2Z64C

Crystal structure of mouse tlr4 and mouse md-2 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
b'QQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4
publication title Crystal Structure of the TLR4-MD-2 Complex with Bound Endotoxin Antagonist Eritoran
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2007-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2z64C00
3FXIC 2Z64C 4G8AC 5IJBC 3VQ2C 3WEBA 5IJCC 3B2DC 3T6QC 3WEAA 2Z65C 2HKAA 3MU3A 1XWVA 1AHMA 3VQ1C 1A9VA 1AHKA 1NEPA 3RG1C 1KTJA 2E56A 2E59A 3ULAB 5IJDC 3M7OA 2F08A 3MTXA 5KWYC 1WRFA
chains in the Genus database with same CATH superfamily
4GOSA 1L3NA 1NSNL 1RZ8B 3OAYK 4KHXH 3TBYA 4BA0A 4JM4H 3MOAH 4J3BA 4JMNA 1Y07A 2J8UB 4LLDB 1NAML 2LT9A 4DVBA 1Q9WB 3M46A 3IETA 4KNQA 3WHXB 3QDMD 1M6OB 1U2YA 2PYED 4Z7OB 3T6VA 5C1MB 2KT6A 3QDJB 5AALA 2VM9A 3GKWH 2H8PA 3UAAA 1N0XL 2WYZA 3U36A 4E9LA 3HR6A 1E4WL 3F5WA 4OVUA 4U1NA 4BSJA 4AIXA 5EUOF 5HYJA 4RFNB 5DJ6A 4MXWL 3FSZA 3MX0B 2MH4A 2W60B 1T0PB 1JF1A 3RY6C 2V9TA 1SY6H 5DJAA 1U91B 2R29L 4M5YH 3AQYA 4E5XB 1FFQA 1KNOA 2VM3A 3QJZA 4GY4A 3AU1B 2XG4B 4FZEH 2JJSC 3B9KB 4D7BA 2X4TB 3QUYC 1DQTA 2HTKD 2WXKA 4PD4J 4L9LC 3IDMA 1JGLL 3GRWA 1H8NA 1MCOL 2GUYA 2O5XL 3FPYA 3VYOA 5B39G 5CN1A 2JB6B 3CPLA 3NABL 2RCSL 2C1OB 1BQSA 4E41B 5DJXB 1CICB 1HFUA 4LRNL 3HS0A 3ZDYE 4DKFH 3QFJE 3VRLF 4PWEA 3ISYA 1W8NA 1MJ8H 3E1ZA 3MLXH 3I50L 1BFVH 4BQ6A 3V79C 5F3HA 2FNWA 3KW7A 3FU0A 1K4CB 4NEHB 1TXKA 2H2SC 3FU6A 1N8OE 1Q1JL 2OMVB 2PP9A 3EGXB 3TASA 2P4AB 2E9WA 3LH9A 5I9QC 3MUGA 3DTDA 4FG6D 1AKPA 3LVTA 4ZFFA 5HDBE 2X05A 3VD5A 3VD2A 4XPTH 2V3DA 5CUSL 1EBPA 3G5YA 1RSYA 4M4RB 3C60A 1P4BL 1MI5A 2VXSH 3MA9L 3LHPL 3W0WE 1JWSA 4HZ1A 2KQNA 4LSUL 5FO9A 2N0KA 1FYTD 1QFWI 3UBXG 1SXSA 4LRIA 1DVQA 1TQBB 2WM0A 4LP5A 4AYID 4DN4L 5CCGE 3HI6H 4A7UA 1QRNE 1XTLA 3L2LA 3N0PB 1GTFA 1FORH 1YVLA 3GRGA 1ICTA 4PV8A 3C08H 2CLZA 1M2OA 4JM2F 4F24A 1XAKA 3ESOA 3P77A 1IGYA 4PJHB 1UENA 1N68A 2K6WA 4DEWA 1ETZA 1KCWA 1AHMA 4UQEA 4ZPTA 2RBLA 2NNAA 5FA4A 5C0BA 4ZMWA 2P45B 4QRUA 3OF6A 5FO7A 3V4PL 2R27A 3WDHA 1ZLEA 3DK0A 4XP4L 1OWWA 3RTQD 4NC1C 4XPGL 4CL7A 3M7OA 4H8WH 4OCXL 5HDQL 3PREA 5TDPB 4J3OG 5FFOA 3U83A 1T7ZA 1UOWA 1MIEH 4JDZA 1MFCH 1NGXA 3HAEA 4NENB 4H8PA 1DBKH 3PQYE 4XNAA 5E6UB 3H7BA 1OSZA 4ICWA 1UFGA 1GGCL 1EJ6A 1P6WA 4NP9A 3I3BA 5DHDA 3CU1A 1MQ8A 3K3QA 1S9VA 1FZMB 4WNQA 4RCAA 1A7QH 3CBKB 5LQBL 1EHXA 1G0XA 2F08A 2PYEA 4LKCA 2R2CA 4HIJB 3ZDZB 4PJAA 1UD3A 4KY2A 3AY4C 2NYYD 3QUML 2LU5A 1G4RA 3HJ0A 4P5KA 4A2HA 1X7TA 1KJ2H 4X5LA 1OAXH 4YSEA 4KPHL 3UBFA 1K2DB 2DEXX 3CIAA 2BSTA 3F7YA 4JQIA 4QRRB 4HH9B 1O6SB 3LV3B 4X0KA 2W9EH 4GMTH 3FBKA 1OY3B 1W0VB 1J86A 3PNRB 3S36H 1N6VA 1UD5A 3FFDA 2Y2YA 4IJ3B 4U1MB 5KN5A 1IGTB 1CVRA 3ZRSA 1DANT 4EF3A 1HDMB 1GW6A 1L9PA 3D08A 1MFAL 1OXYA 2KZWA 3PAYA 4WWKC 4YR6B 5C70A 2NUPB 4KNUA 4PJXE 2VQ1A 5AOZA 3VA6A 2OJEB 3US1A 3KYKH 1AY1L 2CDEA 4PJIA 1E4KC 3L3JB 1WZKA 1M56B 4YHLL 3NJNA 5EWIH 2EDYA 3NJHA 2J88L 2CLVA 5EU5B 4OLVL 2P8MB 1SF3A 2L7QA 4LCWD 2NUTA 1U30A 3TA3C 4FDWA 2H2PC 5EN2B 2BHZA 1KLGA 4FABL 5KVGE 3T65B 4R6UA 3JYBA 2HVKA 4L1SA 3RDTC 1C9SA 4G8EA 4MJ6B 4XP9H 4FTDA 5F7EL 4MQ7B 5K1VA 3PP4L 1MRDL 5DJ0B 3VFWB 2ENQA 2CIKB 3MGTA 4Z78A 2J71A 1J48A 3MKKA 3NFSL 4HAFA 4LMQI 3ULSA 4GRLD 1QR1B 1FYTA 3X14A 2NZIA 3IKKA 1MHPH 4X8JA 4HKXB 2GFBB 1L9QA 3OXSB 1H15A 3O3BB 5CHNB 3VXRE 2ADJB 2ZT9C 4ABWA 2EXYD 5EZIL 4MQSB 1Z5LB 2ALWA 1LGVA 2GUOB 1WZ1L 2O6FA 4BRJA 3EYFB 3LZRA 4Y4FA 1UB5A 3OBAA 1RJLB 4K7PH 3JTSA 1RUKL 1MKFA 3D33A 1IAIH 4G80B 4HWZA 3EXLA 1ORQB 4YQXL 5CJBA 3RWIB 3KPPA 4B96A 5IFAL 3RTQA 3EJPA 4D0BA 5DMIH 1NPJA 4NHUB 4U0QB 3L3OC 2CWRA 2DI8A 5AWNH 3SPVB 5C0JA 4J39A 1A7RH 1SVCP 4XGZA 4AUYA 1A7NL 4YL4A 1FL5B 1FFOB 1T83C 4G6AD 2BRQA 4ZOCA 2XWBB 1DJWA 5FCUH 1R3JB 4OJEH 2ZKHH 5DLMH 2LVCA 3GS7A 5EZPA 3UPCA 1LO3H 1YUKB 4Z3IA 3RVWD 5AAWA 1J12A 3QXTA 2N7SA 4EIBA 4QJ3B 4WF7A 5IEKA 5LGJA 2AJVL 4OCYH 3F6LA 5IWLA 1Y18B 4RZCB 1A25A 3RX9A 3V4VA 1T0MA 1A47A 2RB8A 1QPPA 3NSXA 5T3ZD 4BZ2H 3POCA 3S37X 4KMQA 5LB1A 3WEXB 4Q4EA 4OF3A 4LP4A 5I2IB 3MBXH 1HYSD 4JFEA 5MHSE 5L9DH 1A2YB 2E56A 3IEAA 4E9RA 1EVTC 2A83B 5DK0A 3WG7B 4TRPL 5CZXD 3POHA 1FLRH 1C1EL 2FE0A 5JMRA 3DVGB 3L45A 1HAWA 5C0FA 4LSSH 3QK0A 4AE1A 4AQAB 4EUPH 1CT8B 1TTFA 2D7OA 1BECA 3KJ4C 2FJGA 5KAQF 4UNTA 3HRZC 1E27B 4YBQD 1V3LA 1U8NB 1YN6A 2ODHA 3H55A 5HI4C 3VYPA 1FVDA 2WNGA 3LN5A 4X5RA 5CLZA 5IB1A 1ZPUA 5CCKL 4MQTB 4YE4L 2Q9OA 3V0FA 1GGBH 3PL6B 3LS5H 2OL3H 2B1OA 2X9WA 3QDGB 5C0CE 5IR1B 5GJSH 4YHZL 3EG9B 4G59C 3ZZSA 1UATA 3RAJH 3PJLA 4LCWA 4FD0A 2XWCA 4N0UA 4HJEA 5B7EA 2ARJQ 1KJ2L 4MDJB 2HZHA 2OXHB 3I9IA 2X42A 4XO5A 1UVQA 1BLIA 3B6SB 1AGFA 1RCYA 4Q74A 3ZR6A 1OHZA 1INQB 2EO7A 2P26A 3UCQA 1MLCA 3KPQB 4OCSH 4PJBE 4PRAA 1RQ5A 5E2WH 4HUWA 1C12B 1CDHA 1KCRL 4XNBA 3C6SB 4UQ9A 4M3HA 1GH7A 4GRLA 2YQGA 1XGTA 2AITA 3ME0B 1I85C 3U79A 1BF2A 3OKKB 1YRKA 1B2WH 1XSOA 3FU7B 3EOTH 4PWHA 5HHVH 4ADGA 2ZUQC 2WIMA 1R1CA 5J57B 1VCAA 3L48A 3TYGL 3GLAA 1IO4C 3GGWA 3QPQC 2PUQT 3FQNB 4L3CB 1S7VB 2HJKB 3SDXB 3QWRA 2D9QB 3T3MF 5IV2A 2Q2LA 