5DCCA

X-ray crystal structure of a tebipenem adduct of l,d transpeptidase 2 from mycobacterium tuberculosis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
352
structure length
352
Chain Sequence
DLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the inactivation of Mycobacterium tuberculosis non-classical transpeptidase LdtMt2 by biapenem and tebipenem.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
total genus 89
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dccA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dccA02
5K69A 1Y7MA 4JMNA 5E5LA 5DUJA 4QR7A 3VYPA 3ZGPA 4A1IA 4GSRA 5E1GA 4ZFQA 4A1JA 5LB1A 4QRAA 4XVOA 4A1KA 5E1IA 3ZQDA 5DCCA 3VAEA 4JMXA 2HKLA 3U1QA 4Z7AA 5DC2A 5DZJA 5DVPA 3VYNA 4QTFA 3ZG4A 5LBGA 5D7HA 4LPQA 4K73A 5DU7A 4HUCA 3U1PA 3TURA 4A52A 3VYOA 4QRBA 2MTZA 4HU2A 4LZHA 5E51A 1ZATA 4GSUA 5DZPA 4GSQA 3TX4A
chains in the Genus database with same CATH superfamily
5JHAA 4IRZL 3H0TB 2OL3L 4LSRH 4ZW8A 3GPSA 3LCYA 4LLUA 1NFIA 1U3NA 3VGFA 3T2NL 3D18B 2DQJL 3DHJA 1FFOA 1RP9A 1ZK5A 4AYDC 4XP6L 2FX9H 3HRZA 4XNBA 3UZVB 3SD2A 2IQ9H 3DUUA 4L3EE 1WS7A 3IJYB 3U46B 2CLRB 3QULA 2Z8SA 3OXSA 4DK5A 3ZTNL 3IF1A 1KBBA 4RGMB 4F57L 3U6RB 3OV6A 2X44D 3K2UH 2V7NA 2RMNA 1MDAA 3PGDB 2HFGL 5D5ME 4CGTA 5ID1A 2GIYA 2H2PC 3L4XA 5HHOE 4E5XA 4H0GA 2E86A 3TONA 4MX7B 4QRRB 5FCUH 1EHAA 2XIIA 3HUJE 4A6YA 2ITCB 4NB7A 4N68A 3RWJA 4X7FC 3DMMD 4KRPD 4DKEH 4J3OF 1NH6A 4BCZA 1UZ6E 3LPFA 5BJTB 3RWEB 3BO8B 1U6AL 3BUIA 3EADA 4YSAA 1RZ7L 1QHPA 2HVKB 1Z3RA 3GSUB 1E4WH 3UJIL 3ZSTA 2ZOLA 2R1XA 4BSVB 8CGTA 4PV9A 4LRNH 5F8RC 4KRNA 1RZGB 1MOEA 3FOLB 2LT9A 4A68A 1CUOA 3GMRA 4IEFB 2NPLX 2BP5M 2E4TA 2HRLA 4XPGL 3TOPA 1AQ8A 2ZSVA 1WT5A 2AJYL 2VISB 4RMVA 2NDGA 1OY3B 3DHPA 1S8DB 4JKPH 4DCQA 5EEUA 2MOVA 4UB0H 4DETA 4IDLA 4HZ1A 2ZCKH 3EO1A 4DKTA 2HG0A 3IDJA 2FLRT 3N06B 3OKKA 1HEJC 5EUOA 3BPOB 3DOHA 3VFRB 2C9XA 4QJ3B 2KHAA 1QBML 5J9PA 4YO0A 1QSFE 5JA8B 4L1HA 5EU6D 3T0EB 5CINL 5I5JA 1WFMA 2HTKD 1X7QA 4YDVB 1U33A 1I85A 5J11B 4M62L 1R19A 2NY7H 5JOEA 3GXMA 4ODSL 5GGVH 4DEPC 4DQAA 3SDXF 3QBTB 1J0JA 3GGWB 3TVMC 3GGWA 2Z92A 3NDZE 3U9UB 2NR6D 2LQRA 1JHLH 5DXWA 4GBXB 5GZNA 2P43B 4JM2A 3KPSE 4J39A 2DMBA 1II4E 2BVUA 4M8VA 1WBZA 5D4QA 1WBZB 5FWQA 2GIMA 2ZKWA 4M61A 3F65A 4LEOB 3BGFB 1LEGA 4HMEA 3QJOA 5IQ7L 4XN2A 2AANA 4ZAKB 2ATPA 3D2UB 4NEHB 1UWEL 1A66A 1V7NL 5E8OA 3IDIA 4IOIB 3OAWA 4EBQH 4QXGH 2BXZA 2E7LA 3G5WA 3P3YA 4X6FA 1PAZA 4XXWC 5HHOD 1TYEB 2OYLA 3TA3B 2KQMA 4V33A 4LLAA 1E9QA 5A6LA 1KZYA 1HNFA 1ACYH 2OI9C 5DK3A 3QQDB 4RGNE 1IEHA 1I1AB 2G2RB 2WKOA 3L3GB 1A21A 5F1SA 1QD0A 3Q5YA 4OFYD 3WKQA 4PSRA 3W39B 3C87A 4RH4A 2OLDA 1CFSA 2B1HH 4PJAB 4HUVB 4XAWH 1NEZB 4OZIE 1E4XI 1IM9B 1NEZA 3MRQA 3NSJA 3BWAB 2ZJSH 4LASH 1EFXA 3QXTA 4EN3C 3VFMB 3RZCD 2NTFA 4CSTA 4L37B 4H8WH 2WNXA 1SXNA 3RGVB 4C47A 2K45A 4CSSA 1GYWA 1BF8A 5C08D 5K9QG 3SYCA 1CE1H 1H9VA 1QO3B 2ZP9A 5KG9B 1NPUA 2FRGP 4LCVA 3MLTB 3BAJA 4X8JB 4KY2A 3DNKA 4GAAA 4PYGA 3VMNA 5F9DC 3NZ8A 2DV6A 5IB2A 5AW5B 4KWUA 3AU1B 3FFOA 3HMWH 5H37H 3ZOAA 3DK2A 4N3UA 3GMOB 3GK8L 2E7MA 4UQEA 5AL8A 5IVXA 5IFAH 1QSFD 5IVXB 3O3UN 3P73B 3CX5K 3FU3A 3ARFD 4D8PA 5J11C 4M48H 1L9PA 4LL9A 4OCWL 3D3VA 4OD1H 4OFQA 5DS1A 3D3VB 2V2XB 4OD1L 1QUNA 4I9WE 5GIRB 3QJHB 5KANG 1E4XL 3MRLA 5HDBE 5C09E 4L1DA 5A2KH 1F00I 5JYMA 4IBWA 2GT9A 1E28A 1Y18B 3I6LE 3K2UL 2YAMA 3GK8H 3EJYD 5KS9E 1RPQA 3QEHA 4PTTA 5D1QD 4J4PC 3IGLA 2EZ0D 1NFDE 4LGPB 4BKLB 5C0RH 3VWKB 5D6DC 4PJBF 5ALBL 2OR7A 2DIBA 3DMMC 1KGUA 1WZLA 2BS9A 4WK2B 1YAZA 3R06B 3G08A 2WVVA 3VFTB 3R06A 2UV3A 1PCXA 1SLWA 5IQNA 2ZG3A 4GUOA 4N2BA 2XG4B 5F72S 3WSQL 1UZGA 1XAUA 5HGBA 1ZJBA 2FCBA 4YDMA 2H3NA 4G8IA 2F8OA 2VAJA 5FYJE 1CTOA 2E4FA 1J1PH 1ZRUA 3EFOB 4IKKA 4YHIA 1SNRA 5J56B 5HHOA 1KLUA 4JX0A 5E00B 2GAZB 3D39B 2MOQA 3MJWA 5TE7H 3NEOA 5DWPA 1U58A 4ODSH 5GGVL 4DP9X 2CGRL 4YFLI 5I9QB 2ZX6A 4R96B 2IIJA 3OKDA 2L4OA 3WMQA 1I8LA 3X1EA 2UUDK 3ATAA 4K7PY 1JF5A 1E4KC 4FQIL 4N2DA 5E5MB 3SE4A 3SKMA 3CMGA 4WWKC 1VADB 4M6OL 2XPZA 1YVLA 1E8WA 3JV4B 5DA4A 4UTAL 1JNNL 1KEML 2AJUL 5FX3A 3HBQA 5BXFB 2MPAL 2JE8A 1ZWIB 1JGIA 4XPTL 5C0FA 4NENA 5C07B 1OOAA 1D5MB 3QZLA 1UUSA 3R19A 2Z3FA 4P5KB 2EC8A 5KVGH 4JGNA 5ICYA 3CH1B 4LDEB 1XGQA 4WTZA 2HKFH 1T1WB 4F8NA 2R2CA 3JV6B 4MS8C 1CLZH 4AC4A 1D9KA 2HZHA 1YPZB 5ACLA 4UZUA 3ZZ1A 3O6LH 2X4UA 4HJGB 2W65A 4Y5YC 4I4WB 3KDPB 1ZTXE 4JZOB 3WO4C 4JZOA 2N56A 2VQTA 4N6QA 1ZKAA 4FXTA 2WWKO 4JFPA 1O7DE 1T7YA 2Q5BA 3GS4A 1ZT1B 4PP1C 3CCHA 2QGCA 4L8DB 3C6LC 3CCHB 5F1IB 2JJSC 3PU7A 1U8HA 1NC2A 4YEEA 5F2FA 5GRWA 4ES8A 1HSBA 2H32B 3D0VB 3DX0A 4U3SB 2RJMA 4MMZB 5ESVA 3SYPA 1AE6H 2ZXEB 3D50A 2PR9A 1I1RA 3CFDA 2Z7ZA 1QSED 5B1KA 2Y7QB 3DO7A 4JO3H 1CVSC 4AG4L 3MRRA 1FCGA 3FB6B 3L45A 1ZT4A 2HRPH 1MW0A 5HY9A 4XBPB 4L05A 1OSPH 5FDYA 1CR9L 3B9KB 4MD5B 4U6HA 4PW4A 4LRNL 5HTSA 1THCA 3QCUL 3ZDXF 2CWRA 4Z7OB 3TXAA 3O9WD 5FECB 2AK4E 1JZ5A 5FB8B 5IBLC 4DKEL 3P4MA 3EIFA 5D1ZI 4YDIL 3P4MB 4WI3A 4KNQA 3Q6FB 5C0AE 1YDPB 1F3RB 1KELL 1HEZB 2B15A 1ACCA 2M8XA 4PHZA 5GS0D 1HHIA 2DLIA 5DUJA 2XYCA 2WV3A 2ARJB 2G60H 5DQDH 