5DCCA

X-ray crystal structure of a tebipenem adduct of l,d transpeptidase 2 from mycobacterium tuberculosis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
352
structure length
352
Chain Sequence
DLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Structural insight into the inactivation of Mycobacterium tuberculosis non-classical transpeptidase LdtMt2 by biapenem and tebipenem.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 89
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dccA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dccA02
5DZJA 4GSRA 5LB1A 4A1IA 4XVOA 5E5LA 5K69A 2HKLA 4LPQA 5DCCA 5DU7A 4QTFA 3U1PA 5DC2A 3TURA 4ZFQA 3U1QA 4GSUA 3VAEA 4HU2A 5DVPA 3ZQDA 3VYNA 2MTZA 4Z7AA 4QRBA 4JMNA 3TX4A 4A1KA 3ZGPA 4QR7A 4JMXA 4K73A 4A1JA 3VYOA 4QRAA 5D7HA 4GSQA 1ZATA 5E1IA 4LZHA 3ZG4A 4A52A 3VYPA 1Y7MA 5E1GA 5DUJA 5E51A 4HUCA 5LBGA 5DZPA
chains in the Genus database with same CATH superfamily
1UB6A 2BSSB 1Y0LA 5ES4B 2WIMA 4PW9A 1QBLH 5E8OA 1O75A 3QIBD 4RWYL 1F4XL 4MMYA 1RHHB 2W9EL 5D7SH 2DQJH 2MPAL 1ZT1A 3LZRA 5TDNA 1I9RH 3CZSA 1E9QB 2Q86A 3GMNB 3D09A 3ZE2E 1LO5B 1E4XL 4X9GA 1OP3K 3GMMA 2PP8A 4YHKH 1E42A 2RFXB 1WLHA 3O6ML 1S8DA 1U2YA 5ALBH 5F3HA 2EDMA 1YRKA 2F53A 1YECH 4LRIA 2E59A 4BWUA 1G6RH 4XMKL 3HZ3A 5LUMA 4LQFL 1KBGL 5DJXA 4AL8C 1S7TA 3M8OH 1L7IL 1RJYA 2CIIA 2XZZA 4HPOH 5FK9A 3DPBB 2WTOA 2GQHA 1J1XH 1CI3M 1CXIA 2IBZX 2O6CA 4AYMC 4ZW7A 4HS3A 4QXUL 4FNLH 2ITEA 3IDNA 3LB6C 3S37H 3SBWC 4BFIA 1NGXA 2OSXA 1QUNA 1JWUA 5JZ7D 3P3UA 1I75A 3SKOA 2FYVA 3JV4B 3F6IA 4PJ8C 5IQOA 4JFED 1EQWA 3SE6A 5KSBB 2EXWC 1LO3L 3GRWA 3OR6B 5F9WB 4J4PD 1W9XA 2BNQE 2AITA 3DYPA 1T0NB 2Y24A 3E3QC 3SBPA 2P5WB 4AE1A 2BZCA 2YAFA 5H37G 5J89A 1OK0A 1F4WL 3GKWL 4XNQB 1J88A 3V0GA 3GXDA 4XE5B 3D3VA 3U9PH 4OBRA 3WTYA 3A0OA 1EA9C 3BVVA 1TLMA 3L9RA 4LB8A 3HVNA 1PLBA 3W1ZA 3W39A 4JZOB 5T1KD 2KQMA 1XBDA 3QFJD 4PCSA 3F5WA 1KY6A 2OULB 3QW9A 3HHMA 3B3IB 4NWTH 5LBSL 3OTTA 4NQED 4XP9H 3ARSA 1DVXA 1T5XB 1EZVX 1ZS8B 4MA8H 3BQUA 5LNEA 3KE0A 3FUEA 3DA0A 1A6WH 1QI4A 3OGCB 5EORL 4BK5C 4N0UE 4EQ2A 5I74C 1ETZB 5D1XE 3VD9A 3A22A 4AZUA 5EF1A 1NICA 2R4SH 1TQSA 1WISA 5EEUA 3DJZA 3SDYL 1MXGA 1Z9SA 5AZ2H 4EDXA 4LNVA 3T0AA 4I0CC 5FV2A 1X5MA 4OB5L 3UG4A 3TJEL 2GJZA 1MI5D 5IEKB 1N12A 1GJWA 3FONA 1BJ8A 4OGZA 4E5XB 1CXEA 1WA1X 4LCVA 1BZ9B 1DL7L 1GHFH 2VSMB 3QR1A 5CJQH 5E00A 1PLAA 1BDYA 3C5ZD 1N0XH 2NY6B 3NIGB 3PABB 4GFTB 1FIGL 2X3CA 4RAHA 1OAQH 3UBXB 3AZUA 3GEFA 3QUMH 5B38A 3T0EC 1NC2B 3VFOB 3WY1A 3DXAB 4BCZA 2KLTA 2NNCA 1WA2X 3O41B 3CN0A 1HEHC 1ZXQA 2VL4A 3S34H 3G08B 2OX5B 4ZFZA 2ZNXA 2X4SA 3DIDA 4N2DA 2EXTA 3GJFK 3MBEB 4KX8A 1XD1A 1ZANL 4P9HC 4YGVA 4KZ0A 4RWHA 2X4RB 4PLJC 4UBDC 2D7PA 1IAIL 4J3OH 5AYUH 3KLAA 5J1AB 2NQ3A 2QPDB 5SWZD 3X12A 5AD0B 1XTLA 1V3JA 1N6QL 2WXPA 4U2ZA 4WHCA 3PQYB 1ZHBA 3B8YA 1NCBH 5DHEA 3IRPX 4KPHH 3GSRB 2VISB 4Z7VB 4Z7WF 2QQKH 3MRPA 5F97E 1IC0A 3ZHLA 3ISRA 1CFNB 2R2HB 1MCIA 4HBQA 2DQUL 3AC0A 2GCYA 1UZ8B 2BP8B 5A2JH 2P28B 4Q7DA 1Y18A 5IV2B 5FUCC 3PGDA 1M2VB 5DJ2A 2C3WA 5ADOH 5HDQL 3RX5A 1XIWB 4EOWH 4MJIA 5J1SC 1F56A 3X13A 1FV1B 4FQ1L 