQA 2ZJSH 5I1CL 2XZCL 3E6HB 3RHWK 4CKVX 3BT2H 4ZDHB 5SWZA 5FYLH 1A21A 3WCYA 3BZFB 3MRKA 4YNYB 3CC5B 1H8OA 3QJHA 3THMH 1F3JA 4LAJH 5E1AB 4DUVA 5BOPA 2D7TH 3DIFA 5TPWL 2DTSA 4GG8B 4JPIA 3CFBB 1FO0B 1ERNA 4U1JA 4M6AA 3T2NH 1J0KA 4PREB 5HGDB 5TJWK 4LU5H 2NY6C 4RGMB 3LIZH 5ICYB 2BSSA 3K81A 4LVNC 3B9KA 4GG6E 5L2KD 5J1TC 3D85B 5H8DA 4Y16A 1YMME 4OFKA 2OJEA 5C6TH 3GNML 2IFFH 2A73A 3PNWA 4OLYH 4UT7H 3LQZB 1MUJA 3FO9B 3QXWA 5E1HB 3TBTB 3LB6C 4MSWB 4Y89A 3UAJC 1YEHL 4NFDA 4HW6A 1NGQH 1LO0L 2BNRA 5IMOB 1SEQL 3FONA 4PJ5E 4KK5C 3WIFA 4DCQB 3QUKB 1JGDA 2Y36H 4Y5XC 5A16A 3OG6B 2IANB 1C5CH 5SWQA 1RUMH 3CFJB 1HKFA 2RB8A 1WV7T 1IC7L 1I75A 4X6CA 5GRYA 4X6DB 4Y5YC 1HHIA 4WI3A 1QFOA 1JZ8A 1CGTA 3TVMD 2FX8H 5IMOA 5F44A 1T20B 5J13B 1MHPH 1PKQE 4JFFA 4WCYH 3QUYA 1RZKL 2IQAA 1L6ZA 2BC4A 1JTOA 1T4KB 5D7LB 4XVUD 2YRZA 5EBWB 3KPRA 3CFKB 3DSFH 5KANG 2BNUB 1S7QA 5HI4D 3MNVA 3OF6A 1RULL 1S8DA 2FBJH 3G5VA 4S2SB 5E8NA 1E0OB 4F57H 2BNQE 1S3KH 4TQEH 2WIIA 1F4XH 3CAFA 3TN0B 1I8MA 3IDNA 5D1QC 1N7MH 4GRMB 3SE4A 1KCRH 4PJ8B 1Q1JL 2W91A 5GRVK 5MEOB 3JWOC 2DAVA 3OR6A 2G60L 2J6EH 4HUNB 2ADFH 4JFDE 4RDQG 3QEQB 3BXNB 4LNRB 2XZQL 3O2VH 4XMKH 1HWHB 3CZFA 1ONQB 3LHPL 3BQUC 1FBIH 1G7HA 5HD8D 5FA3B 3VG0H 4LKXA 4DOHB 4XPBH 2VLRA 3JXAA 2MKLC 4P23C 3U4BH 4PP2A 1XR8B 4YGAB 3SJVE 1ZHKB 5GPRA 1X5KA 4WJ5B 4CVXB 3C09B 5GRUL 5L7XH 4KROD 1DBJH 3F7RA 1ONQA 5DA4A 1EEQA 1UVQA 5KS9B 3MGAA 5D71H 2YD7A 5F1OB 4OV5B 3MLZL 4O2EB 3H9SA 25C8H 4JHZA 4LLYB 1X3DA 3BGFC 4ERSH 5CEZL 2W1NA 2NTFA 3UYRL 1RURL 5I19L 3O8XB 4QRQA 4JG0H 3DX9B 3I50L 2P8MB 4KMQA 5ISZA 3TM6A 2DQUH 1I3RA 4G9FB 4NO3A 1MWAH 3MROB 1URLA 1E4WH 1FL5A 3PWVA 3ZDXE 1JE6A 4DQOL 3ME0A 3DRQA 4PGEA 1EHXA 1J11A 1FO0L 3FOLA 3FO2B 5HI5D 