4WHDA

Human ceacam1 n-domain homodimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
AQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 1
publication title Human CEACAM1 N-domain homodimer
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 28
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4whdA00
3IAGC 3NIGF 1NAMH 3DV6A 5F71A 1A7OL 1NDMA 5C1MB 5F3BA 1S8DA 5HPMB 5BMFH 3MXVH 5T1LB 1UM4L 3N1QC 3N0PB 2GJ6A 1CS6A 5FXCH 1HK6A 2AXHA 3HNVL 4HF5H 4ONGL 4NM4L 3F58H 4M6MH 3MRIB 2K9UA 3TC9A 4RAUA 4OTXL 1ZTXL 4DN4L 4LCWB 3MLSH 1MFAL 1MJUL 2IADA 1AY1L 5F1NB 1IM9A 1P5UA 2CD0A 1VFUA 3IDMA 4FFWD 4Z7NF 1JGUH 1I7UB 3PHOB 1XF4B 5JOPE 4GRLC 2Y07H 4NN6C 3L3JA 4D9RE 4WO4A 3B5TA 4LPTA 1D6VL 2J8OA 5DHVA 3P0GB 1JF5A 3EHBD 4MCYB 4F9PC 5L2KB 2R2BB 2VLJA 2HN7A 4K8RC 4CU8A 2ESVD 4M4RA 3TH2T 5F72S 3SDXF 5F89B 3HE6B 1F3JB 4XWOC 2C7UB 5DI8B 4PPTA 4PBXA 4P2RE 3EGSA 2A73B 3KGRA 3L3KB 4FTVB 5IBUB 2DKUA 3BPNC 1R3IL 3ARDC 5ICYA 4M7KL 1J87A 2A83A 1CXLA 2BCKB 2QR0B 3LS4H 2FZ3B 3PWLA 2R69L 4L5FH 5MERB 1A0QH 2HH0H 2DB8A 1JNNH 2R1XA 2YXFA 3VXNB 4HUWA 3KPOA 3HHRB 1LEGB 1SBBA 1GHFL 4XP1L 1G6RL 3TYFB 3FQUB 2HJKB 1EAPB 4J1UB 2ZUQC 1F3DJ 4NRYB 3KPMA 4G7YH 4F8QA 3TIEA 4UIMB 4XNQA 5GISH 3SDCC 5E4IA 2VLKD 1XGPA 2GQHA 4PB0L 5IWLA 3IGAB 3IKCA 4R0LA 3FFDB 5HJ3B 5DJCA 4PJ9B 3O81A 1BFVH 3QFJB 4I18A 4WU5A 3CJJA 2J88H 3DGGB 4Y2DD 3MUY1 4PJ7E 4ZTOH 4KVCH 1A6WL 3THMH 3RI5K 3O2DL 3BPOC 2APBA 4H0GA 4C56D 4I9WD 2LTQC 4KJYA 4HJ0D 4LSUH 4B7LA 1NLBL 1I1AC 2PTTA 2GJJA 1YNLH 1CT8B 4OCWH 1N0LA 4CVZA 4X6DF 1IGCH 4RWYL 3QRGL 4H20H 4D0CB 5DWUH 1WIUA 2BDNH 1UJ3A 2VLRA 4GS7B 3LKSA 1DBAH 1NL0H 3LMJL 1SJHA 1EZVX 2W9DH 2X5PA 3JV5A 5FUOL 1J88A 4U1LA 1X5YA 3NABL 1VACB 1ODAA 3GSUA 5IW1A 4YIQA 3BW9B 3UJTL 5JW3H 3MOBL 3OKDA 4XWGH 1B0RB 1F4WH 3TWCH 4DVBB 2IMNA 1A1NA 5J4MA 1MJ7L 4BSWB 4IRSB 3EJZD 4RCAA 4X7TB 5KVDL 2VDKH 4LHUD 2ICES 12E8L 1TCRA 1QO3A 3T2OA 4W4OA 5DUBB 5B39A 3FO1A 3QYCA 5L88H 1V7NL 1RIUL 5EO1A 3CC5A 1N7MH 3ZKXB 3QDGD 3NTCL 3VJ6A 1ORQB 3NCYS 1U8JB 4JG0H 4P59H 3MSPA 3DUSB 3UTPD 4JGUA 4BSJA 1HKLH 4YHZL 3OJMB 2XTJB 4L3EB 4PB9H 3ZE1F 1A6ZB 2FHCA 3RWIA 2BZDA 3HPJA 4XPGH 3T4AB 5FYJL 1JGEA 3ZE0F 3GUTA 3FQRA 3O6LH 3X14B 3REWA 2V9TA 2R15A 4WI3A 2YPKB 3MV7A 4WI8A 4MA1C 2E9BA 2XPGA 3RGVD 4GW4A 1A6AA 1J1XL 1JRHH 2YUWA 4Q58C 4KHTH 1YN6B 1B9ZA 3PJSA 1TITA 2EE9A 4X4XA 4Z7WF 4XP4H 3RWHB 4D0DA 2JJVA 2W1NA 4HX1A 2YPLD 1KEML 4PFEA 3WNLA 3SQBA 4O51A 3O8XC 1A7RH 2GCYB 2VQ1B 2A2QT 3RTQB 4S0TD 4AQ1B 2ZJSL 3QDAA 3ARFB 4XT1C 5FYKU 1HNFA 5ADPL 2ADJA 1N2RA 4EI5C 4I3SL 3UXFA 4LFHG 1CFVL 1A14H 5MENB 4XCFL 3O6MH 3WMSA 5L8KB 1Y18B 3KPTA 4P5MA 1WZLA 4JDZB 2PYEE 2LV4A 1LQSR 1GOFA 5C0AD 4AEIL 1RUMH 5GGRA 2BJMH 5D96B 2WWMC 5EUKB 5HGHA 4OV5B 2RAMA 1HZHH 3UPRA 1KIQA 4F8TA 1FNEA 3GIVA 3ARBB 1E4JA 5DJAA 4WNQA 4TUKH 5C6TL 1UADC 4AT6A 5IBTH 2RBLA 5DK2A 1TQBB 1AO7D 1X6LA 4JRWA 5H37G 1IBGH 4OF3A 4K7PH 3GMQA 1K4DB 3VH8A 4PGCB 1BZ7B 3B3IA 2QADD 2R2EA 5TE7H 3SGEI 1JNJA 4XNYH 2BMKB 2DQTL 4WY7H 2DIJA 4LSPH 4N1HB 5J12B 1C16B 3QA3B 2AVGA 3QCTL 4D3CH 3RA7L 5E1HB 1DBJH 4JRXA 3NACL 1ZT7B 4JM2C 4TN9A 5DFTA 3DUUA 3RX7A 3U7WH 1Y6NR 3P4MA 3RPKA 5HYJB 1D9KA 4JHWH 4E41D 4N0UB 4KRNA 2FEDC 43C9B 5J7CC 5CIPH 3GMNA 3F5WB 1AFVH 3HG1A 1CFNB 2GUOA 1IM3A 4MXQD 4WW2B 2FYYB 1ADQL 1UACL 3B9KA 3HAEA 2DQUH 3OR6B 1N5YL 1B6UA 4RGOH 4YWGH 4NUGH 1VESA 4YZFF 4BH7B 1F42A 2G60H 3CDFA 2VMFA 1JZ7A 4DN3H 5LQBH 4FXKA 1IZKA 1YMMA 2JKXA 5KSAA 3OL2A 4UB0L 3BD3A 1YPZB 1WC7A 5ELIA 1QPPA 1PG7X 4ISVB 3FN0H 4RRPG 2B0SH 3ZDZE 4NBXB 4UIKL 5HSFA 3K7UA 3T3PF 5GGTA 5HPMA 5EIQA 4HD9A 2C3GA 2FCBA 4P0DA 5T1LA 1M6OB 3QNZA 1AE6L 5CEXB 3LS5H 3U7YH 1QSEB 1M7DB 3ZZ1A 4CU6A 3DVIA 1L0XA 3MRIA 4GRLB 5C7XH 4HIEB 5ACLA 5I74C 1EO8H 4LCWA 4Q7DA 5B4MC 4OJFH 5F1NA 3DO7B 4TSBL 1K6QL 2BRRL 5CKGA 3PHOA 1I7UA 2UWEB 4NZRL 1XF4A 4ORGB 1G9MH 1ZLVH 2D9CA 2I60L 4QWWD 1IAKB 4BH8B 2Z8VC 4LIQL 2XA3A 2AK1H 4OLWH 3D85B 2EDWA 2YN5A 5L2KA 3BPNB 4HCRA 3ARDB 1BQSA 3KPRA 4AJ0A 3SKUD 4I13B 2DJ4A 1P4LB 3VXTB 2WNGA 1RUAL 5CD5D 3QG7H 5F89A 4PP1D 1F3JA 3TP4A 1WAAE 2C7UA 1MF2H 5DI8A 4KUZL 4OD1H 4RZCB 2NY5C 3DETC 4RA0C 1EGJL 4L4VB 4FTVA 3FKUS 3L3KA 2NLJB 2JE8A 2MOVA 2FWOB 3QPQC 1CCZA 4FZEL 2BCKA 4PJCB 3RY5A 3RUGB 2QR0A 2FZ3A 4LRNL 5ANMB 2DD8L 2ZUQB 5MERA 1Z3GL 4MS8D 4NO0D 1NBZB 1IC4L 2APWA 1A64A 3PXJA 4JJHA 3VXNA 3UTQB 3QIWD 1LEGA 5D4QA 5FUCE 1VGKA 2C4XA 5I9QB 1RZ7H 3SDCB 3TYFA 3FQUA 3CH8A 3MCLH 3QNXA 3UJJH 1EAPA 1QSZA 5LXGH 1B90A 5EDXA 4NRYA 3IFNL 3ARGD 4LCIH 1LHZA 3MGAA 4IMKA 3RU8H 2WLYA 1FVCB 1TCMA 1ZA3B 3TIDB 4MAUH 2VZUA 5L9DH 1RPQA 3IGAA 3BPOB 1Q9KA 2LTQB 4JPVH 5DJDB 3FFDA 2Y6SD 5HJ3A 4KJWD 4PJ9A 1I1AB 3FN9A 1W0YT 3DGGA 4DJMA 2VDQL 1CE1L 4KHXH 4LU5L 5M94B 1ULVA 3JVGC 2WLZA 5CP3A 4GLRH 3X13B 4M62L 4U33A 3TCLB 3RZCD 4PJHE 1QNZL 1JI1A 4HPYL 3RWDA 1HKFA 1PKQB 3QZWB 5HYSG 1CT8A 4JFDB 1NLDH 1QD0A 3MNZB 2R8SL 4PG2A 2IG2L 1DUYA 5CZKA 4D0CA 1BZQK 3GSNL 1BVZA 3QCVH 1OPGL 5I19L 3SBWA 2GIYA 4ZO6A 3ZKQD 1GXEA 2XN9B 4OLVL 3F12B 2A1WL 2OR7A 5DK3A 3EO1B 4WWKD 5CCKH 3IRZA 3UROR 5E00B 5CJOH 3WKNA 