1ZA6B

The structure of an antitumor ch2-domain-deleted humanized antibody
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
344
structure length
324
Chain Sequence
QVQLVQSGAEVVKPGASVKISCKASGYTFTDHAIHWVKQNPGQRLEWIGYFSPGNDDFKYNERFKGKATLTADTSASTAYVELSSLRSEDTAVYFCTRSLNMAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGG Light chain
publication title The Structure of an Antitumor C(H)2-domain-deleted Humanized Antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 324
sequence length 344
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1za6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1za6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1za6B03
2AQ3A 1GAFH 5HHPA 3NA4A 4Q74A 2FRGP 3S34L 3V9FA 4G7YH 4LLDB 3RBSA 4JR9H 3VXRB 4Y5YC 1MRDH 4R8WL 1CTNA 5EU4B 3QO1B 4MLIA 3DNKA 1V3MA 3ZL4H 3EYQC 4MVBD 2GJ6A 5B22A 4GLRH 4LGPB 3ARBA 4HWBH 5CD5D 3G5XA 3LZFL 3HRZB 4GBXC 4OFVA 4QOKA 4LCIH 4X4XB 2ZJSH 5BCAA 3WO4B 3LQAH 2XQYG 1HYSC 1DQJA 3VFRA 5I19H 3DURA 1XF1A 2XA8L 5D7JC 3CIQA 1XF5B 1HSAA 4R6UA 4PJGB 2FJGA 1KIPB 1F3DJ 4MLSA 5I1GH 3FZUC 2EIZA 1TQCC 4KKLD 5ITBL 4WO4D 1MEXH 1ZWIB 3S96A 4OIIH 1XT5A 3BH9B 3RVUC 4JQVC 3BXNB 4KK6C 3DV4A 1FIEA 2HT2D 1FH5H 3K46A 3FT2A 4NYLA 2N1KA 3JTSB 5F9WB 1PQZB 1INQA 2AK4B 3HE7D 1QO3B 1VERA 3QR2A 2DQHL 3CSYA 4LSQH 3TBYA 5GGUA 1P7QA 5CMAB 5C8JB 5C0AA 2HT4C 1IQWL 5AAMA 4ZFFB 1PKOA 4LPTA 1PD6A 3DX9B 5D7LA 43C9B 4XP6H 4MJ6A 12E8H 3IAGC 5INDA 5C0BB 1CBVL 3VRIA 1EXUB 4JFZL 1Y6MR 4QRUA 3HTLX 2HN7A 1JPSL 2H32H 5FB8A 3C8KB 4IRSA 5IJVB 4FQIL 3RNQB 4EI5C 1IC1A 1MH5A 1QYGL 5IB5A 1H9VA 5C07B 3VXPB 4R2GB 4KZEL 4MHHG 4Q6YA 9CGTA 4MCZA 3RZCA 4ORZC 2CXKA 4LLYA 2YC1A 3D3VA 1AD0B 5F88A 4MAUL 4R4NC 1MJ7H 2V5TA 2BC4A 4HPYL 1A14L 1DLHB 3NACL 7FABH 2DQJL 3DJ9A 3U1SL 5J1SC 4W4NA 4KKAC 1RMFL 5ERWB 3PV6B 4XZUA 4ZAKA 5F96L 4YDJA 4OGAD 4B5EA 1OTSC 1PX4A 2CD0A 2EDEA 2J1KA 4IIQC 3STLA 5DJ2B 3Q6FA 1ZA6B 5IB1A 3CSBA 2OXGA 3ULVH 2X4PA 2XT1B 3A6OA 5F44A 3QUXC 5KSVB 4Z0XA 1ZVSB 1NMAL 2ZKHH 2AABH 4XWGH 4OCLC 2OM5A 1W72L 1N0XL 3O8XD 2WUCL 4M9PA 3IFLH 3EUUA 2C26A 2AW2A 2O5ZL 3GB7A 4WU5A 5A2JH 4PLNC 3MXVL 1HSBA 5DFVD 3LKOA 5JIIA 1LK2A 4KUZL 5AD0B 1CLOL 3GBNH 5FUOH 2AJYL 4OZIB 4PJCE 3VFUA 3G6DL 3T0ED 2CK0L 2BNQE 4JZJA 2IWGA 3GRWL 5IWLC 4K23H 1MJ8L 3L5HA 3TP4A 4GKZA 4CMMA 4ZD3H 3RDTA 1F4XL 3TWCL 3U2SA 1QA9B 2EYSA 3ISWA 3QUYB 3GSUB 4NZRL 3SO5A 1AHWA 4KHXL 1NCWH 1CGXA 1RK1A 1YPZE 1RIUH 4LPWA 1A02N 2XPGA 3GKZA 3QUMH 2XN9E 2EDFA 4PJBB 3BPLC 4X5LA 1EFXD 4JM2C 5DK3A 3UBXB 5LXGL 2IH1A 1QLEH 4XI5C 3S7GA 4BH7A 1BBDL 3HNSH 3SOBH 5I8KL 4MD0B 5EU7E 3UTQA 4WWID 2PN5A 4L9LA 3EFDH 3BD4A 4E41B 4AEHL 3V4VL 2BFVL 4LVNB 1GHFL 1OTUD 1QFWL 2Z93A 2BDNH 5D71H 1S9XA 2YUWA 4JN1L 3D1MC 5JPNB 2R56H 3TA3A 2C1OB 4RMUA 3BEWB 1WT5C 3LB6C 4KKCD 4O2FA 5HHVH 3REWB 1I3GL 1IAIH 4XNQB 3DMMD 4KJWD 4MQTB 4YHLH 1SEQL 4NNYB 1VFAA 3QWQB 4Y4FC 4P2QE 1ULVA 3K7UA 1NAKL 5FIEA 4ELKA 3TBSB 2FH6A 3PL6B 3IRPX 3VH8A 1AGFA 3BWUC 3U0WL 3ZE1F 1EO5A 4LSUL 2E8ZA 3BKML 4W68A 4GMSL 1NL0L 4S11A 4HUNB 1PVHA 3R06B 3BPCB 3VE0B 4QCIA 1ZLUK 5CSZA 5KSAC 4PRNA 1CFSA 1YYLH 2MOVA 4YGVA 5GGSA 3ULUF 4LLWA 2GK0B 1W72B 3ARFD 2Q86B 3GNMH 3UTZB 4I77L 3B8SA 1RSFA 4P59L 3NBNA 1WWBX 3N1MC 1L0XA 4X6EA 2AXFA 2BVUA 5ESAB 5MP6L 3BEVA 3LDBB 1VA9A 5BVPL 2R0WL 1DBMH 1H15B 4TTGA 1IQDA 4LNVA 4WI9A 4ZOAA 5E5UB 2CIKB 3MRLB 3BN3B 2YHGA 2DM4A 4PGJA 5FKPB 3VD9A 3EHBC 4GAGL 3SDAA 4HLJA 1EK3A 5FCSH 4WWKD 4XB7A 1MFEL 5SX4H 1R24B 4YC2C 3JV4B 4HJ0C 4N5EC 2AQ1A 4NFBA 3THML 5ICXA 5SWZA 5I75B 4G9FA 4J8RB 4KK9D 3V8CA 3MNWB 2RR3A 1S7SA 1KNOA 1RZJL 2W9DH 2FIKA 4I3RH 5BO1L 3FAWA 1QBMH 3K2UH 3MCLH 3WHXA 1NBYB 4S1QH 3VGDA 1WWWX 4JQIH 3NAAL 2UUDH 3I50H 1H5BC 5KJRL 3EO9H 1QP1A 1ZSDA 3VRLF 2IPUG 4GRLA 1OAUH 3KS0H 4NKIL 3TJEH 3RVWD 1M7XA 4V1DA 1EIBA 2H8PB 4HC1A 3NCMA 4HUVB 4OV6F 2H1PH 4HLZG 3U0PA 2AXHA 5I16A 1VGKB 5BZWB 3KPQA 2EYTA 3KG5A 4M61A 4XNZC 4NZTH 2QBWA 1R5WB 5MEND 2GHWB 4RFNB 3IDXL 3KPSD 4JO4L 4PJIB 2DWEA 3W9EA 2N4IA 3JWOC 4RX4A 5EIIA 1FZOB 4XPTL 5HYSB 1G9MC 1PBYA 4N0FA 3OKLB 1F4WL 1P1ZA 2P5WB 2WBJC 3WFDH 1U2HA 4QRRB 3IFOB 4DKAA 5A3ID 2IPTH 1YEJH 3WHE1 2PUQT 2BNRA 1OM3L 4PJ9D 2YUXA 4U1JA 3MA9H 2COQA 1FQ9C 4L3CB 4M5ZH 1DVFD 1R3HB 4XNUH 4NQEE 1ZA3A 4OZFH 1Q9KB 3LS4L 3D2UD 3OGCB 1CT8B 4LCCB 4M48L 1L0QA 1CLZH 3PHQB 4K8RC 4PGZA 2OSLA 5DK2A 5KSUA 5DHYA 2G5RA 2F54B 3NN8B 3RIFF 2JJSA 2CSPA 2IADB 4YE4L 5H35A 5BQ7A 5D1ZD 2EXYD 4XP4H 3QI9C 4PJ7B 1JJUA 1MRFL 3OAZH 3OX8A 1MFDL 2IQ9H 2W0FB 3MC0A 1T04A 3U6RA 5EBWB 3QO0B 1A1OA 1FLTX 1SJXA 1UB6A 1JFQL 1ITCA 5DMGC 5EU6E 4N0CC 43CAB 1I9EA 1BVLB 2B5IC 5KBNC 4WFGE 4D3CL 2GSGB 5IT2L 1XF4A 3IAPA 4GRWF 4QKXB 1X5IA 5KVGL 1ZEAH 3MRHB 3G5ZA 4N0RA 1NANH 3I84A 3MRGA 3WS3A 3VWJD 1YN6A 1Q9OB 4YBLC 1BGXL 4JFEA 1HHJA 4ZSOE 3V52L 4P9ML 4JFHE 4JRYD 2Z35A 4PJ8D 3KLDA 1NDMA 2P5EB 4XWOC 1JGEB 2XWJA 4MA8L 3D25A 3F8UB 2D7MA 1AQDA 2YD9A 4KJYA 1P2CA 4PP2A 3MV7E 2FX8L 4UT6L 1H8OA 3NFPA 3TZVB 5E4EB 5IEKA 3RIAK 5DD5H 3WJLA 4PREA 4FFZH 1QFOA 4MXWL 1D9KC 3VXUD 4NRYB 3TF7C 1AI1H 1G6VK 1IZKA 5CJQL 3SJVD 2Z4QA 4JLRB 4PRAB 5GS1B 2G2RB 