4JNXA 2DQIL 4BK5C 3T3PF 5ICZA 2EDHA 3HNTH 1DUYA 3BKCH 3Q8FA 5DRZB 3IFLH 2XRAL 4MYPA 1RU9L 3E8VA 2XSKA 4G6KH 4V33A 4H8QA 5B21A 1NANH 1RZKH 2ZJSH 5E8NB 1PFOA 1LO4H 3M17A 1AXIB 2PCFB 1ONQA 1CFQA 2ZE0A 1FFTB 4F8PA 3MHZA 1WISA 4RVBA 2KDGA 4JY6A 1X5MA 1I9JL 3BKML 2HMIC 3ZE1E 2W5PA 3PIQB 4Y5XC 5CJXC 1FSKC 4OCLC 3STBA 1YEDA 1J0ZA 2JI3A 3FONA 1VIWA 2GJJA 2Y7MA 4Z7UA 2R0KL 4YBLC 5DD3H 1X5GA 4PS3A 4D9QE 3MPCA 3L3GB 4QNPF 4P5TB 4WRLA 4YUEH 4P9ML 1N70A 5INCB 3DDGA 4PGEA 4GG6E 1G7IA 1L9TA 3FCUB 3QRLA 1AQDA 3GFUA 2XPGB 4L48A 1XD0A 1U9KA 4AV5A 4JZNB 5DD1L 4JM0A 4NNPH 1IIIA 3DIDA 4AXWB 5EOTA 2P80A 5CN2A 2IEPA 4O2EB 1PZ5B 1OAUH 1IUZA 4KVNH 3GIZH 1EANA 1DE4B 1E9OA 3DMMB 1MHCA 4A2EA 1FFNB 3GSUB 4UOW0 4QOKB 3FFCD 4ZODA 5IQ9A 4JM2D 4LQFH 3GEWB 1HH6B 5BV7B 4M00A 1J5IA 4LAQH 1HU8A 4PJGF 1F13A 2FHFA 2ZKWA 1DHKA 3N3EA 4WI0A 5CIPB 4DP4X 2YOAA 3V5DA 3MROA 4ZNEE 2VLME 1U3NA 1XSKA 2Q6WB 3EYSH 2OS7A 2V2TB 1OGSA 4DNLA 1INEH 1YY8B 1SUHA 3ETTA 2E7BA 3ENEA 4M6NL 4CKVX 5H94B 2OMWA 5F0PB 2CD0A 1YLBB 3II3A 2K6ZA 1BAFL 2WXGA 3X1FA 1D7BA 2HT4C 2Y9RT 4PJ5A 1CF8L 2GY7B 2XBTA 3ULVC 4FI8A 4XVSH 4OGAD 4U6YB 3RGHA 1XXFC 2DWEB 3HAEG 4HIHA 4JQXA 5BZXA 3S5LA 4L29B 1VACA 2VLKE 1BBJA 4NM8L 1ETB1 1UH4A 3DJTA 2EP6A 4GW4A 4Z7VE 4MA7L 1IGCL 1XFPA 3BWUC 3L5HA 3T4YA 4ZO6A 5BVJA 4ZSOA 5C3IA 1MEXH 5ACZA 3TZVB 4H88H 3D2TA 4NO2A 3QEQB 1HK6A 2YOCA 5F1IA 1JZFA 4EJ1C 2DQDL 4L4JA 4PMEA 5CSGA 5IB2B 2I32A 1B4JH 1CD1A 1Y6NR 1BOGA 1XZ0A 3SY6A 3B9KC 1BQHB 2WUBH 1SDYA 1TO5A 3FTZA 4RRPM 1NKGA 2ZKYA 4LCIH 4NAMA 3EFDH 1ZGLP 3ARGA 5FIEA 4YDLB 4WK0B 4XNZB 2PN5A 1QR4A 4Z7WE 3IJYA 2OXGB 4ZX4A 4H0IA 1BZ9B 3LRGA 3MRDA 4XMUA 4G7VL 1CICC 3OB0K 3KPRA 3RJQB 2ZX8A 3N40P 3VFOB 4I3SL 4E42A 4JO1L 1JFQH 1T6BX 1FC1A 1MIMH 3ULVF 4XN8A 2L7EA 1NQBA 3RVXD 3PPEA 4G9FE 4PJDF 2JMRA 3QS2A 3UYPA 3MRHA 1I3RB 5DGRA 4XNQA 3CFBA 4OF0A 3BWUF 3LRSA 3L7FB 2FIKA 4XBEL 2AJXH 1ECZA 4OIAA 5HHMB 1VENA 4EDWH 5DC9B 5K9JH 1MVUA 1KF9B 1FNGB 3EJSA 2Y7NA 3FJTA 4LZKA 4FXTA 2WZ5A 2WYTA 4DP1X 3T8XA 5EMYA 1E9QA 2H9GA 2YGQA 1DJZA 4ZFZB 3FFCA 2JJSA 5J3HC 4U31A 1FI8C 5IM7A 3QUYA 1TKWA 5BRPA 1BM3L 1VPOL 4HKJA 8FABB 2YC1A 4HCGA 2R23A 1PZBA 4PBVC 1PYWA 4PJFF 3SDYH 4HMCA 4ZD3H 4U1JA 3L4ZA 1Z9SB 3REWA 4PGZA 4AYGA 3BW9A 5CP7A 4PCSA 4B3VA 3MBWB 3QSKB 3QFGA 4IMKC 2XZQH 2Z35A 3HMXL 4HLJA 5LJYH 4M6MH 2P5WD 3VJ6B 2VC2L 5CEXB 1IQWH 2FGZA 1BM7A 3FN0H 5HHOB 3ARDB 1LQBC 4WDIB 1KFGA 1QD0A 2MPAL 5IESH 1V3MA 2IOIA 5FUOL 4ZUWB 1XCWA 1ZVSA 3GMOB 4DZ8B 1J11A 5AKSA 4GO6B 1S7RB 4F3FA 2L7UA 2YARA 3MRJA 4OZIF 3QEUB 3QJFA 3FYIB 4LKXB 2VB5A 4MAUL 3ZL4H 3GIVA 5DYOA 4ELDA 4ZDHB 5ICYA 2QPDB 1FDLL 2JKWA 3BUBA 1NL0H 3FQXA 4KRNA 1IQDA 1LO0L 1NBZA 1NMAH 2O1AA 2YR3A 3MLWH 5CZKA 1MH5B 2FBJH 5HDWA 4WTZA 5B7MA 5CBEB 3KYNA 3CCHA 1R3KB 4DJMA 1Z66A 3FTGA 3SEPA 4U4BA 4GT7A 5A2FA 5EFIB 3QRGL 1MCBA 1S9YA 1HHHB 4ELKA 3G04B 1XSJA 5JOFA 3EJYC 2DWXA 3GMNA 4NIKB 3HZVA 3G6JE 4UNVA 5J89A 1GGIL 4H1LH 3R0MA 2E7MA 1UUNA 1UACL 3SE3C 2J57A 2F0CA 4TNWF 2DICA 4S2SA 1EV2E 3EH3B 2AXGB 4K94C 5DK2A 1J0KA 5J13B 3O4OB 2PCXA 3N44B 3NCJL 2ICWJ 5IT2L 1A66A 1P2CB 5IF0B 3WXWH 3ZQWA 2F1BA 1NGQH 3G5XB 1FZKB 2EEDA 2Z8VC 3ZRFC 3TEYA 3EJZC 1IT9H 5SWZE 4H88L 5IK3A 1FO0H 3A6OA 3UG4A 1TTAA 4PRNB 1CS6A 3JWNG 3ML9A 5AL8A 3H4FA 3VD0A 2X4UB 4X42A 3JBG7 1LEGA 3ZMEA 2WHVA 1OIOA 1WITA 1F3DJ 2YLHA 4ODWB 5CGMA 5D1QD 3LB6D 4U1KA 2E9IA 2YKLL 1L9OA 3AJ7A 4XXDA 3U0WL 4NSKA 4G8FB 3VSUA 2F74B 2NSMA 1BV8A 5E8EB 2NTFA 4QXTA 2UZXB 3LQZA 4IJTA 4M61A 4TNWK 4A6YL 2LAAA 3GMRA 3NJMA 4UZGA 3MV9A 3B4NA 4YWGH 1NPUA 1XDTT 5HY9A 4YXHL 5C6WH 5IQ7H 1JHKH 4MX7A 3UBHA 1XX9C 1UXMA 2R1WB 4KRMB 4NKOA 4BFIB 5F1NB 2GAZB 5KS9F 2QDVA 2VCOA 5C0AE 1SZNA 4OIBA 1CJYA 2EDMA 5IUSA 4GS7B 2G75A 3DXAB 1P69B 2IWEA 4FQJL 2GTWB 4EIZC 4WWKA 5GS0D 2GJ6E 3QWOA 4FG0A 4QXGL 2DQCH 1DUZB 5EORH 4U1IA 3MCKA 3P30L 1MRFH 1AGEA 1U42A 2I9TA 3OXRA 2Q8BL 4HK0B 3ES6A 3FOMA 4P06A 1FH2A 1NC4B 1E4KA 3QHFH 3SDAD 1EERB 2O5ZL 5I6PA 3HNVH 2XQYA 3N9GH 1RURL 1G9HA 4O58H 3D25A 4XPHH 3VXTB 3DJZA 5CCJA 5K9QG 1YUHB 1N26A 2HRPH 5KVEE 4YHML 1YNTB 1CUOA 2VAAA 1X5ZA 3TA3A 1UEMA 2VR5A 1C7SA 1B0WA 2IBZX 1TTCA 1FFPA 1EJOH 1JZ2A 4DAGH 3FUHA 4GW1A 4NGHL 3RDTA 1MELA 4JO2L 1TMCB 5AVSB 3OR7A 3VDBA 1U8PA 3MRMB 4EN2A 4J5VA 5KW9H 1GW0A 2XT1B 1HINH 4FHJA 3SGKC 5CR1A 3FAXA 3GMPB 4ZZKA 1XH1A 3OGCA 4X6BB 1TZHB 4DIXA 2AV1B 1QA9B 5D9SA 2QSCL 4N2HA 2A73B 4MRCA 3IFOB 2IAAC 4LVNC 1VFMA 4BFNA 1ZXQA 3D30A 3P2DA 1LE5A 1JNHA 4K23L 2CJUH 2L8AA 3LMJH 2W07A 4I0CC 4OJYA 3BT2H 3QXAB 4MKTA 4JM2B 2VDNL 5EOQH 4J2QA 1YPZF 5A2JH 4IEFA 5D4QA 4PREB 3CFJB 1DN0A 4AW7A 2J3SA 4Z7QE 4MVBD 3VXSD 2KQMA 4LEOA 5E8PA 3OSVA 4LARL 1WFOA 4B5EA 1K8DA 1SYVA 2O61A 2XBZA 5D4HA 4X0NA 5JYMA 3FB8A 3L3OA 4UDUA 3EF7A 1I82A 3PL6C 1P4LB 3L1EA 1JIBA 3GMQA 1XGRB 4LIQL 2D2CC 2P5EB 2FD6L 4KY1L 4QTHB 3EZJB 3BDBA 1MW3A 2DQFB 5FA3B 5IQMA 4IIQB 2N4IA 4NZRH 4JZOB 4K55A 2ROYA 2YUZA 1QSFE 3CVBA 2QPUA 4DF9A 3IJEB 2QKSA 4OM1L 4F8LA 5IEHA 2Y07L 4N90E 2HMID 2YO3A 5CSBA 2A74A 3A4AA 2DJ4A 1J1OH 1U8OB 5EBLB 5H4YA 2X6VA 3EJJX 5KSAB 2FK9A 5D1QA 1QNZH 4ZI8A 1ZA6B 2BHUA 