2A9CA 5IVOA 1A7QL 3FQWA 3U9WA 3SKMA 3DX8A 3FO9B 4JFFA 4YR6A 1Q1JH 1KPUA 5EEVA 1X9RA 3LEVH 3MU3A 3US0A 1MJJB 4FXTA 5HP5A 3WEAA 4YLBA 5E51A 2VIRA 1E90A 1F00I 5CINH 5DQ9B 4IRSD 2P43B 1FFRA 3EGDA 4R90L 3JTSB 4RRPA 1TTFA 5JHLL 4UV7H 5MERB 1U8IA 1XL4A 1QZNA 5HYSB 1I8MB 2ODIA 1GZPB 2YA1A 3WFEH 4NIKB 5BMFL 3O3DB 4FQ2H 2ZWKA 3MOAL 5FAAA 2OKMA 4ONGH 3V6OA 3W2DL 4JMNA 4P57B 4LSPH 2XFGB 3EO9L 3MRLA 4FG2A 3CMOH 2GEEA 2XFXA 3MRQB 4WUUB 1OT4A 1A6VL 4DP5X 4G8GA 3ABKB 1VZHA 2R69H 1RH8A 3R1GL 4JFDE 4HFWA 5E08H 3UTQB 1JV2B 3C6SB 1YEHH 4FFTA 1H15B 2D3JA 3NFSH 2DQIL 4NQSB 4JO4H 5C6TL 4QHKI 3MRDB 1C8PA 3GMLB 4FKEA 3KPRB 2YS4A 3DRQB 4QTIL 1UENA 1I1RA 2BVOB 2Y36L 4K3JH 1CIDA 3QZPA 4Z95H 2CU9A 2OP4L 2V7NB 1KXTA 3SQBA 3UTPE 1IGTA 3O4OC 4TUJA 4BH7B 4WIQA 4NXSA 5MHSE 3BN9D 3LH9A 1EX0A 3RPIA 4J3XA 1P5UC 1BW8A 2Z7ZA 3BVDB 3KXFD 4ODXB 4X6BA 3K2UH 3SQOL 4JK0D 1T0MB 2CQVA 1UHVA 2QADC 1UVQA 4LRNL 4XP6L 1WFMA 2N1KA 4W9KC 4UQIM 1V55B 3NPSB 4RISH 3UZEA 3D85A 5FA4A 2UZXA 1JF1A 3VGAB 4XMVA 3ULVC 1ITBB 2N01B 1JNHA 1MRDH 3ELAT 4MQ7B 4HMEA 1L7TL 3GLAA 3BVXA 3PWPD 3QNXB 5FGCE 3V4LA 4E41E 4I8DA 2GI7A 4M62H 2FIRT 5ITFA 1YNLH 2F74B 1A9BB 5F9OL 4DERA 1XCTA 3TT3H 5ERWB 2Q6WA 2ICWI 1UEYA 5T1MA 1A6UL 3WENA 3G3LA 5F7FA 5KYXB 4UDUB 3QWRA 4LGRB 5C2UB 4MNGB 3X1GA 4GAJH 2IFFL 5DJ8A 4R4BB 4B27A 3GUFA 2BH0A 1Z5LA 1RQ5A 5IF0A 4PJDA 2P24A 2DH2A 4XVTL 1CF8H 4EXKA 1AKJB 1A4KA 4N2EA 1NCNA 1YMHA 1L6XA 2DEYX 3D87B 3I9AA 3ULSB 3BHBB 3CXHJ 2FGZA 4XMPH 2J5WA 2G5RA 3JSSA 3MPCA 2GITB 2OMTB 3TLRA 3WIFA 5CGMA 3X1EA 4HJTA 2XHNA 4D94A 4JY6A 3GD1C 4XO5A 5D7KE 4MRCA 4RMWA 4LHUB 3P4NB 5GS2H 2HAZA 2LLLA 2NNFA 4ALAL 3NP4A 1ACZA 1UM5H 3ZT6A 1IGCL 1UM4H 1W8EA 3KWWA 3OHXA 5A2LH 4GKZB 3W81A 2CGYA 4YBLB 3HG1E 4YQXH 3DYOA 2YPVL 3SE3C 1YNTA 2ZJSL 3F62A 2E9BA 3JXAA 4PJ8D 4Q56A 3QJRB 4Y2OB 5D72H 1BD2A 2EXWD 3RIKA 4GP4B 2V2WB 2FGWL 3OAZH 2X9YA 3QDME 1NPJA 2VLLA 2B4CL 4L8SC 3F2LA 2A1WH 5KVFH 4TNVF 1HXYA 3MCYA 5E5UB 4UDTB 1H8NA 2FEEI 3CUPB 3L3HA 4YMPA 3FUHA 1FSKC 5AQ0A 3L5XH 2W59A 3HKFA 3UJIH 3B2XA 2PPEA 4P5TB 1T1XA 1KEGL 5DHMC 2WXKA 3PL6D 3KL0A 3OAUH 1P84J 2A0LD 2C1PB 3H55A 5DVLA 4NP9A 3UTZB 3K6FA 3ZVVA 4E9YA 4OD3L 1HL9A 3AY4A 2MWCA 1YEKL 3BFQG 2RAMA 3DSNB 2F0CA 3KYNA 3ZGHA 4WJKB 4AY0A 2DRUA 2I85A 3QEQD 3S4SG 5ACLA 1A14H 3IE4A 4ODUB 3KLHC 3AWGA 1CG9A 5GRZA 5F9JB 3AAZB 3B9KB 2H1LM 1PF3A 1IFRA 3VRLE 1QLEB 1O6SA 3HI6H 4KK9C 2WM0A 2V5YA 3FB6B 5DZLA 2X4OA 1TTRA 1AACA 1HQ4B 2DW5A 5IROC 1PBYA 2VDKL 1MFDH 3WXVL 3K0WA 2DMCA 4UI2A 4Y4HA 3LV3A 4HETA 1AZZC 3V6FA 1M6UA 4HQQL 1QBAA 3U4KA 3KR3L 4FOMA 3ZN6A 1QYGL 2NY2B 4CBPA 1MHCB 2ZP9A 4XPFH 2HJLB 3WDJA 2QHLA 5HI4C 2JKRM 5C7ZA 4ZTOL 1W16A 2VJ0A 3OKLA 4TPRL 3S9DB 4X0KB 5KYYA 4LSVH 4WRLA 1KBBA 3H7BA 4HOWA 3F7LA 4HGWB 5DRZB 2TAAA 1ND0A 2N56A 3BVNB 2LT9A 3TV3L 2N0KA 4YDJB 1XH2A 3FCTA 3IAQA 1S9WB 4JPSA 5FYKL 1ODUA 2F8VA 2P8MB 2YARA 3CLFH 1T80A 3GMPB 3GB7A 4M56A 1JUFA 4UTBL 5EOCL 4CC0A 4JM4H 2VSKB 3I3BA 2Y1VA 4R5XA 1W15A 4GQRA 5C0CE 4UBDD 3A4EA 4L5FH 5A6LA 1QKZH 3O3EA 4WFFD 3MCLH 5DS1A 1HH6A 4JE0A 3RWJA 4KDWA 4EXPX 3FQ2A 5K1VA 4M8VA 1K85A 1REIA 1V05A 4XMZA 4XRCB 2EDOA 1Z9PA 