2Z64C

Crystal structure of mouse tlr4 and mouse md-2 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
QQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4
publication title Crystal Structure of the TLR4-MD-2 Complex with Bound Endotoxin Antagonist Eritoran
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2007-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2z64C00
4G8AC 3WEBA 3WEAA 3ULAB 5IJDC 3MU3A 3VQ1C 3M7OA 2F08A 3VQ2C 1AHMA 3RG1C 2HKAA 1KTJA 3B2DC 1NEPA 1XWVA 2Z65C 3T6QC 2Z64C 5IJCC 3FXIC 2E59A 5KWYC 1WRFA 3MTXA 2E56A 1A9VA 5IJBC 1AHKA
chains in the Genus database with same CATH superfamily
1T22B 1SXAA 4LASH 3UAFA 3KLHC 3GMLB 3MU3A 1J1OH 1BJ1H 4P46C 1CPUA 3U6RA 4F2FA 1YEWA 3BI9X 1BQ5A 1CLVA 1B2WH 1U3HC 3IJ8A 4M5YL 2Q7NA 1EGJL 1UKTA 1VPOH 3MOAL 1U8QA 3Q8AA 4FNRA 2ZXGA 3GI9L 3FUKA 4XO3A 5TFSH 3NAAH 4Q58C 4DEWA 5EBMB 2EKSA 2BCKA 4OLYL 4QRRD 5EBWB 3CVIL 5K39B 5CEXB 4FNTA 3RP1A 1G7PA 1KELH 4PG9A 1S7SB 4U0QB 1JNJA 1WIOA 2QPEB 1D2PA 1VLXA 2B59B 3WEBA 5EOTA 3JV0A 1A3QA 4JS7A 2XN2A 3D4GA 3EJPA 4WW2C 5KYXB 4MAZA 4D0DA 3IM1A 1WPCA 4Y4HC 2Y1AA 1AQHA 1XBRA 1URZA 3PQYE 4JFOA 1PLGH 3VXOB 4JFXA 2WZ6A 5I1IH 3IGKA 4JFFA 5AZEH 1S5IH 2CBQA 4MBRA 3TWYA 5CCHE 2N0KA 2XKNB 1AJ7L 2A1WL 1I9IH 1MUJB 2P5WD 3IWVA 3VB8A 1N4XL 3CSYA 4IU3B 2VMJA 5B3SB 2ESVE 3CXDL 2ICEC 2OI9B 3V0EA 5DJAB 1HYSC 5LHDA 3D6GA 4YR6A 3U6XA 3L08A 3DX8B 5FKPA 3MRNA 3ZDXF 2HJKB 2CLZA 3PS6A 1GGCL 3SQBB 1T1WB 1XGQA 1L5GB 5CKGA 1MHEB 4M7LL 4YZFF 4HS6A 3P54A 1FF5A 3MRDA 5IFAL 1XCTA 4B53A 3L5WB 2P46B 4JL1A 1OE1A 4PJFF 1CR9L 5C2BL 1PZBA 2D7PA 2HFEB 2X4SB 3PL6C 1N64H 5FM4A 2PYFA 3EFOA 5DJCB 3TIDA 1WRFA 4MMYB 1DBJH 4DGVL 3S8WA 3DETD 2WLZA 5DK2B 4ANXA 2OBGA 2FWOB 1XB6A 3D39E 4NKDA 4X7EC 4PRIE 1F3DJ 2VAJA 3BMWA 1AS7A 5HGAA 4CBPA 1ASOA 1QO3A 3L1OH 4NRXA 3U7WL 1IEAA 1D5XA 2WC7A 1J18A 1ZJBA 4G6AC 4HQQL 1JNHA 2NXZB 5FV2A 4R5VA 4HCIA 4H5SB 4BFIA 1UB5B 1O6SB 4PJ5E 3QT2A 1OP5K 5JUEL 1O7DE 1AQMA 2OYPA 3X1NA 2E86A 1GYVA 5I5IA 1W0WB 1ULVA 1CXKA 3K46A 2XT1B 3HE7D 3NN8B 4X7TB 5KOMC 3OGCA 4X7SL 2EIKB 1MPAL 5I1AA 2HT4C 4HVBA 2CDEB 1DEDA 3D4ZA 3X1FA 1T2JA 1JL8A 5FEBA 4TYUA 4G82A 2G4EA 3QCVL 2UUDK 3N41F 3KYAA 1U8JA 2FHFA 3GBLA 3C60A 2DF3A 4P2QB 3VD3A 1G7JB 2PWEA 5F9DC 4AL8H 1CTOA 1D6EA 4MYWB 5AL8A 4NKOA 1XDTT 2XPGA 2AEOA 4X9YA 4UI2A 3IKKA 2OP4L 4PY7A 1P7HL 3ILDA 3B83A 3NPSC 4U33A 3MRQB 5CN2A 2CRZA 2P48B 4AYFB 2XQYK 5C07E 3SDAC 4FLRA 4GBXB 1TEGA 2G3ZA 3GNML 1E9OA 3UEZA 1FGVL 4QEGA 1GC1L 3X11A 3RGHA 4KRLB 2OR7A 5MEQA 2X2YA 5C0CE 4R4ND 4IBQA 5I8KL 5IROA 2JJSC 2X0UA 3DURB 3I6GA 5I15H 5G5DA 3S35X 1B0GB 5D1XD 5IJKC 5FA4B 1MNNA 2X4UA 3KD4A 1RJLB 1X7TA 1F4XL 3V0IA 4R6UA 1TTRA 3U2SA 1K8DB 5IB5A 1N26A 4AMKL 4IGBC 2E9JA 3DPDA 1F3RB 1QR4A 3DV4B 1OM3H 2V5TA 4JANB 5AWNL 1J9SA 3T6XA 3SZKC 5HGBA 2J6EA 1H6FA 2AI0L 4MQ7B 4PS7A 3TIEB 1EEUA 5ITBL 5SWQB 3D08A 3MLYL 3FTUA 1U8IA 4JLRA 4P2OB 1WLHA 4YDVA 2XN9B 1XZ0A 4JDEA 1AZVA 3QEQB 4EXPX 1XFPA 4IBZA 2PPAA 2V3DA 4P5TB 5GZNC 4Y9BA 3T8XA 5D93B 5I1GL 4AYGA 2J6WA 1IM9B 2R23B 1KT2A 1DQQA 4MAUH 4YBQD 2DTSA 1T0MA 4ZPVA 1EMTL 3NIFB 3RL2B 1UOLA 2VN5A 3STLA 5C7XL 4NYLA 2H1XA 5EA0H 2VJ8A 4AQ1A 2IQAB 1HHKA 3BUTA 3QA3A 1OW0C 3VXUD 1QSEE 3HCVA 4PJAA 3IDGA 3VYPA 1MFEH 1J48A 3DSNA 3QRGH 3NPZB 5LGHL 3PIQB 1FYTA 2G2NA 2PP9A 1ZLSL 3S98A 3AITA 3DUUA 1N5YL 3LVEA 3MGTB 3NDZE 4X9GA 4XXDB 2AW2A 4QLWA 3TT1H 4QTIH 4FP8H 2R0KH 2UY6B 3BESR 2MJWA 1L0YA 1DVFB 4FULA 3VI3B 1KGUA 4DP5X 4DUWA 3AWGA 3MCKA 5T3ZH 5HI4D 3QFJB 1Z3GH 3V0VA 5JXAH 4F20A 1XD1A 3LNEA 4XCEB 2O6CA 2CBPA 4NHCL 3V10A 3B34A 2TSBA 1ZLUH 2ITEA 3U46A 3GPSA 3EDDA 1Z1WA 3SE3A 2RGSA 2EDXA 3ELQA 2AQ3A 1ZLVK 2WO2B 4P5KA 2CLRA 3T1FB 3RIAF 2A9NL 1F3JA 4YO0A 3INOA 5D7JD 1DLFL 5CN1A 2WKOA 3HW7A 4BFKA 2QSVA 3AG3B 2C9PA 3DGGA 5IK3A 4APXB 1BZ7A 5ADPH 1JHTB 3MV8E 4Z0XA 3K74B 3RPBA 2H6UA 2NXYB 1JS4A 3NABL 3NTCH 3SGDH 1KG0A 1RK1A 3UAEA 5CEZE 5FDWA 1A6WH 1C12A 4PJCB 2ITFA 3CZEA 3VXTB 4KMLB 1F3DH 4MMZA 5ADOH 1U8OB 2D3JA 3TEUA 1HH9B 3RDTD 4H4NA 4OFYD 4FDWA 3MLUL 5JZ7C 4LVHB 5AD0B 4UM9D 1ZV5A 1B4JH 2XYBA 1E5YA 2DYPA 1NFDB 3MI6A 5AW7B 4W9IC 4YEEA 4X5QA 2F5BH 2ICWI 5F8QC 5CP7A 2Z1KA 5D1ZA 3IRCA 1UACL 5HDOA 3MRKB 4J4PD 3LRHA 3KGSA 4GRWH 2PW1A 4JQXA 2PCYA 5IB3B 3OMIB 1UD3A 1WAAF 5KYUB 4NNPL 5H8DA 1OHZA 3DX3A 4Z7UA 5I28A 2VDRL 3WHE1 4KO9A 3QIWB 1YJDH 4NN7C 2AEWA 1KV7A 1WA0X 2C4FU 4HX1B 2H9GB 5ANMB 1YNTA 3CZSA 3VXSB 2X4NA 4MB4A 5F3HA 2XIIA 3S37H 4BKLA 4LCYB 1DBBH 4UBDC 5T1MB 1U8MB 2ZCLL 2FQDA 4NQED 4WSJA 3S97C 3WNNA 1YEIL 2C9RA 1JCVA 5LJYH 2WLLB 3JWDH 1D5IL 3KLQA 4GUPA 5KUKA 1MXGA 2AGJH 4JFDE 7PAZA 4LSSL 1WFOA 2EADA 3HZKB 4XR8C 5D5ME 3QWOA 5C08B 1KXVA 1C1EL 1U3NA 4J3OD 2NSMA 5B38A 1OGTA 3MLXH 4DK5A 5I30H 1YO4A 3L6FA 1BVKB 2FIRT 5D71H 3ZDWA 1R1CA 4NJ9H 3HG1E 2IFFL 5KVEL 1I4FA 2BINA 2DQCL 4KKBD 2YXVA 3BKML 2EE6A 4P59H 3JV4B 4Y2DD 1S3KL 4WUUD 2V3EA 2VLRE 4PJGB 3C5JA 3POHA 2X1QA 3ZO0A 2LW3A 3GJFB 1BEXA 1HH6A 2O61B 1NGZA 1PKQE 3TZVA 4LLVB 4PRBB 1MCOH 2VDRB 4KZDL 3GTTA 4L5FL 5DEJA 3TYFB 3VNYA 5HYQA 4AW4A 4AH2B 1H15A 1USZA 4M5SA 3OKMA 2CO1A 2BSTB 