1FL3B 4GAFB 1F4WH 2UYLA 4M7JH 3HJEA 4YDVA 1E2WA 5G4NA 1INDH 3LKOB 1WWCA 1CYGA 2IGFH 3HOGA 4ZK8A 4DQOL 1TTRA 2G0KA 5KSUA 1XCQA 3CIQA 4C8XA 2J8OA 1WEJH 3B2UC 2F61A 3FQ4A 2DEYX 2AERT 2J6EH 4H25A 1DVFB 4RISL 1HHIA 3UEZA 3UO1H 5DUBA 1QLEL 4O02B 1QRNB 1UM4H 1XGYH 3N85L 4GYBA 3BZ5A 1NCIA 4NUJB 4ONFH 5D6DC 4K3DH 1BD2B 2XZAH 3HRZA 1VFBA 2WXRA 5T8IA 4AW4A 1YEKL 4I4WA 3AAZB 2XTJB 4TULH 1OCWH 4DEPB 4FTVD 1F4XH 4XMLH 2BSSB 1QW8A 2QPFA 2C9RA 1FG2B 3CC5A 3UTZB 1HL4A 4GNKB 2CKNA 4ALAC 1LNUA 3C5ZD 3BVXA 4MJ2A 4R7NB 1BIIB 1TLKA 2VDOB 2NSQA 2X5PA 2Y5EA 5FOJA 1LK3H 2RIKA 3SDAA 3DVFA 4P4KB 3HC4H 5A6MA 4LHQB 4FQ1L 4LL4A 2W65A 3LQAH 3VRJA 4D3CH 4YFEA 1AMYA 4PB9H 5J6SA 2WLIA 1K3ZA 2NX5E 1UOVA 4XHJC 1KCBA 2VDQB 5DJYB 4P23B 5JORA 3KPLB 4HUXA 4RMTA 3T8VA 4DPCX 2FUQA 1QBAA 3MBED 2WINB 4R7DA 1MCKA 3S4SA 3ULVD 4MYWB 2X53A 4ILDA 2A9AA 4L4TA 4N9OB 3ROOA 3TPUA 4DGIL 5I19L 3JVGA 4WTXA 4P5TC 4HPYL 5FGBC 4UM9D 1OEZW 3PV6B 3AG1B 2GY5A 2JFCA 1H3PH 3DETD 4EOWL 3MRCA 2C7FA 5EO0A 2ADFH 2IQAA 3P4MA 1OL0A 2YEZB 4P5MA 5AZ2L 3HVNA 2G3ZA 3G6AB 1CE6B 1XR9B 4NQDE 1CU4L 1JZ8A 3JUYA 4PCTA 3AG4B 4FNUA 3G9AB 1AOZA 2J4WL 1Y1DA 1ADWA 3DMMC 2UWEF 1GSKA 5IP4A 5LO7A 1ADQH 1A7BA 4ZO8A 1BQRA 4HT1L 1F6FB 3AFLA 3AWEA 2Q3AA 4WEBH 2BOBA 3KEHA 3OLIA 1NFIB 1R3LB 3M1OA 5FK9A 3WY2A 4KRPB 1KB5L 1J8SA 5F7YC 1ZS8A 5BV7C 2AXFA 5J06A 3NIGE 4JDEA 3UG3A 1WUZA 1N3NA 2P5WB 4I85A 4DVRH 3EYQC 1NFKA 3B3BA 1I7RA 1YZZA 4PJGA 2KL6A 5IJBC 4NO3B 2EH8H 3VI4F 3L3HA 3K91A 1JF6A 1VB9A 3T2NL 4YIQB 3GSNL 3U2SA 9CGTA 4RA0C 2Y5QA 5MEND 1E5ZA 5BRZE 3FTUA 4AL8L 3AQZA 5DJ8A 4PGBA 4OSUH 1XWVA 2GHWB 4QO1B 1LDPL 4Y5XA 1J05B 1QKZH 5LCVA 3MREB 5IMMA 5F9JB 1IEAA 2NCMA 1T22A 3B9EA 4WSKA 4AM0B 5BXFA 3NUKA 1HXKA 3BT2L 4WHTA 5EOQL 3WUZA 2ICEA 5DZJA 4KK8D 5HHPA 1MCHA 4Z95H 4U3SB 4Z77B 3WFBL 2Z0BA 2ZUYA 1I3GH 2DY2A 4TUKH 4XB8A 5D2LA 3QQ4B 3UAEA 4OM0H 3WNJA 2YD1A 4MB1A 4IBUA 5KSVA 1J88A 4MTMA 4HWBH 4KKPA 2X1OA 4IKLA 2BSDA 1FAIH 4P2QE 1MJUL 4OQ1A 2YHGA 4WCYL 1X4ZA 3BZEB 4Y9GA 4JHAH 3QFDB 4TVPD 3TZVC 5E1IA 4FQHA 4N8CL 4RBPH 1L0XA 4WTZG 5T5NG 4TSCH 2R2EB 4N2IA 4DFHA 4Z6AT 5DVMA 2APWA 3SCMD 4JDVB 4U6VL 2AK4D 3L1OL 3ZO0A 1PPIA 2IH3A 1RJYA 4KFMA 1Q4NX 4ZFOA 5JLZA 2PXYC 3FH8A 3OKOB 3ZT5A 2HH0L 1NIAA 4GB9A 4U7KA 4YDLC 1MNUH 4XNZC 2J44A 1HTYA 3ROLA 1VSCA 2HFGL 4ODUA 1DEEA 4YNYA 4CKQA 4ZMQA 3SD5A 1AQKH 3UABA 5TF1H 3S2CA 2QQLL 3K4DA 4WW2F 3X1NA 2BVPB 1SBSH 5C6TL 3KPNA 4N0YH 2DWDB 2WTRB 1SHWA 3MBEA 5IMOA 4U3XA 1ZT1B 4Y2OB 5HP5A 2IANA 1AI1H 2NW2A 4GXUN 3GQFA 1U95A 3MRQA 1QFWM 5FKPB 1R17A 5IUCA 3DHUA 3FHQA 1BFOB 1F4XL 2DAVA 1T04B 4PJDA 2JJWA 5DJZA 1NEZA 2ZXDA 3FQWA 1DBAL 4LLDA 5IB5B 3W11C 5KJ4A 2OKMA 1OGPA 2UVFA 4I9WE 1EMTL 4JGJA 4PRPE 5CEZL 1GSMA 3MV7E 4KX9A 4ENED 4WKZB 2XUWA 4G6JL 1T7XA 3QNXA 4QT5B 1R34A 3DJSA 3JWDC 4OZ4A 4GUOA 1KTCA 4RWYL 3MNWA 2DYSB 4OD1L 5I1KL 1O0VA 2A38A 4JVUA 5FPIA 2JIXB 5JYLA 4AMKL 4H20H 2EH7L 1MFEH 2X4RA 1TT6A 2AQRA 1FGVH 4OJFL 1KGWA 2H7WA 4AUJA 4E5XA 1KN2H 1J0IA 5JW3L 2XG4A 4YXLH 3BLPX 4CVZA 1MWAH 3ZX1A 3R0NA 4K8RC 3FF7A 3O11A 2GT9A 2XYBA 4OZGB 1CFMA 1CL7H 5DWUH 1ECYA 1FZJB 2BP0A 4GRWH 2XXCB 4OFVA 5L2KA 2XZCH 4DOHB 3MLUH 1GL4B 4QGYA 1B6UA 1AXTH 1KCSH 2CQVA 3GZQA 3X3GL 2CIIB 5MENA 1PKOA 2C1OA 2VMEA 1UCBH 1M1XB 1YEEH 5FX3A 4H8VA 1CICA 5SWQB 3EIFA 4KJYA 4NYLB 5GRVK 1HWHB 5ANHA 3TV8A 1J5CA 5FM4A 3ARDC 5LHDA 1CLYH 3ESPA 1RJCA 2VLRE 3MCLL 2OMXB 4AEIL 4XBGA 1QFOA 3T0BA 1ZANH 1PX4A 2XQYG 4KO7A 2VLJE 2K7QA 5DJDB 5JHLH 3HZKA 1QYGL 2PCPB 4ODTL 1ETJA 3PFUA 1DQJB 1JRHH 4HCFA 4CGUB 4EI6A 1JVLA 2BIHA 4FADA 1ZRUA 1OQOA 4RGND 3WIHH 3OAUL 2PYFB 3Q43A 3E8UH 1Z7JA 4JFXB 2Y36L 5I5RA 1JP5A 5K39B 2OYPA 1U8IB 4JANA 4UIKH 3VXOB 1M2VB 3TBSB 4IK6A 3DI2B 3QJHB 3VXSB 1KJ3L 3QORD 4XMXA 2Q86B 3HRPA 4PJ9C 3BZFB 5CR8A 1FBIL 1HHKA 4D9RE 1EHLL 5C3TA 4ZW8A 4I3GA 2Z6FA 4ANWA 4J6RH 4RRPA 3OKLB 5D6CA 1G9NL 3I6LE 4FLOA 2ZOTA 1K5WA 5GZOD 2WLYA 1AOHA 5TE7L 3WFDH 1JD7A 4HFWB 1QQDA 3IWUA 4LPVA 1T6WA 2TRHA 4HF5L 4BIKA 1L3WA 2CK0L 4CAGA 1G6RA 3P40A 2X09A 3ATFA 1BW8A 3LRKA 4YHNA 4BKTC 5J13C 3O4OC 4I1NB 2B59B 5PAZA 2OMYA 2IPUG 3C5SB 4R90L 1MJJB 2GC4C 4Y2LA 1FAIL 4WV1B 4AUUA 1TSRA 1WWAX 2R8SH 1HZHH 2XKUA 4K5LA 3KWTA 5EZJB 2F58L 3FULA 3QJTB 3L7EB 3ASWA 3RX5A 2ZPKL 4DWHA 4MCYA 3QW9A 1BZ8A 4OTXL 4A7TA 1WPCA 3F8UB 2AVFA 2XACC 1NC2D 1V3JA 4JFHE 4FULA 3F05A 4HSAC 4WK2B 3TTSA 1KV3A 3S88L 1XGPB 1FIGH 3CN3A 2JKNA 4HIJA 3VM5A 4WO4B 3MZGB 4Y1AB 5TH2B 2IOOA 2CKBH 2ZOKA 5CD3B 4HC1A 1JGDB 2X10A 5CINL 1OQXA 5E9DD 1X5IA 1MNUL 3F62A 3V10A 4V1DB 1V3KA 3OC8A 4FTVB 4GH7B 3Q48A 1EGJH 1A7PH 5KANI 3EFFA 2DM7A 3FMGL 4GS7C 1F86A 3H42H 2EYRA 2DW5A 4LLMB 2PTUA 4JFPA 2IAMB 2J1WA 2JQZA 4X4ME 4FFZL 3IDUA 1UJ3B 3ARBD 3VW3L 2A6DA 4PJCF 1IBGH 3SE3A 4TV3A 3FOLA 1BVNT 1N67A 5L6YL 4ZW5A 3ZE0B 5ISZE 1N64L 1U0QA 4MA8H 4KXBA 5A2BA 1EO8H 4FZ8L 3ZGIA 4FQCL 3BGFC 1S7WB 2BNUA 5C0ND 2HRGA 1LK2A 3MJWA 4OLUH 5EU5A 1IZKA 32C2B 3KDMA 1S7XB 4UTAA 3MACH 5E2UL 1U2HA 3FKUS 4HKZB 4R4NC 5DZNA 5KVFH 4L8SB 3K71A 2CALA 2VAJA 3TN0B 2YPLD 3CFDB 3O3AB 1IC4L 2APVA 1XR8B 4FP8L 1TZGL 5FDWA 4OF8A 4UT7H 3LZPA 2VDLB 4ETQB 