1ZANL 1GGIL 1DLFH 2P8LA 2OYPA 1J1PL 1NGPL 4J7RA 5FO8B 5FYLD 4ZXBC 5J12B 4HUXA 2WM0A 1MCKA 3PWPD 3MUGA 2X42A 3WMSA 1DBAL 3D39A 1U93A 4JHAH 4M00A 2ZCLL 5C0DA 5I71C 4J2XA 1YY8A 5F7EL 1IEAB 5D5MF 1WWAX 3SPVA 5EOTA 3WN5A 1KB5A 2GQHA 3VRJA 2WIIA 5CZXC 1AY1L 2W0KA 5H2BA 2VL4A 5I2IB 1DBJH 3BE1H 5F9OH 3WDHA 1N6QL 4P46C 1NGZB 3N85L 4R4BA 1QSFD 3OWEA 1FSKB 5T1LD 4MNQE 4ZS6C 2CMRL 1MSPA 1BD2B 3EZJB 1Y18A 4ZS7H 1U8MB 3U7YH 1RZKC 2PR4H 5JDSA 1GZQA 3ZE0F 5HHOA 2BXZA 3P9MB 4PJAB 1NCBH 1JF6A 2O26U 3DXAD 5IQ7L 2F74B 5FYKH 1G6RH 4RA0C 2DLEA 4PJ5B 5D93C 4DK3A 4F37F 3TN0B 4LCYA 5I1JL 3KYOA 1JRHI 3MA7A 3KLHC 3U9PL 5DJZB 3RWDB 4NUJB 4TRPH 5H8DA 4P23A 1JWSA 1XIWB 2F19H 5I1AA 5E2VL 4ODHH 1MUJB 1F6LL 1PSKL 1NFDA 2FEDD 3PWLB 4YDIH 5FECB 3GEWB 3VRLE 4M7JL 5D2NB 5EZOL 5KVDL 3RFZC 4Y1AE 5AYQA 3IXAB 3PGCB 2B20A 4Z77A 3VXSD 5EC2B 4ZO6A 4J3VA 3GSOB 4KY1H 2GTZA 2VLJA 4QHKJ 1C5DA 1OAZL 1T80A 5E56A 3QWRA 1KLFA 2AJ3B 2X4SA 2ESVB 5D1XD 2HRLA 1I8MB 3HZVA 2FWOA 2VSCA 3DX7A 3QUKA 4K71C 1IM9A 4S1DC 4MAYC 2AK1L 5GSRA 1KEGH 2VOTA 3H7BA 3KDMB 1QPPA 1HH9B 4TUOA 5JR1H 1GGUA 4QTHB 1CU4L 2DBLL 5EBLB 4GG6B 3LKNA 3NOIA 1FORH 4JFYA 3B9KA 1L6XA 3QXUA 3OKDB 3OJDB 4OLUL 1RUML 3IDJB 3ROOB 2DQUH 4Z7UE 4EN3A 2NCMA 3LN4B 2MTPA 4GO6B 4PJDB 5IB2A 1T1YA 4JFPB 4JFQB 4NRXB 2AXGB 4Y89A 4K3GA 1F8TL 3O3AA 4KHTL 3AREA 3PDOA 3SDDA 3UTSA 4H1LH 3PQYB 3WEXA 3OKOA 4X98A 4ZPTA 3BWAA 2VLRB 1G9NH 4DGIL 2FR4A 4HZLA 1BIHA 5SX5K 2D7OA 4OZHE 3V2AR 4F9LA 5L6YL 4P4KA 5E1HB 5F7HA 2WW8A 3U7AA 3V7MA 4U1HA 1CF8L 2D7QA 2NY1B 5K9KB 5A43C 3QPXH 5FGCB 2IEPA 4Y88A 1G7IB 3FN0H 2X1QA 1ADQA 1F3JB 2HLAA 4WVRA 2MWCA 4YFEA 3H6JA 4U05A 3P0VL 4X6DF 4GKOA 5IHLB 4NHCH 3OF6A 3IFNH 5EZLA 4HIEA 5JA8B 2H9GA 3OR6A 4NZUH 3O11A 5CCKH 5L2KA 1A1NA 4OTXH 3HS0A 4I1NB 3VWKB 3AU1A 3MMEA 4NKQB 4FQCH 3RY6A 1KOAA 2WBWB 3EOBA 2YD8A 1D5MA 3QG7H 2PO6C 4WW2C 2J8UE 5IOPB 5C6PB 4I18A 2QJDA 2R1XA 5E95B 5LAXA 1A5FL 1U3ZA 1V7ML 3LKPA 4U1IB 2W60A 4UV7L 2NMSA 3PIQA 3ZHDA 3OR7B 1MF2H 2VO5A 2ZUYA 1WUNT 3BGFB 3O9WC 5GRYA 3OXRA 3C60B 2BX5A 2FBJH 5IVXA 1FNSH 3VD7A 5KAQF 3FOMB 5AEAA 5E6IA 3HNTH 2APTA 2FJFB 5IR1B 3DVNB 1WAAE 3EYUL 4X7FC 2HFGH 1MLCB 3QDJD 5IMKA 1MCPL 3IDGB 2EDQA 3P4MB 3FTGA 4LSPH 1D5ZA 1GGBH 5J13C 5CZKA 3SGEH 2PW2A 4BZ2H 5IGXH 2PYFB 4U0QB 3HMXA 3HE6B 5JNYA 1KUMA 1L7IH 3RTQA 1XGYL 4PJGE 2XWBA 4KTEH 3M17B 2HYMA 3MLVL 4LRNH 2C3HA 1JHKL 2OXHA 4FG6D 3OKYA 2DTSA 3P73A 4X8XA 4XCFL 5IV2B 4LSTL 4QRPA 2E9JA 4WTXA 4BH8A 4O02L 1JNHB 1T2QL 3FQRA 2FD6H 4KTDL 2XY1A 3ZE0E 5CHNA 3P3YA 3ULUL 3RWJB 3RVXD 4U6XB 3RWEA 1U3HD 3RWCB 4GS7B 1RPQA 4QEGA 1WC7A 2P7TB 1UA6L 1YEDA 4S1RL 5IMLB 1CL7I 1LO2H 3NTCL 3ULSB 4DQOH 4B0MM 1DQML 4XVUC 5C0BE 1P4IH 5HDBF 4JFFD 2FHBA 4OGXH 4IDLA 2XOTA 5CGYD 3NCFB 3B5GA 4XAWH 3EAKA 4Y4HA 1NLBL 4N8VB 3VXRA 3RQ3A 5IIEB 2LE9A 1N2RA 3RX7A 5EU4A 4K7PX 3QO1A 1S9VB 5D7IF 5C2BL 2QEJA 3PJSB 2H45A 5DD6B 5KW9H 3HRZA 4FP8H 3MV11 5B21A 3CPLB 5SWSB 4XXDB 4CVZB 1Q94A 1OB1B 3BZ4B 4JFDA 4YUEL 5F70A 3EIFA 1XF5A 4A6YH 3I2CH 3WD5H 3MJGX 2J4WL 5CP7B 4KV5F 4OFYD 4HK3N 3U46B 3TPUB 3UJTL 2NTFA 3X3GH 1ZHNB 2HMID 1A6VH 1MQKL 2JKXA 3FN3A 5C0NC 3TVMD 1ZWIA 1CDIA 1U92A 1A7RH 1BFVH 3BH9A 1I7ZB 3LEYL 5J11C 3CGTA 3TCLB 5BJTB 2AGJH 3ZLQC 2XI9A 3RWGA 3F7RA 2Y4SA 3GJEA 4NBYB 4AEIH 4LU5L 1PQZA 3GSQB 2AK4A 1QO3A 5T3ZE 4OJFL 3PWUA 4EIZC 4KWUA 1EEQA 3FHQA 3O3BA 1HINL 5C8JA 4OZIE 3O6FA 4P5TD 4M1DL 4ZFFA 3V5KB 4M93B 4F3FB 5E7BA 4EDXB 1XZ0B 1IL1B 2NX5A 2A0LC 43C9A 3VFNA 3WFCL 2X09A 1CWVA 1ODAA 1CK0L 1LDPL 1E4JA 3QZWG 5ESVB 3HZMB 2BVEA 3C8KA 3MCG1 4M8VA 5CINL 5IJVA 4XPAH 1M6OB 3UC0L 5C07A 1DL7H 2QLVB 1U8LA 3LRHA 4XP1H 1E6JL 4XPHL 2EDJA 1TNNA 1DP0A 5GRJH 1CD9B 2EKJA 2ZUUA 5C09B 3RUGF 1NUDA 2VDKH 2IQAB 4UTAL 3NGBB 3O2WL 4AENB 3X11A 5TJWK 3WKNA 3S88H 5HYEA 4OD1H 1TVBA 5ERWA 1NUFA 4E41E 1X5LA 3LEXA 3PV6A 3MGTB 4AYFA 4Y4KD 5E08H 1BZ7A 2VDPH 2V5YA 5IROC 3ZT7A 2VSDA 4YHIA 1ZA6A 3SY0A 2GW5A 2YD7A 4OLXH 4ZUUA 1JYXA 4U1KB 4FXLA 5KSVA 3CK0L 4YX2H 3LQAC 3QUZB 4M03A 3ILPB 5HI3C 1N7MH 2VDQH 4PRPD 4TSCH 4ELMA 2EIBA 4FQHB 2EDBA 2DDQH 4PLKD 2BRQA 4RBPH 3TYGL 3HNVL 2E6JA 5IMMB 3S4SA 3S5LB 5D72H 1PFCA 5AD0A 3ARTA 4LPVA 3CJJA 2D7NA 2WAHA 3EYQD 1FFPB 2YEZB 5MENE 1JN6B 3KPSE 4GBXD 1QA9A 3VFPA 3QUYA 4AIZA 3GJFB 3FL7A 4KZDH 1YYMH 2DLIA 1HYSD 4OB5L 3OAUH 5D7JD 3NFSL 4N9GB 3LN5B 4G42A 1I4FA 4PJBA 1KIQB 3QJHB 4NCC1 5KSBB 1KT2B 3UBXA 3FZUD 4F9PA 4U7MA 4MD0A 4N0YL 3JWDH 4HF5L 3RVUD 1RZFL 4KK6D 1JZ7A 4XBEH 4GRWH 4TSBH 3V6OE 2NY5L 2F53A 5C0RH 5BRZA 3BRGC 4YXKH 5JPNA 2WQ8A 5J1AB 1R0AH 2YPLB 1YMMD 3BEWA 2GI7A 2HT4D 1RZGB 1MCLA 3RAJL 1BF8A 2DTML 2DWDB 2ZG2A 3MV01 1IJ9A 3BPNB 5CUSH 2YMXL 3CDCA 4NNYA 3T1FB 3IS0X 3BIAX 3NIGF 3U79A 1MAKA 3PL6A 3U4BL 4EI5D 1AE6L 3MLXH 4POUB 4JEGB 5T5NF 3QIUC 4NQDD 5DMJB 4JO2L 1NCAL 4L5FH 1U8NA 5L0QB 3FT4B 4R4ND 3ETBF 2I9TB 2JB6A 4UUJB 4B7IA 2GK0A 3RIAF 1W72A 1ZHBB 2XQYK 4JRYE 2Q86A 3WFBH 4XRCB 1R3IL 3HLAB 3UTZA 1PJ9A 4KKAD 5HGDA 4OCRL 3RJQB 1RK0A 4ALAH 3N0PB 2R69L 5EA0L 3IDIB 3F7PC 2BSTA 3QEUA 2UWEF 1DFBL 5A16B 4NN6B 1OTSD 1MFCL 3VXUE 4WENB 1NCCH 3JWNC 1H15A 3HUJB 1EV2E 1QSVA 1JRHH 2V17L 4PD4J 