1JNHA 1NGYB 3MOBL 1VDGA 5LXGH 4QRRE 4HT1L 1CFVH 2B2XH 3LD8B 4JDVA 2XWJB 4TPRH 4F80A 4PFEA 3CFCH 1NL0L 5D93C 2NXZD 4M8VA 2ADJA 1X5IA 3ARVA 2D7NA 5DR5L 2PO6A 2VLMD 3UTSE 1LWRA 3OSKA 4PGBA 3TJHD 3UTTD 1L0QA 5DO2D 3RGVD 3FB8B 1WICA 5L8JB 4YHLH 4HIIB 1YYLH 2IJ0C 3GMLB 2UVEA 1T03H 3D69A 1NC4A 2APBA 1NANI 4PGJA 1IAMA 2ZKHH 3PGFL 3U7AA 1DSFH 5F6HI 1WITA 1A1MA 1WIOA 5AEAA 4NQVA 1FZJA 4CBPA 5IV2B 2IMMA 2WM0A 3ZT6A 2PYEA 4ONFL 4L3EA 4RBPH 2WLZA 1ZLWH 4YK4C 3C9NB 4CMMB 5KSAB 5EUKB 1WBXB 3K1DA 2QTEA 4MQSB 1JGEA 2EIDA 1SY6H 2F8OA 3VFWB 4XP5L 4AM0B 4GG6F 1T03L 4LASL 1YECH 1INDH 2BX5A 3LKNB 1EH9A 5MI0C 1ZA3B 5AG8A 1UACL 3OX8A 3VXRD 3RZCD 3Q3GB 5FYKE 3TO2A 3VRLE 2VIRA 2Z91A 1AO7A 1EVTC 2EDEA 4FQ2H 2BXYA 3C9NA 1A1NA 5KTEH 3MZGB 3DMMD 4JRWA 1UC6A 5HYJD 1JMZA 3NTCL 3LN5B 1ADQH 5GGTL 5MHSE 4LARH 4JB9L 3S37H 4P5KB 4I18A 4OTXL 4BJLA 3PWPB 3D0VA 2NY1C 3P0VL 43CAA 4V1DA 5H94A 3V6OE 2A6DB 3A6OA 5BOZG 4WI8A 3K74B 1W8NA 2VJXA 4FRWA 1FO0H 2RFXA 4C56B 4Y5VA 5JXED 3VGEA 1YEEL 4QXTB 1RZIB 3MJ8A 1J05A 3WLBB 2BRRH 2EH7L 3QIWB 3MRNB 5C0BA 1KTDB 4PREA 5IFAL 1QSEB 3T0XA 3W2DH 5IP4A 4R97C 4EBQH 1MAMH 1WAAA 2AKRB 4HIJB 1MCOH 4N8PA 4P3DB 5EOQH 4YDIL 3SQOH 3W11C 4WHTB 3D5OF 2NY1B 4NKDA 1I9EA 1PDKA 5CINL 1ZVSA 4U6HB 1ZLSL 5F6IB 5DRZB 3U46A 5D1QA 5BMFH 2HJLA 1GZPB 5MENE 4Y1AA 1EEZA 1JK8A 1TTUA 3O41B 1L7TL 3RUGB 1YDPA 4ONHB 1QPPA 2X4NB 4KY1H 4ZTPH 3CCHB 3RUGF 3QUKA 1RJZB 1B90A 1FE8L 3VXQB 1S7VA 1AXTL 3UPRB 5ICZA 4E41E 1FC1A 1OSZA 1R6VA 1KGCE 4JVUA 3PQYB 1NMAH 5ESVB 4MQ7A 3IDIA 1DBBH 2X70B 3VG0L 1N7ML 1B4RA 1UM5L 4YEFA 1CGVA 1T1YA 2XZQH 3O2VL 4ZOBA 4MJ6B 1RVFL 2ADFL 1A5FH 3QNZB 1S7UA 3RTQD 4HEME 3V7AG 4I13B 2ZUQB 5KW9H 5HYJB 2HN7A 1IT9L 5I8CA 5I1HH 1ZHKA 4PB0H 4QHKJ 