2ADIB 2WP3T 3IETB 3ECBB 3GM0A 5ESQB 1F3DH 5GS0L 3RVVD 5EC2A 4JFFD 4LAQH 4QHLB 4XVUD 1LILA 1FNSL 4TSCL 1B0RA 4DVBA 4BSWA 1W8NA 2VYRE 2BNQB 3WSQH 4X7TA 2NY1C 4UV7H 1ZSDB 4B53A 2GHWB 3O6FD 2V9RA 1E4KC 2XQBL 3D48R 4YHLH 3S4SB 3WIHH 4F3FB 1B4JH 4ZAKC 4W6WB 1MLCB 4YHIA 5JXEC 5HPOA 4ERSL 4ETYA 3BFOA 5DJ0B 1U8JA 3STZB 4PS4L 3DUSA 1L7IL 4MA1B 5C0IA 1YJDC 1C7TA 4JM4H 1A6ZA 3EZJB 3T4AA 2D03H 5GS0D 4HH9B 3JWDL 4KY1L 1MSPA 1ES0B 4OD3H 1FIGL 4LVNC 3CXHK 5IVNA 3BQUA 1E4WL 5DVMA 2EDYA 4JLRB 2YPKA 5TDOB 3V95A 3ZKNC 4N68A 1ZGLP 3MLXL 3O8XB 1YN6A 3N1FC 3MRQB 5I8KH 4XTRD 3VXUE 5JIIA 3JBG7 2YEZB 5FA4B 5ESAB 4AG4L 4U1SB 3T1FB 3QPXH 3RGHA 2EIZB 4NT6B 3NAAL 4FP8H 2GCYA 2VQ1A 3G6DL 3GBML 4L4TE 3RTQA 5K9KB 4YFLI 2WP3O 3NGBC 4A6YA 1NCWH 3ARFA 4F7EB 3H3PL 3L5WB 4KAQL 2KQMA 5FHBH 3RL2B 2ICWB 1NUDA 3UC0H 5MENA 1KTDB 1MEXH 1EIBA 1Y18A 3L9RB 4ZSOE 4ZUTB 5B3JF 4JDZA 1EO7A 3SDAA 1MI5D 4WFGD 4G9FD 5DC9B 1R24B 2APVA 5MP6L 4OV5A 1JHTB 1F8TH 3H8NA 3ARBA 2ZKHH 4LASH 4G9DB 5SWZD 2RFXB 4NQDD 4LKCB 1U95B 1X5JA 3TFKD 4R9HA 2B7DT 3P30L 1JNLL 5LJYH 4U1HB 4Y16C 1P9MC 4Z0XB 2FEEI 1K4DA 1E4XI 1BZ7A 1KCRH 3QDME 4JM2B 5KZCD 5IGXL 4IS6B 2ATPB 3CGTA 1C16A 4XXDB 1J1PH 3QA3A 5HY9B 1MVFA 3TNNB 4CDGC 2EDFA 5E2TH 1NCBL 4JKMA 1OHQA 1QBAA 2HT2C 1MUJB 1MIEH 1VADB 4MNGB 3L7FB 5I1CH 5HYJA 4PRPB 4N0UA 4K7PX 43C9A 4GAGL 4NQCD 1FL5B 3EO9L 5AAMA 4CRPA 2JCCE 1OCWL 4Y5YC 4DW2L 1SBSH 1CFNA 1ZKAA 2NY6B 4WW2A 1UWXH 5D2NC 3HR6A 2FYYA 4OZGF 2DAVA 3OR6A 4R90H 1K8IB 3FB7B 3LQAC 4KVNH 1IT9L 4BH7A 5LCVH 4G6AC 1RMFH 2DMCA 3NH7H 4X6CB 1T7YA 3BSZH 3MLYL 5AYUL 3V7AE 3IFLH 3FO0L 1TJGH 1EVUA 4JO4H 1JK8B 3RI5F 4AQOA 1YPZA 1T03L 1RHFA 1S7VA 3HMXA 4EUPG 4ISVA 5L7XH 1H3PH 3D6GA 4WDIA 3VG0L 5I74B 3TJHD 5KVFH 5CSZA 5CEXA 5CKAA 3BI9X 4HPOL 4JHBA 2IPTH 3UTTD 5K9JH 1QSEA 4L3CA 1M7DA 4OGYL 2Z9TA 3JWOL 4GRLA 4DTGL 4HIEA 3VFRB 2EIDA 4KQ3H 1OAYH 3H42H 4Z7VE 2WIIB 2V5RA 2Z93B 2WBJB 2WMPA 3N9GH 4RA3A 2UWEA 1NSNH 4ORGA 2FBJH 4UTBL 5IB2A 1FQ9C 5KJRH 4WU7B 1N5AB 3L7EB 1IAKA 4BH8A 4WW2F 3MV9A 2J7LA 4MJIB 2YZ8A 3CX5K 3D85A 1FPTL 1ORSA 4O00A 3HE7D 5D7SH 4Z95L 5DVNA 4JRYD 3L6FB 1IE5A 2P4AB 1P4LA 1X4XA 2GSIB 4M1GH 5DJ8B 25C8L 4X6FB 2XQYK 3D5OF 3F65A 2FX8L 3WIIL 1FCGA 4RZCA 2YBRB 4LF3B 4L4VA 2BFVL 2NLJA 2X4RB 4RX4D 2MKWA 4PV9B 4PJCA 3RUGA 3KR3H 4LEOB 2HFEB 5ANMA 1MNUH 5J9PB 5I18L 2VDMH 2CR3A 1NBZA 4X6EA 1YMHA 4QYOB 3C6LD 1A3LH 1XGYL 4JO2L 2Q8BL 3O9WB 5HHPB 4E0RB 3UTQA 1NAMA 3I50H 3SDCA 1HCVA 2Q87A 1KPVB 1MCJA 4AZ8A 3RWFB 2PYEB 3B5HA 4GQ9L 2IH1B 1JNHB 4NZTH 1PQZB 1RV6X 4PRHD 1P2CB 1FVCA 2AK4D 2X4NB 4LPYA 5CEYB 5I1HL 4XVJH 4P23D 2UWEF 1J0KA 5DJDA 2FLBT 3BUYB 3B2VL 3REVB 4XAKE 2F5BL 4WENB 3U82B 1I1AA 4TQEL 5JQ6H 1V3JA 2ZUWA 3MYJB 4IEFB 6FABL 2DRUA 4ZFGH 1F2XK 1NUNB 5SWSE 3TCLA 3IF1B 4GXVL 1XH3B 5LWYL 1PKQA 3D69B 3QZWA 1KXTB 4JFDA 5CJBA 1H3WM 3MNZA 3OTTA 3VXMD 1I85C 3MUZ1 4JEGB 3GSOB 4OLYH 2DF3A 3SDDC 3PP4L 3S34H 4PJCF 3RUGF 1IZJA 2XRAL 4KV5F 4NFCA 1A5FH 1BQUA 2XN9A 3GSVB 3F12A 4X6BB 1MAKA 3L95B 2NY1B 5E00A 2QQNH 2IBZY 1YYLL 1ZANL 3ECBA 3O4LE 3EDDA 5ESQA 1NGQL 3O11B 4QHLA 4RAVA 4ZOAA 3V0WH 4JQVC 4ZAKB 3UJIH 3U4EA 1J5OL 1HI6B 5B8CC 2BNQA 4Q9BA 5I8OH 1ZSDA 4ZOBA 3C87A 2UZXB 5F7EL 3S4SA 4DKAA 2J8HA 1WUNT 2YHGA 1MLCA 4I1NB 3MLRL 4LVNB 2EDDA 3CSBA 1WWWX 4BFEA 3STZA 4YXLL 1IGMH 3MFFB 5EOQH 4J3WA 2DTSA 5L8LB 2D7NA 1T5XB 4YE4L 3MRGA 4LGRB 1IM9D 4HH9A 5CGTA 4M7JH 1RZKH 3U2SB 4JLRA 1A4JA 2F54D 1U8KB 3K1KC 5TDOA 5DURB 3O8XA 5CJQH 1FRGL 3MRQA 2OZ4A 1UB5B 4U6HB 4DAGH 2YEZA 2AGJL 4FOMA 3LPGA 5FA4A 2VDLH 2VLJD 4K3DH 3NGBB 1QTYT 4I2XE 4U1SA 3CVHB 1DLFL 1M7XA 1IAOB 5DQ9B 4K3JL 1BEYL 1YN7B 3QUMH 3ZKMD 1EUUA 3C5JB 5CINH 1J18A 5DA0B 4QRPE 1DTUA 3HA0A 5K9KA 4JG1H 4PJ5D 3ZYOA 1P7HL 3FO2A 3NA9L 2N4IA 2KH2B 2KZ1B 3MRDB 4N1EA 4FQPA 4P2RA 5DMIH 2ICWA 4DK3A 1RU9L 1MCWM 1S78C 3WYRA 1KTDA 1IKFH 3KJ6H 2ITCB 3WDHA 3L9RA 1MCPH 4RMUA 4ZUTA 1CXKA 5EU6D 1H3XA 4DGVH 4OZIE 2EE2A 4Z8FL 1R24A 4Y16B 3PDOB 2R1YB 5FGRA 2P43B 5C2UB 3QUXC 4HJJL 1S5HB 4G9DA 4WW1A 1EUTA 4U1MA 2RFXA 4JDTH 4LKCA 4NUJB 1U95A 1NMBL 3KPSE 3G5ZB 2ZNXA 4QHMB 4S10A 4U1HA 4Z0XA 4YHOL 2VKXA 5TE4H 4OLZL 1BQLH 1OM3L 1GC1L 5DD6B 5C0EA 3LEXB 3RJQB 1A1MB 5BS0D 1CR9L 5ALBH 2ATPA 4TOYL 4U6VL 3BD5A 5HY9A 3TNNA 4PJ7A 5HHVL 1HH6B 3EYSL 3AXLA 1MUJA 2A6IA 1Q0YH 1VADA 4MNGA 3L7FA 3IU4L 1A9BB 3U4AA 2R0WH 4MAYC 1FL5A 3IFOB 4OF5A 3VFSA 4HQQH 4GBXC 3QEHB 4NKOB 5C9JA 3N50A 2VH5H 1K8IA 4J4PA 1T0MB 5T1DL 3FB7A 4K9EL 4RGND 4LEXL 4POZD 5FDYA 2NY0D 1RIHH 1CICC 2DTMH 4YBLC 3MNVA 1GGCH 4X6CA 5TF1L 1F4XH 4ZODA 4JR9L 2YZ1A 1RD6A 1KELL 5IUSA 1JK8A 1HCFX 1AHWC 4Q0XL 1UZ6E 2B39A 4K7FB 5EIIB 1U8LB 1KCVL 4ZDHB 5J1AA 2C3HA 1D5ZB 4NWTL 4YXHL 3QQ3B 1UZ8B 1YEKH 4OM0L 5IMOB 2NQCA 3D3VB 1GVIA 2P44B 4ZS6D 5HVWA 4HS3B 1NEZA 3H7BB 5EZIH 4PJ7F 4WHTA 4N90E 3VFRA 2ZOLB 4ESKA 5A3IC 4OF0A 1GGBL 2WIIA 4UV4L 3SGKA 2R56H 2IQ9L 4UT9L 2B4CC 3QQ9D 2Z93A 1EHLL 4JREC 2WBJA 5GJSL 2EDJA 5IFHL 2DJSA 1W0WB 4IRZH 4XC1L 1KLFA 4WU7A 3S37L 2BSTB 5CIPA 1OTUD 4MJIA 2XA8H 3QEQE 3WFDL 4V1DD 4X7CC 1R3LB 1GRWA 4IIQC 2Y72A 3L6FA 3J8F7 4JFZH 