3QEQB 5C0BD 4XMVA 4XNDA 2P48B 2UWEA 2DJUA 2HFGH 3FRUA 5JQHC 3H4FA 3HE7D 1JPSH 4LVNC 2ADFL 5FF6B 1Y0LA 1J5OL 1CB4A 1E5AA 5CGYC 2JB6B 1TNMA 4O2FB 2NXZC 1PY9A 1W0VB 2UZYA 5GS2H 4TLSA 1I9IH 1F56A 3WLBB 4K5LA 3OJDA 2DL9A 4IRJD 3CUPA 3G7TA 2SEBB 2FHFA 1LO0H 4WHTB 4FXKA 4U1IA 1V8HA 3W56A 4P2CG 5KYYA 4YZFF 3HFMH 3LEXB 4ANUA 1M05A 2WAHA 1HQRB 2P5ED 1JZDC 3P2BA 3K8LA 1HINL 4G5ZH 1EA9C 3ABGA 3KLDA 4JG1H 3ZL2A 4JG0L 3SCMA 2D2CC 4ZOAA 1LL1A 2Z91B 4OJAA 3IRZA 3CZLA 3M8OL 4TS6A 1X7TA 1TPXC 5L8LB 3QZOA 4GIOA 1LM8V 2QR0A 5HYJD 2ED7A 2VDOL 3QEUB 5F7UA 1FAIL 4OUOA 3VB8A 1MY7A 4G1EA 4LU5L 5ESQA 1PD0A 2E9WA 4JM4L 4TQPA 1ID2A 1C5CH 1DQDL 2HPTA 4D3CL 1Z9SA 4LK4A 2XWZA 3MLWH 5BVPL 2HMID 3PAUA 3STLB 4XOAA 2QADC 3CSPA 4QOKD 5JHBA 1YEHH 3QDJB 2BNRB 3ABKB 4EMZA 4X6BA 1AYOA 3CLEL 3LNIA 2O5YL 3AAZB 2Q8AL 5I8OL 4U1GC 5KBLA 3FFDA 3CJJA 3LSOA 4AGQA 1DVFD 2G30A 3RIAK 5I1EH 4AQZA 3S8GB 1ACZA 2EXYD 1UD3A 4LEEA 3TIDB 2HAZA 4PB0H 3TIDA 1RL1A 3QEGH 4WU5A 1PIFA 3KPRA 4N2LA 4MWFA 1JMXA 2X0UA 2H45A 2LABA 3UGXA 1ITCA 4GSDH 1MKFA 5ALCL 4CKQA 4E9RA 4DEWA 3O6LL 4GW1B 2QFRA 2CO7A 1L7IH 2F5BH 1C5BH 1VERA 2XYBA 3MMEA 3O2WL 4HZLA 3PHOA 4FXKC 1FSKC 1NMAH 3D07A 5KOMC 2ADJA 2PCYA 5IB1A 2XV2A 1X5AA 1WAAA 4WJ5B 5IB1B 4HJ0C 4XMLL 4YSRA 1T5XA 3VJ6A 4OH2A 2DQHL 5IKCB 4FXGC 1CXKA 1S9YB 4PI2A 2AEWA 2HLAB 3JUYA 2HRHA 5HI4C 3D7PA 4ZTOH 1QKZL 2R1WB 4KROB 1C7TA 1YJDL 2R0KH 5CNHA 1A6VL 3GIZH 3SDDD 4KXAA 2YPVL 3WGVB 5ERWB 5AYUL 4U3CA 1XEDA 5I1JL 1CD1A 2MTAA 3MV9A 2QVTA 3RG1C 5B21A 3K6IA 5F9OL 2AV7B 1KJ2A 4NPYA 4LXFA 1TNNA 3DI3B 4YE0A 1KB5H 2F1AA 1BIHA 3IU3A 5LGJA 4UZGA 5IHLB 4G3YL 2DYPD 1VFBA 2AEIT 3D2UD 4ZW6A 1P5UB 1WCBA 5LAXA 1BQUA 2XN0A 2NZ1A 1S3KH 4PCSA 1NCJA 2VQ1B 2EDDA 1UD5A 3ATDA 4LSUH 3ZDXE 5I2IA 4EZKA 3UADA 3ALXA 3HS8A 3O9WC 1NBZA 3HR5B 2A74C 3IT8D 1IGCL 5HYSB 3PY9A 4QRPE 3W81A 1YEFL 3O0LA 4G80A 1CO1A 4CNIA 1U9KA 1YEKL 3FRPA 2CBMA 2DBLL 3BIKA 2MNJB 4UAOC 3B9VA 4N22A 5GGUA 3U79A 3WKNA 2GQHA 1PSKH 2EH7H 3HRPA 5E5UB 2J1KA 4NSKB 2C7UA 2OTUA 4L4TE 4EPSA 2ENYA 3FT0A 4G8GA 4W4OC 3PAZA 2KMWA 4QRAA 3ARGC 1DCLA 1OD7A 3QYCA 4I8DA 1UZ8A 2ED8A 3GXNA 3WEBA 5IT2H 5IJDC 1K8IA 4AY0A 4TF4A 3FHQA 4R90H 3RTLA 3VI4E 4IGBA 2ZCHH 5IM7A 4WUUA 1P7KA 2ATAA 2N01B 4N1EA 4JO4L 1ZHBB 1ND0A 3FCTB 4HX1B 3RU8H 2HRGA 1UD6A 5C0BE 4EUPG 2P8LA 3E1ZA 2E59A 4GAFB 3DRQA 5HP5A 2B59B 1ZDQA 2WCPA 4MAZA 5HPMA 4OCRL 3EGXB 3KPSB 4DVBA 2XFXA 5DRWA 4RQQB 4Q2ZA 1I1YA 2Y1ZA 1YEWA 1D6EA 3QAQA 3W9EA 1FLTX 4OI7A 4FQJH 4QF1B 4B96A 1P4UA 3Q1EA 3IWVA 1P53A 3SYAA 5D7LA 2VDQL 3S35X 4K7PL 3X3GL 4JRYB 4NJAH 2WBKA 5T3ZL 1ZA3A 4ZS6C 2L7EA 1OAYH 4UQIM 4X6CB 3T77B 4M4RB 5CO1A 4KO5A 3ZBMA 1DJZA 1FFOB 2IPKA 3X11A 1B2YA 4C83B 4N8VA 4JHZA 5AYQA 2Y4SA 3FB8B 2G5UA 1MG3C 3VG9C 3ZKMC 3QXDB 3DUUB 4IBUA 2VMCA 5CEZL 4F7MB 2KDGA 4JM0A 3UG5A 1ET8A 4PJDB 3NN8A 7FABL 2WINB 4KJWD 2N7BA 1I53A 1R46A 3GXPA 1U92B 3ROLB 1TMQA 2QQLL 5B22A 2Q7YB 3PF2A 4BE6A 1E43A 5BO0D 1E40A 2W0PA 5CSZB 7TAAA 5EIIB 3BWUF 4C4KT 1RZIB 1B4JL 1TKWA 1AXTL 1A6PA 2F5AH 3HE6B 2FBRA 1K6QL 3VD3A 3OAUH 3DJ9A 2VR9A 3N42F 4MLSA 3FF8A 3PHQA 2KERA 4YMPA 4FQ2H 1CFQB 3Q2WA 3VXUE 3KPTA 4GI8A 5IW3A 4JPWL 4KK9C 1MF2L 4NWTH 4X83A 3O6MH 5F9WB 2J8HA 3R4RA 1BLNA 1I4FA 2QKIB 1G7HA 5DVPA 1T3FA 3KH3A 3G5YA 1FNSL 5FLUA 2JK5A 4B9PA 4AG4H 4MBOA 4MJ4A 1UWGH 2X4SA 4NHUB 4RGNB 4XBMA 4X80L 5I0YA 5LBVA 4IBTA 4XN5A 2AQSA 4UDTA 4AQEB 5DSCA 3NJFA 3T0AA 4Z3IA 4F15C 1TU2A 2K8QA 2ARWA 3P1VA 2CZNA 3NFNA 4RMTA 1ZS8B 1W8EA 1LK3L 1S9VA 4YDNA 1Q1PA 5E70A 1T0NA 2DY2A 4UTBA 1MJ7L 1OF0A 1FFPB 4Y5VB 2KUTA 3MA7A 3QJQB 4DEUA 5H2BB 4Q4EA 2KL6A 1U8OA 3P2DA 3QFDB 3GMRB 4IEFA 1IU1A 3SO3B 2QSVA 5D2NC 3CFCH 1EAPB 4JDEA 4UILH 5D1ZD 4JDEB 4K94H 5FA3A 2F58H 3B9KD 1UGNA 3O3AB 4LVEA 2KDYA 4NQSA 3UJIH 3VD7A 1A7QL 5LAPA 4Z95L 1QP1A 3FT3B 2IF7A 1YEEH 4Q58C 2Y6SD 3SE8L 5ABZA 3BVVA 1QSEB 2ZCLH 3PFQA 4IK7A 4NOFA 4X9GA 3D6GA 4HJSA 1WFTA 4XNMA 3ESPA 2JQAA 3MJ9L 3MLXL 5IJBC 3BGMA 2YJQA 4K73A 1KIRA 3K4AA 3KJ4B 1EJOL 2DQIH 3HTLX 3O9WB 4TPRL 5B3SB 4M9OA 1AP2B 3MLRH 3FSZA 4OGAC 1ASQA 1SYVA 3H1ZA 4KRLB 1XF4B 3W0WD 3JZYA 5B1CA 1AQDA 1EZSA 3QQDA 1IT9L 3PDOA 4HYTB 1HWHB 1SMOA 4PJ6A 4ZXBC 1KXVA 1QQDA 3FN0H 4I88A 4KK8D 4HWBH 4Q6IA 5IEHB 1DSYA 3T8MA 4QMEA 5D7HA 3OGCB 3H9SE 5T5FH 5AW9B 2BCMA 4BFEA 5T1KB 4XP1L 5CD5C 1G7QA 1E5YA 4Q14A 4QHKJ 5B4MD 1EO5A 4AE1A 1LO3L 2H32H 4X4KA 4GI6A 5KYXB 1BG9A 2CBPA 1L4IA 3CC5A 5KG9A 3HPLB 4V1DA 3PWUB 3L4VA 4NHCH 3VRIA 4ZUSA 1NCUA 2KYIA 1MH5A 3FZUC 4P23B 4KMQA 4U6YA 1ZLVK 2KPWA 3EGSA 3ES6A 3EDFA 3WNIA 4M48L 3EDJA 3UIYA 2IGTA 1E5CA 4PRBA 4Y2DD 3HZMB 3FF7A 4MJ2A 1W0YT 1SHXA 3SE9L 5GZOD 2Z0BA 1RQ5A 3MRDB 3HNSL 4WI6A 2AZUA 1EZLA 5LNEA 3HMWL 3I6GA 3BPCB 3M46A 4LL1A 2X70A 1S7QB 2YD3A 2RACA 2X70B 3PWLA 2OMTB 2X89A 4FNTA 4HIJA 5MERB 5JA9A 1MCLA 1KMGA 3CHQA 5A2JH 2XTJC 2WKGA 2HJLA 1PDKA 4KAQL 2AJXL 5D1QB 1CT8B 3DVGB 5E99L 2OSWA 4MQXC 2VZVA 1TQCC 3L8QA 2VZ3A 1G0YR 2W80C 5KJ7E 1O6TA 2BW5A 4XN4A 3SDDB 4L9LA 4DN3H 2FT8A 1N0LA 4XZUB 4ZDHB 2Y5TB 1IKNA 5E08L 5HGBB 5D1XA 4QLRA 3UFIA 5TFSL 2DQUL 4NQDD 3QP3A 1DZBA 4H8QA 3IGKA 5ETUA 3MLVL 4JAMB 3GMQA 