4V1DE 2Z35B 3IXAA 4JQIL 1YJDH 4GRLA 3SJVD 5EOCJ 1ZA6A 3UTPE 2EDXA 4E5XA 5IFJA 4LSSH 3GSUB 3GI9L 3PHQA 1AJ7L 3CMGA 1SJHA 2OI9C 4FP8L 3O3AB 4BZ2H 1MCFA 3CXHK 4HWZB 5EH1A 4MDIB 2HYMA 5FO9B 1RQ5A 1X4XA 1MHPL 1YY8A 1HZHL 3BP5A 1OAUL 3A6CH 1DBAL 3ZDXF 4YJZL 1DDHB 4HMEA 2PCPA 4LF3A 4Y4HB 3QQ9D 1DQQA 1N64L 3T4YB 1RUQH 2YBRA 4AEIL 2CO7B 4YEEA 1C5CL 4UT7L 2RBLA 1SQ2N 3SDAC 1T1XB 2Y6SD 4OZ4B 4H8WL 3FO2A 3WYRA 2AJ3B 3O8XC 4PJIB 3CK0L 1BLNB 5C0AB 4MAYB 3I75B 4GXVH 2OI9B 2VE6A 2JJSA 4KKAD 4HLZG 3OJ2C 3ZHLA 2R2BA 2L4OA 4PJFB 1SM3H 4ZO9A 1AGEB 3MGOA 1WEJH 1NCCL 5BJTB 5HGBB 5C9KA 1YMMA 4QRQB 1LP9A 4DFIA 2WIIB 3KHOA 4I5BB 1T7VA 3A6BH 5SWZE 5GHWL 4EXPX 3TJEH 5F1NA 4OLZH 5ID1A 1UEMA 3MUY1 5AZ2L 4YXHL 1MNUH 2Y5EA 1EAPA 1WWWX 3V5HA 3SDDA 5I1CH 2ORBL 3AY4A 1MVUA 5A2JH 1BD2E 1AGEA 3MGOB 2JJVA 3ARTA 1XIWD 4NQCD 3BDBA 1HKLH 2GY5A 3TCLA 5KOVC 5FHBL 5L9DH 1OP3K 4WU7B 2OL3H 5TE6H 2DMBA 3L1OL 2OL3L 4KZEH 1KXVC 4XNMA 3L3KA 5LG1A 3V7AE 4RWYL 3TO4A 2Z9TA 4J1UB 3IFLL 1GC1L 4AEFA 4I3SL 2I60H 3MRDA 1Z9SA 4K7FB 5HDQL 1A6AB 2ZCHL 3GIZH 4G6FB 5F1IB 1NMBH 5DVKA 7FABL 5F89B 5AZ2H 5GHWH 3VFNA 2FZ3B 3EFDH 3QDHA 4ETQB 3ISWA 1A9EB 2OTUB 4L9LB 4C56D 2WWMC 5CJOL 3K0WA 5CCKL 4CNIA 1XF1A 1G7LB 5CIPH 5DO2C 1WISA 3FAWA 5IESL 4PJHA 5HHOA 5J13C 3TH3T 3RX5A 3EYUH 3AREA 1NLBH 3VFUB 1QBBA 3W5MA 5ISZD 3D85A 4FZEH 1I1YB 3VFOB 1J05B 5IWLA 1KBGH 1Y0LA 3DUUB 4HIEB 4N1EA 3ZYOA 4ZPVB 1HILA 3QFDA 1NGXB 4O58L 4PRIA 2LTQB 1NGZB 2X10A 4GUPB 4X98A 2Z31B 2UUDK 4NFBA 1UWGL 5J57B 3SE8L 3CLEL 3TBVA 4EVNA 1OAYL 3IKCA 1UM6H 3ULUF 2N4IA 4AEEA 4PLKD 4OF0A 4O9HL 4Y19B 1LK3H 4ODVL 2O5YL 3QCVL 2PTVA 5C0CD 3CSBA 1SVZA 5C92A 4DKEL 4P59L 4L3EE 1A7NL 4GUPA 4N0YL 4JO2L 1IJ9A 5FFLA 3O4OB 4LP5A 5ICZB 2OR9L 