4ODXB 2GSIA 5CWSA 4U0RC 2FHFA 5DJ8A 4X6FA 4PJBB 1LK2A 5D7LE 1C1EH 5C92A 1EJOH 1U0QA 2YBRA 4LF3A 3P9LB 3X11B 4CN6A 1RZFL 5LVEA 2OJZL 4TPRL 4PV9A 4LEOA 4H25B 5FYLH 5J9PA 1X3DA 2DDQH 4LPWA 1KGCD 2DL9A 4QYOA 3O9WA 2H2PC 3PDDA 4M8QA 5F21B 5HHPA 1OAQH 4E0RA 3MOQA 1ZHNB 3L5IA 3OWEA 4WHDA 1KPVA 4ZSOB 3RWFA 1NCTA 2PYEA 5TQ2L 5EBWB 4Z76B 4PY7B 4F7CB 1M4KA 3HZKB 2FX7L 1MPAH 4OFDA 2ARJQ 5T1KB 4HHAA 3UBXI 1PQZA 1SY6H 5IJVB 3JVGA 4JZOB 2X4NA 3MLWH 2D4FA 1ZEAH 5CEYA 1QBLL 1T2QH 3TT3H 4GRMA 3BUYA 1CL7H 3A6BL 3REVA 3BVNA 2NPLX 4BJLA 5DR5L 3P11H 1KBGH 2GK0B 5DO2D 1EA9C 4CMMA 2IBGA 1T2JA 4JRXD 3MYJA 3HCVA 1KG0B 1UA6L 3QDMB 2VDOH 2WUCH 5DJ6B 3SDDB 3VWKC 5J13C 3F8UB 4NWUH 1D9KD 2ZUUA 5IG7B 1ZS8B 3IF1A 3ZYZA 5H37H 4XXCA 1KTRL 1XH3A 3STLB 4OT1H 3D69A 5E24E 4G42B 3B8YA 3PWJB 1GL4B 5GGTL 3GSOA 4OZFB 3B9KD 1AC0A 5FYKH 5JHDE 1MHCB 2CK2A 5K59E 2EDOA 2X05A 2DQGL 2I5YH 3D2UB 4PLKC 5F96L 4TNVF 1P4BH 5LBSL 1EPFA 3GSVA 3BN9C 4XB8A 3SJVB 2I9TB 4X6BA 4JQXA 4Z9KB 4JCLA 4L8DA 1IGIH 4C56E 4I9WE 1UKQA 1E4KA 3O11A 4I4WB 2EO9A 5CHNB 4P5TB 5D70L 1QSFB 1BFSA 4ZAKA 5JXEA 4N5EC 5E2WH 4EKXA 1HI6A 5HD8D 1KJ2L 4P9HL 3CPLB 5DJZB 3SGDH 3AS2A 1KXVC 1RAMA 4S1DD 4HCRL 1ACYH 4ENED 2ED7A 4HWZB 3NFNA 2OTUA 5DSCB 3V5DB 4PRNB 4MDJB 3UYPA 3GB7B 5D7IB 3M1BA 1Q1JL 3GGWB 1T5XA 5IF0A 1YC7A 4LCWD 1HOCB 1FZOA 1INQB 2XTLA 4IRJC 5E99L 3TJEL 5FIEA 3KYAA 3S36L 1UQSB 1F4YL 4GH7B 3U2SA 5KAQF 1U8KA 1OAKL 3N85H 1XGTB 2X10A 1IGFH 5E6ID 1UB5A 4U6HA 5L2KD 1RY7B 4DUVA 1WCQA 3KPRD 4OIIH 2XT1B 3K4DA 3UTPE 3VA6A 1IAOA 3SKJL 5E2VH 5DQ9A 1YEDB 1YN7A 2D0FA 5JW4Q 2ILLA 4TTDD 1SEQH 3IAPA 1C5DB 3C5JA 1OAXH 1OAUL 2FATH 4GXUM 1DQLL 4FFYL 3RWJA 5DFVD 4HXBL 5J89A 3NZHL 5IOPA 3BZ4B 1LDPL 1WAAA 3MRDA 4XNXL 5D1QA 4F37F 6CGTA 3NOIA 5DRZB 2DLFH 4KZDL 4ACPA 5DRWB 5DDHB 1P7QB 2XNAB 3QUXB 5GHWL 4GLRI 4EXKA 3A67H 2X1PA 2ITCA 4XCYA 2BVQB 1H15B 3ZDZF 1WTGT 1SMAA 5BW7C 4TULH 3QH3B 1C5BH 4Y16A 1P9MA 3PDOA 2VITB 2R1YA 1PEWA 4FFWC 5C0CB 3AY4C 1EEUA 1HNGA 1S5HA 5F7FA 4NUJA 2UVFA 4FQLL 3G5ZA 4QHMA 3RWGB 2PTVA 3V4VH 4ORZC 3EHBC 1YEEL 3WUWB 2DI9A 1MLBB 4DKEH 5EZOH 1HXMA 4WJ5B 5FKPB 5KSBB 3LH2L 5DD6A 1YEJL 3LEXA 1A1MA 4R2GB 1PD6A 1PW3A 4UBDD 3V52H 1NFIA 4MAYB 4XMPL 5BOZG 2VL5B 4GBXB 1HH6A 4V2BA 5JPMB 4KTEH 4QNPE 4FRWA 3B9AA 4NN7B 5K33A 1A9BA 5L6YH 2DLHA 2WAHA 5EU7E 5LAXA 1WEJL 5SWSB 4ODHH 3SDYH 1R5WB 2VLLB 4PJHA 5LGHL 1AO7E 1JGDB 3IFOA 3T08A 1WAAF 3HB3D 1CICB 1MIML 3IAQA 4YBLB 4DQOH 4GW5A 3QEHA 1H8NA 1JTOA 5MEPA 3SCMD 2MQ3A 3ME0A 4EIZC 5DZNA 3V6OE 1T0MA 3SE3A 1ONQB 4ELME 4YDKL 1AHWB 4LCYB 4NGHH 5SWQA 2FX9H 3BDXA 3PIQB 2OL3H 1CDJA 5T5NG 3TT1L 3MLUL 3W9EB 3GRWH 3VU2A 1F6AB 1DL7L 4NKIH 3OKMB 5BVPL 4K7FA 4Y2DC 4CMHC 5EIIA 1F13A 1U8LA 4YR6B 1DE4B 3WEXB 2AXFB 3CXDL 4I5BB 4ZDHA 2EEDA 1GAFH 2CLZB 1L0QA 4OF6A 1D5ZA 3DX8B 2YR3A 3QQ3A 3WFEL 4KPHH 2EDQA 1BAFL 1UZ8A 2PR4H 4D9LH 4HJ0C 5DHYA 4F2MB 4LSVL 4A6YL 1EFXD 3D3VA 3RAJL 4JREB 4DWHA 1N0XH 3HI6L 3BQUD 4K2UL 4MXVF 4HS3A 4JDVB 3IDNB 4OM1H 2ZOLA 3K8MA 4UT6L 4F57L 4HG4K 3P0YH 1WZ1H 5HTSA 2SEBB 4YC2C 5HGAA 1K3ZA 1VEPA 1VFAB 4IIQB 5F7HA 4PJHF 3RJDA 2YA0A 1W0WA 4OIAA 3NCJH 3ZYJA 4Q6IC 4U0RB 1GPOH 5IESH 3KPQB 4GRWH 3BGMB 4OLXL 4Y19B 1S9WB 2IAMB 4O58L 2BSTA 2VR9A 2BOCB 4Y89A 4YO0B 3VW3L 4QXTB 3VFWB 2RR3A 3VXUA 2Q3ZA 4ODTL 1CQYA 1R3LA 1MAJA 2YK1L 2W0FB 4I2XB 3U9PH 3EJZC 3WS3A 4PJBA 1J1OH 2D7MA 2BOBA 2C26A 1UH4A 4NP4H 4O2FB 3Q5TA 3ILPA 4YDLC 1T21B 4QRPB 3P9LA 3X11A 5DD1L 1NCNA 4JFXA 1I7ZA 3QAZC 3HLAB 1QKZH 1FYTD 3C2AL 4H25A 3SDAD 4PJ8C 1ZHNA 4J6RL 4CVXA 5HDBF 5KVMC 3FMGH 5AUMA 4ZSOA 1AGDB 1VGEH 4XP9L 4JY5L 3RGVC 5EBWA 4Z76A 4PJEB 4OZIB 4F7CA 1FAKT 3HZKA 5HHNB 5T1KA 1I1YB 5IJVA 4JZOA 1G6VK 3RVTD 1WK0A 3RWCB 3LD8C 1OAZL 5IMMB 3KPSB 1L0YA 4KQ4L 3WFCH 2B5IC 2FSEB 2GK0A 4Z7OE 2BY3A 3U6RB 1TETH 3QDMA 5DJ6A 4G3YL 3SDDA 1UKSA 4WHYG 3C5ZD 4EBQL 2AXGB 5ICXB 5IG7A 3C08H 4K94L 1ZS8A 3HMXL 5IMLB 5GZND 1K85A 2AAVA 5ISZD 1DBKL 1OGAE 2I25N 4G42A 4HH8A 3QQNA 1YEGH 3O41B 3HFMH 3WHE0 2AJUL 4P48A 2VR5A 4P4KD 4OZFA 2RCSL 4WWID 1MFBL 5BCAA 3LCYA 3EDEA 1MHCA 2ZNWA 4B7IA 1RVFH 2CIIB 1VA9A 2YWYA 5J06A 5C07D 5CUSL 3BGFC 4JQVA 3D2UA 2VNCA 4KDVA 2P1YA 3BXNB 2XOTA 3SJVA 2I9TA 2JCCA 3DYMA 2M8XA 4S1SH 1FAIH 2DQDH 4NHCH 2IBBA 1F5WA 4WIQA 4JPKL 5D6CA 3LEYH 4I4WA 1WQVT 5CHNA 1L9MA 4P5TA 1AP2B 4WVRA 3U4BH 2M1KA 1TZHB 3K2UL 5DC0A 1FSKB 2HWZH 3IS1X 3QWOB 5BV7H 3BKJH 3CPLA 5DJZA 3L3OB 2QADC 3V6OC 4IRJB 3R8BB 4HWZA 1IAIL 2FECL 1X5AA 4KKAD 4L9LC 5DSCA 3V5DA 3MMEB 3NCFB 4PRNA 5FYJU 4MDJA 2IAND 1S7UA 1P6FA 3EYFB 3GB7A 4TVPE 2XXCB 4MB3A 3GGWA 1QBBA 4S1RL 4Y1AD 4TTGA 1DQQB 3QBTB 1HOCA 1XIWD 3LN5A 1L7TL 3GNMH 1INQA 3Q48A 3WNMA 3ARED 4EUPH 4IMLA 5EIVA 1FNGB 2VR4A 2YD5A 1LDSA 2VDPL 4MXQC 1Q72L 3BKMH 2F8OA 5DMJB 2HMID 1XGTA 4TNWF 4JFOB 3MV9D 5IHUH 2YMXH 5CP7A 1NAML 1ZMYA 3VFGL 4Z7VA 5EOCL 3SKOA 2PW2B 1MFCH 4IHOB 3BKYH 5BMFL 1AKJA 2OX5A 4L8SA 1RZIA 2JCCF 1YEDA 2IPUG 1AGFB 1MCOL 4HC1A 2VZOA 1S7RB 1QHOA 4CW1A 1A6VH 3QEQB 1HH9B 3VFVB 5IEHB 1RJLB 4HKZB 2AS5M 4OZHE 2A9MH 2O5ZH 3BZ4A 4MMXC 1F11B 2YD9A 3CFIC 1D5IH 5D7LB 3VFTB 5I76B 