5JOEA 3QUXD 3WIIL 3GRWA 3SDCA 2RAMA 3AM8A 4HWZB 3MRLA 4W6XB 2JK5A 2WLZA 4UZGA 2RCSH 2A2QT 4P3CH 5FKPA 2NY4C 3G6JB 4IHOA 3BDXA 5C0IB 1CFNA 3BP7B 3PWPE 1IGIH 2EO9A 1YY9C 1WTLA 3JV4A 1YN7B 2BRRH 4OUUB 3VH8G 4UI2A 1NSNH 2DQDH 3KPRB 2CDFB 4E42A 1HDMA 1REIA 5EU3A 4BUHA 4OT1H 4FTVD 4OAWB 4JDVA 3DO3A 4WI5A 3MNWA 2F54E 2CLRA 2APBA 3MUHL 4S10A 3U30B 1YEGL 2CO7B 1CLYH 4M3JA 5D70L 4PJ7E 5EO9B 5IW1A 2Y5TB 2ZG1A 1K4DB 5E4IA 1NBYA 4LVHB 2AERT 3DGGA 2NW3A 3QDMD 4M43H 4G6KH 1FG9C 1S7UB 5A40E 5K9JH 2FNBA 3L5XH 1MCOH 1GZPB 2NNAB 4OM0L 5D8JL 4WEBL 1DQDL 2Z0BA 1I8LC 4JM2D 2ARJA 2VQ1B 2H8PA 3ARDB 3W5MA 3T8XB 1LO4L 2C7UB 4XI5D 3L95A 4RSVA 2BMKA 3IXTA 5I1IL 1VGKA 1BQLL 5BZWA 5DJ0B 3FONB 1J12A 4LLVB 4Y5VC 5DMIL 1I3VA 2IANE 1R5WA 1XR9B 3FMGL 1ZOXA 4PJIA 3IETB 3NABL 1D5XB 4PLOB 5JHDB 1ES0A 2V5SA 5HYSA 4OD2B 3EJZC 3ARBC 3OKLA 2XZCH 2P5WA 4FZ8L 2JJWA 4EEEA 4HDIA 4QRRA 1EHLH 2VDNH 2NLJA 1OGTB 4I0CC 3CD4A 1EFQA 3MJ6A 4G3YH 5T1KD 1A7PH 4HK3J 2JJTC 4PTTB 3RKPA 5JOPD 2KPNA 4L3CA 1Q38A 1QSEB 2ICWJ 1R3HA 4Y4FD 3VXSE 5BS0B 1RUPL 3VXOB 2X1XR 5F9JA 4LVOB 1Q9KA 4QRTA 1M7DB 2YKLL 4UB0L 3OGCA 4UINL 5I9QB 5T3ZH 3D69B 3E6FA 3PHQA 4HSQA 2PW1B 1VCAA 4NKDB 4RFOL 4PLJC 2F54A 3KJ4C 3FRUB 4P2YA 1KJMB 4HS6A 1LD9B 3A67H 2ZCKH 4XNYL 1WLHA 2ZOLA 5KSAD 4PRDA 1BLNB 2NYYC 1FZJA 1P6FA 2Y23A 1UEMA 5TE4L 2VH5L 3IRZA 3ZKXB 3LOWA 4OFDA 3QO0A 4R97C 4ODWB 1CDUA 3H8NA 1RU9H 3CUPA 1BVLA 4P9HC 5EFIB 3X17A 1Q1JL 4KRMB 1BD2E 2GSGA 4WW1B 1X44A 4HAGA 3X3FL 3IVKB 4UQ2B 5ACLA 1A6UL 3SHSA 5I1EL 1A9BB 4H8WC 4M1GL 2CJUL 3FB6A 1QFUH 3LD8B 1UGNA 4IRJB 4PJ5E 4IRSC 1LMKA 2C1PB 3EHBD 1IM3B 1CL7L 2MSPA 5L2JA 4OZFA 4ENEC 1P4LB 4HKZA 1KCVH 1A8JH 4HJ0D 4N5ED 1BJ8A 2P5EA 4YHZL 1JGEA 5GGVY 5EOCJ 3DARA 1HE7A 3RZCC 1P9MA 3P30H 1QHPA 4HK0B 1Z3GL 2ERJC 4KGLA 3QXTA 5DVMA 1RY7B 4PJXF 1HNGA 1GC1L 1G7JB 1TIUA 2IC2A 2BHZA 1YQVH 2A74B 4L3EB 3O3EA 2GK2A 4KMTL 3QFJD 4D0BB 4MSWB 1IT9H 1UKQA 3M07A 4PRAA 5GS1A 2AJSL 2G2RA 3MNZB 5F7MC 2I26N 1B4RA 5DVKA 5FO8A 4GQ9H 1S3KH 1U3YA 3HC4H 2Q87A 4OM1H 1JNLH 5MEPB 4AG4L 5GGVL 5F7KC 3B2VL 2E9BA 3BO8B 3DVFA 3T0AA 1OAXH 2R2CA 3QA3A 4ZOBA 2XRAH 2H41A 1IEAA 1NMAH 2IAMA 4N9OB 4NKMB 4XCEB 3R8QA 4LCUA 1OARH 1I8IB 3F6IA 5HSFA 3MV9D 5ADOH 4P2OA 5I2IA 2E6PA 4HXAH 4UILL 1C1EL 3T09A 1SM3H 1U8JB 1R3KB 3TBVA 4UDUA 1X6NA 2L7UA 2D9CA 1S9WA 2Y5EA 2BVQB 2F5BH 4DGYH 1BBJA 3Q5YA 5FCUL 1EVUA 4JZJC 1INEH 1OP3K 4YXHH 2CUIA 5I0DA 1F4HA 1U8MA 5JQHC 1JI1A 1HKLH 5LQBH 5FDWB 4F7MB 1BOGA 5ISZD 1T22B 4PJDE 4F57H 3P9MA 4PJAA 4DW2H 5K59F 1KJ2L 2WSKA 2F74A 2HVJA 3TGXA 3S35L 2HWZH 2YD3A 4G6ML 4EDWH 3N9GH 4CMHB 1QKZL 3PQYE 4KVCH 3RWDA 1MJUL 4AH2A 3TO2B 4G8GA 2L4OA 4NNPH 2VLRE 3KXFD 4I0PB 1XIWA 2D03H 1NJ9B 4K8RD 1GOGA 1MUJA 3P0YL 1E6OL 3FO9B 1OL0A 1UJTA 1YEKH 5DT1L 3X14B 4KU1A 4Z6AT 3D87B 3UDWA 1CGUA 3H9SD 1VENA 3FO0L 4ZTPH 4L9LC 5FYLL 5D2NA 3QI9D 4HKXB 1Z9MA 1HILB 4X4YB 1D5BA 1N6UA 5IMOB 3PGFL 3PGDB 3W0WB 3IXAA 35C8L 4L3AA 4NKOB 4KQ4L 3PGCA 4C56B 4X83A 2Q6WA 2IPUK 1U6AH 5I30L 1CXFA 2VTFA 3TA3C 5EC2A 5DMGD 3DRQB 3GSOA 4N0CD 3MRBA 5HHXH 3V6BR 4UOW1 5I8OH 4JPKL 3S9DB 5BOPA 5IFAL 2AJ3A 2ITCB 3DIFA 2ESVA 4JFFE 1I8MA 3V0VB 1MHPL 1C5BH 1MI5B 3KDMA 1U8KA 1HH9A 5DVOA 3WFHB 4FFYL 3ARGB 4PRBB 1WFNA 2ORBH 4GG6A 5EBLA 1I9IL 4JRWA 3QNYB 2Q76A 1IC5L 3T4AB 4XWOD 4BZ1L 4M9OA 3OKDA 4L4VD 3OJDA 1I9RL 5FA4B 3QJFB 1ZLUH 2HH0H 3IDJA 3W39A 1CE6B 3I9GL 4X5WA 1C12B 3LN4A 4QWWC 5CBEB 3HG1D 5I6XC 4JFPA 1S5IL 3REVA 1CFTA 4NRXA 4Y8DC 4M7ZC 3OAYK 1X4YA 4UT9H 5DRZB 1KPRB 2HJLB 4JRXB 3EFFB 4PB0L 3IF1A 1XF3B 4GMTH 2VLRA 5EH1A 4ZXBD 4G8EB 1OTTC 3ZT6A 4YBHA 1U8HB 3T4YA 2CGRH 5F6IC 5EU7C 5K9KA 3IU4L 3K0WA 4QHKI 1G7IA 1W0WB 1KJVA 1F3JA 1IAMA 4KRLB 5DMKB 1CS6A 4D0DB 4HKJB 3KLSA 1KJ2B 5GHWH 1QUNA 1SJVA 5D96C 5F6HJ 5CZXD 4JREC 1CDJA 4KJPC 1PYWB 2NY0D 2B4CL 5JHLH 5K9QG 1JHTB 2NXYC 4P46D 5GZNC 3VWKA 4U1GC 4ZS6D 4YHML 1FIGL 2OTPA 1KTLB 1IGTB 3EOTH 4NO2B 4F33B 2FATL 5JXEA 5IOPA 4RGMB 3M8OL 3MLTB 3CFJA 4S1SL 5F9DC 4OQ1A 5GISL 3QDAA 4U1IA 2O61A 4K7FB 5B8CA 3BSZH 2CH8A 1NGXA 5MEQB 4ONOA 2DJ4A 3G9AB 3QIWC 3KLHD 4YDLC 4J6RH 2CRYA 4R96B 1BM3L 1YJDH 3ZE2F 3BAEL 3FOMA 3FFDB 4NO0D 2DQTH 2DLTA 2FCBA 2ZUXA 5T5FL 3MLUH 5IR1A 3DVNA 3TEUA 2ATKB 5LGJA 4HW6A 1E4XI 3MYZA 1WITA 2APWA 4JM2F 1WK0A 5SWSE 3IDGA 4HCRL 1KTKE 3P4MA 4UT7L 1QFHA 3UP1A 2HJFB 2PYFA 3D0LB 4MA1B 3HE6A 2AJUL 3GIZL 3I6GA 3C6LB 3HMWL 4IMLA 4WFFD 1X5AA 4JPWL 4FQJH 4KDVA 2KZWA 5FHAL 1FYTD 2DJSA 5E2JA 2VXSL 2APFA 3M17A 3C2AH 2FJHB 4W6YB 4PRPE 4OFPA 3SE8L 1GYAA 2OBGA 4S1DD 4IJ3C 3M1BA 5IV2A 3I02B 2FGZA 3G04B 1G9NC 4DKEH 1TVHB 4FXGB 3LS5H 5F21B 3C6SB 3O4LD 2HJKB 4ODSH 1NC4A 4U6XA 2LABA 4HJJL 5CJ5A 1CFQA 3RWCA 1EAPB 2VDMH 5E2WL 3U9UB 3KYMB 3H42H 3LS4H 4X5XA 3RWIB 1B0GB 1N64H 1XH3B 2JJSC 5I66A 4BK5A 5IMLA 4UTBL 1ZHKB 25C8H 1FGNH 5C08D 4YZFE 1XCQA 3ULSA 5F7YC 1AFVH 5KG9B 1T1ZA 3HC0A 4LHJB 2YPVL 4FN0A 4ODTH 2VDLH 5DQJB 3H7LA 1BZQK 1TZGH 4GXVH 5IBTL 4OLZH 2ENSA 3SE9H 2XQBL 2LVCA 1BFOB 3TV3H 2V6HA 2FEEL 4WTZA 5BV7C 1T03L 2K9UA 5KVFH 2NY6C 2YPKA 2XFXB 3TH3T 3UXFA 4IMKA 4XP5H 5HHMB 1UACL 5TDOB 3U48A 2XZAL 3PJSA 2ZWLT 4Q9QH 2NY2B 