5B3NA 3HE7B 2AK4B 1UH3A 3GMMB 1FLTX 3PQYA 3GSNL 4LSSL 3F6LA 3WEXB 4NT6B 2EDDA 1T1ZB 3ZKSD 1S78D 1KTDA 1CD0A 4YK4B 1J86A 1FZJB 3SKJL 2BSSB 3SGJC 2DQGL 4U05A 2CUMA 4IOFC 2VLJD 5I1HL 2O61B 3KPNA 2ZG1A 4DVRL 5T3ZD 2GTZA 2FLRT 3KYOA 4HJGB 1QEWA 1T3FB 4XVTL 1NEZA 2Z8WC 4OZIB 1RVFH 2HN7B 2X9WA 4ENED 1K5NA 5C3LD 2XY2A 1VADA 5EFIB 5IEHA 1XF5A 3VA2C 3BKML 1F3JB 1ZEAH 4HX1B 2VO5A 3B5GA 2VDQH 2XRAL 3GSXA 1UM5H 4DCQA 4JRYA 1WVZA 4MNHB 1U8JB 2OR8A 1JPST 2V5MA 3T0EA 1GJIA 4IJ3B 4MA1C 5CAYB 1NMAL 4WFFD 3NA9L 1NBZB 3FB5B 5I73B 1QKZL 1BQSA 5C0JB 1FIGH 1XR9B 2WP3O 4ZD3L 5F7WC 3I6KB 4S10A 3N9GL 5ESVA 4MGXA 3NZ8A 5H94B 2HJFA 2GITB 2NXYD 3BAEL 3OKDA 4QRRB 5FYKU 1NKOA 5GGRY 3RY6C 3DVIA 4IBLT 3QEGL 1IKNA 1L7TH 4S1RL 4Y5VB 2W07A 5E7FA 2HVKA 1KT2B 2ZOKA 1CL7H 5BMFL 4RQQB 5D5MB 1FGNH 4GLRI 5IM7B 2XQYG 4GRWF 1LEKA 4IRSB 2PTTA 1TTGA 2BVUA 3ARQA 3ARPA 3RWHA 2YEZA 1NCAL 2CKBA 4N1HB 1RHHA 1S7WB 1DUYA 4G6KH 1CLOL 5MERB 4W70A 2WBJA 4RRPA 1NGPH 1DZBA 3C6SB 3RJQB 3E3QC 5I8OL 3BPNC 2B1HL 4NO5A 3S7GA 4NBXB 2EE2A 3VRLF 2FBOJ 1DBKH 3KDMA 1YEEH 3MLWL 3MV01 5DD1L 4NZDA 2NY2C 3DX8A 4OLUL 3L9RB 4EEEA 5ALBH 5BV7L 4U4BA 4HQQH 3VFVA 3LEXA 3BH9A 5C0CB 1JFQH 2VZTA 3BP5B 3C8DA 4Y19D 3H7LA 2LE9A 3LH2H 4HBCL 2V2XB 1A14L 4PV8B 4UQ3B 4ODHL 4F7EA 1S9YA 2O5XH 5CKGA 5M95B 4ODTH 1YEGH 2EICA 4OJFH 2QR0B 3HZMA 2W0FB 4OSUL 5HDLA 4H88H 3QXAB 4MX7B 2BMKA 4H1LA 4PBVC 4KGJA 2ICWI 3BZ4A 2V2XA 4OZIE 3M8OH 5C07E 3D39A 4OZHF 5C70A 3ARSA 4FTVA 4QLRA 3TV3H 1LMKA 3IDJB 3IYLW 1HH9A 2GSGB 2ZSWB 1B6DA 4ZSOA 1I3GH 3R1GH 5ITFA 1MHHB 5I1AA 2WBKA 1B2WL 1VFBB 1ND0B 5T1LD 1P84J 3S34L 2EDOA 1G9ML 3S6CA 1OWRM 5JOPE 4MA8H 4N8CL 4PRHA 1NFKA 4M6OH 5L88L 1H5BA 2Q87A 3RIFK 2Y7QA 4LMQE 5BO1L 2K1MA 4JO3H 1IGTA 