3UO8B 3SGKC 3IFOB 4JNXA 2MRYA 3O3EA 4PLJC 4Y4FA 2BP8B 4F8QA 4AL8C 5I75B 1Z6JT 3D39A 5IP4A 5F9OH 2NSMA 2XN9A 5DFVD 5EORH 2KPNA 1N3NB 5HGAB 5EEWA 3JV0A 3TBBA 2XVBA 3MBWA 5J12B 4LNVA 5CFAA 1LEIA 3FTZA 1XMWA 3A4DA 3FBQA 3VXSE 4B50A 3CSBA 5DHDA 5GRZA 1AC6A 1I9RL 3MYJA 4R84A 4NAQA 1FORL 1YEEL 2VW7A 5E8PA 4Z95H 4N0YL 4D9QE 1MRFH 1NAML 4C56B 4PR5A 3VRLE 3GBNL 1ZPLA 4X6DF 5GS1B 2OW7A 3DRTA 3IFPA 3RL1A 5IBTH 1IC4L 4OLUH 3NOIA 2X4UB 1PX3A 1EHKB 3QWQB 3ML9A 5L4IA 1A7OH 1UT1A 3KGUA 4GSDL 4OM1H 3DJZA 2QZ5A 2NLJA 4NFBA 3LKNA 2X05A 5J6GA 4K2UL 3H9SA 1JTTA 3S4SB 3ULVH 1QUPA 2P80A 4U0RB 4LKCA 3N0AA 5JHDB 4XWGH 1INDL 1F3JA 1PG7X 4S2SA 4WNQB 1INQA 3KPMA 3RY6C 4ZMOA 5I1LA 1JZ2A 1OK0A 2X4OB 5KSAC 4U1HB 3QJVB 4JZNA 3RAJH 2BJMH 3UZQB 3OAUL 2MSPA 1SXBA 1XR9B 3GZQA 3LZFH 1QFOA 3DO7B 2P44B 3F7QA 4H25B 3PV6A 4JFQA 3H3PH 4UOW1 3HS0C 1YY9C 4KVNH 4PV1C 3CE1A 3V5KB 1TZ8A 5E6UB 4AW7A 3L7FA 4BFJA 3IJEB 3H7BA 1RK1A 4X5XA 3IJEA 2G4GA 3MBED 4KKPA 5AD0B 4JM4H 4OQTA 3HE7C 4OKVB 3TT3L 4XVOA 1JE6A 1F6AB 2X88A 4MNGB 3O8XA 5B1JA 1ZVSA 3QDJE 1IKFL 2CHDA 2OL3A 2BRQA 2VNCA 3D52A 4I48B 2K6ZA 1BXUA 4QPEA 2VLRE 4E9TA 4PD4J 3DV4B 4PRIB 4Z7UA 2F8XC 1Q90A 1AHKA 3SDYH 4IRZH 1J5HA 2OW6A 2Z4QB 5BW7A 1O5DT 1N6QH 3QIBC 2P9RA 4D94A 5AENA 1TUPA 4PJ9A 2O6CA 4LHUB 5L4MA 5JW4M 3RI5F 1LO0L 2EE0A 2FWUA 2XBTA 1RURH 4ABWA 4FQCH 4CADA 2YAEA 3QI9B 2JKSA 5FM4A 2IBZY 3C60D 1HOCB 1PU0A 1YPZF 4XNAA 5DC2A 4AMKH 1FO0L 2YARA 4N5ED 2NY1B 1FZOB 3MYZA 3Q13A 4KRMB 1OGAB 3RU8L 1NCIA 1U8PA 5T1DL 4E9SA 2ARJA 3IYLW 4NUMA 4PB9H 2P5WB 4KVCH 1XF5B 4OCLC 4DGIH 3FRUB 4OJFL 5IVZB 2XNAA 5IT2L 3DTXB 1ULVA 1ZXKA 2EO1A 4N8VG 4PJ5B 3CBJB 2CDEB 5DZ9A 1KGCD 1WAAE 2H1PH 5DD1H 2KZWA 2CHWA 4CN1A 2W88A 3N04A 1RUQH 1DVSA 4R0LC 3APCA 2IANE 3VDCA 5IJCC 3FL7A 3CXFA 3I9GL 1MREH 3QORC 4FI6A 1KCSH 2CHXA 2JIXB 1Z3GH 2YMOA 1B0GB 4N25A 3HC3H 5JIQA 1QACA 4S0TD 5FOBB 3HUJA 4ODTL 4XWOC 5FW6A 2V3EA 4YHMH 5DHYB 3WJLC 3AS0A 4JKMA 3DMMB 1I8IA 3KCWA 4XRCA 5C0EB 1AH1A 3KPRE 4PLNC 5CBAB 4NKIH 2FSEA 4HGKC 4LLUB 5J0BA 3OKEA 2WWOA 2MFNA 2ODHA 4QRRD 1H6EA 5I73B 1CLCA 1ETB1 2WXHA 1ZIAA 2XLLA 1GIGH 3NFPA 2OJ1A 3E1F1 5B8CB 3EG9B 4WO4C 3C8KA 1OM3L 3FPXA 3EG9A 4POZC 5JLZA 4QRPA 3OLDA 4BSWA 3ULVF 4QRPB 4BSWB 3GTTA 2NT1A 4XXCA 1N5YH 3AY4C 3CFEB 2KI6A 3AC0A 3DDGA 3H9HA 4W6YB 5D5MF 5FYJH 5I15H 3AAZA 4G6FB 2WUCH 4JN2B 5ICXA 3SQBB 1IILE 4NZUH 3HI6H 4RIRA 5ICXB 4YHYB 2AQ3A 2ICWA 3QUZA 1UTDA 1OAQL 2LOEA 4LCYB 3EJUA 4XX1E 4P3DB 4H8PA 5DFTA 2IQAB 5EOQH 2GG1A 4AIEA 1LO4H 2MKLC 3GXFA 3V55A 4X0KA 1S7RA 3QPQC 1PD6A 5L4JA 1GJUA 1NLDH 3U9PH 4UM8B 1RK0A 2FL5A 3II3A 1M1SA 4O02L 1G0DA 5AOIA 5ALCH 2JNZA 4BFOA 4EN3B 2XV0A 2MCAA 1AKJA 1SGKA 3IJ7A 4R7XA 2DEWX 4YPJA 4PJXA 3DTDA 3KBFA 4GKOA 5I1IL 5LGJB 2CK0L 4FQPA 4IKIA 2WKLA 5CN1A 1DBAH 4YXLL 1JRHH 2WBJC 4F2MA 5I0VA 5I1JH 4FTVA 4OIIL 1T5XB 5K39B 1CGSH 4F58L 1XH3B 4JRYE 1QEXA 1G6VK 3F6JA 1MI5D 2B2XH 4XN9A 1KGCE 3GJEA 5F88B 4BFBD 3KPNA 3TCTA 3K6SB 3PJLA 2HLAA 4OT1H 1TCRA 2ATKB 3HW7A 5IFHL 4MMXA 1MVUA 4GW5B 1ZDSA 1OM9A 3IXAB 4HGWA 4IHOA 4KO9A 4R7NA 1D5XA 2WUBH 3MJ6A 1EBAA 1P7BA 3EH1A 3P4LA 4HT1H 1PZ5B 3BZ4B 5JXAH 3MJ8A 4XB7A 3QE5A 3UJTH 3AWEA 2HFEB 1FVEA 2EDYA 2YFNA 3TBCA 4BZ1H 5I8KH 1WG3A 3QIWD 1SY6H 1UC6A 5E6YA 3CLFL 2MIZA 2VLJD 4G6KH 4NSKA 3KYOA 5TDNB 1R5WA 1U8MB 1YEJH 1AGDA 1TIUA 4HWZA 3FTSA 5JTWA 3HCVB 4L8BA 2KZKA 4OCNC 5I1CL 1OGPA 1I8LC 1UM4H 4MZ3A 3BLKA 1U3HA 2V5YA 4H8HA 2PTTA 4WUUB 4ZAKA 1KCSL 4X4YA 1JGUL 4XOBA 3CLFH 4MVBD 1KTLA 1MCIA 2Z31B 4P59L 2XBZA 5A6IA 2P8LB 3QJSB 4MMZC 2H1PL 3PXHA 5DRWB 2GBTA 4G8EB 5D8JH 1GMIA 1RULH 2D0GA 2IAAC 4H0IA 2XBDA 5TDOA 2VW4A 5DLML 1TOXA 1F4XL 4K7FB 3OKMB 3SPHA 5HGGS 4Y1AA 1G5GA 1HN1A 5ECJE 3FO9A 5GSVA 4ZAKD 1BX2B 4AYBA 1SJHB 4NQQA 1P7KB 5JNYB 4EEEA 4OU3A 3QUMA 4HUXB 2YPLD 2J8UA 3I50L 2Q3XA 4JDZB 5I8EA 3O4LA 5FXCH 3Q2NA 5F7WC 1HZKA 1DQLL 1QO3A 5AOZA 5EB9A 2NY0D 1IEBA 4XC1H 1KBPA 4RQQA 3NZ8B 5IB2B 2XWTA 5J13C 4XCEA 3ZIYA 1SEQH 3ARYA 2BFVL 4UBDC 2D3VA 4P4RA 4JUTA 4LHQB 5D7LB 1LWHA 4OSUH 3H3KA 4HKXA 4HKXB 3UX9B 1F1DA 3AG2B 4D8PB 2IPKB 2PXYC 3X11B 4C83A 5J13B 1JZFA 4FZEH 3PP4H 3WTSA 1OL0A 3SY0A 4YL4A 4FFVC 4K3EL 1OPGH 2X2JA 1BZ9A 4CMHC 1OTUD 4LMQE 5EEZA 2R4SH 5KW9L 1TLMA 4G7QB 1UQSA 4FKEA 3ZL1A 3ARPA 2F74A 4WHYH 5DVMA 1D5ZB 3BDXA 5L7XH 3Q06A 2FO8A 4XVUC 3MV7B 2UUDH 4G8AC 4G59C 5FKAB 1J8HD 5CSZA 4TNVF 3IPFA 3ZRCC 2DQEL 1W72L 3LKSB 2ZOUA 4D0BB 2GEEA 4Y16D 4NO5B 4TM9A 4NQCE 5C09D 1CR9H 2DBJA 4NO5A 4QHNA 3X2QB 4CU7A 1JNJA 4PV8A 4LMQI 3QA3B 4FOMA 4CN4A 4XPTH 5JHMA 1JCVA 5IHZA 4ENEC 3IK2A 3GRWA 3BO8A 3X1BA 3UBXG 4G8IB 2BRRL 4JFSA 5AKSA 3EFOA 1Y1DA 1HWWA 5BV7H 2P49B 4BEIA 1NFDB 4QRTB 4UDUB 3EF4A 1ORQB 3BWZA 1Q0EA 1FNSH 4ZUTB 4Z8FL 3UG3A 4JZJC 2EO9A 4K23H 1Q0XH 4G6JL 3IXTB 1EGJH 2B4CH 4NUPA 3MJGX 3SJVA 5HBBA 3EO1B 2HJFA 2V9UA 5I24A 4YS4A 4OGQC 2WJ5A 2AEOA 3BFQG 4KX7A 3JV4A 3MV8A 1Q9KB 1RIVH 5E9DD 4OTXH 3GIVB 2DQUH 3NCYS 4HH8A 3WTVA 2K9FB 2CUHA 5EC1A 2A6DB 2NY5L 3ILQD 4TVPH 2WNKA 3TGXA 1XD0A 4LOEA 1S5IH 2R56H 2OM5A 3D9AL 3GBNH 2A4CA 2XN9E 2QTEA 3D39E 1U8OB 2VZOA 3EJQA 3L9YA 5FA4B 3MUJA 1LWRA 1JVOA 