3C60C 3MACH 4FA8A 4J3TA 4W93A 5IUSA 3UPRA 1OIOA 4AVKA 3RVWD 2JCCF 3FU8A 1RFDL 2AQPA 1T5XB 1OAQL 3BDYH 1CJYA 1EUTA 3TF7C 1I1RA 1QRNA 1NMBH 5ETUA 3H9HB 4XPAL 3BVWA 2VXVH 4NNYA 4GAJL 1I3GL 2YD1A 2X4PA 5SWZB 4I9WE 4KAQL 5I17A 3HC4H 1IBDA 3RB7A 3VW3H 3QZNA 1L9SA 3VFVA 4URKA 5DD0L 3E9TA 3CU7A 1TF4A 2ZOKA 1S9VB 2DL9A 4PBWD 3V4LA 3IDNA 3MGOA 4E9QA 3QULB 2E8ZA 5GHWL 5IROC 4FAAB 4ZZFA 1QWNA 5ICXB 3CWGA 4G7SB 4PV9B 1QSFB 4H25B 5IBLD 3J07A 3EBHA 5IF0A 3LXCA 1I1YA 4YIQA 1KBWA 4R7VA 2R69H 4FN0A 2FJGA 4OZFG 3DPBB 2YWZA 1J8HD 1VACA 3QRBA 4YHYB 1LE9A 3LKRA 4OU3A 2K9FB 3QI9C 3MAWA 1DHKA 3C09B 3ZDZB 4CSSA 5K59F 4IHOA 4HUWA 5MHSE 4E5XG 4OBRA 4PJ9D 1A0QH 1MCEA 2GT9B 1XF3B 4OQ1A 1V55B 3ZE1E 3V4VA 1JWUB 3C6EA 5E94B 3QWRA 5IGXH 5KJRL 4NLHA 4OSUL 3BRDA 1DUZB 3RZWA 1DSYA 3GHPA 4PLNC 4JE0A 2IQ9H 1Z9PA 2QQLL 1IEHA 1X7QA 1A64A 3BPNC 3W0WD 3VFNA 3LPGA 3WI9A 3WTYA 3DSFH 4XRCB 3TO4D 5ANHA 3VWKA 3GMQA 5D2LF 4C4KO 3UTSE 2KH2B 1G7MA 2BSBA 4I2XA 3MRHB 1SOKA 2HKHH 3QIUD 3TBVA 4UTBH 2CJTA 4I3SH 3PP4H 5F2FA 1Q94B 4LHUB 1SM3L 1C5DB 1PZ5A 3EO1A 4F8LA 5I71B 3MV7E 1IGFL 2Y1ZA 4RX4A 3SYOA 3B56A 1HNGA 4DFHA 2YMTA 3NJIA 2V7HB 3QXTA 4AQ1C 2ZP9A 3LPOA 5HYJE 1FORL 4HK0B 2HTKC 4E9WA 2GVYA 2GAZA 3SE9L 4HMEA 5D8JH 1E3ZA 1DFBL 3D7PA 3RY4A 1GA2A 1CFSB 1E5UI 1SBBA 4MNQD 2H5UA 1JHLH 1B2YA 2Y1YA 3IFNH 3ZTEA 4L3AA 1AAJA 1CB4A 4EI6B 5AAPA 1QABA 2VAAA 1NPJA 4HLJA 1E4WH 4LEXL 3QEUB 4XP5H 3ES6B 1HHHA 3NZUA 3KJ6L 4TN9A 1Z9NA 3TBBA 3THML 1RXLA 1M3IA 2VM4A 3O2DH 5DC0A 5DMKB 1OCWL 3JYCA 2CK0H 4HF5H 3V4PA 2ZX9A 1UM5H 5TK2A 3O8XB 3UIZA 5DEGA 4BFNA 4G8GB 4OZFB 1E4HA 1EXUA 3FT1A 2GB2A 1JPFA 3SE3C 3NJVA 4NQSB 1CVSC 1EEYB 2R39A 2NY5C 3HHMA 1JV2B 3MCLH 3X1GA 1WZ1L 3FZUD 1CDIA 1NWPA 3PLYA 2YEQA 3FFCB 4KUCF 4EZJA 1CLYH 2CO7A 5CCKL 4R4FL 3HN3A 1TTGA 4G1EB 5C0NC 2WQUA 1KYFA 3OJMB 3UIYA 2H2SD 3U1SH 3SJVA 3ZT5A 4JN1L 4HIJB 3HC3L 5J8OA 2CKBL 4ZTOL 4YSUA 2D3LA 4Y16D 2W1NA 3OAZK 2XPZA 5I5RA 1ZLDA 4KH2A 1RJZB 4N8UA 1BAWA 2VZSA 1T1XB 4MMZC 3T4YA 4A68A 3APCA 1P1ZA 3AMKA 4QRPD 5EZIL 5LNDA 3WKPA 5E1AB 1KSRA 4OUOA 3W39A 3ZDYF 1TPXC 4HIIA 4PUBH 3VFPA 4H2CA 4PV8B 5ESVB 1IC4L 1AH1A 5AOJA 4XPHL 4B0MB 2BXZA 1T6VN 4M7LT 3WD5L 1E4XI 4A66A 4UV4L 5KBKA 3ZTNL 4QHUB 2WSKA 1RERA 4BZ1H 2ADFL 3IJEA 3VXMB 2D0GA 4CAGA 3UJJL 4AYDC 1BZ9A 3PP3K 3LS4L 3MYJA 4ZW3A 1NLBL 4CU7A 4K23L 1AO7D 1USQA 1JK9A 3G6DL 3HI1A 3H8NA 5D9SB 2MMXA 3FB7A 1ZT4B 1BD2B 2VC2L 1EIBA 3O6FD 2OMWB 4XX1G 3QFDA 1ET5A 5IHUH 4QRQB 1I1AD 3O0RH 5GJSL 1G7IA 2P5EA 3V6BR 1NJ9B 5HHOA 2FBJL 2DW5A 5FA3A 5DGRA 1WG3A 1A1OB 1FG2B 4QRUA 3HAEB 4G8EB 5LUMA 1NC4D 3RTQB 5AFAA 2AANA 1M7DB 2C8NA 3D25A 3ILPA 1INDL 5ABAA 1Q9LA 2P8MA 1E0OB 3DVGA 4Y4HB 2FEDD 1PY4A 4G9DB 3GUFA 1KXVC 2DQUH 2FLMA 3HUJE 3MQIA 4KPHL 3TPUA 5ALCH 2B1HH 1SEQL 3SBRA 3SYAA 1XGTB 1FNAA 1Z0NA 2EECA 2DJMA 3ET9F 3WL9A 3NSCA 3PYCA 1AOZA 4FJ6A 1IC1A 5DD5L 4JZOB 3WO4C 2YD9A 4I9XA 4NZDA 5DJ6B 2IALA 3EYUH 1NBVH 3EHBD 2ZX5A 4P04A 3RIAK 1KJVB 3RZCD 1SJHB 4O5LL 3U9PH 5KAQF 1NCAH 5IMMB 4HIEB 2OMTA 2Y23A 3GMOB 1HWHB 1S9WB 4NCC2 4UILH 3LRKA 3TZVC 4Y5XA 1ZANL 3KPRB 4NQQA 4GEIA 1PJ9A 4OFKA 2J56A 4NQDD 2OS7A 4TKWA 1XF5A 1MNUH 4EOWH 4IKKA 5BMFL 3O6MH 2OJ1A 3VFRB 3LQAH 5SWSB 4HC1L 1M71B 3B8YA 4JFED 4TUJA 3BIBX 3PL6B 4BFGA 1I8IB 4A6YB 4Q56A 1J8SA 4JZNB 5HDLA 2EXWD 1FE8H 3PFUA 3FQTA 3PNWA 4OF5A 4R9HA 4DNLA 12E8L 2ZYRA 1MHHA 1HQRA 3RAJL 4F33A 3Q0HA 2VL5A 2F54D 1G9NC 1WFUA 2DM4A 5D4HA 1KENL 5EN2A 4NUGH 1TZIA 5F0MB 3IDMA 3FT0A 5KSVB 3DXAA 2YARA 3GSNL 4KI5C 1KBKA 3N5AA 4L37A 4X0NA 5INCB 5LCVA 4ZMVA 2XX1A 4F58H 1U58A 3LEXA 1MKFA 2IAAC 5EZOH 2A9ML 2E9IA 3LN5A 3RKDC 2L7JA 1YN6B 4U6TA 3EH4B 1UEMA 4AJ0A 2J4WH 4JGJA 3FO1A 1Z32X 4GUQA 5JXEA 4MB1A 4XBPA 1KJ2H 1JGEA 3PY9A 3QNZA 4ZBJA 3ZKMD 2VOTA 2XNAB 1P6FA 1T7YA 3VI4B 2VRKA 3MODL 3W5MA 3EW3B 4WO4D 1SDDB 5IUCA 1KNOB 4AXWB 2A74A 2AERT 3RX9A 5KSAA 1AR1D 4X4XA 5FC9A 5I75B 4NCC1 4CU8A 2WLNA 1YEJL 1XGPB 2DWDB 1GPOL 1RIHL 3CN4A 4DVBB 1FCGA 4YXLL 1XH2A 3NZHH 2G2RA 3FTGB 5J11C 1EAQA 1IBYA 2AV7B 3VWKC 3CVHH 1SOSA 3P69A 4FQLH 2GCYA 3FT3B 2NQDA 5F70A 1MJ8H 3MRBB 3UJIH 4CADA 4ELKB 1FFQA 1RHHA 3KLAA 1R0AL 4OI9A 2YXWA 5T3XE 3Q8CA 3HPLA 2ENQA 2HCZX 3R1GH 2YAQA 4G6MH 3AMLA 4X6DE 5KVFL 4AEIL 2NY1B 2CLVA 1CLOL 2IH3A 2ZOLA 5DA0B 3T0BA 1PAMA 3EJQA 5K1NA 3Q48A 4PS4L 1NSNH 3BPOB 3B2VH 5EOQH 3D51A 1T4KB 5BVPH 1NEZA 1T21B 4KXDA 4ZO6A 1RZ7L 2H26B 4XB7A 3I50L 2IMMA 1Z3RA 3MX0B 1RURL 2X89D 1T03L 3FT2B 1GW0A 4KQ4H 3BH8B 2AJYL 3N40P 1MRDH 4F7KA 1OAKH 3LEVH 1YNLH 2EYRA 4WUKL 5KN5B 4OD2A 3S5ZA 3VFSB 5AKSA 3WMPA 4BKSC 3KYMB 3JTSB 2ZJSH 3CMOL 1NEUA 1F97A 4NENB 4TV3A 3FN0L 4Y19D 3FPXA 4HIHB 1FL3A 5DVKA 3TS8A 2Q2LA 3RNQB 5IJVB 2ICWJ 4G7RB 4MAYD 5EO9A 4DKEL 1U6AH 3BCFA 2W91A 1QBML 4BRVA 2KC0A 4PRHB 5IOPA 4M8UA 4CSTA 4JR9H 1CD8A 3N43B 4TNEA 3OPZH 4TVPE 4J2XA 1TLMA 2YBGA 2HWZL 5E8NB 5DYFA 3ULVE 1A7BA 4LLAA 3RWFA 4F37K 2V0AA 3OHMB 4A2FA 1IKFH 3DV6B 4NO0A 5H2BB 1R47A 2DBJA 3SE8H 4LLWA 4ACPA 4PLJC 4JVWA 4C4BA 4F7CB 1F6FB 1UD5A 4N2HA 4CKQA 5ICZB 4MNHA 3A67L 4HJJL 5I8CB 3UBFA 2BVPA 2YA2A 1VKXB 5BVJB 2NY7H 4WHYG 4LPCA 5F9WC 