4WHDA

Human ceacam1 n-domain homodimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
b'AQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 1
publication title Human CEACAM1 N-domain homodimer
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 28
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4whdA00
3PWUB 4DQOH 4ZS6D 2HMIC 2EICA 4D0DA 1KIPA 4CJ1A 2RR3A 3WSQH 1RI8A 1UCTA 4J12A 1DFBH 3L3DA 3QNYA 4JO3L 5CGYC 1H3PL 4NQDB 1HHHB 5BOZG 4UINL 1JF6A 1T7WA 1WWAX 3LQMA 3ARXA 2I5YL 4OGXH 5ENWA 1ZSDB 2R4RH 2IANA 1NFIA 4HS8H 1BECA 3RPIB 5BW7A 2I07A 1ORQB 1RAMA 2BNRA 3WS6A 2OX5A 4IRJA 4FXGA 1GGYA 5D7LD 2VDQH 4KQ4H 2FZ3B 3BEVB 1S3KL 2IALB 3O2WH 2B0SH 2ADGA 3ULVD 3DBXA 1OTUD 4AIZA 3NGBC 5E5MA 2BNQE 1MLBA 2PTUA 1MEXL 2VL4A 3FO2A 3FB7A 4L8BA 1TJHH 4NCDA 3LKQA 3OJDA 2NNAB 4NN7B 1A7QL 4HZAA 3OHXB 4I2XB 1N7ML 1QTYT 3GMNB 5EO1A 2ZPKH 1KJVA 4OLZL 2BHZA 4O02H 4XNXL 5D7KD 4URTB 2OR9H 4L3CB 4R3SB 1OB1B 2EYTB 3RRQA 1KBGH 3IJHB 4IRSA 5HI5C 3CDCA 5E56A 1EVTC 2F5AL 4V1DD 4S0TD 5AG8A 4UQ2B 5EUOA 1F2QA 1KTLA 2DQGH 3LZFH 3TFKC 4JO4L 4Z5RB 5CEXB 4LOUC 5CBEB 2Z91A 3V5KA 2CK0H 4MA8H 3LKNA 2BOBA 3W5MA 5MEOA 4JLRB 4WWKD 1R24B 1N5YL 2PYEA 5DHVA 5DFVC 3S4SG 4ZFGL 3RUGF 3OSKA 4WEBH 2W1NA 4OZIE 3SO3C 1MAKA 4M7JH 3LN5B 5FOJA 3NFSL 4M48L 4AZ8A 4I4WA 4FQPA 5E6YA 4PRBA 4KJPC 5E1AA 4NZJA 1LK2A 1KCVH 5IROC 4HGKC 4KC3B 3QEUA 4M8VA 5L2KE 1NEZG 1FNGB 5BRZD 1NGXA 2VAAB 4O58H 3B9VA 2J5LC 3KYAA 4PGDA 1CLZL 4KKCC 2YN5A 3C5ZD 4ODWB 5C8JB 2MCPH 3HPJA 3DRTA 4Y5XB 5DT1L 4RISH 1WBZB 4X6CF 1YEFH 2AK1L 1MFAH 1JPSH 2P8PB 1LNUB 2R29L 1FL6A 4WCYH 2GCYB 5CD3A 4ZUVA 4FP8L 3NA9L 3AVEA 4XNYL 1T6VN 2OL3B 5AEAA 2EH8H 3QEQE 1DBKH 3JWNC 2HWZH 1G7MB 4FFVD 4PJFF 4EEEA 3TZVC 3CUPB 1A7NH 3S96B 1G7JB 4S1DC 25C8H 3D3VA 5GS0H 4PLJC 5DWUL 2YUZA 1INQB 2MKLC 3T3PF 3WJJC 2E9WA 1U8OB 4YFDB 3PWNB 3GSVA 3QWQB 3ZTNH 1IEBB 5I0DA 4LPVA 4MA7H 1MHHB 2NY5C 3GSOA 3NFNA 4PV9B 1EFXD 2EDLA 2UV3A 5D1QA 4PJEB 4L4TD 1QUNA 5J1SC 4GMSL 4JY4A 4JQXC 1T04B 2P48B 1ZHNB 1I85A 5FFLA 1WZMA 3ARFD 3PNWB 2DQIH 4NRYB 4TTDD 1O0VA 4MNQA 5IT2L 1DQTA 4M5YL 5D72H 3CMOH 4LVEA 1KPRA 5HHXH 1KJ2L 3V4VL 3BZDA 4U1JB 2R23A 3GMLA 4ZDHA 4P49A 1MUJB 4YHML 1NAMA 2Q76A 4WW2F 5ISZA 5I17B 3MRJB 4L1DA 1LVEA 2AGJL 1UZ6E 3H3KA 4CL7A 3TH3T 3CX2A 4XP5H 1CD0A 3CDYA 3NH7L 3L5XL 1K85A 1QRKA 3FFDB 3L3KA 3SJVD 5DVOA 3W39A 1LE9A 5DHYA 3DECA 3VG9B 4W4OA 3HR5A 3IJYA 4JRXA 3RGVA 5EU7C 2FRGP 3SDAD 1TJIH 4FRWA 5C07E 2ARJB 2DB8A 4UIMB 1OWRM 1P1ZA 1HNGA 5D7SH 1UJ3B 2ZOLA 2HYMA 4BELD 2DTSA 3JWOC 4ODUB 2PYFA 1RZIA 1RZKL 4H26B 4AEIL 1EHAA 5JW4M 3CC5A 5TE7H 1XF3A 4ZO9A 2LAAA 3OR6B 2DQTL 3QUZC 4N1CA 2GTWB 2NY0B 5DEGA 4DUWA 2YKLL 4Z18A 5JPNA 2I9LA 3ZTJG 5LXGH 4HGMA 4WUUD 2ATKA 3TA3A 4JCMA 1ZT7B 1ZHKB 5JR1L 4GBXD 2P24B 4C54A 3QIUB 3QUML 2Z93A 1JRHH 5F71A 2MKWA 5L6YL 3DV4A 1DEEA 2YUWA 5DFTA 1BFVL 2B2XL 4WFHE 1OSPL 5IHLB 1BVZA 3SE4A 1LQSR 4P5TD 2PTTB 4X4XB 1AY1L 1BEYL 1ADQA 5J0BA 1ONQA 2ADIA 1DQDH 5GGVL 1C5DB 2OXGA 2NLJA 3U0PB 3MXVL 3OKOB 3LS5H 3RWGB 5IESL 1AGBA 3VXNA 2EDQA 1AIFA 2VQ1B 2DQUH 1HQ4B 1G0DA 2X9XA 5CILL 4IOSD 4ETYA 1Q1JL 3NABH 4YBLC 1Z5LA 2BERA 2Z9TA 2YD3A 4G3YH 1AGEA 2VLRD 1OAXL 4H88L 4OZFH 1VGKA 2CUIA 1FVEB 2AJYL 3E0GA 3CLFL 1N3NB 2B1AH 5H35B 4LDEB 3I9GL 1X3DA 5MEND 1XH3A 1YECH 5DRNB 2XZCH 4UIKH 3RIFF 1PFCA 4Y2DA 4RZCA 3WFCL 1RK0B 1BZ7B 1IL1A 4ZFFB 1IC4L 3Q6GL 4MJIE 1DBJH 2V5RA 3BP6A 5E8DH 5HHQA 3CMGA 3WYRA 5JA8B 4LLQA 3O3EA 4JM2A 3FQWA 3BRFA 4EUPH 3W82A 4BH8A 5TH2B 3IU3B 1EXUB 5FUZH 4GAGH 2HVKA 4KVCL 5J13B 5TDNA 3DO7B 5T3XE 4K7PH 3MRGA 3QNXA 3FO0L 4UTAL 1SBSL 3O41B 1MFEL 4OM0L 5EO9A 8FABB 1MPAH 3VRJB 1KGCE 2FJFB 4HKXB 2C5DC 5A2KH 2GFBB 2YUVA 4RIRA 3MXWL 1J12A 3GSRB 3VFOB 3L5HA 4JHWL 5FO9B 1RULH 4Z7VE 1HHKA 1WTGT 3DX7A 5LWYL 2B4CH 4J3UA 4UU9A 1NCBH 5HDLA 2A77H 1NBYA 1NGWB 4F3FA 3Q3GB 5EC2A 1G1YA 3RL1B 5EOTB 4WHYH 3O6FC 3IKCA 4O2EB 2JCCA 1NMCB 2XWJA 3UPRB 3V6ZA 3VWKB 4NQDD 2DIBA 5JLZB 4NO5B 4G9FD 5CWSA 5GGSB 4APQA 3GI9L 1XF2A 5TE4L 5DMKB 3GMQA 2FGWH 2QQKH 1CL7L 1L9NA 5FUOL 1NGQL 4NNXB 1JIBA 3HCVA 5FKAA 3CPLB 4QRRB 4FABL 4EI5C 5I16A 3KWWA 4L3EA 1RJYA 2RGSA 4EOWL 4PJBF 2NXZC 2W0LA 5SV3A 2Y07L 2X42A 5C9KA 3MV7D 4GSDL 4JN1H 4W68A 1JFQH 3RY5A 4N0FB 1V7NL 1JGEA 3UTQB 4D8PA 4XHJC 5F88B 2VDLL 4RNRB 1OL0A 5TDPB 5FYJU 4YHLL 3RKPA 1H3GA 4I1NB 1ZA3A 2Y06L 5DUML 1HSBB 4KUCF 1JWMB 1LO2L 1A9BB 4LSQL 1YN6B 4JHZA 2FIKA 2CLVA 2AEPL 2XOTA 3X11B 2EYRA 1ES0A 4NWUL 2DQCH 3L1OL 3RWFA 2V5MA 4Z95L 5IBUB 4PJAB 1J05B 4L9LB 1I9JL 2GTZB 1ZE3C 2F58L 5EG6C 2AEWA 4HUUB 4OM1L 3BPCA 2YRZA 4G8IA 2PNDA 2R1YB 2D2OA 2EE9A 4KAQL 4LAQH 3EYVB 1I8MB 4JKWA 2ICEA 5ANMB 3SGEI 3CIQA 4UUJB 2PW1A 3KXFD 1IMHC 3UP1A 1EBAA 3SDXA 1PG7H 1TZIB 1FBIL 5KZCB 1QRNA 2RFXA 4OV6F 1OGAD 4KI5D 1TETL 3FHQA 2PO6A 5I1CL 4I0PC 1CXLA 3DUHA 5IIEA 5IFJA 4J8RB 5SWZE 4FG6D 3VFTA 3DHMA 2X10A 3PGFL 1WAAA 3H8NA 3K8KA 5JTWA 1L7TH 1MCNA 5DEFB 3TNMB 3JV6A 4X5WA 2X4SA 5INCA 3K2UH 4PY8J 3MBEB 1OGTB 5I8EB 3B8SA 3I84A 1UWGL 1JF1A 4WW1A 5KS9E 4G80B 2VAJA 3TBVA 1JPTL 4PTUA 5HHOD 2AI0H 2FX9L 3VDBA 2IBBA 