1PLGL 1KJMA 5IWLC 1BQUA 1ZA3A 4LBEB 1SJEB 2YWZA 1AE6L 3HR5A 4NRYA 2NY0D 4C55A 3DX6B 5I73C 4U2ZA 2WUCL 5DEFA 2F74A 4PJ5A 5J7CC 2BFVH 4XAKE 1Z5LA 1ZE3C 4LLYA 1LHZA 2C1OB 3T3PE 2QHRH 4LCIH 4P5KA 1B0RB 4O5LL 3VGBA 4JM4L 4ODBD 4XCCH 1MAJA 1Q9LA 4JRXA 5TGBA 3T09A 1MJ7H 1BGXL 4U33A 5E2VH 1ULVA 1MFEH 3F5WA 1FORH 1MJ8L 1UGNA 1H3GA 4UUJA 1R3KA 2QQLH 3U0PA 5A2KH 4JFPA 3U0TA 2H9GA 3V9FA 1Y18A 3RVVC 1FPTL 1QO3B 1PZUB 3I50H 2DBLH 3MV8A 2D7OA 2UZXB 3HE7C 2R4RH 4YHMH 4HXBH 1U0QA 4PJ7B 5KSUA 4XRCA 4WNQA 3DYOA 3ZE0E 1NUNB 5EZIL 4ZXBA 2JB5H 1WFNA 4GKNA 5A2LH 4TYUA 4KJQD 3RWGA 1U8QB 4P2RB 4OF6A 4PJ7E 3TZVD 1HILB 3QEQE 4CN1A 4YWGH 5L7XL 2Z92B 3NABL 1JF6A 5GSVB 5IBLD 2E7CA 5E5UB 3KPNB 1NCTA 3VDAA 2Q20A 3VFRB 2LTQC 5EU6B 4ZAKD 3K4ZA 4MHHG 3T3PF 3DROB 2X42A 3GSVA 1I1CA 1BFVL 1IVLA 2X4RA 4F7CB 2GFBA 2VXSL 3P0YH 5J9PB 1U8LA 4IS6B 4ZQKA 2AVGA 3G6JB 4JM2F 1M4KA 3D39D 5D1XC 1S9WA 2VH5L 3OKKA 2F53E 1BPVA 4XNUL 5JQ6H 4PRAB 1M7XA 3CC5A 4WENB 5C07A 5CMAA 3VG9C 4J3TA 4E9LA 3ULUD 3CZJA 1A7OH 1GGCH 4F9PA 1OSPL 4FQ1H 5GRJL 3KNBB 4RGNB 1RPQA 4JFDD 3SGEI 1BBDL 3V4VH 1QSFB 3UC0L 1JYVA 3WL9B 4JEGB 4OBRA 2YD9A 4BH8A 3PP4L 3QIUB 3GSQB 4IOSD 3RWDA 3IU3B 3DMMA 4PJ7F 4ZYKA 3QQ3A 5EOTA 1U95A 4WTXA 1I3VA 1XH3B 4X80L 2OP4L 3MYJA 2X7LA 2PCPB 3FO0L 4HKJB 2WNGA 4P46B 2UZIH 4JPKH 3A67L 5T33L 3TO4D 2VDKH 1CD1B 3PWJA 3DRTA 5GS2D 1GGIH 1F58H 4NCC2 3P30L 3IDGA 1TITA 5C0RL 3PDGA 4O4YH 2XICA 4PJHE 5HHOE 1S9KC 4IMLB 2GK0B 5E0QA 1EJOL 2AJ3A 3MRFA 3QDME 4IHOB 4MDJA 3NFPA 3IU4L 1A7QL 5C6TL 1GHFH 1MCPL 2X5PA 3CDGB 1T83C 3U7WH 3PABA 4X6CB 1LEKB 1RK0A 2ARWA 3FRPA 3OGOE 4CVZA 1QFWL 1FZMA 4OZIF 5LBSH 3ET9F 3HZMB 2CKBB 1OB1A 5ERWA 5IT2L 1YA5A 4NKIH 3LIZL 5DHYB 3X17A 3ARDA 3NCCB 3NCBB 