4DP9X 1BAFL 1QUNA 3P4OA 3JT2A 3FU7B 4YDMA 3VDBA 1XXFC 4L8SA 2FJSA 3JXAA 4Z9KB 1JWSB 2UZXB 2C9UA 2WQAA 3I9GH 1Q9WA 5JHDB 3GSVA 3AS3A 2X05A 3ULUC 4X9HA 1LDPL 1MDTA 1V7NL 3D07A 3E6FA 1JI1A 1YPZB 5CZKA 4B9KC 3NFNA 4O4YL 5JOFB 2WYTA 4IJ3B 4P2AA 5D72L 4ZMQA 1G5GA 4PJ5A 4KKLD 35C8H 4KJWD 4X4KA 1RUPH 4PI0A 1T3FB 2K4WA 3QHZH 4L4VA 1MZZA 1NM9A 4O02L 1WP6A 4OZGB 2M8XA 3SKJH 4LESA 3SDXB 1K2DB 5LGJB 4JRYB 1F00I 2H6PB 4BSWA 3TF4A 4NM4H 4W6WB 1RD6A 2CIIB 1UENA 2WP3O 3ILQD 4GQ9L 1ZA3B 1OPGH 5FGCB 4QHKJ 5HSFA 4OAWA 5CHNA 4HXBH 3ZZSA 2IGFL 3LN4A 3MV11 1QFOA 3W57A 4M02A 2VIRA 5FO7B 4Z77A 2E4TA 4DGUA 2YMXL 2VLJE 4IEFA 4GW1B 5IB2B 1TVBA 5DD3L 4LCWE 5TDPA 4G70B 1JN6B 4HOMA 2Y2WA 4G7YL 2HTLC 5IHZB 4HJSA 4P23B 3VGEA 4MMXB 2N7BA 3HG0A 4IIQB 4JB9L 4TOYL 1UASA 5D1QB 5DK0A 3GIZL 5DWPA 5FK9B 1BMWA 4F92B 1JGVH 1E67A 3LRSB 4X7CC 5AYQA 3L5XH 5GS0C 2ZNXA 4WGVB 3ZMEA 1G4MA 4UOZA 2E59A 2F1AA 2C34A 4LSTL 3VFUA 2Q5BA 3GTVA 3V7AG 4ADIA 4XPTH 1UM4H 3QJRB 5IMLB 3BAXA 5JHAA 3GHEH 2MCAA 5IKCA 3RWHB 3VFWA 4O02B 5EMYA 2VNCA 4LK4A 2QVTA 4WENB 3F00A 1Q0XH 5DFWH 2VYRE 3O4LD 3PWVB 1IQDA 4BXVA 3MRJA 4NN6B 4Y5XC 2WNWA 4F93B 1C08A 3QPQD 4ZS6C 5F1IB 4KY2A 1JRHI 1YECH 3GBMH 3VRIB 4JCLA 1YSOA 3KPMB 4JHAH 4UT9L 3RPIA 5LKNA 3BXNA 2A6DA 3W9DA 4JM4L 3CC1A 1EWHA 1CURA 1U30A 1S9KC 1YVLA 2CUMA 2EIBA 3L3JB 4M6OL 3BVNB 4WDIB 3H9SD 5E08H 2B77A 5ESQA 2BIOA 1DVQA 3GXDA 3ZVVA 1UFGA 4I77H 4P2OD 3NA9L 2XN9D 3CSGA 1NDGA 4PSRA 3KG5A 2VLKB 1RZFL 4X4YA 1J5OH 1N5AA 2BNRE 5C09D 2XG4A 4IOFD 5C0EB 2AFNA 3V6FA 2DMHA 2JI1A 1IM9D 4HUXA 1CDJA 3OKLB 2WGNB 4GSDH 4H20H 1A7NH 1CFBA 5L88H 4HLZH 4YHNA 3LTVA 3RWEB 3N04A 4OF3A 3BAEL 3WSQH 1BLIA 1ZHKA 2WVSA 3B2UC 3I6KB 4TUOB 5TE4H 4ZUWB 5IV2B 4ZFQA 1CGVA 4LDLB 4W6XB 3DRQB 5DO8A 4FABH 5JXEC 1DQIA 4GYBA 4G43B 5T5FL 2IPKA 2ZWZA 2OMUA 1RK0B 3PHOB 1FHNA 2MQ0A 5CM1A 3BSZH 3WFDH 2PO6A 2O5YL 1QSEA 2DY2A 3H9YA 3PV7A 5HDWA 1Z9LA 3CJJA 5GIRB 5E5MB 2A74C 3VGHA 5EFIA 1UXSB 5KSAC 5MP6L 1A14L 2F53B 1C5BL 1SJVA 5DDHB 4MFHA 3T0EB 1KIQB 3GLDA 3K4DA 2DLFL 2R1XB 1L0XA 2FECI 4GAAA 2OX5B 5F1NA 3RIKA 4XO4A 2HRGA 3BZEB 1F56A 3QEHA 1JNNL 5IREA 1GYWA 1V54B 3OX8A 4O2EB 4OKVA 5GRYA 2AAVA 3IAQA 5I6OA 4PJ7A 3CH1B 4GSRA 3MYZA 1MCSA 2OMVB 3GSXB 5EU6A 3OWRA 5FUZL 3BKJL 4F3FA 3N91A 2Z8SA 2L7UA 2ZPKL 1NQBA 2IAMB 2YEZA 1RSYA 2NY5H 2BVQB 3EF7A 1C5CL 2C9AA 4OCRL 5D2LE 4KHTL 2YPVA 5CJQL 4ZFGL 1KPUA 4OCXH 4CJ0A 4HUMB 2X42A 1E3FA 4XCYB 2DDQH 4UT7L 1OAUH 3RX8A 4JPSA 4CGUB 5I0XA 4P3WA 1DN2A 1ROCA 4W9FC 5F9AC 3BUPA 4MDIB 5A2BA 1O5DT 1ZLEA 3Q43A 2W9DH 3O41B 2Z92A 2P3YA 2B7DT 4MWFB 5LNEA 1KGCE 2FO8A 1L6PA 3TU6A 2M1KA 4G8FA 5I23A 4LO9A 1F86A 2CK2A 3QQXA 2IPTL 3D85B 2NSXA 4XVSL 2OA9A 4HAGA 5IESH 3EFDL 1A6UL 3RA7L 3IMUA 5IM7A 1URLA 4P4RA 1HHIB 1PG7L 1YEKH 1S7XA 3BKYL 1AQ8A 5A2JH 2V8LA 3IU3A 2CBOA 3HJEA 4JKPL 4W68A 4IRJB 4GMSH 2DRUA 1ESOA 2NCEA 5DGQA 4BE6A 1NCCH 5DS1A 5ABZA 4KFZC 1LK3L 1ZHBB 2EH7L 3UZVB 3HOGA 4NKQB 1F4AA 2XQYA 5ID0B 2QSCH 3QIWD 4NO3A 2R0ZH 4UM8A 5K9OB 1BPVA 2GJPA 5I0YA 1RUML 3NJLA 2BVOA 5I9QC 3VXSD 1IBBA 2OTWB 5CLTA 4Q14A 2YO3A 2XWTA 1KXTA 1IAOB 4M7KL 4PVLA 2QZ5A 2MRYA 1T7WA 5L2KA 2WXLA 4BFRA 1RU9L 4N68A 4G6KL 3UERA 4G6FB 3VD5A 3Q1EA 1OY3B 5HHPB 4HZ1A 1SNRA 1TQCC 5T8IA 4L8SC 4NT6B 1RIUL 3RUGE 1FRGL 1I7TB 2YN3A 1IM3B 3EYFA 1YN7B 2I7SA 3HI5H 5DS8A 5E8PA 3CFKB 4UIKL 2BNQB 3ZZ1A 2D7TL 3GLZA 5B1AB 2A77H 4RBPH 3FAXA 3KAAA 4AGPA 1R3HB 3ARDA 3IDIA 4KTEL 4XP6H 1MHCB 3BGFB 4L3EB 4BFOA 2XTJD 1AQKL 3O2VL 5F7DB 2IV8A 1O7DC 1OHQA 5HI5D 2W94A 4FFTA 2R29L 1Y18A 5G4OA 4L8CA 1EJ8A 2YUVA 2G60H 4PPTA 1EZUA 4LIQH 4QRTB 3BWZA 1K5NB 2OFQA 1TQWA 1PF3A 3EGXB 3MRRB 1MVYA 1SFDA 4X99B 3V6OA 4HETA 5HYFA 1V10A 1QBLH 3DO7A 3VA2C 1MJUH 4KNTA 1UOVA 1IGJA 2OYMA 4GP8B 3ARED 1H6TA 2AJ3B 2ZUQB 3VXNB 4XNYL 4XGZB 3CX5J 1M1XA 3KHOA 5T33L 3BD4A 4DTGL 1KFGA 3MNZA 4XCNA 2VLLB 2ARJQ 3B7SA 3BP7B 4XNMB 1G9NH 3OKNA 5CILL 5DLML 4P3CH 5K9KB 1WAPA 4NIYE 4PIRF 4TUUA 4WI3A 5ISZE 1YNKL 4M9OA 4QWWD 2J8UB 3NCYP 3UC0H 2CXGA 4NP4H 3FQRA 3SYQA 1QSFD 3JV5A 1YY8B 4N8CH 4O51B 3D0LB 5D7SL 5J6HA 4OFVA 1H6EA 1YLBB 5E8OB 1NCGA 4NQCB 1UUNA 1ASQA 5AAMA 4C4UA 1TZGL 2XZAH 1XCQB 4DN3L 2AXFB 1AHWA 2FAUA 5KVGL 3UTTB 4HKZA 5FYLE 2DEXX 1VFAB 2VLMD 4PS3A 3JUYA 3ZR5A 1B9KA 3ZTJG 2KLTA 2H0JA 4WWPA 1G9ML 2CIKA 2LLLA 3GKWL 3KPSE 3MJ7A 3ZQXA 1TZ8A 3C5SA 1E7VA 4NZUH 4HZLA 4MQTB 4FNUA 5DJ8B 5FGSA 4F2EA 3G04A 3WIFB 1XB8A 4PCKA 3RFZA 2A5UA 3MNVA 3A24A 4PJHA 4FHJA 3TNMB 1CWVA 4HT1H 5FUOL 4ZMAT 4AT6B 3RU8L 4JFYB 2WINA 1O9VA 4EVNB 4NZTL 4OUUB 3SBQA 3A21A 4GAGH 4ZK8A 3BHBA 4P4KB 3PABA 3Q8FA 4EBQH 2Y6SC 1ML0A 4X5XA 2WKLA 5AOIA 1KFAL 5F9OL 4Y1AA 3KWTA 1OALA 2W0LA 6PAZA 3DJSA 1HEZA 3WOVA 2BSDA 2ZXCA 3PDOB 4X98B 4ZXBA 1QZNA 3MV7A 1KB5L 4XNUL 1H3WM 2IXQA 1A2YB 4YSEA 7FABL 4N25A 4OFQA 2JIXD 1XGUB 3AZUA 3QAQA 3TP4A 3NA4A 3F04A 2YD7A 3GSUB 5GGQH 3A22A 3DMMC 2W65A 3VQLA 1E30A 4QOKD 3VTAA 2DLEA 1CI3M 2Y7NA 3Q01A 4CILA 4YUEH 4RIRA 2QGEA 4XO8A 1NAKL 1P69B 4MDRA 4PVMA 2GJ6D 1U92A 3NH7H 5C0AD 5L0QC 3Q9QA 1LO3H 3LKOA 4OM1H 1R9FA 1JGLH 1P53A 3ARGB 3BAJA 1RIVL 4WCYL 4TQIA 1JZ6A 1GIGH 