1M7DA 5I75B 4PH8A 4BFOA 4UM9B 1RFDH 3GSWB 4R7LA 1R0AH 3P9WB 1JMXA 4MFHA 2AK1L 4AIOA 2YPKA 1NCCH 3CX2A 1N9PA 4NNYB 5DJ0A 4G8GD 5C97A 4GP5B 4ODXB 4DK3A 2H6UA 3K1DA 3MRBB 3D0VB 3VQ1C 4A37A 2NNCA 5I1EL 5JO5A 3FB7B 4LPTA 5EZOL 5FUZL 5I16B 2OSWA 5DD0H 2Y2TA 2GFBA 1TETL 3MYJB 3VI3E 2SEBB 3CFUA 1WFNA 4GQPH 4JB9L 1N19A 1Z5LA 1WO2A 2NOYA 3GHPA 2FLMA 3EYFA 3KPSA 4LCCC 2CO7A 2YD9A 3ARZA 4I48A 1JTPA 1YPZA 1YEGH 4XMZA 1JPFB 2BSCA 3CMOL 4G80A 1JXKA 1CLYL 1Q94A 3P73A 5GZOA 5GQBA 2DDQH 2KZBA 1EAQA 2PABA 4GQ9L 3RWIA 2FX8H 2W88A 4I13B 1IJ9A 4N5EC 4JVWA 4DGYL 1TVBB 1YYLL 2GKIA 2ZX6A 4AQ1C 3LSOA 4JG1H 2FJFB 2OULB 3L81A 4W81A 5ES4B 1IM3D 4O2FB 4JRLA 3E80A 1CGSL 3CFQA 1T5WB 1OV8A 2ENSA 1I8MA 5BOPA 3A67L 4QHNB 5T3XH 4IIQC 3VTAA 3WN6A 3RA7H 3GO1L 2H32A 5CGTA 4FQPA 4NZUH 2QGEA 2N56A 1T1WA 2OMNA 4V2CB 4OFPA 4YVNA 4HCRA 1V8HA 1OM3H 5MP6L 1QW9A 4S1RL 4UV7L 3MJ6A 5IFHH 5L2JB 1WS8A 1Y18A 1YEIL 1L6PA 4XCYB 3DSNA 5KSAC 3TH4T 3KLHD 4KTEH 1TCRA 3BO8B 1WTLA 1VFAA 4WHDA 3O81A 1SPDA 1KZYA 3GRWH 3ZHDA 4EPSA 4U3HA 4M5SA 3HG1B 5JW5A 5IBTH 2VTFA 3KW8A 2WNKA 3FN3A 5C08B 1ZLDA 4UT6L 1OP3K 1DVFC 1A6PA 3DVGA 4D8PB 5M95B 1PZAA 1QVOB 5JR1L 2EYTB 5IQNA 3UTTD 1F3JB 3L5XL 5IBUB 4Q56A 1WTGT 3BSZH 3SCMB 4MZ2A 2AK4B 2MMXA 2XTJC 2NXYD 3HI1A 1L7TH 4IGBC 1NLDH 3FO1B 5DS2A 3CHRA 5I1CH 3DX8B 3HE7D 1XGZA 1E0OB 3DBSA 3LIZH 4P5SA 2COQA 3U0TB 2D0HA 4JFFB 4P4KC 2IALB 2R9HC 4BFFA 1OD9A 5C0RH 1T5XB 3EBGA 5C0DB 4HYTB 1SJHB 1LXMA 1W72A 4Y19D 3F04A 3QUKB 1NMCB 1YG9A 4K15A 3ZDYF 4G3YH 4KUZH 4NQTA 4XCCH 4Y4HC 1USQA 5I0WA 4JKLA 1UCTA 3SE8L 1CK0H 4P23C 2OXHA 4F57L 3P0VL 1OALA 1OW0A 1NOLA 3BP7B 4LPXA 4H8UA 4NN5B 5B1CA 1JE6A 5BOZG 4Z5RA 1BAGA 1S9WA 5B38B 2ICWA 1BMGA 4LQ1A 1INQA 4EEEA 1T6VN 5EZLA 2FWOA 3CE1A 4UF7C 3U6XA 4G8GA 5FYLL 2OYMA 5HDBF 4JFVA 4XNMB 4ORZC 4L9DA 3WKQA 2WB1A 1LP9B 5TQ2L 3ME0A 5GGVY 5JDSA 4BZ1L 5B3JF 5L0QB 3ZL1A 2OBGA 2X4QA 4RSVA 4X7FC 1NAKH 4P46B 3OPZH 2WOYA 4PRHA 3U9UB 3ZHLA 3RYMA 5KS9B 2X1XR 5D6DA 2EE3A 3HAEH 3RHWF 4CU8A 3FQNA 2EAEA 2R0ZL 1YQVH 4NNXB 4LSRH 4RAVA 4X6DE 3VFGL 2CRIA 1QG3A 2PO6D 2VXVL 5I66B 1E30A 3CG8A 3L6FB 4LSVH 2MPVA 4HK3J 4M1CD 3CFCH 4P57B 2UWEA 2DOCA 3F6IA 1SYSB 4ODSH 2UZPA 4PGJA 1XHHA 1T5KA 2DQTH 3FCTB 5DZPA 4OT1L 1OZUA 2YAPA 1IFGA 4GKSB 4PW9A 5HGBA 1WV7T 2BIMA 3GSRB 1RMFL 2OTPA 5AW7B 3II1A 4E5XG 2YJLA 1KELL 3RU8L 3WNPA 1H6UA 2CM6A 2PCFA 3MNVA 3ZHKA 2DM4A 1AAJA 3VI4A 3QI9D 4HISA 4NPYA 4PV9A 5FR3A 3VXUB 4CC0A 3S36X 5IJDC 4HAGA 3KYOB 5DI8A 4JQIH 2H1PH 1F8TL 4OLZH 3V4LA 4BFEA 1F3RB 4EZKA 3FTWA 3F7RA 5FV1L 4QCIA 2ZYIA 1OSEA 1I1FB 2O6DA 1RK1B 3ARFB 2UY6A 5L8LB 3PFQA 4PSRA 4BUQA 4RGNB 4UU9B 4EIUA 1YEGL 4O51B 5D1XB 3HZYB 4JKNA 5FGBA 1MY5A 2X1QA 5E0QA 1HILA 4FMFA 4HS6B 3S96B 1B0IA 1T80A 2FYYB 3BIKA 3EJCA 1JK9A 2XPGA 4IKNA 4PAZA 3TCLB 5CJQH 2H6PB 4JZNA 3ESNA 3QORB 4AEHL 4JFWA 5F6HJ 1G4MA 4MSWB 5JHDE 5GRJH 4AXWA 3UTTA 4PRID 3GB7A 4EKXA 1PZ5A 3RA7L 3AG3B 3APDA 1P4IH 4MNGB 5AW3B 1YJDC 1FE8H 1UM6L 4NKMA 3DMMA 3IFPA 2CDGA 1IBYA 1GPOH 3HE7A 1TJHH 1MQKL 4WY7H 1HH6A 4KJQC 2ZX5A 4HS8H 1XXDC 4HUVA 1TCMA 1JCKA 3D18A 4QRPD 2VKWA 3II2A 5BO1L 1KFAH 2BSBA 3FCSB 3P2TA 4Y19A 1HL5A 1HKFA 2X2HA 1HNGA 3KAAA 3TGXA 2FTAA 1SDDB 3TWCL 4KZEL 4RRPG 3AROA 4RMQA 1I8IB 5SWSE 4K7PX 1T03L 3AXLA 3AU0A 3COOA 4JO4H 2VSCA 4M7KH 2UXGA 1GAFH 2VXQL 2VDMB 4WW2A 1NC2B 2H3KA 5T1DH 3VMOA 2P52A 5I8KL 4PR5A 3BRDA 2P8LA 1MFDL 1NCNA 4YHKL 5F7UA 1EVUA 5BS0D 1AR1C 2NW3A 2DQJH 4PP1C 1FGNH 5DK3A 1V7ML 4WU5A 5E9DB 3GHBH 4TOYH 2I5YH 4OIIH 2H0PA 3D3VD 5IHWA 1TNMA 2IDCA 2Z7YA 5F7LB 5C0RL 1HXYA 3KE0A 4Z76B 2EVHA 2DQGL 2OQJB 5AB0A 4PSPA 4UT9A 4KDTA 5FHAL 4LSTL 2WOBA 2WV3A 2PO6A 4BDVB 4HPOL 3S3SA 1LM8V 3EYVA 1SNRA 3T1FB 3TVMD 5FF6B 4M1DL 2OR9H 2IPTL 4KVCH 2MRYA 3KM1A 1DDHA 3QEHA 2MOGA 2C7UB 4Y5VA 3KPOA 3A21A 5JZ7D 3LZOA 3LNGA 1P7HL 3REVA 2QTEA 3MLTB 4R0LB 4U2ZA 2PXYA 1GZQA 3MO1B 1Z1WA 1JZHA 1RHHB 2WQWA 3ETSA 3F7PC 2AABL 4QDGA 1N4XL 1AKJB 3WFCL 1A9EB 2C3WA 3JT0A 3HLAB 2YPLB 4KK5D 4M56A 5GGTH 3MODH 2D7NA 4Z7NE 1L7IL 2HPOA 3TESA 1QSFB 2VSKB 2ZXBA 4K3EH 3UX9B 2BNQE 2F5BL 3ZUCA 2B3RA 4DEUA 1K5NB 1RIVL 4XPAH 3VFOA 4N6RA 4BWTA 3BPNB 5HHQA 3RWEB 1BQUA 1DQDL 1WHOA 3D07A 4FG4A 4RDBA 5T1MB 2GITA 3BDYH 3E38A 1JGUL 5JIKA 3V52H 2F5AL 1YMHA 1YAIA 2A9MH 3NZUA 2AQ3A 4LBEB 2PWDA 3QCUL 3BP5B 3Q8BA 4TLKA 5K59F 1THCA 3P9MB 4GO8A 1I3RA 1QSEE 4JEGB 4ZAKD 2AQNA 2FEJA 1JMZA 3RWFB 2IG2L 3MGOB 3OMAB 1RJZA 1OGAB 2GTQA 1EH9A 3HKFA 4PYGA 3L2MA 4LDOB 3ZT7A 3BWSA 3JWNH 2WLLB 1FNGA 1DANU 4JRYA 3F7VA 3I3EA 4DUWA 4O00A 5CSZB 2X1WL 1QI4A 1A3RH 2X6CA 3H2QA 1X4YA 4W9KC 3S98A 3ZK0A 5KUMA 2G3NA 1N59A 4QD2E 3RE0A 4LNVA 1BF5A 2A5UA 3WIIH 2A9CA 5IIEA 3W39A 3ZYIA 1NCWH 4ABQA 5BUGA 3D87B 4XC1L 3D52A 4QRPA 3D39E 3S34L 1F11A 1U3HC 2RH0A 4I0KA 5DHVB 2GTZB 1HL9A 1EO7A 1HN1A 3CDZA 2DZEA 2WB7A 4XXCA 1JBJA 1WFTA 4QY8B 1A9VA 3BE1L 3KWWA 4M6OL 4ZPVA 1CURA 4LAJH 3LIUA 1C5CL 1Q9LB 3BYTA 3LJ3A 2C8NA 1TFHA 2DQHL 2NZ9C 3QG7H 5KYXB 4WV1C 4IQHA 4ZXBC 3PGDA 3ARDA 3I02B 1URLA 2VN7A 3HNSH 2V2XA 4D9LL 1G6VK 3GMOA 1CD0A 1ET5A 1QABA 2EC8A 3B3IA 4M1GL 4G6MH 1IV8A 5BS0A 2BVYA 