4IBVA 1E6JH 1Q9WB 2ZYRA 4B7LA 5A2KH 4BRVA 1M53A 1F45A 1GYAA 4P2RD 5B8CC 3NCCB 2CCVA 4HLEA 3PWJA 4AG4H 2WBJC 3LH8A 3BWUC 4MQTB 3VW3L 4NSKB 2MCPL 1QAWA 3EYUH 1CVRA 3RU8L 4X4ME 3UYOD 1FI8C 2UWEB 4LCIL 3TFBA 1VADA 1KMGA 3L4ZA 4Y4KA 4PJHB 3D25B 4TUUA 3C9NB 4AQ1B 1LO4L 1T1ZA 5GGQH 4XX1E 2LHAA 4EUPH 4BKLA 3IFLH 4HOMA 4CC4A 3IDUA 3QA3A 1R4XA 2MOVA 1ORQB 4JQIL 3PNWB 5ESQA 3C6LB 2V33A 4HWUA 4FA7B 1SJMA 1D9KA 3HNSL 3EO0A 4XNUL 3D33A 3S35X 2GK0A 2NXZC 5IB5B 1W8OA 4Z8FH 5E2TH 1IJNA 4MAYC 2WLYA 2I26N 3TYGL 1ULVA 2Q3XA 3KEHA 3ILQC 4NUPA 4ZUTA 5MP6H 4AWJC 1AGEB 3U0TA 5AVXB 5C9JA 2OR8A 3BLPX 4NUQA 4XXWA 3O2DH 4DW2H 1W91A 4WDIA 3STZA 3ORJA 3WO3B 2VR3A 1U95B 1IARB 1X7QA 3ARFA 4W9DC 1RJZB 3JT2A 3S2AA 2Q7AA 3EH1A 3K4DA 4F93B 1PNCA 5EZJB 2XQYG 3TZVC 4UM8A 1TVHA 2Y5EA 1MJ8H 4NUGH 2AKRA 2HLAB 3IMVA 5DU7A 1UA3A 4PRAA 4YE4H 2CKBH 1RZKC 4Y4FD 4PV8A 4AXWA 2PPFA 1KYFA 1WO2A 2MFNA 1FNAA 3HG0A 1M6OA 2PO6A 3Q6GH 5C0RH 5HGBA 5I1HL 2C4FT 4OJCA 3VCLB 2YR3A 3IFPA 4HH9A 2FJGA 2D7NA 4BHUI 2WBWB 4NZTH 5I6OA 4EZKA 2FNBA 5CILL 2V37A 4PJGA 3R7QA 1ID5I 3LEXA 1TPXB 4KOCA 3OJMB 1ZS2A 3BDBA 4XHQA 1EDHA 2PTVA 3VX1A 2XWTA 3L3OB 4X5LA 2XWJB 9CGTA 2EABA 4JJ5B 3GS4A 3IGKA 4PHXA 4P4KA 1KEMH 4LESA 4WQOA 4YOKA 1PKQB 5GHWH 4BV1A 2G3XA 4X6EB 2HKHH 1IJ9A 4FFWC 3T2OA 2E9WA 1PSKL 4Z7NB 3T77A 1WWWX 3SHSA 5KVFE 4P3CL 5E94A 4BQ9A 2YMOA 2YFNA 3QORA 1Z2KA 4PP1D 4U3SA 2ZUVA 1SJHB 3DX6B 3NSCA 1M71A 3Q01A 5T5FA 5I5RA 2R8SL 1CPUA 1E67A 5DK2A 1KIUA 4HX1B 3D39B 1JZ8A 4MSWB 4PN6A 4FP8H 1PY4A 3OXRA 1H5BC 3CVHA 4BH8B 5KBMA 4ZX5A 3K91A 4WO0A 5DDHB 1JN6B 1SXNA 2GIXA 4LL4A 4NKOA 3QIBB 5LWYL 1TZAA 2VMEA 2PTUA 3QZLA 4XGZB 4AYEC 1I7TB 3CFQA 1T7XA 2NY7L 3OPUA 2DLFH 3VM5A 4FFVD 4RAVA 4Q0XH 1IVTA 2VLMD 4F3FB 1H0DA 4GSXA 3GJFB 5JORB 2WUCH 4DEUA 2CBPA 4DP6X 1WGVA 2J2ZA 3QXWA 2A9MH 3FQUA 4NO3A 2R1WB 2J8UE 4JCWA 3C2AH 3ZL4H 5BRZD 4KUZL 4UNIA 1JRHH 4ADGA 4BSJA 3STBA 4M6OL 4W4OA 1PZ5B 3HRZC 2WIIB 3WIIH 3TVMD 2GC7C 1GC1C 5HI3C 5CFAA 2A6DB 4LCWE 2WNXA 4PGBA 4C55A 3ETTA 2UVFA 4P59H 4HIXH 1ZLSH 3HC3L 4QHMB 5EU5B 2X2IA 3GBMH 4FZEH 1HL8A 1U3ZA 4JRWA 3S36H 2ZF9A 3HA0A 43CAB 1UB5A 1MF2L 2Z3FA 4BYHA 2MOGA 3LD8C 3EH2A 2ADFL 2ZG2A 3HG3A 3VFRB 2VDLH 1TT6A 4PY7A 1HL4A 4LBAA 3OR7B 4UZSA 3IDGB 1SLXA 1IT9H 1EDQA 1FHNA 2AV7B 1J8HE 2CLRB 4JFEB 2Q0ZX 4TSCL 3M1OA 4ZMTA 3QXDA 3N43F 4TOYL 2DQJL 2WWKO 4PTTB 5DO2D 2VXQH 4DPBX 1I9RL 1JV5B 4U7MA 5C0EA 3A3YB 1SLVA 2H9GB 5LG1A 2ADJA 4I9XA 1N8ZA 2FSEB 4RZCB 3ZE1E 4AUUA 4LF3A 2VL5A 5DFWH 2Q5BA 1KCBA 2CMRH 3A24A 1Q0XL 4KNTA 3L95B 4LLAA 5ALBL 5KSUA 5I75C 2FD6H 1YECL 4KU1A 3FO2B 3VE0A 4ZMZA 1M05A 1DQMH 1E5AA 3MNWB 3EXLA 5T1KB 2DIJA 3HZVB 3QFJB 3PWUA 1T1YB 4G8IA 3M8OL 2DQFB 1LLAA 3EUDA 5JIMA 1NLBH 2J6EH 3CDZA 1Z66A 3M86A 4PJ9A 4NQEB 4HAKA 4KK9D 3FCUB 4DQOH 2BSED 3MJ9A 4P2YA 1Q9OB 2OXHA 5DF0A 4QGTA 5IROD 1ZVNA 4FHJA 2HKFH 4FNLL 3SYQA 4WI2A 1JS4A 2XRAH 4GMSH 3S37L 3GEWB 5IQLA 2YGOA 4PRID 4HUKB 1BFVL 3QJHB 1MCLA 1DDHB 1MI5B 4MB3A 1KLGA 3QHZL 3CFCH 4XN1A 2GY7B 4EQ3A 1NAKL 1FO0H 1YYCA 3VH8A 3BXNA 2Z1KA 3C5ZB 5FFOA 1DBJH 5DUPH 1TEGA 1T7VA 4Y1SA 3S2CA 4TN9A 3QQ4A 2QELA 5D5MB 1AGFB 4GMTH 