4GSXA 5TGBA 5FGBA 3SQOH 5TH2B 4PJDF 5ESAB 1B0WA 5I6PA 2IAMD 1X6LA 3L2MA 5T3ZE 2VXUH 4PCYA 1JWSB 3PAVA 4M5ZL 2CGRH 1G1OA 3FS9A 3TT1L 4AOFA 1BAFH 1NL0H 2DQ6A 4XVUD 1UCTA 3BZFA 3H8NA 4XE0A 2OMVB 1P7QA 5HDRA 1VKXB 1S7VA 4Z76A 3WIHL 4JDVA 4O2EA 4GMTL 4M1CD 4Y9FA 4O5LH 1XFPA 1DLHA 3UBXB 2L3BA 5J3HD 5E1QA 2Y7QA 3L3JA 3ZRSA 1H6TA 4E9WA 5L2KA 3P4OB 3O6KH 3NIGE 2TSBA 2V9QA 2YBGA 3BGFC 3KS0J 3EYQC 4OLVL 4A2MA 3S8WA 4OIFA 4GH7B 4UT9H 1NEUA 3V0VA 4JFXA 4DPAX 4UI2A 1FH2A 4CKVX 3WXVH 4PEEA 1SXCA 1KF9B 4E9XA 4M00A 3IDNB 4K71C 5GSRB 2D3JA 1EO8L 3EHBB 3HNSH 4QTHB 4X7CC 1XCTB 3D09A 4LF3B 1T5WB 4PCKA 4Z5RA 2AEPL 1FJ1A 1HHIB 3GFUA 5DS8B 1HCYA 5T1LB 3LIZA 2A6KB 3TBVB 4N9GA 1E0OB 1SUJA 1XGPA 4M7JH 4GW4B 5AVXB 2QPUA 3I6GB 2BDNL 5PCYA 1CS6A 4FNSA 1S7WA 2NMSA 4GLRH 4P3CH 1H5BC 2JCCE 5E2TL 3QFJE 3FCUB 5KYXA 3LNDA 4GP4B 5EA0H 4V1DB 1WD9A 2PTUA 5DQ9A 1NGXB 3HB3C 3JWNG 1JF1B 1I9EA 2AJ3A 3ML8A 4OR1A 5DJXA 1VFOA 5DJXB 3TZVB 3UDWA 5M95B 1VIWA 4KUCF 2QGEA 5C07E 4OLWH 1RIHH 2OQJA 1DQVA 1P9MA 4PTUB 5L8JB 3AREB 4PJEE 2ICEC 4FFYH 1I8AA 1UH4A 3HB3B 4OVUA 5K5YA 4R26L 2XU9A 1YPZE 1XGTB 4TSBH 4WZ9A 3G5ZA 3I6KB 2BVEA 5LWYL 4MD4A 1HT6A 2WTRB 4MRBA 3KJ6L 3L9BA 3PL6C 4LLWA 4OW6A 2X5PA 4DN4L 3QDMA 4F7TA 2X4TA 1XGYL 1OCCB 4EI0A 2B0SL 2NOYA 5F6IC 4ALAH 3TFKC 4DKFL 1N26A 3GTVA 1WK0A 3G5VA 4NRXA 1M3JA 3WL9B 5L88H 4JPVH 3TP4A 2B1HL 2WPGA 3LQZA 4KO6A 3H9SD 1ZTXL 4MA1B 4JS7A 1J12A 12E8L 3HG3A 3K4ZA 3QFJA 4LEBA 4K71B 4UYPA 1OGAE 2EEAA 5DJ6B 4CL7A 5TF0A 4NN6C 1XGYH 1QHOA 3MRGA 1DVFC 4OZFG 3ZUNC 3WJMB 3CXDH 3MNMA 1WFUA 1X9LA 4X5WA 2AQQA 5IQLA 4JPIB 2A9BA 4TSAH 4XXWA 3EOAA 4YSPA 5DD0L 3N1MC 2YD7A 5DJ8B 3QC6X 2GABA 4JFZH 2V9TA 3HG5A 2O5NA 3WFCL 2DQHH 3BP5A 3X3FL 5I17B 4IMKC 4ZFGH 1VEPA 3IMBA 3FO0L 4LIQE 1KYAA 3RDTA 1LNUB 4BQ9A 3RDTD 5JMRA 2CNYA 1PJWA 3TVMA 4LBAA 4TVPL 1A47A 4YHLL 1CICC 2IANB 2BX5A 4V1DE 1WJ3A 3SE8H 3UTTE 1QG3A 3L1FA 3RBGA 5KAQG 3VXQA 1HNYA 2W9LA 2QMKA 3ZDYF 3RBSA 3OKDB 4KXCA 2MHAB 1CFVL 2CBOA 2CO7B 3MMEB 5IF0B 2WQAA 4X4XA 3LS5L 5EFIA 5HVWA 1MCQA 1HQ4B 4XX5A 5EFIB 2CUIA 3VFSA 2H2SD 3S36X 4Z1PA 4KK8C 1U6AH 2DQMA 1KCRL 3MRPB 4L4VE 3U4BL 4HS3B 1I1FB 1M2VB 2Q2EB 3SDCC 2VSMB 3P11H 2BNQE 3M07A 1U8CA 3L95B 3TYGL 3PDGA 5C3LD 2OAAA 2CO2A 1I3RB 1Y07A 3S35L 5EUKA 3NGBC 3ZGPA 3UP6A 3ETSA 2H1XA 4RMSA 3DVFA 2WQ8A 2BFVH 3CQPA 2YD8A 1OKEA 3HHSB 3DBSA 4RVBA 5ERWA 1I3GL 2R4SL 5KTEL 2ZCKL 3MLWL 3KDMA 3FUEA 3MUZ1 4FULA 4QY8B 2NY1D 5D9SB 2BCKB 4X7DC 1RZ7H 5IMMB 4PJFA 1OCWH 2JELH 1KBGH 2IWKA 4OJCA 1DJIA 5D7IB 4MXQD 2PYFB 5D7IA 2WYZA 4LSTL 1Q0YL 1C08B 1DJGA 3B8YA 4H1LG 1KPUA 2GK2A 3QS2A 4XT1C 1KB5B 3A3YB 1BVLB 2CJTA 2R2BB 1SJMA 2EDJA 4EZLA 4NJAL 1ZXQA 3V0JA 2Y06H 1AMXA 2HMIC 1CF8L 2BNRE 3NYKA 1JNHA 3UPRA 1X44A 3K6DA 4KDVA 5EBLB 5EEVA 8FABB 1FHGA 3HE6C 1A4BA 2ALAA 3ULUH 1LD9A 1FNLA 5CZXD 2WBJD 1IIKA 4D9QD 4ORGA 1URLA 1ZHLB 5E94B 1JWUB 6CGTA 3JVGA 3O3DA 4WWNA 1CLOH 4ONFH 4Z3GA 2DQJH 2IBZX 3KHQA 3LAFA 3S6CA 4ZMTA 4E42B 4WI4A 3ZZLA 3AQXA 3FU7B 4AT6A 4G8GB 1CU4L 3CVBA 2HT3C 5LBSA 3QEQA 1GRWA 1IGML 4R2GC 2PPCA 1DEDA 1JZGA 2DQTL 4KMTH 1UM4L 3DTXA 5IM7B 3SEPA 4Z7VB 4CSPA 2JTYA 3K2MC 5CZVH 3EJZC 5I19H 2WLKA 5I30L 5E2UL 3GSQA 5C0JA 1XSOA 1NWOA 3NCMA 2BY0A 3MNVB 3RY5A 4FMKA 5BV7L 3HLKA 2VDNB 4M3JA 2C3VA 2A6IA 5CZRA 5IR1B 1PNCA 1NDTA 3IDGB 3UERA 2NR6C 4WCYL 2VSKB 5DJ0A 3BEVA 2WQVA 5JDJA 1U8PB 1A6UH 1MZZA 1HQRA 1DVFB 4PJAE 1IE5A 2H8PA 2EDRA 1JV5B 2IH9A 3OGOE 3MXVH 1MI5B 2PO6C 1MZYA 1R5IA 2B2XL 4WVRA 5CIPB 1C8QA 1Z9LA 4FTVD 5MP6L 4HBCL 2FO4A 4HMCA 1DVZA 3CFTA 4PY8I 5SX4H 2EDBA 2NW3B 2VOTA 5GZOC 4UNVA 2B4CC 1AD0B 3HPJB 3G5XB 4Z3JA 4V2BA 4PVNA 1PZ3A 4HT1L 1LEKB 5DJCA 3VGGA 3OMZA 1R17A 5JMOC 3QDGA 3FB7B 4DPCX 2C1PA 4R97B 4TOYL 3TV3L 2AC0A 1SY6L 3IDXH 5EOTA 1SXZA 5C8JA 1QNIA 3MLYH 4EI6B 3SO5A 4D0CB 5ILTH 1XIWA 3FQNA 2FBOJ 1CDCA 2WTPA 3MJ9A 4XC3H 3H0TA 4YSCA 1B9ZA 4OSUL 1KFGA 4G11A 3FQ2A 4AMXA 5F3HA 3ZHKA 5TE4L 5EMYA 4M43H 5GRJL 4JR9L 3T3ME 2H9GA 2HH0L 1KJ3H 4YZWA 1QNZH 4PJIF 3MLYL 3S48A 5I0DA 3MN8A 4KV5F 4JFDE 4ZQKA 4QD2E 3U0WH 3I6SA 4PW3A 3ARGD 3QIUB 2R51A 4GYBA 4BELD 3V4UH 4ES9A 5J8OA 1D7CA 4UT9A 4ODXB 3L17A 2APTA 3EYOB 5BRZA 2WXOA 5EBWA 3SPVA 1YEIL 4Y19A 4ZXBB 4XN8A 3EFFB 4ZSOB 2VE6B 2JF1A 4JFFE 5F88A 5BS0D 5HHPA 3H3BC 4FZEL 1R3IH 2QHRL 3QIBD 1X4XA 3CX5J 1W91A 4UWQB 2GHZA 2HB0A 5DURD 4WO4A 3RWIA 5FO8B 1DVYA 2CIIA 1AGFA 2ADIA 4K5NA 5HHME 2H7WA 3UOAB 1ZJAA 2EC9U 2ZF9A 2LLGA 2P42B 2AV7A 4DOHB 5ADPH 2J88L 3SGDI 4H5SA 4OLYH 4OIBA 4B0MB 4PB0L 5TD4A 1R0AL 3PWPD 5BUAA 3KR3H 1TO4A 4KJWC 5IG7A 1EEZB 5AUMA 2CM6A 5DQJA 1TXKA 1OP3K 1UACH 3KS0H 4K9EC 2YUXA 3VFRA 2ATKA 1AVAA 1IGMH 4OGYH 4Y9GA 4FA8A 2F7PA 4GW5A 3CFJA 4IOFD 5MEQB 1AHMA 4Q0XL 3S9DB 4JQVA 4RA3A 1FFNA 3IDIB 2ZICA 4QCIA 2X6CA 5JQ6H 3V4PH 2PF6A 4BQ6A 5IGXH 3GBML 1MG2C 3GD1C 2A9DA 1QI4A 3POHA 4NM8H 5EO9A 3R1GH 2DTML 4FQCL 2Y07H 3RPIB 3WOVA 4OV5B 3B6SA 4QNPF 5EC2A 5DC0A 5DD6B 2BS71 5HJ3B 5IFHH 1SOSA 2O6PA 4AL8H 1JGEB 1CDGA 3BFOA 3D87B 2X38A 1UCBH 4A2DA 4P2OB 1G6RL 5D7KE 1U8QB 1QQDB 4K8RC 5BPPA 1IM9A 2WWMD 4N2KA 1A7BA 1OB0A 5TQ0L 3VXTA 2ZSWB 5CZVL 1AGCA 1LVEA 