2Z64C

Crystal structure of mouse tlr4 and mouse md-2 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
QQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-like receptor 4
publication title Crystal Structure of the TLR4-MD-2 Complex with Bound Endotoxin Antagonist Eritoran
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2007-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2z64C00
3WEBA 3MTXA 5KWYC 3T6QC 3RG1C 3B2DC 3WEAA 1XWVA 3VQ2C 2HKAA 2E59A 5IJCC 5IJBC 5IJDC 2Z64C 2Z65C 1A9VA 1KTJA 2F08A 2E56A 3VQ1C 1NEPA 3ULAB 3FXIC 3M7OA 3MU3A 1AHMA 1WRFA 4G8AC 1AHKA
chains in the Genus database with same CATH superfamily
2OA9A 1AS6A 1A7RL 3C8KB 2WCGA 5SX5K 4J8RB 3UTQA 3V6OA 3BVUA 3LN5B 3P30L 5CILL 5GSRB 4NFCA 4P5TD 1I75A 4BM7A 5K1JA 4LOUD 5JHDA 5EEVA 2MFNA 5SX5H 1UXMA 3RWEA 4JG0L 1F41A 3LKQA 4ES9A 4RAUA 2ZAIA 4QJ3B 1OAXL 4GQQA 4FNSA 4NQCE 5FYLD 4RGNE 3EG9A 2IGFL 1ED3A 1NDMA 5C3LD 4MNGB 3LXCA 4PFEA 2HA1A 3ZTDC 4A37A 4HFWB 1QEWA 4CC1A 4WAFA 2VM9A 1HH6B 4JUTA 2UUDK 1XCTA 3WN6A 1CG9A 1IC0A 5IQLA 4N0RA 4UB0H 5FO9B 4M8UA 2UUDH 5SWZB 1DYZA 2FHBA 1T0OA 3G6JB 1S3KL 3CXDH 4GT0A 3V6OC 3VXPB 1SXNA 4K9EL 1L9QA 3LKNA 5L2JB 4TVPD 1YNKH 2XVBA 4X99B 5DFAA 3Q9QA 1X5KA 5E4IA 4W9LC 3IB4A 1M57B 1R24B 4LVOC 4FTVB 1UB5A 3OAUL 4UT7H 5T3ZD 5EORH 1XIWA 5ICZA 3CH8A 1CR9H 3WTXA 1T22B 1KXVC 4FP8H 2I9LA 2N4IA 4ZMAT 4RAVA 4XNZC 1KIPA 2YSSA 3R8BB 1UG9A 1JPSL 4ZX6A 3QO1B 1CL7H 4PJGA 5AD0B 3QC5X 4MHHI 4JO8A 5K59E 4MAUH 4PV1C 1ETB1 2FZ3B 4PP2A 1KGCE 2PYFA 1FFTB 5FO2A 5C6TH 3D4ZA 4NM8L 4HJTA 3WFDH 2CIKA 2R27A 3CJJA 4YPGB 1YMHB 4WJ5B 1OQOA 4E41A 2ZXAA 4JO3H 1Z2KA 3RVXD 3MOAL 3D50A 3VTMA 1HE8A 3E1ZA 5EU5B 1K3IA 3FT4B 3Q8CA 4ONFH 4ATTA 3FN0H 4NQCB 4EIZC 3LVEA 1F86A 5A3IC 5IBUB 1F3JA 3D39A 3HCVB 4JFZL 2PYEE 3HZVA 3LQMA 1BAWA 3MOBH 4AL8C 1JBJA 4M6ML 4M43L 4X42A 2WXFA 4XTRC 3E1F1 3UTPE 4DQOH 1E5BA 1I8IA 4QHPA 1ACYL 1TYEB 4EUPG 5J1AA 5I15H 4FQPA 3RU8H 2R4SL 3QT2A 3X13A 3IJEB 5I0DA 1J5DA 4HHGA 3IMSA 3KYAA 2X10A 2ARWA 2W59A 2HRHA 2YLKA 5I6NA 2OMZA 3WNKA 4PH8A 4FQ1L 5E8EA 5DJZB 2BIOA 1QACA 4IJ3B 2EXYC 3BUYB 1W91A 3L9EA 5DMIL 4WEBH 3GM8A 4QJ4B 2ROYA 3UBXG 3FBKA 1FO0L 2UXTA 1Z0NA 4HX1A 4O02B 4ONGH 4F5CA 2EIZA 4FE9A 4O2CB 1MFCH 4XP5H 2ZCLH 3D07A 5IHUH 3LSOA 3B1TA 3MV7E 1BF5A 5BZDB 1JZEA 5FA3B 2GSGB 4U0RC 3EADA 1NANI 3UAAA 4JPVH 3U79A 2BY3A 3NSXA 2QBWA 4UIMB 2LU7A 1T7ZA 4UNIA 4YAQB 1IM9D 1V54B 4I85A 4FFVD 1VEMA 3AREA 4NRZB 3BEWB 3H0TB 3ULVH 2APXA 1BF2A 2B08A 1P4BH 4HS3A 3ZPDA 1HH6A 4CVXB 2BCKA 2ODHA 1U8JA 4GKZB 3NP4A 4JN1H 4JQXC 3RWDA 3G5YB 3K80A 3LS5L 3PUCA 3P4OA 1Q72L 3U82B 3F62A 4Z7OE 3OGCB 3VACA 3ZIYA 2V5MA 3MTXA 4PJ9B 5ICYB 5LQBH 1NAML 4ZG1A 4YDKH 3LMJH 1X7QB 1R24A 4ZD3H 1G84A 4EDWH 2R2CA 2EO1A 3FCGA 3EO0B 3UTTD 1OP3K 2BIQA 2Z31B 1B0WA 4F5CE 4L8CB 4WWNA 1LMIA 4MCNA 1A7OH 4FXTA 5ERWB 1HWHB 1IBFA 5EN2B 4AVJA 3SDAB 4UQ9A 3AJ7A 2Q8BL 1W72L 4ZT1A 2FEDD 1I3GH 2FZ3A 5EO1B 1OXYA 1ZHLB 4E0RB 3K5RA 1A6AB 1D7DA 5HGDA 2P8LB 3IFLH 1BOYA 3MV7B 3GMLA 1CJYA 1NC2A 1E3ZA 4HZLA 2N1KA 4PGZA 4WTZG 4Z78B 2B1AL 2FWOB 2VQ4A 5D2LF 2EUVA 2NCEA 4Y19A 4ZSOE 1SVCP 1F3DH 1GS7A 3FBQA 4X7SL 4K15A 2YUXA 4MVBC 1V7ML 5HI4C 5CP3H 1N59B 3WDJA 4GY4A 4LNVA 3SPHA 4IBSA 2CJUL 3DV6B 3OL2A 3L7FA 3NFSL 1U8IB 2NY1C 3CFDB 2VERN 4S1DC 5C07B 3KPOB 4BJLA 1YJDL 3MNMA 1HWWA 4HUNB 5KBDA 2WIIB 1OVZA 1K8IB 1PKQE 2VXQL 1CMOA 1AY1L 2UZIL 4WU5A 4O5LH 1B2WL 3OXSA 5DD1H 2WNWA 1BVLB 2EYRB 2Y69B 4MYPA 2NY7H 4QRAA 4XPTL 4E42B 2Y4SA 5ABZA 1F4WH 5C0ND 2QFPA 1HZHL 3F7VA 5JNYB 2GK2A 4BK8A 3AITA 2DLFH 1M05B 3HFMH 5DJZA 5AVZB 4KQ0A 3BUYA 5B39A 3UDWC 3W9DB 3MGTB 2WMPB 5T1JA 4UQCA 1ZHNA 2JF1A 4BV1A 5GZOA 4RX4A 5L6YL 4IEFB 5AW5B 2QL1A 4LF3A 1UEYA 4G7VH 2P5EE 4KDWA 3BMVA 1N7ML 1UM6H 3MACH 1SZNA 3V7AG 2RCSH 2H1PH 3MFFB 1TVBB 3OF6A 3APMA 1SJXA 5FA3A 2E7MA 5T5NG 4ZNCD 1JYNA 5SV3A 2HT4D 2CD0A 2GSMB 4XODA 1T66C 2C3VA 4GB9A 1MCOH 5DHMC 5HYIA 4M7LH 2HJKA 3ARBB 2ZQKA 3G6JF 1C12B 2IAMA 4NYLA 1UKSA 1PCSA 4APQA 2M1KA 3GF8A 1SLUA 3NVQA 3ARTA 5BMFL 4M5TA 3GXDA 1OEZW 4Z7UB 5HJDA 3PDGA 3O6FD 2C1OB 3V4VL 4NZ8A 3L08A 3OKLA 4UU9A 4MA3B 3T2NH 5AWNL 5GZOC 3VFVB 3HLAA 4UM8A 3AAZA 3IS0X 1Y0LB 3VWJA 3IGKA 5G55A 3OSVA 3BH8B 1A1MB 1PVHA 4MJ2A 4YL4A 3TBVB 1HJBC 3HBZA 2GITA 1PKQB 3VWKB 4B7IA 4TOYL 3J8F7 1WFOA 2AQTA 4GG8A 4RNRA 2RBLA 2PPEA 2IAMC 1AZZC 3MV8D 1FZOB 1XMWA 4ZFOB 2BS8A 1A14H 2OZ4H 3IKKA 3ZSTA 3BJ91 1L0YA 1S7TB 4M93C 1NIBA 2J8HA 4ADIA 3PDOB 3QXWA 4L3CA 1G5AA 3EO0A 1KLUA 1KTRL 3N1PC 2AVFA 4IBLT 4UV4H 1ZA3B 2A9NH 2Q5BA 5EN2A 1DLFL 2O5ZL 1FF5A 2H0EA 3VFWB 1QBML 4GRLD 1DQVA 1VFAB 1NEPA 1NTDA 4E9LA 4OCSL 4C56B 2P5EB 1UWEH 2ZG3A 5FOJA 4I3RL 3B2XA 4Q9RH 5GJTH 1H3VA 2P8LA 4UDTB 3TO4B 4W6YB 3VI4A 4QTHB 4WNQB 1UT2A 2K9UA 5JIPA 1DQMH 2FUTA 4IRJD 4Z78A 1XF5B 3NCJL 2FCBA 1TZ8A 5EFIB 2IPUK 2NY3D 5F1IB 2G75A 4MMYA 1HNFA 1RXLA 4N0CC 2A9DA 1TCRB 2Z31C 1CIUA 4LKCB 5I5RA 3L17A 1P6WA 1N26A 5CZXD 2FO1A 1QNZL 1FVDB 5FR3A 4G9FB 3RX9A 3SDAC 5L88H 2A9CA 1N6QH 2WW8A 2ZICA 1B6DA 1BVNP 2H45A 2V5RA 1KTDB 3AUWB 4M6OL 5IROA 5BS0D 3QZWA 4Q97A 4OGZA 3QSKB 3NJHA 1JZIA 