4WWKD 2C7FA 4O02B 2YAPA 3ARGC 3B5TA 4KKNA 4FNRA 1T7WA 3BH9A 2AV1B 1Q9KB 5G5DB 4D7PA 4I18C 1UD5A 3V4PA 5CF3A 3IGLA 2CO6A 4X4XB 3UYRH 4GW5A 1PEZA 5FOBA 1WYJA 4GI9A 5G4MA 4CSTA 4X4YB 1GGYA 4ZX6A 1GSKA 4Z7UA 5F7WC 4B3EA 2ZT9C 4NT6B 3BSZA 3CFMA 4NENA 4MA8L 2OSWA 1WZKA 1SBBA 3HRPA 3H6JA 3UAJC 1A6WL 3ZK0A 3TEYA 3UYPB 4LCCC 3JV5A 1KB5B 2WBJD 2R4SL 2ITFA 5SWZB 3UTSD 3DIVA 1AE6H 3DGCR 4BE5A 2K6WA 4ODHL 4F9PC 4QRUB 4WWOA 3L4UA 1DUYB 1BYOA 4B9GA 4PR5A 4TTDC 2BVYA 1IGJB 2FZ3B 4FTDA 2IWFA 1SMAA 1XGTB 2KI6A 1BG9A 4CSZA 1AXTL 3EJYC 1VDGA 3QI9D 2WQSA 4LKXB 1GHFL 4YZWA 2QV4A 1KIPA 4PJBA 3NSYA 1IC7H 3MFGB 3DVNA 4XP1L 1B3JA 4D8PB 4FQQA 5FDWA 2F54D 5AW9B 4XH2A 4F7TA 5I9QC 2FX9H 2NXZD 2LE9A 4EBQH 3GRBA 3K8MA 2XG4B 3U36A 5I2IB 3ARBC 5J9PA 3L7EA 1D5MB 2WV3A 3ILQD 5C09D 3ZKNC 5K39A 3KPOB 3S34L 2LFEA 4JY5H 1J5IA 3RVTC 3ZDWA 4X8JA 1EJFA 1XCXA 3HKZA 4JKLA 2VWEC 5ESVA 4GW4A 3BP6B 4YHOH 4RMTA 3IU4L 5AYUL 1KELH 2OQJA 5HGAA 1ZD6A 4L1TA 2BSDA 4IRSB 4PJDF 2PETA 3TZVD 2WUBH 1AANA 2ILLA 2DV6A 5I6MA 2CXGA 1SDDA 2BNQA 4XNBA 2IXQA 3LNIA 1NCBL 2H26B 5B1AB 4KO9A 4JG9A 2A6KA 4I5BA 4MHHG 1N0LB 1QLRA 4G1MA 1I8LC 4XVJH 3PWVA 5E24E 1NKGA 3UAAA 4JQVC 3NCBB 4XOBA 1A9EA 1ZT7B 3MVSA 3NQIA 4KVCL 3CIAA 1T66C 4FYQA 5GZNA 4KI5F 2D7QA 4NQQA 5I6XC 1WFIA 3EOAA 4Y8AA 1ZOXA 4IRZH 1HSAB 1MWAH 2UY6B 3G5XB 4KRPC 1TVBA 4EOWL 4ADIA 1YNTF 3VXTB 3ZT7A 3LZFL 3LS5L 4PWEA 5T8IA 4N0UA 5DJYA 4JDZB 1B4TA 4PREA 4FFYA 5C08E 2MCG1 1Q1JL 2OL3L 4DESA 1T04B 3ZG4A 3P73A 1BF8A 1E28B 2G30A 2YLHA 2AK1H 4PV9A 4GG8B 5I18L 5E6ZA 4XR8C 1KG0B 5I17A 1GYVA 3IU3B 1AZNA 3KXFB 4NN5C 5DZOA 5CINL 1Q94B 4L8CB 4FQJH 2L8AA 1SLWA 3CPUA 1T89C 4GAAA 4UV7L 3E9UA 2AQTA 4U1IA 1PJ9A 5DEGB 4FQ2L 1L9PA 1YEGL 4LAJH 4PRBA 4XO9A 5DJCA 1NH6A 5GQBA 4ONGL 1FGNH 2W60A 5C0AD 3UO1H 3H3BC 2WBKA 1NCAH 2ATKA 5D7JC 2BOBA 4YHMH 5E8PA 4AM0Q 3AS1A 3PWPB 2GJ6A 4QKXB 1K4CA 2GKIA 2NLJB 1ETA1 2HB0A 2R69L 4OD2B 4AIOA 1QI3A 1ACYL 4YK4B 4NPKA 4GW1B 2YA2A 1UH2A 1YEHL 5AL0A 2VR4A 2QEJA 3NFSL 4ETYA 4IW4C 2OFQA 4KITB 5HPMA 4Z7QB 2FEJA 3B6SA 4K3JL 5SX5H 2LU7A 4Z95L 3L3KB 4PG9B 4FFZH 5LKNA 1I3UA 3HLAB 3L16A 2ICWB 3QXVA 5IQ9B 5JNYA 1HNGA 2FLBT 3U0WL 2ED9A 5DHVB 5LGJA 3AQYA 1D5IH 5HHMD 1AP2B 5HI3D 2WLMA 4PRNB 4Q9QH 2AJXL 3OKOB 1XHHA 1Z1WA 4W70A 1NFDB 5I1EH 1XGUA 5FGRA 4U1LB 1UEMA 3PV6B 5EULV 5LAXB 3H2WA 2YBRB 2PWGA 3KYKH 4PGDA 1NANI 4PRDB 3SDDD 5TDOB 4RISL 3TOPA 1MSPA 3VG9C 3WEBA 1MWOA 1P7BA 4OGQC 2JJTA 4U2YA 1FBIL 2V17H 4YN3A 4WENB 4LDCA 1B9KA 4TVSa 4GRWB 3IFNL 4G6MH 1LDSA 1HX0A 1U3HC 2VLJD 2V4LA 4PJ8B 5JMRA 2EUXA 3PE9A 4DUWA 1E3ZA 1KJ2B 4G7SB 3TT3L 1X7TA 1KLFB 1SJEA 1M7DA 4UB0H 4LVNC 2BIMA 3ECWA 3F65A 4NQVB 1IL1B 2ED6A 2AJSL 4PIBA 1C5DA 5B38G 1P69B 3PL6B 1P7QA 5CHNB 5IW1A 3NN8B 2E86A 3FBQA 1J1PH 4P2OC 4XMPL 1OZUA 3VDCA 5JO5A 2XWEA 5DR5L 1DN2A 1VSCA 3DOSB 1DJYA 1GCFA 3OLEA 1IAKB 4RMBA 4TVPD 3PJSA 5DRWA 4AUYA 1HC1A 2VAAB 3QEQB 4FCHA 4L3FA 3CDGB 2CO1A 3WFHA 2HKLA 2D0HA 4ZO8A 4N1EA 1UM5L 1KJVB 3IWVA 1GZHA 1QHQA 1RUKL 4JFDA 1UM4L 5JQHC 4OV5A 3UPRB 3MROA 2EDTA 2OZ4L 4FX5A 4TNEA 4RNRA 3VFWA 2VNCA 4QXVA 4KMLB 1WD8A 5D72L 1TFHA 5JPNB 3OWEA 3LKRA 3MLWL 