4OLWL 2QQNH 3CPLA 3L1OL 3U4EB 5IQ9B 4XXDA 4CVZA 2OL3L 2QHLA 3WIHH 4DN4H 3BZ4A 1XCTA 3O4OB 1YMME 2Y36L 4YHYC 3ARVA 3WJLC 3QRGL 4H88H 4Z5RB 4XMKL 3U46A 1GH7A 3JZ7A 4M7KH 2PO6D 3F12A 5LGHH 2DQFB 4MXVE 1Z0NA 4K9EL 1AXTL 3U7WL 1WFTA 2K7QA 2O5YL 2X4NB 1I7ZA 2IF7A 4JM4H 1FAIL 3TCLA 5BJTA 3TBWB 5IFHL 5JORA 1YNLL 2IBGA 3LHPL 5DRWB 4NQDE 5IP4A 4CNIB 1JNNL 3F7YB 1X7QB 4PGCB 3O9WD 4PRIB 4NJ9L 4ZFGL 1Z9OA 1J0YA 3ECBB 4XC1L 5IW3A 3Q1SH 5J0BA 1U2CA 4DCQB 5I15L 5KVEH 3MBED 1JF5A 4F3FA 2P8PB 1WEJH 4EDXA 3GHEL 1IL1A 3SE3C 1IFHH 1UB5A 1YNTB 5JW5A 2Q20A 3O6KH 4HAFA 3MJ7B 5ESVA 3UPCA 2YK1L 3DUUA 1U0QA 2RIKA 3H3PH 2Q1EA 5KN5B 1M6OA 4A6YA 1PY4A 1Q9WB 5DD0L 2CKNA 1AJ7L 3O0RH 4WHYG 2OCFD 5A2KH 4I48B 4KTYA 4U6HB 4Q9RL 1KEML 3BQUB 4MJID 1RFDH 1RZ7L 5C09A 2UWEB 3VXMD 3MBXL 2DYPB 1BZ9B 4R7NB 3AMLA 3GMLB 1U91B 4YAQB 1FE8L 4HWNA 3LSOA 2DQGH 3CSPA 1T3FA 3HB3D 1VFBB 3WKMH 3MGTA 4FTVE 1T0PB 1TPXC 4RISH 4NPYB 5EO1A 4PB9H 1CR9H 2YPLE 5HI5D 1U95A 1RJCA 3RPKA 2J3SA 3QDJB 3GMNB 3QUZA 3DPBA 4JJ5B 1HHKA 3ZE2E 3R1GH 4YHPB 3QDGA 4XVUD 5DDHB 1MCJA 2G75A 3T0BA 1H3PH 4JAMB 5C7XL 2OL3B 5TE6H 4FQHA 4MWFB 1N26A 4HH9B 3LIZH 5IMMA 1IBGH 1YEEL 3KS0J 1XMWA 3S5LA 1LP9F 2FIRT 3V5HB 2F8VA 5F7LB 5DUML 2VR4A 5HDOA 1CQKA 2C3GA 1QRNB 4ZFOA 3S3JA 4LEXL 4P4RB 2JCCB 2PETA 4GW5B 3MLPA 1GIGH 5HYJA 2YEZA 4HX1A 3ZSSA 2L7JA 4OGYH 1JZ8A 4XPBL 2Z91B 1D6VL 4YWGL 1ED3B 2P24B 4UU9B 1DBBL 2X9XA 3QQ3B 2FLRT 2Z31B 3NIFE 4N9GA 2ADGA 2C3WA 5J9PB 2IFFH 1NUNB 2IBZX 4EN3C 3QJHA 1KXTB 5KSBA 1KT2A 1F42A 3AUVA 3LN9A 5JOPE 5C0ND 1J1OL 4KRPB 2ZSVB 3BDYL 3LKSB 3AREC 2PKDA 3G6JE 5C1MB 2X41A 2NY7H 3D18A 1A0QH 1TETL 4HUWB 1JGVL 1A7OH 5SX5H 4F9LC 3RWFA 1LO3H 3S4SG 3KPRE 1RUQH 2OK0H 1PEZA 5D6CA 2YPLA 3GI8L 1R5IB 1TTGA 4UNUA 1A3RL 4K3JH 1CGVA 1T83C 2FHCA 1RZGA 4HZAA 2QSQA 3DX6A 2VLKE 3MLWL 4WI2A 2A0LD 4FXKB 5GRVK 4JPVH 4L4TD 4Y19B 3T1FA 1ZGLP 4RDQG 2R8SL 3F7VB 3SN6N 5ID0A 5GRZA 3IDMA 1OGAB 3SCMB 4G43B 2SEBB 4NT6B 1VFOA 3QEQB 5F3HB 3ARUA 5GJTL 3QXVA 3EZ8A 4YHKL 5H37H 1TJIH 3UBXG 4AT6A 1RHFA 4X6CF 1BPVA 2XNAB 4LEOB 3DI3B 3SKMB 2UZIH 2I9TA 4UUJA 2DOCA 3D48R 4JY5L 5E8DL 2ZPKH 4DZ8B 4LCWD 3SGJA 1RHHA 3EJJX 3HE7A 4XRCA 3MXWL 3BZDA 5DD3L 3U82B 4EBQH 4XPGH 5EULV 1X5HA 2HKHL 2MJWA 1DQQB 2EH8H 3IDIA 3MOAH 2KKQA 2JE8A 2WBKA 4I3GA 2NY3C 3NPZB 3S37H 5JHDE 3K8MA 4RZCA 3NCEB 1NAMB 2Q8BH 5E6IC 5EDXA 3QHZH 3JUZA 1VFMA 1HZHL 1FVEB 3HUJA 1JVKA 4I3SL 2MPAH 4HWZA 4JO3H 4WUUB 1KCLA 3QEHA 1CE1L 5DJ6B 1F4YL 1AKJD 1G1YA 2QQLH 2A73A 3SEPA 3RGVB 3MLZH 1CXLA 1F6AB 3QAZC 3NA9H 5IB4B 3MOBH 3OQ3B 2G9HA 4KK5C 5ECJE 4QHNB 4OI7A 4ONFL 1I7RB 2DM7A 5BS0E 1HI6B 2GYSA 3A6BH 1YN7A 4OUUA 2I24N 1IEBB 3GI9H 1SBSH 5SV3A 3RTQC 3SKNA 2CRIA 2CDFA 5BZDB 1BOYA 3Q2CA 4OAWA 3U36A 5HGHB 4XVSL 3MV9E 1MHEA 3FCTB 4QXGL 4PS4H 4Z7VF 2AEQL 4OSUL 3N1QC 2Y5TA 1K4DA 1T1XB 4LPCA 1A6TB 4MQXC 4WV1B 3MRIB 1S7UA 4U3HA 5D5MA 4FABL 4KRNA 3OJVC 1GZPA 2GSIB 5LVEA 5ILTH 1JMXA 1OOAA 2PYED 3A6CL 4LARH 4MCYA 3IDYC 1FZKA 3EOAB 1J0KA 1JUFB 1N5YL 3O8XA 4RGNB 2VISB 4JHZA 3T8XA 2C7UA 5LJYH 4O4YL 2XKUA 1AR1C 2BHYA 4E9LA 4DKFL 5DJ0A 3FONA 2UY7A 5JOFB 2F9BT 4U1LB 1A7QH 1L9MA 2M26A 1S7WB 3KYKH 1D5XA 5DWUL 1XGRB 3T0EA 1FN4B 4K3DL 4CU7A 3KWWB 5I8EB 2XG5A 3AY4A 4N1CA 3ZT5A 3H9SE 1MIMH 2XZQL 4NHUB 3V4PH 3RJDA 4I2XA 2DMCA 5C2UB 3P9LB 4NBZB 1FL6B 2FO1A 1LP9E 1OGTA 4L3EE 4W4OA 3WO4C 2W07A 5IVZB 1WZ1H 3F6LA 4PTTA 4LAQH 3WJJC 1QSEA 4LQFL 1DBKL 5DEGA 5D1QB 4P2RB 3C08H 3KPPA 4YDKL 4HIIA 1EFXA 1M7DA 4ONGH 4Y16B 4X9HA 5E8OB 2ZG3A 3D69A 4WJ5B 1JZ3A 3UTTD 2VZTA 1FLRL 3O2VH 4NKDA 5T3XD 5ADPL 3FRUA 1YNKL 5EUOF 1KJMA 1LD9A 4PRHD 2A6JB 1BF2A 3UPRA 1WCBA 1BLNA 5INCA 2EEDA 2CRMA 5JMRA 4WW2F 3QXAB 5F9WC 5ALCH 4HJGB 1H0DA 1D5IH 3MUZ1 4QT5A 4ODWA 1J8HD 1IGFL 3G5XB 3MRFB 3OKNB 2KQMA 4JE4B 5EFIA 5HYSG 3JSSA 3QZWB 2UZYB 3S3PA 1CDBA 1DQJB 3IVKA 4UQ2A 3INUL 5FGSA 3AB0B 1TJGL 2ITDA 4FZEH 3SDYH 2VDOH 1KBGH 1I1CA 2NY4D 2C1PA 2FJGB 1IM3A 2W0PA 4R2GC 4KK8D 1P4LA 1YY9D 2EIZB 1E4XH 1IZJA 4LLMA 3GGWA 3RPIB 2ICWI 1OP5K 2VLME 4HK0A 4NCC2 3CFBB 5D2LB 4TN9A 3DV4B 4RIRA 5I1KH 3ARFA 4W70A 4TUKH 4NP4H 1W8NA 1G7JA 3FT2B 4NYLB 4WIQA 2A74A 3BIKB 1INQB 4L29B 4NJAH 2DLGA 2VXQH 2DIAA 4NQCD 4D0BA 1BIIB 3J7HA 1I1AC 3CSYB 2RQ8A 1GGCL 2PTVA 5JLZA 3TFKC 2PTUA 1OVZA 4X0KA 4M3KB 5IESL 2BSED 1VADB 4C56E 2OP4H 5D7LB 2YZ1A 2ZCHH 4X6DA 4ZTOL 2Q7NA 5MEPA 2VKWA 1DEDA 2KZ1B 3BO8A 1LILA 1AR2A 4QRUB 2QQQA 2NR6C 3SQOL 4XMPH 1NCDH 4DN3L 1CTOA 1MH5B 4WWKA 3BRDA 2E9WA 4NKMA 4IRZH 4XCEA 1ACYH 3MV8D 1IAOA 1MWAL 1V5JA 4LASL 1PAMA 3EDKA 3B83A 4MCZB 3D85B 4D2NA 1JPTL 3KLAB 1U8JA 4OZFG 1R3KA 4ODUB 2BC4B 2OQJB 4PJEF 4ODVL 5E9DD 1FO0H 2GJ6D 5E6YA 3PP4H 1FBIH 3EJZD 4MQSB 5AUMB 3ARBD 1VGEL 1AO7D 4F7MA 5FDWA 4TSAL 1K6QH 4XZUB 3OKEB 4ZAKB 3QUYC 2NZ9C 4TYUA 3DECA 1SEBB 2IH3B 3SGKC 5IB1B 2GJZB 1E27B 2X4PB 4NOFA 5T1DH 5FUCE 4Z0XB 1A6AB 3TO2A 1B6DA 4HBCH 3UYOD 1IC4H 4Z7VE 1LE9B 2VC2H 1NJ9A 3TIDB 1CDGA 4R90H 4UDTB 5ESQB 3W9DA 4F9PC 4PLJD 3GB7B 1P84J 2DQIL 3LKOB 4WDIB 1NCUA 1VHPA 2Z9TA 2AI0L 2NYYD 1UZ6E 4LVNC 4X4YA 5IMOA 3PGDA 2EDTA 3W0WA 3VFUB 2FX9L 5EB9A 5JW3H 4HXBH 5E00A 4NKOA 1JWMA 4MJ5B 