5L7XH 2XJKA 5I1KH 4MD0B 4Q9RL 1XR8A 3L3KA 4XMPH 3AQYA 4BWTA 5F7YC 3DA0A 4U1HA 1A7QH 2CGRH 2Z0UA 1WITA 3VTTA 1KTDB 5HY9B 1BFVL 1KPRB 1KPVB 1AD9A 3VWJD 3RGVA 1FDLL 2WYIA 2VR5A 1MWAL 4HXAL 4DZBA 3CXHJ 1KB5B 1MJJA 3DDFA 3AQDA 3CLEH 3U25A 2J88H 5ACLA 2EABA 4LXFA 4MJJA 4C56E 3HG3A 3G5YB 4XWOD 2AK1L 3S5LA 4BINA 1IGCL 3DTDA 4IMLA 5F6IC 2HX7A 2EEBA 5FM8A 4JRWA 2HLEB 2PETA 4RNRB 3TM6A 2ZG3A 2JJUA 3D5OF 1PFOA 3ULUH 3HI6L 1KTRL 2C26A 4X80H 3FOMB 2Y5TA 4YE4L 4MKTA 5J5EA 4AG4L 3D4CA 4JK0D 2C5DC 4RDQG 1VGKB 1F02I 3P73A 3NIFF 3ARBA 2XZQH 4HHAB 1RJCA 4JRXA 4E41A 1JZ4A 1AGBB 3KLLA 4GMTH 1MFCH 2IOMA 3KLHD 3V79C 4HUCA 4UQBA 2DWSA 4JFPA 4JPKH 1PLAA 2DJSA 1JZ2A 2DMKA 4OF7A 1U3HD 3TLRA 2MPAL 4F2ME 5LXGH 3CQQA 4OW6A 1JTTA 5JHMA 1MLCB 1B2WL 3WFHA 1KCLA 2VQUA 4D3CH 4ZNCD 2JXMA 4NHUA 4B0MM 1L0PA 4P2RB 4QIRA 5DD6A 4I85A 5JMRA 1MCFA 4XHQA 3EDFA 2Y06H 4P06A 5I19H 1YG9A 4W70A 4OCMC 3S4SB 3Q13A 4P05A 3VI3F 5BRZD 3U79A 3QJUB 4ODHL 2NYYC 2BIQA 5E1QA 2XWJB 2R0WH 4Y4HD 4POUB 1TTAA 4XP1H 2VXQA 4NAMA 4JY6B 4B60A 4HH9A 1SQ2N 4K3DL 4K2UH 3GLEA 4PJFA 5TJWK 4U1NB 4ZFOB 4N1CA 4BH7A 4DAGH 1JDDA 5GS0H 1KIRB 3BQUA 3QQ3A 4JMXA 1J5DA 5T1DL 1Q9OB 2JI2A 3BCDA 1JF6A 4PJBE 2WBWB 3KGTA 4KROC 4Y1SA 3T2QA 4ODTH 5A16B 1HYSD 1JCKA 4GRLB 5HJDA 2YAOA 2BIPA 2ZP8A 4FXLA 4MJIA 2AK4E 3V5HA 1H3PL 2PYEA 3HS0B 3IWUA 1B6UA 2YPKA 2Z8VC 3G08B 2QBWA 4A7GF 4EPSA 2EVIA 3H1ZA 4PJCF 5GRJL 3KM1A 1LEKB 3E6HA 1PY9A 4XP4H 2IWGA 3C5XA 1DP0A 1EAJA 3V6OC 2K3HA 1HILA 1RLWA 3KPTA 4QHLA 3NK3A 5SWSD 1UD2A 4JO2H 2J1WA 1QFWH 3FQXA 4F7MB 3JBG7 1ES0B 3PL6D 1NFDF 2VJXA 5E2VH 1K4CB 4J2QA 5FIEA 3TFKC 4JKLA 4BXSV 5HPMB 1N64L 4AJVA 5MENB 5EV7A 1DBJL 5CZXC 2YRPA 3SPCA 3O0LA 2IH9A 1RZ8A 2WTPA 4PYHA 1M57B 2B2XL 4UIMA 3VFOA 2GITB 4G6AD 4XMKL 3P9LB 4YHIB 3TPKA 2WUCH 5D7LE 4ES9A 3L1OL 1CD1A 4K3JH 4CVXB 1JOIA 4HW6A 3FBKA 4YWGL 3H4HA 2VQ1A 2V9QA 2BVEA 2XN1A 3K6OA 5GGVY 5LCVH 2C1PA 1LNUB 5F6HI 1TSRA 3KM2A 4XTRC 3QDJA 2CUIA 2DQHH 3CU1A 1MLBA 2ZSVA 2FX9H 4PFEA 3TBTA 15C8H 5JMOC 2HT4D 4ZFZA 1P7QA 2FQFA 1ZCRA 4B9JA 1UFUA 2W81C 4FYQA 2DJUA 3NCBB 4U1MB 1AHWC 3NEEA 1BQHB 2ZSWA 1T80A 3IYLW 4QHNB 3EH2A 5ENWA 1MI5D 5EZPA 4AQEA 4D0BB 3OKKB 8FABA 3QS2A 1JFQH 4NCDA 5F89A 2N1KA 2DQDL 2FYVA 3TESA 3BD5A 4EI5B 4ELDA 5JQ6H 3QORB 4OD1H 5JOPE 1MCJA 3CZFA 1JV5B 3CTTA 3ARYA 5E4OA 3OKEA 4PJGF 1I9JH 4PEEA 1DVXA 4IW4C 4XMZA 4HPHA 4I13B 4N2OA 5ID1B 3T0VA 2LFGA 1BF8A 5ELIA 3LJ3A 5JNYB 3Q6FA 1CICC 2JB6A 2E7BA 1U8HA 2VERA 4X9FA 4APQA 3OMNB 4ETYA 4POZC 4JAMA 3QUXA 5FYKE 3IPBA 3BZ4A 1UXMA 1FPTH 3TBCA 4GG8B 1E4KA 3KL3A 4RDBA 2X0WA 4YNYA 5B1JC 4ZXBC 1E3XA 3BRGC 4HKXB 4WY7H 3WN5A 4WI9A 4KX9A 5HHMB 2CJUH 1NCJA 1UJ3B 4GO8A 4MDJB 5GRVK 3U30C 3TJEH 5I73B 3ARFB 2LT9A 4QF1A 5HHQB 1L7IH 2JLPA 3BZFA 4IGBD 4UNTA 5DZ9A 3FHEA 5F7WC 1Q0EA 4K94H 1Y6NR 4KDTA 1KGXA 3GMNB 4JPVH 1JGDA 2PWGA 4ALAC 4I3GA 1BX2B 1U8CB 1ZT1B 3IN0A 3BLKA 1ZVSA 3QC6X 4FXKA 2YAEA 5DR5H 3IRZA 4Z76B 2IANB 2GY7B 2HLAB 4UT6L 4XVJL 1DQLH 2WXKA 3BUBA 6FABL 3G9AB 5F7EL 4DUVA 1PYWA 3I74A 5BV7C 3KCPA 4XN8A 1Y07A 1Z0MA 2WTRB 5AVVB 2WWNA 2EE3A 1T5WA 2Q76A 5GZND 4Q2ZB 4QXTA 1MCPH 1FNGA 1DQVA 5D4JA 3JT0A 1RZKH 2IVFC 4JO4H 3SE6A 1PQZB 2XV3A 1AS6A 4TULH 4I5BA 2F8IA 3ZDZF 2MNWA 1EDYA 3STZB 2WUBH 2J72A 4WI0B 3X12A 4CVWA 3B9AA 1TZOA 3RGVC 3EO9L 2GY5A 2VZ1A 1U42A 3HNVL 4FQXA 5I8OH 3RWCB 4BKTC 3QYNA 3PGCA 5CLZA 5FYJD 3DRTA 1SN0A 3K6FA 5EA0L 1U41A 1GKEA 2N3JA 4C83A 3US0A 1E2WA 4G42A 5DHXB 1E27A 4IOIB 4FRWA 4L4TE 2PR9A 2BY0A 1NZRA 5C0JB 1MFEL 3P0VH 3QRGL 5AVWB 2FL5A 3GRWA 4L48A 1JZJA 1XSOA 4AQAB 2LU5A 4ORGA 5CLXA 5IVXB 1TVHB 2ZUWA 2NYKA 5HGHB 1LE5A 4J3UA 4X50A 2P80A 3K80A 4JNXA 2ZX8A 3IGUA 5EOCL 1JWMB 4NO5A 3EGDB 1GL4B 3ARBC 5DUPH 4F7PB 5T3ZL 4AW7A 1Z3GL 2PWDA 1P1VA 4KDWA 4ZOEA 3SY0A 1ZWIA 5DUJA 5CD3A 1CDCA 2EAEA 3QO1A 4JRYD 4KOCA 4OJCA 5IW1A 1AGFB 2Z93A 1CFQA 2WWOA 4WK4B 3WY4A 2Y7QB 3HIZA 1KCVL 4X6FA 3QDGE 4CMHB 1YRKA 3D9AH 2XZZA 3VXRE 3ECUA 1OOAA 3KJ4B 2G0KA 3QNYA 4WWKA 4H8QA 5IBTL 5B7EA 4S1DC 4GSQA 3FUIA 2VDMH 1O9ZA 3QDME 1WAAA 1JZ3A 1P0SE 1JVOA 5ADPL 4N0UE 1A6TA 2OPCA 2ZF8A 4M4PA 4NPYA 3IDJA 3NTCL 4XAWH 1WAEA 2W60A 3REWA 4JKMA 4RWHA 3KYKL 1A6WL 4NWTH 5E56A 2B9BA 1LO5A 5F7FA 3HRPA 4HFWB 5DRZA 5JZ7D 1KCUL 3MV9B 5KVMC 4OZIB 4JFFD 1RUKH 1ZJAA 3BE1H 1HCFX 3LKNB 1AGEA 1A6AA 3MLWL 3PQYB 3TN0B 5KBLA 2A6JA 1FH5H 3H2PA 2YD5A 2Y72A 3FCTA 1QLEH 1SMOA 2GHZA 4PLKC 4PP2B 5F88B 3JWOC 4FJYA 4YL9A 2ESVB 4BCZA 1PSKH 2ADGB 2ZWSA 4UWQB 1NIEA 1PTZA 1ETB1 2R59A 3CFDA 2HJLB 3UGUA 3TONA 2JH2A 3ZHFA 5M95B 4LCCB 4O2FA 1FO0A 3WNPA 5FFGA 3AQXA 1W8OA 1YJDL 3L7EB 1C8QA 3RL1B 3VSQA 3HBQA 1H9VA 2H41A 1SYSA 4F8NA 1A1NB 2WZPD 4EDWL 2DAVA 1P5UA 4UBDD 5A40E 1CF1A 3S37L 2AAAA 1MH5A 5DT1L 5DURB 3QYMA 3S2AA 1L9PA 4UUJB 2ROXA 1JD7A 4XMTA 4RGOL 5HPOA 2WOBA 2H3NA 1D5RA 1BF5A 1JZDC 1P4BH 3QISA 5BJTA 43C9A 1I8KA 1QASA 2VLKD 2CO3A 4IDJH 4PRIB 4UU9A 4GB9A 4YBHA 4A7SA 2YFOA 4LAQH 1T20A 4UOJA 2JCCA 2NY2C 2VUYA 2I9TB 4AEEA 3K72B 3LDBB 2BNRA 2NNAB 3DIDA 3DKHA 4DVRH 2P5WA 5D71L 1T1ZB 4NJ9L 2QQNL 3N3EA 2GABA 1HCYA 1DEEB 1I8LA 3DBSA 4JFQA 2GK0A 3HFMH 1FV1A 