1KEMH 4KO6A 1FF5A 4JGUA 3H8NA 3C2SA 4WTQA 4LESA 2HFEB 4ZDHA 1EZUA 2A1WL 2XKNB 3IKCA 4LGRB 4N6QA 3AMLA 4XAWL 4WO4C 1LJMA 3BWAB 4JPWH 1MH5A 3D3VA 3THML 4R4FH 4K5NA 4OV5A 1SXCA 1X4XA 1UM5L 2V5RA 1R3KA 4KQ4L 2AJSH 4DN3H 1JPGB 4ECNA 4LEEA 1QTPA 2AP2A 2D7MA 4OR1A 3T6XA 2FO4B 3NFNB 1TVHA 3O6MH 4FMVA 1Q9KA 3QQNA 4G11A 4HA1A 5GGVL 1WQVT 5E8OB 4NQDB 4YDIL 3WAJA 4PJ9A 3ABMB 3NSDA 4JHBA 1QFUL 1SEQH 4AEEA 1PKQB 4IRSB 4P04A 3BKYH 5K69A 3N6YA 2ZUTA 3RNQA 3K0WA 2DIJA 3MV8E 2X28A 3IDIB 1HI6B 3EUDA 4OF5A 5T3ZH 4F37F 5EEZA 2IAMC 4LT7A 1OTTD 1UJ3C 1JHTA 4I2XE 1XV8A 4FQXD 4PJCA 3SPGA 3VFTA 2VUOA 3K2KA 1X5AA 4H5SB 4YGAB 1H3TA 1OSYA 1U36A 2AXGA 1KT2B 1D5BA 1FGNL 1P5VB 3C2AL 4TS6A 1CLZL 3CTTA 4JPSA 5E4IA 1MHHB 4HG4K 3QG6A 4BD4A 4W6XB 2C9UA 5MI0B 4OLWL 2I9LB 1CXFA 3G5XA 3VM7A 4KROD 1U41A 5FO8A 2OMBA 1HQ4B 3QFJD 4JY5L 5CGYD 3TN0C 5GJTH 3BQUC 4HXAL 3E9TA 1DQVA 1BDYA 2XN9A 2HG5B 4JFSA 3SPIA 5DUMH 5FGRA 4PCKA 4XP5H 5I75C 4LLUA 3MLRL 4MZIA 3V0JA 4R7VA 1O7SA 5C07D 4HKBA 5ICUA 4GIOA 2WLZA 2Y06L 3R19A 4BQ9A 3V4VL 1KIPA 1N0LA 3NQKA 4Q7DA 2R7EA 5D7EA 2VE6B 4F33A 1KDIA 4C56D 1TMQA 1MLBB 3Q3GA 1PD1A 4N2BA 4S1DD 2BIOA 2R56L 1YNKH 5EUKB 5ADPH 3VX1A 1I7UA 2TSAA 1H5BC 2ZCHL 2XA8H 4FNQA 4I89A 1I53A 1FL6A 4UB0L 1A4KA 1XIWC 2QR0B 2ZX7A 5AEAA 1R5IB 4X50A 3FUJA 5JHMA 4OUUB 5IMLA 3S3BB 2Q3ZA 1JL8A 2XN0A 2KS0A 2DQEL 3BN9D 3V7AG 1CVSC 3DX1A 2A4EA 3PJSA 1F18A 4ZUTB 3QI9B 3IXAB 1RAMA 1NC4A 3C8DA 1DJXA 1BVNP 3TURA 2H1LM 1DSFH 2MJWA 1PCXA 7FABL 3VXTA 3D50A 4MAYD 1IGMH 4QHLA 5I8CB 2NQCA 1PY4A 2BVOB 5I1LB 2VSMB 3G6DL 2W9DH 3PQYD 4WJ5B 2C4FT 4FKKA 2GI7A 2VXTH 1JSYA 3INUL 3ZO9A 4N2FA 2G9HA 3D0LB 1AGDB 3F58L 3GLZA 1Z9PA 43CAB 4PBWD 2YZ1A 2JWYA 3LZFH 1E9PB 4M62L 3ULUH 3TFKC 1CB4A 4L8BA 3VCLA 2HJLA 3SDDD 1ZIBA 2ZUVA 4ZS6C 5HYEA 4PVMA 2WXFA 4QXUH 4TUJA 1P7KB 4JVPA 4K9EC 4PRIB 3NVQA 1WBYA 4XH2A 4X6BA 4E9WA 2EIBA 2HKAA 1I9RL 3OX8A 3EJUA 4AQZA 4CUCA 1QA9A 2NY4C 2Y1VA 2UZYB 4OCRH 4BQCA 3MJ9L 2A73A 3DA0A 4DUVA 4H0HB 3GSVA 2BVTA 2QT6A 2XDHA 3MJ7A 4RQQB 4Y2DB 4ONHA 4GQRA 4CVUA 3G08B 3I9PA 2NY6D 4LCCA 3U6RA 5D7LE 4BV1A 5EA0H 2ODIA 3JWDL 5A6LA 3SZKC 4O9HH 4PJ5E 4FQIH 4EDXB 1A4AA 3NA4A 4FQXA 1N2RB 5DVLA 2X1PA 5GRZA 3I74A 1EFXD 5GRUH 4ICXA 4AQ1A 2MKLC 1KCKA 4AC2A 4DKEL 1YEHL 3L9BA 4OLYL 1PD0A 3T2OA 4D0DA 4W9IC 2B77A 4Z7WF 4G82A 3QPXL 2OK0L 1WC7B 1IAKA 4D2NA 1ET7A 4HS3A 3UJTL 1WCBA 5JQHC 1OT2A 3IRCA 2WVVA 1OK8A 4OGXL 5A3IC 4F15B 3X13A 5EU4B 3QIBC 4X9HA 1U93A 2DI9A 3MNDA 2BZDA 5J1AB 3RUGF 4ATWA 3C8KB 1BZOA 3LH2H 1MJ7L 2H0FA 3O6ML 4DTGH 3UC0L 3D2UA 3TNMB 4MNHA 4XN5A 1AD0B 4HLZG 5MEQB 2F15A 1RZGA 2F7QA 4PRDA 3OMNB 2FYVA 4P05A 5IFJB 4FLHA 2ALAA 4KUCF 1W16A 1PZ3A 4ACPA 2W94A 1JJUA 2F54B 1E7UA 5F9WB 4GKOA 3NZHL 4NJ9L 2V7NB 3DUUA 2BPBA 2Y2WA 3P4OB 3W0WA 1KTKE 3ARWA 1MFBH 1DVFA 4N2GA 3TVMB 1QLFB 4P46C 4TPRL 4MNQD 4NRXA 1JYXA 1QRNA 2QLYA 4NUJA 5LBSL 4O5LH 2ATKA 2W1NA 3BD3A 3VXRD 2CLRB 3V5HA 5F96L 5T5FA 2ZOLB 2BSSA 4Y9FA 5I30H 3LKRB 4IGBA 2ZX9A 2R4SH 2WCPA 5EO1A 3UTZA 1WAAE 3CAFA 1QZ1A 1YN7A 4YLBA 1J8HD 4FFVC 4DFIA 1JV5A 3L9EA 3WD5H 1S5HA 4JCLA 3O2DH 5TD4A 4A55A 4PN6A 3TEXA 4PGDA 2YD3A 4IBLT 3T2LA 3BH8B 5DD6B 3TTYA 4CDHA 2BCMA 1NCAH 4MAYA 2XY2A 3TS8A 5ICXB 3BZDA 3ARXA 4Y4HA 1BQHG 3IE4A 1RKRA 3NCYS 3P0GB 3RWDA 1KY7A 2YAMA 3PQYA 2IDSA 4P23A 4L3ED 5IW3A 4GUPB 4E9TA 1DLHA 1R9FA 2D3LA 4NAQA 4Q89A 4XO3A 3SJVE 2E7HA 2EVGA 2XA8L 4ZAKB 2J5WA 1AHWA 4JUTA 3ARFC 1UZ6E 2NY5C 3PF2A 4LIQE 4DESA 3QCTL 5CZVL 2DLFH 3O6FB 3SDDA 5IGXH 4ZS7H 1G9ML 4J27A 4F1ZA 5D1XC 3CDCA 1QEWB 4BCZA 3EHBB 2DWYA 1IFRA 4HWEH 2F19L 3PXHA 5C9JB 5MHSD 5TQ0L 3CBRA 5DUPL 2NLJA 1H8LA 4MMXC 2RD0A 3BSHA 1NCGA 4XMKH 3OM3B 4LSPH 5K9QI 1T3FA 3DX9A 2QQKH 3H3KA 3FS9A 1SXNA 2EICA 1NFDE 2WD0A 3H9SD 3RVUD 1BVLA 3G6JF 3FTYA 2CA3A 4QYOA 1A3ZA 2QKIC 3S35L 2W9DL 1REIA 1TF4A 4UUJB 3HVDA 4HUUA 3HUJE 3T77A 1NFIA 2EEFA 5IBLC 4PJXA 3QAZB 1F4AA 2V5YA 4K07A 1MG3C 1S8DB 2VWEE 4OCWL 4DO4A 5HI5C 3WEMA 5HVHB 5L7XL 2CHNA 4AIEA 2WAHA 1WGOA 1CBVL 6FABL 3NDZE 2WVTA 4GI8A 1C5DB 4M8RA 2XFXB 1Q0YH 3FTVA 4KITB 2YMOA 4LDLB 1MCFA 2AEQH 1ZTMA 2GSGA 3AW5A 4OCRL 3TT3L 1HSBA 1B4RA 1HKLH 5E2TH 2VL5A 3V4PB 5F9JA 2ERJC 3KGRA 4AM0A 3AQXA 3CFIC 1UXSA 5FKAB 1OTSC 4ZMNA 4Z77A 3OKEB 5DEFB 5CJ8A 4FYRA 3RQ3A 1A0QH 4EQ2A 1NWPA 1EXGA 4X6CB 2RGSA 3SQOH 2ZOOA 2HFTA 3CFKB 4X9YA 3EDDA 3K2MC 1P9MA 4H0GA 3TIEB 5E00A 3O3DB 1U33A 1S3KL 2ZTBA 3VXRA 5A40E 2XVBA 1MXDA 5LGHL 4DGVL 3JV0A 3Q44A 4AGMA 3BP4A 4BGLA 1VKXA 3DK2A 3CVHA 5AKVA 1YC7A 3UTSB 3V2AR 3PE9A 4JDVA 1B2YA 1KPRB 4HV8B 3O4LE 3JT2A 4R0LC 3VQLA 4IKJA 1U3HD 3BISA 4BCYA 4DHLA 1CI3M 1G7JB 2AGJH 1WDAA 5BJTB 5D96B 5IQOA 3FNKA 1T20B 4GSRA 4PVLA 3MR9B 1K6QH 4OQTL 3EOAA 5EF2A 3D9AL 2XNAA 1WF5A 2WBJB 2BXYA 4DQAA 2BVPA 2VR9A 3CJJA 4WHCA 2VN4A 3BPNC 2Z31D 1D6VH 1F42A 5C07B 4W1TA 1D5IH 4FQ2H 1LQSR 4OZHE 5EC1A 2EIZB 4X7EC 2HKFL 5GGQH 3SKOB 1EAPB 1L4IA 1YEFL 3G9VA 5DHEA 5IHHA 1PBYA 1RZPA 1ZK5A 1DJHA 3QNYA 4JR9L 4L3AA 5FGCE 1ZSDA 3VFNA 3PY9A 5IB5A 4F7CB 1T1XA 2YUXA 3L17A 4D9QD 1ES0A 5E2VH 3QCVL 5KYUA 1DBML 5D70H 2DJSA 1MAMH 4XMPL 3IGKA 4WZ9A 2CUHA 5IB3B 