2KBGA 2DLFH 1P7QD 4Q0XL 5C0AD 4U2ZA 1CICB 4CMMB 3RHWF 3U2SB 5DHVH 3MLSH 2DF3A 1J5OL 3AS2A 1AHWB 4PJ9A 3V0VA 5T1KB 5C3TA 1IARB 3FHAA 3GSWA 1DVFA 1MCBA 1MI5A 4DVRH 4XX1G 1PG7W 3WFHA 1ZTXH 4QXTB 1S8DB 2YN5A 5E70A 4IRSD 5C0FB 3PL6C 4Y7MA 3QNYA 4Z9KB 4NWTL 4ENED 1IE5A 2RFXA 5TFSL 2FX7L 1IKFH 2B1HH 3WO3B 3RZCD 1QR4A 2MCPL 1D6EA 4JDZB 3QJFA 4TOYH 2OZ4L 4NQVA 5CBEA 1A6PA 3P9WB 5EZJB 2Z93B 2FBOJ 3QIBD 3BKCL 3VFWA 2B0SH 3K4AA 2XG4A 5D7IA 2YWZA 1PG7H 2W91A 1KPRA 2HJLA 3CFCL 4JRXA 2YRPA 3EFFA 1MAJA 1XF3A 1KN2L 4O2FB 4LOUC 4F15B 3LDBC 3GFUA 3CVHH 4HWUA 2R4SL 3GHBH 3MUY1 2BJMH 4AIOA 4OCWL 4HQQL 3BKJH 1VFAB 4ELKB 4TVPL 3VWJA 3GKWH 2D7TH 2ATPB 1FGVL 1W0WA 5DMKA 1MREL 4GFTB 4HKJA 1KJ2A 3VGAB 3L9RA 3B9EA 4LNRB 3UJJL 1P5VA 1PYWA 4FQ2H 3JWOH 5I75C 1O7SA 2MQ3A 4QCIB 4K7PY 1JHTA 3NCBB 4PRNB 4BUGA 1P7KA 4POZC 2LTQB 1G9MH 1FDLL 1OAKH 2WQRA 4LLWB 4QHMB 3GK8L 3RA7H 4WI8A 4TQEH 3SJVA 1MFAH 5F1SA 1KTLA 1IGTA 5EIQA 3WSQL 4BSWB 4GLRI 5DEZA 5DD1L 4HBQA 5HDQL 4XCCL 4Z7WE 2VXTH 1FNHA 2MKLC 2A83B 5HVGB 3IJSB 3BISA 3PDGA 3ESVF 2ADFL 5E5RB 4EUPH 1BP3B 4Z0BH 2B1AL 1RURH 4K8RH 1NMCB 4R96A 3VXME 4K7PL 3OZ9H 5JPMB 4EQ3A 3SDAB 1BREA 3B6SB 3HA0A 4HS8L 4Y2DB 5DO2C 2J6EL 4AMKH 1FCCA 2X4TA 5F8RC 5C70A 2ATKA 3BKYL 3KYNB 1J1XH 5SWZB 2UVEA 4U1SB 4RFNC 3RUGA 1QSFA 2CRZA 1I75A 5CBAA 5T1LA 4LAJH 3OHXA 2YBRB 1S7SB 1H3WM 3GBML 5F6HI 1EJOH 3D0LA 4XTRC 1G0XA 1EBAA 2FIKB 3F7QA 3TA3D 3C6LA 5C9KA 5J3HC 4HG4J 5LWYH 3WHXB 4XPFL 1HHGA 1YEHH 3DXAA 3Q6GH 2FJHA 4IEFB 5K33A 1RD6A 1G7LB 4JKWA 4ZFZB 5TQ0L 1ZLSH 1YMHB 3VU2A 1EBPA 4JO1L 3O41B 4X4MA 4YBQC 5KS9F 1KB9J 4R4FH 3I02A 3G04A 3EYSH 2FB4H 5DLML 3DHJA 4NBXB 4GRLB 1TVHA 3MACH 3L3JA 5DFWH 4U4BA 4DFHA 4V1DB 4HEPG 4LCCC 3O6ML 4LPXA 1KCUH 3PWJA 4OIAA 5I18L 2A1WH 3F58H 3U9UA 5I16B 3K4ZA 3RWIA 1B0GA 3KPQB 4JQXA 4M61B 3MO1A 3L3KB 1KCKA 1ZHKA 4QWWD 3CLFH 3ZHKA 1Q0YH 2DWEB 3W9EB 4N90E 5KG9A 1CN4A 5EO0A 2AKRA 5EC1B 4NM8L 3F5WA 4EQ2A 3T2NH 5CEXA 4DVBA 3ILQC 2EDXA 4OCYL 2APVA 1BFOA 3ARYA 5D1XA 1OTTD 4AG4H 2A6KB 2BNRB 3T2OA 3T3PF 4NN7B 2XFXA 4C58B 1P84K 5TDOA 1RZJC 2R0LL 5BW7C 2E7CA 4HPOL 5J89A 2C4FU 4M6MH 4L8CA 5GRWA 3WXWH 2WUBL 4KPHL 4OF6A 1Z2KA 4OGZA 2OSLB 4XH2B 4OKDA 5KSUB 1LNUB 4KJPD 4MZ3A 1KIRA 4HD9A 5DHYB 5C6TL 3N06B 4XMLH 2NXYD 4PJHF 3TZVC 1P69B 5E4EC 1S9KC 5GZND 1FC2D 1B88A 1BEYH 3HG1B 3ZMRA 1RZKH 1QNZL 2XIDA 4WEUD 3VW3L 4TNWF 4L4TE 4X9BA 4YHOL 1Z3GH 5TPWH 2FECL 4AK1A 1SVZA 1C5CH 4LHUD 2DQFA 5GS1C 1MCDA 1OPGH 1UB6B 2X4NA 4P2QD 4M5YH 5DRWA 3UJIL 1A4JB 4FRWA 4N5UA 4AEEA 1EGJL 3NCJL 4CNIA 5J12C 3F7YA 1J18A 1UWGL 1X7QA 4PGCA 3QIWD 4NRZB 5KANI 4PRIA 4CN4A 1UM5H 2Y07H 5IF0B 3G5ZB 4F8TA 2D0HA 3ECBA 3MLYL 3MRGB 4ZUSB 3EYVA 3WS3B 2OR9L 1YN6B 4PJFF 2P8PA 1UWEH 1F90H 2P43B 3MJ8B 3HAEH 2JCCE 2Z35B 1YNTA 2NY0B 2V2XB 1NDMB 4NM4L 5E2TL 2XWJB 1NMBH 1AQDB 5E0QA 3CSGA 1K3IA 1EUTA 4PP2B 5IEKB 3QT2A 1PDKA 4X6CB 4XVTL 1IMHC 4RX4D 3TJHC 1FSKC 3L3HA 1Q9WA 2VDRL 5E03A 1OCWH 4TPRH 4XNMB 1OP3H 4DJMA 4YHNB 3ALPA 3ZKSD 4U6HA 2D4FA 2P8LB 3KNBA 3OG4B 3W5NA 2O5XH 1NEUA 2UWEA 3CLEL 1B4JH 2DYPA 2JB5H 1BZ9A 1LDSA 1WCQA 1IAII 4G6FD 3GMLA 3WV0A 4HUXB 3TN0C 2R4RL 1OLLA 1OLZA 3MUGB 4MJ4A 4KVNL 1VFBA 2QADB 3D39B 2H3NA 1ZV5A 1RUAL 3UCRA 2J7LA 1KC5L 4DWHA 5C0DB 1G7MB 1VKXB 1XIWC 2Z8VC 2OJZL 4YQXH 1DQLL 3DROB 3QCTL 4O2CB 4NPYA 4UIKH 2Y06H 2YRLA 3SPVB 5EOTB 1RJYB 3WN5B 1CGSH 1CFVL 2WIIB 3UDWC 3QDJA 3GMNA 4JGJA 4TULL 4A2MA 3S6CA 4KAQL 1KCRL 3MJ9L 3MODH 5D2NC 1IAIM 4C4KT 4JJ5A 2GITB 5KZCD 4R4BB 4YHPA 2W1NA 4Y19E 1JTPA 1HNFA 3GIVA 4O5LL 5ELIA 2AJXL 1OGAE 4XXCA 1FL5B 4HH9A 3HI6L 5GGQH 3QEQE 4LBEB 3V5HA 5DC9B 5IG7A 2R0ZH 2NY6D 3T3MF 1MCCA 1QTYT 4HLZH 5IEHB 4LCYB 3KYOB 1QRNA 4OZGE 3MA7B 3MGOB 2BNUA 1Q0XH 4GW5A 5KTEL 5I1CH 4M62H 4NUGL 4JFED 1MIEL 4P23B 1JWSB 4PG2A 5AZEL 5I1AB 1ERNA 3MLRH 1U3HA 2P24A 4UU9A 4X80H 1PEWA 3QQ3A 5A2IH 3VA6A 3BJ91 5DUPH 5J9PA 3BD3A 5JUEH 1GJIA 1MRCL 3VGHA 1NKRA 1JZ2A 1N59A 4CW1A 1OHQA 4WUUE 3OAYH 4Z77B 5IW6B 2V2WB 2X1WL 3LKSA 4RMRA 5C9JA 5CZVH 4OBSA 2GTZB 2VLJB 1CYGA 2X1PA 3T77A 1FNFA 1N4XH 3TT1L 1TQBB 1LO0L 2NPLX 4MXQC 1JYWA 4HUWA 2X4SB 4YFLF 4Q6IA 3UZQA 3S5LG 5GSRB 1MPAH 2ZZUT 4Z95H 2VLLB 2KH2B 4DOHB 4NGHH 2NY1C 4TUOB 3WFEL 4OZ4B 3LKNB 4DAGH 4JFYB 1JZ5A 2JELL 3B9KB 4JN2B 1N3NB 4IBLT 3UYRH 4FXKA 3S98A 4OD3H 4LKCB 1J87A 1YDPB 3F7VA 5ITFB 3DHMA 4AL8L 2J8OA 4EVNB 3LEVL 5L9DH 2SEBA 4OFYA 3AMKA 3VWKC 3QEQA 4YFLI 5F3HA 1LQSR 1T1YB 3ALWA 4WFGD 4FQ1L 3VGGA 1RQ5A 4C4KO 2EDHA 3JXAA 3RU8H 3FB5A 1UYWL 3HZYA 3TVMA 5DC0A 1TZHB 5JXEC 3LV3A 2BXYA 2MFNA 3C8DA 3PDOB 5HHOD 1MCFA 3WEXB 4X98B 3SKMA 4DZ8A 3UMTA 4JFHD 3BGFC 4P4KB 4X7DC 5EOCH 4U1HB 5IHUH 3C60C 4ZNEE 1ZVHA 5LCVH 4P5TA 3NPSB 5CEZL 4ETYA 3MV7D 3MBEB 5E8PB 1JPST 1L7TH 1YEFH 4DTGH 4NQCE 4U6VL 4HFUL 4Y5XB 4LFHG 1MCWW 3QBTB 4FQXB 2ZUVA 4HIEB 1MFBH 3OR6B 5DJ6A 1TJHH 5HHNB 4WFED 1A1NB 3HS0B 4JZOB 2VR5A 1JTTA 1SY6H 4PJXA 4R26H 3AU1B 4G6JL 4QHNA 1I7RA 5JQ6H 3EOBB 4HWEL 1ZT7A 1HI6A 1D5MB 1IAKB 2E27L 4P2RE 3UO1L 3HE6C 5DC4B 3ZHLA 4I18B 4MJIB 2B8OT 3V0AC 5BZDA 1E4WL 5LAXB 2H6PA 1CXIA 2BOCA 4QXUH 1KIUA 4YPGA 5CSGA 3PIQB 3GMRA 2E8YA 1KULA 