4Z7OF 4J23A 4POYA 3TN0A 5JXAL 3MREB 2OZ4H 3NAAL 4EJ1C 3LSOB 1I7ZA 1EDQA 3TV3H 4LCWE 5EIQA 1U8MA 3CFDA 2D7QA 3WIHL 4S1QH 4WY7H 3W9EB 5DJXB 1M1SA 3FQUA 3BYYA 2GT9A 3QAZC 4DUVA 3GFUA 2NY4B 2VXVL 3EYFB 5B8CB 3PGCA 4MAYB 3WXWL 3VFWB 1PBYA 5ADOH 1U8JA 4LQFL 4KMTL 2E6PA 5DHXB 1HHGB 2A6KB 4PP1D 1DE4A 4Y4KA 4H25A 4X80H 3L3JB 3VI3E 3SKMB 5GGRB 5FYJL 3UTPE 3VXME 1HYSC 4L4VE 3W9DB 3KPLA 5FUCE 1N8ZA 1RIHL 4PJ7A 4KDWA 3OAUL 4S1SH 4TVPD 3EOAB 4NN5C 4EN3D 4ZOCA 2IBZX 2BNQB 4RDQF 5E8OB 3V6OC 4G6FB 1ZEAH 2AJSH 5E95B 3TBWA 1I7RA 1R3KB 4DQOL 1H3VA 2F8OA 3TESA 3MRMA 2OBGA 3WSQL 1MREH 4ODVL 5BCAA 3QG6A 2GQHA 3E3QE 4NHUB 1DFBL 1P7QA 4C55A 4F7MA 4OQTA 4I0KA 4OGXL 1OAQH 3UTTE 2R4RL 2DKUA 1BZ9A 3PHOB 3EYQC 2PF6A 2OM5A 3JSSA 4HS8L 1QR1B 3FQRA 2AK4D 4P46D 4YGVB 1S7VA 5TJWK 1D3CA 5I73B 4CJ0A 1OTTC 2EKSA 3T4YB 3QCVL 5CP7A 4Y5YC 2MQCA 5F7EL 2YPLE 3OKNB 3O2WL 1IGYB 4I3GA 3TPKA 2P8MA 4OZIB 4U31A 3UO1H 5CEYA 2NY0D 4GRLA 5EU4A 1M7DA 4QHMA 5HYSB 2XKSA 5DS8B 3V4PH 2UYLB 2V5SA 4YZFE 5C0ND 3L7EA 5GS1B 4ZSOA 1QSVA 4M6AA 2ZPKL 5L2KB 1SEBB 3QXAB 3GSQA 4WU5A 2OR9L 5DJ0B 3UBXB 3MRLB 3MJ7B 3SPVB 3DNKA 3DURB 3HZMA 3TT1H 4TSAH 1S9XB 4ZNEA 5DQJB 2YD4A 3L6FA 2H8PA 4KJQC 1Q9KB 2MHAA 3LZFL 1FNLA 5DHVH 1DSFL 4LDLB 2YN3A 1U2HA 2CK0L 2CLZA 1QVOB 1U42A 5L7XH 2AXJA 2DL9A 4MA8L 5K9OB 4HKZA 4YE4H 2EH7L 3CFEA 2E27L 2WK2A 3QEQB 4U6VL 2ZG2A 4P9MH 2ITDA 3KHQA 1BP3B 1F4HA 4MHHI 4YHNA 4PRHA 3BPOC 3ET9F 3ZKND 4GRWF 1KCVL 4ACPA 4PRPE 4UQ3A 4Y4FB 4O58L 3ELAT 4MXWH 1U8KA 3DMMC 1WTLA 3OGOE 4QHKI 4TSBH 2V2XB 5DK0B 3PWPE 2OJEA 1KN4L 5DVMA 4M93C 4RISL 1ORSA 3ZZ1A 4F2MB 3LD8C 4NBXB 2HTKC 1YEFL 1V5JA 4P0DA 3WFBL 4YFLF 4MD5B 4F15C 4YHOL 1BLNB 4YR6A 1AC0A 4F7CB 5D7LA 3SDDC 1T4KA 1KB9J 5FOBB 4ZOAA 1MY7A 5J4MA 1QFUH 2DTMH 5JIKA 4FQHA 4HX1B 1DBKL 1LP9E 2J8UF 2BCKB 2HWZL 3K1DA 1J10A 1CE6B 2AW2A 4G6AC 4PTTB 2B1HH 4S10A 1A7NL 2KZWA 4JKKA 1QLFB 5CD5C 3O0RL 4XAWH 1IZJA 5GS0L 1CE1H 3P73B 3L9RA 1U3YA 3FQXB 5D7IA 1IQDB 3G6JA 2GSGB 2D4DA 5T1MB 5IHZA 4WO4A 5DMGC 2FLBT 5DR5L 3VXOA 2EE2A 4MA7L 2L0DA 5F1IA 4I3RH 4WV1A 4D9RE 3EDFA 4V1DA 1A9EA 2NW3A 3U4EA 5C07B 5L0QC 1HYRC 3VFNB 3F58H 4AQ1B 5HI3C 2XNAB 3T0XA 5D1XD 5GZNC 5HYFA 5ESAB 3ZDYE 4NQTA 3CH1A 3FT3B 4PJIA 2DQIL 4ERSL 1KIRA 1NAMH 2VC2H 4NP4H 3GJFA 3CMOL 1HH6B 3Q5YA 4TUKH 4Q2ZB 4XNZB 3IF1B 5J9PB 1ZLUK 4NO0D 4OZGF 2V9TA 1BBJA 1XGYH 1E4JA 4OKVB 4RRPA 3MNWA 3MO1A 3C8DA 2WIIB 4XP5L 3TBSB 1GC1H 5IB5A 4K7PX 4QRRD 1IQWH 3RWJA 4OLEA 2WBJD 3MROA 5EU7E 1IT9L 1S7QA 3ZSTA 4AIOA 4C4KT 4P2YA 3O3UN 3C5ZA 5CJOH 4GXUN 1J0IA 2BVEA 1IC7H 1TJIL 4FQXD 5GIRA 3HE6C 5L88H 4J3XA 1AXTL 1CBVH 1XIWC 5D7SL 2DD8H 5E8NA 3GJEB 5T1LA 3VFUA 2ZUYA 1BD2D 2VDKH 4XNMB 3RZCB 4M02A 5B4MC 5ID0B 1UH2A 5JO5A 3VMOA 1DQQB 3GM0A 3MZTA 3HC3L 3MUHL 3NVQA 4M6NH 3U1SH 2A2QT 1F58H 1NDGA 2X5PA 3QDGD 4LP5A 1RZKC 1I1YB 4GW5A 4ZOEA 5LXGL 4KJWD 4CMHB 3MV11 5JDSA 3GIZH 2YMXL 4MJ5B 3TNNB 4Z7NF 1T0NB 4R4FH 3RI5K 1KT2A 3L3HA 1DDHB 5GGTL 4Z0XB 3VE0A 1IAIM 1E4WL 2JJTA 4JFXA 2A6DB 5KOMC 5INDA 5ABDE 3V5HA 4YNYB 1N0XH 4Z78B 1EEQA 4MJIB 1AHWC 1ZWIB 3H9YA 3B5GA 3KGRA 1VDGA 1G9EA 4M5ZH 4FFZL 5KZCD 3H0TB 3CVHA 1NUGA 3ARFA 4HFUH 1SEQL 3D9AH 3PL6D 4E42A 3ARZA 1UB6B 3T2QA 2YHGA 1HEZB 1MIML 2DQUL 1KELL 4U1SB 1Z2KA 5F9WC 3U36B 5KSVA 4MXQC 1QO3B 4ZQKB 4G3YL 4MDIA 4F7PA 1T66D 2G9HA 4XVSH 4L29A 4XI5D 1DN0B 3ZE1F 5T33H 5FCSH 5C0EB 4XX1G 1UT9A 2ZCLH 2B1AL 4AENA 3CFBB 3SJVA 5AYQA 4FQQB 4GT7A 3WNLA 5F9DC 3C5JA 1D6VH 4KFZC 4UIKL 4X7SL 2NW2A 4OB5H 4DVBB 2CGRL 1OF2B 2VXTL 4TUJB 1YMHA 2VDRL 2VKWA 4MAUL 3RX8A 1G0YR 5I1KL 5AYUL 1DBJL 3FN0L 5JPMB 3ARPA 5E8DL 1P2CB 3VFVA 2R2BA 1XGTB 1C8PA 5EOCL 3KG5A 3EO0A 4HLJA 4MAYD 3F7YB 1AR1D 3X3FH 4HDIA 5FUZL 1KLGB 4HJJH 1KUMA 4HV8B 4HIHB 3RDTC 1YMMA 4WUUA 4H20H 4K7PL 3MLYH 4DCQB 1X5KA 1GGCL 5I1AA 1NLBH 2N1KA 1S78C 3H7BA 2Z31B 1U3ZA 1Z0NA 2IFFH 3N1PC 1JGLL 5JHDD 3QPQD 1YQVH 4YXHH 1IVLA 2PCPB 1TIUA 3REVA 1OP3H 2F19H 3S4SA 1QG3A 4YHYB 1RULL 1MI5E 4JZNB 4B53A 4F33B 2BNQD 4R26H 2B4CL 4P5TA 4G6FD 2OXHA 1U3HC 4K71B 2A77L 4OLVH 5FO7A 3RHWF 3V9FA 1M7XA 1R6VA 2OI9B 3LDBB 5GHWH 1MHPH 1RD6A 3GKZA 4PLNC 1NEZA 1S7XB 4BFEA 1MCPL 4AH2A 3O45B 4R0LA 2OSLA 5F7DA 1N59A 1QD0A 1U8HB 4YX2H 3OJVC 3GMOB 3A6BL 1KPUB 3KYNA 1UWXH 5JZ7D 1CD9B 4HJGA 3C8HA 3MOQA 4JFFA 2FGWL 1OARH 4K3HA 3H9SE 4Z7UA 2VLRA 4BSVA 2XV6B 3HZVA 3I6KA 4ZAKC 5F1NB 4HWEH 5E5UB 3MCLL 4FHBD 2E5EA 5MENA 1D5MA 5BJTA 1FGNH 2J88H 3UEZA 1T2QH 4QRPB 2VL5A 1H8OA 4CU7A 5J11C 3CFJA 4JN1L 4Y4HC 5IBLC 3G5ZB 2JCCF 3VRLF 1CZ8H 3ROOA 43C9B 4PLKD 1XEDA 3T1FB 5JW3H 4KY1H 5A3ID 4UAOB 5IK3A 5SWZB 5AAMA 1G6RA 3NMEA 2CMRL 4KTEH 4UTBH 3O8XC 4NC1C 5T3ZH 5JMRA 2Y6SD 1XGQB 3I85A 4MGXA 5C0FA 5MEQB 5GS2H 4FS0A 5KS9B 5IVNA 4YDIH 5GZOC 1KCSH 3L5WA 3RWEB 3P4MA 3MA9H 1X5HA 1JK8B 1YEDA 4MS8D 5LAXA 3MUZ1 4RAVA 4LCWB 2VKXA 5ELIA 4F7EA 5JORA 1GRWA 2Q8BL 3QUKA 4FZEH 4GG8A 1G9NH 1BM3H 1ED3B 4Q0XH 5JXEA 4JHAH 3BKJL 4RMVA 5I1HL 1MVUB 3EO9L 3LN9A 3QIWC 3I3EA 2VISB 3E6FB 1D5XA 4Y1AA 1JTPA 1FNHA 4GAFB 1GZQB 2CO7B 4M9PA 1A3RL 3GMPB 4DFIA 1KB9K 2AQ1A 3IDIA 1BAFH 5GGSY 2KUTA 5LGJA 4G9FA 