4I5BB 5ITBH 3IYLW 4BFGA 5SX5H 2YPVL 1CMOA 1AQ8A 2UZIH 4U1SA 4L37B 4CVXB 4C57C 3MN8A 4HU2A 4ZBJA 5BZDB 1AGBA 2MQ3A 2W59A 4FNLL 2B2XL 3P0YL 6CGTA 3DGGB 2DD8H 3WKNA 4PGCA 3KXFD 2BY1A 2NY1D 5AVRB 3V9CA 3ZE2E 1CFVH 3A6BL 4GAAA 3SIKA 5FS5A 4RDQF 2WXNA 4KKAC 4OZGA 3KCPA 1EXUA 1FZJA 4XWGH 1EEZA 5HSFA 1OLZA 1RZIA 4ZOBA 3O41A 1L5GA 3GZPA 4H13C 2X2IA 3L5WA 5C0CA 1DYZA 4BBWA 2DYRB 4G7YH 3DX4A 4A2LA 1RP9A 5F21B 2VDOL 3FB5B 4NYLA 5IVXF 2WXPA 3TJHC 4DPRA 2ENJA 1GIGL 3U4BH 5KYWA 4UTBA 1AG0A 4XNXL 1XGQB 2V5TA 1U8HB 5DGQA 3K7UA 3U1SL 1E3XA 2QGDA 5IW1A 1W0WA 5GS0H 4LL1A 3DROB 5I17A 4PJBA 3EW3B 2F8XC 4GRMB 4RX4D 1KYOJ 2VH5H 4YFDB 3C87A 5AOMA 4GXUM 4ZO9A 3FO2A 3IMBA 1WIPA 3CZGA 1E6JH 1TYJA 4L8DA 2DBLL 4YMPA 2VLKD 3LEXA 4JFXA 4MWFB 1PG7L 1NTDA 4AZ8B 4Z18A 4EUPA 1CFNA 4Q8BA 3R1GH 4KGLA 4W4OC 1MN4A 2ADGB 3NGBB 4FYTA 1EFXB 3P3SA 4G42B 3LEVH 5AW2B 5H35A 1Q9OB 1TJXA 4XPFH 1HWGB 4NP4L 1WE5A 5LAXA 1JNJA 2DMBA 2C34A 4WNSA 5CEZE 5E08L 3X3FH 4OKVB 3DPBB 3OKLA 1U3HA 2OFQA 2OI9B 1ULVA 2LU7A 3I9GH 1AS6A 3UL4A 2D7QA 3BUIA 2EACA 2XBDA 2ZP0T 5ECGA 4AX3A 3MLYL 1KLUA 3CK0L 3JTTB 5GGSA 1I4FA 4Q9BA 2YAHA 2V7HA 5GRYA 3U48A 2A6IB 2DQUH 2H6OA 1NIBA 2B1HH 3HPLA 2QHRH 1A0QL 1Y0LB 1RP8A 3CVIH 3UYRH 2P42B 4ZXBA 3CSGA 4URTB 4OFYD 4JFQA 3BPLB 4Q9QL 2ESVB 6PCYA 4KK6D 1X9UA 5I1IH 1MCQA 3KYAA 5ESQB 3RZCD 1DVUA 3MNZA 5GGRB 2WWMD 2QQNL 2EABA 1LO5B 2FX7H 4WFHE 2X70B 5I0DA 1QMUA 1DJYA 1GHFH 4GW5B 4NAJA 1M7XA 4EBQH 1WA0X 5DO2C 3V8OA 4LNRB 5T1KD 4GG6A 5FYKL 3TA4D 1NM4A 1MREH 3FCGA 5D7IE 1KJ2B 1TU2A 2P24B 3MGAA 3Q0HA 4MNQB 4B41A 2BINA 4KUCD 5CD3A 3EH5B 4HIXH 1IC7L 3UTQB 3DURA 5AKTA 4XCFH 4PJ7B 5EU6E 1D2OA 1TQVA 1YY9C 4AIZA 3D0AA 2P8PB 3NACL 3TM6A 4MBOA 1QBLL 2B0SL 1J8HB 2R0LH 4XI5D 4G1MB 1ZJBA 2G5BB 5INDA 4GAJL 4CW1B 4LK4A 3RPIB 2NT0A 1G1CA 4L4TE 1KENL 3ZKNC 1S7QA 1OCOB 2NY0D 4HGKC 4NDMB 5ACLA 2JTDA 3UOAB 3C6LB 3IJHA 4RWHA 1NBYB 4ZNEA 4L3EB 4O4YL 4OLXH 4UAHA 2IBBA 4V2BA 3SO5A 4ZTOL 2R1YB 5D70L 4LPCA 3MQIA 2CU9A 3EOBA 3FUMA 5AYUH 3A23A 1U4EA 1ED3A 3ZIYA 3DUSA 5DT1H 3U7WL 2B4CC 2Z7UA 1T89C 3WTTA 2J56A 2GJRA 4XE0A 2TSBA 4ZUUB 3UH8A 3BQUA 4IDJL 2DI7A 3CFDA 3O3AA 1XR8A 5AAMC 4XP6H 2GPZA 4AE0A 5EEUA 1A3QA 1DQMH 2IFGA 3GZOA 1UWEH 4CSTA 3NIDE 5E51A 1A14L 3GSWA 2Y7LA 3CXDH 1WBZB 2EXWD 2HSIA 4QEGA 2J1KA 1FWXA 1VGKA 2MCMA 4NNYA 1KCLA 1CFVL 2AXJA 4PEEA 5IG7B 1ZTXL 3L4YA 3P9LB 4F2ME 5BQ7A 4MMYB 3CDYA 5TK2A 4WUUD 4Z7VA 1E5YA 4NZ8A 2GCYB 3ARVA 1JK8A 3UAJD 4Y16B 2A6KA 3EDJA 3BAJA 2YD8A 1E5BA 1U8JA 1W8EA 2KYIA 1CFTA 3IDJB 1ZA3B 3B9DA 3IJSB 1H5BA 2ZWYA 1N5YH 4OGZA 1BLNA 2WW8A 1XIWA 1P5UB 4NQEE 4XP1L 2ZONA 3W9DA 2BS9A 4YK4B 1ZHBB 5C92A 3QRBA 1U8CB 4U1HA 3TV3L 4ZMTA 3ULVH 5DDHB 1JHLL 3O0RH 3E6FA 1Z3GH 2O5YL 3GNML 5F89B 1PLGL 2FJFA 5GHWL 5MEPB 3SE6A 2VH5L 4FX5A 1KIUA 4K0OA 5C2BL 1XB6A 2CO1A 2QVFB 3H6JA 4HSQA 1XBDA 3OHXB 1SLVA 4B3EA 1UOKA 4NERA 1E8YA 2X4PA 5IKCA 1OAJA 1F90L 5DQDL 1R75A 3B5GA 3S37L 3A6CH 4F15C 2PWHA 4FFYA 3NN8A 1GZPB 5E2JA 1O7VA 4YE0A 3ZTDC 4JMXA 4IOSA 1MF2H 3CFEA 5SWZD 1ZPLA 3FU5A 4XCYA 4G9FA 5TE4H 5T1KA 4Z9KB 2GBVA 4BH7B 5HGAA 1GYAA 4HETA 4XPFL 3CH1A 3CN2A 5B4MC 1J0HA 1NCBL 2OM5A 2QJDA 3WO3B 4JL1A 4KKBC 1JZEA 4TTDD 3L4XA 2R4RH 1MRCH 1ANUA 4YDJA 2JCCB 1SRDA 3ZDXE 1DVYA 1WWWX 5LG6A 1O9ZA 4FLSA 5I5IA 4KTGA 4PY7A 3EAKA 1UASA 3APCA 2OMTB 4G70B 1A21A 1JXDA 2DLIA 3C9NA 1LEKA 2DIAA 1AQHA 2A77L 4N0FA 3T4AA 3WL9B 4ELME 4PJ8D 5I1JL 2ADIA 2JB5L 4UWQB 5E95B 5I6KA 1BIHA 2D31B 4UQ3B 4PTUB 4X98B 4B7IA 5ESVB 2IADB 3HB3B 4R26L 2F7RA 2FLBT 4CN6A 5AYTA 3DX8A 5E6SB 4ZJ9A 2OL3B 2NY2D 2GJ6D 3DX0A 1A6ZB 2AQSA 4KKCD 2J8UE 1DFBL 4JHZA 5DQ9B 3SB3A 3KD4A 3SGEH 1HHGA 2PW1A 2BVQA 3LD8B 2XY1A 3F12A 3T0DA 2XV0A 1S7SB 3HFMH 2EADA 2GJZA 4Z7OE 1KOAA 2ZSVA 1NIDA 3QDJE 5C0DA 4J8RB 3OKDA 3QUKA 1KYOK 3DX7A 1ZJAA 4NO0D 3MVSA 3O8XD 1EO5A 3QIBA 5JXAL 3N50A 3QEGL 5K1JA 3QUGA 3S97C 3TJEL 2IQ9H 3BP7A 4RESB 3O6LH 1FN4B 4J6IA 1EEQA 4RBPK 1UZGA 4J3OF 5KVDL 2GK0A 5AZUA 4X5XB 3BESR 1KXQA 4N22A 3OJDB 2RFXA 2WIIB 5LCVL 2FH6A 4FFWC 3CQPA 2Z93A 1CZ8L 3O6FC 3W2DL 1HE8A 3PWPD 4Z1PA 4P4RA 2D03L 2A6JB 2Y6SC 4OLEA 3UAJA 5F7HA 3SKJL 5FW7A 3SGDH 2OR7A 4ONGL 2WMPA 3E0GA 3F7QA 3EBHA 1IX2A 2J1YA 1G6RH 1OTUC 1M71A 3GF8A 4NT6A 4P46A 4P48A 3U9UA 5B1AB 4J4PC 4E41E 5A16A 2ZUSA 2P47B 1MG2C 4TLTA 4EN3D 4QAWA 3IPEA 3HR5B 1ML0A 4MJHA 3WUWB 5DT1L 1UXLA 1PDKB 2JJTC 1FPTL 1RVFL 1RZJL 4PI0A 1MCDA 2XXGA 5CU5A 3G6JA 2VRQA 2PTTA 4YSOA 5IMKB 5F7WC 2VR3A 4KTDH 4X80H 4LSQH 2C9PA 3D8MA 4MMZB 1D5ZA 2VUKA 3JZ7A 1P4UA 3GSQA 3FCTA 1A1MB 1R24A 1T66D 3GMMB 3QAZC 3T8MA 4N2LA 3TBBA 2FX9L 1U58A 3PGFH 5HVHC 3VO0A 4PB0H 4YHOL 1HXMA 4KJPD 4ODBD 5E5UB 2Q3XA 5D1ZD 3HTLX 5AOLA 4HC1H 3UZVB 4HWUA 1E4XH 2AJZB 4KAQH 1YC8A 3HA0A 4XOBA 2B5IB 5BVPL 3US9A 4XRCB 3NRQA 3WEBA 3BEVB 4OFIA 1E5UI 1O6VA 4WU7B 1M7UA 5DQJA 1I7TA 4QF1A 3PHOA 4XNUL 5HI3D 3WLBB 4OU3A 2NY3D 4HH8A 5J7CC 1I1FA 2YWYA 3V0VA 2CZNA 3BVNB 4PJHE 4L4VB 3UG5A 5F93C 5ETUA 1E5AA 1P6FA 3NDYE 3PUUA 4NUGL 4UU9A 5GSVB 3W56A 2ZUXA 3WFHB 3ZRCC 4XO4A 1JWMA 3U4EA 5F8RC 5D1XA 3HZYA 2HLAA 2VC2B 4G83A 2JF1A 3S96A 4XZUB 5KVMC 2Z7ZA 