1NFIB 2BP8B 3VDBA 2JK5B 4KK8C 2YHGA 2WCSA 3PWLA 2EE2A 5D93B 4N2NA 3MRIA 2W07B 4UV7L 5K59F 3IPEA 4YLCA 4UTAH 4DH2A 4GQPH 3HS9A 1MVYA 3SDXA 3LVTA 1OE3A 1KTJA 1RURH 4HEPA 3D69B 4BK5A 3I3BA 4CDHA 5IKCA 3KZ8A 4QRSA 2GJZB 2GFBB 5C0CE 4OV6F 5EC2A 4H20L 4NP4H 5IROC 3ROLB 2D73A 2H2PD 2OXGA 4IRSA 4JMNA 4WGVB 1KMGA 3QUYD 4X4ME 3S3BB 1DQTA 3CVHA 1UUNA 3MTRA 1X5FA 4OQTA 4N0YL 3IDNB 4ZX4A 3P3RA 3WSQH 2Y24A 3VRLF 3JVFC 5FIEA 1D5BB 3U6RB 2F5BL 2AI0H 1S9YB 3SY0B 4D9LL 4ZMZA 4AT6B 1JF1B 4CADB 4OFIA 4GRMB 5KVEL 2FJGA 4BK5C 1NLDH 2FJSA 2F7RA 4KGJA 1OM9A 3MLSL 5IMKB 4UUJA 1NFDB 4LBEA 5CCHE 4G5ZL 5JZ7C 3V0GA 2P43B 4P23D 2AXFA 3GSVB 1HHKB 3CN4A 5I1JL 5JPNA 5ETUB 1RJLB 5HJGA 1TQTA 5TDOA 4LASH 3CFKA 5TDPB 4A2MA 5JQ6H 3SQOH 3WL9A 4NBYB 2K6WA 3ARBC 1P2CB 3S4SB 3MJ7B 1MHHA 1Z5YD 1GVIA 3I9GL 3QDJE 4GI9A 3SDDB 5AW2B 1CYXA 4HWNA 4PV8B 1S7TA 5GGTA 3PDOA 2VN3A 4J8QA 3E2HB 3FQNB 2WLLB 3FRPB 1L5GB 5BVJB 3W82A 3OHMB 3WY1A 4IJTA 4AG4L 4HBQA 1IGIH 1ZXKA 2LU4A 5JPNC 2EVFA 1A1OB 3STZB 3VXTB 5FKAB 1MI5E 3SY6A 4K94H 4C56A 3BKMH 1OCOB 5HTSA 2EEDA 1W2KT 3VWKC 4OFKA 4WZ9A 3U9PL 4JK0D 4G3YL 4P4KD 2WLZA 4QTHA 3Q8AA 5B1JA 1IQDA 2EO7A 3MSPA 3O3AA 4U1MB 3W39B 3KYNB 1MFEL 2JJTC 3QG6B 5GGSY 3UAJA 5H37A 3H53A 4N2FA 1ETZA 3U2SB 2GPZA 1A4CA 5DQ9B 1HEZB 3HG5A 2DIBA 4PR5B 4E9SA 3VYPA 1OSPL 3ZGHA 1YNTA 4UWQB 2ETWA 2BZ7A 1ACCA 4BWWA 1TZOA 4G9FA 4GIPD 3UZQB 3I6LD 3DX2A 3V6ZB 5CLXA 2GC7C 1AQ8A 4TTDD 1X7SA 3GTNA 1FZKB 1NGXA 4OVVA 3BVVA 2K0RA 1DVZA 4GW4A 3BH9A 4HJ0C 3TIEA 3TO4C 4KNQA 1CQKA 1GJUA 3MLVL 5B1JC 1N2RB 4MD4B 3WS3B 3P73B 4QIRA 1FL3B 4H5SB 1ECYA 2IDUA 4I48A 3U0WL 2XBZA 1Z3GH 2WIMA 3C6LD 5D71H 5FYJE 4AIZB 1EEZB 5TGBA 3QXDA 1JPTH 1W80A 1EAOA 2WWKT 4JLRA 2XTJD 2J8UE 3BE1H 1JXFA 3DVGB 4HZ1A 5D8JH 4L1SA 2UWEA 1C16B 1EJFA 4QRRE 3S0PA 3DYMA 3GK8H 5B22A 3H9SB 4RGND 2SEBB 2ZJSL 4Z7UF 1T83A 3UMTA 4ANKA 2JKWA 1N67A 4YBLB 3ZK0A 4GUCA 1OT2A 3FO0L 5JA9A 3ARUA 5D93C 1QPXA 3P4MA 3GD1C 4TMPA 2PLTA 2VYRE 1A9BA 1NQBA 1W6WA 4XPAH 1E4WH 1LTXA 1TQUA 4O2EA 1MQ8A 3E8UL 4UTBA 3F7KA 3SODB 4MCYB 2WM0A 3ZU8A 4JQIA 2VE6A 2YGVA 4LPYA 3RB7A 4QT5B 4X4YA 3GIVA 3BZFB 2NY2B 5IMKA 4DAGH 4WFHE 2DQGL 5TTRA 3WIIH 1KIUB 3QXUA 1WA2X 1H3PL 3KPNA 4ANWA 3OKEB 3IDUA 3S2AA 5LDSA 1JVLA 1H8LA 4NT6B 2J57A 3UGEA 1P6AB 1UFUA 2A6DB 3TLRA 3M1BB 4UNTA 4MQSB 1M1SA 3LQZA 1PEWA 4NB7A 1KPRA 3EHBD 5KVDL 3GI9L 1M6UA 2DTML 4M1GL 5IVXA 3B2DC 2NNFA 4X80H 4AMXA 3ZMNA 3ASOB 2YRPA 4YHIB 3GMPB 3KS0H 3QRLA 4K71B 2WLLA 3FRPA 2P80A 3HJ0A 4OGXL 3JV4A 4BQBA 1EVTC 3QJHB 3NAAH 3BSZA 2XWJB 5DJ6A 3CN1A 1A1OA 1K4CB 2DQ6A 3NA9L 4NOFA 1A7QH 3ARGA 4XCFH 3PIQA 1R3JA 3BN9D 3BGAA 4OT1H 2OMNA 1AZRA 1NIEA 1A2YB 1AGFA 2HX7A 3HEIB 3MLWL 3APCA 4RAHA 4CC4A 4M7ZB 1O7DE 4NOBA 3EYFB 4PCTA 4UF7C 3MJ6A 3AZUA 1N6VA 4G6ML 3NIDE 2D3VA 1GKEA 2YAOA 3QG6A 2XPZA 4OF8A 4HJJL 4YHKL 5IFAL 4YDLB 4TUKH 2RTTA 3U2SA 1N12A 1HHHB 3E2HC 5ALBL 1HEZA 4PR5A 5IQ9B 3KLAA 4GSUA 3U2JA 2YBRA 2EDNA 3LKOB 4CN4A 4U31A 5E8NA 5IVOA 4PI0A 4AQAB 4JO4H 2X2IA 4JG1H 1OAZH 4MJ5B 4OLZL 3KCPB 1XL4A 2BOCA 3U9WA 3ZTEA 1BYNA 4Y0GA 2XWXA 3B56A 2QLVB 3G5XB 4PRIE 4J5VA 2R0KL 2D3JA 1KN2H 4F7MB 2OJZL 4NC0B 4JO5A 2FR4B 4CC4C 3T4YA 1CK0L 1DO6A 1N2RA 2QVMA 4FEMA 4I13B 1BAFL 5CAYB 5IB2A 3QIUD 4KO5A 1MWAL 4RISH 2P3YA 2WWKO 1KYUA 4NWUH 1RFDL 5FAAA 2PO6D 3TPUB 3IDIA 2GBAA 1AG6A 1FCCA 2F18A 2ZOKA 1KACB 2MOVA 3L4UA 3MRKB 4YE0A 4PJ7E 4PJ6A 4X6FA 2IQAA 1K8DB 2APBA 5GGSB 1C16A 3MRJA 4JFEE 1U4EA 2ITCB 3GBDA 3DXAA 2SEBA 1VCBC 1IKFL 1KCKA 3BCFA 3PQYE 1NFDF 3QQ4A 5HYFA 1HT6A 3EH2A 1NCNA 4IOSA 1B4JL 2G3NA 4BEIA 4MAYA 2RD0A 3BFWA 4K3JH 5FHBH 4HUCA 5DMJB 3HOGA 5DD5H 2Z9TA 4AZ8A 2BY1A 3QE5A 3GBNL 2Q6WB 1OOWA 1VLXA 4TNFA 5DC2A 5I71B 4KQ4H 3F7YA 3OLDA 1NGPH 2VDOB 1URZA 3HKFA 3V4PH 1WC7A 5E2WL 1XGUB 3BZFA 4L37B 1Q94A 4Z5RB 1Q9KA 4XCCL 4FF9A 4YFDB 1CFTB 2OR8A 1VPOL 3KWXA 1T03L 2YN3A 2VR3A 3OR6B 1RUMH 1CGTA 4YBLC 1FG2B 3OKEA 4POYA 5CP7B 3VQMA 3HHRB 3IDGB 3TTYA 1KT2A 5B1CA 2WXGA 5IOPA 1KJ2B 2FECI 2XG4A 2QVKA 5DRZB 3LIZA 1NGQH 4N8PA 5CBAB 3EYVA 2BVUA 4LSVH 2A1WL 4M7KL 5ESQA 1CVSC 4HFUH 3H7BB 4H2AA 4LDCA 4QRBA 3O4LE 1JNLL 3TCLA 3RWGB 2NY2C 4OCMC 3A6CL 4KK5C 4P4RA 3WELA 2DQTL 5LJYH 4DVBB 1II4E 2PCFB 2EACA 4AL8H 3Q3GB 5JHLH 2ALWA 2XWJA 1HYSC 1EHLL 4WHTB 4MD5A 2IOOA 2AEOA 1RLBA 3GMNA 2HT3C 1MWOA 4I89A 4X6BB 5DMGC 5A2AA 5CCGE 1B9ZA 2QKIB 1NIFA 1ZS2A 4NKOB 4QRPB 5EF0A 4PS7A 3DA0A 4IIQB 4J3WA 1L6XA 4AVHA 3ABLB 4PSPA 2FE0A 3IFOA 4EZKA 2F8IA 3NJIA 5F6IC 4JN2B 3VXRB 1VFUA 5CGBA 1FJ1B 1FAKT 2NNXA 1T1WA 3L4VA 5G2NA 1BIIB 2JXMA 4R90L 5IQ9A 1O6SB 4K71C 2ZCZA 4KNUA 1NMAH 1R0AH 2PTUA 5ENWA 3B1UA 2AK1L 3SJVB 1EAPA 2NMSA 1G6RB 3HRZB 1UYWH 4BQ8A 1L4IA 4OLVH 4YSSA 3V4UH 4F7MA 4XCNA 5DGRA 1IEBA 1SBBA 3PWPD 4M7ZC 2CG9X 4JMXA 4XNXL 3BISA 4HIHB 1DHKA 1DQQA 2QGBA 2YQ2A 5E1GA 4HH9A 4PYGA 4U0QB 1N4XL 4DN4H 1D6VL 2XQBL 4HF5L 2ZXWB 5GRUL 3C9NB 4TSBH 2ZSWA 1XZWA 1MLCB 1A22B 3QH3B 4YDLC 4W9IC 1BJ8A 5LWYH 1Z5HA 2JELL 2WYHA 3AROA 3MRKA 4P5TB 2XN9A 4DGYH 3QUZA 1HYRC 5IJDC 3MR9A 3NH7H 1TPXC 5C0AB 2P7TA 3HLKA 2D2OA 3ILPB 4G1MA 4OF5A 1CI5A 4JHWH 3L5HA 4NQXB 4JPIB 4TUJB 