3VMNA 3VG0H 1L7TL 1M05B 1WCBA 1BVKB 3K2UL 4DAGH 3Q1SH 5H2BA 1T5XB 3JTTA 2IPTH 3VXMB 2HRPL 5EULV 5HD8C 4L4VB 2DI7A 4ZUWB 5E6IC 3SDXF 1JRHI 4RSVA 2EE6A 1W8NA 3T3ME 3MV7A 1QLEL 4UT9L 1A3LH 2ICWI 2ITCA 3QO0B 4KK8D 3EOTL 1DQLH 3B3IB 4S1QL 4KKNA 1HDMB 2NYYC 4F9PC 3NACH 3HE7D 2ATPA 2VDPL 1KLUB 4X8JB 5EC1A 1WAAF 4PJHA 1FZJA 5IVXE 1ZGLM 1T1ZA 4XP1H 1D5ZA 3L3OA 4LDOB 1A7BA 3GBLA 3JTSA 2OQJB 1A47A 4WI6A 2V2TB 2GSIB 5CJBA 5C0CE 4XP4H 4AM0B 1NBVL 4KKAD 3VD7A 2LFGA 1YYML 1S9KC 3UYRL 1A1MA 2DM4A 3K1KC 1SJEB 4PRAB 4QHLA 3BXNA 3NGBB 4FQ1H 3F12A 3V6OE 3RBGA 2YPLB 1KIQA 4IOFC 1ZHBB 1U41A 3FQNB 2BVQA 3OKKA 2X4NB 3HB3D 2GEEA 5DQ9A 3NCEB 3SQOH 2AJSL 3KXFA 4G42B 3V6FB 5IOPB 2A83A 4HS6B 4DN3H 1FFNB 1OGAA 1MREL 2WUCH 3G5VA 5E08L 4MNGB 3GSUB 4OQTH 5JW5B 5CHNA 2CDGA 3CSGA 4X7TA 3GO1H 4NZTH 5GRJH 4RGOL 3X13A 5I8KH 4RFNC 4PJ7F 3IDJA 2XQYK 3ROLA 5CSGA 4WFHD 1B90A 3ECBB 1FG2A 1T83A 4Y5VC 4HUVB 3RBSA 1A21A 3QISA 5HHOA 3STZA 3BH9B 1JWUA 4M7LH 5D7JD 2P8PA 4JQIH 3TVMC 3P4NA 3RZCD 1WSST 2R2HA 4H1LA 4JZOB 5KW9H 4PJGE 3HLAB 3AGVA 1T22A 2F54E 4HKBB 3SO3B 4RAUB 3QEHA 4JFEE 4JFDD 4I77H 3ZE2F 8CGTA 4GQ9H 3T2NH 3U6RB 1J0ZA 4JFHE 3P9LA 4H8WH 4HWBH 2QJDA 4WI7A 4OAWB 1WFTA 1OAUH 3DYPA 4LARH 1WWCA 1EJOL 2AXHA 4GG6F 4K3DL 4XPAH 3O6KH 5FDWB 4E5XA 1E4XH 2J5LB 3ZSSA 1MFNA 3QB7C 4O4YL 1I1AC 4OLWL 5JDJA 4PRPB 2X1OA 2E8YA 2VMFA 2Y7QA 1XR9A 1A0QH 1ETZA 5D4QA 4CVXB 3BP5B 4LKXB 3FQTA 3PWPB 1ZLUH 3TT1L 4TSAL 5JIHA 5DK2B 3QCTH 5C0JB 5ACZB 5DJ6A 2J6EH 4QHUB 3INUH 4POZC 4WNQB 5D2LE 1PLGH 5LCVH 4U6TA 4Z0BH 1T04A 2XIDA 3SHSA 4KZEL 3FT4A 1X5ZA 4JZJC 5F44A 4EN3A 4OD2A 4DKEH 3GMMA 3TZVB 2QBWA 3ZT6A 5BVJA 1CU4H 4H5SB 1LP9B 4NQCA 1P6AB 3VGAC 4P9ML 2XRAL 1GGIL 5BQ7A 4NRZA 1RZ7H 1YPZE 3U82B 1N5AB 4Z77A 5E7BA 1KGCD 5JA9A 2WQ8A 1TVBB 4N0CC 4XNUL 1N0LA 3IDGA 1KEGL 1G7LA 1R5WA 2F74A 3MYJA 4P2CG 5EU6D 1B4JL 3NN8A 3W81A 5C0GB 1WGOA 3U7WH 1OM3L 1BMGA 4MNHB 3RIAK 3GSNA 2LU7A 1DANT 1REIA 2AK4A 4P46A 2ARJA 1CD1B 2EYSB 3L7FA 3G9VA 1S5HB 3IXAA 5JHLH 2QQQA 4GRMB 3EYOB 5D5MF 4NT6B 3SDYL 3T77B 4JPVH 4HMEA 1MHCA 5F7UA 1KENL 4BSWB 1XMWA 1QFUL 2DTML 3ARUA 3OKLA 2F5BL 2Z4QA 1GIGH 5I66A 5E2UH 2B1HL 1KTKE 2X44D 2GITA 3GB7B 4NPYA 5DUBB 1DVFD 3WL9B 1CE1L 1D5BA 4LLWB 2OTWB 1NCCH 1RK1B 2Z31D 2XTJC 1R5VA 3OXRA 4GMTH 4RFOL 3GRWA 3VXPB 4QLRA 1EPFA 3SDCC 4ZUTA 3PP3H 3MLXH 4NRXA 4XCYB 3B9KC 4PJCE 4R7DB 3NPSC 3O4LE 3LIZH 4I3RL 1UXSB 5DI8A 5F9OH 2XZQH 3QYCA 2QR0A 1OSZA 3RVVD 3FRUA 3ULVF 4I18A 3F58L 5I15H 1MRFL 4IMKC 5CSBA 3H42H 3U2SA 3HN3A 4YHZH 2WUBH 2D9QB 1ZT4B 2H9GB 4DZ8B 3K2MC 3QUZB 5K59F 1NAML 2Q7YA 3CX5J 1RVFL 2NY3C 2VC2L 5CBAA 2KL6A 4JRYD 2EXYC 2V7NB 1R3IL 5D7IF 5DYOB 2ORBL 4U1MB 2NY1D 4LPUA 5BVPH 3DOSA 4WI4A 4HKJA 3E8UH 1GOFA 5J6GB 3OAYH 4NYLA 2BVPB 3P2TA 5CSZA 3MTRA 3C08H 1F3JB 4U6YB 4C56E 4B0MM 1GC1L 1IQWL 1N3NA 4MCZB 1LWRA 4NJAL 4QY8B 3IDUA 4G8GE 4K8RD 4WIQA 3D69A 1PYWA 3HI5H 4XNQA 5CJOL 4PJIF 4J3WA 1WF5A 4G5ZH 1IC7L 1I9IH 2X89A 3MV8E 4XCFL 2W38A 2HAZA 2VDKL 3W5NA 4U49A 1RPQA 3X14B 2HKFH 4N0RA 1I3GH 2H41A 3MUY1 4YDLC 2C3VA 4JQVC 1YY8B 3U7AA 1IM9D 4JAMA 5SWZD 4YBLB 1QBLH 1F6AA 1F58L 5IW1A 3H3PH 1XCQA 5T3XH 5F9JB 1UM4L 5CZXC 4LBEA 3SGJC 2B20A 4W70A 5F72S 4XTRC 3OKEB 2VXQL 1GGTA 4QXTA 2XN9D 2CXKA 3GIZL 3LEYH 4HIJB 3DUSB 4CVZB 4Q97A 1T0MA 4R4FL 5B39G 1QSED 3WN5C 1G7IA 5C0RH 2YRLA 4V2BA 1ADQL 3AAZB 3Q5TA 3QG7H 4LF3A 3BP7A 4LCWD 3PV6B 3IETB 5K9QI 1N0XL 1OW0A 4OD3H 3IAPA 4UT7L 4NHCL 1SY6H 2GAZB 4ONOA 1NGWA 5D1XA 4M5ZL 5EN2A 3TBTA 1FYTE 2LVCA 3HMXH 2DJSA 1Z9OA 1FV1A 3D9AL 2A0LC 4LCYA 1JGUH 3BQUC 3I02A 3UJIH 3RY4A 3SCMD 4Y16A 3QUXC 5KSBF 4A6YB 4QTIH 4K07A 4NO0A 3BESR 5CJQL 2ZUQC 3TCLA 4KDTA 5BS0E 4NFBA 4XPTH 2YXFA 3VRIA 2Z92B 3VXMD 3CPLA 3SBWA 5J7CC 3MLVH 5ETUA 5F6HI 1J87A 3HRPA 4XCNA 2WBJA 5C08D 2W60B 5EIIB 1D6VL 2WAHA 4KK5D 4OB5L 4XBEH 4XRCB 1MIEH 2CO6B 2P5EE 2C1PB 3V7MA 3PWLB 4FQXA 2HMID 3O6FB 2VH5H 3F7VA 3U83A 3VW3L 1BD2A 2BX5A 3IDNB 1S7WB 4XP9L 4XPGH 3BWAA 3VFMA 4Y19E 4GAJL 4KKBC 4J4PD 1CXHA 1IAOA 1WFUA 1XF5A 3G5YA 2Q8AL 3PXHA 3MRQB 3LPWA 4X9IA 1YN6A 1OHQA 1VFAB 3X3FL 3QDGA 3UTTD 3H9SB 3MLYL 4EI5B 2L7JA 3ZO0A 5DRXA 2NXZB 3NFPA 1P53A 3VXSE 4ELME 4QRSB 1YQVL 4HHAA 3HNSH 3I6LE 2ZJSL 1J8HE 1FNSH 3LKRB 3MGOB 4F9LC 2CKBB 3PIQA 3RL2A 2XWBB 3JV4A 3VFRB 1RZGA 3BIKB 1A7RH 4F8QA 2VLKA 1I8KB 4OLVL 2AJXH 4OI7A 5DJZA 5GHWL 2QL1A 4RQQA 1MHPL 2B4CC 4HUWB 3C5SB 4OGYH 5D6DC 1WUNT 5EU5A 3PL6A 1CLCA 2X1WL 4Q9BA 3DIFB 5FYLD 4YX2L 3AS1A 5HI5D 1WISA 3IFNL 3PDGA 2Y4SA 2ZZUT 2H6PA 2VLLB 1OARL 4S1RL 4BFGA 3WNPA 3TO2B 3EGSA 4LMQI 1AP2A 3MODH 2YPKA 4X8XA 1UVQA 5I8EA 1CICA 3EO1A 3T0WA 2X1QA 4MQXC 4HWEL 4TULH 5EZJA 3C6LD 5HHME 3RNKB 4P23C 5L9DH 1VHPA 2GKIA 2ZWLT 1S7SB 4XH2B 4CVWA 5EORL 4NNYA 1JV5B 3NZHH 1Q9OA 4PJDE 4RBPK 5FM4A 3R1GH 2CDFA 5BV7L 3KPQB 5EOQL 2R56H 2F53E 2FO1A 4I0PB 5C6PB 3TH4T 5ESVB 4Q9QH 5H37G 3QRFM 3QDME 1N64H 5JW3L 4JGUA 4I5BB 4KY1L 1W72B 3HAEA 4Z7UF 4NC1E 1JTOA 2ERJC 2JK5B 5AZ2H 3P0YL 2ZNXA 3P77B 4UTBL 5T3ZL 2X70B 3ZL4H 4EKXA 3QQ3B 4EVNB 2R69H 2V2WB 5T5NG 4OF0A 1S7TA 4DZBB 4QTHB 4CW1A 3CDGB 4RA0C 5SWSE 