4HF5H 4JKPH 2CDEB 5TFSL 3EO0B 4QTHA 1HQ4A 2OJZH 2GAZB 1U8HA 1H15A 4MNGB 4FXKB 1RUAH 5CSGA 3UDWC 1T89A 1H5BC 2Q3AA 4PJ9A 3RVWC 4PPTA 3IDMA 3DX8B 1BJMA 4M1GH 2FLBT 2YK1H 1AKJA 4KK6C 2A0LD 3SGKA 1NBZA 4R3SB 4WI6A 35C8H 2LABA 4NP4L 4LAQH 1L0YA 4OCLC 4WW1B 4MYWB 1ZLUK 1F6AA 4P5TB 5CJXC 4HH9A 5JR1H 1MLCB 3GB7A 2WBJC 5EU4B 4GAFB 5J3HD 3KPOB 5F9JB 3WFBL 2PO6C 2C3VB 2EH8H 4FG6D 2F15A 2P8PA 4S1QL 1SYSA 1KB5L 5E2UH 5FM5M 4KI5C 4H20H 1YEFH 2FR4B 5I1DA 3MRGB 3IFPB 1CU4L 3ZYZA 5I1JH 4FQHA 4B53A 32C2A 4O00A 5I1LA 3W39B 3FTGB 1F4HA 6FABL 1LO4L 2NNAA 3PWNB 3CMOH 3QB7C 5EBLB 1YY8B 3HZKB 3VWKB 3BP7B 3TPUA 4D9QD 5DJYA 4Y4HA 4M9PA 1WWCA 1JRHH 1T7XA 2X4UA 2NW3B 4IRJD 5GGQH 4X9GA 1RV6X 5IVXE 3ZE0F 1BM3L 2IH3B 4JN1L 3V4UL 4NM8H 3BIKB 5EWIH 3RRQA 2HT2C 3C2AL 4M8QA 1MRFH 3N85H 3QHFH 3R0NA 5DYOB 2XNAA 1R5IA 3JUZA 4TUOB 1A4KA 1AQKH 3I6GB 2AK4E 3LRSB 4K7PH 4NQSB 3L3KB 2I9LA 4OCYH 2VDLH 2Y06H 3UAJD 4M7LL 4U1NB 2ZCKL 1HQRA 3MFFA 4DK6A 2P7TA 4J23A 2Q8BL 4LLMB 2E7HA 5KSAA 3DHJA 2HVJA 3TT3H 4UUJB 1NBQA 1ACZA 4M1DL 2B0SH 3WEXA 4F7TB 2FB4H 4WRLA 4FFZL 2GJZA 4U6YA 1CXLA 3AXLB 2DKMA 2EDHA 4OF3A 3QUZA 4U1KA 5E94A 2P7TB 4ZFGH 4GXUN 3OKNB 2W9EH 3GJFK 5MEQA 3DARA 3H9YA 3P2TA 2AJVL 2D7PA 2BOBA 3MLXL 1TZHB 3EJZD 3HFML 5DZLA 4R90L 4ELMA 5CZKA 1EUTA 5ADPH 4UTAH 3L95B 1N3NA 5HI4C 4HG4J 2I5YH 2GKIA 4XMLH 5I1GL 4Z5RB 4WFHE 1DFBH 1OGAB 2MCPL 1CICC 3SO3B 4QYOA 3ULUE 4IIQB 4ZTOH 3F62A 3NACL 4BH8B 2MHAB 2DLIA 2ZUYA 3ZKQD 3F7VA 4JQVC 1PEWA 1E4XL 3O6FD 3GMNA 5C2UB 2AXGA 4OZHE 3GSOB 2FIKA 1S9VB 2P48B 4M48H 3O3UN 6CGTA 1J8HD 4PRDA 4PRNA 2YUVA 4BZYA 1ZWIB 5C0DB 3MX0A 1EEZB 4FFWC 4H5SA 3KXFD 4KAQL 3V4PL 1KB5A 4TUJA 3ULSB 3QH3A 5ACMA 4I8DA 3HPLB 1UADC 5BS0E 5FCUL 3QXDB 3JV6B 4HEPG 