3QNYB 5IW1B 1ESOA 2F1AA 3UEZA 2C9AA 3IMWA 5I1HH 4ZPTB 3QPXL 2ITDB 2Y7QB 3QRGL 3VRJB 1G9NL 1SXBA 3MBXL 3GMRA 1B6UA 4R5XA 4R2GD 4ILDA 5IVZB 5LBGA 2AV1A 2CK0H 4Q4EA 1JD7A 1J5IA 4CW1B 1B4TA 5FF6A 3T1FB 2Q6WA 2Q7YB 4FZEL 1MJJA 4HOMA 1L6ZA 4WGKA 4YSCA 3V0EA 2FJFA 4H44C 1E42A 2C9PA 1ZSDA 2X53A 1BXAA 2VLKE 3IJ9A 4JUSA 3T0BA 3OLGA 3VXUB 2KYIA 4OZIE 4QAWA 7PCYA 2XETA 4OZ4B 1E7UA 4TL4A 3BP7B 3DI3B 3B9KB 2QZ5A 5CP7A 3Q1EA 1EZLA 1F13A 3BFOA 1LE5B 1DFBH 5H2BB 1EX0A 2QVTA 3CXHK 4B53A 4NXKA 1P5VA 3L1OH 3LAFA 1JZ8A 5TFSL 4ZMVA 4ZDHA 3RGVD 2BRRH 2HVJB 4Y1AE 5I71C 1IAOA 1SN5A 3FUEA 2XIBA 4KROD 5IK3B 1ADWA 5FDWB 1AO7A 4GXFA 1ITCA 1YQVH 2DM2A 2NYKA 1DSYA 2CXKA 4NQSA 4TNEA 3U7WH 3GXMA 4FQIH 3WTVA 1N8OE 4JO2H 4N85A 4FQHA 5HDOA 4KHTH 4RSYA 1SF5A 2RA1A 4KPHH 1LL1A 4NHCL 2FEEL 3MRFA 3B9VA 1XO8A 3L3OB 3NQKA 5ECGA 3ARYA 4TPRH 4DPCX 4WTWA 3C8DA 2C8NA 4UM9D 3QCTL 2AEIT 2FRGP 4S0TD 3RZCD 1HC1A 3GXTA 2X41A 4NKOA 1MPAL 4PY7B 4XRCB 4YHMH 4AGPA 1B0RA 1C5DA 3QUHA 1INQB 4IIQA 1M56B 3KPQA 4UYPA 1DBKL 2FSEB 3SDCA 3ZYIA 3FOLB 3MKKA 4XH2A 2FATL 3HNSH 1GY1A 1FRGL 5J7CC 1MQKH 4ZZFA 3WIHA 4ZW6A 2VKXA 4K2UH 4XMZA 3REWA 1NCWH 5JO5B 2VDPB 3S4SG 2ESVE 3X2QB 1ZLEA 4OW6A 4NZTL 3GB7B 5FGBC 1MHPL 2BRQA 1RK0A 3FFCD 1J5OH 5DZPA 4FYSA 2DH3A 2O5YL 2NCMA 2QKIC 4ONHB 3V79C 1JJUA 5MEOA 2Z4TA 4PJAE 4IIQC 2Y6TE 3OV6A 2WINA 2XQYA 3EOAB 3SDCC 3P3SA 4KTYA 2JB6A 2NY4D 1GC1L 5AVVB 3QH3A 1I1FB 2A6IB 5D7IE 3WFCL 5EEUA 3GLAA 1PLGL 4O02H 4Y1AB 3UYRH 4MZIA 2LGNA 1A6TA 1NMBH 3FCSB 3QA3B 1EDYA 1Q0EA 4GW1A 4YXLH 3D5OF 2VDLH 4WI0B 5I8CA 4X6DE 5IW1A 4JPIA 3DPDA 3BJLA 4PJCA 1UOLA 3BXNA 2ZE0A 3HRZC 3I3EA 1JHTA 1JWSA 1V3KA 1BEYH 1LO3L 1MCQA 3ECVA 3J07A 4NHUB 3K2UH 3VXSA 1QQDA 4KNSA 5IBTL 3OPUA 1IGCL 2E3VA 1QRKA 5FHAH 3N50A 5IMMA 5KW9L 3NEXA 3DWTA 3QZOA 1QZ1A 2BVTA 3T1FA 2V2TB 1QMUA 3GLDA 5FKPB 5TH2A 2Q7YA 3I50H 2ZX5A 1EFXD 4K7PH 1MLBA 4HHWA 3Q6GL 4L4TE 4PJIE 4CKVX 2Y3NA 2ZWKA 4DWHA 4NN7B 4N3TA 3KDMA 4P5TC 3RFZA 1QKZL 2VXSL 1BDYA 1BF8A 4LOUC 1JI2A 4D3CH 3I2CL 5ILTH 2H8PB 3BP6B 3PWVB 3KPMB 5F70A 4L9DA 1H6TA 1BPVA 2J2ZB 2YARA 1GAFL 1BM3H 5IB1A 2EIBA 1IGJA 5D7KE 4ESKA 2ESVB 1HNGA 3MODL 4K4KA 4HC1H 2R23B 1LD9B 3NBNA 5FK9A 2YN5A 43C9B 6TAAA 5LGHL 3Q0HA 1RUPL 3JV0A 5LXVA 3B37A 4PJDB 1FIGL 1MI5D 4PJAB 2CO4A 5JYMA 4U3CA 3W5MA 3GKWL 1NUNB 3VD3A 1Z5LB 5F8QC 3ZX1A 3HR5B 2B59B 1BBDL 5SWSD 1FQ9C 1Q9LA 4PLNC 1F45A 4ORGB 1AZBA 1KCUH 3RNQA 1INEH 1MF2L 2GG1A 3KW7A 4CGUB 3CSYB 1CBVH 3O3EA 2HRGA 3QRBA 1NDGB 5JYLA 5I28A 4PGEA 5F7UA 3I02A 1M71A 2D7PA 4L8SB 3O2DA 3TASA 1MCPL 1T1XB 4A2LA 5T5FL 2ZXGA 4EUPA 4ZPVB 1OQXA 4GMTH 1PG7X 1RZPA 2AK4E 1E8ZA 4I0KA 4F92B 2DQCH 3EGSA 3DOSA 3ASNB 2WXMA 4JFVA 4MNQD 4BUQA 1BMWA 3AW5A 1ZA6B 1GZPA 3FULA 5KG9B 4PV9A 3QZLA 5GISH 1NLBL 2F2HA 3FF7A 5ISZE 3PXJA 1BW8A 1QW8A 1NDTA 3RVXC 3HPLA 1D5ZB 1JN6A 5C0EB 3B8SA 5C3TA 2AJVL 4F57H 3L3OC 3JSSA 4Y4FD 2VDQL 1PZSA 3TESA 3VFSA 2Q20A 4UT6A 3S97C 5DHDA 1VFBA 3RL2B 3ZE2E 5JOPD 5E03A 2FL5A 2W80C 4JJ5A 4ONHA 5BZXA 3G08B 2YKLH 3GBMH 4HQQH 1ZGLP 2VLJE 4HIEA 2R1WA 1LO4H 5AG9A 1NCBL 4L29B 3FQTB 5EEXA 2CHNA 2ICES 4F9PA 4OLEA 3RUGA 3IF1A 2P8MB 2OTPA 4N2KA 4NQVA 4OLYH 2MTAA 3DYOA 3HG3A 4AMWA 4GQRA 3QIBD 3C12A 3NCFB 4HUVA 3NSYA 4D0CA 1S7XB 4Z7VE 3GFUA 3TN0B 3WNJA 4UQBA 1U8NA 1AXTH 1TVHB 4PGDB 1CU4L 2BSCA 3H56A 1WD8A 4XNQB 2LFGA 2X4UA 3DBXB 3ESPA 3D3VE 5IG7B 4JFQB 1YRKA 4FJ6A 3TTSA 1IM9A 5F0JB 4FXKA 2QHRL 4WFHD 2G30A 4JZNB 4FNUA 2ZCHH 3HC0A 3ZE1E 4OKVB 1SJEB 5ID1B 5DMKB 3L3DA 4F9PC 3P77A 1R5IB 2Z92B 1SJHB 3O45A 1QVOB 2P52A 2Q76A 3D05A 3WY3A 4DO4A 2XN0A 3UO1L 4I2XE 3NIFB 1MZYA 1CT8B 4CA4A 3DRQB 1HH9A 5E8OA 1WHOA 5T8IA 1BEXA 1NAKL 1QZNA 3QQ3A 4LAQL 3BP6A 3VFNB 3MV8B 4OM1L 3DX4A 4E9RA 3OMAB 1TENA 5CD5D 1AGBA 1RU9L 2DKUA 3RHWF 5MENB 2YAEA 5EZPA 3UTTA 1HL8A 1QI3A 2EINB 2F8VA 4LLDB 3BHBB 1MCFA 4RZCA 43C9A 4CVUA 5C7XH 2Q8AL 4Z6AT 4NRXB 4AGQA 1TZAA 1C5CL 2R29L 3US1A 1SRDA 2KZBA 4KVCH 2VLJB 3B5HA 3SOTA 4R6UA 4AV5A 1Z5LA 4PWHA 5IBLC 2OW7A 4NN7C 1IAMA 4Y16B 4YR6B 4N0UE 3OPZL 1KEMH 4L05A 5DRNB 1JV5B 1MCJA 3THMH 1E9OA 3CVCA 3LS4L 3NN8A 4IRJB 2LW3A 3NACH 2D0HA 3V52H 3HB3D 4L8SA 5CEYB 3D3VB 3IMRA 1KB9K 1PG7L 5EIVA 3C6SA 3X1BA 2FEDC 1KBGH 2HP4A 5I1AA 1QSEB 4UQAA 4X5XA 5TE6H 2FD6H 4JM4H 4M4PA 4ZPVA 4H1LA 4PRID 3U36B 2ZKMX 3KGUA 1AZCA 2AQNA 2G9HB 4F7EA 5D5MB 4IRZH 5ANHA 1WBZB 2OSWA 3CMOL 4N2AA 1ZA6A 5KG9A 3BD5A 1JCVA 4JB9H 4OJEH 5FYKL 5EZJB 2YGQA 1WIPA 5CEZL 1CFQB 5C0EA 4JHBA 2CKBA 2WSKA 1VA9A 1BYOA 1LK2B 3MV9D 4NO0B 2MSPA 1AD9A 4TV3A 5C0GA 2X88A 4L8SC 3P9WB 4GRWE 4JFED 3FW6A 4X6EA 5ICXB 1EJ6A 1QBAA 4ZFZB 4BFKA 35C8L 4Z7AA 5B8CA 1SXAA 1TZGH 5DUPH 3PQYD 1ZVHA 1X5HA 3PV6B 1PZ2A 3QHFL 4MXWH 1IARB 1L9PA 1DQDH 2X1XR 4HXAL 4R7XA 2I7SA 3QCUH 4XXCA 1JZHA 5ESAA 3TBWA 1UH3A 4LGRB 4W9KC 4PREA 3ZUCA 5C0NC 3CTTA 3K81A 2EDDA 4DKEL 1F11B 5K9KA 3SQBB 5FUZL 2LV4A 3BSHA 5C2BH 3QIWB 4MDJA 4A7QA 2XA8L 3QI9D 4KOCA 1CDYA 1TO5A 2VJ8A 3OJDB 4E9QA 3K0WA 4TN9A 3W11D 2O6FA 3IVKB 3O6FA 1X9RA 4JKLA 4HS6B 1KWKA 4OKVA 4PD4K 4JFFE 1KWGA 1AQMA 3CFEB 4FQ2L 3RZWA 1KJ3H 5HHPB 2Z92A 1SJHA 1BX2B 5H94A 1BIHA 