3X17A 3U36A 1J0HA 1I82A 5IESL 3P3TA 3E8UL 3TESA 3TPUB 3TPUA 2BO0A 2P7TA 1HFUA 1MCDA 4KPHL 1HYSC 5HHMB 4YLBA 1AGBA 5CS7A 2IXQA 2XPGB 3UEQA 2UZIH 4FFZH 3JT0A 1UVQB 1QZNA 1E4KA 5FW8A 4F8LA 2JCCF 1ONQA 3QG6A 3QR1A 4RNRA 5T3XE 2A83A 2J1WA 4XZ4A 1A3QA 3L3GA 2IOOA 5GRJH 2PO6D 1A5FL 4NZRH 4RBPH 4F1SA 3ZJAA 4MKMA 2BSRA 4JFWA 4ONOA 4URTB 2OMYA 1HHHB 3LMJL 1NCTA 1BX2A 1SOKA 4CVXB 2WQSA 2YRBA 2ZAGA 4YHZL 5E4AA 5D70L 2WLZA 2Y24A 2CJUL 2E0PA 2ALWA 1VJSA 3MLUH 3PQYB 1U0QA 4M43L 2JELL 4L8SA 3ISYA 2BNRD 3ZYJA 4QRQA 1IRAY 4Y9BA 2A38A 4K2UH 4U31A 3P30H 1ASPA 1DJWA 5C0DA 4UANA 3VG9B 1SJEA 5IUCA 2E9BA 1ZLSL 1LHZA 4APXA 2Q7YA 4U1JA 5C3TA 1YY8B 5KBKA 2AK1H 2Y36L 4CBPA 2PTVA 4LSSH 2WLHA 3MUY1 4YL9A 1ZSDA 4OGAD 3U0PA 2HKFL 2X4NB 1M7UA 1ZOXA 2WVVB 2ADGA 5AZEH 4E9VA 4GLRI 1VZIA 3QA3A 5KJRH 2WHVA 3KEHA 2QPDB 1S9WB 1KC5H 5G4MA 1CFBA 1T0PB 1WUNT 2WY3B 4U1LA 1RJYA 5IIEB 4U1LB 3LTVA 4KKNA 1FIGL 4YFEA 3GMQB 4TUKL 5CJBA 4NUGL 2XA8L 3AQYA 4XP5L 5D72H 1E8YA 4J3WA 2BPBA 1BLNB 2C8NA 3BN9D 3GSVA 4QHLA 3HMXL 1B4LA 1Z5HA 3OF6A 4JCWA 3SDXE 2OBGA 4R96A 2C3HA 4JW3A 1COBA 3VFGH 2B39A 3EJRA 4OY9A 3G08B 1A3LH 1SF3A 3SKMB 4HCIA 1KEMH 2AJUH 1MY5A 3EJCA 5CILH 2HWZH 4NQDB 4KVCL 4MNQE 4HAFA 3B34A 5G2NA 3FTVA 1T0NB 2I9TA 4JFYB 5L4FA 2Z93A 2YA0A 3VM7A 1L9OA 3MRHA 3MA7B 2O26U 2MCMA 1WF5A 3VNZA 3RY6A 4ONGH 5DUPL 5L9DL 4FNRA 5IEKA 4FLQA 2DTSA 4B6ZA 4L48A 2W65B 1F4YL 1U58B 3DX9A 4RFEB 4Z0BL 2V33A 1BVNT 1BBJB 2XXFA 5SV4A 1FLRH 1SXSA 4K9EL 4DKDC 1DUZA 4JFPB 5I30H 3F64A 3D51A 3FN9A 4L8DA 4HP5A 1G9EA 5D6DA 4BK4A 2ZXAA 5M94B 5HHVL 1MFAL 3V4PA 4A7GA 1J5DA 1NOFA 2ZOKB 1D5MA 2DQTH 1GOFA 1BOGB 3AWGA 3MLVH 2L7QA 4O02B 5B38G 2A0LD 5HHNA 2CO4A 1KIRB 4MB3A 4PB9L 4Z7WF 2XZAH 3PL6B 3S36L 3PL6A 5FEBA 5FA4A 3TS8A 4J2QA 4DPBX 5KBNC 5D7SL 3WNMA 5C1MB 5A3ID 1RLWA 3APDA 2DB8A 3AQZA 1BFVH 2ENPA 3DHUA 2YJLA 4I0PA 4UTBH 1MAML 2DDQL 3WTYA 1I9JL 3JQOB 1EMTH 4RISH 2C9VA 3SDXB 2F61A 5CBEA 1BM3H 1M6OA 4PIRF 4BXSV 4CVWA 5EU3B 1CICA 2KS0A 1RZJL 3BVNB 1B9KA 4M7JL 3AT9A 3T08A 3VGEA 1GYUA 3NCJL 1DQJA 1IFHH 4Y2NA 1GHFL 3FUKA 4MCYB 2IALB 5T1KA 1A0QL 4GMTH 3GJFK 1HYSD 1TZGH 3L6FB 5HGHB 2Z4QA 4OF6A 2BC4A 1F3DJ 1T2QL 5D7KD 5DUML 2R9HC 4E41B 1MFDH 1GC1L 4DSYA 3BLBA 4LOVA 4YXHH 1IC7H 5AVSB 3I74A 1J5CA 3QJZA 3SDDC 2UZXA 1GR7A 3QGVA 3IJHA 1FFQA 4A2FA 4F3FA 4U7KA 5E4EC 3O2VL 4PVBA 1MRDH 4KUCD 1H3PH 4KFZC 4Q6IC 2ZUSA 3F58H 2AXJA 1DN0A 4UQ9A 3GB7B 3APNA 4GRLA 2AXGB 5F89B 1JNLH 4GRLB 2GVYA 4K0OA 3EH5B 1E90A 4XNZC 1CURA 3DLQR 4AQAB 4PJCB 5LUMA 1NBYB 3SE3A 4XXDB 5B7FA 4A7GF 1CE1L 1XGPB 5H4YA 2X6BA 5DC4B 3B83A 3QDMB 4RLDA 2XNAB 1SLVA 1F90H 4I2XE 3BQUC 3KYKH 4J12A 1P5VB 1NGPH 4UQCA 5C9JB 2W9EH 3C09C 2EDXA 3UCQA 1RJZA 3SJVD 2FIKB 4X4MA 5LB1A 1KTKE 4XWGL 3FQRB 3KPLA 3NG5A 5FDWB 5BQ7B 3SYOA 1JIBA 2NTFB 5CJXA 2UYLB 4MCNA 5D1ZA 1KTCA 3LJ3A 1QRKA 5J6HA 4UOJA 3G9VA 5DEGA 3OKLA 1TVBB 3OZKA 4OCSL 4RRPA 3E7JA 1AZBA 5LVEA 1OB1A 4X8JA 3R7QA 4IRSB 3WJMA 3HUJB 1WC7A 4IRZA 1WC7B 2Z0UA 4X99B 5IMOA 1CGWA 3ZE2F 4M7ZC 2E7LC 4GQPH 4LLWB 3P77B 1HS6A 1H8NA 3E3QE 4F7TB 5C0IB 4LCCC 4PJHA 3FQ4A 3VD4A 3BZDA 5LKNA 2OK0L 3V79C 3GS7A 4GJTB 1IJ9A 1A9BB 1UKSA 2D7PA 3CSGA 4WUKL 1A9BA 2B4CL 1KLGB 4KDTC 4PWHA 1BWWA 4AZ8B 5IQ9A 3UBXI 5DFAA 4TSAL 3DYOA 2HT4C 4LVHB 4NKOA 3PWVA 3V0AC 1FFTB 4G7VL 3NQKA 5CCKH 2EDWA 1RIVL 1XR8B 3TJHC 2PABA 5C6TH 3GMMB 4QT5A 1W6LA 2O5XL 1BXVA 3LRHA 4JFEA 5JW5A 3U48A 3H55A 3STLA 1H3WM 4DF9A 3A4FA 4QO1A 1JERA 3RUGE 2M1KA 3QFJD 5C08B 5BUGA 3F12A 3UYPB 3UYPA 4OD3H 1MI5E 1KCKA 2Q20A 4YN3A 1WFOA 4YHPB 5C9KA 2BNUA 3QDAA 3JYBA 2WLLB 2DLFH 1NEZG 2NYYC 3LN5B 2WLLA 3NABL 1FG2A 3GSWB 3QDMD 3Q8FA 1IO4C 1JN6B 1KXQA 1V3JA 3B2VL 2X9XA 2CKBA 5EF1A 2FJUB 2CKBB 4NYLA 1MWAL 1I1AD 4L8SC 1RIUL 1AKPA 5LG1A 2YFOA 2ZKXA 4YUEH 2P5WE 1E6OL 2Y25A 1KPRA 5AW1B 5KYNA 2Y6SC 5D7SH 4J6RH 4IYKA 4OLEA 4PLKC 4X5LA 2VDLB 3L2NA 4N2NA 4GW1A 4TNWF 4Y2LA 4H88H 3WN6A 3WEXA 5BVJB 3SO3C 2CR3A 1EMTL 2XWXA 1OLZA 3BZEB 2ADJB 4H0LC 2EICA 5I1AB 1GKOA 2Z9TA 4NQVB 5FW7A 4GXUN 1HI6A 1BQ5A 1URIA 2BVQA 3ZIMA 1U8JA 1U8JB 5EIVA 1F6FB 2GTWA 3E9UA 4IIZA 3HE7B 1BQHG 3BCDA 2CD0A 1OSYA 2L7JA 4P5TD 1DE4B 1M42A 3GC3A 5JZ7C 2YIHA 4MAYC 1RZPA 4NQXB 3S34L 2NNCA 1DP0A 1KCVL 3GBEA 3R18A 3HRZC 4BH8B 4M8QA 5INCA 3F5WB 4OQTH 3EXLA 5HHVH 1QPKA 2CA4A 1NLBH 2DQGL 4JFHD 1SYSA 4CUCA 1EAJA 1SYSB 4ZFQA 1D9KB 3N85L 2FEDC 2OSLB 4P2RB 2VQ4A 2VABB 4OLZL 5SWZB 2X2UA 2CRIA 3CX2A 3L1OH 2OTUB 5AAMA 3M1BB 3ZDYE 3ZK0A 1S7UA 3WFDH 1D7DA 4XO4A 1GGCH 3PL6D 4JPKH 3GXDA 3UTQA 4FYQA 4F5CA 4E0RB 5LGHL 4POYA 4LAJH 3DBXA 4R7VA 3BP6B 1IBBA 4K15A 3VGAB 4IK6A 4PJ9B 2I9LA 3BH4A 5I5RA 5DZOA 1I7TA 4DGYL 4L0ZA 1KDJA 1PVHA 3HR5A 3ZW3A 2VLJA 4QXWA 3KXFD 4K9JA 1A1MB 2IWEA 3UZEC 4CNIB 4WGWB 5HY9B 4XBPA 4WW2C 4MJ5A 5I6XB 1MAJA 3COOA 2VERA 3ZT7A 5SX5H 1YQVL 4YLQT 4YHNA 5ISZB 3HMXA 5H94B 4ZUVA 3W0WA 3EZ8A 2JCWA 3SZKC 3ZPDA 4R83A 4K5PA 4YBLC 4FFWD 2QFPA 1KGYE 2J25A 1BPLB 3SZ6A 3KPPB 3M45A 3FNKA 3KNBA 1H19A 3WE6B 4G8FB 1PJ9A 3G6JF 5BQDA 4ODVL 1XSJA 3I75A 2IOMA 2WSDA 1BQHB 4YC2B 1YN7B 3TF7C 4PBWD 3RGBA 2J1YA 4WI2A 1R24B 1MCFA 2J73A 1KGIA 4NUJB 5CGMA 