2HLFC 2LFGA 3B34A 3HS0A 4CDGC 1MZZA 4R26L 4ZUVA 2NY3C 2EDJA 1XF1A 4YPGA 1CGTA 4JFPA 5I1CH 3L5XL 2VQ4A 5JW4R 1MVFA 3TN0D 3UJIL 4XBGA 3MNVB 2X89A 1UTDA 3PGCA 3QIUA 3VXPA 3ULUE 2QSVA 2WYTA 4KKCD 1NBQA 4U1HA 4JHUA 1PCXA 1WBXB 4LSTH 4DO4A 4ENEC 1UA6H 2GJRA 2C9QA 2L04A 2BDNH 2G75A 4PJGF 4E41A 1HHKA 4LOUC 5GJSL 4TL4A 3AWEA 4WY7H 2BIQA 2EYTA 4JFYB 5FYJL 3B56A 4ZBJA 1SYVB 3GRWL 3BQUD 3LEYH 4L3CA 3VGHA 3RWCA 5I8OH 4NJ9H 1VJSA 3VDBA 4PGCB 1RKRA 4PRPD 5FYLH 1TTAA 4ZSOB 3IXTA 3BVTA 4QY8A 1UCBH 3EJYD 2LAAA 5KSBE 5F3BB 4GBXA 2JI1A 2LOEA 4MWFB 3D07A 1S9VB 4NCC2 5L4MA 1P6AB 5KN5A 1QZ1A 2Y7QA 3CFIC 2KUTA 2J8OA 2YPLD 2WINB 4OZGE 2P5WE 4XPFL 4K07A 3S3SA 3FTGB 2VZOA 4RIRB 4XB8A 1RLWA 5DLMH 2G9HA 1NEZA 2HVBA 1AS7A 4DKTA 4LSVL 1P5VB 4JVWA 2IMNA 3H9YA 1DBBH 2PF6A 3TJHD 3ARBD 3Q8FA 4Z5RB 5DCCA 3CZUB 2OXGA 3KYOB 1VCAA 2XV0A 2D0FA 3EFDL 1Q9LB 3PY9A 5AUMA 3KPPB 2LTQC 2GSIA 2XNAB 3RTQA 1A6ZB 4JM4L 5F71A 4PJIB 4LPCA 2XDHA 3HG1A 2BS71 4L5FL 1QKZL 1X6NA 3GWJA 3MCLL 1SBSH 1RUQH 5C7XH 2GPZA 3A6CH 3S4SB 3CD4A 2X4PA 3B5HA 3QDMA 3TT1H 2XVBA 4FABH 2VLRE 2ZD0A 4Y16C 4WU7B 4P5MB 4X7FC 4KDTC 5H8DA 1KTJA 1OE3A 4DP1X 4HUXA 1ODAA 3EYUL 5I1JL 4P5KA 2FWUA 1UKQA 2YXMA 1T66D 4P5SA 1OSYA 5ETUA 4XN4A 4Y4FB 1TZGL 3NIGE 2OTPA 2QGBA 3U1SH 4MJHA 5I0YA 4ELMF 2ICEA 3JV6B 2MMXA 3IFLL 4IHOA 5FLVA 4QEGA 2CGZA 5E9AA 1SEBA 4HXBH 1H6EA 3DXAE 1M1XB 2H4EA 1FZKA 3L6FB 4QCIA 1SY6H 2FBJH 5IHHA 3CV5A 4Y5YA 3HG4A 1DE4A 4ZPVB 1X44A 4QXGH 2ADIB 3O4OB 2ZWNA 4J23A 5E2TL 1UH3A 4A63A 4JDEA 2IPKA 4LHQB 1E9PA 3UJTH 1U93A 1P5UB 2HG5B 3ALXA 1AVAA 3MRIA 4OFYD 5AAWA 3UMTA 2OYPA 1LK2A 2QSQA 1UXSB 4U33A 5TH2A 2TSBA 1A6AB 1GS6X 2ESVE 3ML9A 4B96A 1WBYB 4NO5A 3V79C 1QRNE 3P1VA 3ZY7A 4A7GF 1TYJA 3ZDXF 2IOIA 1GAFL 1WICA 3BUIA 1JDCA 5F0LB 4UYQA 5HGDA 5T5NF 3BMVA 1QNZL 3BUPA 4Z7VE 1AO7E 1I9JH 1ZMYA 2N1TE 2P45B 3CDFA 2YC1A 4YBQD 5D7JD 4UT7H 4N5ED 1MW0A 25C8H 1MJ8L 4NUGL 3HE7C 4AJYV 3E6HB 1DFBH 2CDGA 1EXUA 1HOCB 4PJEB 4Y2DC 4D0DB 2J56A 4J8RB 2CKBL 3ZTNH 2F19H 3DV4B 5I26A 3MAWA 4QO1A 1YZZA 5C0RL 5I19H 2WTPA 1IKNA 2Q7YA 4RFNC 4M7JH 1KCWA 3HE6C 4OI8A 3Q0HA 4LP8A 3RY5A 3TWCL 4RGOL 4GKSA 4MMXA 2ITCA 1GR7A 1LDPH 3E0GA 1CK0H 5C0CA 2ATPB 3DJ9A 4ZW3A 1U8JA 2IC2A 3IJSB 2AVGA 5L88H 1KCLA 4GLRH 4OM0H 3BIAX 2J4WL 1M56B 1OF2A 1LWHA 5JDSB 3MFFA 4N0FB 2WQUA 4OKDA 5KVEL 4G8AC 5GHWL 5ICYB 5BRZB 4XBMA 4HKZB 4V2CB 2N7AA 3PXHA 3NJIA 5AALA 4X4MA 5F7LB 3ECQA 3TVMB 1QA9B 1YUHB 1TQBB 1BJMA 2X10A 4JO8A 4K15A 3B5GA 5EU3B 1RK0A 3NDYE 1HHJA 3L5HA 3WY4A 2N4IA 1G5AA 1DZ0A 4WUUE 3VWKC 1G1KA 1IC4L 4JGMA 3REWA 4KUCD 4Z7UF 2HT3C 3X1NA 1L6ZA 4W6XB 2QQLH 1EHLH 2FL5A 2WHVA 2X42A 4GAYA 4L8SB 1JDDA 3MTRA 3HEIB 3PHOB 4A1KA 4MA7L 3KPRE 1DJZA 1AR2A 5HJ3B 3ARYA 4QHUB 1T83C 5AW8B 3UGEA 3WS3B 5T3ZH 3OC5A 4PBVC 5EUKA 1TQTA 1XGPA 3FPYA 4LQ1A 3EO1A 4Q0XL 5AOZA 1NBCA 5B3JE 2AQNA 3G6DH 4U4IA 2WUCL 3SKUD 1OP3H 4P2OD 3HMWH 4AYFA 1RZ8B 3DX7A 4ZFGH 4MCNA 5FYLE 4PJBF 4XPTL 2MKLC 2WYZA 3CVDA 3HG2A 3C2AL 3ARWA 2CUIA 5G55A 3FH8A 5JPMA 2FR4A 3WIIL 1BYPA 5T3ZL 3K1KC 1GGIL 4TUKH 3TBWA 4B9JA 1QNIA 4WW2C 5EZLB 4GKNA 4P59L 4EI5C 4HIXL 1ZLSL 3LKQA 2XJKA 2WXNA 5AFAA 1HQRB 