4WGWB 1NMAH 4QO1A 2R0KH 5DRZA 4UOW0 3IDGA 4ZUUB 5DRWA 5DDHA 2XNAA 3QUXA 4L29B 4QTIL 3P2TA 3OB0H 4N8VG 2BVQA 2I07A 1H15A 4BZ2H 3BIAX 3CAFA 5I0ZA 4G43A 3LSOA 3MYZA 3QH3A 5FM4A 4U3XA 2VITA 3EKCA 5C0CA 1FE8H 2ZCLH 1BM3H 1Z0MA 2ZCHH 1WWAX 4BQ6A 4QWWC 2ATKB 5CEZL 2AJYH 1NCDL 3UX9B 1RFDL 3SKMA 3RWGA 3LS4L 4L5FL 1TXKA 4Z7VF 4MYWB 3ULVE 3T2NL 5I17A 5GSRA 5FKPA 5E1AB 4WJ5A 4HUNB 3OF6D 1E6JL 4PRDB 5CD5C 4G6MH 1WBYB 4TVPH 1BJ8A 1MI5E 2XKSA 4PP1C 4WFGE 4X9BA 3X17A 2C3XA 4MAYA 3LQAH 3EUUA 2O61A 2VL5A 4JFDD 3CLEH 4GBXA 4R8WH 3NZ8B 3EJYD 1FVEA 3KLDA 4IOSD 3B2UC 5E8DH 1KJ3H 2GTWB 4NQDE 1WBXB 1YYML 4YHMH 5SWSA 5EA0H 4MS8C 1R5WA 2VLLA 2Z8RA 3QIWC 2H9GB 2K7QA 4U49A 2VLKB 3QUKB 1F58H 3THML 4KROB 4NZDA 4XCCH 1FNAA 3QG6B 1ONQA 5AZ2L 1AHWA 3ARGC 3H0TB 4Y2DB 3MGOB 4CMHB 1JGVL 2D3VA 2J4WH 3M17A 4ODSH 3BT2L 32C2B 3PIQA 1JHKL 2OZ4L 4C56B 1WCBB 4IDJL 3O4LA 2Y6SC 4XHJD 4HBCH 4KJWC 4OB5H 1F6AA 1EHAA 3OKMA 1HWGB 3TBSB 1MHHA 4OFKA 2AXFA 5ADOH 1G9EA 4I5BA 2NY7H 5AZEH 4MVBD 3SKNA 4HGWB 2CLZA 4KTDH 3UDWC 3DX8A 4UILH 3RZCC 4XH2B 4YC2B 4F2MA 3BX7C 3D39D 4PLJD 4NKMA 1HHKB 4QKXB 5JW3L 1M71B 3DWTA 1LO5B 3GJFB 2Y25A 3TWCL 4JDVA 3GHEH 4W70A 2QQLL 4GMTH 4X5XB 2VRAA 1KYOJ 2SEBA 4GMSL 4XNUL 5IBLD 3MV01 5MEQB 2DBLL 1VFAA 4IIQA 4LMQE 4OCRH 3VD5A 4JVPA 4C57C 1BBDL 2UY7A 2XZQL 4WWKC 5AD0B 5JOPD 4X99A 3MRMB 4LHUB 3ULVH 4MHHI 5E6YA 1U3HC 4Y19A 1S9WA 2IAMA 3G5VB 4JG0L 2BOCA 5TPWH 1FFPB 3WKML 2P5WE 3RVVC 4YO0A 5DUMH 4QXTA 4XVUC 5IKCB 4YDLB 1LNUB 3QDGB 4PB9L 4LLWB 5CJXC 2W0FA 4I2XA 5DD3H 2R4SH 1BZ9B 3QAZB 2AQ3A 3O6LL 3BZEB 4FN0A 3O6FC 5DXWA 4P2RD 4O2FA 4OGAD 1T0PB 1Z9SA 3TCXA 1T21A 4QRPA 1JRHL 4OGXL 3PWNA 3AMKA 3HLAA 1HILB 1NGPH 5DRNB 4M7LL 2CLVB 3RGVB 1H3UA 2VOTA 3Q5YA 2JELL 2V17H 1YNKL 3PQYE 4Y2OA 3MRJB 1QP1A 3GKWL 2IBZX 5GS0C 4P3DB 1BGXH 1U91B 5F7NC 5FK9B 1F4HA 1ZHLB 1M05B 3NCBB 2YPLB 4AEHH 5SX4I 1T3FB 3LD8B 1AGDA 2Z91A 3V2AR 2DS4A 4UDUB 4XTRC 4OZIA 1XGQB 2B5IB 3SY0A 2BHZA 5HHNA 2R0LL 4L1DA 1I1YA 1WZMA 3AS1A 4PLNC 1BVKA 1JN6A 2GK2A 4U0QB 3FQTB 4DEPC 4GAJL 2VZ1A 4R4BB 4Z0BH 3RWCA 2X4OB 2FO4B 1W8OA 5IMMA 2CR6A 3KPSA 2J12B 3B9VA 1R5VB 2FSEA 3U6RA 4TRPL 2ZOKB 1RUML 2BJML 1IEHA 4MQXD 4PD4K 2AXGA 5IJKA 3LPFA 3FCTB 2OK0H 5IMLA 4FQIL 2KKQA 5C0AB 1N64H 4K71C 1PKOA 3NIGE 2EE3A 4PRHE 2W38A 4ZYKB 2NNAB 1NCAL 2XXMB 3O41A 4W6XB 4WEBL 2LU7A 3I75B 1J8KA 1KC5L 3VMNA 3P73B 4H88H 1GGYA 4J4PD 2CIIA 1S9YB 5TE7L 3OHXB 1CLCA 5A2IH 2CDEB 2H32H 2AEIT 1YDPB 1MVUB 1AO7B 2AEQL 3QJHA 2BHYA 3BXNA 1F4AA 3QHFL 2OTPA 4JPIB 5HI4D 4D3CL 3WDIA 3OPZH 5EORL 4HS8L 1CLZH 3BAEL 3TFKC 2NW2B 2VDRL 2QLVB 4PRAB 1QFUH 2Y06L 4L9LB 3QWOA 4OZIF 3GBNL 1J8HE 4IJ3C 2ZG2A 5DFWH 1AFVL 3C9NB 3GIZH 1F6LL 4E41B 3QCUL 3OB0K 1ND0B 8CGTA 5EU3A 2DQUL 5EFIB 1MOEA 2VXTL 3SGJC 5DMKB 3BMVA 3A0OA 3EYFA 5E7FA 3CCHB 5E8EB 4MCZB 2BXYA 1CK0L 1HHGB 2ZP0T 3NFSH 4FQHB 2F5AH 5DTFB 3DRTB 1RURH 3SE9H 4KRMB 1J9CT 2WBJD 5F6HJ 4O02H 1JWSB 1FNGA 4ODWB 3RNQA 2I9LB 4JAMB 4PG9B 3WNKA 5GRUL 2OYPA 5E2UH 2E7LC 3WO3B 4JFOA 2VC2H 3GBLA 4M6OL 1GGUA 2PW2A 2E8ZA 1F6FB 1C12B 1UM5L 2BX5A 4DCQB 2CK0H 3FOMA 3WXWH 4UTAH 1AGFA 4OQTA 3DOSA 4M3JA 5CBEB 1S7RA 2B20A 1LWRA 2EEBA 4O5LH 4UDTB 1PGRB 3LEVH 1TQCC 4J3TA 1SM3L 3QEQA 5IVOA 2X1XR 4JGJA 3LHPH 3GK8H 1P5VA 1HH9A 3VFVA 5IEHA 2H26B 5CMAB 4OJFL 1O7SA 2F54E 4HKZA 4MJ6B 5DUPH 2HFTA 1CL7I 1F11A 3TJHC 5BW7A 5JQHC 4HKBB 3O9WD 5D7LA 3VFTA 2UZIH 1YECL 3TN0C 5K9QI 2GFBB 4NO3B 4ZUUA 4G8IB 5BZDA 4HLZG 1UZ6F 3T8XB 4OLWL 5TJWK 3MA9L 1KTLA 3EO0B 5E5MB 3FRPA 4X9IA 1CI5A 4X6DE 3EOYG 1R3HB 2APXA 4X4ZA 4OD1L 2DIBA 4NOFA 3AM8C 4CJ0A 2ATKA 2HKFL 4GUPB 4KXZH 5JO5A 2FD6H 1JHLL 3VD3A 3W2DH 1QFWH 3HE7C 1FHGA 1U3JA 1S7SB 3RVUD 5JHLL 4CUCA 1YA5A 5M7QA 1BFOA 4ZTPL 2VE6B 5E1AA 2Q8AL 5I1GL 4R4FH 4YLQT 4PRDA 4JKLA 3JWOC 1TDQA 1WBYA 5GGQL 1W72H 5ALCH 3WJJA 2MSPA 4HWNA 1CBVH 1YJDL 3FT4B 3NZ8A 4K23H 1A4KB 5F3HA 2QQKH 4LCIL 2AEWA 2GTWA 1WBXA 1UM6H 4K3EL 4XPTH 3ARGB 1AR1D 5CILL 3V4PL 3C6LC 4EOWH 1BP3B 1YNTB 1OGAB 4JFYB 2Z92B 2H9GA 3LKRB 4WFFE 2VLKA 4TUJA 5BS0E 1VERA 3ZE0E 1ETZB 5JHDA 5KS9E 2CRZA 3QG6A 3R1GH 3S5LB 4Y2DA 4FHBD 1REIA 3QUYD 1C08A 4YDIH 1D5XB 32C2A 1B4RA 1S7XA 5D7JC 4C56A 1WCBA 3QQ4A 4P23C 4WI2A 4Z7WE 4XMKH 3RZCB 3RFZC 5HHXL 1U41A 3TBSA 1HYSD 2DQHL 5CGMA 2Z35B 4EZMA 4MD0B 4HGWA 1A47A 4EN3D 5CZXD 1I9RH 2HFFB 4QXGL 4QRRD 1C8PA 4LLUB 4XH2A 3O2WL 2O5XH 3KYNB 2GY7B 3VFUB 4X4ME 3SPVB 1U8QB 2Q3AA 1DBBH 2ICWI 4P2OD 3KLAB 4LAQL 1M71A 4WWKB 1LO5A 3GJFA 3CSPA 4UT7L 4ALAH 1MWAB 3SHSA 5DHXB 5DS8B 4F7MB 3C6SB 4X5XA 5E9DD 2E9WA 5E95B 4E42B 4JFFB 5I73C 4HXAH 2IALB 4G8GD 5MEQA 3A6CH 5I15H 1S7WB 4YHLL 3WIHL 2OI9B 4FFZH 3MRMA 4LHUA 4O2EB 5EWIH 5L2JB 3G5VA 3O6FB 4S1QL 1O5DT 1FFPA 2D7TH 5IKCA 2A74B 4G6FB 1MCHA 3MODH 3GSQB 1LNUA 4JM4L 3MLVL 4LLWA 2VISB 1EDQA 3FZUD 4OD3L 3BZEA 3MACL 4YUEL 3MV11 1D5BB 5D1QD 4D9QD 1EO5A 1G7LB 1JTPA 3NIFE 4FQ1H 1RUPH 1PDKA 1Z6JT 3S98A 1OTSD 1DQMH 2CJUH 3DSFL 4XPFL 1LE5B 3MLPA 2J2ZA 1HILA 5DRNA 4YX2H 2CLVA 3RGVA 2X70B 5ERWB 3MRJA 4V1DE 4P3DA 1U91A 3FT2A 5FK9A 3CK0H 1ZHLA 3FONB 4DEPB 2YPLA 3G9VA 3OAUL 3IU3B 2Y4SA 