1RJLA 4YXLH 2NW3A 1CDUA 1NCCH 1AD0A 3EUDA 1JHKH 4MNHA 4LQ1A 2C4XA 2WLIB 3MA9H 1IGCH 3ARGA 2X0VA 5ELIA 5CR8A 1JPEA 1A25A 3O6FB 3UL4A 4RWYL 5FHBH 3CVHL 4JJ5A 5AG9A 2I7OA 2Y7LA 2YXMA 1UJ3B 5FYKE 5EU5B 1XCWA 2YPLE 3VW3H 4I7ZC 5C0EA 4JR9H 4ZW7A 3QO0A 1G43A 3EBHA 5BMFH 5KYYB 1CGSL 4W70A 4F58H 3IETA 1HL5A 3BH8B 1NGQH 4FG4A 1LQSR 4K3DH 3FH5A 4IBZA 3ZL4H 2ZAIA 1A9VA 5JXEA 1KB5L 3FB8A 3MRJA 2FYYA 4E9YA 4U1NB 4MAYB 5HDQH 3SHSA 2BW4A 3OAZH 2FUTA 1E3FA 4TULL 5FYJL 3QDGD 1FI8C 1UH2A 3IF1B 2OX5A 2V37A 1JXKA 4TNGA 1J8HA 2QL1A 4MVBC 2WJ7A 2Y2YA 4DP8X 4MQTB 3LV3A 3RB5A 4HCRL 1GSKA 4WUUE 5GS3A 4IJ3B 4ODXA 5C8JB 1DVUA 3TN0D 1R3KA 3UYRH 1XIWB 3FQNB 5C70A 3K6NA 4WFHE 3KWVA 4JVWA 4AQEA 4ELMA 4ODHL 2FZ3A 4TSCH 4OFIA 3SGEI 1ZAGA 2AMGA 2H26A 4FFWC 4X7TA 1ICTA 2KT6A 3S3BB 5IESH 3D34A 3FQUB 2WVUA 1FFPA 4Y5VA 2NQ3A 3FQUA 4EZMA 5CMAB 5HHQB 2FQGA 5CMAA 3OAYH 4OCRH 1UFGA 2GSGB 1SEQL 1FBIH 4JFUA 5CEYB 2XRAL 3LNHA 2PO6A 1LJMA 3QR2A 1CE6A 43C9A 1AKJB 5DWUL 3KXFA 4HWEL 4F7KA 1BZDA 5BRZB 4PJIA 4LSVH 4GO6B 4K3JH 1N5AB 4UDTB 4FTVB 4F1ZA 3ZG4A 4WHYG 3LHAA 4ZFOA 1B0RA 2Q76A 4PJDE 2R29A 2J71A 3L3OC 5DQJB 3S96B 3VDBA 3CDFA 1OAKH 3KPNB 2OV0A 5EU4A 5GJSH 2CQVA 2EADA 5CJOH 4PUBL 1S9VB 2EIBA 5E8NB 3LIUA 1F58L 1Q9WA 3EYUL 3BQVA 1FVCB 3U6XA 3ORJA 4WY7L 4HWEH 3D12B 4YDJB 3EYSL 4QRSA 4ANXA 1UACL 5A43C 3BKCL 2IV8A 1KUMA 2H0JA 4MJIE 5ANMA 4Q4IA 5E2WH 1TVHA 1AP2A 1KOAA 3GSXA 3M88A 2FB4L 4LBEA 1OTUC 3AXLA 3ZDZE 1WRFA 2FUQA 1MNUH 2QGDA 1AGDB 1CLYL 4DK3A 3O3AA 4HWZB 3WIAA 2KLRA 1A64A 4B41A 4GPVA 1ZIBA 3BEWB 1MFEL 1PZ2A 3FN3A 2Y1YA 5E2UH 5HDLA 4NC2B 2BP3A 1RHHB 2V2TB 1L0QA 4JQXC 4UV7L 3STZB 2HA1A 1JSYA 2NY4D 1DVTA 3V52L 5I1IH 1OT1A 2DD8L 4N5EC 1Q0YH 1HH6B 4NO0B 2P7TB 4DO4A 3P4NA 2BVPA 4GRWE 1J88A 3WY3A 4W9HC 2LVEA 2RHEA 1XAKA 4KZEH 2ZT9C 3ZTJG 2J44A 3MC0A 4NC1E 2R23A 4P49A 4A7QA 2VB5A 3PJNA 3W11D 1EHXA 5F7KC 3LB6C 4RNRB 3PWPE 4FHBD 2C5DC 5IB3B 1YEFH 2MNWA 1TQBC 1XHHA 4KVNL 4ENED 3NJMA 4U1KA 2QVMA 2DEXX 4LCIL 1T5WA 3C2AL 3HZYA 4Z5RB 1FJ1B 2XTSA 1HCVA 4RA0C 3TBWA 2G5BB 2N7SA 3KGTA 1L3NA 1W8NA 2PW1A 1OP9A 3VXTB 1GAFH 4EOWH 1GTFA 3HVNA 1AR2A 4MCMA 4XTRD 3IN0A 4GW4A 3WJLA 4HKJB 3QIBA 3QORD 3IWUA 3ULVC 2VGLM 4G3YH 4JY6A 2VN5A 5F21B 1H15A 2AXFB 1NGWA 3G04B 4A67A 5D96B 1U8KB 1ONQB 3QG6B 3FU5A 1BP3B 1NM9A 5B1BB 1PZAA 2VL5B 3EGSB 3ES6B 3EGXA 3O45A 2C3XA 1KBGL 1PMYA 1AG0A 2BH0A 4GAGL 3A22A 1ZSDB 4M7LT 3U0PB 2IAMC 4FQ1H 3D69B 1FL6A 2BXYA 3HR6A 4KI5E 2B3IA 2Q0ZX 1S2EA 3F01A 3LOWA 1HHKA 2XOTA 4JANB 4ZFGL 3T09A 1KENL 5I1DA 4MXWH 4BK8A 2F08A 1FNGB 1Z7JA 1CDIA 1EDQA 4PGDB 3IGFA 2DLTA 3NIFE 1RMFL 4QRQB 1Q9LA 4C55A 1TZOA 1EEYA 2BFGA 2TAAA 3VSQA 5FFOA 1JZ8A 2OJZL 1INDH 1JZ7A 5EORL 1CFNB 4YHML 1GY2A 1A14L 3C5ZB 1BJ1H 2FH8A 2NX5D 4OUUB 1NKRA 3UH8A 2YGOA 1M7XA 3I9PA 3ULUC 4RDBA 2VH5H 2EDKA 3L5WA 4FQLH 4EIUA 2YD2A 1DDHA 2OS7A 1TEFA 5J3HC 4YXKH 4NKMB 4CMMB 1HILA 4NQDA 2Q87A 4CAGA 4M6OH 4Y1TA 3H4HA 1A8ZA 2WBXA 2I25N 2I26N 3NA9L 4PGBB 4AYSA 4PR5B 2NY2C 5TJWK 3AGWA 3MV01 5GS1A 3FT9A 2XQBH 4WW2A 2YPKB 3VTAA 4F7EA 3Q2VA 1JYWA 1JK9A 5B1JC 1FYHB 5KOVC 4B9CA 1SN0A 4W81A 5LGHH 3N85H 1CL7I 1NCAH 4JRXE 2NY5C 1J8KA 4B5EA 3WUWB 1CU4H 2HFFB 4MSWA 4Y4HA 1YYML 1RCYA 1GW6A 4QOKA 4GUPB 5AAMC 4JKNA 5INDB 3FAXA 5J12C 2JCCB 3L1OL 1UADC 2LU4A 1UWXK 4LSDA 1Z32X 5GRVL 1S8DA 3T04D 4ZMWA 1YZZA 1IAKB 5EC1B 2VJ0A 2WM0A 4UNIA 4U1HA 2V7HA 4OJFH 1NANH 1QSFB 3JWDH 4O58H 2I5YH 1HVXA 1UJTA 4Z3FA 3RWJB 5CP3A 3L54A 2AJXH 3U82B 1CZ8H 1OEZW 2HUHA 2HVKA 1IM3D 2IH3B 3N41F 5LWYH 2A9NL 4OF5A 4DGWC 2NZ9C 2ZKHH 4AJVA 2NUPB 1JZEA 3F84A 9PCYA 3L7FB 1ET5A 4V1DD 3FOLA 4NN6B 1Q4NX 3TNNA 1JPGA 3JXAA 4XPAH 1PG7H 5L2KD 3CVHA 3VYOA 4MA1C 2DWTA 2A73B 3TO4D 4XMPH 2QDWA 4JDVB 3GINA 1WICA 3Q9PA 2IVFC 4LASL 4N6RB 4YXHL 1ZD6A 3L6FA 4W68A 1CC3A 1VHPA 5IQOA 5DRXB 5IK3A 3AADB 3IGUA 4PRPE 2WGXA 2WLYA 4G6AC 4OFYA 4JHAH 2J4WH 3F8UB 1OTSC 2EIKB 4UF7C 4U6HB 4OB5H 4KKRA 4NP9A 3L3KA 1SFDA 2WZAA 1X5ZA 5KAQF 4Q9RL 1WBXA 2I07B 3IMRA 3QJUB 3NIDF 3OHXB 1BM3L 3NVQA 5F6IB 1N0XL 5DJDB 3C6LA 2OSYA 3K2KA 4M4PA 5KYWB 1JFQL 4GOSA 2VXSL 1AANA 1JDCA 2OP4L 3PABA 2YBRA 3CDGB 4HBQA 5D1XC 5AYTA 2ZCLL 1BZEA 1SDDB 2BJML 4KKAC 4AZUA 4IRSC 3LZRA 4H20H 4RFOH 2XY1A 3MDJA 2O6DA 4HLZG 5DJZB 1CVRA 3U4BH 2YXFA 2JB6A 3WMSA 4TYUA 4BK5C 2EIJB 3ULVL 3CQFA 4Q89A 5CHNA 1XSKA 5CHNB 4DP5X 2GJRA 3OJDB 1T21B 4HSQA 2QTVA 1QI5A 2AQ2A 3T6WA 5B39B 1AOHA 2Y72A 5GRXG 5L6YL 1E9QB 3ZLQC 3ZQDA 1TTAA 3LEXA 4M6NL 4ZTEA 2NQCA 4WV1C 3EBAA 3MTRA 2WTRA 4U6VH 4EVNA 4P9ML 4L9LC 3GTNA 2CRZA 5LDUA 4P2QA 4XBGB 2CHNA 1LE9A 4NZDA 3AXHA 5C09B 4PVLA 1G9ML 1P6WA 1CQYA 4LPYA 3NIDE 3ECQA 3ZDWA 4B9GA 1R1CA 4HJEA 2DQEH 2NNRA 4RRPM 3WL9A 2VLMD 4J8RB 2OMTA 5JLZB 1MHEA 1S9XA 2ZWNA 4AEIH 4DN3L 3S88H 1Z9SB 2DI8A 1JGVH 2QQKL 2BVYA 4L0PB 2EEFA 4DO6A 4D9RE 4WNJA 5CJ8A 2YD6A 3SE3C 3TNMB 3ULSB 1TZAA 4X5QA 2K6WA 1FH5H 1E6JL 3MBXH 1X5HA 1QR1A 3DMMA 2H6PA 1AQMA 3F62A 1VPOL 3QZPA 3VFTA 1BEYH 1DUYB 5CD3B 1XD1A 1DUYA 1S7SA 3OKEB 5CD3A 4ZDHA 5E9DE 5DJYA 3I3EA 5SWSE 4AZ8A 3WS3B 1UWGL 3K72A 5ICUA 5DZPA 4PWJA 2VDPB 2QVKA 4KDWA 3RB7A 4X0KB 1PZDA 3WU1A 4PBXA 