5GS0L 3ZYZA 1IM9D 4HUUA 3WE6B 3FCTA 5DYOA 1FVDB 5E1AB 2I5YH 1HIMH 3OXRB 1GPOL 4QTIL 1NANI 1T1XA 3E6HB 1RZIA 3MRIA 2CKBL 5CIPH 1A6WL 2GJ6E 3KR3L 4MNQD 4GJTB 3RBGA 4GS7C 5FM8A 3WNKA 1KPVA 1QLFA 4XCNA 4QOKE 1B2WL 4UNTA 4Q97A 1EUUA 1NGQL 2DS4A 3EOAA 4EN3D 1JUFA 1GAFL 2CXGA 4G7YL 1AQKH 2VISA 1D5ZB 4JR9L 4PJEB 4YO0B 3WL9B 1MRDL 2PW2B 2M1KA 3ZL4L 3UTSD 3ARED 3ZDXE 5DZOA 2N7BA 4LSSH 4XGZA 4XNXH 5GGTH 5MI0B 4F58H 5JOFA 2XWBB 4HWBL 4U1LA 3LPGA 3VGBA 1NGYA 1XGRA 1FN4A 2WINA 4LCIL 3KWWA 3HI1A 2ZJSL 4IMKC 1YPZF 1F2QA 3LQAL 4NHUA 2BSSA 5I19L 1M7IB 4QRPB 1JI2A 1X4ZA 3U83A 4GBXA 3FQRB 3P9LA 1FL6A 5CHNB 1CD0A 3RWEB 4Y1AD 2IJ0C 3ZZ1A 3OF6D 4G80A 1JMZA 5C0AE 2CLZA 5I1GL 3GSRB 1OF2B 1WC7B 5D1QA 5L2KD 4K3EH 3BZFB 1YEDB 5FFLA 5ICYB 5HYIA 1MEXL 2Z8RA 4OIIL 4Y16A 1XGQB 2NXZB 4OQTH 5D7LE 4WJ5A 1FH5L 1RVFH 1W0VB 2GUOB 2VQTA 2OMNA 2IGFH 4JQVA 4MB3A 2A6JA 4LSQL 2E3VA 3LQMA 4Y4HB 1UH2A 1N2RB 1NBVH 3QXAA 4HJGA 3LPFA 4QGYA 1CXHA 4XP6L 12E8L 4LVEA 3D3VE 1A7NH 4X99B 2NY3D 3MYJA 4PGBB 2VXVH 2UY6A 3MRFA 5GGRY 3OKNA 4B53A 5FAAA 1RULH 4M93C 5E6ID 1F4AA 1Q94B 3QZWA 4JFDB 4YIQA 4JG1H 4LIQE 2E7LA 4F2MB 4HHAB 1E4KA 1NBZB 4MNGA 4KK5D 2VITA 1KCSH 2CKBB 3I6KB 1MJ7L 5HGAB 2NTFB 1IGCH 4QF1B 1YECH 4V2BA 4QXWA 2H2SC 3RPIA 3RTQD 7FABL 5DQ9B 3SDXB 1U92B 3CFBA 3WCYA 2XTJB 5D2LA 3WXVH 3QCVH 2A9MH 2AS5M 1UEYA 4LCWB 3RWGB 3GJEB 2IG2H 3NGBC 1G9EA 3BIKA 2ED7A 4L29A 2ENYA 1BIIA 3PABA 3PWUB 3ULVL 4M7LH 1HXMB 3O3BB 4D9RE 3VXTB 4IIQA 4HS3A 4TTDC 2ZKHL 3O6FB 4MQXD 2AABL 4XWGL 4C57C 3EOYG 1VADA 1Z6JT 2NX5B 3QUXA 3VFNB 1J0JA 32C2A 3IFLL 1E0OB 4BFEA 3JVGC 3WNMA 1X9QA 1AKJB 5C0CB 3QUZC 3JTTB 3UX9B 4CN1A 4U3XA 4OV5B 1XF2B 4N68A 1AR1D 1U8LB 3GBNL 4KQ3H 5FUOL 1MAMH 1WWCA 1JYVA 3O2DH 4Y8AA 5HPMA 2OS7A 3D85A 4K23L 3KLAA 5F1IB 4Z78A 5CILH 1Q9LA 4ZD3L 1AXSA 4QHLB 4ODUA 5GXBB 2OQJA 4CBPA 4HGWB 2OI9B 5TF0A 4DUWA 5FHBH 3X11B 3ZKMC 5AUMA 1NAMH 1NCWL 4WI6A 1MCQA 5HGBB 4UV4H 1TVBB 2ID5A 3LEXB 4C55A 3TH2T 1KENH 1RIUL 3QHFH 3OKEA 1BZ7B 1HHIB 3OJ2C 3QDMA 4URTB 3QUML 5D7KE 5DQDH 3GSXA 1SEBA 2IH3A 4YHIB 3SY0B 2GJZA 3VFTB 1E27A 4ZUUB 4FS0A 4UOJA 1QLEL 5GPRA 2PYEB 4FMFA 3HNSL 1A6AA 3SOBL 1M05B 1OT2A 2UV3A 3VMNA 1LE9A 4JM2A 1RUKH 2C4XA 5T3XH 2CIIB 3TIDA 3MFFA 3QFDA 3UTPE 3EFDL 4UDTA 5ESQA 4ELMB 5J6GB 2ED9A 2BDNL 5D71L 2R56L 4WDIA 2CPCA 4X4ZA 3S4SB 3B8YA 2DICA 2HG5B 2Z92A 5AWNH 3D6GA 2VMFA 5HHVL 3LCYA 1IAIL 2AK4D 3CH8A 4MVBC 3V0WH 4MJ5A 3ABZA 5B3JE 5F1NB 3ZO0A 1GGYA 5GQBA 2VIRA 4YHLL 5KS9B 1FO0A 1CICA 1TETH 4G8FB 4LDLB 5FYJD 5D7SH 4IDJH 3VFPB 4AIZB 5GGRB 4JHWH 5I1DB 5CLWA 3IKCB 4OLVH 5T1KA 3BPNC 5C0BD 2OTWA 3G5YB 3SGDI 4U2YA 5KAQG 3CXDH 1WZMA 4QXTA 1JGUH 4G42B 1S8DA 4ZOCA 1I4FB 5C0FA 3WLWC 4APQB 1A21A 1YYLL 5C07D 1ZGLA 4R2GD 1K4CB 4WGVB 3PP3K 5IHZB 5BVJA 3SGEI 3KVQA 1NGWA 3GNML 4OFKA 4H0HB 4JDZA 4PRHB 5C0JA 5L0QC 3GMOB 1VPOH 4FFVC 3HR5B 5MERA 5DR5H 1FYHB 5EZJA 2F53B 3SGJC 4XBGA 1AGCB 1DBML 5SWZE 1MWAA 5BRZB 1B6UA 1G1CA 1I1AD 1VSCA 5JMOC 3P4NA 4G9FE 2VXUH 3VFOA 1ZE3C 4MD4B 4HT1H 4LSVH 3TFKD 3TO4B 4U1NB 4NN6C 3FO1B 1WIOA 2EC9U 3U4AA 4U3CA 3HHRB 1I85C 5E99H 5DHVA 3C5SA 3ROLA 3O6LH 3WDIA 2R15A 3ESUF 2NR6D 5HHQB 2ATPA 3GSNH 1CIUA 4TVSa 1NFDF 4M6NH 1CE1H 4GAJH 1FV1B 1E28B 4LNRA 1J7VR 3FQXB 5T3ZD 1U8NB 2W9DL 4V1DE 4I3RL 4JKLA 2HLFC 4H0GA 3ZTNH 1IGMH 3OXSB 2VYRE 1QBML 2JB6B 3K2UL 3MCLL 4S1QL 1HN1A 4O9HH 4QHMA 4HGKC 1J9CT 4AM0A 3QFJA 4JQIL 4LSRH 5HGDB 5CEYB 3U30C 1TMCB 1RK0B 2APXA 4BSWA 3I50L 1MY5A 1RIHH 4TVPE 3EO9L 2BSTB 3QEUB 4NWUH 1S5HB 5TDPB 3QUYD 2NZ9D 1OAUL 4LVHC 3TJEL 1F02I 4PJFB 2A83A 1F3RB 1H5BA 3IJSA 3Q5OA 4MDJA 3GBLA 3SDCB 2H1PL 5GJSH 1KN4H 1O0VA 3B43A 4ZQKB 2JK5B 1OAQH 4NZTL 1DDHB 3QSKB 2BNRE 3ARDC 4G5ZH 3F62A 4IHOB 4QNPF 5JPMA 2AEIT 6FABH 3H9YA 1CFNB 3B6SA 4Y2DA 2VERN 3DI2B 1ZLWK 2UVFA 3SKJH 3KYNA 3S37X 3VA2C 1YEIH 2EICA 3MUJA 4E42B 1HDMB 3GZKA 4U1SA 4E41D 4GXUM 5EU3B 3WFDL 3IJYB 4JDVB 2YBRA 2IPTL 4MGXA 2CLRB 1YEJL 4H20H 4P9HH 4WHDA 5ISZA 1XR8A 3BHBB 4M5ZL 5IW1B 1NH6A 5CJXA 4XNUL 1FRGH 3QDHA 1CD8A 3K4DA 3DGGB 2G5BB 2OZ4A 1K5NA 1G7LA 2NW3B 3HRPA 4H8WH 4W4OC 4ZFZA 1YMHA 1EZVX 3LMJH 4GW4B 1CLZL 1MVUB 1FNEB 3O41A 4D9LH 1TVDA 2F8OA 4EUPA 3KXFA 4LVOC 3PL6D 3TLRA 2ARJB 5I9QC 4OLEA 4XP4L 2W9EH 3L95B 4OCMC 2P44B 2BMKB 3IXTB 2IQ9L 2DKSA 1TXKA 3KYAA 1FPTH 3L3KA 3QI9A 2QKIB 4JFEE 2PXYB 1EEUA 5D6DA 5L7XH 2H26A 3KPNB 1ES0B 5EC1A 3AXLB 3RX5A 3LAFA 3ZKXC 3EDFA 3LRGA 4LIQH 5ETUA 3KAAA 2KUTA 4WI3A 3V6FB 1ZEAL 4HDIB 1G0YR 4E0RA 4LOUD 2JIXD 3UROR 2NLJB 4PPTA 1A3LH 2A6KA 4YXLH 2ICEA 3HZKA 5J4MA 4J3TA 3FFCB 1U9KA 1T2JA 2HKFH 2HRPH 4R0LB 1A3QA 4KROB 5F9JB 4P57A 4UBDD 3LD8C 4YDVB 4Z7UF 4IRJC 4QRTB 4WCYH 2VZUA 4PGDA 1WICA 5DD5L 1KLGB 3DETC 1EO8H 3E6FB 4FFZL 3SO3B 4Z76A 1T21B 4XH2A 1V05A 4L4VA 3D39E 1LNUA 4OCSH 1C7SA 2MCG1 4HIXH 2RHEA 2BVTA 1OP5H 1AI1L 3WUWB 1G0DA 4HS6B 1DUZA 2ZOLB 4PRDB 1L0YA 4POZD 1DLFL 3HG1A 3WDJA 3NMEA 3QIBB 1FZJB 5L8KB 3EO0B 2QTEA 4OZHF 3CAFA 1XGUB 2J6EA 4RGOH 1DUYA 1FAKT 3MREA 4WY7H 1DANU 4ZUWA 3MZTA 3CUPB 4ZXBA 4JHAL 2HVKB 4RRPA 1A4JA 4G7VH 1VESA 5HJ3A 4X7SH 2IBZY 4NRZA 4S2SA 1UXWB 5IF0A 5HHOE 3FB6B 4ZUSA 5I1HH 4WUKH 