2FYYA 2H6PA 2ZG1A 4K94H 1TPXC 3LEYL 1T21A 3SODB 3BUYB 4MMXA 3P4LA 4ADIA 4ZMLA 2V37A 4MSWA 4YO0B 3QXVA 3CHOA 4NM4H 4UTAH 4TVSa 5E4AA 5HD8D 1X7SA 3ZTNH 3B8YA 1DVSA 4M7ZB 5C0AA 5FYLE 1UKTA 2APXA 2E46A 2YBGA 2GBTA 2QKIA 4RNRA 1FIEA 1ZE3C 1QO3B 2GJ6A 2IPKA 2P9RA 3N04A 4OGYH 3W9EB 4IU2A 3BZ4B 2Y3NA 3HPJA 4MRBA 1QBMH 2ZWLT 3A4DA 3V55A 3N1QC 3ZDZE 4LEXH 1J1XL 4LCVA 5E8DH 1ZLUH 2P48B 4JDTL 1HIMH 1T7VA 5D96C 5EC2A 1E28A 3IMVA 3O8XA 5ENWA 3BVWA 4E0RB 3VXNA 4HCIA 5ANMB 3RZCB 4W9CC 1XF3B 1JV2A 4ZTPH 1LE9A 4Z8FL 3KCWA 4GKNA 2YAOA 1YNLL 4OCNC 3RUGB 4WWNA 2NX5D 2WBJC 3M1BB 5AUMB 3UAFA 4QRRE 3X12B 3ZKMC 4CNIB 3V0WH 4FXGB 2IO5A 1PIGA 5IQLA 1NLBH 4YSCA 4QRTA 2BDNH 4NZTH 3VXMD 1OOAA 1KN4H 1KEGH 3VE0A 2CGYA 3BYYA 4FQQA 1B0RA 5J6HB 5IHZA 4MQXD 3VMPA 2YFNA 3TBWB 3AGVA 5JOPE 5I18L 2BFVL 1MCNA 3P4NA 1MCCA 3NIFB 2NXZB 1F58H 3RILA 1KGJA 3WS3B 2CE6A 4LOEA 1YECL 4QRQB 4EN3A 3HFML 2H32H 3Q6FB 4OGQC 5DJCB 2YUVA 4TVPL 3ESVF 1X7QA 4HCRH 1ZAGA 4ERSL 5T1LD 2IJ0C 4LXFA 5IVNA 3I75A 4DW2H 2NY0B 3N1GC 2ROXA 4A6YB 3CV5A 3GSOB 2A9DA 4YPJA 3PP3H 4R0LA 2XZZA 3LKSA 4P2OB 3HG0A 3RP1A 3MO1A 5I6MA 1TZIB 5CD5C 4NI3A 2XWEA 5FCSH 3WLWD 4JZJA 2OTWA 5I15H 4MKMA 2J2ZA 2DF3A 3VXPA 1KSRA 4JFZL 4M5ZH 3B2MA 3IU3A 3KLAB 3JQOB 2AAAA 4GLRH 3F84A 4C4KO 4I7ZC 1QSFA 4KQ3H 4Q6YA 1Z5YD 3FUKA 3PWVB 1OSPH 1K5NA 3JV6B 5DHYA 1JI1A 5BRZD 1SBBA 1KPUB 2BNRE 2JLPA 4XCEB 1RERA 2PNDA 3BP6A 1JUFB 4KK9C 1OE1A 3GI8L 2N7AA 5ERWB 4M7LH 3RZWA 1Q0XL 4WUUB 2ARJB 3CFMA 3U30B 1TJGH 3WDIA 1IEBB 3TBTA 3OKMA 4R2GC 2J25A 3V6FA 3RWFA 3I2CH 4R5TA 3TO2B 1DQQA 4NQCD 1I8KB 1A6UL 3FRUB 1UH3A 1IKNC 3QA3B 2OSYA 4L8CB 3MJ8B 4MDIA 1A3LH 4X7TB 4JHWH 4EIGB 3H6AA 2I07A 1GVIA 1NCDH 1W72H 2OJZL 1SM3L 2YXWA 3QQ9C 4NRZB 4P2QD 1WRFA 3MOBL 4GAYA 3BVTA 3K6SA 4JFDD 1CGTA 4KAQL 3O6KH 2YAQA 4Y5YB 5HTSA 4B0MM 3I6GA 2P49B 3EYOA 4AG4H 2AEPL 2OI9C 2K3HA 4N2KA 5C8JA 2B1AL 2VKXA 1MPAH 5ID1B 2GTZA 3VFMA 2W95A 1HE7A 2ZYSA 4PWKA 1JNLL 3FSVA 4IBSA 4KHTL 3CZFA 1H0DB 3X11A 2OAAA 2VDNB 5AD0B 2CBTA 3Q2NA 5B1BB 3WXVH 1TYEB 3FQUB 2NX5A 1U2CA 1A1OB 2YD0A 4HJ0D 3I6KB 2JSFA 2OMUA 3EDFA 3WEAA 2BIQA 1UD2A 3BPLC 4AWJC 1OD7A 1FYHB 4DZBB 5AB1A 1N7MH 4JQVA 2NY7H 2ITDB 4J3SA 5JNYA 1EUTA 3QJVB 1C16A 3ABGA 4UDTA 1PAZA 5IVZA 4ALAH 4UQ2B 3RFRA 4PBXA 5D5ME 3PWUA 1EHKB 5DWPA 4E36A 3CXHJ 4WJKB 5C09B 3L3DA 4X7DC 1MAJA 4TQEH 1XVSA 2FR4B 2YSSB 4YN3A 5HHNB 2YMXL 3SDCC 3DO7A 5FYKU 3QDGE 1BZQK 1OP5H 3TL5A 1HH9B 3WTSA 5JQ6H 3MV7D 1SN5A 4PJ8B 2K78A 1S9XB 4PHZA 3NFNA 2R1XA 2BOCB 2BZ7A 3IWVA 4X6DF 3V9EA 4NQDA 3LPWA 1D9KD 1CFBA 3EBIA 3R4DA 1G7HA 3LVEA 3HBZA 1SJEB 3B7YA 3PHSA 1HWWA 4H1LB 4ZX5A 3MNMA 3ALWA 5I1AB 4J2XA 5F1OB 1HQRB 1MCIA 3CGTA 5CKAA 2WXOA 1JGEB 1PGRB 1RULL 3QUXD 1A4JB 1UKSA 4GSDL 1JD9A 1AD9A 1F4HA 5IBUG 4NO0B 3BH9B 3B8SA 3O9WD 3BUTA 4U0RB 3C6LC 2FATH 3RKPA 3BUDA 5GSRB 1J0YA 4WEMB 4S1QH 1S78D 5BRZA 3FH5A 1DL7H 5D2NB 4NQUA 1FO0B 3BHBB 3V7AE 3LAFA 2WXLA 1JVOA 2HT3C 4LHJB 4Z23A 3IM1A 2COVD 3SDXE 3WAKA 3HE6D 1JI2A 2HG5A 4P2CG 3ZSSA 4Z0BL 5D7HA 1KUMA 3U6XS 3NH7L 3WJLA 3B7RL 4L5FL 5KSBB 1I1AD 4G6FB 1I7ZB 4J3OD 4NWTH 4AKOA 1JN6A 2CO6B 2VLJD 2VDML 3CLEH 3P54A 3EOYG 5BV7H 3T6QC 1K85A 4HXBH 3VD7A 2VE6A 5B38G 5CIPH 2FT8A 2Q76B 3G5VA 1J7VR 4P2QA 4APQB 4Y16C 1QWHA 2XIIA 3HBGA 4IKKA 4HLZH 2Y72A 1KJVA 5EUKA 2P46B 3CLWA 2QADD 1ZD6A 5IB4A 3VWJD 3CDGA 1NDGB 1P5UC 2BRRH 5GS1B 3RLSA 1U8QA 5BOJA 4YK4C 3FQTA 1XH3B 4JKWA 1FV1A 1KG0B 1ZGLB 4TUOB 5D7KE 1Q90A 5D1ZB 4UV4L 3H3PL 2WZ0A 2B20A 1A6TB 4PJAF 4HIIB 3O2WH 4JUSA 4BSVB 1AIFB 1Z5HA 4XHQA 2ZKMX 3FO0L 1SHSA 3OHXC 4U6XB 1UB6B 4OW6A 1JF5A 5E70A 1MHEA 3C75A 2B9BA 4RFEA 3Q9QA 1PJWA 1A4BA 1VEOA 1NGZA 1A5FL 3P3RA 2NY3B 3HC3H 4LOVA 2V3EA 4MS8C 3T0ED 4XAKD 3BXNA 3UJIH 1G7MB 3A4FA 3ILQC 3VH8B 5J6GB 4F8NA 4KKLC 4UT9H 1KB5B 4IRZH 1Z2KA 5B39A 2ED8A 5A2LH 3OMIB 4I0PC 3JYCA 5I73B 5EEYA 2XQ0A 1SGKA 1IIKA 1TZAA 3UXFA 3SBRA 1UYWH 2D3VA 1VGEL 3BUPA 4QOKE 4AQEB 3FTXA 2WKGA 3QIWD 3M8OL 3MRRA 4U2YA 2BSED 4JFHD 2IGLA 1P1ZA 5GS2H 2ISDA 2WLNA 1CR9L 3K8KA 1XCTB 4PRPA 4UNUA 1DVTA 1UA6H 3MV7A 4ZRGA 1AO7B 3LS4H 2WO2B 4ZMXA 2EE6A 4QTIH 2C26A 3O2VH 4M43H 3MRNB 5EO9A 3WYRA 2EO9A 1D9KA 3ZKXB 4UBDC 4UQAA 1ZHNB 3KBEA 2DQMA 4G8AC 3TO4C 4Z7AA 1RZQA 1AP2B 4ES8A 3MMEA 3R7RA 4LLYA 5I1GL 2FJHB 1BYOA 3MRPA 4GP8B 4EXPX 3E6HA 2OZ4L 1FVCB 4HBCH 4NJAH 2F53B 2FEDD 3DO4A 2FZ3B 4LHUB 5E4EB 1IM9B 3HB3C 2I60H 1N7ML 2I24N 4D8OA 2OMZB 4WGVB 4YSPA 4YZFE 4NRYA 2YK1L 3LD8C 5ISZD 1C08A 1YMMB 2XYCA 3UJJH 5JUEH 4Z7NF 1WHPA 2NNFA 4AYFB 7PCYA 5E6ZA 2EEAA 4G9DB 3N42F 5B8CB 5EU4A 3DSFL 1WZLA 5J1AA 4NO5B 3VXMB 2FO1A 2ETWA 1KBBA 2PR4H 1E8XA 5CGBA 2YEVB 3EDKA 3QEQE 2L04A 3PAUA 4Y4KC 1R4XA 2IH9A 2JXMA 2IC2A 2VLRA 3V4UH 1J10A 4AOFA 1I1AA 3KPMB 4MJIB 3ZU8A 3VDCA 2VLJA 2MEJB 3QQ3A 3RG1C 2VIRB 3NJXA 2NR6D 2E74C 3SQBB 2YRPA 3O3EA 3LHAA 2WKOA 3ZTEA 4N9GA 5F7BA 4N24A 1R5WA 2FHBA 3DHJA 3TX4A 1SOXA 4ZQKA 1Z3RA 5D8JL 3ERXA 4JK0D 4JRXD 1IAMA 3AY2A 4ODHL 1ACYH 4LP8A 3WKMH 5LWYH 4P2RD 5I8EB 3WMQA 4JN2A 2EDWA 4KMLB 1ORSB 3BGMB 1JPSH 4P3DB 4PLJD 3RIAK 1SQ2N 4LPUA 1I8LC 1NAMA 2WJ7A 4WIQA 1L0YA 2C1PA 2GSIB 2ZOLA 