5FF6B 5D8JL 5H2BA 1RMFL 5GGUB 3BEVA 5ILTL 4U6VL 3NGBC 3BYYA 1UYWH 5CGYD 5C0FA 5DJ0A 3HC4H 2D9CA 5F9WB 4S0SD 4UIMB 4JGMA 3LD8C 3V0WH 2WAHA 1I85C 3QUXA 5JW4Q 2SEBB 4QCIB 5MP6L 1UKTA 1VHPA 1S5IH 1FZKB 4JJHA 1WWAX 2IF7A 1U8MB 1I7UB 5FYKD 4R4BB 1MIEH 1I4FA 2G75B 2NY2B 1VERA 4NC1E 5FUCE 2EZ0C 3CSPA 1H3WM 4ZS6C 5L2JB 5FKPA 3S5LG 35C8L 2QR0A 3JWOH 2JTDA 4QHUB 4GMTL 1I8KB 3AU1B 5CSZB 4LHUG 3MA7B 2DDQL 3EDFA 1NPUA 3IS1X 4DZ8A 3CH1B 1TZIA 4MDJB 4EIGB 2W0PA 2M26A 1L6XA 3T2QA 4WEUD 2DQCH 5E2WL 2NTSP 2COQA 2ED7A 3IDXH 2DF3A 4JAMB 5IB1B 2YPLB 3UX9B 4NO2A 5HHXL 2H32A 5D1ZB 4XVSL 1I8IA 3SBWA 3VRIB 3QYCA 1DQQB 5C2BH 1TZGH 2H45A 4JKWA 3EO0A 4IMKC 1QFWH 4QTHB 4X6DF 5TDNA 1KTLB 4EXKA 1MEXL 1PYWA 1H15B 3MRCA 5T1KD 1XGTB 3KPPA 5KZCD 2F54D 4PJ9B 3L9RA 1RZFH 2ESVD 1MIEL 2P5EB 4K3DH 4ZYKB 4M1CC 1EJOH 3MLUL 4APQC 2OYPA 3TF7C 4OT1L 1XMWA 3ALPA 4QHNB 3CXDH 3VGDA 5A16B 3P30H 4D9RD 1C12A 1UJ3B 4LCCA 4UILL 3QA3B 4E5XB 2XTJB 5C0ND 3K8LA 5HHVL 5GGVH 5K9OB 4JLRA 3T08A 5JOFA 3FL7A 4UNVA 1CD8A 4G8GA 4G9DB 1EUUA 4XTRC 4L8BB 2QLVB 2A0LC 3FMGL 4K8RH 3ARGC 5IGXH 4J4PC 4JFZL 3H9SD 1CWVA 3AAZA 2XV6B 3WDHA 4KK8D 2DQIH 2D0GA 3DI2B 1UM4L 4HJJH 1IGIL 2QBWA 1FNGA 3PWLB 4M6ML 4YPJA 1MI5D 5J3HC 5GS0C 1KEMH 2D7MA 1BHGA 4JQXA 2AJYH 2VQ1A 4Z9KB 5FXCH 4YBQD 4NQDB 1CFSB 2BVPB 2UY6A 1KOAA 4GW1A 2AS5M 4XNUH 4L5FL 4OAWB 5D72H 5EC1A 4EN3A 4F8TA 3ULVE 5FK9A 1XIWA 1ZTXH 3I9GH 3LKOB 4G80A 5FOBA 4Y5YB 1OARH 2RGSA 3WKNA 5C0BE 1BVKB 4BFIB 2Z92A 4NQUA 1E27A 1VACA 1L9NA 2F74B 2VXSH 4Y5XB 2VWEC 5HSFA 2BSED 1I1AC 1UCBH 3G5YA 2Z93B 2VDPH 1AO7E 4DTGL 4HC1L 3QR2A 3V52H 3W5NA 4P0DA 3BRDA 1QRKA 3H6JA 4Y4FB 3MLXH 3L95A 4JRXD 4YHZH 4Z77A 2LVCA 3C2SA 3B9VA 3X11A 5HYIA 2VDOL 3FQWA 4ENEC 4OIIH 1XF4A 