4CRPA 2G3MA 5CJQH 1VACA 4L3AA 5CJ5A 1XWVA 2HT4C 2HFFB 4PJDF 2DYSB 4PJAF 1P84J 2HXAA 5KS9E 3QXTA 2AAAA 5TF1H 5I1LA 1CF1A 4WRLA 4UOW0 1A3LL 3DHUA 3MV8A 1QR1B 3IYLW 3LZOA 5L0QB 4B41A 2YS4A 4QLWA 3DROA 1T1YB 1CIDA 4AVKA 3NZSA 3O6FC 4NC1E 1UXSA 2BOLA 3STLA 3BHBA 1YVLA 5AW9B 2F7IA 3VW3H 1VB9A 1RPUA 1YN7B 2AANA 4GRWB 4X6DF 5CWSB 1GR7A 3L3GA 1I8KB 4GRLA 3RWCA 4L3EE 3CK0H 3HG1E 3GYRA 1MCWW 2A5UA 2OJEB 4W4OA 1MRFH 1W8OA 4DGIL 4GEJA 4YR6A 2APWA 4G43B 4IDJL 4JFYB 1JV5A 3TJHD 3KLHC 4XP6L 5J4MA 4IRJA 3BT2H 3VFPA 1U41A 4JFDD 1A65A 3OGOE 2WNKA 4DZ8B 5A40E 4GG6B 4I9WE 2B1OA 2H3KA 3KPLB 2WBJD 2VKWA 5CEYA 4CL7A 4ODVL 4OZFG 3JWDL 3HZKA 2MKLC 4NNYA 2BFVL 1TTUA 2GTZB 5C8JB 3CBRA 1DVXA 3PGCA 4GRLC 1U9KA 2GABA 2P49B 5C0RH 1YEKL 2BVPB 2WKOF 2E7BA 4DK6A 4BRJA 3TO2A 5I16A 3VE0A 4ICXA 2WANA 5C09E 5BS0A 1IEAA 2JJWA 2RFXB 3CZFB 4W4OC 4W6XB 4YHPA 5D5MA 4IOIB 3R7RA 2XWDA 3QNZB 4ZAKD 2FQGA 2UYLA 2YD6A 4K8RL 5B3JE 2VMEA 1Z9SB 2J43A 2CBMA 1U8KB 4FRWA 2YEZB 3OKOB 5EZJA 3A21A 4HKXA 4IRJC 2DI7A 4HGKC 3EUUA 4XGZA 3TNMB 3V5KB 4KZDH 1RCYA 2PP9A 3I85A 1JG9A 3ZYOA 3RY5A 5KS9B 3N1GC 3FB5A 5I8KH 2YFOA 2DJUA 1D5RA 3K8MA 2IDQA 1G87A 4WI5A 5CZXC 1Z32X 4JREB 5IQ7L 3IRZA 3UZVB 3FO2A 2EDEA 2QT6A 1VAHA 1N10A 3P2BA 1E0OB 1UM4H 5CCKH 1EEQA 3QUYA 3RWIB 4I3SL 3LZQA 4WFFE 5EDXA 1XB8A 1HN1A 2HTLD 3K46A 4JPQA 3T65A 1CFVL 3K6NA 5FCUL 5ECJE 4U49A 5JMOC 1F11A 4ZO6A 2V7NA 1YSOA 3C60D 4X7EC 5F3HB 2LT9A 4ODSL 1DN0B 3NIFF 4YLBA 5B1KA 3RKDC 3PP3K 4BFNA 3ZQ9A 1J1OH 1WFUA 4LT7A 3V55A 4CKQA 4OCXL 2OJ1A 1QNIA 2VLKD 3VQ2C 4BD4A 3PP3H 3O3BA 3O8XB 4OZGA 4Y2LA 1EV2E 3CFEA 4P23A 1J0YA 5HHPA 4WO4A 3ZRFC 1J05B 4Q4IA 1EO8L 4NQUA 5AUMA 3WG7B 4PBDA 2Y25A 1ASQA 2F74A 3ZE2F 4LU5H 5D7JB 2HFFA 1H19A 1H6FA 4JRXE 2AABL 1YHPA 1L7TL 2EYTA 3QIWC 2GAZA 1YDPA 4ENZA 1PLCA 2VN7A 3IFPA 3IN0A 5BZWA 3VD5A 4LP8A 4BGLA 4X9HA 2F53E 1OCWL 2GJ6D 4I4WA 4S1RL 3T0EB 3LIZH 1YG9A 5LGKA 1CFSA 1ORSA 3GBEA 4MA1B 3WE6B 1YCSA 4Z7VF 1IB5A 1YN7A 3NPZB 5KN5A 4ODHH 3CUPB 1E4KC 1PD0A 3AXHA 4PRDA 4Y2DB 2O6DA 4KJQD 3ZE0B 3K6IA 2PR4H 3P0VH 4Q2ZB 2HG0A 2IPTH 3UYPB 2R9HD 3EJUA 4P4KA 2ZOLB 3U46B 1FL5A 1CTOA 1I1YB 4M48L 5T1MB 1LP9A 4W93A 4NLAA 4G80B 1OPOA 2NXYD 2Y5QA 1MRCH 2X4SB 4BE5A 4BINA 5LCVH 5L0QC 3WUWB 2Y1YA 5E5MB 2AEPH 3ARDD 3QXAA 2BP5M 3TNNB 4JR9H 4NKMB 3JTSB 4AK2A 1S9XA 3DX7A 3RIFF 3U1PA 2HKFH 5LHDA 3L5JA 1SFDA 1OGAE 4QUOA 4H26B 4DP8X 4G8GE 5KVDE 3FKUS 3F05A 4QCIA 4N2BA 3OJVC 1H15A 3PHQA 4HPOH 3VGGA 1E2WA 4BFRA 1LO5B 4R7VA 1SHMA 3ZHNA 1IGYB 1WZKA 1XL6A 1GTNA 4KRLB 2Q3ZA 1ZKAA 2PTTA 3IS1X 2C3WA 3QNXB 1D5XB 4EF3A 1BZOA 1A64A 3TA3D 3QWOA 4NO5A 5DK0A 1GW6A 3C6LA 2IXQA 3C2AH 3NJVA 4JRXB 4J7RA 4UB0L 4PJ5B 1IX2A 5J6HB 5AVXB 3BI9X 3CDGA 1YEHH 2IBZY 2CDGB 1AYRA 2ZOOA 1QFWI 2Z93B 3CXDL 4TSAH 3OQRA 5HVFB 5IESH 4P2RD 2WC7A 2WXIA 4Z77A 4LAJH 2ZNXA 3UZVA 1YNKL 2ORBH 4TTDC 4UQ3B 3IJYB 5TK4A 2AXWA 1IE5A 3VG9B 4KHXH 4UT7L 4N2OA 5EORL 3H6AA 4DP1X 4Q52A 1CR9L 1HI6A 1T89A 3BAYA 4FP8L 5A2JH 4PS3A 4Q56A 1DJYA 1RZGB 25C8H 1M2VB 2MMXA 1CL7L 1MRDH 1QR4A 2XY2A 3C6LC 4L4TD 1DN0A 1GMEA 4DETA 4MAUL 1GY2A 4XHJC 2WAQA 2XTJC 2CBOA 4ZUWB 2QADD 4JREC 3WFDL 1IBZA 4FFZH 1H8SA 4OTXH 4AITA 2EXSA 2IQ9H 2OFQA 3DUSB 4IHOB 1V55B 4JO3L 4M7LT 4PBWD 2OMWB 1OGAB 3KHQA 3ROOB 2VDOH 1XZ0A 2WBWB 3S5ZA 1J05A 1IC1A 1FP5A 1FH5H 1T89C 2OTWB 4ONFL 5DS2A 5GHWH 1ZRUA 4GRWF 3W37A 1BBJB 1GPOH 2VISB 3L48A 1U42A 4HCGA 3FN0L 4G6FD 3II3A 5DD3H 1VADA 2KQNA 5DJ8B 4QTIH 3M8OH 1KDIA 3SGJC 3KL3A 4NUJB 2VXUH 3MOBL 4QF1B 1NSNH 4K5OA 2WXNA 1KJ2H 5E6ID 3ZL1A 3O8XC 2P5PA 3FYEB 4DQOL 5GRJH 3QYMA 5JA8B 2XQ0A 1OB1A 4GG6F 1OSEA 5I15L 4JDEB 1LLAA 1KB3A 3RU8L 2H6PB 5D4JA 1U95B 4QHMA 3JV5A 5SWQB 2CJ3A 4Q2ZA 1WPCA 3UYPA 1PCXA 3LKSA 4RIRB 1XGYH 5ICUA 4M56A 3CFNA 5DYFA 3PPEA 2XWEA 3VXMB 1VCAA 4WEBL 1OP9A 1J1PH 5T1MA 2AK4D 3MO1A 1MCDA 3PWNB 4ONGL 4PCSA 3GTTA 3Q6FB 4M8QB 3NT0A 1MFCL 3GQFA 5F1NB 2HN7A 3RKPA 4XP5L 2ZCLL 5E5MA 2H2SD 2H9GB 5IHUL 2ED8A 2Q2LA 4NCDA 4Q0XH 5F7MC 3T0EC 5EO0A 5ISZD 2PWGA 1RUAH 1WAAE 4MA1C 2BY0A 4U1KA 4B3EA 2V4LA 5KS9F 1TU2A 2BM3A 1BVKB 2IOIA 1RZJC 2A6KB 5EA0H 5GS0D 4WHYG 4Y2DC 1KUMA 4OZHE 2BSED 1UH2A 3BN9C 3PHOB 4G70B 1OP4A 5CGMA 3UADA 4PJEE 5JDSB 2BWIA 5AZEH 2F54E 5DHYB 5I24A 3POHA 4FD0A 3ULVL 1P4BL 3QIUA 1FHGA 4XNMA 5KYYA 1G6RH 2AKRB 4L9LA 2E9JA 4JN1L 4JRYE 1A1NB 3NEOA 1NICA 5J5EA 2PO6A 4OIFA 2AP2A 1BJ1H 4K0OA 1BQHG 1X5LA 4AZUA 5CHNB 4LSPH 5LQBL 1UOWA 2DV6A 5HDWA 4BSWB 4YDKL 1NJ9A 2Q87A 1RMFH 1B88A 4JFOB 3RNKB 4XO9A 3LMJL 1RHHA 4M7JH 3SKOB 4ZD3L 5KSVB 5DEGA 1XF3A 2G3ZA 1T20A 2WLIB 4N9GA 1P4LA 3FL7A 2R2EA 5D96B 4EDWL 3PHSA 5AW3B 5AOKA 2JE8A 4JY4A 5C0IB 3QIUC 1VFMA 5CM1A 4HPYH 4FKHA 4NUPA 2HLAA 3VRIA 3FHAA 4EPSA 1I85A 1A7OL 5FYLH 2G0KA 3HC3H 3C75A 3FTGB 3LB6D 3TBBA 3VH8B 1I3GL 1QHOA 5AKRA 4FABH 3LRMA 1E2VA 2PWDA 4NI6A 1CQYA 3BN3B 3IFLL 2XG5B 4KI5D 3ZHFA 4IM8A 2JQAA 1Y18B 5HHMB 1FN4B 3ZT6A 1YMME 5C97A 1DE4B 3VG9C 1UJ3A 3MA7A 4TVPH 3ORJA 1MCRA 4X7TA 2HAZA 2DQJL 1AFVH 1BBJA 1UFGA 2VISA 1SLXA 5AVWB 3QDMD 2O1AA 3ZE0F 3HZMA 4I18A 3GUTB 5I1IH 5T3ZH 1I85C 2VZ1A 4JG5A 1KYAA 3RGVB 1S7UA 1OTUC 3L3IB 