3MCKB 3NN8B 2H1PL 1XGQA 3BO8B 3D0LB 5EH1A 4F58H 1I1FA 1QYGH 5FHBL 3C60D 4GT7A 3UAJD 5GS1B 2PN5A 2W59A 3Q1SH 3VE0B 3MRCB 1CZ8H 2M26A 2RGSA 3IJYB 3ZKMC 2ZZUT 5SV4A 1R5VA 2CQVA 3TPKA 1T66D 5JR1H 4I77L 1RUQH 4U1IB 1JWUB 2ZOKA 1WSST 5GS2H 4KTYA 5E8PB 3HC4L 3FCTA 3N1PC 4QHUB 3HMWH 1MI5B 1VFOA 5C0AA 5ACZB 1T04B 3SN6N 3F7YA 3UZQA 3BISA 1L9NA 1QLFB 4ZYKA 2G75A 2NNAA 3DMMA 3I75A 1MCDA 3P73A 5SWZB 4IOIB 5KVGL 4NQDB 1S9YA 3O6KH 3MROA 3OHXA 3KVQA 1P4IL 2CDEA 1YDPA 1MVUA 1AO7A 5TE6L 5J11C 3UBXG 1C7SA 1CVSC 4IJ3B 5C08E 2QSTA 1CFBA 4JPIA 5KZCB 2VO5A 1NBYB 3QO1A 1J0JA 2R2HB 3V6OA 1UXSB 3BD4A 4I18C 3SE8L 3T2PA 2NW2A 4ELMA 2V7HB 4PRAA 4OCSL 1WZKA 5T3XE 4LSSH 2Q6WA 4ZS7H 4XNMB 4H0IA 3C9NA 1SBSL 1NBVL 2XWBB 5JW4M 5CFHA 1S3KH 3ULUH 3X3GL 3UTOA 5EFIA 2AQ1A 1CFQB 5DMKA 4HS6B 4P57B 3CCHA 5E8EA 4MCZA 2BNUB 5A1AA 1HHGA 1S5IH 1G0XA 4GRWF 5GGSB 1AI1L 1UJ3C 3DRTA 1FNLA 3IFPA 4OCYH 5F88A 3OXRB 1TJGL 1JWSA 1TMCB 5FOBA 4LPCA 1LO3L 4JAMA 4PG9A 1FV1A 1INDH 4N0FB 5C86A 1GC1C 2B1AH 4N0YH 2I24N 1TQCB 2EDBA 1FJ1A 3VXUD 4MA3A 4RGNC 1XF5B 4POZC 2NY0C 4DCQA 2R1WA 2MKLC 2Y5EA 4GKOA 5K9JL 1A7NH 4AEEA 5CBEA 3RVWD 4UDTA 3GSRA 4L4TD 1EXUB 5F7LB 2ADFH 2OQJB 3UTTB 3LKOA 3LKQB 4ELMF 3O0RH 4G8EB 1NJ9B 2H26A 3VMOA 3HUJE 4Q9CA 4MJ6A 1T7ZA 2L7JA 1E28B 1NSNL 2FBJL 1UT9A 1FGNL 1A7OH 5KJRL 2GFBA 3B4NA 1IARB 4ZS6C 4NO3A 4DOHB 1UM4H 3T8XA 3BDBA 1TIUA 2BRQA 3HNVH 4ONGH 4P9ML 4NM4H 3EO0A 2EO1A 3RRQA 4S2SB 1A7PL 1I9IL 1GJIA 3LZFL 3KWWB 3ROOA 3QQ9C 3HE7B 3UZVB 1R3HA 2CKBB 3C8KB 4M7LT 4DN4H 4JRYB 3VGAB 2NY3D 3Q0HA 1MFAH 1MJUH 4AENB 1AY1H 4DGIL 2EXYD 1NUFA 4FQCL 4P2QE 2VWEE 4GUPA 5A43C 2VAAB 3U9UB 1OTUC 1BWMA 1S7SA 1D6VH 2VE6A 3PV6B 4LPXA 2JIXD 3I50L 2HLAB 2V2TB 2BVOB 2BSSA 4BZ1H 1MAML 3C6LB 1EEZB 1LO0L 4NC2B 5BO1L 1JZ5A 1A4KA 3ARRA 1P6AB 1C5CL 1R3IH 4URTB 5B3NA 1KPRB 4Z7UE 4M7KH 4MMZC 3TO2B 4HK3J 2RQ8A 3ARGA 3P9MB 5CS7A 3K3QA 1A3QA 1KIPB 2R69H 1YNTA 3JV6B 1OGAA 3DBXB 4JFYA 1EGJA 1DCLA 4KDWA 4PRHB 5HHME 2AK4B 2MHAB 2Z92A 1PYWB 3LKRA 2XQYG 1MCFA 4WHYH 1V7ML 3KNBB 3T0BA 5INCB 2VUYA 1ETZA 1GHFH 1G6RH 1HYRC 1QEWB 4XP1H 4FQXD 5DVOA 3OKOB 2L0DA 4LSQH 2IC2A 3S5LA 1SYSA 2LU4A 4GKSB 4ZFGL 2OM5A 1QQDB 4G6JL 4UQ2A 1MRFL 2GITB 2HG5B 1GZQB 3W5MA 3UDWA 5E70A 4WTXA 4MNHB 3RZCA 3FTGB 3E3QE 4OLUH 4OLYL 3LDBC 4PB0H 4ZD3L 5B39G 2VXVL 2VTFA 5DO2C 4KRPB 3VXMB 2Z35A 4ZUSB 4MD0A 1A5FL 3WCYA 4NQED 2X6MA 2HFFA 2FJHB 1D9KC 3O2DH 4I0CC 4LLUA 2QQNL 5I73B 3KYNA 3VFUA 5CZVL 4PJFE 3SPVA 1U8QA 4X4YB 2EYRB 3KLAA 1NLBH 4NNXB 4WWKA 2CO6B 3ZHDA 3B9KC 4XB7A 1MWAA 5DS8A 3C6SA 2DKSA 5A2JH 2P8PB 4E42A 3QRGH 5I8OL 5C0RH 2IALA 5D5ME 1AKJD 4M93C 3QULA 4N8CL 3S9DB 4FG6D 5B3JE 3F7VB 1S7WA 3RBGA 4QXUH 1I3GL 2Q7NA 2YD1A 5DGQA 2F53E 1QACA 1X4ZA 3LMJH 1CU4L 1NDMB 2P7TB 4O2EA 5FUOH 1S8DB 4ONFL 5L2JA 5BQ7B 5CBAB 3O6FA 1HHJB 1IGML 1J05A 3NABH 4LOUD 5EOQL 3GSQA 3UJTH 2VISA 5HD8C 3IT8D 3VWJD 5J56B 5GRZA 3EFDH 1MJ7H 5F70A 3T0ED 4WEMB 3X12B 3E2HB 1RZKL 2ICEB 4S1DC 2EDEA 5FA3B 1TVHB 5KVDH 2IADB 12E8H 4ENEC 1G7LA 3IDMB 3MO1B 1YY8B 1NANH 1V7NH 1Q38A 1RIUH 3DTXB 2XZCL 2YA1A 2F54B 2VDLL 3NTCH 3TBWB 4NC1E 3G6JE 1FG9C 2X70A 5DHVB 5ERWA 4YGVB 5GSVB 4Z78B 4YHZH 3H6JA 4XP5H 2VLJB 3FONA 1OP3H 5FYJH 2A9NL 3GMMB 3QXUA 5GRJH 4P9HC 3IU3A 5FO9B 3G08B 3I84A 5E6IC 2XWJB 3MCKA 3NN8A 1FH5L 1LP9F 3BO8A 3D0LA 3D25B 4X6DB 1GYAA 1J1XH 2AEPH 4OZGE 5TF0A 2A83B 4PJ5B 3IXAA 3VH8G 5DMIL 5GS1A 1FYTE 4R2GD 5T3ZE 3MRCA 5D8JL 3IJYA 2HJFB 4XAKD 4J3SA 4TTDC 1KEMH 1MCPL 5BRZE 3KAAA 2GAZB 4QRSB 4U1IA 1HHHB 4YHYC 5DFVC 4ZO7A 5I6XC 5E2JA 2ZJSH 5SWSD 1JMZA 5EU6B 3VFNB 4Y7MA 2AJVH 4QHUA 5E03A 3KPMB 1MI5A 3T3MF 3TIEB 5ACZA 1T04A 4I3SH 5J11B 5KVEL 1U6AH 3RIAF 4F9LA 1YEIL 1FORL 1CFVH 4EVNB 3UTSD 4IOIA 4WEUD 4NQDA 1FZKB 5TFSL 3L1OL 1RZJL 2X1QA 4I18B 4OZHF 3MUHL 1U8HB 2DL2A 3RHWF 4AEIH 1G7MB 5BS0B 3O4LD 1HXYB 3P0VL 1NBYA 2HAZA 5JIPA 2R2HA 2P5EE 1UXSA 5HHOE 4X80L 1Q0YL 2VXQL 2W60B 5FECB 2V7HA 3NBNA 4AIXA 4R26L 5D2LE 5DJXA 4ELKB 1CLOL 4XNMA 4KKCD 2VXUL 5IT2L 3P4OB 1UJ3B 4UBDC 2XWBA 4Z7WB 2UUDK 2AERT 3K4ZA 2X7LB 4QGYA 5I71C 2DQTH 1Q8MA 1CFQA 5JLZB 4P57A 3BYTA 1BLNB 2BNUA 3ULVF 5IROC 2K7PA 5GGSA 3NACH 4ZXBB 3E3QC 1NQBA 4RGNB 3SBWC 3OXRA 1N4XL 3GSXB 2NY4D 2NY0B 3HB3C 3DECA 1XFPA 2ITDB 2W65B 3V6ZB 5EPMA 2IAMD 3U0WL 3FT3A 1RZ8A 4OUOA 1NCUA 1NFKA 4JKPL 1ADQH 1UACH 1LO2L 4AK1A 3PHQB 3L3HB 2IANE 5D1XD 1U8MB 2IMMA 2HJLB 3BIBX 1Y0LB 1S9VB 4Q9RH 4X83A 3O3DA 1UCBH 4Y1AE 5CLTA 5FDWA 2X2YA 2OP4H 3W39A 1JYWA 1VCAA 1EXUA 2P5WA 3GUTB 3STBA 2OQJA 2Y23A 1R0AL 1JPFB 2E6JA 1JF1A 3LKQA 4G8EA 1NJ9A 2R56L 4UB0H 5IBUG 3QI9D 2XTJC 4GW4B 1A6AB 1CWVA 1U93B 4MSWB 3TBVA 1E28A 3PJSB 4IRZL 4XBEH 2WBKA 1LE9B 5JIKA 3DNKA 4I8DA 1GGTA 4XBGB 3BQUC 2FGWL 4OAWA 1Z0NA 1AE6H 3AM8A 3NCMA 4AYFA 3MRKA 5DMGD 4DZBB 4O51B 4S2SA 4JFZL 2ENYA 3C5SB 3VDBA 3KWWA 4V1DB 1PZ5B 4LAJH 3HE7A 1BMGA 2CKBA 4JRYA 1EJOL 5E8OB 4J12A 4KV5E 4TSBH 2BRRH 4OCXH 3V6BR 3S96B 4TYUA 1MCKA 2EYSB 4NZRH 4PJDE 8FABB 1JPSL 2OLDA 1E27A 3TO4A 5I66B 2NTFB 3PV6A 4R3SA 3KHOA 4ODVL 4LVHC 2AABL 4HUXB 3IJHB 2V2TA 3QIBB 3C6LA 1EEZA 1RUAH 3WV0A 3UPRB 