4HUNB 5G5DB 4WUKH 5TDOB 1LTXA 3FB6B 3S3CB 5ALCH 4Q0XH 2HX7A 3PGCB 4L18A 3B2VH 4RAHA 4MMZC 3P11L 2CHDA 4HOXA 1DBBH 1CTNA 1EDHA 1UT9A 5C0EA 4CILA 4KKRA 1BG9A 1PFCA 3V6OE 2EUXA 2R2HA 3MRGA 5GIRB 3FT2A 5HHME 3IDXH 1PY0A 4YGVA 1QX1A 3CXHK 3MRFA 5KOVC 2B5IC 4XVTL 1BBDH 4K5MA 3WCYA 1K4DA 1T1YB 4TSAL 1LEIB 3RIKA 2P7TB 1TDQA 2Q7AA 4HJGA 5K9KB 3QIWA 1DBJL 3QXWA 3UP6A 1M6UA 2BSEA 4POUB 4YH6A 5IVOA 1MUJB 2J5LC 4AVHA 1FNSL 1T4WA 5LXGL 2EUVA 1HNYA 1CXIA 4Z0XB 1XF2B 3S7GA 4JFDB 3GT6A 3DBXB 4FHKA 5DEGB 2H26B 3PHQA 3X17A 3OZ9L 3DX6A 1T0NB 3MXVL 4J4PA 3PAVA 3K72A 5ITBL 1PLAA 3NA9L 4K3HA 3FHEA 2ZUUA 2VITA 3PWLA 3DV6A 2MQ0A 3H7LA 1X9RA 5HHOE 4PUBL 3QIUB 3HC3L 5GRVL 2JJTA 5A43C 2HVJB 4MCZA 3VUAA 2VDPL 5F9OL 3LKQA 4UT9L 2WXJA 2V2WA 4X4MA 2IFFH 3G5ZA 4FNTA 1AZNA 35C8L 5KZCD 1XF5B 3BOVA 1DN2A 5F3BA 4BXSV 2EEXA 1JYVA 4CN4A 2G0LA 2WQUA 3D69B 4C47A 4HZLA 2HJFB 5EIVA 1AGCB 2K8MA 1KCVL 2QGBA 3DJ9A 5T3XD 5ADOH 4I77L 1E6OL 5HYJD 1GS8A 2AQTA 3V4PA 3NZ8B 3V0GA 3HG5A 2AC0A 1N5AB 1M05A 2XTSA 5HHXH 4NWUL 2DMCA 3WFEH 3NIDB 3AZUA 4LSDA 1CGVA 3OD3A 4XVJL 4FYQA 2X89D 1S7UB 3GI9H 3K2UL 3SY0A 2WTOA 3TH2T 1RD6A 4AM0Q 4AYEC 2JVUA 3RI5K 1JZDC 2NXZC 2ZCLL 3MRLB 5EHFA 1YDPA 2BHYA 2WYHA 3UIYA 3ZTCC 3VSTA 4KI5C 3VI3A 5EBWA 4S1SL 3TP4A 1U6AH 5F72S 2VERN 3K8LA 3WIFA 3QUXB 1ZKAA 4YPGB 3UBXB 4G1EB 4QHPA 4KMTH 4Z7UF 1MDAA 3QUMA 4ORGA 3TIDA 3LN4A 3O9WB 1ZWIB 3NEOA 1T7WA 4TSBH 4P2OC 1ZT7A 5DYFA 3LY6A 3RY4A 1Q72H 2QSTA 4MB3A 5FYJU 2R0WL 4X4YB 4UILH 2FBOJ 1MI5D 2ZAIA 4K3JL 5D7JB 1A6VH 4FQLL 2GJPA 3HE6B 4QJ5B 1MCPH 4XB3A 4APXA 1IKFH 1JS4A 1V7NH 1WAEA 5TPWH 2R59A 2AJUH 2DTMH 5LWYL 2CRMA 5LNDA 3PDOB 5L88H 3PUCA 12E8H 5HYSA 5L4IA 3DXAE 4J8QA 2GIMA 1NGWA 1F6AB 1B4LA 3BAEH 3AUVA 3R06A 4X9IA 3ZSTA 5FOBB 3N2JA 4IU3B 5CP3A 1T2JA 4JAMA 2V3FA 1QFWL 2QVKA 2HKHH 3H1ZA 3Q1EA 1SJXA 2IH1A 2ZCZA 3CZSA 2BVEA 5C0BD 5GRXG 4EI5C 5DRNA 2FL5A 3OF6D 1SLWA 3VWKC 3N43F 2A9NH 2FBRA 4I5BA 1OPGL 4UTCA 1CGYA 3SE9H 3VWJB 4IRJD 4GBXD 5JXEC 3DVNA 5IROD 2H3XC 3K74B 1RIUL 3WE6A 1BQLH 1BGXH 3ECUA 1WG3A 3VRLE 4GKZB 5JHDD 2QELA 5CU9A 3SBQA 1U8MA 2VLLA 4Q9RH 1L0PA 1MWAB 2QHLA 2H3NA 4UIMA 4X5WB 2JK5B 4Y5YC 4GXVH 3FAWA 4HD9A 2GSMB 3GD1C 3V95A 5KJRL 2HWZL 3LX9A 4GRWB 4YC2B 1C5BH 4FYSA 3RL1A 1BWMA 3NSCA 4AENA 2X0UA 2WUCH 3NCEB 3UZQA 1KB9J 2XIBA 2GABA 5I76B 4NZJA 1NMBH 3ZLQC 3AB0B 3G5WA 2AJYH 1DQKA 3T0EB 3LRLA 4RAUB 1OB1A 4GMSL 5I1HL 2Y5TA 2BOLA 4CJ1A 3ILPA 4XVUC 3TF7C 4YX2H 1A65A 1B0GA 4AJYV 4Q14A 4X6EA 4R96A 1DLFH 2EYSA 5E5MA 1F45A 2LW3A 3L9RB 3RGVB 4O02H 3F00A 3AREB 5SWSD 3BKJH 5DFAA 1XGQA 4HUKB 1MW1A 3VG9C 2AJ3B 5T5FH 4DT2A 3QBTB 5GGRY 3ULUF 4V11A 1UWYA 2X89A 5LNEA 1GJWA 3MA7B 1XGUB 3KJ6L 1RUQL 2NQ3A 3MLZH 2OCFD 4HU8A 3L3IA 1IBFA 1AFVH 1IKNA 2WC7A 4NC2B 4ZX3A 2XXFA 1NJ9A 3MJGX 2P5EE 3KGTA 4G5AA 3RX8A 2YRBA 1RIHL 5T33H 5B7FA 1IBDA 3ECBB 1QLRB 4BK4A 4AZ8A 1YCSA 2D7TL 4JCMA 1HC1A 1TJIH 3OR6B 2ZXCA 2VDQH 1ZHKA 2HN7B 4NQQA 2PCYA 4RIRA 3RB7A 4LGSB 5CFAA 4FFTA 5K9OB 3IAGC 1I31A 3US0A 3BSZA 4X6DA 2CDFA 1FNEA 4QWWD 4XCNB 4P3CL 3KBPA 5B22A 4O2CB 1WAAF 2CBOA 2FJSA 1SEBB 4OI9A 4J3XA 4FCHA 2WZ6A 3IVKB 2WO3B 4P9HL 3V0AC 3LIZA 1C8PA 1CO1A 3H9HB 5EBMA 1OANA 3RY5A 3S9DB 4JG0H 4OKDA 3AXHA 3OAZH 3NG5A 3GXPA 5T1JA 2XWTB 2VWEC 3KWUA 3SYCA 2Y1YA 4GSQA 3X1BA 4U0RC 3OC5A 5IHUH 3F2LA 2MCPL 1PVHA 3STZB 5L8JB 3VFRB 4JPVH 5EULV 4M93B 1PQZB 4YHIB 1GZHC 5TFSH 2ZSWA 1HOCB 5BMFH 1BJ1H 2BNQD 5KBMA 1BD2E 5DD5L 4AV4A 2XTJE 2BP3A 2X4OB 1UZ6F 4I18B 1E67A 1IC0A 1YA5A 4D7PA 5FHBL 4KXZI 4I0PD 4LLWA 4Y4FD 1PG7X 4ZT1A 5JPMA 2E3VA 2YZ8A 3BAWA 3UP1A 4BKLA 2CKBB 4TNFA 1V10A 3EGDB 4JRXB 3IAQA 2HT2C 5FECB 1CLVA 1VADB 4F7EA 2BJMH 3SDCA 4MA1C 1QSED 2XPYA 4IRJA 4GBXA 5IROA 5C86A 3MLVH 5GZNC 1ZV9A 5D71L 4JFYA 4H40A 5ITFB 4APQC 5F7NC 3HHSB 4PS4L 5JHDA 4J28A 5AVZB 5LLIC 4F7TA 1E65A 1HYRC 1NICA 4X99B 4HFUL 2BO0A 2DYPA 1W2KT 3GINA 1SXBA 4NX0A 3V5KA 4K7PY 3HEIB 2O4EA 3T1WA 4G1MA 4DCQA 3TNNA 1HEZA 1JNNL 5KVGH 2IH8A 2XV3A 3KL5A 3JV4A 4QHMA 3VGBA 2XV2A 3LNFA 3RPIA 4N3UA 1G7QB 2FB4L 4N0CC 3QQDA 3D39D 1CLOL 4PRBB 3MUZ1 4NQSB 4PJEB 3BPOB 1WD8A 2Y7QB 3FK3A 1GC1L 5T5NF 3C6LA 4CN1A 2BMKB 4K7FB 1C8QA 4JFED 3IDNB 3Q13A 5DSCA 4IMLB 4MJ4A 4R3SB 1WVZA 4HLEA 3K1KC 4PPTA 1S46A 1WLHA 5SWSA 4F20A 4ZUUA 2VDRH 3L3KB 4P59H 8CGTA 2HTLC 1PLBA 2XQBH 1YJDH 4XNYL 3IGAB 4OD2B 5DFTA 4OF6A 3UCRA 5I73C 2ZNWA 4PLKD 3CVHH 1RUAH 2CGRL 5KG9B 1K9TA 1IC5L 1J5DA 4ZTEA 4KXCA 3TBCA 4JJOA 4GIPD 3WJJC 4WK4B 5KYYB 1QHPA 4KHXL 4AL8C 2P5WE 2DN7A 3SYQA 3H85A 3MOAL 4HJSA 4JM4L 2EKSB 5E6IB 4HHWA 4AQ8C 1FH5H 1O9VA 1HAUA 2XWJB 4JE0A 4KFZC 1N8ZB 4K71B 4WHYG 2BFGA 5DHMC 3VFSB 25C8H 4PP2B 5DJ2A 1KMGA 1ZA3A 1GGTA 1OARH 4QMEA 5AL0A 3GKWL 1G84A 1CF1A 5CZRA 2CO4A 2RHEA 4LLQA 1I9IH 5FYKE 2HFFB 2YUWA 1PZCA 2OCCB 2B14A 3TBYB 4B53A 4ODVH 1MNNA 1SY6L 5LNGA 2BWDA 4XOEA 4I1RA 2QZQA 4M5YL 4DVBB 3JSSA 5E94A 3EDEA 5MERA 3IETB 3PABA 4KVPA 1AS8A 5E1GA 4FZEL 2XIDA 5J5EA 4U3CA 2H8PB 4MHHG 3U36B 3OHXA 3VA2C 4PVBA 5DMKA 3F5WB 4U1NB 3FHAA 5DJ6B 3BCDA 5I74B 5LBVA 4AK1A 2GHZA 4DP9X 2BNQA 5B8CC 4N5UA 1ZDSA 5DJAB 5KTEH 5FUCE 4AY0A 1EJ8A