4ISVA 2OSYA 2VUYA 3S36L 3P9MB 3IBEA 4JRXD 2QVTA 4LL1A 3UZQB 1VHPA 3TXAA 3RFZA 1GH7A 2HLFD 3ROLA 2ZUQC 4PRIB 4IRJA 4LLWA 4JKMA 4WHTA 3CFJA 3SKNB 3QXAA 4MNGE 1IT9L 4Q58C 2BXYA 3KS0J 4DH2A 3QULB 2GK2A 2C4XA 2F1EA 1I4FA 2DL9A 4LVOB 2E4TA 2VXQL 3T1FA 2BHZA 4IGBA 4A67A 2DLGA 4ALAC 5ID0A 1U2HA 3BH4A 1XR8A 1PNDA 1INQA 1BCIA 3AFLA 4Y9GA 3K72B 3GKZA 1P7KA 1JWMB 1X5LA 5KOMC 3U2JA 4WWKB 2FD6L 4L9LB 2PW2B 1FNFA 4HKJA 3RL1B 1DQML 3UDWA 3GI8H 2XN9D 4L37A 3Q1EA 4A04A 4MD5A 5DD1L 3BWSA 3IJYB 2B4CC 4LOUD 5HYJE 4NQCD 4OZFH 3L81A 4I48B 3NUKA 3H53A 3BP7A 2WMPB 4ODSL 1ZV2A 2IH9A 4WWNA 5B8CB 2EZ0C 5EU6D 3II2A 2J1YA 3QG6A 1Y6NR 2RJMA 2HRLA 3UTSB 2PCPB 1YDPB 2X4TA 4LOVA 5E2UH 5C70A 1TF4A 5E8EB 2K78A 3AM8C 5LCVA 2C3GA 4NPJA 3O0LA 1IBHA 2VR7A 4CA4A 1JZJA 1VZIA 3QI9B 1FO0L 5CIPB 1S5HB 4GQZA 5D8JH 1D5BB 2J8UA 2WZ5A 3SGEI 2UZYB 2IDTA 3RKDC 2VO8A 3P9LA 3M17A 5DUPL 4U6VH 1BZ7A 4PB9H 2ZOTA 2A6JA 2F54B 4YNYA 3VXQA 2QZQA 1FG2B 4LCWA 1XTMA 2NXZB 4D9QD 4GMTL 3K3QA 1QEWA 2JB6A 3L5WB 3OKDB 2AANA 4Y2NA 5C09B 3LKOA 2EO1A 1H6FA 2IPTH 3US1A 2H0EA 2WXFA 1TUPA 2J88H 3K71B 5DC2A 3UEZA 1OGTB 3B2VL 3ISYA 5TGBA 4A68A 4JZJA 4KO5A 5D9SB 1XT5A 3V2AR 1FFNA 2B14A 2IGTA 2BY2A 1WZAA 1D6EA 5IB1A 2X70B 4XCCH 1QFWI 4G8FA 4JFXA 4Y16D 3L8QA 5I5MA 5CD3B 5K9KB 4MDJB 3RWDB 1J8HA 1EH9A 3WD5H 3TZVB 1WE5A 1BIIA 2A73B 1KPVA 2VDNH 3CN3A 3V5DB 4F7CB 3TIEB 1NOLA 3CC5B 4HWEL 1IEAB 4AE0A 5MENA 1K3IA 4M3HA 2LVEA 1NAMA 4IMLB 5ANMB 2BCKA 2OW7A 4XMLH 1KTCA 4BSWA 4Y4KD 2Q76A 3DTXB 1XGYH 3EJRA 1UQSA 2JI3A 5E9DD 4KZCA 1ZGLB 4NRZA 5CCJA 1XX9C 4LFHG 4EUPA 4P48A 3NCYP 1TQWA 3OKKB 2HFEA 2ZYSA 4P4RA 5INCB 2EKSB 1RUPH 3IDMB 2ZX9A 2P3YA 3P4LA 2WZPD 4HUUB 3WUWG 4X99A 3IRZA 4HEPA 4Y19D 4YHOL 1MJUL 2FX8H 3D05A 3ME0B 4N90E 1KELL 2JLLA 3WGUB 3X1FA 1TCMA 1OAZH 1TU2A 2LVCA 2D03L 4HP5A 2OTWA 2WUBL 4KXAA 4N6RB 1WQVT 2PNDA 4Y2DD 2UWEE 1BPLB 3EJTA 3RZCA 3WIHH 4AIEA 1A4BA 4AIXA 2C3XA 4OSUL 3LHAA 4PJHE 4W9EC 5C0AB 2Z65C 1MN4A 1MCPL 1T2XA 3MA7A 1VFOA 4XVJL 1MIML 4MAZA 4HKBA 5E0FA 3VTTA 2IWGA 3QJXA 4G6JH 3KYMB 2EUZA 3HZMA 1KCRL 4EKJA 3IVKB 4JDVB 4K5OA 1IGYA 3BAYA 4GG6E 4MA3A 2O6PA 4PLNC 2FJFA 1NA8A 3PS6A 5FYKU 4ABQA 1RULH 4LLMB 1BXUA 3MLPA 3TBTB 1G5GA 5DK0B 1I85A 2MQ0A 1GCYA 1W0WB 3EGSB 1S7SA 4G43B 2JMRA 3U46B 4Z3TA 3STLA 3GSUB 1A2YB 3PWNB 4Y9FA 2KMWA 5F7EH 2GTQA 2YAQA 1KFAH 4LVHC 2Y9RT 1K5NB 3F85A 3FT3A 2AK1L 3A4DA 3RA7H 3HRZB 5IEHB 2JQAA 1WK0A 2QFPA 3BISA 3TA3C 5HHMB 1SFDA 1PX3A 1OW0A 3K2IA 5I16A 2XWXA 4IHBA 5BRQA 2EINB 3VFVB 4ODTH 4GI6A 2R4RH 1NGZA 5FKAB 4EIUA 3DO4A 4D7BA 3SDDB 1ZTXE 3C87A 1NL0L 4X80L 3G5ZB 3LD8B 1T22A 1ASOA 1FGNL 2HT3D 1TZOA 3UO1L 4NKDA 1NCAL 1CFTB 5IMLA 1DLHA 1O6VA 1RERA 4HHAA 3BUDA 1N18A 1IIKA 3OKMB 2VLJB 2CDFA 2NR6C 1DSWA 4M1DH 3QYNA 2WVVA 1A4CA 1YY8B 1WD9A 4Z3HA 1Y0LB 3VH8G 1UWEH 4KROC 5CBEB 4B9CA 4Z3IA 4FLHA 4HSQA 1FGVH 2EUVA 4BFRA 5B7EA 2OMYA 2AABH 2YPKA 3MBXH 2OYMA 4LK4A 1NC4D 1XAKA 3H9SA 5FA3B 2Q86B 4MD4A 2P44B 1PKQE 4FFZL 2EEAA 4FI7A 4I87A 4A2LA 4B6ZA 4JY4B 2AEPL 4LFHD 1EBAA 3GMMB 1DBKH 3WEOA 1KGCD 2HP4A 4I89A 1D5IL 4FMFA 3TBCA 2ALWA 2K7QA 4Q9CA 1UC6A 5F3HB 5I1EL 4DP2X 2QR0B 4LSQL 