3N1MC 1KIQB 1CF8L 4JFHD 3GJEB 5HDOA 4KUZH 2KZWA 4KKLD 2F15A 5FCSH 2KL6A 2A77H 1ZVSA 1QG3A 2C3WA 3I3EA 1KPRA 4AT6B 4M43H 4OSUL 4FZEH 1NCCL 1IQWH 3SDAC 3TO2A 5DK2B 3CZJA 3A6OA 3P9MA 3TT3L 4LRNH 2DD8H 3VH8B 3GMQB 3DBXA 4PRHA 2AK4A 1IC4H 2MHAA 1PYWA 4HFUL 4MWFB 3BGAA 1T80A 5FYLD 5C0FB 3P11L 3KNBA 3NMEA 4KKNA 5INCA 1QEWA 3HNTL 4OZ4A 4KH2A 3LDBB 3OKOA 3ZT5A 5FGBC 1CD9B 4NWUL 1QQDA 3DVGB 5I1EL 3IFNH 4JRXB 1FN4B 1HIMH 4LFHD 2GITA 4OT1L 2XG4A 1GZQA 3RVTC 2J8UE 4Z5RB 3EW3B 5GIRB 4MNHA 4QTHB 3FTGA 4XVTH 2IPUK 4KFZC 5EBMB 3AFLA 1IM3B 4ZUSA 2I5YL 3D87B 3B9KB 2VDQH 1CE1H 3HAEB 1OP3K 3C5ZC 1J8HA 2EKSB 5F9OH 4OCLC 5GZNC 4M62H 3T4YA 4KI1A 4M93B 3ZE2E 4JPWL 1QNZH 2E9JA 2EYRA 3VFPB 1JGLL 4HPYH 4NNXA 4FXKB 4P4KC 4WW2C 3WFBL 4L4JA 4JHAL 1KXQE 4N90D 5E2WL 1WITA 1MELA 2LU3A 4RMRA 3RKDD 2R8SH 2IG2H 4JY4B 5HI3D 2E27L 4PRBB 2F58L 1WC7B 2CRMA 2COQA 3GSNH 1TPXC 5FYKD 5GGRY 3F7VA 1OPGH 4XI5D 5I1JH 3M45A 3JWNC 3UPCA 5JOEA 2P7TA 5FB8B 2A1WH 2HTLD 5BQ7A 5CBAA 1HHJA 3HRZA 3DXAE 3D39E 3QNZB 3QNYB 3QEQD 4H1LB 1EK3A 1I3UA 4K94C 3LB6D 4Y4HD 1FO0B 2NZ9D 1FFNB 1FNSH 1SEBB 2DLEA 4PJXF 3V5HB 5T33L 3OKLB 2AJZB 3X12A 1WICA 2ICEA 2X4PB 2YXMA 2DQFB 2RHEA 4KXZI 1TVHA 5FA3A 5D7LD 2HVJA 1EBPA 3CU7A 5CJ8A 1INEL 3CFJB 1QFWI 3MO1A 4KKAC 1YY8A 3VRLE 1F90H 3DTXA 2VAJA 2F54A 4POUB 4QRTB 1KJ2B 3TBWA 4O9HL 4ERSH 5HDQL 4UUJA 4YGVA 5GSVA 4Z78A 5E6IB 4PS4H 3VDCA 1XIWC 2CMRL 5FM5M 1L7IH 1MCWW 4QHKJ 4QRQB 4BKLB 1KLGB 2Y7QB 5EUOF 3AREC 3KPRB 1SEQL 4LARL 1CDGA 5GXBB 3JWDH 4KY1H 2GI7A 3GMMA 4MHHG 1FIGH 3CX5J 3DHMA 2XKNA 1X5KA 2HMIC 5FO9A 3G08A 1E4WH 2NXZB 2W07A 1OGTB 5C09E 2XWJA 4PGBB 2NX5E 5CGYD 2FR4B 3D25A 4X6DA 3MLXH 4HLZH 3F7PC 2F19L 4EI5D 4Y5VB 4PJ5A 4YHYB 4P4RA 2DQJL 5I6XB 1OF2A 1G7IA 1B0GB 2DQEL 4AG4H 3IRPX 1S9XB 3CUPB 2BP3A 2HJFA 3A67L 2PUQT 1GCFA 3BRDA 3NAAH 2GAZA 1VGKB 4QRSA 1V8HA 3GBMH 3NCEB 1HHHA 3QNXB 1FC2D 5TDPA 4QOKD 3H9HB 4JZNB 2EZ0D 5EU6A 3VFNA 3H3PH 4KAQH 5I9QC 4PJGE 1JZ8A 4KROD 3DRQA 3KPNB 4EVNA 1CFTA 1Q9KB 5IIEB 5JHDD 1FZKA 5D1ZA 3MREB 4KK6D 5EZOL 4X5LA 5SX5K 4KK8C 1U8HA 15C8L 1G7MA 1N3NB 5MP6H 4BSVB 2H2SD 1U2CA 5BS0A 1HXYA 1T7VA 3RDTA 2CDGB 2E9IA 5KS9A 2Q7YA 3RWDB 2VZSA 2W60A 5FECA 4WHCA 4WCYL 4YBQD 5I71B 5L6YL 5BVJB 2E3VA 1B2WH 3SDYL 4NZJA 5F1SA 1DUYB 1MQ8A 4TSAL 4ELKA 4FFVD 2CSPA 3P30H 5JXAL 1IC5L 1KPUB 1OQOA 3P4OA 2EH8L 2ERJC 2EIBA 3GSWB 1D6EB 1RK1B 4Z7WA 4ZUWB 4B41A 2X7LA 4UQ3A 5IGXH 5JUEL 5JLZA 4RSVA 4DFHA 3EJYC 3VDAA 3SCMB 1BLNA 1IL1B 1RI8A 1UKTA 1XF2B 5KTEL 2QL1A 5EC2B 5FCUL 3KG5A 4ZXBA 1ITCA 3CMOH 2HRPL 5FFLA 1VB9A 2V9QA 2X4TB 4X4MA 4LPUA 2JJTA 3VFOB 4BUGA 3GSXA 3GRWL 4D8PB 1AC6A 4NKIL 4GAGH 2ITDA 3DUHA 2W65A 4P99A 3TA3D 3V6ZA 3EYVB 3EO9H 3WLBB 4DW2H 3LQZA 2D0HA 2X4UB 4YHIB 1VFBB 3PHQA 3OKNA 3L3HA 1U8MA 1ZWIA 2HJLA 1Y0LA 1S9VA 2DWEB 2F53B 1EJ6A 5C0IB 4D0BB 3QIUD 3MLYH 4RMQA 4XHJC 1EFXB 5AYUH 3DI3B 5KS9F 1AD9B 1JPFA 3FO0H 4EDXB 1CDBA 3BQUB 1T03H 1EMTL 4MVBC 1U93A 4MSWA 5C6WH 3GKZA 2Q76B 2DBJA 4PLJC 1LE9A 3VG0H 4RAHA 3W5NA 4XBGA 4CVWA 5I1IL 3H2WA 4D2NA 3WE6A 4JO3L 2O93L 4HPOH 1EAJA 4DZBA 2RJMA 1U9KA 5T5FH 3G6JB 4OGYH 4YBHA 5IBLC 1CGSL 3C5SA 1KB5B 4V1DA 1PZ5A 4A6YB 3UCRA 4UINL 5HI5D 5E8OA 4OKDA 4LVHB 2GJ6E 3S96A 1CN4A 1MRDL 2EYSA 1BPVA 8FABA 2NW3B 2OXGA 5I66A 1TJHL 5EB9A 1MJJB 3D9AL 3EYUL 4OZGB 4YAQA 3GHBL 2NTFA 3S3JA 1CYGA 3H9SD 5F9DC 1FPTH 1FYTB 4WTWA 4Z95H 5DC4B 1IFHL 5C70A 4HUXA 3SDAB 3IJHA 1MRCL 3QIBA 5F97E 4XZUB 2PXYD 4OGAC 25C8H 1VGEL 5K9QG 4XRCB 3DMMD 3GJEA 3QZWG 2BFVH 2HA1A 4FNLL 1CGVA 1BD2E 2B2XL 5K9OA 3LOWA 4CADA 3MRFB 3JXAA 3ROLB 1P1ZB 2Q86A 4XP6L 4MWFA 1ED3B 3NIFF 5C0FA 4JO2H 3WBDA 4HIXL 4HAFA 4NRZA 3ULUF 2VN7A 3AU1B 3C08L 1X4YA 35C8H 3DVGA 1FN4A 4JQIL 1LMKA 1MFDL 5T5NF 3C5ZB 5C08A 4AMKH 4Z5RA 4NSKB 1NDGA 5GIRA 2ZG3A 3HFML 4QTHA 1DJSA 1WWCA 2P5EB 5HHOB 2IPKB 5EBMA 5I1HH 5ISZB 1RVFL 2YD3A 3S4SG 3B2VH 3BP7B 4CGTA 4X7SL 4TQEH 4P4KB 5D2LB 4NKDB 3T77B 2OR8A 3V7MA 2LQRA 2F8VA 4MQXC 4EI6B 2EKSA 1KJMA 2X4SB 5C07B 3BEWB 6FABH 1ZA6B 2C3VA 3UP1A 1WIOA 1TPXB 4K3GA 3T2QA 3LEYL 4H8WH 5A2LH 3VFPA 2NY6C 5LWYH 2YPVH 5DJ2B 5H94A 3P77A 5A40E 2NTSP 1UWGH 3S6CA 3VGFA 1ZGLM 4ODUB 2XV6B 4J4PC 4FABL 5TQ0L 1LK3H 4JY4A 4WI5A 4AY0A 5ITBH 4PRBA 1S7VB 2YD2A 3OR7B 1IAMA 2LVCA 3W9DB 2XRAH 2DJUA 4WDIB 5FB8A 5IQ9B 5HI4C 4QRRE 3SO3C 5CSZB 3NCCB 3MRPA 3QNYA 4NPYB 4XPAL 4H1LA 1KLUB 1FO0A 4L3CB 5F6HI 1FFNA 1N59B 2IANB 4XPBL 1SEBA 3V5HA 4KMTH 3E8UH 2VLRE 3OKLA 1J5OH 2AJZA 5I75C 4Y1AB 4R4ND 5E9DE 2X4PA 2DQFA 1XIWB 1VKXB 3BKML 4G8GE 3X3FL 2HT3D 3VI3E 3CFJA 3AREB 1RHHA 2VXSH 5F7EH 5IB2B 4PLOB 3ZL4L 1BFTA 4QRTA 1KJ2A 3KYOB 3MV9B 1H8OA 5E6IA 3SGKC 4QRQA 1ORSB 2KUTA 1T1YB 4BKLA 1KLGA 2WBJC 2Y7QA 4YE4H 2DM4A 1MJ8L 4PYGA 4HT1L 3VGDA 1OGTA 3BRFA 4D9QE 4I0PD 4PGBA 1WFNA 2FR4A 3MGTA 1TVDA 1FRGH 4KGLA 2PNDA 3TGXA 4Y5VA 3I9GL 1MCSA 3SQOL 1B0GA 1S9XA 3CUPA 4X6EB 1YMHB 4P2QA 3K1DA 2DICA 4PJDB 4K3JH 1BEYH 2FB4L 1NAMB 4OFVA 3ZTNL 4W68A 3BDYL 3H9HA 4LCUA 1JPST 4JZNA 4KDTC 4B50A 1KENH 2ZCHL 3O9WC 1OGAD 3MJGX 5IQ7L 5LKNA 3BN3B 2BERA 3WD5L 1G0DA 2EXWD 3KPNA 5IIEA 3MREA 3HUJF 