4TXVB 4ADGA 5LO7A 2DL2A 5D72H 4LSDA 1UADC 2P9RA 4QF1A 1BLIA 1HIMH 4JRYB 4O5LL 2YBGA 5DD1L 2XKSA 1UXWB 2V3EA 1LEGB 4E36A 1OARH 3MUHL 2NY7L 4C8XA 2OPCA 3ZUNC 4ZSOA 1E8XA 2X4OA 1F4WL 3RHWK 3CHPA 1WLHA 4HCFA 2ED9A 1RUQL 2RACA 1UJ3C 2O5XH 3D2UB 5K9OB 1ROWA 2DLFL 3EH4B 3HFML 3TBYA 2WXJA 3HPJB 4PLKD 4RIRA 2WVTA 5EC1B 3NFNB 1U8HB 3H55A 3UMNA 1I31A 4I18C 3SO3B 2YPLE 4H8UA 4GO8A 1R3IH 4H8WH 4R96B 5EOQL 2JIXD 1FFRA 3GRWH 4G7VL 4HS8H 1S9WA 2P8PA 1U58B 2WKLA 3CFJB 2H9GA 1UM6L 4AQEB 3MACL 1DQLH 2XUWA 2H26B 2RCSL 2H1PL 7CGTA 3PF2A 1RQ5A 5EEWA 1FFPA 4H0IA 4LP4A 4LPUA 2P24B 3VCLA 2GTWA 2ZUVA 1MCOL 1MW1A 4M7LL 2XFXB 1ADQA 4N2CA 1YMMB 1EHNA 5AW0B 2MOQA 5F9WB 2WN2A 4JVPA 3DDGA 2IFGA 2W9DH 3PWPA 2WYTA 3SYPA 4DKDC 5DHYA 1SOQA 2VDPH 1XAKA 1DQIA 3GHPA 2B8OT 3T2NL 3BEVB 3X11A 4PIBA 1R5WB 4GXVH 3RI5F 3EIFA 1Z9LA 4L3FA 1YEDB 3D0LA 3QUMB 1TT6A 5F1KC 3DOIA 1FG9C 3CGTA 3MUGB 4G59C 4EDXB 3KGTA 5BRZE 3BO8B 4KC3B 1CGWA 2WNXA 4JHZA 5F7DB 4HK0A 3RNKA 3SKOA 1OAXH 4KVNH 4GKSA 4HDIB 3FZUD 1A14L 2OZ4L 2WLIA 3QDGD 2YA1A 2FX8H 3ZKMC 4K5LA 2LAAA 3BOVA 3Q2CA 2VN5A 2E9BA 5T1KD 2CSPA 2ZSVB 4UV4L 1XDTT 3BWUC 3ESNA 1UA3A 1D3CA 3Q2WA 4OLXH 4P3DA 3VDCA 1QLFB 1R3LB 3VH8A 2YPLB 4APXA 2A38A 1PX8A 1UWEL 2OMYB 4DEPB 5GJTL 2E7LC 4Q9RL 3ZMRA 1E90A 4B3VA 4EI0A 1T0MA 4R26H 4OM0H 1DQML 1NKRA 5GIRB 4ODUB 5D96C 1UCBH 9PCYA 3FMGH 3SPCA 2VWEC 1KBKA 5AKSA 2AQ2A 3LV3B 4L3ED 3ZBMA 3HG1D 3U0TA 5L88L 2PUQT 1N6QL 3L3IA 5DEZA 3TPKA 4WEUD 5FS5A 2DYPB 2EJ1A 3OAZK 4UMGA 3AT8A 5TE4H 5IUSA 4X5PA 4CSTA 5DURD 3D30A 3SCMD 2ILLA 4MSWA 4W9ZA 1FBIH 2H32B 5JORB 5DJCB 1E7VA 4QDGA 3OAZH 4U05A 4CMMA 4OSUH 2I24N 4LCVA 1IGTA 3DSFH 1TJIH 2H3NA 3MUY1 2XJKA 4LL9A 1J87A 3KDPB 4UM9A 2QTVA 3RZCA 5B4MC 3R0MA 3HS0B 5BPPA 2WP3O 3M1OA 3QJTB 4IS6B 1JRHI 1RURL 1TJGH 2GCYB 2QTEA 3FQUB 3ZO9A 2UZXB 3H2PA 5GS2D 3PJSB 4Y4KD 3JT2A 4Y8AA 3RGVC 5C09D 1J9CT 4U3SB 1TOXA 4AIOA 3NJKA 3O3UN 4PHZA 3CFJA 4PCYA 4NP4L 1QLEB 4QLRA 2IOMA 3DVIA 3C6EA 4WUKH 3VSTA 3N1MC 5LBSH 1K72A 2W9EH 3ECBA 1PG7W 3FU8A 1RZIB 1EA9C 4QRUB 4ABWA 2JNZA 2V2XA 4U1SA 3WSQL 5K1NA 1R5VB 3VGBA 5ALCH 2MQ0A 3FFCA 4MJ6A 2AI0L 3RZCC 4LLVB 2FSDA 3GDCA 3CN0A 2UVEA 4IOFD 2XPGB 1NLDL 3KS0J 3SO3C 5C0CA 5I0WA 3CIAA 3TH4T 2FX7H 4Z0XA 2BNQD 2AVGA 4B9GA 2HFEB 4X4MA 2LAGB 1B3JA 1F0LA 3F6JA 1AH1A 1TKWA 3X1FA 4WNJA 1HVXA 3R4RA 3HAEA 3M86A 2PTVA 3DJTA 2QSCH 3QIBB 3CFBA 3MUGA 4LASL 1F18A 5DVOA 5JQ6L 3SQOL 2YAQA 5F7DA 3B9AA 5GRXG 5KUMA 3QYNA 4XO4A 1JPGB 1TETH 3A4FA 5FOBB 3WUWG 1C08A 1E28A 4XE5B 4OFYD 4PRPD 3SE6A 4P05A 3FO1B 2M26A 4WHCA 1UT1A 4TVUA 2PW1B 3IWUA 1WAAF 2R2HA 4JY6B 2ZG1A 1RSYA 2EYSB 3ZL4H 1ACXA 2X40A 3EFFB 5I6XB 1ORQB 2NY4C 1J12A 1EFXA 2PWEA 5AOLA 1RZQA 3VXNA 1IGIL 3BD4A 5FO8A 3U1SH 3A22A 2X28A 4YNYA 3E0GA 4K94L 4PWGA 4PJEF 3BKML 3Q5TA 2XJLA 2CWRA 5DJXB 2Q0ZX 3ATEA 3ETBF 4I1RA 4Q7DA 3U0PA 1PZCA 4J4PD 4YIQA 4OIAA 5AAWA 2E74C 2F53D 5D6CB 1I7UA 3B2PA 5HGBA 1PLAA 1YO4A 4PRNB 3SE4A 2DQUH 5LLIC 5BJTB 1S5HB 1FNEA 4C59B 5IB5A 3FT0A 5AYTA 4H0LC 5F1SA 2X0VA 3FUIA 3B83A 2FYYB 2HFTA 4GBXD 3MNVB 1MI5A 4N8VB 4UT9H 2M2DA 1EUTA 1RJYB 3BAXA 1PTZA 5FUCE 2EDLA 1X5XA 2WCPA 4P2OB 3HI5H 5SWSA 3NDZE 3HIZA 2EIMB 1YN6A 1XF1A 3N85L 4KUCD 1XEUA 2R0LH 2A0LD 1DUZB 1FPTH 3OZ9H 4Q6YA 3QR1A 5AAWC 4YK4B 4OCWL 2YEVB 5GSVA 3KHOA 4WHDA 1Z3GL 4X7SH 5D71L 1LILA 5D6DA 3HB3B 4WUUE 2IH9A 3VI3E 4F1SA 1JPTL 4G8GD 4GLRH 1FGVH 1BFVH 2VCOA 4FEIA 2Y5TB 3WEXB 1G7IB 3BE1L 1OL0A 1BXVA 1I53A 5D8JL 5FGCB 1VGEH 3II2A 3ATFA 1QUNA 1YJDH 4R9HA 5F0MB 4XPBH 1AS8A 1IM3B 1ZMYA 4U3SA 3GK8L 4EI6A 5JMRA 1UZGA 3IJHB 2Z4QA 1JHKH 4Q6KA 1YUHB 2KDGA 2DMBA 4MNQA 3CFCL 5KYUA 4XMPH 3EYUH 5CN2A 5CZRA 3BZ4B 2F19H 5F7LB 3SBWA 3WKMH 4XN7A 3EJSA 5E95B 2IH3A 1RZIA 2YK1H 4QRUA 5FA4A 1RVFH 3GSOA 2BVQB 2ZKHH 4Y4FA 1R5VA 2LR4A 5C6WH 3RIFK 5J06A 5J1TC 4XPAL 3VYOA 1E4WL 1T7VA 2J8UA 3AFLA 2OMBA 4ZRGA 3K2MC 4OFPA 4QRRA 5IQMA 3CC5A 4IMKA 4HV8B 4KDTC 4GIAA 4X98B 4DAGL 1JZDC 3KGSA 3CMGA 3PL6D 4J23A 2HFEA 4DFIA 3EFDH 3WIIL 3Q2LA 3QEQE 3GXFA 4HT1H 1CZ8H 3QIBA 4B97A 3C2SA 2ZAHA 3SBWC 4W9DC 1KBWA 4MMXB 1IAKB 2BMKB 5I26A 4U3HA 3QI9B 3ZDWA 1IJNA 2DLEA 3OKDA 5KYXB 1T21A 2GSIB 5L2KB 3DBSA 2QEJA 4X80L 5TJWK 1QSFB 1EO5A 3FO1A 2PW1A 3HKZA 5F7NC 3BUBA 1NCJA 1T4WA 1GKOA 3NJGA 4TUOB 3V4VH 1NMCB 3CFQA 2ZXCA 4GXUM 5FM5M 2HPTA 4DP4X 3K6SA 1JNNH 4KV5E 5CEZE 1A4KA 1ZT1A 4JFUA 4RWHA 4QHNB 3VI3B 3WLWD 5BQ7B 4HWZA 3NAAL 1PZ5A 1SHSA 4F7PB 5HHQB 4HGWB 4FHBD 1CE1H 1XXDC 4XMXA 4U6XA 4Z8FH 3QIBC 2G5BA 1A7QL 1I8MA 4WNSA 4OT1L 4XCFL 3CZEA 2RQ8A 4HU2A 4YSEA 6PAZA 1BM7A 1SVBA 2OSYA 1HX0A 3KYMB 5F7WC 1J5HA 5JW4N 2QQKH 2XX0A 4YSDA 5JOEA 1ET8A 1SYSA 5E7FA 2Z7WA 5L4FA 4CJ0A 2VH5H 2E7HA 4CVZB 2J3SA 1KB5B 1AC6A 5E9DE 3V4LA 1MFNA 1NC4D 3MGOB 5AALA 2EDMA 1J9RA 4FQXD 3BT0A 5DZOA 4NUGH 1W15A 2Y72A 4QNPF 4U1NB 1FV1A 3ZKQD 1F5WA 1U8PA 5I6XC 1OANA 4JO4L 1B0IA 1OAZL 4JG1L 3IXTA 4F2MA 5I75B 1JNHA 2UZPA 4DKFH 5JTWA 3RY4A 1U0QA 3TYGH 3QEQB 1FYTE 1KN2L 4GRWH 4M9OA 5K39A 1BAGA 3O4OB 4PJBB 2DQMA 2YRZA 3V0AC 4BKLA 3UL4A 3NCJH 5CD5C 4RISL 4NWUL 3FB8B 4LXFA 2WBJB 2OTUB 2A83B 1OGTB 3HE6D 3G6AB 5BRPA 