3IJHB 1DBJL 3BE1L 5F9OL 3SKOA 1KELH 5JXAH 5L2JB 3MJ8A 1JPGA 5DO2D 4OZFB 3BUYB 3BH8B 3RNKA 4HKZB 2V5MA 1UM6H 2V2XA 2J8UF 1WGOA 2G60H 3VG0H 1C08B 4ZS7L 3U7YL 2PR4L 2WANA 4X6CA 2Y72A 5AYUH 2YUVA 1NFDE 3DSFH 5EN2B 1NCBL 4XNMA 3VFMB 4XTRD 5FYKL 4RA3A 1G6RL 3NZHH 3O3EB 4YHNA 3V4UH 1A22B 1ITBB 2LAGB 4CVXB 4WFEE 3VFGH 5J3HD 4QRRD 3GO1H 3P11H 4TRPL 3NCCB 3PWNB 2F19L 4YBQD 1WAAF 4ODHL 2QQKH 4CMHC 4KC3B 1INDH 2VLJE 4P5KB 4YDIL 1QSZA 3NZ8B 5F3BB 5MHSD 1G7MA 3QA3B 4I0PC 1VKXA 3SE4A 3DROA 2IAMB 4O2CA 2Y25A 5IJKA 4LCUB 4E5XB 2B2XH 4DOHE 2F54D 1RJYA 1DE4A 4P2OB 3GMPB 3HAEA 2EECA 2I07B 4PJGF 4EOWH 4ZYKA 3BVNA 4U7SA 2DQEH 5I1LA 5T5NG 1P4BH 4O00A 3TBVB 2P47B 4K94H 4RCAA 4UDUB 2GITA 1KFAH 1ONQA 1FJ1B 4KY1L 1S9WB 1I7UA 4J4PA 5ACMA 4QNPE 1BBJB 3ARSA 3CFEB 4G8IB 1KTDA 4JB9H 1RIVH 4OLYH 2VWEE 5ALBH 3BW9B 3ILQD 1FL5A 5CJOH 1KEGL 1I9JH 1BOGB 4OKVB 1FYTA 3QULA 3OPZH 1MNUH 4LBEA 3ZDYF 4JVPA 5JR1L 4R7DB 5DJAB 2HVJB 1GC1C 1J11A 5IEHA 1FORL 4HKBA 2BCKB 3UTSE 3TNMB 3MGOA 5DFTA 3FQUB 4AH2B 4G8GB 3ARGC 4MD5B 4X7EC 3O4LA 1KV3A 2IAND 1R6VA 1JGLH 2DQUL 1KXQE 4MYWB 1FZMB 4BQ8A 4PJCB 1EGJA 4XVJH 2BNQB 2P5ED 3N1FC 4NO3A 2QSTA 5E94A 3TZVD 5IKCB 3BT2H 1OD9A 1LGVA 5C08A 3X12A 5DS8A 3H0TB 1D5BB 1KPUB 3BRFA 2Q7YA 4MB5A 2D4DA 1G9NL 4JHBA 1PZ5B 3T04D 4FNLH 5L2KE 2Q6WB 5IW6A 2V2WA 4OCXH 1FNGB 5FUCC 4CRPA 3MRBB 2XN9B 1FHGA 1QFPA 3QPXL 1U8QB 2VKXA 3DIFB 3FN0L 4F7CB 4HFWB 4OCNC 4JKPH 1G6RB 4HC1H 3KJ6H 2VLLA 1U8KB 4NHCL 3CNKA 4BQCA 3MOQA 3IFNL 2DKUA 4OZ4A 1NC2B 4LKXA 4BFIB 4NZUL 5CCKL 4U7KA 4OTXL 2Q76B 4JN2A 1N3NA 3IDUA 4FQCL 3BFOA 3GMMB 4I9WE 4LKCA 2R0KH 5CGTA 3PNWB 3QG7L 2NXYB 5IVXE 5IM7A 1YDPA 5EUOA 5ITFA 4EVNA 1KACB 3W39B 2VRAA 4NQSA 1UM4H 1QVOA 3TJHD 2AJVH 4X5WB 4ZOEA 1MLBB 3W81A 4NFDA 1T5WA 1BD2D 4WW2A 3REVB 1MF2L 1CFTB 2A38A 4EZMA 4PY7B 1TZHA 1JF1A 4N8CH 4RGMC 1VB9A 4P2QB 1W8OA 2ICWA 4JY4A 4OZIF 3MJ9A 5FK9B 3IF1B 2FBJL 1FNSL 4PJ5D 3TN0D 3O9WA 5JO5B 2J5LB 1FFQA 3S36H 1T6VN 3HNTL 3PF2A 1CZ8H 3T4YB 5AZ2H 15C8H 3MROB 3MRJB 1XIWD 3MBEA 1KJVB 1UENA 5E8PA 1PG7X 4LSPL 4QRPE 4Y5XA 1JL8A 1GGBL 4BZ2L 4FQXA 5IGXL 5HHNA 3H2WA 1L7IL 4JZOA 3O81A 5IFJB 5FO7B 1IC7H 4KTEL 3VFSB 4ERSH 1IAKA 2X4QB 4LRNL 2YRZA 5BV7H 3C6LC 3MRCA 4MJIA 2X89D 2DD8H 3CFJB 2FD6L 2O61B 4K07A 2CQVA 1F58H 2F58H 3RY5A 2ESVD 5B8CB 4H1LB 2FL5A 4LHQB 1NGXB 1X5FA 3WE6A 3MR9A 5CP3H 4XB8A 3VG9B 1EHXA 1II4E 1FVDA 5C92A 5E1AA 4M1CC 4NO5B 1OP9A 3VXRE 3E6HA 1KYOK 3L3GA 5ACZB 3AC0A 2DQCH 1LO2L 4MA7H 3OG6B 3AAZB 3DUSA 4OF3A 2FEDC 5BMFH 2WZPD 2GT9A 4DQOL 3SGDH 2HFFB 1P4IL 5LGJB 4OGXL 1FCGA 2PTTB 4R3SA 2R29H 5KZCB 4XP9H 4JFDE 4MDIB 4XAWL 4N1HB 2YOCA 4PJEA 4YO0A 3WL9A 5EZIH 3I6GB 4IMLB 2B4CC 3PQYD 3EYFB 4NQXB 4B7LA 5LGKA 2VLRD 5KW9L 4MXQD 1T7VA 3N1GC 4FP8L 2FO4A 5FUZH 2MHAA 4D0CA 5H37G 3M1BB 3TT3H 1OWRM 4RWHA 1M7IA 1N0LA 1UVQA 1PY9A 2NY2C 3MTRA 4N0UA 1KB5H 3ZDYE 4A6YL 3I2CL 1BAFH 4NN5B 3WD5L 2AK4E 1NC4B 1GXEA 1CFQB 3O4OC 1S9YB 3GSRA 4X5XB 3X3GL 5B3NA 1A6VL 1OF2A 5IK3B 3BZFA 5I66B 5FYJE 3HPLB 5ICYA 4TNVK 5EOQH 2A9NH 1XGQA 4JGUA 1A7RL 1BFVL 3VWKD 2NX5E 2KQNA 1XCQB 2CR6A 2AGJL 2VZVA 1W0VA 1T1ZB 2GUOA 3HC0B 5ICZA 1A4KB 5JXED 2IBBA 4AEIL 3QCUH 1EHNA 3B3IB 4NQEB 5C07E 1AGDA 5GGTA 1DJSA 3PE9A 1N5AB 4PUBH 3BP6B 2YPKB 2A77H 3C60D 3MRKB 4X99A 4NOBA 5GRUH 5I0ZA 4PGBA 1WVZA 5TQ2H 4OF0A 1U8IA 2ZUWA 5IVNA 4XPAL 1EMTH 2AEPH 1SYVB 1DL7L 2AVGA 4XP1L 1XCTB 3VXQB 4PYGA 3BMVA 2ZP0T 2J88H 4F2MA 5GRJL 4HHAA 5EU6B 3VMOA 1RJLB 3EW3B 1NBZA 1OW0A 1UJ3B 2YA0A 4CAGA 3CMOH 3I6KA 2CKBA 4I4WB 2VDKL 5HGAA 4QF1A 4OQTA 4ZFOL 3F12B 3HE6D 4RNRB 1G7PA 1NEZB 3X13B 5DQ9A 1IEHA 3SDXA 1PKQB 3BQUC 3S88L 4OD1L 4RWYH 5JORB 4J3XA 4ELME 5E08L 3QPQC 4LCWA 4GSDH 2VDPL 4ZSOB 4W81A 1F00I 5SWQA 4D94A 3O3DB 5F7FA 2Q8AH 3WLBA 4NC2B 3RVVC 3GJFK 4OLXL 4CVUA 4L8SB 1HXMA 4BSJA 3T2PA 3MV7B 3CX5K 3VDCA 3VXTA 3RL1A 5IROA 4HWBA 4YX2L 3VJ6A 5T1MB 3C5ZB 4OIBA 1MVFA 5AAWA 1UB5B 1N7ML 2VDQL 5JW5B 2V9RA 3E3QC 4CU8A 4TSCL 4OBRA 1CI5A 3FT3B 1AKJA 1XGPA 2DDQL 5C0CA 1QG3A 2BHUA 3DUUB 5I74B 3JTTA 4OV5A 2V7HB 4A6YB 5D72L 1XF2A 1A64A 1U8OA 3UAJC 3HI5H 1K8DB 1VFUA 1JIBA 3KPOB 4XXCC 4PJ7F 4PJBE 4ZPVB 5F1IA 4Z8FH 4FA8A 1CDHA 4QHLA 1TITA 4GG8B 1L4IA 4HGWA 1HQRB 3BIBX 4KZDL 1MFNA 1YYML 4LPUA 3LSOB 5HGBA 1T3FB 1ADQH 3OAUL 5EWIH 4X9FA 2DIBA 3TM6A 1KGCE 2XKNB 4K9EC 4XC3H 5SWSD 1HHIA 2F53E 1QBLH 3OKKB 4BYHA 2BY2A 5BRZE 5GZOC 5DGRA 2VUYA 3VFTA 5EO1B 4FQLH 2OTUA 1U95B 4KKBD 2Z31C 3SKUD 5L88H 5DJ8A 2PYEA 4DGVH 4Z7OE 3MRQB 1M05A 3JWDL 3TPKA 4K2UH 2CIIA 1HHKB 3WNLA 5IBLC 3QDGB 2H32A 2G75B 4KI5E 1DSFH 4XBEL 4TSBL 5J6GA 1UCBH 3G08B 4QRSB 1G84A 4KRPC 5C0RL 5LBSH 4YXKL 2X7LB 2HG5A 3CVIH 3MPCA 3WNOA 3E8UH 1BQHB 1LEIA 4ZFOB 5F1NA 4U0RB 4P5MB 5CUSL 5KS9A 3ET9F 3BP4B 3ZDZE 5HYJB 4HX1B 4G8FA 3BI9X 5GGRA 2X44D 5I1DA 3IKCA 3MLXL 4JDTH 1CGWA 4X9GA 1SJHA 5GSVA 1TDQA 3G5YA 2F8XC 3FO2A 5JW4R 2ADGB 2X4UB 5E2UH 3TH4T 4L5FL 3SCMC 4F7PA 4APQA 3HMXH 1K4CA 1ZT1A 3UTTA 5IHZA 1S7RB 1HQ4A 4UNVA 5I73B 1NDGA 4PV9A 5CKGA 3WFBL 2H2SD 4PRHA 4ALAL 1WBXA 3GMOA 1BQUA 3L5WB 5C09D 3HR5A 1KG0B 1KJ3H 2EDDA 1OAYH 5F72S 4KJQC 3D18B 4YR6A 1HOCB 3RWFB 1AGCA 