4Z7UA 4MXVE 1U2HA 2MMXA 3O45B 2BVUA 4HLJA 1TJIH 2Z8WC 2YOCA 3RIFK 4TVPL 1MHPL 4QGTA 5I1KL 4Z8FH 1MWAL 1OTTD 4MGXA 1N3NA 2IWGA 3AB0C 1QSVA 2BVTA 4BSVA 2ERJB 3OZ9L 5D6DA 2ZCKL 2P42B 2CDGA 4HJJH 3UMTA 2FHBA 4Q97A 4L8BA 1NMBH 2Z31A 5BVJA 3RVUC 3IB4A 3ARSA 4F33A 3S88L 1GOHA 5FUZL 1TTUA 5IROA 1KPUA 4YHOH 2J8UB 1OM3H 3PWUA 4KKBD 4FZ8L 1GC1H 3GSWA 1D6EA 4Y88A 1A6PA 1RK1A 5D93C 4ZUWA 5H2BA 2FNBA 4XXCC 4WTZA 2D2OA 4YFEA 4XCCL 4DVRL 4TOYH 4U6VH 4TVPD 3SCMA 1IL1A 1NC4D 3OJDB 5J6HB 1XF2A 5HHVH 1OSPL 4G7VL 3EYSH 1FFOA 3MLZL 4RAVB 3IU4H 3U4EB 4UI2A 1AR1C 2X4TA 1KFAL 2C9AA 2D7QA 4RNRA 4Y0GA 3GFUA 3VFOA 4D8PA 4JQXC 1NANI 3KPPB 3ES6A 3FQNB 1GOGA 3EYVA 3WLBA 2WIMA 5ADOL 3OKYA 5C0BD 4G6FD 2X4UA 4HGKC 4MLSA 4Z7UF 1VFBA 2XY2A 5HDBE 4K9EH 2WQ8A 3QUYC 1PLGL 2DWEA 2F53A 1QR4A 4D0BA 1AIFB 3MRGB 3DXAB 1EH9A 1EFXA 3D39B 1HYSC 1AD9A 1KELH 2IFFL 4GMTL 4HEME 1LO4L 4EDXA 3RP1A 3ALWA 1X44A 4Q0XH 5E56A 1A4JB 2YSSB 1I7TB 4EN3C 5CZXC 4OI8A 3U46B 4GXUN 1UG9A 2ZUTA 3OKKA 2Q76A 3ULVL 3MBEA 4NWTH 2ZUVA 4MD4B 3CVIL 2P8MB 1QLEH 1XZ0B 4QRUA 1A7QL 2DI7A 3G6JA 3HC3L 3EAKA 4Q74A 1BOGB 1L6XA 1KB5A 3MR9A 1GGBH 4UV4H 4KI5E 2V5TA 4PJFF 4UT9H 2C4FT 3FO2B 5T1MB 1EHLH 1QVOB 2CGRL 5GJSH 3ZT7A 5IFHH 2VZ3A 1YQVL 4XC1H 4P2RB 3TM6A 5C09B 2NW3A 1NGPL 3S37H 1DSFH 4YFLF 3ULVD 1MJJA 1CXIA 1IGYA 2V17L 3OB8A 4OZGA 3G9AB 5FM5O 5D5MF 3DI2B 3WFDH 3GM8A 1BGXL 3FZUC 1FYTA 5F44A 1DEEB 4M48L 1EERB 5D1QC 4AEHL 3R06B 4XZUA 3QDHA 3ELAT 1U3YA 3MC0A 5BRZA 4XRCA 3OJVC 4MXWH 1OTSC 4J23A 4WW1B 4U1MB 1G9NL 1IVLA 9CGTA 1NUGA 3DLQR 3T65B 4XVSL 1XAUA 1VPOL 2OJZH 3MV8D 3QUZD 5FGBA 3MRFA 3EBAA 3ROLA 1P1ZA 4NO5B 4KWUA 4EQ2A 1GZPB 3VG9C 4IM8A 5FUCC 1J11A 4OIBA 1ED3A 5C0EB 5MHSD 4RMVA 1CD0A 1F02I 2G5BB 4NBZB 4N9OB 4HGMA 5DQDH 3ZHLA 3AU1A 3VI4E 3G6JF 1YUHA 4PJ7B 1K2DA 4WUKL 5TQ2H 3AXLB 2A6IB 3C60C 3O3AA 3UAJC 2FX7H 3C5ZA 3O2VL 4NSKA 3HAEH 1QRNE 1WFUA 2PYFA 2P5EA 5HHOA 2IPKA 1QBLH 2ZSVB 3RL1B 5IP4A 5ISZA 3VFSB 1U8PB 4MZ3A 5I1LA 1T66C 2FJFB 3ESUF 3A6BH 3BP7A 2QV2A 5C9JB 1JE6A 3T0AA 4P4KA 2WUBH 5D2LA 5DR5H 4NKDA 3T77A 5GRYA 1J12A 3DX6B 1R5IA 3ZDXE 4EI6A 4BK5A 1UA6H 2X4SA 3QHTC 5C07A 1SJEB 3BEWA 5EG6C 4LDLB 1ZA6A 3RVXD 1PFCA 1X5LA 1MQKL 3MNVB 4G6KL 3U1SL 5F7UA 4AH2B 1I8KB 5DT1L 1QFUL 5DJ2A 5F7MC 3QFJE 3SO3B 4ODUA 5DF0A 3SE3C 5GGTH 2BXZA 2R29L 2PW1A 3CLFL 4KU1A 1UEYA 3OR7A 1HSAB 5KSVA 3W9DA 2YWZA 1M1SA 2DQGH 5F96H 4RISH 5J1AB 4GG6F 4NQEE 5LBSH 4ZFFB 4RBPK 5IQ9A 5I75B 3TYGH 2WANA 4J3VA 4KZEH 2P5WD 2CKBL 2LAAA 4NPYA 1KN2L 1KLUA 2F5AL 1FIEA 1DQDH 1T7XA 1NEZB 5D70H 1N59A 2IANA 4WHTB 1QLRB 4Y1AA 4P9HH 5MI0C 4P3CL 4HULB 1XIWA 1VKXA 1CGUA 5E2UL 5IVZB 3KYKL 1I75A 3RX5A 3AREA 3TVMA 4HCRH 4HG4J 3U36B 2F9BT 4GKNB 1PG7W 3ZO0A 3MBXL 5D2LF 4NDMB 2IGFL 3KYOA 5CIPB 2VKWA 3PQYD 2CH8A 1Q1JH 1T1YA 3KPLB 4O5LL 5D72L 1PVHA 5E99H 3TJEH 4X98A 5CWSB 3UO1L 3S36H 3GK8L 4RIRA 3T0EE 1LK2B 4OCMC 3TO4D 1OAKH 3INUL 1RJZA 4MNQE 4L3EE 1OARH 4CNIB 3ALXA 1FLRH 4GOSA 1N6QL 3RVWC 1Q9WA 3MOAL 4LCCB 3SKJH 1X5HA 4PJDA 4M8QB 3PGCB 2P46B 5BZWB 1CXHA 4JCMA 3QXDA 4NZUL 1QOKA 3QXAB 3I2CL 4HXBH 2P45B 1BJ1J 4RDQF 3NZHH 3I6LE 4HHAB 1LDPH 3TF7C 3AB0B 4XNXH 4EXPX 3TZVD 5CP3H 1YEFL 4OUUA 4GRMB 4KZDH 4HIHA 3VXPA 4C4KT 3BVNB 3JZ7A 4QY8B 5GHWH 3GO1L 3O45A 4R4FL 4J2XA 4CMMB 3RQ3A 3HCVB 5EC1B 5IMKB 1DBMH 2H3NA 5ALCL 2NY3C 1J0YA 2EXYC 2KDGA 3AAZA 4U2YA 3OF6A 4K23L 1IQDB 5D93B 1AQKL 5MENE 3OXSA 4KRPD 1Q9LB 3O3EB 3UTSE 1J8HD 4P3WA 1YEEH 4HWUA 2J8UA 1T20B 5EO0A 4K55A 3LH2H 4ZQKA 4PJDF 2XWTB 3R1GL 4L8DB 1KCSL 4YHPB 1ZHKA 4XMPH 3U48A 3OJDA 5J6HA 3FHAA 3FRUB 4YDIL 4C83B 1A1OA 2ICWJ 1B6DA 1HQ4B 4XMKL 2L4OA 3QUYB 3KPPA 1RUKH 3FQNA 4G5ZL 1MIMH 3DROB 3PDGA 2AKRB 4P5TC 4FQXC 1BOYA 1H0DB 3NFNB 1I9RL 2OTUB 4MLIA 3NPSC 5DD0L 4YDKH 3PWVB 4C4KO 3M1BB 3ET9F 5DEZA 4EN3B 4OFPA 5IF0B 3QEGH 2CPCA 4QRRB 3HPLB 1OOAA 1DVFB 1FZOB 1AIFA 3DXAA 3WNOA 3D39A 1WVZA 4PTUA 3TT1H 3MLUH 2ZPKL 1BJMA 1T4KB 4P2OB 1H9VA 1DL7H 2YSSA 4M1DL 1I7TA 3OGCB 3HI5H 5I15L 1JV5A 3U46A 4QHNB 3OAZK 5E9DB 1F45A 3EOTL 4XX1G 1BF2A 2J8UF 1MFEL 2A6JB 1HQRB 4G8GB 5FHAL 3WFEH 4WI6A 4P46A 2D7TL 2VDNL 2X1OA 4MD4A 4LSVH 4A6YH 2P8MA 4OV6F 4FA8A 1XZ0A 3RAJH 3MODL 3HI6H 1G1CA 4K2UH 3CFDB 1YPZE 3CIQA 3CFCL 4XAWH 2ID5A 1BOGA 4GSDL 4UT6H 4F57H 1HINL 4L8SC 3RWJB 2I27N 4FG6C 2DKMA 3GMLB 4OFYD 3CMGA 1BIIB 1RUPL 5T1MA 1JL8A 3ZE2F 5IOPB 1QVOA 3I3BA 3MJ6A 4LOUC 5D1QB 5C09A 2I26N 1U8IB 4ZPVB 4OFIA 4YX2L 1AXTH 4O58H 1S9KC 1A6UH 2R0ZH 3VW3H 3L3GB 5DEGB 4XCYB 3VWJC 1T89A 2YK1H 5FV1L 4M6NL 3T0EC 1DEEA 2H2PD 4M5ZL 1NEUA 2Y9RT 3R06A 4X7EC 1OWRM 4U1NA 3VG9B 4PGZA 1F00I 4KRLB 5HVHC 2W9EL 1KJVA 2Q1EA 5EN2B 5D1ZD 3UYRL 4WI7A 4OZFG 3T65A 5DD1H 1ZVHA 2GSGB 1CDUA 3C2AH 4NO5A 2B1HL 1GZPA 2J6EH 3C60B 1HXMB 4WFFD 1A3RL 1JYXA 4PJGA 5DD5L 5JR1L 3NA4A 3BUTA 3K0WA 4FQJL 2G5BA 3RDTD 2PO6A 3VRLF 1NFIB 3FAWA 4J6RH 1AQDB 5GRVL 1RZKC 4DKFH 1MY7A 1R3JB 4JFHE 3MTRA 5C0ND 5SX4H 1XEDA 4R2GC 3DV4B 5LAXB 2AI0L 3EIFA 2MQ0A 4PJHB 3V7AG 3RL1A 2ZSVA 1ZXQA 3MFGB 4G80B 1U8PA 4YHKH 1OAZH 4MA8L 2FJFA 4XC3L 4GW5B 5FYLE 5MEPB 4KQ4H 4LP5A 2Y36H 3DX6A 4NN7C 5E4EC 