4YDIL 5JHDA 2ID5A 4LRIC 1E28B 5GGQH 2AV7B 3H9HB 1LEIB 1ZHLA 4X7EC 3OKMA 4N1HB 4N8VG 5E8OA 3W0WD 3TZVD 4FZEL 2QSCH 3QAZB 4KK6D 5FYKH 1BM3L 4Q0XL 1BX2B 4JHAL 4S1DD 1QZ1A 1R3KA 1FLTX 2CUHA 5JQHC 4PLJD 4ZYKA 1AD9B 5IVXB 1F13A 1DANU 1H0DB 1HH9A 3U9UB 2X4RB 1E6JL 1RJZB 1F4YL 1U36A 5DJCB 2C4XA 4MYWB 5C0CB 2HJFB 1A1OB 4IOIB 1CFNA 4G6JH 3Q1SL 4FZ8H 2FBJH 2IPTL 5CIPB 3UTOA 3DROA 2CRYA 3MRIA 4M6MH 4P2OC 1JZ6A 1HHJA 4J6RL 4NN5B 4P2RD 2X9WA 1CGSH 1CGUA 3UZVB 3VGDA 2R8SH 3ZTJH 1YEGH 1DBAH 4U7MA 5ICYA 6FABH 1U8PB 4XWOC 1A3LL 5DD0H 5F3HB 4YPGA 1ZA6A 1WT5A 4MXVE 4U1KB 4RMTA 5HGDB 5CAYB 4LIQH 4FMFA 1T1WA 2VYRE 4I13B 5GS1A 1U95A 4XP1L 2YK1L 3WUWA 1JNJA 5F1SA 4I8DA 5EBWB 3M07A 1DUYB 2NY7H 3CX5K 1FYHB 2H32B 3R06A 3SPVA 3C2SA 1FC2D 1DLHB 2LVEA 2E3VA 1A7OH 4Y5YB 5FYJE 2BY1A 2Q3AA 2G5BB 5F89A 4ZFOA 1WWWX 4Z7QF 1ZLSH 2NTSP 4FQ1L 4PJGB 3L95A 1XCTA 3FOLA 3G08A 4XB7A 2FEEL 2DLHA 4JFEB 3SN6N 3LS4L 2W9EL 5ICZA 4NBZB 4KRPD 5ECJE 5C3TA 5CMAB 2JKXA 4EDXA 3S34H 2CRIA 2NY6C 4UB0L 3VA6A 2PXYC 4JFPB 2XWTB 2VDOH 1RSFA 2WUCL 4OQTL 1KJ3H 1U9KA 4JDZA 2PW2B 2CIKA 1MRCH 1IAIL 5B21A 1UA6L 4NZTL 1CI5A 2B5IC 12E8L 4J3OC 4Q6YA 3HG1E 1TNMA 1CXKA 3O11A 4XPBH 3IVKB 4YXLH 4NZDA 1EGJA 3P11H 5BW7C 3PWVA 1IGJA 5D2LB 3V0WH 4F2MA 3BW9A 3M8OH 3LVEA 4IRJC 3WS6C 5HGGS 2APWA 1P7HL 1VKXA 2BSTB 1G1CA 5D71H 2IPUK 4ZFZB 4QF1B 1F3RB 3VGGA 1R3HA 1FL5B 4KI5F 3G04B 3FAXA 3PDDA 4GQ9L 1LILA 4YDKH 1HZHL 1EHNA 1A2YB 4X6EB 4HX1A 3GUTB 3BPOB 1CE6A 3HE7A 1EV2E 3AXLA 1CGTA 5HHNB 3CU7A 3HUJA 3TYFB 4NSKA 4FQJH 1YPZB 3S7GA 5KJRL 3DMMB 1RHHB 3PQYD 3FQXA 4LCIL 3NTCH 2I60H 3U48A 1F02I 3ILPB 4HH9B 3TH2T 4W4NA 5I30L 3T0ED 4FXKB 4M93B 4IRSC 3LD8B 1X44A 4GJTB 2YD5A 1I1FB 2J8OA 3QCTL 4NFDA 4F15B 2FJHB 2R39A 3AMLA 3INUL 3SDDB 1MNUH 4HS3A 4AEHL 2C3GA 1LDSA 2ZKHH 3NIFE 5LCVL 2XG4A 4Z76A 5IJVA 3MLTB 3NCJL 4X6CE 3P9WB 4UDUB 3S6CA 1N2RA 5DRZA 1BJ1J 1TTGA 3VXUA 3QBTB 3KPSD 2QTEA 5JOFB 5BZDB 1RZ8A 4WFEE 1R0AL 4BH7B 5E03A 3KDMA 1MLCA 2DQFA 1RZ7L 4NQEE 2BVOA 4OKVA 1IGIH 3GSXA 2ICCA 1P7KB 5DUPH 4PJEF 4LASH 3GSNH 4DGIH 3T3PE 3FKUS 3RU8H 5L0QB 3O4LB 3UXFA 4QHKJ 1KB5A 3GGWB 4CADB 1MI5D 3BH8A 5FKPA 4NO2A 4X7DC 1F4XL 5T1DL 3JWOH 1AQDB 1UCBH 2N7BA 2CSPA 4LEXL 2ZUUA 3NIGF 5D7JA 5J3HD 3RZCA 2Q86B 1NQBA 3ULUD 5DTFB 3D0LA 4C83B 3A0OA 4R4ND 4OSUL 4JFDA 1EHLH 4GH7B 4BQ8A 4JPVL 4ZUUA 3K8MA 2EDYA 1J1PL 3RX5A 2AXFB 3DX8A 3QA3A 1X5IA 1GIGL 4R7NA 3FB8B 5E2UL 2V5TA 3RGHA 3NPZB 2KQNA 5F7KC 2XTJE 3H9SD 2DKMA 2ZUSA 5CJ5A 1CYGA 3SKUD 1TQCC 3U46B 4OCMC 2DIJA 4RDQG 4GMTL 4MJ5A 1EX0A 2IADA 4MD4A 4HBCH 1DDHA 3L3IB 3WNNA 2H2SC 2VABB 4O51B 3HE6B 3LIZL 4PGCB 1XIWB 2XZQL 4RCAA 3C87A 4BFIA 1AGCB 3EOYG 2ZG3A 5DJ8B 4X99B 3MV8B 5D1QC 1CFTA 3VGBA 4UT6L 4HC1A 2JIXD 2BXZA 3F5WA 2VR4A 4ONGL 3H42L 1H5BA 2L4OA 3MNZA 4YHZL 1VFBB 2WUBL 1HKFA 4LPWA 1I85C 1F4WH 5IB2A 4GKZB 4QEGA 4X6DB 1YNTB 1X6LA 2AEQH 3CCHB 3BGFC 3D25A 3VXRB 1KXQE 4G8FB 3MV9E 3X12B 4X9GA 5BVPL 2MPAH 3PP4L 1QO3A 4ZQKA 4D0BB 1CQYA 7FABH 3C08L 2NXYD 4QOKA 1JP5A 1OPGH 1C08A 4X9HA 4H0GA 1QFWH 2AKRB 4MX7B 3CFBA 1IEAB 4EXKA 3QUMB 1FNEA 3NCFB 4W4OC 3TCXA 3DXAE 1GC1C 5EU6A 4B41A 1OAKH 1AHWB 5GGUA 4E0RB 4Z7VA 3RGVC 4YJZL 4LVHC 2Y5TA 4G5ZL 4NM8H 4YUEH 4R96A 1I9IL 4ZO7A 5JW4R 3QQ9D 4ZTOH 4HEME 1NSNH 1H9VA 1FYTB 4HULB 3IJSB 2HTLD 1JCKA 1I3GL 5F9WB 2FEEI 4N8CH 4KDVA 4YWGH 3MJ8B 2Z35B 3F7YA 4FTVB 1UKQA 4MCYA 1QBLL 3DPBA 1MRDL 4WDIA 1S8DB 4A6YH 5C86A 5KSUB 3I75A 2Y72A 2BFVH 4HV8A 2R0LL 1Z3GL 3BDXA 1H3XA 2BRRH 1DVFA 2J12B 1C12B 1GGUA 4P4RB 5BS0B 4MLIA 3TA3C 3OR7A 1TZHA 4HCRH 3GBNH 5AZEL 4RFEB 1UXWA 2GJ6A 4HXBH 2UWEE 3GHBH 4K7FA 1A4JA 1ZS8A 3TJHC 1MCFA 2WWKT 4LKCB 2HH0L 1B88A 2P5EB 1FJ1B 5E8PA 1DBMH 3CVHL 4OCRL 2GYSA 3TT3H 4X98B 5C0AA 1R3JB 1U92B 1GZPB 4P57B 4P2QA 4N9GB 5LKNA 1FG9C 3HMXL 2DLFH 4PJ5D 5FHBL 3LEVL 4Y19B 1KPVB 2W0KA 4PG9A 1TQBC 3RDTB 3I6GA 1JGUL 4JRYA 2EE3A 1ZLVK 1I4FB 1OTSC 3DX9B 3S37X 1CLOH 4AT6B 3EOBB 5C0CD 3T0DA 4NJ9H 2LABA 1TMCB 2ENSA 1HYSD 3TPUA 3F65A 2FR4B 2CIIB 4LLUB 4LLDA 3UYPA 4POUB 1E4XI 1YNKH 3VXSB 3A67L 3MLVL 4PS4L 4WUKH 4BQ9A 3RWIA 1J8HB 1JN6A 2CKBH 1U3HB 1MHEA 4Y2DC 1MIEL 3WHE0 1MJUL 1DEDA 5EPMB 4MWFB 4M1GL 3RVWC 3WS3B 3MRFA 1O7SA 1MWAA 4Q6IA 4LU5H 4PJXA 2QADC 3VI4E 5HYJD 1NCAL 2P7TA 4OUUA 5E9DE 5C6TH 4JM2C 1IM9A 3O2VH 5SWZA 3LRHA 5DD6B 4RX4D 4QRQA 4KJYA 4ZAKB 4ZXBA 1TDQA 1D9KD 1GAFL 3U0TA 2XN9A 5HHMB 3MR9B 2LV4A 1QSEA 3DVNA 5J11B 4GXVH 4Y4HB 5JOEA 1FNSL 1ZT1B 2F54D 3PGDB 2GY7B 1CLYL 4JFED 3MLUH 1JNLH 4U0QB 2IAMA 4XCEB 4HPYL 5KN5B 1FP5A 5IMOA 1HWHB 4JFHD 1A7RL 2F53B 1Y18B 1X5LA 3GSWB 3HHRB 3HC0B 3QQ4A 5C9JA 1VACA 3REWA 3MRHB 3QHFH 1LE5A 1UB5A 3HPLB 2AAVA 3O8XB 2A74B 4UDTB 1OP9A 2EDWA 3SCMA 3BN9C 5HJ3A 4APQC 4FFYH 1CTNA 2DN7A 2M8XA 5TF1L 1V3KA 5ESQA 2DF3A 5SWSB 4TULL 3T04D 1H3WM 1J9CT 4X5XA 4NO3B 4PRIE 1AGFB 4IMLB 5GJTH 4Q9RH 5C08A 1VENA 4QXGH 4ONHA 4NC2B 4NZUH 3P3YA 3D39A 4JN2B 3R1GL 4BQBA 4YAQA 2R56L 3QIWB 4CRPA 1FQ9C 4QWWC 1HILB 4FFWD 1FSKC 4XGZB 2CKNA 4LFHD 2BXYA 1A14H 1G6RL 5BV7C 4Q9QL 1N64L 3WUZA 2V6HA 1LEKA 4C4KO 1K8DB 1ACYL 2P1YA 4J4PA 5T5FH 3BVNB 3DMMD 