1NCCL 4UAOB 1J8HA 5D6CB 1JRHL 3FQNB 3IDNA 4PJAF 1Q72H 1ZS8B 4MD4A 1V7NH 3TO4A 2LV4A 4TTDD 4U1NA 5HYQA 4Z7UB 3DV6B 3FO1A 2RCSL 1QD0A 4P3CL 1U36A 1DQTA 3DX6B 2C4FT 2W9LA 4IOSD 3DGCR 4F7TB 1IGIL 4M6OH 3QUZD 2BRRL 5HHQA 5ID0B 3IDMB 1NSNL 4PJHA 3RGVC 2DQDL 1H3UA 1NLDH 3TIEB 4J3UA 3VGFA 5EORH 4BM7A 3QUMA 3H3KA 4OT1L 4LF3B 4OZHB 1FV1A 1E28A 4KFZC 4NIKB 4WO4B 3FQXA 3UTOA 4AEFA 5DJCA 4AT6B 1CLYL 4F37K 3OXSA 5T33H 2YSSB 3MRMB 1RHHB 3HE7B 4M43L 3GSVA 3ZKMD 4G6KL 4GRWB 5CEYA 2QHRH 5K9JL 4RAUB 3L5XL 1MCOL 4PJIE 3CDYA 1EHAA 4GW1B 1S5HA 5TDPA 2FGWH 4ZO7A 2HP4A 4RZCB 2WP3T 4WV1C 4PJFA 3RZWA 4ESKA 3W2DH 5CLTA 4WHYH 2EDKA 1JPFA 3WYRA 2P5WE 4O2EB 4GG6F 2J8UB 3NFNB 3QEHB 4QRRE 4ZQKA 2BZDA 1B0RB 5FOBA 1T89A 2A73B 3EKCA 1DDHA 4RGNC 2B7DT 2F15A 3VD4A 1K3ZA 3MV8A 2G9HB 1JNJA 2EDRA 4LGRB 4Y5VA 4NCDA 1K2DB 5ANMA 5EU5A 5FYJU 2EH7H 5MHSE 3SKNB 4PJDF 5JIPA 5BOZG 3D9AH 2XZCL 3HC3H 3S97C 3U36B 3IJYA 1F45A 4IS6A 4JG0H 1OSPH 1P53A 2VDNL 5E9DA 1EHLL 1MHEB 2V7NB 1JHLH 1AO7A 5FYJH 2YPLD 2DI9A 4G3YL 1A7PL 4GT7A 3LH2H 3BHBA 4LFHD 3NVQA 2BP3A 4JFXA 2F5AH 1HCVA 2G5BA 3V5DB 2JJTA 3BOVA 2DI7A 5D5MB 3LQZA 4GW4A 1MVUA 1FNEA 5T3ZL 1TNMA 1PLGH 3CZFA 2X9YA 5D1QC 3MRRB 1T5XB 1LK3H 4O58H 4MCYB 1FZKB 1YZZA 3WLWD 3A67L 2ZCKL 3NH7H 1OY3B 4Y16C 3O8XB 5TE7H 5TF1H 4LMQE 1G7HB 2QSCH 1Z9SA 1MCRA 3LY6A 3RX8A 2R1YB 3B5HA 4FFVD 2FZ3B 1ND0A 3QEGH 2QKIA 3MNVB 2PXYA 2Y6SC 3GUTA 1RU9L 3T0EB 2P5EE 3KPNA 3JUYA 3AXLA 3S34H 4LDOB 4BK4A 3DVGB 3DYOA 3V6FA 4I2XB 4R8WH 2P48B 3LB6D 3L6FB 1QFUL 4LLQA 2AV1A 4RFEB 3O45A 3BYTA 3DLQR 3LZFH 1JK8B 2K3TA 5DA4A 2WP3O 3FFCA 5CAYB 1S7XB 1KCVL 2ZUQB 5DEGB 3AB0C 4R0LA 5CSBA 2E7LC 4YDVA 3KPPB 2YD2A 4HIIB 1DCLA 1U3JA 1E4KC 1EFXB 3P30L 1EO7A 2XA8H 1KLGA 5HVFB 1T21A 4EUPG 3QNZB 4QRQA 2D0GA 1YQVL 3KPRD 1CVRA 4JCLA 3WUWA 5CFHA 2HLFD 3PWVB 5DRXB 1IT9L 3UPRB 5FA3B 5HVWA 1WCBB 5INCB 3QIBA 5ITBH 3EO0A 4C59B 4GQ9L 5TDNB 1S3KL 1ETZA 1XGUA 2VLKD 1I1AB 4KMQA 4U1MB 1H0DB 3HC4L 4QT5B 4K3HA 5BXFB 3QQNA 4OM1L 1JNLL 1VEPA 2DQHH 2HVKA 1OAXL 3DMMB 3MGAA 5F7DA 2XRAL 4BKLA 1UXWA 1IQWH 1DR9A 1OARL 2VZOA 1JYNA 2BSRA 1EEZB 4PJAE 5ADOL 2ITDB 4XX1E 1HHHB 3IJHA 4HXAL 3ARDD 1SM3L 4Q58C 1CBVH 1QBBA 3EGSA 3EYOB 3KHQA 4JFZH 5FOJA 1S78C 3BUYA 3BH8A 1JPSH 2F5BL 4DGYL 4G8GE 4WGWB 3WIFB 4AQ1B 4LLMB 3GGWB 1INEL 1ZT4B 4FQIH 4YXHL 5DHXB 1C08A 1QYGH 2BVPB 3BGAA 4KZEH 1HKLL 1Z5LB 5LQBL 4KDTA 2IMMA 1QR1A 4RIRB 4F57L 5JIHA 3ARFB 5JHDD 5EN2A 4DW2L 3HN3A 3VFMA 2NQCA 5FO9B 4MAUH 2HWZL 2LU4A 5D2NE 4CVXA 4EDWL 4HPYH 1EDQA 2OR8A 2RBLA 3N9GL 2VAJA 1A14H 3BJLA 3QQ9C 1MCHA 4CADA 4KVCL 4YJZL 5JLZB 3NACH 4ZAKC 5F97E 2DQJH 1M4KA 4NNPL 3RY4A 3U1SH 2DIJA 1LE5B 4X0KB 4QY8B 1RMFH 2D03L 3PWNA 4HUKB 5CD3B 3CH1A 1T66C 1QSED 3OJMB 4X6DB 5F96H 5BS0D 4GQPH 1YEKL 5EPMA 1K85A 4P5KA 4RRPG 5F3BA 3NZ8A 1F2XK 4ZTPL 2ESVE 2AJZA 3T0XA 4WWKB 5FYKE 1IAOB 4E5XA 4QGTA 3GMPA 1W72H 2EYRB 1N0XH 4GG6E 2I07A 2WUCH 1U6AL 2O5ZH 1FJ1A 2OLDA 1VEMA 5HHXL 5I8OL 3MXVH 3OTTA 3CFEA 4G8IA 5FKAA 3SQBA 1FVCA 4X7TA 4KUZH 3BW9A 1CLOH 1F97A 1C5BL 3BPOB 1CICC 2AJYH 3RWHB 2WBJD 3RDTC 4OKVA 1QACA 3G6DH 2CK0H 3GRWH 4R7DA 5DJAA 4G9DA 2ORBL 3DO7B 1AHWC 1MJ8H 5KVMC 1BVKB 5DSCB 2MMXA 1F4XH 3TWCH 2BCKA 3TNMA 3FQUA 4NZRH 4MD5A 4KHXH 4IRJD 1GVIA 3EDEA 4YZFF 2HH0L 2DJUA 3DETD 3DSNA 1FZMA 3T08A 4PJCA 3PP3H 2D7PA 3W9DB 3N50A 4U31A 2BNQA 3G9VA 3E2HB 5FGCE 4MQ7B 4HIHB 5IKCA 5MENB 5LXGH 3KPSB 4UT9L 4U6TA 1BBDH 1WIPA 4TNVF 5I8KH 3H0TA 1KPUA 1OSZA 4PG9A 3HAEG 4GMTL 4L3ED 1CD1B 5E00B 3ZTJH 4P3DB 1JWMB 1PZ5A 1YPZA 4AEHH 3V4VH 2BFVH 1GHFH 4JVWA 1QFWH 3CDGB 5JTWA 2CR3A 1FNGA 2CGRL 2JIXB 3HPJA 1LVEA 2XN9A 5EBGA 4JN1H 4F15C 4KUCD 1U8QA 2VABB 4PJ9B 4F7CA 4HFWA 1CG9B 3ZYJA 5DUBB 3GSWB 1DVFB 5GHWL 1G6RA 2M2DA 3C8HA 4ZDHB 2M8XA 4DEPB 1I3GH 2V2TB 3D2UB 1NC2A 4BFIA 5JHLL 1SEQH 3K81A 5FM4A 3VGAC 1NAKH 2RFXB 3GMMA 1JV5B 3PNWA 4MXVF 1D6EB 3EOTL 3U0WH 5D1ZB 1MELA 4LSUH 2VL5A 3BKMH 2LTQC 4GMSH 4NQVB 1MLBA 1NL0H 2ZNXA 3VFWB 1D9KD 3BSZL 2EDYA 2H2PC 4PY7A 4F7EB 4K94C 4LHUA 5D7IB 3VXNB 4P2QA 4J6RL 5FK9A 4I77H 4P59H 1YJDL 3JV0A 5GS2D 1N6VA 3QIWA 2DQTL 5JO5A 2NW2A 4S0TD 3MLUL 1XGTB 5MP6H 1FP5A 3MROA 1NMCC 2R0WH 5BVPH 3MRJA 4X6BB 3VWJB 4I0PD 2VLMD 5B39G 2P4AB 1NCTA 3VI3F 3SDAC 2BVOA 2GFBB 4JRYB 4Y2DC 4PJ8B 1ZLWH 2VAAB 3L9RB 1WJ3A 4GAGH 4M6AA 1CGTA 5KSBF 1MFEH 1P7KB 1S7QA 1T7YA 5IFJA 4FQJL 4BQBA 3THMH 3W0WD 4RQQB 5FO7A 3VXUB 3ORJA 3C2AL 3VFSA 4M7LT 4XHJC 2X4QA 3SJVB 4C56D 4CN6A 5E8NB 2GTWA 3IKKA 5CJXC 4DKEL 1RZJH 1BX2A 3LS5L 1BJ1H 4H1LA 2BY0A 1EH9A 5BO1H 3OBAA 3DVIA 3PWPB 4ODSL 1NQBA 4LQ1A 1MI5D 2D31B 2WK2A 5HD8C 3I85A 1RJZA 2VDML 4NO5A 3ARGD 4LLUA 3H42L 4GRLC 3NAAH 1N64L 1T4KB 4JPIA 5ACZA 5KJRH 25C8L 2X05A 1FGNL 3AAZA 4HMEA 2X4TB 4NKIH 1AFVL 2HFFA 4ODTL 2VDLL 1HH6B 2PTTA 3B9AA 1TZGL 3MCKA 1YC7A 4GXVL 5LG1A 4GUPA 4OLZL 5D6DC 3SE9L 1KF9B 3RUGB 1QSFB 5CBAB 4MDIA 5T1LB 3OHXB 4ODBD 5DGQA 3TV3L 5KVFL 3IDXH 4JO4H 4BSVB 2PCPB 4JRXD 4XP5L 2BOBB 5I8CA 3EYFA 4NQXA 1LEKA 1HHGB 3DXAB 4XPTH 4Q9QL 1Z9LA 2QQNL 1F4WH 4NN7C 1QEWB 4LSDA 4MAYD 4YEFA 3WIHL 3NIFF 4DN4L 1PKQE 3VCLB 5CP3A 1OM3H 3L3JB 1MCSA 1NUGA 2IANB 1J0ZA 1T0NA