3V4VA 4DTGH 2VKXA 5T3XL 4M7KH 2BP8A 2A9NH 2HVBA 1J0KA 3H9HB 3DUSB 3MX0A 1E3XA 1MRCH 1DVQA 3PHAA 1CGUA 3ILQC 4QUOA 2R2EB 3QCVH 3SQBA 2ADYA 1WQVT 2ZQKA 4PVMA 5CIPH 4WENB 3D85B 3P9MA 3EF7A 4WV1A 1NFKA 2DQFA 3BT2H 1UA6L 3GJEB 3TX4A 2XTJE 4GAYA 4HH9A 1RZKC 5K1JA 2K70A 4X9FA 1BFTA 1EQWA 3L5XH 3QISA 3UTZB 5IOKA 3S98A 1RUKH 4HGWB 4U3XA 4R7NB 1CFTA 2GUOB 3S37H 2XG5B 2J6EA 1ILSA 3JV6A 1GS6X 5I73C 4RETB 1HX0A 4M6AA 4EN3A 2BCKA 2NNAA 4D8OA 4JFFD 4NM4L 2K4WA 4ZRGA 4NM4H 1H0DA 5SWZA 1QTYT 4R8WH 3Q8BA 1R5WB 4X7EC 4LCWE 2QADD 1GY1A 4IS6B 3QPQD 3UBFA 1R6VA 3MRFA 3WIFA 1X4YA 2BY1A 3MRFB 3HJ0A 3WIFB 4DZBA 1QSVA 5IB5A 1X9QA 3WTUA 1WD8A 4O5LL 4UT6L 1HSBB 4Y5YB 2IEPA 2O1AA 3S3DB 4PPTA 1FZMA 1DBML 1PF3A 3RVWD 5ICYB 5I76B 4Y89A 3ARQA 2AV1A 4DGVH 4EI5B 1H3UA 1FVEB 2WZ5A 2ZWSA 1JDDA 4MA7L 5F0LB 1I1CA 3WFHB 4X5RA 5ISZA 3H7BB 2EYTB 3K6OA 4X5XB 4U1MA 3Q01A 1U8MA 2FQFA 1WIUA 1E3ZA 3NJXA 2COQA 4U1MB 4BUGA 4LLDB 5E7FA 5HJBA 3UIZA 4XPBL 4BUHA 5DTFA 3US9A 3Q1SL 1NC2B 4CBZA 1CIUA 3LH2H 4LPQA 1HXYA 1CIDA 3QUYD 4CW1B 3B7SA 1RMFH 2OMBA 4GRWF 4QXTB 1FWXA 3RIFK 3VXOB 1M6UA 2A9ML 4PS3A 4UINL 3U6XS 3O4LB 4KY1L 2F53B 3L1GA 4F8PA 1T4KA 4A7VA 2EJ1A 1A3LL 3JTTB 1IAII 1KC5L 4MMXC 1ROWA 3BD5A 1S7TB 3TM6A 1LO2L 3MXWH 2UXTA 3MRIA 4LHUA 4RGMC 5F7EH 2IDUA 4YBQD 5KW9H 1UXSB 5JHLL 5C7ZA 3O6FA 3V0DA 3ZHLA 1JGVL 2QQKH 3IDYC 3T0WA 1EZUA 3TCLA 4JFVA 3QI9A 3V0WL 3LEYH 5JPMB 3AS3A 3ZKXC 3CUPB 4OAWB 5ITBH 3KPPA 4XMKL 4O2CA 3WAKA 1OT4A 2GBAA 4F9LC 5JR1H 1BYPA 3GI8L 2IMMA 4J3TA 3IETB 2Z31C 5FM5M 3B9EA 1QHQA 1FNFA 3K5SA 4N5UA 4ZOEA 2DM4A 4ZW5A 1A1OA 2XY2A 4U1NA 4L8SB 1KBKA 1JZ3A 4L5FH 3VCLA 3PGCA 2FE0A 3UAEA 3CMOL 2QVIA 2OX5B 4L4VD 1JCKA 1UXWA 5FYLE 1SJEB 1A6VH 1U91A 2GJ6E 5HI5D 1UA7A 2XX1A 1WIOA 4QRPD 1IAIL 5CKAA 5D1QE 4L4TA 3ZYIA 2BLFA 2EXYC 3HNVH 4XCCL 3JWDC 3UGEA 2M2DA 1D7FA 3RFZC 3RNKA 1KYDA 5EIQA 5DMIH 2RB8A 2OMNA 1TDQA 5MHSE 5EZJB 4LQFL 5FWRA 1HJBC 1IAIM 4AUUA 4IBYA 3GNMH 4PRDA 2WYTA 3N91A 5JZ7D 1Q38A 4N2MA 5D7JC 5E2VH 5HDWA 3LRKA 5TF1H 3KYAA 2ISDA 1C5DB 3QUHA 1TJHH 4WFFE 5D8JL 2FD6L 3ZQXA 1OANA 1NUNB 3IPEA 2HTLC 4P46C 4NZRL 1JPTH 4XO5A 1CD9B 4IIQB 3GXIA 2OPCA 3QIUA 4FQHB 4RMUA 1MELA 1F18A 4FI7A 1RJCA 4PJ8A 4IKNA 3FSAA 4PJ8B 4HIXL 4XC1L 1JL8A 3T4AA 2GC7C 4HXAL 3U6RA 4LPVA 1CMOA 4R4NC 4H1LH 2F2HA 2K9UA 4UIMB 4ZX4A 4UIMA 3IVKB 2Q76B 3S96A 1XWVA 1EBPA 4RIRB 4JG1L 5F6HJ 3KEDA 5GGQL 4OZ4B 1DSFH 3TYFB 1KTDB 3D33A 4M5YL 4NDMA 4AQ1B 4AQ1A 4HF5H 3P3RA 3MV9E 3DOSA 5IOPA 3BJLA 1AXIB 2J2ZB 4AVHA 5L2JB 3SBPA 2WNWA 2YKLL 4JRXA 3MLZH 1MJJA 4YIQB 2XTLA 1F8TH 3GEFA 1UG9A 5F96L 1NBCA 3TF4A 3GHPA 2FJFA 4PRNA 4QEGA 4YWGL 5IV2B 1CZ8L 3RX5A 3IJSB 2VW6A 4JQIL 4I9XA 1F2QA 4Q0XH 3I6LD 3IRCA 1CD0A 3S3SA 1FBIL 5GS0C 5IVOA 1R47A 1JXFA 1J87A 2A6DA 4Z7WB 4P0DA 1JRHL 1TPXB 2GHWB 2FT6A 3LKPB 1OP5H 3UTSD 2YMTA 3RPBA 3WFBL 4N24A 1TQSA 2B14A 1U3HD 2RFXB 4KK6C 3K7UA 2FJHA 3DYPA 3MKGA 3NFSH 4MJHA 3C6SA 2MMXA 3EZJB 4OF8A 3O9WA 4Z78A 4JM2F 2LU7A 4NQCB 4O02H 4AIZB 1CTMA 4AIZA 1NLDL 3PWJB 3V0VB 3PWJA 1XF4A 3NUKA 3A6BL 5E1GA 4QTIH 1KJVA 1CLOL 4ONFL 4UQ3A 3RVUC 1IKOP 2HRPL 5EV7A 2JMRA 3HZYB 2NXZB 3MFFB 1IAMA 5GRYA 1YUHB 2Y1AA 4MDRA 8PAZA 1NC2D 3BN9C 3POCA 4LLMB 4Q7DA 2W5PA 1N6QL 4ZUUA 4HU2A 2VDMB 4ZUUB 3TLRA 4AM0A 5KZCB 1BZ8A 3IAPA 2Z31A 2KZ1B 4KGJA 2AJSH 3MZGB 3MA9L 4R0LB 1YLBB 3JVGC 5K9JH 1EERB 3Q9QA 5GSRA 4FLOA 2C7FA 1LP9B 4M93B 1NSNL 1SZNA 2AS5M 5J4MA 2L7UA 3GIZL 5TDOB 4OKDA 4TVPE 1SN2A 5F1OB 4ZFZB 4KKBD 3QRBA 5CJ5A 1CFSB 4ZNEE 4OCYH 1BAWA 5BW7C 4P4KB 3ARDD 2IMNA 3GSRB 4OF0A 4KHTH 1Z3GL 4Z0XA 1RJZB 4UM9A 1DL7H 1TTUA 1JZ6A 2X53A 4MA3B 5KSVB 4LSSL 5HYJE 2NX5B 5D71H 4W9GC 5DO2C 1KCRH 1T6VN 4HWNA 5KVEH 3STBA 3OKLB 4U2ZA 2UVEA 5D5MB 1J05B 2VLRA 4KMLB 3DX7A 2A5UA 4KTGA 2H4EA 3BXNA 1I1YB 1DDHB 3VH8G 1JHKL 4FFZA 3C08L 5DHEA 3ZU8A 4DP6X 4KJQD 4HOZA 3PREA 4UZSA 4JPKL 5EIIA 4L3CA 5D2NB 5I66B 4LLVA 4OQ1A 3Q2LA 2C3WA 5DD3H 5E24E 4F37K 5F7MC 4MTMA 5F1NA 2LW3A 2D0HA 3UXFA 1OARH 5F93C 1RZFL 2N1KA 3AACA 4ADGA 5DGRA 1HAUA 2O5YH 1QRNB 1PBYA 3UYOD 3MV7D 1BSIA 1QFUL 5A7EA 2BSSA 4UTAH 1PLGH 4F7MA 4IU2A 2CRMA 4W9DC 3WFDL 1MN4A 2CLRA 3QULB 1XXFC 4HXAH 5FFGA 1DQDH 3PP3K 1V10A 1E42A 3S34H 1T3FB 4AYGA 2VITA 3FU0A 4A37A 1NCNA 3DXAB 3VFSB 4DGVL 1JP5A 2WXMA 4FF9A 4ICXA 4A7UA 4WEEA 3WHE1 2V3FA 3OPZH 2AITA 3BDYL 5J1AB 2CO1A 4OD2B 2W9DH 4Z7AA 4KMTL 4UIKL 4UT6H 2PCXA 4HIIB 2DWEA 5CAYB 3EO9H 4X7SH 3RL1B 3T1WA 3ZE1E 4ELMF 4Z7QB 5CEZE 3BVUA 1MCWM 1TQTA 2ZPKL 2OXGB 35C8L 3GHBH 4WWKA 1MFMA 2H3NB 5AKRA 3X14A 2NX5E 4O51A 1KPRB 5F7NC 2BIMA 3KDMB 4JFOA 4XI5C 4TUJA 3TC9A 1IBGH 4AXWB 2J1ZA 3AROA 2IH1B 1GZPB 2JXMA 2XFGB 1F0LA 2D8KA 3WEXB 3OQRA 1UXLA 3V0IA 4JY5L 3NSCA 4LSQH 4ZUWA 3B2MA 3PDDA 4H8WL 4HOMA 4L0YA 3A6CL 4I1RA 5J57B 2FX8L 3PNWA 2VRQA 1U8CB 2R2BA 3L95A 3LVTA 3PNWB 1P7QD 1QBLH 4FN0A 3HE7A 4UNTA 2FECI 1T89C 3NFNB 3QR0A 4ZI8A 5BXFA 4X4ME 4OCWH 3TIEB 1URZA 1PX8A 2VLKB 2QBWA 5EBLA 3QXUA 4I2XA 4Y4KC 2IGFH 1T1WA 2DLGA 1R0AH 1BEYL 1Y7MA 4PLJD 1BVKB 1BVKA 2R7EB 3US1A 1YPZA 1WBXB 2I07A 1QFWI 4RMWA 3BDBA 1QPPA 3HG1A 5EPMB 3SKOB 5EPMA 4GG6A 2AF2A 1AGEA 5DJDA 5I18L 