4FKHA 4GUQA 3EHBC 1R1CA 4RFOL 2Q3ZA 5I0WA 5I15L 1TG8A 4F7PA 2BXZA 1RJYB 1WRFA 2CIIB 2Z64C 1PFOA 3OXSA 2F58L 1U8NA 1CLOH 1CU4L 1G9NH 1EO8H 4HWNA 5IM7B 5I1LA 2V17L 3BWAA 2NCMA 3U7AA 4G6ML 4UOQA 1NGWB 2O5YL 1F2XK 3G9AB 4WI7A 1VPOL 1MFNA 3SE4C 4CVWA 5J4MA 2ZXGA 1UWGL 3IDNB 5FWQA 4PUBH 3ZTJH 1TJHL 1XXDC 1AZUA 2OZNA 4LP4A 2H32A 3GIVB 1L3NA 1KIQA 1LK3H 4AQ8C 2DL2A 1JTTA 4QDGA 5C08A 2Z34A 3EBAA 1IAMA 3LZOA 3MLRH 4N0YH 4R3SB 1NCDH 3NFPA 3D0LB 3MUGB 5AW1B 3SJVD 2VITA 1OV8A 3TN0B 2DIBA 2GSGA 3Q43A 1T0OA 4PHZA 4BA8A 3L54A 1DVTA 2Z7WA 3MLZH 1GYWA 1J1PL 3BH8A 2CJTA 5E5RB 3FOMB 3TEXA 3L9RB 1JNNL 2VAJA 2DLIA 1FYTA 1FNLA 3WDHA 2IPUG 2LU4A 4TUOA 2NNRA 4LCCB 3RUGB 3F5WB 2EZ0D 3B9VA 4WJ5A 2HFGH 1CC3A 4YLQT 5BV7H 1SRDA 1S2EA 2NSXA 5CN2A 5DC0A 3KG5A 4MVBD 3BQUB 2YAMA 4HIIA 1QPXA 1FLRH 4LAQL 5FHAL 4GB9A 4NOFA 4Z77A 2J6EA 2X0VA 1NDGA 4MX7B 4HZAA 1BAFH 3IS0X 4JFEE 3WO4C 3KNBA 4FG4A 2H2SC 4GJTB 4L9DA 3SPIA 3BEVA 4XWGH 2EXYC 1OXYA 1RUML 2YPLB 3UTTD 2QZ5A 4FL4C 2IOMA 2GJZB 3FS9A 4OY9A 3IS1X 5I1CL 3FONB 1HI6B 4JCMA 1FL6A 2WVTA 3DLQR 3B43A 1MFCL 3O6FC 5CO1A 4HCRH 5I9QB 3WLWC 2H6PA 4MS6A 4RSVA 3QQ9D 3ARBB 3B1TA 1F4HA 3MJ9L 2ED7A 3HB3D 2VXVL 2L7EA 2D4DA 3QFJE 4LXFA 4CDHA 3CH8A 3RGVC 3LKNB 5B38B 4K73A 4ZPTA 4NQEE 3SDCC 1YNKH 3PAUA 4LSTL 2QDVA 2EYRB 3LZLA 3MTXA 1KYDA 2CA3A 3NESA 3ARDA 1A3ZA 4ZFZB 2BDNL 4AEIH 4DZ8A 5DI8B 1CICC 5IIEA 5J6HA 5EU7E 5L0QC 4LLQA 1XF5A 3MR9A 4QRQA 3DOHA 4PJAE 1R34A 1ZCRA 2EO7A 2XBTA 3LEYL 3RTLA 5I8OL 4PMEA 3E1ZA 1CYXA 5FYKD 2I7OA 4M4RA 5C0GB 1PQZB 2X88A 3RBGA 2VLKD 3RY6C 4Y88A 3UC0H 1A3QA 5J3HC 1UXWA 3G9VA 4X7CC 2NYZA 5D2LB 2HWZH 2E0PA 2YGVA 4DTGH 3E6FB 5I6XB 3MRPB 4IBQA 2Y1YA 1CLZL 5DLML 3DIFA 2DTML 5D5ME 2ENQA 2GCYB 4X7TA 4BZYA 3MDJA 5C9KA 4ZAKC 3BSZL 4NB7A 3B7RL 4K5NA 2C9AA 3W0WD 1G84A 1IM9A 3BE1H 3VXNB 2DJ4A 1P0SE 1BVKB 3TS8A 4H2CA 2HTLC 2W9LA 4OFQA 4OUUA 4V33A 1V3LA 3M1CA 3BSHA 3X13B 4TQPA 2BSSA 1E3FA 4M9PA 3ZTCC 1BMWA 2PXYC 2AXWA 3DX8B 4GIAA 1D5ZA 4NN5B 4ABUA 3H85A 1SBSL 4WNSA 5SWZE 1RHHA 1RUQL 3LDBB 1NCIA 3NP3A 4YUEL 2EDRA 2K45A 2HG0A 3KL5A 3A6CL 1LEIB 4QRTA 3V5HB 1JL8A 1LO5A 3NIDE 2O5ZH 4JR9L 3I6KA 5J13C 4H1LH 5D7JB 1U8IB 2X0UA 1KGXA 3CXFA 4FNQA 2VDRH 4ENZA 3FUDA 4OCNC 1PZ3A 4QJ3B 5F6HI 5L6YH 2DWXA 4LSUL 2EH8H 3CLEH 3N44B 2ZUSA 2G3MA 2XFXB 4E9VA 4R2GC 5L4IA 1MFBH 3LQZB 4JO5A 4MMZC 1N5YH 4HG4K 1SY6L 3DPBA 1T21A 3N40P 5E5MB 4YHZH 4FNUA 4A66A 1MCQA 2VJ8A 3DV6B 1HCZA 1SZNA 2CLVA 4W9LC 4QXGL 1M57B 2J1WA 4TKWA 1AFVL 4QRSB 4RCAA 3TA3D 3QUYC 3APCA 4X9BA 3UJTL 1Z7JA 5D1XD 1P1ZA 5AVTB 3JV4A 1FH5H 1KXTB 2VMCA 4CRPA 5D1ZC 2PR4L 1DZBA 4XN8A 5KSBA 4RZKA 5AZUA 4AI7A 1OP9A 1TTCA 3U4AA 3VWJD 1CD9B 1ET5A 3RPIB 1Z0MA 3VG9B 3FT2B 1T0NA 4G9DA 2ARWA 1W72H 3QYCA 4OZGA 2P5WA 1UD3A 3J2PA 1I9JL 2B39A 1UVQB 1V27A 3FF7A 2WY3B 4XNQA 4HUVB 3HFMH 25C8L 3QWNA 1I1AD 5FA4B 2WGNB 2UZXB 2FO8A 5CEYB 3WN6A 2F19L 1P4LA 1JNHB 4JZOA 1ZV9A 4L4VE 1TJMA 2DJUA 3B3IA 4MDRA 3S6CA 2WBXA 5ITFB 5IJBC 1T5XA 1ZS8A 5HDBE 1JK8B 2Q6WB 1KGWA 5DD5L 2F8OA 5I1DA 3GXPA 1ETZA 2O1AA 5TF1L 5L88L 4Z78B 4PVNA 5TFSL 5HYQB 3OPZH 4OM0L 3INUH 2R56L 5EUOB 3UIZA 1QSVA 4MBRA 3OAYH 4UIKH 