2AQ2A 4XB8A 5JIHA 4GRWB 1J11A 2K7QA 1BLNB 3QSKB 1G6RH 2MHAA 2PTTA 2ZE0A 3H6JA 3QZWG 5EU4A 4NC1E 5HHVH 5A2LH 2MH4A 5I8EB 1D7BA 1H0DB 1OSPH 2FJFB 3BSHA 2ZOTA 1W8EA 3H0TA 3IDXH 1VERA 5AB9A 1EV2E 1W91A 2PWFA 1X5MA 4QMEA 1PY0A 1SJMA 3D3VE 1DANU 3I84A 4J8RB 4MCYA 2ZG1A 4L8DB 4PGCA 2DWYA 3GS7A 2BP3A 4JMNA 1THAA 4BK8A 5EEXA 3C60D 5MEPA 5HD8C 4LSVH 1Y1DA 4NWUL 5DRXA 3T0ED 3V6ZB 1JF1B 1IE4A 1A4JA 2EXYC 2FNWA 2I60H 2WXQA 4MCMA 4OGAC 2EEDA 2IPUG 4AC2A 5D4IA 1UKSA 2HJFB 5B1BB 4WFED 5FYJU 1XGRB 2HRPH 4HEME 1MEXH 2VXVL 4DP2X 1RSFA 1OGSA 4RMVA 1EEQA 5C07B 1A65A 2OL3H 1WFMA 3RURA 3SO5A 3VW3L 1JERA 2H7WA 25C8L 3HNSH 3DGCR 3H3KA 4Z7OB 1L4IA 1U8LB 2C9XA 1MQKL 3BP5A 3LRLA 3CH8A 5IROD 1EHAA 1TENA 4FG6D 5C0CB 4U05A 1E4KC 2XWRA 2A2QT 2N01B 2YPVH 2EXTA 3HE7A 4S0HA 4KRPC 4BZ2A 3QCTH 3ULSA 3B2DC 3OLDA 4FXTA 3VRLF 3WN5C 4YK4C 2MOVA 1OP5H 3U36A 4K55A 4MCNA 3FO2A 5AW9B 4MB3A 1KULA 2VKXA 1PX8A 1BVLB 4M8QB 2BP0B 3EKCA 3MBWB 1EJFA 1QTSA 5EWIH 3QI9D 5KYYB 5IJCC 3RPKA 3WEOA 4MJ5A 4N4YB 4KDTC 2GTZB 3D85D 4ODUB 1IC5L 1E5AA 1DUYB 4XXWA 4X7DC 1G7QA 1A0QL 1CFTA 4PGDB 5J3HC 4Z3JA 2JI3A 1A3LH 5E9DB 5IGXL 2ZUSA 1HCVA 5C0DA 3VXQB 4I1RA 4GNKB 5ESAA 3RJQB 1WZMA 2IQ9L 4YPGA 5DC2A 2ZKXA 5F96H 2AKRB 3IXAB 5LBVA 3QZWB 4AM0Q 4ANUA 2EEFA 3PREA 1ZTXH 1AQDA 2JQZA 4FD0A 5EZLA 2MCPL 4GP5B 4LVOC 4UNUA 2NTFB 1ZTMA 4ONFL 1VF5C 2HKHL 4HCRH 3MRGA 4FFZH 3NJNA 4UTBL 2XA3A 3ZL2A 3VI4F 4HKJA 2WKGA 2D03L 3NCJH 2NLJA 3SCMB 3VACA 5JQHC 3FYEB 4DERA 1A6ZA 2O5ZH 3M1CA 4J1UB 4OIBA 1BZDA 3UBXB 3TL5A 3F12B 3GZKA 4IBUA 2HH0H 3WLBB 4FQXC 5IW6A 5JPMA 4K71B 1IGIL 4PJEB 2CQVA 2HTKD 2VITB 5IEHB 2XWBA 4KNSA 2OM5A 2C1OA 4G6FD 4RFOH 2BJML 2YXMA 1N0LA 4U1GC 3W81A 3IGAB 4PY8I 2BOBB 4FLOA 1JPGB 5CEZL 3V95A 3OZKA 4Y1TA 4M5TA 3VD9A 4R0LB 3WIIH 1IM3D 5D8JL 4QD2E 1AP2B 1X7SA 1NGXA 1J8RA 1VIWA 4EAEA 3GJFK 1FSKB 4OZHE 5IHWA 1E4WL 4BRJA 4ZUTB 3RNKA 1KYOK 3I2CH 1FL6A 3NACL 1IGYB 4LQFH 4F8QA 4JHZA 3P3UA 2BZ7A 2CK0L 4HF5L 2G3NA 1UM5L 2A6KA 5A3IC 3MLTA 5AYUH 3RGBA 3CZKA 2G9KA 3U82B 4BH8B 5E4IA 3ZKXC 4N6RB 1F58H 3E3QE 5TH2A 2Q6WA 2EP6A 1KCRH 1WFJA 3CK0H 3CHRA 1FVEB 4E0RA 3MCLL 1TQSA 4HUUB 5C0ND 3W56A 4AI7A 5H37H 4WWKC 3B43A 1GOGA 3QPXH 5EO1A 5E6YA 3U1SL 3BW9B 4DOHE 1D9KB 3SYPA 3VXUA 2R4SH 3CVDA 3N43F 5D2NE 3DO4A 3PDGA 4MSWA 3FB5A 4NC0B 2M26A 1P4LB 2E75C 1L6ZA 3UDWA 2D4FA 1PCXA 3PJNA 5F6IB 2EZ0C 1LO0H 3QAZC 3CUPA 2ZAIA 2B5IB 3CC5A 3QHFH 4PM1A 2DYPD 2XTSA 1J9TA 3N44B 4PJ8A 4PUBL 5F6HJ 3FOLB 5FOBA 3BGAA 2B14A 4GLRI 2ARJB 1HFUA 2APBA 2B4CC 4LB8A 1AGCB 4M6NL 2GKIA 4D0CB 5ISZA 5I74B 1FFPA 2PKDA 1TO5A 5AOMA 1D6VH 2WJ7A 3D0AA 4UQAA 1AIFA 3WIHA 2H8PB 4QRAA 3HE6B 5CSBA 4OV5A 2ZXBA 3I75B 1IC7H 2IG2H 2NX5B 1JGIA 2YD4A 3QJTB 1AXSB 3LSOA 1JDAA 1F18A 4DEPC 5C0BE 1OARL 4XPFH 3NSXA 2Q7AA 1HINH 3HC0A 2EO9A 3FB8B 1ZLVH 5LAXA 1WBZA 3GHBL 1REIA 1YPZF 1F4YH 1EEZB 3FQ1A 1SXSA 4ENEC 1AHMA 1CGSH 4YMPA 1SVZA 2NW2B 2VGLM 4U3XA 3DTXB 4PTTB 1KN2L 4OFDA 2SODB 3VH8A 4K5PA 3PXHA 4OFYA 1R3JB 4OZGF 4XNQB 4ZAKB 5FW8A 5DJXA 3SDXF 1CU4H 4UM9A 1E9PB 4F9PA 4JFDB 4OLVH 4I0PA 5IQ9A 4WK0B 5D5MB 2DQUL 5K33A 3UTPE 1WFTA 1F90H 5ALCL 2B1HL 2BM3A 3MLVH 5GGSA 4F15B 2IADA 4TQ8A 2X9WA 4HV8B 4Y4KB 2WIIA 3DVNB 1AANA 1UM6H 3HG1B 1I8LC 4HPYH 4YJZL 1NBVL 1SZNA 3GB7A 1JDCA 3B5TA 4ADGA 3IAPA 3CBJB 2VLRB 1NCAL 3NP3A 4A2EA 5JO5B 3VB9A 5FF6A 3OAWA 3LKSB 2ICCA 3DX6B 5J89A 4BUGA 1R3KB 1PKQB 3D18A 4ZYKA 5E03A 3QR1A 3QW9A 3T0DA 4RH4A 4O2CA 4JO5A 4PVNA 2OYLA 2D2OA 2HZHA 3LQAL 1M4KA 4NQEA 5CJ5A 2GSMB 1X5FA 2WMPA 2Y07L 4FG0A 5FHBL 3VCLB 3KYOB 2P4AB 1BZOA 5C08E 1QRND 5C9JA 4FQHB 2FLBT 1SYVA 2VJ0A 1NFIB 3L4XA 5BV7H 2X1PA 4CJ1A 3FCSB 3HMWH 3ARGD 5IG7A 3KPQA 4LLQA 2CD0A 4K9EC 2Y24A 3DYOA 4RMSA 2BSRB 2J1KA 1ORQA 4K7PL 5C8JB 3P4LA 3BVVA 5BQ7B 4KI5D 3T65B 4GQZA 4X5RA 3EG9A 4WGKA 3FHQA 2OQJA 4Y2DA 3FU6A 4WHTA 4QRSA 2PMZA 4X6EB 1I1FA 5BO0D 3QUYC 1KGJA 3O3AB 2AJVL 4AK1A 4Z78A 2OTUB 1SLVA 2J4WL 4YDJB 1CE1H 2XUWA 3P0GB 4N8VA 1G7HA 4U4IA 4XC1H 1YYMH 2LV4A 3X13B 1KJ2L 1AC6A 3E1F1 3S34H 4PGBA 5JORA 5DQDH 4JPIB 4U1IB 5ECJE 4C58B 4F7EA 5A7EA 4FKKA 1DQDH 4XXWC 4XODA 5JW3L 4LKCA 3V0JA 3N55A 1EZVY 4L8BB 1PEWA 3ZE1B 1C7SA 3L4VA 5SWZE 1X9RA 1F6AB 2W59A 1V3MA 3DBXA 4U1KB 1J8KA 2OJEB 1F2XK 4NM8L 3VFMB 2OSYA 2VQ4A 2Y25A 3NZHL 3HS9A 1R3LA 3VWKD 2ZYHA 1QSVA 3RWJB 2EIZB 3FJTA 2AJZA 4AVHA 2J5LC 3KR3H 4LU5H 5KS9E 2YQ3A 1ZS8A 4FQLL 4GW5A 3UJIL 2E46A 3UTSB 1IAIH 2EUVA 5BZDB 1M7XA 2PPCA 3BPLB 3MN8A 2MOGA 2PPFA 3RILA 4OJEH 4DSYA 4G6ML 3CIAA 1J9CT 1TZHA 2FSEB 4X8JA 3EJCA 5KEZA 4P5MB 1JZGA 1NSNL 2ZKWA 3VSTA 5DQ9B 5EOQL 4EEEA 4DWHA 5BVPL 2O5NA 2GUOB 2ERJC 4ZD3H 4FLQA 2QSQA 5DJ0B 3K6SB 5JPMC 4XMWA 1U8KB 3CDYA 3VGFA 1PCSA 2APSA 4KQ4L 3KW7A 4XVTH 1E40A 1OAKL 2CA4A 3E9UA 3LEVL 4TF4A 2AXHA 3OKOB 1KJ2B 4IBYA 5DHDA 5HYJB 5ACMA 4OJFL 1XF1A 5DHVA 4PJ9A 2VXQH 4HP5A 1SJEA 4ILDA 2ZJSL 1FGNH 4ZMNA 5FV1L 1B90A 2ITCA 5EEUA 4JVUA 1JXFA 2KBGA 1HHJA 5FKAA 1U6AL 2SEBB 3EFFB 1E6OH 2NT1A 1QAWA 3IFLH 4KZEH 4PS8A 5FUCE 4IKNA 1J5HA 3WEAA 2FGZA 3TWCH 3TO4A 2UWEB 1BZ8A 3OPZL 4DGIH 3T3PE 1HHGA 2OXGA 3CVHB 3JWOH 3QIUA 2ATAA 3I6LE 3A6CH 