3S37L 5CCKH 5J1TC 5IMLA 2D0GA 1U3JA 3HI1A 4KV5E 3T0AA 5JUEH 1FFPB 5TQ0H 3VDAA 2BMKB 1QNZH 1GJIA 2D03H 3ZL4L 3UTTA 1D5IH 1E27A 2I9TB 3PDOA 2R69L 2HTKD 5IB1A 1P4LA 3D0VB 3VFSB 2IGFH 1RV6X 4JEGB 5E6IB 3WEXA 5FDYA 1GPOH 3SKOB 3QUYD 3SDDD 4HIXH 4BFBD 4XBPA 1TCRB 5GGQL 1Q94B 1P84J 3QNZB 1EZVY 4IM8A 2HFFB 2UZIH 5E2VL 4ALAH 3DUUA 4LSUH 4KMQA 5FYKL 1A6AB 3C6SB 3QXWA 4YLQT 3TBYB 3K80A 3DYOA 1IGTB 3CLEH 1QSFA 2EIEA 3V8CA 2PO6C 4HGWA 4R8WH 1T20B 2EEAA 4PV8B 2DLGA 2BC4B 2FDBP 4ZPTA 3THMH 3KYOB 5F70A 2BP3A 2H32H 2I5YH 3O4LD 3G9AB 3QULA 1WJ3A 5HI3D 4G6JL 1T1YB 2FHCA 4OZ4A 3ARRA 3C6LA 1TPXC 1LD9B 5IHUH 3TN0C 1CGSL 3SY0B 2R8SL 2WWMC 1KJMA 2AEIT 3QFDA 1YEGL 1DBAL 6FABL 1S3KH 2A9NL 3DSFL 1S7UA 2ICWJ 1H15A 1MEXH 4NKMB 4OJFL 1AJ7L 1NFDA 3C9NB 4GXUM 2X4TA 4GO6B 4LIQL 1J1XH 1WBXB 2WLZA 3RUGA 4C56D 5B39A 3KPRE 3E6HB 5GISL 4CMMA 4RFNB 3S5LB 2NY7L 3HG1B 1Q0XL 2VN4A 4G8GD 2W0FA 4CVUA 2RAMA 2O61A 4Y5VB 5A40E 5F3BA 1F6FB 5J1AA 3DV6A 3WLBA 5KAQF 3GIVA 3MRPB 3TVMB 2R2EA 3MV8D 3WKNA 4ETQB 1A7OL 4HUXB 4HJ0D 4HK0B 1NGYA 4JDVA 4JO4H 4L8SA 3FO1A 3CFKB 3WCYA 5LQBL 3QJHB 5F7YC 5ID1A 3OAZH 3RVUC 1SYVB 4HUMB 3BIAX 3OB8A 2BNUB 4LSRL 1KSRA 1N5YH 3W0WA 3V95A 1NCUA 2W59A 3VH8G 2IFGA 3PWJA 5I74C 4ZUSB 3N06B 3NFSH 1W0WB 1I1AB 1QFPA 1VEMA 1F97A 2VDOL 4YDJA 5JNYA 3BHBB 4MHHG 1EEZA 1MRCL 2E7HA 4IHOA 5MI0C 3S97C 4PJFA 4E41D 3OB0K 1RURL 2YA2A 1DQJA 5EZOH 5BMFL 1J86A 4IIQA 5C7XL 4EDWL 2DLIA 1HI6B 2IANE 4XPBL 4LSDA 4YXLL 2FO4B 2BNRE 3P11L 1WFNA 2IQ9L 3FB5A 5DT1H 4PGJA 3LV3B 4LEOA 4P2RA 1D6EA 4MJ6A 4MSWB 2PR4H 2R29H 5D71L 5B38B 1FYTD 1PKQA 3ARGD 4X6CB 5AWNL 3VJ6B 2WINA 3VGAB 4FP8H 2H2PC 4JO1L 1FNAA 3MRBA 3T77A 3QWOB 4YDKL 1CIDA 4GW4B 4MXQD 1G7QA 3S88L 3TGXA 3V8OA 3LQZB 5FA3B 3MUGA 3QJFB 3T8XB 4GRLC 1ZVHA 2AP2A 4XT1C 3MRNA 3BEWB 5TQ2H 3TYGL 4FQJL 1W0VA 3UDWC 4NQEB 4JFOB 1OCWH 3QHTC 4TSCH 3CSBA 4F7TB 1BFOB 3D85B 3NTCL 5HGHB 4TNWK 5GRYA 4PRDA 4WW2A 2W91A 5KG9B 1AKJB 5GSRA 1D7FA 3KPOA 4R7DA 3B6SA 5EUOE 5MEPB 5J89A 1T03L 3NCYP 2P5ED 1EHXA 2XFXA 3FTGA 4PRNB 4TVPL 5FM5M 4GMSH 1MNUL 4D0CB 4N5ED 2ZKHL 3X3GL 5FECA 2W65B 2DWDB 2PYEE 3G5XA 2JB6A 1NDMA 1A5FL 4JANA 4G8EB 1I9RH 1UZ6F 3RWCA 4M5YH 3C60D 3QH3B 2HJKA 1ACZA 4L8CA 3I50H 4YHMH 2VUOA 4ZS6C 3TWCH 2XTJB 1EEYA 2MJWA 1V7ML 1DUZA 1BOGA 3SDCB 2AGJH 4PY7B 1IGIL 5ITFA 2X7LB 3O3DB 3B9KB 2LU4A 4R2GC 1MJJB 1K8IB 3NH7H 3L5XH 3P9MB 3NPSB 4HFWB 1NCNA 4OIAA 4LASL 3I6LD 3GSNL 2SEBA 4DGIL 2VRAA 3RU8L 1J8HD 1BVLB 1UJTA 1U3HD 3FRPG 4U6XB 2UY7A 5DMIH 3VXQB 1K5NB 7CGTA 1G7PB 3RI5F 3DSNA 3OG4B 3OKDA 3MRDB 1CS6A 3VMPA 1PZ5A 1XGUB 2NY3B 5CLTA 4LCCA 2YBRB 3KNBA 4M3KB 1OTUC 5JMOC 3OX8B 3OGCB 2OK0H 1A22B 1KIUA 3N1QC 3KLAB 3MV9B 5KSAD 2IWGA 2DQTH 4HW6A 1WITA 1WVZA 1TVDA 3D3VE 4ZAKD 4G6ML 1BWWA 4MA3B 3MACH 2BY0A 1FN4A 3FL7A 1CDCA 3HZKA 4N0UA 4P59H 4LMQE 3RVXC 3MZGB 1FZKB 3PQYA 5HHMD 5JR1H 1FO0A 4WO4C 1QR4A 2Z8RA 3QUMH 3KPPA 3BIBX 3T0EA 5DQDL 3NCMA 3DXAB 2CLRA 4HC1H 4Y4HD 5IBLD 1HSAB 4N8VA 5L6YH 2DYPD 4WV1C 2UY6A 4PGBA 1BFVH 4QYOA 2HT2D 2AJ3A 2C26A 2F53D 1E0OB 2X4PA 4A2LA 4HWZB 2AERT 4YDLB 5GGVH 1I3RB 1F4WL 3IKKA 3MXVH 4MNQE 2VNCA 3ETBF 3QDMD 5IESH 3F6LA 4K3EH 5KOVC 4L8DB 4DUXA 5FF6A 3KPSA 3O8XD 4HAFA 5ISZE 1FC1A 4M8QA 1SJXA 3O6LL 3ARBA 1NKOA 3F7QA 1MCSA 2X40A 2ZSVB 5ERWB 1AGDB 5CILH 5IR1B 4M43L 4DGYH 1RZJH 1KTDB 5GZOD 1OAXH 2DWEA 4YO0B 4ODSL 3WN5B 4D9QE 2EDRA 3HZYB 1PGRB 1QFWL 1IAKB 1U91A 3CLFH 2UWEB 2FBOJ 4LCUA 3I9GH 3LEXB 3S98A 3FFCD 1CGXA 3QZWA 2PUQT 1L4IA 1K2DB 1OAKL 1MI5A 3C5ZC 1CDJA 2ICWB 3WFCH 1X5GA 3C09C 3JUYA 3FMGH 3QIWD 3IAQA 4JFQB 1CFQA 1IC4H 2HG5B 2VXSH 4ZTOL 3BAEL 5EU3B 4EQ3A 1NSNL 3S8WA 3FT2A 3IDNA 5H94A 3EDJA 1S7WA 1VESA 3BQUB 3ESUF 1IGCL 3QUXB 5TDOB 3O6ML 1FVDA 1P84K 2I27N 3ES6A 4M61A 2ZUQB 5FB8B 4AJ0A 4A6YL 2EDFA 4FFVC 5SX4I 1JZ7A 5MHSE 3FJTA 5J12C 4BQCA 5I8CA 4LHQB 4LPYA 4PFEA 3P0GB 5I8OL 3FO0H 1SBSH 4U1LA 1MFEH 2J4WH 4TRPH 4Z7VF 3RWHA 1AE6L 4HCRL 2R0WH 2ZG1A 3GBNL 3OXSA 5KBNC 1FLRL 2FYYB 1A8JH 3VFPA 1FFOB 4P5MB 2XXCB 1HIML 3MXWH 4KK9D 1F90H 2JJTC 4JHWH 1MCLA 5IW6B 4PREB 2EIDA 3VFRA 3O2DH 2JIXA 1U8IA 4PJBA 3U7YH 1Y6NR 3HNVL 4U6HA 4MQSB 1BIIB 1P5UA 2DLFL 3ARFC 5E9DB 3QI9D 4U1NB 2FECI 1A1NA 4HIEB 4TTDC 2ZUWA 3FB6B 4ODBD 2Y36H 5A16A 4QHNB 1FL3A 4EUPB 2UVEA 5FO8A 4J1UA 3T08A 2VXUH 4NQXA 4NJ9L 1CL7H 5FUOH 1NGQH 2ICES 1F11A 3DTXB 5I1JH 3FO9B 4FABH 1A6WL 3F7RA 4IOFD 2XKUA 1T7YA 4EOWH 1S7SA 2FLRT 5LG1A 2IH1A 2DQHH 2P47B 1HXMB 2IQAB 2Y07H 1FZMB 1Y0LB 4PB0L 1YC8A 1S9WA 1AC6A 3P0VL 4BQ6A 4RAHA 1NMBL 2OP4H 2VDLH 2HFTA 1MVFA 2YD7A 4YHLH 5CJXA 3BOVA 5C6TL 5K9KA 4I5BA 5C09D 1UKSA 2A6IA 4KXZH 4JJ5B 5C3LD 3O2VL 4OZHE 1EMTL 2AJZB 5KVDL 5SWQA 3HG1D 2LU3A 1RIUL 1AO7B 1RUKL 2M2DA 4XPFL 1I7UB 5CEZH 4P23B 5HDBE 5AUMA 1JVKA 2R9HD 1CT8B 5IF0A 4NQVB 3GNMH 1OAYH 1PQZA 1X5FA 1U58B 1L0QA 4PRIB 3W2DH 1NGZA 4KRMB 1I9JH 2F58H 4GXVL 5HBBA 2CDEB 3NOIA 3MLUL 4IJ3B 5CINH 2EZ0C 1YY9C 4P5TC 5EUKA 2Y25A 4AEEA 1YQ2A 2FHBA 1CDHA 3O9WD 1FBIH 3KJ4C 3S3SA 4ZPVB 4PJ5A 5K9JL 2ERJB 1TETH 3QHFL 5I1CH 5A43C 4R0LC 1QBMH 3TIDB 4N90D 2IPKA 2O5XH 5KS9F 3WFHB 3RQ3A 3IFPB 