5FO7A 1JWMA 2XXMB 3LRSB 4JFWA 5LAPA 2Y5TA 5ITBH 2Y1VA 3WEXA 4G11A 5F93C 4BFIB 4JAMB 1HHJA 2OYKA 3LRHA 3MRRA 2QFRA 2W92A 3PWUA 2R8SH 4PRIA 3ZHLA 3ISYA 2LVCA 1E5YA 3IJHA 2VAAA 4P2OC 4BBWA 2YC1B 2GC4C 3QQDB 2WNGA 4AYFA 2F54D 3BAIA 1NGWA 3SE3C 3HG2A 2WOYA 3FQXA 2TSAA 2HJFA 3ZVVA 2FIRT 2AXGB 2DL9A 3HN3A 4M61A 3D51A 3VXOA 2KMWA 4PP1D 5FHBL 4HLEA 4K3JL 4X9BA 1RH8A 5J1SC 2JB5L 2BVQA 4PW4A 4U1GB 4YK4C 5DD5L 3SYAA 5JR1H 3MV9A 1ITBB 3L4ZA 4PJ7A 1VZIA 4KRMB 2C7FA 3CXHJ 4KQ4L 2ICWA 3HB3C 4F9LC 4Y2OB 1NGPL 3MRNB 4JFEA 3V4PL 4HJGB 5F7EH 4XXDB 5HD8D 3I74A 4FI6A 3D25B 3JV6B 2ADFH 3CSTA 3QEUA 4G72B 3PQYA 4ICWA 4KY1H 4ACPA 4AEEA 3FTSA 1D9KB 5D55A 5KAQF 1R47A 1HNYA 1OZUA 2VRQA 3K2KA 4YL9A 1NWOA 1P5UB 5CMAA 1G1KA 4QHLB 3M7OA 2BVYA 2DQIH 4J3TA 3LY6A 4V1DE 5INCB 3VGHA 4U1LA 2KLTA 2RH0A 1SY6A 2WQWA 4MMXA 5F9JA 1SBSH 5D9SB 5DJ2A 1SLWA 2DDQH 1NGQL 3DETD 3QI9A 1HXYB 4ZMNA 4M5ZH 4NN5C 4LSVL 1W0WA 1WT5C 3RJOA 3DTXB 3D33A 4HFUL 4GAYA 2ARJQ 5EU3B 4KXZI 2DQEH 5J11B 4UBDD 3JVGC 3L4TA 4G42A 4AL8L 5JHLL 1JTPA 2N0KA 1ND0A 5DRXA 3GGWB 4MCZB 1TMQA 1NCCH 3JBG7 4DGVH 2OYLA 3GJEB 3WXVH 2H47C 4MMXC 5F97E 1SDDA 4M1CC 4XN8A 2IANE 2NTSP 1NPJA 2B4CC 3IU3A 3QI9C 1W0VA 3AY4C 5DSCA 5T1DH 3HZYA 3CBJB 4BRVA 3D0VB 3W11C 3D0AA 1PU0A 1NBYA 3OX8B 2P5WE 2BWQA 4HMDA 2GJ6B 2FIKB 2HVKB 2YD3A 1NMCC 4PJXE 1T0NB 4I0PB 3K71B 1I7RA 1Z9PA 1NMAL 1R0AL 4NZFA 3WJMB 3KYOB 4FQLH 1QHPA 1OCZB 1D5IH 2DH2A 4YHZH 5I1DA 4MMZB 1M7UA 2WPGA 3UEQA 1S3RA 1VZHA 4HWBH 1J8HE 2ZYHA 1UYWL 1R4XA 4AM0B 3VJ6B 4M4RB 4Z3TA 2V5SA 2VSCA 2X9ZA 4OLVL 1RZJH 3RWFB 4GAAA 3V4UL 3IGLA 5FM4A 1E9PB 4ZMWA 4PJBA 2NXYB 2Y06H 4OZFA 4ENED 1P1ZA 1PQZA 2VZ3A 4XO5A 4V1DB 2ZG2A 1WEJH 4JFDA 4DN4L 3EJZC 3BIKA 3RDTD 4TSBL 4TL5A 2G2NA 3MNZA 2WBJA 1FZMB 2A83A 2BP0B 2W65A 4L23A 5LWYL 2OMUA 3G6AA 2NXZB 2PCXA 1OSPH 2VMJA 2F0CA 2QVFB 1KGUA 2AZAA 1QEXA 3NH7L 4R97B 5GS1B 1G7MB 2FO4A 1WBYA 1QLRA 3F58L 4R3SA 2HX9A 3DMMB 4JHWL 2OYPA 4P5KA 4KKLD 1UQSB 4A7VA 4AXWA 4F27A 5I75C 5I1HL 1F58H 4ZAKA 4NNXB 3DX3A 5FLVA 2XACC 3TJHC 2AXGA 3O4OC 5EIIG 1P0SE 5JLZB 2A9AA 4IKKA 2CK0L 1AQKH 3B8YA 2NZ9D 1NGZA 4WWOA 1MHEB 3H1ZA 4P07A 1F4AA 3DURB 5BRZD 2WBJC 1IBHA 2TRYA 5DR5H 5GRYA 1KOAA 5FB8A 4Y2OA 4XCYA 3MRNA 4P5SA 2CLVB 4P2RB 1DJHA 1N0LA 2VR5A 2P5WB 3MBED 4K7PX 1XMEB 5AVYB 4IQHA 5A43C 4R0LA 1N5AA 5I66B 3V8OA 2EAEA 2ZUYA 3ABGA 1NPNA 2YPVH 4OH2A 2VRAA 3C5ZD 1TSHA 4HCIA 2FJHB 3L4WA 4HAGA 3VI3F 4JM2D 3TJPA 1U8QB 1EGJH 2OZNA 1HSAA 4HH8A 1BQ5A 1DFBL 2EZ0D 3DSNB 3EZ8A 4TYUA 3RI5K 3C60A 1VFOA 1B2YA 4QOKD 3L1OL 3GLEA 4U1GC 1JIBA 3SHSA 1CFNA 3NFPA 1TNNA 2BRRL 2YXMA 2H0PA 4F7TA 4NRYA 3DTXA 2VLKA 1I8LA 4L4VE 1YQVL 5EU3A 2OQJA 4KXAA 4OZIA 3GSUA 3U7WL 4FQIL 2N1TE 2N7BA 2EH7H 4LEEA 4R0LC 4JO2L 4WEEA 1SM3H 3MPCA 4KHTL 3SKJH 4KPHL 4EOWH 1AG0A 4N4YB 2R51A 1D9KC 2I9TB 1GSKA 1CXFA 3CLEH 3DPBB 4KXCA 4NKDA 4IU3B 4TPRL 2ENPA 4MCZA 5A2BA 1JK8B 2HTLC 2C3XA 1DDHA 2A74A 4MGXA 5D1XE 4YHML 1PIGA 2CO7A 2VLME 1J9SA 3FTUA 4LBAA 4PVNA 3ZR6A 5EBLB 3DGCR 4YN3A 1T7WA 2MNUA 3OVUB 4JFHD 1H8NA 2XKNA 1ZWIB 2CUIA 4Z7WE 4AENB 1NOFA 2G2RB 1X7TA 5INDB 5IV2B 4ZMTA 3HNSL 5J56B 1EJ8A 4HKJB 1MQKL 5LN4A 3PJNA 5HHVH 4DOHB 4K2UL 4O58H 3WN5A 1NCWL 2A7BA 4MMZA 5CKGA 1FL6A 5CLYA 1F00I 1S8DA 3BESR 1DUYB 1W8EA 1J5OL 1CCZA 3MLWH 5KAQG 3V9FA 2B1HH 5AL8A 4L2YA 3TEXA 4D9QD 4KV5F 4G8EA 4J3OF 3O3DB 2ICWI 3ARDA 2OX5B 2VDNB 1KTBA 1X6NA 1OK8A 4XBGB 2BP0A 3DUUB 2XZCH 1I7ZB 4O02L 1SHXA 3UYRL 3KMDA 4I0PC 1RZKH 3OHXB 1NMBL 1BHGA 3TH3T 4YXLL 3S3PA 4KJQC 4KKCD 4AUUA 1IKNA 2VDLL 4JFXB 4MMZC 4X8GA 5HBBA 3LPWA 1L9OA 5BUGA 2BY2A 3H2WA 4ZS6D 2R9HC 3NPSB 4ANUA 3H6JA 3BKCH 2OJZH 3ARED 1YYLH 1CE6B 3K2UL 3U9UA 2ITFA 3BLKA 3LZLA 2NXYC 3FU5A 5FHAL 2YO3A 3TA3A 3NRPA 1M7IA 4N8VG 5D7IA 5TQ2H 3UP6A 3D18B 3DURA 1H3WM 3I50L 3OSKA 2Y9RT 4K7PL 1J5CA 1Y6NR 4N5ED 2GBVA 1A6VH 2NXZC 3H8NA 4P2RA 1IC5H 3IFNH 4X6DA 3GNMH 1TLKA 4JJHA 4Z7WB 2XWCA 4NAMA 5ILTL 3MRBB 2ZWSA 1WP6A 4WFGD 2NT1A 3DMMC 4JCMA 2BNRB 1F1GA 4GT7A 3SN6N 1IKFH 1BM3L 3MMEB 3KAAA 3U1QA 1YNLH 4E2OA 4KAQH 4HC1L 1I7TB 1U8QA 3P69A 4M03A 3QQXA 4O51A 1WF5A 3VXQB 5DZLA 3F8UB 4PJIA 4L4TA 5BW7C 1UACL 3MCLH 3PWJB 1KB9J 3WIFA 1FO0A 2FEJA 2MQGA 1U8CA 5D7SH 2YAFA 1KLFB 2BSTB 2IH1B 1XB6A 2UXFA 2ADJB 4P48A 5BOZG 1FVEB 5JIKA 4HOZA 5IM7B 2WKOA 1KCUL 1INEL 1VPOH 4IMLA 5T1LD 2X6AA 5IVNA 1TJMA 1CBVL 1SXCA 4HJUA 5I76A 3F85A 3T2OA 1JK8A 4W68A 3B6SA 5A6IA 2YKKA 4N90D 1BD2E 4F7CB 3QZNA 3MQIA 4NZRH 2EDFA 4HHAB 2E76C 2C7UA 4P0DA 2MTPA 4LOVA 4GMTL 5C2UB 1XH3B 1DBBL 1QRNB 2EUZA 2DQCL 2D7TH 3ZSSA 2QADC 3T6ZA 5E6IA 5INDA 5DJDA 4Z3HA 5IV2A 3SGEH 3MJ9H 4TLTA 5GISL 3ILDA 3V0WH 3KNBB 2DWYA 3AVEA 1S7VA 2BPBA 5ANME 5CR8A 1D6EA 1I3UA 2YGNA 3NRFA 4F57L 3BDYH 4LIQH 1NAMA 1AGEB 4MS6A 4KKAD 2FH8A 5AL0A 5C0DA 3WKNA 4EIUA 2YKLL 3GBML 1DO5A 2AK4A 3QO0B 4HQQL 4RDQF 4JE0A 1LO4L 1CDUA 4UILH 4TNGA 2CM5A 4YFEA 5KJRH 3ERXA 2AAVA 4ZX5A 4PD4J 4OLYL 4NWTH 5E6IC 5PAZA 5ISZA 2ED7A 1BZQK 1W72A 4JS7A 4AOFA 4E68A 1T1ZB 1TZIA 4B9FA 2PN5A 4KRNA 3OHXA 3EYOB 4X50A 3QEHA 4FMKA 2VXTH 4X6CE 1AXTL 2OL3B 2BSEA 4W81A 5EBWA 3SDYH 4P2YA 4ELME 5GGRY 2DWEB 