1RVFL 2XRAL 2YQGA 4WU5A 2X3BA 3P9WB 4PLJD 3RY6A 1PEZA 3S96B 1S9YA 2X4QB 4KXBA 2R2CA 3SE8L 3X14A 4KRMB 4NX0A 1UYWH 3MROB 2XKUA 2VSMB 4R7LA 3F7QA 4R4BA 4FEIA 3TVMC 4F8OA 3K71B 2JSFA 4QY8B 1U8QB 5IB4A 3SJVD 1IBFA 4FKHA 2AXGB 1VHPA 5CMAA 2HUEA 3BFQG 2W5PA 4DETA 4LGPB 2BCKB 4QR7A 2NY7L 4TSAH 5KANG 5GJTL 1AXIB 2NY4C 5DRNA 5EU5B 3UDWC 1X4ZA 1P5VB 2WBXA 4N86A 2OULB 2WBJC 4RZKA 2NUTB 4Z7NB 5CBAA 5K5YA 4D0DB 2NZIA 5DUBB 2VDNH 3I9GL 1SUJA 3MJ8B 1EPFA 1OSZB 2QKIB 4PJ8C 3TYGH 3OMZA 4N2DA 5I24A 4EZKA 1BM3L 4G8GE 4A2GA 4DN4L 4ZTEA 5T1LB 1N0XH 3DIVA 1S8DA 2Q0ZX 35C8L 2Z7ZA 1RUPL 3IXTB 3FMGL 4LSUH 4UQ2A 3QQ4B 2RMNA 4LAJH 1I85A 3SKJL 3FFCE 3QQDA 1IBGL 3MRNB 4NKMB 1U3JA 4NM4L 5BZWB 3SO3B 3WYRA 3KPPA 4ZTPL 4DPRA 4N0YH 3HA0A 5HYSA 1ZGLB 5KUMA 4QRRE 2P5ED 2QFRA 5HHOD 2P7TA 4HXBL 3OXSB 3WXVH 2N1TE 3MRDB 4KHXH 1TKWB 1XCTB 1T2QH 3AG2B 3NZ8A 5E2UH 3IJYB 4EI5D 2FT7A 3QORD 1YEDA 3QB7C 2HTLD 1T04B 4GI9A 3QJOA 4AV4A 2O6EA 3GYRA 2FR4A 4ODVL 2DEWX 3P4NB 4LCUB 5EUOE 5HTSA 3QNXB 1JGVL 3MFFA 3OAZH 4I0PC 5DUMH 5BS0A 2CPUA 3QUKA 5GS0D 3HUJB 2B08A 1IEAB 4XI5C 3L5XL 3VXME 1MCKA 5EZJA 3SGEI 1XH3A 4Z7VE 1P2CA 3DECA 3QIBB 3PWPD 4LEOA 4CVZA 1S9XA 4WFGE 1I75A 1PG7X 4MA7L 4QYAA 3C5ZA 2HVKA 4Y2LA 1BD2E 1Q0XL 4V2CB 3WFEH 3IETB 4YC2C 2XFGB 2EUXA 3VGDA 3Q2CA 3IJHB 5DFTA 3SOBH 1MF2H 5H4YA 1YECL 3PP3H 3GBML 4YDLB 4JHAL 4MS6A 1CG9A 2EYSA 3HZVA 1MRFH 4HLZG 3WMSA 2V5MA 4RGMC 4JFHD 4KTDH 3CE1A 2J8UF 4NKOB 2W0KA 3G5WA 1KY6A 1D5ZB 4L9LA 4YQXL 4WWID 2EVHA 5E08L 4HWZB 1JPTH 2B15A 3FB6B 4LMQI 3VFTA 4I77L 2X4OA 4UTCA 4ETQA 1S7TA 5HJ3A 2NY2B 3EDJA 3O9WB 1Q4NX 3WV0A 3EO0A 4FQ1L 1HC1A 1U2CA 1XSJA 3PV6A 5SV4A 5T3XL 4J28A 1KYDA 4A2DA 2AJSH 1R4XA 4Y2DC 4B6ZA 1ZLWK 1UUSA 1QBAA 4H20L 1A7NL 4F7TA 1QVOA 3W9EA 5L88L 3ZGIA 3I6GB 4G72B 1CE6A 1KLGB 2I69A 3B2UD 3KPRE 1H8SA 4NGHH 4O9HL 4G3YL 4NXKA 2XETA 3NGBB 2X4UB 4KKCC 3WSQL 5JXED 5TE4L 5EDSA 3LXUX 4ZUVA 5FM5O 2WJ5A 3MLSH 3QO0B 4WEUD 4AGOA 3OHXA 1OAZL 4FABL 3FFDA 1UT9A 4AJYV 3G5VA 3L16A 2BFGA 3GUTB 1N59A 1Y0LB 3BSZL 3DUSA 4POYA 2YK1H 1WSST 3WFDL 3S9DB 4JFEA 3GRWH 4YN3A 32C2A 4QJ4B 2ADJB 1W6LA 5E24E 5CLYA 5E7BA 1T0PB 2ZIDA 1VESA 3O3EA 1Q0YH 4DKAA 3S5YA 1QI4A 3JTTB 4IDLA 2FDBP 2F54A 2OXHB 1U4EA 4G8AC 3WEXB 4OF0A 1CMOA 5I76B 2CDGB 4XX1E 3ULVL 3HR5B 2BSSA 4X6CE 4Y4FA 2XACC 2JKIS 4K5OA 4Z5RA 1KBGL 4E9RA 3IMBA 5DS2A 4X6DB 4YLQT 3WTTA 3QDGA 1FN4B 1OP4A 4KC3B 4KQ3H 3BYTA 5SV3A 3UL4A 4ZPVB 3JZYA 2G9HB 4U1SA 5ITFA 2V9TA 5DRWB 4TNGA 3A23A 5IVOA 4NYLB 4NI3A 4AWJC 4P57A 5F93C 2YR3A 4WI5A 2W9DL 4Z3GA 4WNQB 1JGUH 1M2OA 1RP9A 4WO4A 4YDIH 3MNWA 3VAEA 3I02A 3DSNB 4OF8A 2Q87A 1CK0H 1RP8A 2EIEA 3EYOA 5JPNB 4QDGA 2ICWB 2VZ3A 1ORSA 5D55A 5IESL 1Z5HA 1ZKAA 1EAOA 5DFVC 2B4CH 4N2CA 1T22A 4X83A 4OIFA 3MCKB 3GMLA 5FLVA 1N8OE 4LF3A 5CCJA 4GMSL 1LP9A 1BGXL 4URTB 4K3GA 5KVDE 3K4AA 1NCCL 4NUQA 2YC1B 2BW4A 1T7ZA 1F4WH 1RUQH 1FO0H 5B38G 2D73A 3Q1SH 1NBZB 2WVVB 2FIKB 2QSCL 3LEYH 4KXZH 5GGUB 1F3JB 3HN5A 5EBMA 5TD4A 1YAIA 4XNZC 2R1YB 3BOVA 3VQMA 5C1MB 4HISA 5EBWA 5K39A 5CEXA 4XN9A 4MLSA 4CSZA 3LIZA 2B59A 5J13B 4NIKB 4Z0XB 3OAYK 3IBOA 4UMGA 4B7LA 5KYXA 3ETBF 3PGFH 1KG0B 1V7MH 4Y9CA 4ISVB 5HI3C 5L4JA 2F58H 3D39D 4PRHE 3JWNC 2WLIA 2OW6A 3BWSA 4PRID 3VXOA 3HRZB 4MAYA 4ZMTA 4M93C 4XE0A 3HI5L 1XF2B 3KBPA 2J8OA 2XKNA 1CLZH 1MUJA 3T2LA 1WWCA 2A77L 4IU3A 4PJ5D 1OLLA 5D1ZB 5E8EB 2B1AH 4Y7MA 5DJAA 4DKTA 3DX8A 1ZE3H 1YC7A 2HJKA 3QZOA 1DN0A 1X5IA 2X1WL 3FH7A 2GI0A 3SQBA 1I85C 2BP5M 3OR7A 1EGJA 4HKBA 4U49A 2W92A 1L5GA 2NW3B 2GUYA 2MTPA 3MRIB 4XWGH 4GUCA 3TA3B 2GIYA 2LLNA 4Z7UB 4GO6B 1VGEH 1HQ4B 4YEFA 4DO6A 3SDCB 4IMKA 4W9JC 3TCLA 1TTBA 5E5RB 3KH3A 2HFEA 2X4SA 4H8UA 4B9GA 5DJCA 4YDKH 1BA9A 3E1ZA 4MMYA 1R34A 3C6LC 3KNBB 3KWWB 4WHCA 1NDMB 4XMUA 2FWOA 2VLJB 5HDQH 1JVLA 3QUMH 5DD1L 2EJ1A 1CQYA 1GZQB 3QAZB 3BN9C 4X9BA 4HWEH 5I18H 1MFDH 2ZUTA 1YPZE 4B3EA 5C07D 3CHXA 1N3NB 4K9EH 4LRNL 4PW3A 1O6SA 1XIWC 2ID5A 3D52A 4HWBH 4P3CL 4P5SA 1DCLA 1OGTB 1G0YR 3EJZD 3M45A 4LLDA 3LYRA 1QI5A 5F3FA 4YX2H 3SDXE 2X9YA 2ZCHH 1QATA 1W0WA 5IQLA 2FYYA 5KW9H 4X7TA 4YFLF 1D3CA 1NMAH 4NP4L 2X6UA 4BZ2H 4QJ5B 1NA8A 1TFHA 2PR4H 4N8CL 3SSGA 2CDEA 1NDTA 1HOCB 1NH6A 2DQTH 2YGPA 3C5JB 1ILUA 1XZWA 1YQ2A 3C5ZC 3VXPB 5C3IA 4M5ZL 4YBLC 2FWLB 2XZAL 1GMEA 4PVBA 4KJQC 1UKQA 1G9HA 3U9UB 2Z8RA 2VR8A 4P2QA 1G7JA 5ERWB 1IGMH 5B8CB 2HLFC 3CVCA 2EIDA 1RY7B 3O4OB 2YBRB 2KYIA 4JPWH 4BQ6A 1FH2A 4RVBA 3MRQA 1MAMH 4AYFA 1UWEL 4L9LC 5E2WH 4NBYB 5E1IA 3IFPB 2K78A 5AB1A 2Q7YB 1UOWA 2OCCB 4RSYA 1IGTB 1G43A 2YGVA 4HT1L 4Z1PA 2CH8A 1TEYA 3S36H 2Y6SD 3MJ9L 1QFUL 1JFHA 4GAGL 2GEEA 3BFOA 3DURA 4AM0B 4EBQL 7PCYA 5F1SA 3IS1X 4WUUE 3SCMD 1B0GA 3TC9A 3U0TB 2UXFA 5FA4A 4GPVA 1QHOA 3IDNB 4KQ0A 1A5FL 1D5MB 1RJLA 4RFNB 4K3EL 4Z3IA 1K8DA 3MMEB 1LEGA 2V8MA 1IBHA 3C6SB 3OHXC 4DFIA 2DD8H 4K8RL 2FJGB 3OVUB 2D3NA 3NVQA 4AENB 3DV4A 1QSED 3DMMD 3LKRB 3AROA 4FXGB 4JANA 4W9ZA 3O2WH 1EZSA 4YFLI 4IHOB 1I8AA 2Z35B 4JREB 4MQ7A 4Q6IB 3TIEA 3I6SA 5SWQA 2L7EA 2VZUA 5F7UA 2XYCA 5TF1H 1YY9C 4FQIH 1SY6L 1FWXA 2CHWA 4P2OA 4YUEL 2XN9A 3PUUA 1P6WA 1KIPB 1X7QB 3QEQA 3VFNB 1L3NA 