2V6HA 1TTGA 4PLKD 1B0WA 2MJWA 1YEHL 4ZXBD 4LSTH 1SJEA 4EBQH 5SWQB 5GS2D 3DURA 2HLFD 5HBBA 4NJ9H 3HMXH 3HTLX 5CAYB 4AH2A 1I8KA 3VXOB 1PSKL 5DLML 1MCLA 3V0VB 4NJAH 1OVZA 2AJUH 4LQ1A 2AJSL 2RCSH 2WW8A 4ZS7L 2DYPD 5B21A 3L5JA 5IFAL 4APQD 3W11C 1HSAA 5F9AC 3ULUL 5CUSH 2YUZA 4LLQB 4ZFFA 4O4YH 4PJGF 5DHYB 1PKQE 5MI0B 1S5IL 5D71H 4HUMB 5FV2A 3C09C 1JFQL 4K8RH 4KMQA 3T1WA 1QLRA 1QPXA 4KKCC 4NFDA 5HGAB 1FFQA 1AGCB 2XN9E 1RZJC 2QTEA 5IVZA 2YUVA 5FYKE 3VXSD 3PP3H 3U36A 1IAIH 4GKNA 4RFEB 3E1F1 3ULUD 3Q5OA 2OSLB 4NDMA 2FIRT 1CLYH 3UBXA 3EDKA 3VXUB 1A7NL 4S1RH 2JF1A 3KPLA 2NY4C 1L7TH 1KTKE 2ADFL 3FO9A 3WS3B 1AGEA 2IAMC 2BOBB 2X9WA 3UPAA 1ZOXA 2VDPH 4WUUE 1Q72H 4OD2A 4RFOL 4L4TB 3ILPB 3S3SA 4F80A 2LABA 5F1KC 3VFGH 2MPAL 2XACC 4JFXB 5D1XC 5EOCH 1I7ZB 5CSGA 3WUWG 4BQBA 4KDTA 5HXMA 4CNIA 4NHUB 1V3LA 3WJLA 3BH9A 1GIGL 3MRNB 3QIBD 4LCCA 1Z5LB 3PGCA 1MCOH 2N7BA 5C2BL 1CGXA 3S36X 1T1WB 2G2RB 4YXKL 4UZGA 4PP2B 5BZWA 2A6DB 4CVXB 1T0NB 5AUMB 3V8CA 3QI9C 5KW9L 3QXAA 4EDWL 2HVKB 5IB5B 5T3XL 2NY3B 1EHNA 1TZIB 5DMGC 3MLTB 4HK0B 1BD2A 3GI9H 1I1CA 4QY8A 3T09A 1BQHB 4JB9L 3E6HB 4QTIH 4PGDA 2DLGA 2YRPA 1ZT1B 2YC1A 5EC1A 2L7UA 5IMKA 3TH3T 3HZYB 3G5YB 4BZ1L 4QOKE 5C08D 3L5XH 5ENWB 3DIFA 2JIXB 1JPGA 4JGMA 5B38B 2QEJA 2MCPH 1IQDA 2PTUA 1ZLWH 2H8PB 4PGJA 1KOAA 1CD8A 1AJ7L 1Q9LA 5CEZH 4PD4J 1NCDH 3O3EA 1RFDH 5T3XD 3JTSA 5IJKC 4Q9QH 1T20A 3T2NH 5C0JB 1FO0L 1U42A 1QRNB 3SOBL 4GG8B 1AXSA 2UYLA 1FDLL 7FABL 4ZUVB 1E6JH 5HGDB 2JCCB 2YD7A 2XWTA 4YHPA 4LSQL 43CAB 4HSQA 4AIOA 4KK5D 4KKLC 3QHZL 1J0HA 3FRUA 4XPHL 5D6CB 3IS0X 4K07A 4FQXB 4C83A 1BJ1H 1YYMH 3NPSB 5I1DB 3RY6C 1J0ZA 1HQ4A 4OLUL 3QUYA 2V5SA 3V6FA 4ZO9A 2IEPA 3DROA 2AKRA 2GW5A 4XMLH 1H0DA 3KDMB 2NR6D 2CXKA 1FSKC 1VEMA 1Z9OA 3UEZA 4MNGE 5AZ2H 1S7UB 3PWVA 2IJ0C 4PRPE 1XGRB 1JGVH 4DGYL 4EN3A 4NQEB 1IC7L 4POYA 4QRRA 3HPLA 3LN5B 1DVFA 3BT2H 1LGVA 3IVKB 1BVLA 1JHKH 2OZ4H 3G5XB 4IDJH 3MJ9H 4IMLB 1T4KA 4P2OA 1RIVL 3QB7C 5C0RL 1AH1A 3OGCA 4R96B 3WS6C 2ARJA 5CP7B 4QHNA 4QXUL 4Z7VB 5E9DA 3SKOB 1U58B 4RGMC 2A6JA 1HQRA 3HS0A 4G8GA 5HYEA 1AKJB 4X6CE 4L8SB 1Q0XL 1RZIB 4KK9D 1JZ2A 4NNPL 1DN0A 2NXZD 3CFDA 2EH7L 3RKDC 1I3RB 4CW1B 3EFDL 5HI3C 2QQLH 4TVSa 5GJTL 5AWNL 4GMSH 4XNUH 5BOPA 3GMLA 2CIKA 3AMLA 4XI5C 3VWJB 1BIIA 2DBLH 4XBPA 1NC2D 3T0EB 4R7NB 1BBDH 1MREL 2HTLC 4P2QD 2XZQH 1A2YB 3B83A 4QHKI 1U8IA 4ZPVA 1JBJA 3LB6C 3IDGB 4Y4HC 2EDHA 4MD5B 1SJVA 4OI9A 3WKMH 2NZ9C 5HVHB 1RULL 4MNQB 3L3GA 4XP5L 5DEGA 2I07B 3EYQD 3WIHA 2FIKB 4NN5C 4PJ8D 1IKNC 4G43B 3LSOB 4JN1L 1JP5A 5GRJL 4Z6AT 1U8NB 4JKKA 1K9TA 5EN2A 2AEPL 4MJIE 2D7OA 4OGXH 4I48A 3TPUB 1G7QB 3SKMB 2GSGA 2AW2A 4XGZB 5MEOA 4M7LH 2JELH 4GRWE 5I17B 1YNKH 5HHMD 5GSRB 3C60A 3BRGC 3H9SE 2XKUA 3VI3F 3GKWH 3BIKA 3IDIB 4N8PA 1Y6KR 3EOBB 2EIEA 2QQQA 4I0KA 3K8LA 5JZ7D 3LY6A 2O61B 1AQDA 1I9JH 1ZV5A 2Z31D 5FYJD 4BFBD 1R3JA 1EX0A 5CGYC 2AJVL 2EYTB 1FVEB 3SO5A 3DGCR 4FMFA 5FO8B 3QUMB 3F6LA 5JNYB 2X9XA 4S11A 3EFFB 2R0LH 1U6AL 5E4EB 4FQ2L 3T04D 3DV4A 1GGIL 3PP3K 4LBEB 1KEGH 3Q6GH 2AJXH 4GAJH 2VUOA 3WJJC 3WXVH 5IB3B 4WFEE 4G80A 4JN2B 4UOJA 2EDTA 1G7JB 2XZAL 3U7AA 1UVQA 3JV0A 3FN3A 5TH2A 3UTSB 5I0DA 3KXFD 2EZ0C 2BY2A 4TRPH 1WLHA 3MPCA 2JK5B 1S7TB 2R9HD 3M17B 3IJSB 4FQIH 3S35H 3BHBB 4PYHA 4KROC 3VXOA 3V0VA 3V4UL 3O4LB 4WEBH 1NCAH 2F74B 4KK6C 1KC5H 1WV7T 3VGGA 3EDJA 4BUHA 1MHHB 2V7NA 2MNUA 3C09B 4QT5B 5D9SB 4PJIE 3SKNB 2F53D 4JKWA 2AEQH 4LLQA 2DQIL 2FEEL 2H2SC 1E4XL 1KB5L 1MCEA 3P3YA 4HWEL 1K5NB 3QHFH 1QBML 4NKMB 3TBTB 3BKCL 4YBQC 4OKVB 5EORH 4HS8H 3BAEH 2VDRH 3FB6B 2NY2D 4RFNC 2Y06H 4FFVC 1B3JA 2PETA 3GBNH 1AGCA 1U8OB 2NY5H 3MBED 4JFEE 3BE1L 4ZG1A 2OJEB 2C4FU 2NY4B 3QCUH 5T3ZL 2VABB 3MJ8B 5HYFA 3IDXL 4X99B 5F1IB 2CRIA 4RFEA 2H41A 2OSLA 2VXTH 4Y4FB 5GGVY 1CK0H 4Q9RL 3NFPB 4Y5XA 1UCBL 3FRPG 4MA7L 2N56A 2OP4L 1ZLWK 1M7IA 1OB1B 5D1XB 1J0IA 2FRGP 4X8JB 5F8RC 5C3TA 3TA3C 2GYSA 3ALPA 1ZLSL 1E0OB 5I30L 3WHE1 1PX3A 2WM0A 4IOFD 4L4TA 4NOBA 5GRUH 3PNWB 3BWUC 3PWNB 4NQXB 3M8OL 4XBEL 1A02N 4M6OH 3W0WD 5T3ZD 2NYYD 3QI9B 4BA8A 4TUOB 1UM5H 4NHUA 3QIUC 3MRNA 2AQ2A 4I3RH 3NIDF 1HDMB 1Z5LA 1LVEA 5BRZD 1V5JA 1T1WA 5ID1B 2G2RA 4C58B 2R4RL 4PP2A 1SM3H 2A6DA 4NN6B 3U0PB 1T0NA 4J3XA 3B5GA 1RJYB 2Z91B 4OF8A 2NXYD 3CDYA 5JOFB 4IDLA 3SY0B 2HVKA 4OCXL 5IB5A 3F6IA 2Y1VA 1KCUL 1BVKB 1JN6B 1YECH 1TZGL 1CIUA 1TZIA 3MLTA 4HK0A 1WT5A 3MA9H 1BQHA 3E6HA 5GZOD 5ILTL 4MCYA 4ZMAT 2R2BA 3KJ4C 1ZT1A 3H3BC 1T83C 3HZYA 1X5GA 5J8OA 4LQFH 3G5YA 5KG9B 5HI5C 3OAYH 5ENWA 3HE6A 2JIXA 5B38A 3R8QA 2P5ED 5HHOD 4QXWA 1A21A 2A73A 1JPTL 2H8PA 2A77L 4LLYB 3AGVA 2WBWB 4M43L 2HKFH 3B2UD 4E9LA 1IQWL 4ZNEE 1JHLH 3ZSTA 2FBOJ 1MCBA 3ZLQC 5JHLH 4HKXB 1EVTC 4KI5F 4AL8L 1T6VN 5C0JA 4ZTPH 1QRNA 2Q8AH 5I1GH 4GG8A 1H3GA 4ZUVA 3QJHB 2PXYC 2Z0BA 4KUCF 4NC0B 2V2WB 5HGDA 4W4NA 5GGQH 4HEPG 5JW4N 1UYWL 3DMMC 2HJKA 3LIZL 43CAA 4J1UA 5E08L 5GQBA 1RQ5A 2XFXB 2X89D 1YJDH 1HIML 5EU7C 4FQXA 4ZOCA 3KS0J 4UIMA 2RIKA 1EFQA 4DUWA 5I1DA 5DJYB 3VXRD 4K3EH 1UWEL 4XVTL 3V4PH 5CILH 1H3VA 2A0LD 3QFJA 4LHUG 4UOW1 1PG7L 2BVPB 5DRXB 5EU3B 3KDMA 2QSVA 5DMYA 5F9OL 5D2NE