1FIEA 4X8JB 3NJFA 2X1OA 2YA2A 4NS0A 1ZV2A 1BQSA 1UD5A 1BQHA 4G7YH 4PJXF 1HAWA 2ZCHL 3RBGA 2W60A 4DK3A 3CPLA 1DZ0A 3K3QA 2EKJA 4EZMA 2E8YA 2XLLA 2XV6B 4B5ZA 1BD2B 4ELKA 2H2SC 4FLOA 4X5WB 1S2EA 5F0LB 3Q1SH 4M1DH 2WHVA 3T6VA 5DEJA 2P28B 1U92B 3G9VA 2WAHA 1G7LA 1EIBA 2BS9A 3UG3A 1DP0A 5GS0C 3OHXC 2VXQA 4IBQA 2ZP9A 4C47A 4WTQA 3QUMH 3H9HB 2FGWH 2CA3A 4A2EA 4GYBA 5FYKD 5IFJA 2VITA 5CU5A 5ANMB 4F2EA 5TF0A 5FWRA 3IJ8A 2D7OA 2YZ8A 4HK3N 4WU7A 2IG2H 3CIQA 5C7XL 5LB1A 4ZFOL 1FNHA 4KMLB 3RVTC 2BSRA 4WGWB 2Y7MA 2X44D 4FZEH 5C08E 4I2XA 4KVCL 3L3KB 1FYHB 3Q05A 1PYWA 1KLFA 3AACA 5E99H 4XNDA 4J3OG 4XOBA 2ADJA 5DZ9A 3IU4H 2X6CA 5DUMH 1KEML 1UCTA 1PGRB 1GZHA 2O6PA 3THML 3NJXA 3UP1A 5E9DD 1KDJA 3NACL 1KCSL 2C3HA 3PNWB 8CGTA 1HZKA 5ES4B 2J6EH 1IO4C 3DTDA 4OI8A 3V52L 3GKZA 3ILQD 3QDMA 4A7GF 4ELMB 3MBWA 1JGEA 4AC4A 2OLDA 3S37H 4LKXA 4PM1A 4HHAA 1KBGL 4Q58C 4UANA 5TE6L 3RYMA 2FD6L 1E9QB 4JM4L 3RTLA 4N0UA 1FYTD 4IRZL 1DVQA 4KI5C 4LEOB 4G1EB 1WWBX 1ETA1 1LEKA 4AV0A 2CBTA 1Z1WA 3UJTH 4JB9L 3T3ME 3S35H 2DI9A 2PWFA 2B9AA 5EOTB 4N0FB 3S3DB 3GXIA 1DBML 2B9BA 4AJ0A 1XGQA 1C8PA 5DRWA 4XXWA 5B3SB 3WTTA 5DZAA 1OM3H 1JYXA 2H32H 4PVLA 2QSVA 5A6LA 3MXWH 4KITB 2NY5C 3Q2NA 3QO0A 1JV2B 4EI5D 2XY1A 4B95C 4AC2A 2EXWC 2JIXA 3US9A 3CZKA 1A9EB 1TZGL 5DUPL 2Q3XA 5I6PA 4MXWL 3FNKA 3HE7D 1NBZB 3ALPA 1DQDL 1VIWA 3NK3A 4XZUB 4URKA 3QCUL 5C08B 3NK4A 3DV4A 3AMKA 5IMLB 4YHOL 3A23A 1EHXA 5CN3A 4HUWB 4PJHB 2CRYA 2YWZA 1X5ZA 3ZL2A 4XPGH 2OK0H 1MY7A 1QLEH 1CTMA 1EBPA 2NZ1A 4NZTH 5C2BL 4ZJ9A 4XXWC 5AB2A 4Z7WF 3KYKH 4QAMB 3SZKC 3U25A 5JQHC 2XWBA 3RTQB 2A6JB 2C9RA 2V3DA 2BIMA 4MQTB 3IBOA 1IFRA 1WIOA 2BVOB 2BNQB 3BYTA 3MRHA 3MRPB 4NCC1 3GXUB 3TYFA 1WFIA 1KJ3L 1NCTA 5AOJA 2E75C 3VA2C 2F9BT 2Z65C 5CJQL 4DW2H 5JW5A 1XB3A 1F1AA 1DEEA 2OCCB 3NDYE 4KH2A 4ZBJA 5IOKA 4U1IB 5HDLA 3WDIA 5TF1L 3VFUB 2NSQA 4UCFA 1AHWB 3HHMA 4L1LA 2FHFA 3QDGA 4K8RD 4HCRH 1JWUB 4YS4A 2ZUWA 1P7HL 4JFFA 3BAEH 2YD1A 3W9EA 2IC2A 4DCQB 4MWFB 1G7HA 2MCPH 4KXDA 5T1KA 1M1XA 5A2IH 1LE9B 3IAQA 3VW3L 5GGRB 5D1QB 1IUZA 2K45A 3PS6A 4RDQG 1G7PA 3CK0L 1UWGH 3L3KA 4JVUA 5EU4A 3UTSE 1F4YH 4E9TA 3FRUB 5HYSA 3LRLA 1XGPA 4WY7H 4ZZKA 1O5PA 3HI1A 4YSAA 3TF7C 4HISA 2IAND 4ZOEA 4R7DA 2ZP8A 2JKXA 4LQFH 5D7LE 3CVIH 1PMYA 4PJ8B 3FT3B 4NEHB 2R1YA 4TS6A 1XF2B 4HIJA 3X14A 1EXUB 5A16A 3KCWA 1PBYA 4PG2A 1A4JB 2VDRB 3MRCA 4L3EA 3MA9H 3HG1A 3VNZA 2O30A 4OFDA 1OSZB 4UOZA 3ZDZB 3L5WB 4LCUA 5C0RL 3EAKA 1KENH 3S34H 4LCWB 3F01A 4OJAA 2ADGB 4RQQB 5FX3A 4RH4A 3BKYH 2IPKA 2NX5B 5TPWH 1QPPA 3RAJL 2VL5B 3SCMA 4LCIH 2XWTB 4LEOA 4YHYB 2WXRA 2WZAA 2EDBA 3LPFA 4HBCH 5B21A 4LCYA 5HI3D 2AV7A 4IDLA 3D6GA 4KZDL 3CAFA 1HAUA 1NUFA 2QQQA 6FABH 2XT1B 3ZDYB 2Z3FA 5I8KL 1CTNA 4PB9H 3SYQA 2HZHA 5HHOB 1T3FA 4S0HA 4OD2A 4L0YA 1WBXB 5C0FB 4Y4KA 2NNAB 4LCCB 5C09A 5C9JB 2YMOA 3MYZA 4JFTA 3OKNA 1UM4L 2APFA 1EANA 4IHBA 5CCKL 5HJ3B 2KPNA 2MNJB 1NBZA 2DQFB 3BQUD 4R5TA 5EUOE 1FNAA 4NO3B 1MG3C 3OKMB 3IGAA 3UTSB 4L5FE 3BC9A 2B20A 3HUJE 3AM8C 3CDZA 4LLYB 2CIIB 1CUOA 4S10A 2LE9A 5CBEA 4A66A 4F1ZA 2PW2A 4HXBL 5EWIH 2WQ8A 1J1OL 4W9JC 3EBIA 2NY6D 4RRPA 1WGVA 3EBGA 1B0GB 4QY8A 3KWWA 3UC0H 1SJVA 2BVOA 2L7JA 2BNQA 2LU5A 3PL6B 3MRPA 5F3BB 1E50A 2OMTA 2DLGA 1X4XA 1LNUB 2NLJB 2R1XB 5HDQH 4ZYKB 4ZFQA 3L16A 1OLLA 2V7HB 4LU5L 1A7BA 1U8OB 4TVSa 3RIAF 1A02N 3TOPA 4XN5A 3E6FA 1YPZA 1HFUA 2CRZA 2VABB 4XR8C 5IEHB 3VFUA 3KPRE 3RPIA 4NAJA 1BLNB 3KL5A 4XVOA 4LHQB 4L4VD 4PRPA 4IK7A 4X4KA 2ATPA 4E5XB 3EYQC 5ABDE 2C9UA 3RTQC 4N8CH 1EXHA 4IOFC 4WIQA 4RA0C 1UZ8A 1HILB 2Q10A 2VL4A 3LIZL 4F91B 4X6CF 5FYKU 5C7ZA 4ODHL 1O6VA 5IQOA 1L9TA 5MEQA 4ELMF 2Q1EA 3WNMA 2PR4L 1D5MA 1P7KA 1U3YA 2IPTL 2VLMD 4HW6A 4LLUB 4NSKB 2D2CC 1ECZA 2D7MA 2GJJA 4B9IA 1MFVA 2CALA 4J2XA 3ARFB 2XX1A 4EQ3A 1MAJA 4YDJA 1AHWC 1E5CA 3FUDA 4A6YB 3FOMA 4LHUD 1R3HB 5F0PB 5LCVL 2AJYH 2F53A 3DGGB 3WHXB 2R69H 1NC4B 1TEYA 2AEPL 1BJ1J 2BSSB 2J4WH 1A6WH 4X4XB 4XBPA 5B38A 2A4EA 2E9GA 2HKFL 3KE0A 4FQQB 5I0ZA 1KG0B 3KXFB 1AP2A 1QSZA 4GBXA 3QJFB 1KB5H 4G7RB 5D1QC 5B1BB 4JHUA 4PRHE 3W0WB 3EDKA 1A6ZB 4HJIA 4MDIB 4WWID 3S3CB 4BKSC 1VKXB 1XV8A 2HT2D 3TVMD 3VD1A 3QBTB 4MA8H 4HPOL 5HDBE 2X4TA 2CLRA 2VL5A 1JVOA 4J4PC 6CGTA 2JH2A 1P7QD 1ZY9A 1DSFH 4PJFB 4ETQA 3MRDA 4MYWB 1B90A 4PJ8C 5E6UB 3JXAA 3C2AL 2GI7A 4PJHF 2DTSA 2DW5A 4ZXBD 1N8ZB 1YEHL 4G8GA 3VSUA 5IHWA 2NW3B 1JYWA 3GSQB 3GXNA 4TSAL 3K8KA 5IESL 2A4CA 5DJYA 3W1ZA 1WBXA 1MREL 5C0FA 5KZCB 2WVVB 2ORBL 5CJOL 3TH2T 2AQ3A 4R8WH 2ADYA 4KHXL 4D0DB 3CMOH 3S96B 5DLLA 3Q5YA 2FGZA 3BVTA 1QYGH 3G04A 3OMNB 4IOSD 4PLJD 2A0LC 1VF5C 3NABH 1S46A 25C8L 4G9DA 2ZUTA 3U4EA 4PS8A 5HYJE 4XMLH 1MRDL 4Z7IA 3D85A 1FFNB 2AEWA 2X09A 3LHPH 4J3OH 3LZFH 2D8KA 1T5XA 1RPKA 1FFOA 3GSRA 2OR9H 1HHIB 4R4BB 4AE1A 3R0NA 4MJIE 3JYCA 4FFZL 4OTXL 2JKJA 1HL5A 4DJMA 2RMNA 4ODXB 4LCCC 1IV8A 2IQ9L 1H5BA 3HTLX 4KKNA 3QG7H 4KBPA 2VDOL 5FV1L 2NLJA 4ZYKA 2YD9A 3L2MA 1FH5L 1CD0A 4PRHB 2BC4B 1N64H 2WTRB 3GZOA 5GHWL 3VX0A 1OT4A 2DEXX 4F93B 5I5IA 1GPOL 3MDJA 2CO3A 1K5NA 3ATAA 1VZGA 1YAIA 5DD3L 5HDBB 3O11B 2VABA 2BSBA 4HZAA 3RL1B 4ZNEE 2X42A 5IEHA 3M8OL 