2BRRL 1VEMA 3ZSTA 1A66A 3NH7L 1XR9A 1AFVH 4P5TA 1LO3L 2UXVA 3DOIA 2VABB 1JGLL 5EU6D 1IM9A 4HSCX 4H44C 4Y4FC 2R23A 3G5ZA 1CIDA 1NFKA 1GIGL 4D9QE 5HJGA 5I1KL 2DQ6A 2P47B 4XMPL 3RL2A 1A7QL 3DUHA 5KBMA 3RE0A 4JM2B 1IVTA 3L13A 3LNFA 2R56H 5AOLA 3FAWA 3SKMB 2CR3A 3WY2A 1QPKA 2IQAA 1LLAA 3MUGB 3W2DH 4HPOH 3NSFA 2W07B 2OTPA 3MV8D 3DOSA 3EYSL 3PIQA 1LO4H 1S5HA 2F53E 4M9PA 5CEZD 3CBKB 3FNKA 3MGTA 2GAZB 5H35B 3V7AE 3MJGX 2HKFH 4LLYB 1CD0A 1V3KA 4XXDA 2PN5A 3EUUA 4XNAA 3AVEA 5CINL 1CTMA 1EHKB 1DVFA 3VI3A 3X3FH 3MOQA 2O5XH 3W0WE 1FLRH 1EVTC 2K70A 4FG2A 3QFJA 4E36A 1ITBB 4XOCA 4JVPA 1MCIA 5FOJA 3GSOB 5KYNA 3RKPA 1UA7A 4JHUA 1GAFH 4XCEA 1NM4A 3UYPB 1ECZA 2YQ2A 1HE8A 3WDIA 4GMTL 3WIHH 2ALAA 1ICTA 4OGXH 4WF7A 5DHYB 4HULB 4JPKL 3F7PC 3FO0H 1EXUB 3VJ6B 5BW7C 1UT2A 4CNIB 1TJGH 4D3CL 2G4GA 1XT5A 4APXA 4IIZA 4B5ZA 4BUHA 5IVXF 5FGBA 2EYTB 5I19L 4A7GA 5L2KD 2IBZX 3AU1B 4PJCA 3I9AA 2NYYD 3VXTA 4P2CG 2DKMA 2JF1A 3GI8H 2BOLA 1U8OA 4FNSA 1AKJB 1HH9A 4XH2B 1R5VB 4MNQE 4U2ZA 4H0LC 4J39A 3WKMH 1QKZL 5AD0A 4W4OA 4S1RH 3WFBH 3MHZA 4XP1L 5DVOA 3V52H 1NFDA 4K2UL 2Q86A 4HIIB 5EU7E 1COBA 4QTHB 4AZ8B 4DAGL 2J3SA 1R46A 1IC0A 4D94A 3QGVA 3QS3A 4KROD 5IB3A 1RULH 2OI9C 4KK9D 1FFOA 1FVDB 4HMCA 2PXYB 4ZX3A 4ODTL 5KYUA 1HT6A 2VLRD 1WS7A 3MBEB 3L2NA 5BOZG 3ZTDC 2WBKA 3P2BA 2AEQH 3FUNA 3QIWA 1BZ9B 3QWQB 1B4LA 1I8MB 2AC0A 1WZLA 4NC1C 4HX1A 2H9GA 3C2AL 5ANMA 1JVKA 4QXVA 4GH7B 3VXSA 2FX8H 3FUHA 2PCFB 3ARXA 3FSVA 4OZIF 4LCYA 4QAWA 5T1MA 1U8MA 3LNDA 1ZPLA 4EMZA 2FTAA 4Z7QE 3TFKD 1FZOB 4HBQA 2VUKA 4LMQE 5E2VL 2WLLA 1H6UA 5CZXD 1ZK9A 1ED3A 3MZGB 4X5LA 3D2UB 4ZMOA 4NN5B 3HZKA 1LK2B 3JVFC 4X8GA 3GTNA 2F18A 3QP3A 2FE0A 1QI3A 2MIZA 3IN2A 2P8MB 4J3OH 1MREH 3D06A 2NXZC 4JY5H 1BVKA 4JZJB 2LVEA 4I9WD 1JMXA 4MZ3A 1KJMB 4L3EE 4WNSA 3F2LA 2Z6FA 4K3JL 1EUUA 3GPEA 4OIIH 4Y5YB 3K91A 5I1HH 1DBKH 4V1DB 4TLKA 4WHYH 3FTVA 5FHAH 4OVVA 4PJGA 1XAKA 3WNMA 5FECA 2OMNA 1BBDH 3GJFA 4WEMB 4Z6AT 3UO1H 1IMHC 2DQHL 4TSBH 2FX9L 2O61A 1AO7E 15C8L 1NUNB 4JO1H 4LLVA 4PRBA 3QJFB 1KUMA 4PMEA 3TYFA 4XBEH 4MD5B 4AH2A 3DX4A 2BSTA 1A4BA 5TPWL 5GS3A 2OMZB 3RHWF 2MCMA 5MHSD 3AREA 1T5XA 1G1YA 1NEZG 1INEH 3KPSB 2GG1A 5TE7H 5ICUA 3H9HA 4GIPD 4YHKH 5C2UB 4W9CC 3BEVB 3OLIA 2X4RB 4GBXC 3TJPA 2CCLA 2FLRT 3L3OB 4GRWF 1I9JL 4TNVF 4F33B 2J8UE 2HUHA 3UTSD 2KZ1B 3SPIA 1CICD 4IHBA 2QGDA 1G1KA 1S9VA 4DP1X 3MUHL 3MO1B 4POZD 3OGOE 4TXVB 5ICXA 2OLDA 4PV9A 5FO9B 1CD9B 1QSFA 2CUAA 4ZXBD 2WWMC 1FPTL 3SPHA 4G7VL 1U58B 3MV7D 4IRSB 1HZHL 4NZJA 1QBBA 3HB3B 4A04A 3UTTE 3LN5B 3DPBA 4WY7L 3U0PB 1OTSC 6PCYA 4EKJA 4KKAC 4DPBX 3WTSA 2CJUL 3FO1B 1Y7VA 2BX5A 1AZNA 4AE0A 3WAJA 5HYJD 4JN2B 4MZ2A 3INUH 1L7IL 5DHVH 1BMGA 2GT9A 1XF3A 4K94L 1NBCA 5E94A 4JPVL 1U3YA 1DUZA 4XMLH 2O1AA 1RJYB 4BFBD 1A4AA 4Z7OF 4GFTB 1LHZA 2VUOA 1NGYA 1KEGH 4P2OC 3SGDI 1DQLL 1ND0B 3RWDB 4PJXE 4HS8H 3AGVA 2OAAA 2G2RB 3AWFA 5IHHA 3MRHA 1RZGB 3S37X 4P5TC 1GC1C 2P26A 5T5NF 5D93C 1HXMB 1ETJA 1Q94A 4LHUA 1C5DA 2GCYB 1PZ3A 3BKCL 2QTVA 4HGMA 1DLHB 5DZAA 1MCPL 2EE9A 3UPAA 5KZCD 1CYXA 1GGYA 3H3PL 3HPLB 2EVFA 1RZKL 4CRPA 5B3JE 3VGAB 3E3QC 4JO4L 1KTBA 4TULL 4R90H 1OTTC 4FNLH 1N18A 4BA8A 3VQ1C 1N2RB 3RGVD 2V7HA 2WUBL 1NEZB 1NL0L 3VYNA 4HK0A 4LPUA 4XCFH 1DJHA 2WQXA 4JG1H 1WJ3A 5FM5M 3SIKA 2CRMA 3NEXA 3MRPB 2Z65C 3MV01 3GJEB 4PGZA 2D7MA 1CFSA 1PLCA 3FTWA 4C56B 5J9PB 5IT2H 3H53A 2P1YA 1HSAB 4EI6A 4FZEH 2VR4A 4OCNC 2VXUH 5AW6B 4DK6A 3P0VL 5JTWA 2DBLH 3FU3A 3QEUA 1KLUA 3ES6A 1FL3B 3FCUB 3GBNL 3ALPA 3HPJB 4DPAX 4PCYA 1UA6L 4GW4B 1DVFC 3A6BL 4A38A 5DMKA 2C3XA 1DL7H 1OO2A 4KXAA 4JGUA 1X5LA 1WISA 2BMKB 2DYRB 1UD4A 2GJ6A 3ARBD 4JRXD 4OY9A 4R96B 5T1LD 5K9QG 3O8XA 4E41D 3FPYA 3V5DB 5DUPL 4AEHH 1JHKH 4OZFA 5TDOB 1B9ZA 1NGQH 4PJEF 4YLCA 4NQSA 5IB1B 1EEYA 3ZYJA 1JV2A 1CC3A 3BJLA 1JRHL 4LLUB 2RALA 4F2MB 3C8KB 3FFCA 2EDJA 2XU9A 1QYGH 4YSSA 4G1EA 3D9AL 5HGGS 1MRCH 4S1DD 2AJXH 4N20A 3VWJA 1W0YT 4ODWB 4HIJA 3H7LA 3MRLB 4FFYL 2NXYC 4LBEB 4Y5VB 5L8KB 1NPUA 1VCAA 2WLMA 3FQWB 4ABVA 1MCBA 3WGVB 4RETB 2ZKMX 4JFVA 1T1XA 1QUNB 2GI7A 5JHLH 3P4OB 4FLHA 2VE6A 3WHXB 1A7PL 1QA9A 4Y19E 3ZE2E 3FQ4A 1EERB 5KOVC 5E1AA 3ECWA 3N85H 2VN6A 2NY6B 4LVHC 2I5YH 1EFXB 4W4OC 5E7FA 2E7HA 3M46A 4PRNB 4PV8A 4HUKB 4P9MH 2XBTA 1RQ5A 3NJKA 5ESVA 4YXKH 4AC4A 4HCFA 3U9WA 1RUKL 3BE1L 3QQNA 4PH8A 1DDTA 1M7UA 3TEZA 4UDTB 3E6FB 4QHUA 4G83A 1EO7A 5I6PA 1B3JA 3VXMA 5B39B 1FH5L 3RLSA 4AKQA 3M07A 4PRDB 4PLKD 3BH9B 4ZMYA 4OZ4B 5AVTB 2X6AA 4PJBB 4MJID 3WNKA 3E2HB 3SKUD 3CFNA 1KB3A 3QCUH 4FFWC 4H8WH 3WLWC 2IIJA 2AK4B 3L5JA 5D9SA 4AV0A 1ZT4A 1BD2A 1V3LA 1BOYA 2OMWA 4GXVL 4QRQA 2HX8A 4Z3TA 5DSCB 1II4E 1LWHA 2GTQA 1NJ9A 2OR9H 3ECQA 2YKLL 4XNZB 4LARH 4OAWB 5CHNB 3WFZA 1A1OA 1FG2A 4JQIH 3FW6A 3HAEA 2CKBA 5IFHH 4G8EA 3N44F 4MRBA 4GAYB 5BRZA 2VDMB 1HL8A 1IL1B 1M7DA 4IEFB 4I48B 1QFPA 3FRPB 4Y4HA 2E3VA 1B88A 2WB1A 4G9DA 5FFLA 3UJTH 4XN7A 1LQBC 1EH9A 1P4BL 2NY3B 4P0DA 4Z7WB 1XGTA 3HVDA 2Z91A 2NY2D 4IDJL 3O9WD 4DKDC 1IQWH 1MIMH 3MTXA 4JZOA 1YEEL 3E8VA 3DK2A 5D7LB 1PFCA 4K7FB 5DJ6A 1XHHA 2XPYA 2D9CA 3M8OH 3X17A 4JHWH 3N06B 4UAHA 2PCPB 1KJVA 1FYHB 4AYBA 1OGAB 