4Q9QL 3HI6L 2P8PB 5TQ0H 1LO2H 5E9DA 2QQNL 4BH7B 5LWYH 1M71A 3PUCA 5F7DB 4X8JB 4ORGB 1A6ZB 2VR4A 43CAB 5BRZB 3PV6A 3ZKMC 5FOJA 4PRIE 3WXVH 5IMLB 3GBLA 5IHBA 4X98B 3DTXB 5JMRA 3MBEB 4M7LH 1TFHA 3B5HA 4GSDL 1ZT4B 5DQJA 1KPRA 5BZWA 2ARJQ 1BIIA 1NDGB 1MJUL 3NBNA 2X2YA 2EECA 4GAGL 2XN9B 3Q3GA 1MVFA 4M5ZH 4FMFA 1FNEB 4XWOC 3ILPB 1UEYA 3HCVB 3DXAE 4PJHB 5HHOB 5B4MD 4Q9RL 1N5AA 1ORQB 3C08H 4LCUA 3C2AH 4EI5B 1C7SA 3QAZB 4BFGA 5JOPD 1RJYB 1SEBA 5DMGD 1A6UH 5HI3C 1JRHL 2HJKB 5DFWH 2XI9A 4D2NA 3HE6C 2A6DA 2R9HC 3RQ3A 1UA6H 2GJ6B 4QF1B 4XHJC 4U1JB 4HHAB 4JCMA 1AE6H 1HIML 2HKFL 2P8LA 3B5TA 3QG7H 1P2CB 2F53A 5GS1B 3H8NA 3RBGA 4ZUTB 4LHUD 1G0XA 1OPGL 4GW5B 2CKBH 4H5SB 4AMKL 1V3JA 2VDNL 3TZVC 4WY7H 3C5SB 2Q8AH 3X3GH 2RQ8A 3X12A 5ACZB 5CSZA 4X7FC 2DQCL 5E2WH 5IVXF 3EHBD 3L7FA 3SDAB 4QT5A 3EYQC 2FDBP 3G6JF 4NPYA 2UWEA 3RVXD 1JWMB 3DO3A 2WQRA 5JR1L 2XA3A 1OVZA 3ABZA 4HUXB 2BZDA 2GAZA 3O6KL 4NNPH 3GHEH 2P49B 4P23A 3P73B 4LAQL 4ALAH 3U9UA 5DHVB 3VD9A 5M7QA 2JB6B 2P5WB 5DJ6A 2JCCB 4F37K 1FZKA 1OGAA 1NFDB 1JP5A 3MCKA 1G7HB 3GHEL 3O6KH 4HS6B 4NNPL 3G5XB 2FATH 3WFCH 1FNFA 1R3JB 2P5ED 3K4DA 2WZPD 2BSRA 4HWBL 4OQ1A 1L4IA 1PBYA 3HA0A 5J1AB 1UWEL 4OQTA 3WFDH 2IAMD 5D1XD 1XF5B 4QHUA 3O4LB 1OTSC 1VB9A 5MP6H 4YO0B 3T0EC 3RVVD 1ZMYA 1JNNH 1T0MA 2C7UB 1P9MA 2HH0L 3VXNA 5I1EH 2WINB 3N1MC 4L4JA 1A3RH 1C5DA 1FV1A 1UYWL 5C0CE 5E9DD 1BD2D 4DOHE 2R1XA 2FX9H 1GHFL 4Z7UE 4KTEH 4XZUB 4HDIB 1MRDH 5E8NB 4G7VH 4JFDB 4KJQC 3DV6A 4OZFB 4QKXB 4G6KL 5C0RH 4U31A 3LN9A 1F3DJ 4AQ1B 1QSZA 5FV1L 1JGVH 1F58L 3T2PA 1I7RA 3H9ZA 4MAYA 3S8WA 5SWSB 2R15A 5I71B 5F7NC 5D7LD 2XQBH 1HHKB 1VFOA 2VTFA 5DA0B 3C08L 1QQDB 3MACH 5IK3A 3EYVB 3FO0H 5I8KL 2EC9T 1GGTA 4MZ2A 3RWJB 1HHJA 1W72A 1MHCB