3MRRA 3PGFH 3GMRA 3OQ3B 3H6JA 4O5LL 4POZD 4LNRB 4XPHL 1QBAA 3T1WA 4YIQB 3RWDB 4L3EE 4MD0A 4CNIB 4X6FB 3BPLC 3MMEA 1SMAA 3BGMA 5CIPA 1S7RB 2IJ0C 3RTQA 3FOMB 4LGRB 5DJYA 2FX9H 1QEWB 1JYXA 3BSZL 5GJTL 1FE8H 5JXAH 4TUOB 4QXGL 1AFVH 3NAAH 4NZUL 5I76B 5HGBA 5C0DB 3BUTA 2G75B 3C2AH 3D18B 3DRQA 5GRWA 4LL9A 3D2UB 1G9MH 3LPFA 1GSMA 3WIHH 1ZAGA 4EI6B 4WFED 1T1XA 4QGTA 1A64A 4WI5A 4WU7B 5HYJA 1IC5L 2YD2A 1DLFL 4NQED 4LLVB 1ND0B 2VXVH 5T5FL 5E8EA 4OQ1A 3WJLA 5CCKL 1TTUA 4KWUA 3QT2A 3LQAL 3VI3F 4DTGH 4MVBD 4OCXH 2AQ2A 4LQFH 5JUEL 4RX4A 4X5LA 4HIIA 2DQDL 2MOVA 4PR5B 1NC4B 4QGYA 5FV2A 2D03L 1D9KA 3MA7B 4P2OB 5T3ZE 3IGAB 4WHTA 3ZLQC 5T1KB 1A6ZB 5FYJH 1BIHA 2AQ3A 1S9YA 3T65B 2JLLA 2X4QB 1YEKH 2VR5A 1IKNA 4HIXL 1QFWI 4P4KD 1Y6MR 4OZFG 4BA8A 1QA9A 2GK0A 3HMWH 2F54A 3OAUH 4EQ2A 2HLAB 4FQLL 3SDXE 3KLDA 4ALAL 1JUFB 2EEBA 5FA4A 3JUZA 4LSUL 1QRNE 3IRPX 5JXEC 1G84A 5JOPE 3SKJL 1U8QB 3CLEL 4U1HB 2XTJD 1FGVH 4ODVH 5C0IA 4R8WL 3SDCD 3KPRB 1KG0B 5GS0D 5BXFA 2XA3A 3THML 1I8IB 5DDHA 3EFFB 1AXSA 5F1OB 2A6JB 1U8LB 3LMJL 4NUJB 3PJSA 4G9DA 1SJHB 3LN4B 3ULSA 2X4OA 1N6UA 4QCIA 2ADJA 5D9SA 2XXMB 3AREA 5IHUL 2BSTA 1T89A 2NY3D 1M71B 3QCVH 3N50A 3TJEH 5F7EH 2EXYD 5IEKB 2NY6B 1BQHG 2R1XA 1DZBA 1FL5A 2PXYB 1EJ6A 3TIEA 4D0DB 3SKNA 2EECA 4X6EA 3EDKA 3MV9D 5FXCH 2WQRA 1VERA 4MLSA 3L3DB 3V7AE 3QNYB 3QO1A 5F21B 4F58H 2B5IB 1J1XL 5ICXA 1MCWW 1B0RA 5ADPL 5ENWB 1FCCA 4LLYA 2R0KH 4JM4H 1G7HA 2IANB 1NFIB 2I07B 2HN7A 2DMBA 4ZFOL 2BNRB 4IRJB 2XPGA 4FXGB 3PHSA 3QUYA 1VSCA 1A7PL 1I75A 4XCCL 4FXLA 2ADGB 1CDIA 2DLTA 1C16A 4PUBH 4ODXA 4AIZB 4D9LL 1DSFH 5E5MB 1ZANL 1NFDF 1MLBB 2YA1A 2W9LA 4UDUA 3RIAF 4P9HC 3FO2B 2EH7H 3FB7B 2E27H 4L8BB 4LPCA 5IQ9A 3QFJD 3LKQB 5CZXD 3OJDB 2EO1A 1N6QH 4U6VH 3UAJC 1INDL 3MSPA 2B8OT 3BRDA 4BH7A 1SYSA 5EO1B 2K1MA 1KJVB 4KI5C 4PJ8C 5E4EC 3KS0J 2QQLL 2J8UA 3E1F1 1C1EH 4IRSB 4NZRH 4FG6C 3T4AA 5DJAA 5EZOL 4ELKA 2YZ8A 4PJCA 1CFSA 2HKHL 3N0PB 4JVPA 5EUOB 1MCCA 1MFDL 3QHZH 1KTLB 5IVZA 1KN4H 2WIMA 3ZDZE 2Z91B 1T83C 3V5KB 3RAJH 5F96H 2ZNWA 3LKNB 2K7PA 2YUXA 3WFBH 5MEOB 2PR4L 2PYEB 4YHOH 2W9DH 5DHVB 2FL5A 1FHGA 5MP6H 3BPNC 3V0VA 1VFOA 1T5WA 5I0ZA 1MSPA 1W2KT 4I4WB 1K4DA 4PRBB 2D31A 3MPCA 1KJ2A 4UOW0 5E1AB 2WV3A 1LK2B 1JNNL 4ZSOE 3QEUB 5TQ2L 3ALXA 3O0RH 5DMJB 2MMXA 1NGXB 2MQ3A 1OCWL 4C56A 4TSCL 2FD6H 1ZK9A 1FFRA 4OZGA 5DR5H 3HPJB 3DRTB 1P4BL 4G8GA 4ZNEE 3QXDA 1MAMH 2FNBA 1K3IA 1MOEA 2WANA 1FL6B 3MV8A 1X5XA 5CD3B 4ZUVB 5J6HA 1AQKL 4JDTL 1UM5L 2IEPA 4NQSA 1CGWA 2VIRA 4QRTA 1ZVSA 4EN3C 4ERSH 3U0WH 1I9RL 2F8VA 1LO4H 4WTZA 4PRHE 2C3WA 1U0QA 3BDBA 3D3VB 4G8FA 4CGTA 3I50L 1TQCB 3TWCL 2FWOB 2CH8A 1U93A 1TXKA 4TQEH 4R9HA 1KB5L 5I2IA 4Y88A 4E41A 3GSOB 1LEGA 3NFNB 4HT1L 5D1QB 1X4XA 1IT9H 5DMIL 3M1BB 2GUOA 4JREC 5DZNA 1QPPA 4P46C 3MCKA 2C1OA 1AXTH 5D7LE 1F3DH 2ESVD 3BGFB 2EC8A 4MNQB 3ARGA 1GOGA 1KPRB 3F6IA 1CXFA 3EW3B 4BUGA 4U1IA 3HC3H 2R23B 3BX7C 4ZDHB 1NAMB 2Q76B 5ISZB 2OK0L 1RUAH 1UENA 4X0KB 3HC4H 5K59E 32C2A 3ARVA 5I19H 2N56A 3MGTB 2Y23A 3MACL 4MQXD 1FO0H 4P59L 3G6JE 3EHBC 3L3KB 5C0NC 3W39B 4P23D 1JYVA 1LE9B 3BKMH 3BZ4A 2YMXH 4WVRA 5DHYB 3KJ6H 4F37K 3HR5B 2X4UA 4JKPH 3IJYB 4PRID 5F9AC 4ZS7L 3RGVB 5GGTH 4LVHB 5HPMA 2DQEH 2K9UA 4HC1L 1E4WH 1P1ZB 2V17H 3NA4A 2QQNL 3QIBD 3L5IA 4LSPH 3WDIA 3AU1A 4I18C 1WEJH 1M6OA 4I9WE 4PJIE 2PYFB 1RZIB 5K9QG 3V0AC 1N26A 3BE1H 1ROWA 2IBZY 4FFZH 4HSQA 4K9EH 3CC5B 3TEUA 1XF3B 1JHTA 5C0BA 4D3CH 5T5NF 4K3EL 4IEFB 1SEQH 4U3XA 5D1ZD 5DEGB 1KPVA 5FCUL 5JPNB 2I9LB 2VE6A 3C60A 3G6AA 4G43A 1MIMH 2ATKB 3O3BA 1KELH 4BK4A 3TA3B 4KMLB 4DGYL 1RZJL 3DX6A 3W11C 2Z93B 2KPNA 5E94A 4DOHB 3DV4B 1DEEB 4ELMA 2VZTA 2QKIA 4N9OB 2HT4D 1T21A 3HTLX 4K23H 2BOCA 2HVJA 3NIDE 1L6ZA 4X7SH 2NR6D 4AL8L 1ONQB 2ADIB 2CGRH 2LAGB 5TFSL 2VXTH 2NLJB 2VDRH 3D2UD 4MAUH 4MWFA 3FMGL 5I1KH 5DSCA 1IE5A 5AYUH 1AGBB 2P5WD 2GIYA 2VXSL 3FN0H 3VXNB 1TQBB 1RJLB 1AIFB 1NC2D 1EVUA 3B43A 5EOCH 1J1OH 4H1LG 2VLJD 3V4UL 1FZOA 4PJ9A 1Z5LB 5KSAA 4CN1A 1AGEB 1ZKAA 1VGKB 5I9QC 1NC4D 3WO4C 4AY0A 3HRZA 1P6FA 1HHIA 2OLDA 1E4KA 1S9VA 4G6KH 1GGCH 5T1KD 1XH3B 2J4WL 4TRPL 2R0WL 4LHUD 1JGLH 2DICA 3K3QA 1KXVC 4Y2DB 4RZCB 1RUQH 1IL1B 1F90L 2DYPA 4MQTB 3PGDA 3ULUF 4PJDA 2GJZA 3BP6B 3VH8A 4NKOA 1FRGL 1OW0C 5HHQB 2OYPA 4DN4L 3M17A 2QADB 1DBBH 2WP3T 3O2DL 4OI9A 3U7YL 5D1XC 3O3EB 4JM2B 3FQWB 2APBA 4WJ5A 1ZTXL 4BZ1L 3QDMA 2HFEA 4NIKB 4BH8B 2N7AA 1MCPH 2HVKB 3KPRD 3WE6A 5TDNB 4OZHB 1J7VR 1R5IA 3OWEA 2Y36L 5BZWA 4DGVH 5EZLA 4M7KL 1CG9A 1YJDH 3A6BH 3MRGB 3QNXB 4TYUA 4Y16C 1FORH 5EO9B 2UUDH 2VXUL 15C8L 1MCWM 1KXTB 4JY6A 2EC9T 3LPGA 5I1JL 4RIRB 3NZ8A 2JF1A 4K8RL 4NKDA 1PEZA 3MCLH 3SBWC 1HHKB 2WBJC 3DX7B 3FFCA 3K81A 3JBG7 3QWRD 2DQHL 2A38A 2G2RA 1MWAL 4UU9B 3GK8L 1NBYB 2NY6D 4F3FB 5EC2B 2PXYD 4S2SA 4FQXC 1JMXA 4UNUA 4R97C 3IKCB 4YEFA 3AM8A 1EUUA 2OP4L 2JCCB 3IU4H 3GKWL 3ZKMD 2XWJB 4NBYB 3V6ZB 2XYCA 3V5DA 1GXEA 3K74B 5HVFB 4XVUD 4YQXH 4G7VL 5CWSB 4APQB 1P4IH 5IB3B 1XF2B 3MX0A 1UFUA 3GMQB 4GFTB 3JWDH 1NCDH 1YMME 2CMRH 2I26N 3I3BA 4DJMA 2XKNA 3HCVB 2ADFL 4HWUA 4KJWC 5FKAB 4Q74A 3BWUC 5CEZL 4L3EB 4X4YA 