4LMQI 3I9AA 5DA0B 3RWHA 3V6OE 1KXTA 2VXUL 4IKIA 4KNTA 3TIDA 3ULVD 2VW4A 1KIRB 5JHDE 1NSNL 1MWAA 3X17A 2EVGA 1KJ2L 3GMMB 3UAEA 3QFJD 3IEAA 3RBSA 3MOQA 3PL6C 3QC6X 1H5BC 2UY6A 3HMXH 3GJFB 3VFMA 4X5RA 1MVUB 1JF5A 1GYAA 1YC7A 3BWAA 3FO9B 3MNWB 1F6FB 1I1AD 3EJYD 4BXVA 1QBLH 4HOXA 4J28A 3EGDA 2XVLA 1MUJA 2R7EA 5D2NB 5AENA 1L9RA 1XGYL 1IT9H 3RJQB 4NSKA 3ZDZF 1JE6A 1GJWA 1Q8MA 5IB3A 3FU7B 2BK8A 2DQHH 5EG6C 3ZRSA 1CICD 1R75A 5DYOA 1LM8V 4NO2A 4BELD 5HYJB 2ZWYA 4FQXA 2G0LA 2Z91B 1MEXH 3KPSB 4Q0XL 4YXKH 3BW9B 1RUAL 1PEZA 4FQQA 4FXGB 3VD2A 3KGRA 3WLWC 1R3KB 2V6HA 3PGDA 5EA0L 3ZDYF 5I1CH 3EXJA 5FGRA 1U4FA 2OMVB 4UIKH 1KXHA 3GXPA 1TQSA 3DOHA 4RFOL 4PJGE 2XWZA 3R06A 1KV3A 4PGCB 4UMSA 4ACTA 4JX0A 2NR6A 4QPEA 1Z66A 2PP7A 3ARFC 1S7SB 3MRGB 1G6RL 1AZUA 2OV0A 3CLFH 3LN9A 4HYTB 4XI5D 4FQXC 4E41E 1ZGLA 1KPUA 3T0XA 3HE6A 3UTQB 4ODVH 1U3HA 3DRTA 3KH3A 4NPKA 5SX4H 4OZHA 1J0IA 4LSPL 4JDZA 1U6AH 4PN6A 3WOVA 5DQJB 1COBA 1I1RA 2DN7A 2PPAA 3RWEB 3SGDH 3LKQB 4BZ1A 3FS9A 1RMFL 4RAUB 4RMWA 1TSRA 1K2DA 4LVEA 4M7JL 2F54A 1QWUA 4YLQT 1ZDQA 3EG9B 3EO1A 4A7SA 1ED3B 3D39E 4PTTA 4QKTA 3WENA 4DZBA 4F3FA 3WEAA 3QJUB 1GRWA 1QEWB 1WH0A 2GIXA 1G7QA 3UACA 2OSXA 4HPYL 1T2XA 1XSKA 4PGBA 4X8XA 5FYLL 1G0XA 4ADJA 3F5WA 1FFNA 3WNIA 3HC3L 5D2LE 3ELQA 2RIKA 1NIAA 2BDNH 4NIYE 3G3LA 3K72A 1XH0A 2WSDA 4R4BA 4DSYA 4FABL 2DD8H 4OLWH 2DBLL 2JKRM 2J8OA 3LKNB 5IQ7H 3ARXA 1Q38A 1RV6X 4FCAA 4GP4B 4OIIH 2QQNH 5E00B 4Z3JA 1JDAA 2YPKB 5E0FA 1Q0YH 1QG3A 2W38A 1UB5B 3L9RA 4GJTB 4OLUH 2Z0UA 4D0BA 3W57A 1XIWB 3C5ZB 4H25A 1PFCA 1SLVA 4LSRH 2OXHA 5ICZB 1SEQH 4TVPL 5LXGH 2I9LB 4JKPH 5EB9A 3L54A 3PRZA 2ROXA 4RAVB 3T5WA 1KIPB 2YSSB 4PJGB 5I1IL 5T3ZL 1J9TA 2GJRA 3FCTA 4P46D 4TNVF 3G5WA 4PP2B 3RP1A 2AJSL 5CJXA 2I07B 2PYFB 5D72L 2L7EA 3JTBA 5EUOF 5EH1A 2CIKB 1HIML 2VXVH 4TNWF 3Q48A 3GMMA 5HD8C 4HAFA 3FN3A 5I6KA 5J89A 3CDCA 4E41B 1OARL 3HUJF 3AADB 3GJFA 1KULA 5I1EH 5F88A 3MLRH 2H7WA 2YRBA 4MNGE 1GIGH 2O5XL 5SV4A 1DANU 3IMTA 3U83A 3D87B 4Z7NB 5DK2A 1N5YL 4AQ8A 4B5EA 3I6SA 4Y9BA 4GKOA 2AABH 2DM4A 1F3JB 4QXGH 3N91A 4RWYH 5SWZE 3GSXA 4OF3A 4ECNA 1R3IL 4H8WL 1ZE3H 4G6AD 4J12A 1KYDA 4HS8L 3GRWL 5DD6A 4DVRH 2B7DT 1OCWH 2WXLA 3DO3A 1VDGA 1J88A 3WEBA 1DQLL 4UBDC 3PLYA 3GMQA 1NOAA 4FTVE 4GUPB 1F42A 5J1AB 3F2LA 4U0RB 3CHSA 3X13B 4HPHA 3S36H 1A6PA 1O75A 1KTCA 4H0GA 4M6NH 4TULH 3B2UD 5DFWH 4YC2C 2WWMC 5E8EB 4N2GA 3EDFA 5FW8A 5AAPA 5D2NC 5DUBA 3ZQXA 5BO0D 4J3BA 2GY7B 2W9DL 1OE1A 1PAZA 4WI9A 4HX1B 1A66A 2VDPL 2D0FA 2EIZB 1S7SA 2ADIA 1E6JH 2CU9A 4NQQA 4KK9D 3RDTA 4GXVL 3LSOB 3NJLA 4WV1A 4L4JA 1NCGA 3WU1A 4J2QA 1B4RA 3O6KH 3QR2A 4FXGC 5GS3A 1WSST 1UOVA 2HLEB 4HIIA 5EIIA 3HG0A 2VDNH 4FOMA 5DQJA 4EO5A 5MHSE 5ID0B 3LNIA 2VRKA 2IPUG 4CU8A 3EBAA 4WI8A 1KNOA 4KVNL 1KIQA 1H0DA 4P2QD 2FX8L 3AREB 3VXSD 2ZYIA 1GSMA 4HS3B 2J44A 1ASPA 4UINL 2BCKB 1U8JB 4PCKA 3RWDB 4X0KA 2ZT9C 4M6AA 4LGPB 3RDTC 1CXLA 4OLXL 4AYMC 3DX9B 3P4OB 1EXGA 4WV1C 5BRZA 5J6GB 1NBVH 1PZ3A 4C57C 4R4ND 3OZKA 5HDBF 2BWDA 2FWSA 1F4HA 3MBEA 1OY3B 3JTTA 3K0YA 5E00A 2NYYD 2YPKA 3ZY7A 5DC4B 4R26L 4OM0L 1JUFA 1KTLA 3OKKB 3C5ZA 3B4NA 2DJ4A 4GP5B 3H42H 1UCBL 4JM2A 1SPDA 4M8RA 5CIPA 4ZODA 3C5SA 3L3HA 3N3EA 4MKTA 3FMGL 4NPJA 5KOVC 2ATAA 3PGFH 2Z1PA 3VDAA 2HMIC 4XX1E 1IEHA 2HLFC 1NEZA 2NY1B 3UROR 4QOKA 5E24E 4BZ2H 3OMZA 2Y2TA 1UEMA 5I0VA 1OAKH 1MDTA 2I07A 3ES6A 3O0RH 1INDH 5HGDB 5TE4L 3ULUC 2DIEA 3AQDA 4HKZB 4J3SA 3MBEC 3UPCA 5D7LD 2CBPA 4Y7OC 4LEXH 3GMLB 1FBIL 1NC2B 3K91A 4HZLB 3MLTB 4CAGA 4K3EH 4IGBD 4OSUL 2J1KA 1XIWC 2J1ZA 3C5ZC 1SDYA 2JKNA 1TJIL 3DSFL 3EYSH 4Y19B 4AYBA 3H3KA 5BNXD 2VLRD 3X3FH 5C86A 1SFHA 3BIBX 3MFGB 3M17A 3V0DA 1P9MA 2EZ0C 1TJGL 3L7FB 3ESUF 1L3NA 4XPFL 4DUVA 1H3GA 1JGVH 3FC8A 4JQVA 2CHZA 3VRLE 1AGCB 1AAJA 1OAYH 4F15B 2HX8A 4LPCA 4RMSA 4WU5B 1HL4A 2D31A 2NY5H 3MGAA 3OXSB 1SNRA 1I8AA 3BPNC 2NY0D 4P57A 4WUKL 5KUKA 3LPPA 4GUPA 2J1YA 5LBSL 2CPUA 2W9EL 5I8OH 2QMKA 2TSBA 3FB7A 2XV0A 3F7VB 4OKDA 1AD0B 2FBRA 3FONA 2FH6A 2Z6FA 1WQVT 3EGXA 5ALCL 4ABVA 2W81C 1AXSA 3CC1A 1J8RA 5B39B 3IJSA 1ZHNB 2EEXA 3IE4A 2FX7L 4LF3B 1MFDH 4WSJA 4JQVC 4RVBA 2IJ0C 2WYZA 2F8XC 3E3QE 4S1QL 3VI4E 1DJIA 4Z76A 5DMYA 2AGJH 1NFKA 4FFTA 5HGAA 2QSCL 2C1PA 2UY7B 4YPJA 4XOCA 2W0FB 3F83A 1KBPA 3UPRB 4H88H 3HC4H 4AGLA 2AJXH 2C3VB 1IAIH 4NI3A 2WWNA 3O2WH 4MD0B 2HJKB 4WFED 3VGEA 5ID0A 1TETL 2IAMB 4ISVA 1UZ6E 3ULUF 4NYLB 4U6HA 4APQB 4MHHG 4M93B 1AS7A 2Z1KA 3RX7A 5C07E 4UAOB 1FVCB 4LRNH 5DWUH 4BZYA 1KXQA 3G5ZA 1KZQA 2OL3H 2E56A 3OKLB 4UU9B 3ZL4L 5CSZA 3V0JA 1U30A 4HIQA 3HLAB 5IEKA 4UM8B 1WYJA 3BZEA 1U33A 2IF7A 3T77B 3AAZB 4F8PA 2E4FA 1AOZA 3DX9A 1IGMH 3VWJB 4RMUA 5GGQH 1SN2A 3T8MA 1K4DA 5J6GA 4B0MM 1EZUA 1DVYA 1WS8A 5T5FA 3U1SL 3FN9A 3PYCA 4PJGF 3U7AA 3UZEA 1O9ZA 3CHXA 2GITB 3CHQA 1OAQH 3QDHA 2FQDA 3KPRD 1UA6H 4GG8B 4RNRB 1IAIM 4FNQA 4KKCC 5IFHL 4OCNC 4AQ1A 1CXEA 4NZDA 1YA5A 3GO1H 4XPHH 1CXKA 4ZS6C 3OKKA 2X05A 4C4KT 5IT2H 1U91A 3AREC 1I9IH 5FM5O 1JFQH 2DQUL 4RFNB 3LYRA 4L3CB 1KLUB 4GAJH 4BCYA 1WZAA 5KVFE 4FQJH 5FDYA 3LNGA 5KBLA 1IVTA 5C0BD 4Y4HD 1G9MH 5F6HJ 3A67H 4Z7NF 3TU6A 4UT9L 5EFIA 3F7LA