1SJHA 3QDJD 3FK3A 5FYKL 3EOBB 1X5XA 5IMMA 4N0CC 4HIEA 3ABZA 1TFPA 5KSUB 3RX7A 1CXEA 3GMOA 3HFML 1P7QD 1S9WA 5LB1A 2RBLA 4XN4A 3SGJA 3VFWB 3O81A 1HIMH 1G6RL 3QZMA 3UZEA 1FAKT 4FTVB 4ZO7A 5CJOH 2GQHA 3QYCA 2VISB 3FUDA 4UYQA 2WXIA 5SWSA 3VFRA 3RI5F 5HD8D 1M71A 1WA1X 2EDTA 3QJQB 3PL6A 2R0LL 1I8IA 1KTLB 2GBTA 5D5MF 5F0LB 3BAWA 3EH5B 4P07A 5E5LA 4LSVL 3RPIB 3SDYH 3IGFA 3B7YA 3UTQB 2EXYD 1TIUA 1J9RA 2CO6B 4JZNA 3GKZA 4OGAD 3L5HA 5EC2A 5C0FB 2ENSA 3K2MC 3V2AR 3O6LL 2COQA 3T71A 2I60L 4PJDE 2ZUXA 1IIIA 3C75A 1DE4B 1GS6X 1HSBB 1MVUA 1OWWA 3L4UA 3NYKA 4FOMA 3UC2A 3N9GH 2FD6H 2FUTA 3OZ9H 2QVFB 2YPLE 2CZNA 3MXVH 3VA6A 5KSVA 1T89A 5INCA 4PIBA 2OL3L 2E0PA 3WCYA 2D7QA 5T3XD 3NJJA 3OLGA 1V27A 1OCZB 3HNSL 2K1MA 4ERSH 1ODAA 4HJTA 5D7IE 2F0CA 2YGNA 4WKXA 1N6QH 3RJDA 1YN6A 4KRPD 1VA9A 4XXCA 3O4LE 3U1QA 2P5PA 1EVUA 4UTAH 3VD7A 3QCTL 4JM0A 4KTYA 3H3BC 3P9MB 4XP9H 2QFPA 3HLAB 4YHYC 1G6RB 1DQJB 2XNAA 3HBZA 2AQRA 2GHWB 3VI4A 5I0VA 1MI5A 2R2BB 3C09C 3U4BH 1SOQA 1SDDA 4IS6A 1KNOA 1KYAA 4AXWA 1R24B 4OB5H 3HHSB 2WLJA 2XQYG 4HC1A 2WIMA 4ICWA 4W9KC 5CSGA 2PO6B 5DCCA 2A83B 1ETA1 4TNWK 1KMGA 1XGPA 5J3HD 2DWDA 4S2SB 4YH6A 4DVBA 1OAYH 3MRFB 2OMBA 3FTGA 3EJYC 3H9SE 1JXKA 1QTPA 2OJZH 2G5RA 4JDTL 5DC4B 4YHPB 3WKNA 2AV7A 5GGTL 3NJMA 4LDEB 4ODSH 5CP3A 3FT3A 4TVPD 5FUCC 3U2JA 2Y3AA 3MRBA 4KU1A 4TNFA 4CU6A 4ELKA 2XVGA 5C09E 4ZOCA 1BVNT 4N2IA 2ZAGA 3ULVD 3QH3B 5TGBB 3F83A 2EDHA 4BBWA 3GSNA 3QEGH 2HFFB 2OL3B 1DSWA 4NKIL 5I71C 2FT8A 3ZXAC 4HCRL 2BK8A 1JG9A 3C08H 4FFZL 1AVAA 1I3RB 1UADC 3EOTL 2H26A 5HHME 1GHFL 2DM7A 3B2MA 3MX0A 4JO3H 3NCJL 3VSVA 1UCTA 2YSTA 3AFLA 4UNIA 2DH3A 3BH8A 3R4DA 2C4XA 1XVSA 4FQXD 2BFVH 4OCWL 5CAYB 4DW2L 3ZE1F 5KN5A 2HH0L 4NRZB 1KTCA 2MOQA 2VN4A 1HTYA 2ED8A 5E6IB 3KYMA 2C9VA 3JTSA 1NCOA 1G7LB 4RFOL 4P9HH 3VFGH 2O6FA 4HIHA 3RNQA 2ZXDA 5IJVA 2IANE 4ZMLA 4G8FB 1YZZA 4WQOA 4L4TB 4W9LC 3WIIL 2JKWA 4PRHA 2DQJH 4OGQC 3EF4A 5KTEH 5H37G 4LSQL 2ZYSA 1NC2B 1QLRB 2P80D 4M1GH 4TNVK 4XO5A 4GKSB 5JLZB 3SDDB 4GEJA 5BZXA 2P45B 1T0OA 5E8NA 3O8XC 3I2CL 1XSIA 1U2YA 5A3ID 3TBYB 3DV6A 5H2BA 2IEPA 2HXAA 5AYUL 3EZ8A 3CV5A 1X5KA 3MOAH 1F58L 4A7VA 4ZFFB 3GI9H 1KCRL 3CK0L 1FIGH 3VXRB 3BYYA 4QJ3B 4K7PX 1VKXA 1WE5A 2VRQA 5DWUH 3CVIH 3UG4A 3VG0H 3QPXL 1OKEA 3FU7A 3ROLB 4GXFA 1WF5A 2KQMA 3QDMB 2GJZB 2YUXA 4NPKA 3B3BA 1H8LA 1KTKE 3MA7B 2UWEF 4N0UB 4LCWD 1CF8H 1UATA 1JWSA 2UZXA 2ZX6A 3NDYE 2DIEA 2V5SA 2GSGB 3MLZH 1T5KA 5JHDA 2FGWL 1LO0L 2RACA 4FC3E 4HHGA 1JI2A 3CPUA 1YPZA 2HAZA 5T1KB 2RCSL 5F7KC 3V5KB 3BH4A 5JOFA 4FLSA 5JIMA 4AVJA 3DX9A 3F05A 3KGUA 1IBZA 1GS8A 1T3FA 4PJIE 2H32B 4HJGB 3CXDH 4OZGA 5F9JB 4M61B 1K2DA 5LGJA 4JRYA 1D6VL 2H6PA 1QACA 2G3MA 5AW8B 2AP2A 2V7NB 3CN1A 4ONOA 5KBDA 2CIIA 2E4FA 3O3UN 3SEPA 1ZA3A 1CDBA 4ZPTB 4L8CB 1IC7L 3GZPA 4ZNEE 1G84A 4MNGE 3B9EA 3DHUA 3QDAA 3BP4B 1HI6B 1PL3A 4XBMA 2F7OA 5FO7A 4MA3B 1SGKA 5DZOA 1CR9H 5C2BH 4XPFL 5IB2A 5I1DB 3AT8A 4TLSA 2WM0A 3RTQC 1TITA 4DGVH 1JN6A 4ENED 4DJMA 5IHZA 1IGJB 4P23A 2WK2A 1F4YL 2PCXA 2CGZA 4IIQA 4Q9BA 5D1QA 5DZLA 1CGSL 5E70A 2F5AL 3MV9E 3QRFM 1M1XB 4OZIE 2CUHA 3NCXA 1JXGA 4YAQA 3CN0A 4PD4K 1BYNA 1H3VA 4HQQH 3VU1A 3MRMB 2WGXA 4KKZA 1CU4L 5ES4B 1CI5A 3FSOA 1U0QA 3OKNB 2BNRD 2X6CA 5T3ZE 1F11B 3IDYB 1F90L 4RZCB 5JUEH 5IMLA 3ZT6A 3K6IA 4M7ZB 3LKQB 1UM6L 3RWHA 1MFBH 4O02A 2BHYA 4X7SH 5K93A 3FQRB 3H4FA 3MR9A 1YEHL 2UXGA 3GSQB 3SGJC 3G3LA 2O26U 4UQCA 1ACYH 2VQTA 2B1OA 4XBGB 1KYOJ 3UZEC 2BP8B 2X87A 5LLIC 4X4MA 4NQXB 3KPMA 4H1LH 3QCVH 3P3YA 5IP4A 4FHKA 2F8VA 1A6PA 2WZPA 3D3VB 4MD4B 4HOXA 5J12B 3FS9A 3HUJF 2EO1A 5E95B 3TBSA 4WDIA 3BVNA 2WLKA 3LVTA 3I9PA 2OP4H 4YSPA 4ELME 4XPBL 5F71A 3GIVB 3DX0A 3HKFA 2QADB 3ZW3A 1LL1A 1LJMA 4R26L 1FZJB 3RFZB 2VLKA 1UA3A 2RJMA 1NICA 3GNMH 4KJPC 3S5LG 1GC1H 5C0EA 5FW7A 1ASPA 1T89C 3ZUCA 3OKLA 1O7SA 4NERA 1NMCB 5I8KH 3RWEA 2FRGP 2IMNA 5LAPA 4GRWE 3DWTA 1VZHA 3UFIA 4JDZB 4TUOA 4L0YA 3I6KA 4Z95H 5IV2A 5EB9A 3QUYD 4TSCH 4ZUWA 1J0JA 4XXCC 4DCQB 5IVZB 2XI9A 3DRQA 2XLLA 5I5MA 1RK0A 3PHOA 3CSTA 4RISL 4K8RD 4EN3B 2GBUA 4XC1L 1YYML 1A25A 1KWKA 3S34L 5GIRA 1KGCD 5E5MA 4UT9A 3DARA 4H0IA 4M6ML 2F2HA 5DDHA 4LSRH 5I75C 3T0EA 2WAHA 2R1XA 2W65B 2AI0H 2OX5A 3MRCB 3QK0A 3BZEA 4QT5B 5ITBH 2IV9A 3NESA 3ABGA 1CGUA 4A2LA 4RA3A 4O2EA 4MA8L 5F0PB 2FQGA 2WZ5A 4RIRB 2CHXA 4KXCA 1KC5L 3CH1A 3CLFH 3ZSSA 4AGQA 1TG8A 4Z7OE 3LKOB 2OMVA 3KR3L 4LU5L 4IBWA 2HG5A 1HZLA 1CFNA 2BVQA 1UCBL 2NY1C 5HGDB 2YZ1A 2BS9A 2EO7A 3BPOC 5BRPA 2Z4QB 3OG4B 3L3KB 1EMTH 4XCYA 4U1HB 3X1BA 2UZYB 4F1SA 5C7XH 1AMYA 3R8QA 4MDIA 3B6SB 2TRYA 4G9FB 9CGTA 5T5FA 5KANI 4ZD3L 1RI8A 5D4QA 4MWFA 1P84K 4WIQA 3QI9A 5EU3B 4KUCD 4A39A 1AKJD 3CFUA 1DDHB 1JSYA 1IZKA 2JJWA 4XVTL 5LGHH 3KLSA 1ZLSH 4PGJA 3S88L 5JR1H 3D85A 1VZGA 1N5YH 4XT1C 1A7OH 2Y7SA 5E9DE 3NG5A 4QOKE 5EN3A 2DQFB 3P1VA 3T4AB 1V05A 2ZKYA 1HHIA 5DO2C 3DIFB 4X6DF 2ITDB 3KVQA 1E6OL 2GFBB 5C0AE 4OZHB 4IRJA 4KZEL 2YRZA 3Q05A 1S7VB 2RAMA 4DGIL 3TH4T 4PWKA 5KYWB 3UZVA 3MBED 3BUQA 1LXMA 1LILA 1TQBB 1QZ1A 1CVRA 2QMJA 2VSKB 4U0RB 2J2ZB 4AKOA 5ID0A 2BZCA 4I7ZC 3HNTH 3ZR6A 5K9OA 4JFTA 2BH0A 2V4LA 1DLFH