1RJYB 4IRJD 1YC7A 3D0VA 3GNML 1OAYL 3LKOA 1QHOA 3VGEA 3W2DL 2W07A 2DMKA 3QNZA 1JGEB 1WBYA 2V7HA 4QRPE 5CINL 2BVTA 1YEHL 1FSKB 3MYZA 4DKFH 1KTRL 2IH3A 5DO2D 2Q8BH 2XY2A 5BV7B 3FZUD 1A6AA 3J7HA 5HGAA 3BMVA 1ZA3B 3BMWA 5IGXL 3BKJH 1YDPA 1XGRA 4MQ7A 5I1HH 1L6XA 3EO9H 3KLHD 3DLQR 3ARDA 3Q2CA 1M7IB 3JVGA 3QI9A 2FIKB 5FGCB 3PL6C 1T6WA 3Q6FA 5F8QC 2CLVB 1QBML 1JI2A 2EYRB 4IRSD 4JFFE 1ES0B 4HLZH 1A3RH 2O5XL 3WFEL 1OP3K 4Z7UE 2VLRE 3FRPA 3RWFB 4L3AA 1RJCA 2RBLA 1OLLA 4K7PY 4M4PA 5F7WC 3EAKA 1AI1L 3T3MF 5MENE 5E2JA 1CICC 1UZ8A 3BPCB 2HRPH 1KOAA 4G8IB 5FGRA 3TO4C 2ICEB 1FE8L 4U2ZA 1AFVL 4UV7H 2PW1B 3C2AL 2BVYA 3SDXB 2MQ0A 2JJSA 1QLEH 1SVZA 1UWXK 1G9ML 4UT9H 1QRNB 1TZGL 2RFXB 4B7LA 3EOTH 5IFAL 3HS0B 3BZEA 2RHEA 2OTPA 2NZ9C 1XGPA 1HE7A 2BRQA 2PO6B 2XQBL 2AXGA 2Y5EA 5FK9A 3WBDA 2VDPH 4YK4C 1PY4A 5IIEB 5IFJB 3STLA 5FM8A 4PGEA 5FV1L 3VFTB 5C09A 1R3LA 5D2NA 3S3JA 3DHJA 2VWEC 2OS7A 4DTGL 5HY9A 1IILE 4JVWA 3JV6B 4X5WB 2X4SB 4OCXL 5INCB 3HG1A 1ERNA 1JF1B 2P4AB 3TBVB 3LQAC 5IMKA 4PTUB 1TPXB 1NBVH 1NUFA 1F8TH 3MRPA 3TN0B 1RFDH 1YYMH 4ISVA 1Z9SA 3UYRH 1I7ZB 1T3FA 1YEKL 2ED8A 4RGNC 2E6QA 1U8MB 3HMWL 3CFDB 3SE9L 5E00A 1I7TA 43CAA 4C58B 3I2CL 3FQUB 4ENED 2GT9B 1QLRA 2B39A 1NGPH 2P46B 3FN9A 2G5RA 3F7PC 5FYKE 3D3VD 3O9WA 5FYLL 2FSEA 3PGCB 4Y1AE 4ORZC 4CAGA 1FGVL 5HYIA 2OTUA 5E08H 2WWKO 1K3ZA 2PKDA 5CFHA 3OV6A 1UADC 1MQKL 1DE4B 1DR9A 4RGOH 4H25B 4GG6A 3BUYA 5DVKA 5DD3H 4PJGF 2E9BA 4LLMA 3VWJA 3KPLB 5A2LH 1N8ZB 4PJ7B 2EDNA 1K4CB 1LMKA 3KVQA 4TN9A 5JW4Q 4JZJA 2CK2A 1TENA 2A73A 3MV7E 3S36L 4IBLT 3G6DH 4U2YA 35C8L 2VSCA 5TGBA 2EDDA 3TJEL 3TBWB 4OCSH 1I7RB 5IJKA 1LDPH 5I74B 3LRSA 3MRMB 4PJHE 3MRCA 5C2BH 1WT5C 5HXMA 4DW2H 3QG6B 5DLML 3BISA 3LKPA 4GUPA 4OGZA 1HQRA 5MI0B 3BEWA 1EJOH 1FVCA 2BK8A 4F58L 4K3DH 4NFCA 1HN1A 4NQEA 4F7MB 4MNGE 4QT5A 4P5KA 4LIQE 5E6ZA 4D9QD 4JB9L 4O4YH 4GRWH 5E2WL 3UTZA 1KCKA 4OLWH 4F7TA 1IKFH 2IG2L 3ALPA 3QIUD 5D2LF 1T7ZA 3RGVD 2R0KL 1BZ9B 4JM4L 3FQRB 1LK3L 1S7VB 1KCUH 3IDMA 1CL7I 1NBZB 3OG6B 2EKSB 4JKLA 5CP7B 3RKDC 3BD5A 5D6CA 3ARTA 3NCBB 4P4KA 4RA3A 3ARYA 4PUBL 1IM3A 4KZEH 5EDXA 3MJ6A 2P8MB 1VCAA 1YUHA 4MS8C 3KXFE 5CEYB 4UILL 1SMOA 2DJUA 4GRLB 3BKYL 1EAPA 2HFGH 3IFOA 5EU4B 4QHMB 1YPZF 4QNPF 2QHRL 1N6QL 4WRLA 1OGAE 4I48A 4O2CA 5MHSD 3L7EB 3TA3D 2XRAH 4ZSOB 1GGIH 5D5MA 3GSQB 4WU5B 1JGDA 2APVA 4NZRL 1C1EL 4KXZI 1IJ9A 4XXDA 1NKRA 4X6BA 3HZMB 4XNUH 1OT1A 1KEGH 3L6FB 2H8PB 3QHZL 3PG2A 2MHAB 4GKOA 4U0RC 1B4JH 5HHOE 1VADA 1OM3H 1PVHA 3EFDL 2DDQH 3RAJL 5F96L 3WKML 3BO8B 2CLZB 1ZV5A 3CSYA 4HKZB 3DVGA 3CFEB 2E7BA 5E4IA 4BUHA 2W9DL 3PABA 1VPOH 3WIIL 5MP6L 4R4BA 1J88A 2BSRB 2R1WA 3SDYH 2ITDB 1VB9A 1ULVA 4NQUA 3MRKA 1KENH 3MFGB 4PRHB 3C8KA 2F15A 4GW1A 2F5BH 3HE7C 1KC5L 4R2GB 4MA3A 4PJCF 4UQ3B 9CGTA 4EZMA 1UEYA 2P42B 1U8KB 1F42A 4N5UA 4RFOH 2FD6L 3HAEG 3LKSA 4QRUA 2ZCKH 5D96C 4L9DA 2OJEB 3ZE0E 1ORSB 3RVWD 1MAML 4HD9A 3ZHKA 2K7QA 4KKAC 3OTTA 1BJMA 4YR6B 1MRFH 4KKLD 2D7TL 5D7LB 1T4KB 5HVWA 4BZ2H 1UH3A 4TVPE 4JM2D 2AV1A 2Q6WB 4LSSH 4OIBA 2EC9U 1I9EA 4FQHB 3NIGE 4NQCE 1YEIH 2CRZA 1NL0H 4L8DA 4WWKA 1RVFH 2ZCHH 3QFJA 3U0WL 2VZ1A 3GEWB 1LO4L 3BP4A 3VWKD 1R3IH 4XBGA 2ORBH 1HCVA 3L9RB 5D7IB 3G6JB 1OQOA 3KPNA 2G60H 4WO4B 5IHZB 3P4OA 4TQEL 5I1DA 3VXOB 1JE6A 3CVIL 5F1IB 5BRZA 1IGML 4WV1B 2UWEA 1PKOA 1EO5A 3QXUA 4V1DB 4NJAH 1A9EB 2NW3B 3U4EB 4H0HB 1N4XL 2AK4E 1QKZL 3RNQA 4GKSA 2J1KA 1HXYA 2D4FA 5IEHA 2NTFA 4JPWH 3MOAH 3CH1B 2VOTA 4PJIB 4XCFH 2HG5A 4OFIA 4BKLA 5D7JC 5CZVH 1KIRB 4JE4B 5MERA 1IGFL 3GJFB 4AG4L 5CGMA 1UACH 3GI8H 3D1MC 5KAQG 3KYKH 5GPRA 2VITA 1RUAL 3HC4L 1BBJB 4JGMA 2EDKA 2HP4A 5I19L 3MNWB 3MO1B 1LO5B 1UM4H 2YZ1A 5IB5B 4PPTA 1FO0L 3T0BA 3RWJB 2VXQH 3QPXL 5EIVA 5EO0A 5HYSG 2P8LA 3BKML 4OZFA 3MROB 1S7QB 5KSBA 3KJ6L 1MCQA 2FYYA 1GHFL 4JKPL 3WUWG 1QYGH 5DURB 3C5ZB 5I1LA 2YD6A 4NGHH 3O4OC 3C09B 2DQEL 5GIRB 5D93C 3UBXG 1ADQH 1G6VK 1EFXA 4LSTH 5DJDA 5E8NB 5T1LB 4QWWD 3VFUB 2V17L 4LSPL 1WEJL 4UBDD 2JJWA 2EIZA 1FIEA 2YD1A 4L4TA 4UT7H 4KTYA 5JO5B 4OFDA 4NHCH 3ILQD 4ZO8A 1H5BC 3BE1L 1QFOA 1X7QA 4K9EL 2VN7A 2WNGA 1XZ0A 3LOWA 3VGHA 2Q87A 4D3CL 4CDGC 2FJGB 5IKCA 3T09A 1NDGB 1ZGLA 4ORGA 1U8NA 4GW5B 3PP3K 5J12B 1GL4B 1JWSA 5HHPA 2YEZA 1Z0MA 5CJ8A 5JDSB 3O3AA 5T3ZD 5EBMA 1BWMA 5KANG 3MBED 2NY2C 1KT2B 3L3HB 1OQXA 3VE0B 4JFYA 5GS2D 1RZJC 4JFXB 1BHGA 2YRPA 1H3UA 2H26A 4PP2A 4K23L 3B2VL 5INDB 1BQHA 3V5HB 4JFZL 1A4KB 3H3BC 1Q9WA 1INEL 3HI6L 4FQIH 4YBQD 4HH8A 3ULUL 3SDAA 1QRND 3CVHB 3ARFB 1JNHA 1WC7A 3OAYK 4E42B 3VW3H 1KNOA 2ESVA 2D7PA 4WENB 2KH2B 4MB4A 4OFPA 1PG7W 4XP9H 1J1OL 2NY4D 2YWZA 4GAJH 3KYMA 5KSVB 2Q8AH 4M9OA 4MDIB 1TJGH 2G9HB 3F8UB 4ELMF 3ZDXE 4L29B 5GRZA 5AD0A 4GAYA 2FX8L 3CJJA 1DVFC 5JQ6L 4AENB 4G6KL 3SJVB 2JJUA 3STBA 3TN0D 3C5JB 2HJLA 1BJ1H 4GBXA 2NW2B 2BJMH 1AD0A 3VCLA 4Z7WA 4PB9H 2ZJSH 1YMHB 1OAZL 1RUQL 2Q3ZA 1MAJA 4HBQA 1JPGA 2ILLA 2CDEA 5IUSA 4M6OH 3L3GA 3WV0A 3PHQA 3QIBA 3RVVC 3VFVB 3CZFA 5DA4A 2R2BB 1DBBL 2ZOKB 1Y6KR 3VXTA 3EDDA 3EO0B 4DK6A 4ZPVA 5IB4A 5D1ZA 4HDIB 3MNVA 5DRWA 3TIDA 1YMMB 4WUUB 3N1MC 4DGVL 1YJDL 1KYOK 1A6TA 1FORL 