3LH9A 3H3PL 1TQBB 1RAMA 2R4RH 2XTJB 5GISL 5LCVA 2W1NA 3X3FH 4MCYA 1KB5A 5HJGA 2FGWL 4WI0A 4AUYA 4OLVH 1LK2B 2YD9A 2WP3O 1XB8A 4HDIA 4PSPA 3ZXAC 1H5BA 3MHZA 1G9NL 3GO1H 1W0WA 1KYFA 1QVOB 4NZJA 2FLMA 4E68A 4YHLH 4KTDL 4C54A 4BIKA 3KVQA 3PCYA 5C08E 1E7VA 1YYLH 5DMIL 4Z7QE 1D9KC 4PAZA 1J1OL 5EDSA 2VDLH 3FQ1A 3HAEG 2P3YA 4HIEB 1BF5A 1ZHLA 4HIEA 1KPVB 1FGNH 1C12A 2ZWLT 2YN5A 3B2UC 2HLFC 5EU6E 3L16A 4YHNB 3TA3A 3GKWH 3HBGA 4HLZH 1N6VA 4XH2B 5E8EA 3TEXA 5A2IH 5DJ0B 4OBRA 3ZE0F 4YDZA 3KYMB 2VDQB 1EXHA 1BECA 3L7EB 3MGOA 1G6RB 1JI1A 5MENA 1EFQA 4YFDB 1IGFL 4FMFA 3OKNB 4BDVA 2EC9T 2AMUA 3DO3A 4ESKA 4P2QB 4XBGA 3ILDA 3ZL4L 3LYRA 3TBVA 4GKZB 5I16B 4JK0D 5I23A 4H20L 5D7IE 4XO3A 4FS0A 4WTZG 4UB0L 5B3JF 3MROB 4RGND 3CZGA 5MI0B 4L23A 3BPLB 1E9PA 1UM5L 4WKZA 1T21A 4LPCA 1CTNA 1OCZB 4OZIA 3O11A 1NGXA 3QDGB 3L3DB 3F83A 5E9DA 3ME0A 2YAFA 5DUMH 5EU5A 3V5DB 1T2QH 3EW3B 2V9RA 4LCWB 1AJ7H 1RFDL 2WMPA 3K2IA 5SWSA 3U30B 2GITB 3AREA 4OCXL 4E36A 3F7VA 2FSEB 3KBPA 5AVQB 3KLHD 2W8CA 1K4CA 3P73A 4MD4B 1MJ8H 1G1KA 4PRAB 5E2TH 5IHUH 2VIRB 3HAEH 4MAYA 4EDWL 2V2XA 4HCGA 5E8DL 3QIWC 2B8OT 3IFOA 1S9XB 4XMXA 4QRRE 1CWVA 1FNHA 4F5CE 5AG8A 1RIHL 4CC4C 4DP4X 3ZKND 2HJLB 1JWMA 2PNDA 1TZIA 3W9DA 1N70A 2R2EA 4YHOH 3ULSA 2XWJB 1IUZA 1XQ4A 2EZ0C 3WLWC 3CFUA 4FNQA 4WO0A 3D4YA 3EH4B 4A2EA 1RPKA 1A7PL 5DJ8A 4QXUH 1GGBL 1WWWX 1WFNA 2WVSA 4B95C 3INUH 5F8QC 5TTRA 3WS6A 3QUXA 3RVVC 4CVZA 3S2CA 3VXMB 3P69A 1AGFB 2ADIB 4DP1X 3RTQB 4N9OB 4JKWA 4IQHA 4XAWL 2BIQA 1G7PA 4YFLF 4QAWA 3ISWA 3QNZA 1VACB 4D2NA 1I85C 3OLGA 4PY7B 3V7AE 2R56L 3BZEA 2APBA 1XGZA 1ACYL 2OMWA 4R4BB 3SPVB 5I1AA 2XIDA 4GT7A 2WZPA 4OBSA 4ZXBA 5J6GB 5LXVA 2X7LB 2AERT 1G7LB 1VGKB 3H9SB 3S4SA 4ECNA 5IUSA 1JTPA 2J72A 4PCTA 4PRHB 5E6IA 4FQXA 1M71A 3SGJC 1QYGH 1WBYB 2BOLA 1VADA 2B1OA 2JLPA 3NCCB 5BCAA 5L9DH 2XETA 2VT0A 1WAPA 3QYNA 3LKQB 2GFBB 2BOBB 4ISVB 4BRJA 1TCRB 1EFXD 2ZJSL 3DV6B 4GEJA 4XMWA 3QQ3B 4PJCF 4IOSA 1NIBA 1FFNB 3UTPE 4C59B 2CXGA 3QJFB 5B3NA 2AAAA 2V2WB 1U8IA 1G9HA 1V7MH 3QUMH 3WFHA 3V5KA 4LBEB 3N1QC 5AVRB 1T2JA 2ZIDA 4MB4A 4A38A 5KTEH 4HS8H 4TNWK 3TPKA 1OOWA 1N67A 5A40E 5KSBB 2CMRL 1RIUH 3LRGA 2QPFA 2YEZA 4YBQC 3A4EA 5KJRL 2VR8A 3N1FC 2VC2H 5K9OB 3C5JB 3QNYB 3NPZB 1NM4A 3L3HB 4LLQB 4QHMB 2J21A 5DD3L 2BVTA 1DO6A 3V6OE 3N6YA 3P4NB 5EN2A 2X41A 4ZNCD 2AHIA 3BQUA 3FAWA 3H56A 4PY8J 3VXRE 1JNHB 1RHFA 3SKNB 3GMLA 3UPRB 3VYNA 4OV6F 4MJ5B 1XX9C 2G2NA 3FSVA 3JTSA 3WD5L 3OB8A 3C6EA 1UXSA 3QRFM 5AZEL 5EZPA 1B2WL 2J43A 4J7RA 5GZND 1T66C 2YWYA 4PFEA 4M9PA 4NT6B 5DU7A 1M1XB 5FYLL 3DURB 4ZZFA 1N4XH 3DURA 1AQKL 4S1RL 2PP9A 1K4DB 5MENE 5ITFA 3BQUD 2AJVL 5DURB 5DD5H 4YSTA 1F2XK 1XBRA 2OMXA 2ILLA 4NO0D 5KVFL 2XA8H 2BSRB 2QEJA 1DBBL 4LSPL 5IVNA 2NY4B 3FO9B 5GSVB 4O4YH 5T33H 3BOVA 3QCTH 5AZ2H 3B1TA 5EOCH 2BZ7A 1M7DB 4APQA 2ZUVA 3PQYA 2QQLH 5IREA 3NK4A 3KW8A 1J1XL 4C8XA 3HC0B 2OTWA 1AGBB 3T9WA 2F5AL 5AOKA 1YHPA 1HXKA 1I8UA 3U4EB 1SVBA 1I8KB 2UZYB 4X5PA 1HXMA 4N0UA 2RGSA 2PP8A 2X1OA 1LMKA 4A63A 3W37A 3NCBB 4JO1L 4O2CB 4XVTL 2C9QA 3O6ML 5GXBB 3Q0HA 1AS8A 3F3HA 1I7ZB 2FEJA 3HS0B 5IVZA 2YPVA 1CLYH 4QYAA 3UEZA 4J3SA 3F05A 1OCRB 4K8RH 4JO5A 2XVGA 2GUYA 4B7IA 5T3ZH 1DSWA 3K4DA 4N0CD 1CFNA 3BYYA 2XVLA 4A1IA 1T0MA 1G6RH 3HC4L 1T0MB 2BWDA 4KX8A 1MQ8A 1P84J 4Q9RH 2KLSA 2KKQA 3AG1B 4ZO8A 2LLNA 3CFEA 5J89A 5AQ0A 4ELMB 5TQ2L 2E5EA 4KZEL 2UZPA 2J4WL 2X42A 5EZJA 1NIDA 1QTPA 2APWA 2ICCA 1UKQA 5D6CB 4XAKE 3CFBA 4JREB 5JW4N 4OJDH 5EN3A 4RAVB 2MQGA 5JIKA 4NDMB 1L0YA 4BWUA 2FBJH 2IWFA 2EH7L 2ORBH 4ERSH 5I8CB 3MRNB 1QFWH 1JYXA 5HYEA 3KGSA 5FGSA 4BGLA 2VL4A 4YWGH 2W60A 4LESA 1CE6B 3VFPA 4I1NB 3FK3A 4JRWA 3T4AB 2HKLA 3DO4A 3I3DA 5JIDA 4HALA 1PZUB 5E5RB 4G6KL 4KROC 1AO7B 1FVDA 1G9NC 1HNGA 4GRWH 1QFWL 1AR1D 4U0QB 1BJ1J 3WEAA 1KWGA 5E8NA 3ZT5A 3DSNA 2QGBA 5GGQH 3X1NA 4LDOB 3BDYH 4ZFFB 3Q5OA 1YNKL 5HHNB 3QT2A 2J2ZA 3TTSA 5L2JA 5BZDA 5GJTL 2PETA 2YN3A 3U0WL 3DGGB 5ACZB 3V10A 1R9FA 2G3MA 3NK3A 2WW8A 1X4ZA 2FJFB 2VXQH 4X6DE 4FCHA 3MUGA 3BVNA 3MUGB 4PJXB 3VFUB 2P1YA 4F7CA 5FA3B 4JO3L 1A3RH 3MRKB 4YGVA 3V6ZB 5C3IA 2V2TA 2X6MA 2Z1PA 4OI8A 4PS4H 1XH3A 3KGRA 2PKDA 4LLMA 4Z7NE 1OVZA 2QHRH 2NCEA 5HI3D 2ZD0A 4M61B 4MNGE 2Y69B 4G9FB 2J5LB 1MQKL 4X98A 2VXTL 2E6QA 3ZY7A 2WLJA 3IFLH 4I13B 3CHSA 4X4YB 2HXAA 2P8MB 2OA9A 1MXDA 1Q1JL 2JKXA 1RERA 2GSIB 3HAEA 3OVUB 2HT2C 1ZHNB 1OSZA 3MO1B 3QEQE 5EF2A 1U3YA 3QI9D 1JGDA 1JOIA 3QEGL 5EU3A 4F9PC 1VENA 1ERNA 4KKZA 1EV2E 5FUZH 3L9EA 1E2WA 2D7NA 5TDNA 5KYWA 5T1LA 5EO0A 2CIKB 2ZUQC 3HHRB 2VXVL 3IN2A 3I84A 1OQXA 4MQ7B 3W39A 1T83C 4Y0GA 2BK8A 3IBOA 3QZWB 2IPTH 4FLRA 5CGYD 3WKML 2IPTL 1G4MA 1MCOH 1OP4A 1ZT7A 4Z0XB 5CJQH 3QUMB 2HN7B 1GOHA 5KVFH 3C5SA 4W6WB 4ZMYA 2ARJQ 3WDHA 1WHOA 4HC1L 2GSMB 2ZE0A 3L4WA 3D39D 5DEFB 5FS5A 4GFTB 4HQQL 3AQDA 2GJPA 3H2WA 2IXQB 2XV3A 5F7YC 4BA0A 1LP9A 3BXNB 1IGJA 2BSEA 3IU4L 2ZNXA 3GLEA 1AYRA 3CPLB 3L3OB 4PRPA 5C0NC 1RZ8B 5HDOA 4KUZH 4EI5D 1KYUA 1KSRA 2ICES 3T0BA 4JRYA 3BVWA 2BSDA 4N85A 3QZMA 3MRQB 3WNNA 3RA7H 3DPBB 3TO4C 3BWAA 4D9RD 3JWOL 1FL5B 2Z35A 3LMJH 4F8TA 4UM9B 2NY1C 4J3VA 3BPNB 2GC4C 3K71A 3IDMA 2BSSB