5I1AB 2L7UA 2NY1C 3IFNH 3AC0A 3H7BB 4HZLA 4FQCH 1AXIB 4S1RH 2EDOA 5L2JA 3IXTA 3K0WA 4PJDF 2DRUA 3REVB 4XMLH 3S4SB 4X7CC 4UMGA 1CF8L 5EORH 4P5TB 1JPFB 4XZUA 4K8RC 5C0DA 2YWYA 1XF4A 4WTXA 3D18A 5EFIA 3WHE1 2FIRT 1F5WA 5BV7H 3KJ4B 5EOQH 2VZUA 2YSSA 2P5WA 4Q6IC 1NEZB 3BZFA 1ITBB 3IU4L 4AH2B 4R0LB 2OSLB 5F7DB 1N59B 3SO5A 1NC2A 2ZSWA 3KYNB 3ARWA 4YQXL 4HJGB 2VLJA 1P4IL 3QDGE 5HYEA 4GKNA 4JFFB 5L2KD 2XTLA 5FAAA 3JWDL 1NCDL 4BSVB 4Z7UB 2VLRB 3P0YH 3HZVB 4MDJA 1YN7A 3I6KB 4ZXBC 3BPLB 3WHXA 3CNKA 5T1KA 5MENB 1D5MB 5EWIL 5BJTB 5IM7A 3K7UA 4LHUA 3CZJA 1NJ9A 3MJGX 2NQCA 2H2PD 3MLWH 4BZYA 4OFYD 2C7UA 3CFJB 2BY3A 1XR8A 3BDYL 2OZ4A 4Y8AA 2IAMC 2VLKE 5DJ2A 5GRUH 3WD5L 4DKFL 4GRLD 2NX5E 1MH5A 3ROOB 4ODTL 3LHPH 3QEQD 3H7LA 5HYQA 3PWUA 1CVRA 2AS5M 5IK3B 4KTDH 1G6RB 5KVEL 1CDUA 1SM3L 1II4E 4N1EA 5IP4A 1E6JH 5C0FB 1JHLL 4RWYH 4NQDA 1HHHA 3SCMC 2XY1A 4Y4FD 5LBSL 1F4YH 2NCMA 3T2PA 1ZSDA 3MUJA 3L5WB 3P4MB 3RPIA 4WFGE 5K93A 1ORQA 1YEDB 5LAXB 4J6RH 4RAVB 4F7EB 5JORB 4MXVF 3QUKB 4UV7L 1KCRL 5E2TL 4GG8B 4KK5C 2FZ3A 3BEVA 2IALA 5IEKA 4JJHA 2PXYA 4K2UL 4YHPB 4PRHD 5DVLA 3WLWD 1D5XB 1PDKA 3R0NA 4U3HA 4Y1AB 3WXVL 4YHKL 4KRNA 1G9MC 5LGHH 4R2GD 2VWEE 2NNAA 3OHXA 3IDIB 3E3QC 4I2XA 4J4PC 5K33A 5LGJB 4G9FB 1X4YA 3GMNA 1J0JA 2YK1H 3U30C 1WCBB 5CKGA 1KCLA 5DGQA 3BKCL 4L3CA 5H2BB 4R3SA 5I1EL 1OB1A 2EYTA 3JTTB 3IJHA 3WNOA 5JHDE 4JO2L 1F8TL 4RGNE 1RFDL 5C07D 1W0YT 4UQ2A 4EBQH 5IFHL 4Z5RA 3MV7B 4KQ3L 5CEXA 5GRVL 1ZOXA 2ITCB 5CBEA 3LS4H 2W9EH 2EKJA 4JLRA 1R24A 2ATPB 3MBXL 1Q0YL 5EC1B 1NGPL 1FZJB 4PJHB 3DETC 4UV4L 4UB0H 4AMKH 3D5OF 3LN5A 3ZYOA 1T1ZB 2JE8A 3RVXD 4XAKE 5GRXG 1D5ZB 1O5DT 3L3OB 5D70L 4WO4D 3JTSB 2ZUTA 4UNVA 2JELH 1IAIH 4Q9CA 1HKLH 1UA6H 1FNGA 3OMZA 5E0QA 3VGFA 2VAAA 12E8H 1EA9C 5FIEA 5DD3L 1VA9A 4X4MA 1A1MB 4FQ2L 4ODWA 4QHLB 4TNWF 5C8JA 3BXNB 4Y5XA 3F12B 4OTXH 1KIQB 3C6LC 1WBZA 4I9WD 2BVQB 1LNUA 3OKKB 2APXA 3G6DL 4W6WB 5DQ9B 2GCYA 3KXFB 4OCSL 4YGAB 1LDPL 2FEDD 4YC2C 3EYUL 2A83B 2VQTA 2OL3A 1HZHH 3EJZC 1OGAB 4PYGA 3G5VB 2LTQC 1PZUB 5C2BL 4DW2L 1G7MA 4PJ8B 5CHNB 5E4EB 1I3UA 2CDGB 3CUPA 5IWLA 4X7TB 3S96A 1G7JA 2VDMH 5KJRH 3X13B 2IBGA 1INQA 4TVSa 4LCIH 1IKFL 3IDJB 2AABL 3ROLB 1U8OA 5DURD 5I30H 4KZDL 3PWNA 3NIFF 1FG2B 1IEBA 1MHHA 1KCUL 5J8OA 4PV9A 5HHOB 1KEML 3STZB 1JWUB 5GGRY 5E1HB 5T1LD 3P4NB 2R2HB 4H1LB 4O9HL 3BD3A 4PJEA 4GS7C 1T22B 4MJID 4AEHH 4L8SC 3QEHB 4HMDA 3BPNB 3N1FC 1ZHNA 3NCJH 2DKSA 3P9LB 1OWWA 3PNWA 3PXJA 2A9ML 4NRYA 2HFGL 2DQJL 4KK6C 1BFTA 3RVTC 4E9LA 1V3JA 4E5XB 5KVMC 1R0AH 4U1JA 3UC0L 4XX1E 1MUJA 2FWOA 5T3XD 5F8RC 5I6XC 5I17A 2JB5H 3ALWA 3MRJA 2IF7A 2Y7QB 2DM2A 1XR9B 1ETZB 3MFFB 3AB0C 2YA0A 3FQTB 3FFDA 3RY6A 4IIQC 2CPCA 3CFCH 3IFLH 5F7LB 5DJ6B 2BHYA 3AMKA 4O2FB 3M1BA 2ZUVA 1F4XH 1JZ3A 3FT4B 2DDQL 5T1DH 4UIMA 3ULVH 4EN3B 4OD2B 2CRMA 2FH8A 3GMMB 4LEXH 4EIZC 4KGLA 1UJ3A 4OF8A 5BVJB 1VPOL 5HI4C 4NQCB 1YEJL 4ODUA 4OSUH 2ED7A 4H26A 5J56B 2XG5A 1J1PH 5LVEA 1YYLH 5BQ7B 3HUJE 3OR6A 4X0KA 3EUUA 2QV2A 5DF0A 4NRZB 2GTWA 2VDNL 4Z77B 3MGTA 5DVNA 4HF5L 2XQYG 1QSZA 1EBPA 3ME0A 3IDGB 4MMZC 1G7LB 1R5WB 2F74B 1ZT7A 3MYJB 1ZHKA 2P24A 4KPHL 3NN8B 3QIUA 4WW2C 5ACLA 2ZCKL 3CXHK 1Q8MA 4JREB 1GGBL 3GSNB 2AK4B 4P46B 1JPST 3L7FB 4XXCA 2XACC 3IXAB 2R0ZH 4UT6H 2PTTA 4X4XA 4BZ2L 2VLME 4ONGH 3VXUE 1C5DA 2CJUH 1MHCB 4YHIB 3GJFH 4LSSL 3U0PA 3MLSL 3OKOA 3RWGA 3OKLB 1YEIL 1NL0L 1UWEH 1YA5A 2Z4QB 4KRPC 2ZCHL 5I66B 2VQ1A 2GITB 4NPYB 1YMMD 4TOYH 1HQ4A 1D5BB 1I1RA 3I3DA 1R5VB 3OXRB 3PP4H 4HG4K 2G60L 4ZUTB 4NRXB 5IBTL 1FVEA 1XFPA 5DI8B 2Z0BA 5BOPA 3IDXL 2QR0B 5H35A 1IBGH 2BZDA 1BGXL 1OSZB 5DRNA 2EZ0D 4YXKH 3FRUB 4I18B 3LB6C 1YY9D 4QRPD 2QEJA 4RGMC 3U2SB 1MCEA 3QR2A 4JPWL 4HQQL 1RK0A 1BZ7A 3MOAL 4ZFFA 2OJZH 5CZVL 2Q7YB 4JFDE 1B0GB 1RJLA 5CBAB 3N9GL 4LCCC 5FM5O 4X6DE 1UACL 3GI8L 3KYKL 2WSKA 2GW5A 4HKJB 4JFFD 2XZAL 3VXRE 5C2UB 1UQSB 1MRDH 4NYLB 5CSZB 3ZT5A 2IC2A 5TH2A 3IU3A 1EXUA 2UWEF 3DO7A 2R0LH 1Z3GH 4NKIL 1TLKA 3PE9A 1B6UA 3O41A 2DBLH 1DJSA 4IDLA 4JY5H 8FABA 2EDXA 3VRJA 2GK2A 2FJFA 5AZEH 3D69B 1PYWB 4PYHA 4HKXA 4ODHH 4XNQB 1QYGL 4NGHL 3T0EC 1HOCB 2GFBA 2VZOA 3IDYC 1BBDL 1WZ1L 2HH0H 3GSRA 4LSTL 3VFOA 5FO9A 3K4ZA 3CVHH 4OCRH 1CK0H 1J5OL 3U9PL 2C3VB 5D8JH 3Q3GA 3RL1A 5EOTA 4JAMB 5FHBH 3LEVH 1F6AB 5ALCL 3UTSE 2XICA 5IW1B 5HDQH 4O2EA 1XCQB 4HPOH 4I0CC 4NOFA 4LBEB 1WZKA 5I9QB 4OZHA 4K9EC 3WO4B 1OT2A 3UPRA 3QRGH 1V8HA 3ARBC 4FTVE 2VJXA 3VWKA 4F8TA 4QXTB 5ALBH 5JLZA 4NO5A 2E7LA 4QOKE 5GGSA 5HDOA 2FB4L 5DMKA 1T0MB 3DGGB 4NNXA 2MFNA 1G7IB 3UTPD 1JHKL 4QRRA 3A67H 4L4VD 5EU6E 4LF3B 4PS4H 3BP7B 3QDJE 1L0XA 3AY4A 4I3SH 3QCUH 5A2FA 4FQIL 5JXED 4S0SD 3VI4F 1MCRA 1X5YA 2BSSB 5D1XB 1MJUH 5EN2B 5FGBA 3RJDA 3TBTB 4M1GH 3B8YA 4N0FA 3UTQA 2BVUA 1FV1B 5FYKD 3UCRA 1J0YA 5F88A 5J3HC 4LCYB 4Y1AD 4R6UA 3ULUC 3K4AA 4RNRA 2E9IA 5TDPA 1NCAH 4R4NC 5CGYD 4KRLB 4YFLI 3I02B 4Y16B 1HSBA 1A6UL 1JWMA 4NO0B 1A9BA 4LQ1A 4M1CC 5IB3A 2Z8VC 3TCLB 1TJGL 1RIVH 5IMMB 2Q7NA 4CN6A 3KAAA 3X11A 3VRIB 4J3TA 3UJTL 1GAFH 1J0KA 4X9FA 5ETUB 4CUCA 2GJ6E 4XCNB 1SVCP 2WBJB 1MFBH 2BJML 4RMRA 5B3JE 2CR3A 1J05A 4L9LA