5DJ8B 3UH8A 4QRPD 1Z5LB 2RHEA 4CC1A 3KXFE 1CJYA 4NNPH 1GA2A 2P24B 5IF0B 2J8UF 5DWPA 3MRRB 2DB8A 2F5AH 4AGQA 3GF8A 1ZIBA 4YHLH 4DO5A 4G3YH 4CMHC 3E8UL 3FTWA 5D2NC 3HMXA 4HUNB 1J5OH 4HALA 2N3JA 3WIFB 3NIFE 2FEDC 2F1BA 2GBUA 1CL7H 2CNZA 3UBXA 4PCTA 4DETA 5KJRL 1MHHB 2FE0A 1NC2A 2AEOA 2XLLA 4JRXB 1NCJA 3DXAA 3VFOA 1AG0A 3PDOB 2IPUK 5F1SA 2RBLA 1TITA 2G4EA 2OX5A 2X3AA 2DQTL 3I85A 1ZKAA 4AQOA 3EW3B 5TQ2H 3MBEA 4MXVE 3WJJA 1VCBC 3L3GA 2J55A 5F0JB 1U41A 3IM1A 3O9WC 4KK5D 4Z7QE 2X4RA 3B37A 3HC2A 3C75A 5IVXE 2VLLB 4OAWB 2VDOH 5J1AA 4ZG1A 2X53A 2ESVA 3G6DL 4F15B 5C0FB 2V8LA 2WB1A 2EH7L 2NXYC 3EJSA 1SF3A 3O6KH 3ZE1F 3HMWL 3PQYA 1YEEH 4ZFGL 5EDSA 1NFDE 1K2DA 3GSRA 2VISA 4Z7VA 4KXZI 1AO7A 2HX7A 4OT1L 2F9BT 2JB5L 5CZVL 1MCNA 5AVVB 2Z6FA 2WCGA 3OC8A 1CFNA 3HBQA 5F7DB 2R2HA 2WCPA 2XN9B 2BP8A 1BMGA 5L7XH 3DHPA 4NQCB 4MYWB 3PG2A 4FRWA 5IV2A 1E30A 1M2VA 4F8OA 2AXFB 4PTUA 4GRWE 3ZIYA 1UACH 1XIWA 3K8KA 4F33B 5BUAA 4HFUH 2L3BA 1P1VA 1JF6A 5EU6B 3KDPB 1JZIA 1FV1A 1E7VA 3ARVA 1XH3B 4OZHE 2QKSA 4ZW8A 5AKRA 5DLLA 2FIKB 4PJXE 1UZ6E 2HA1A 4J3OG 4N22A 2N59A 2B1AH 2Z31C 3N06B 3O8XC 3ULVH 2FX7H 2APFA 1MJJA 1GZQA 5DEFB 4MYPA 4YXHH 1UURA 5I1GL 3MC0A 4KFZC 4E9WA 1MIEL 3Q5OA 5DQ9A 3Q48A 4LO9A 1XGQB 1OAKH 4FG0A 3JTSA 4HVBA 2CJ3A 3ARQA 5EEWA 1XSJA 5MERA 4OJYA 1ZT4B 4U7SA 5HYSA 1GZPA 3VU2A 4GSRA 4NQXB 3O3DA 3RGVD 3TBVB 3MQIA 4AMXA 4WAFA 1L9MA 2ADGB 2LTQB 2QV2A 4KKLD 3H7BB 5AZEL 3SDCD 3LZNA 4UNUA 3QEQE 4OLZH 2EDNA 3BWZA 3GI8L 3MRQA 1R3IL 1S7WB 4WUUA 5MI0B 4B9FA 1TQUA 5I8CB 2Q87A 1VEOA 3UAEA 1BQLH 3GB7B 2AAVA 5CSZA 2VKWA 1JV2A 3C6SA 3DMMC 1UOKA 1OTSD 4NQTA 1H15A 1TTUA 5DUMH 4Y16B 4E41D 3MRDA 3B2MA 3GMLA 4GRLC 2LGNA 3KPRA 5LBGA 3DRQA 2X2YA 3OB0H 2H47C 2UY7B 2DWTA 3PP4H 5J3HD 2YLKA 5E2UL 1J9CT 4OQTA 2H1XA 5H4YA 2V7NA 1SOKA 1TO4A 2G60L 5C86A 4WU5A 4BH7A 4DCQB 4NC0B 3LH2L 5I66B 2CM6A 1F3DJ 5CAYB 5HJBA 3DJSA 1MLBA 1VRSA 5CMAB 5D4JA 4JNXA 4UTAA 3T0EE 3QFDA 4ODXA 5D8JL 5JHDE 2B77A 1T0MA 1FJ1B 2KDGA 3QEHB 4Y4KB 2BNRE 2DBLH 4U6VL 1T1ZB 4PB9L 3GBNL 4BKLB 1WWCA 3GSOA 4FXGC 5ABAA 2WP3O 5E9DB 5BUPA 1NEUA 4KHTH 2O6DA 3QHFH 5CLXA 2Q9OA 1KACB 1BGXL 5ESQB 3GSWB 4UT6H 1BOGB 1YEJH 2IPTL 1J9TA 3QNXA 1HU8A 2A9NL 1YPZB 4GAGH 4WFFE 2J88L 3EO0B 4L2LA 5D1QC 3FSZA 3RDTC 4DKFL 2VRKA 2X6AA 5CEZH 2F74A 1A9BA 3EYQD 3IT8D 2XJLA 3RVUC 3CHRA 4YDIH 3P9WB 5GISH 1T2JA 4Y19B 1MEXH 4P2RE 1B90A 3D48R 3HN5A 1RZPA 2PCYA 4JLRA 4UDUA 4ZSOE 3V8OA 4AGLA 3BJ91 5C9JB 4MNGA 4F1SA 1E9OB 3WD5L 3FUFA 2PP7A 1OB1A 2WZ0A 4WI3A 4Y2DB 2B20A 1FE8H 3MGOB 5TPWH 4E9RA 4URKA 3Q3GB 1IC5L 5FUCE 1UGNA 2IQ9L 3GS0A 4A39A 3ULSA 5FB8B 5E1HB 4HGMA 3BHBA 4RFNB 3R8QA 1CGYA 3TP4A 2BNUA 4RA0C 3GMOA 4R7VA 5IJKA 1FAIL 3TH3T 4J3OD 2AKRB 3EYOB 4PYGA 4PRAB 3ZL1A 2GITA 2OMTA 4XMLL 4NM4H 1RIHL 4PV8B 3T6WA 4MJ2A 5D7LD 4MZIA 2PO6B 2JIXD 5HGBB 3P4NA 5PCYA 1XGYL 1KGIA 5BQDA 3ZE0E 4GKOA 4U1MA 3IFPB 1BQUA 3HUJB 2YUXA 1RSYA 2OA9A 4PJIE 4GKZA 5F0MB 5FO9B 3F58H 2CCLA 3LEXB 3VRIA 4EAEA 2X3BA 4IQHA 4Y2OA 5FYJU 5I5JA 5JUEH 3QS3A 2VC2L 1A7NH 2V2WA 4RQQA 4KQ0A 5FCUH 4DK6A 1VIWA 5A2BA 5C0DB 5DZVA 4LHJB 2X05A 4UDTA 1FCCA 3CUPA 1ASQA 4J12A 4Q2ZB 5EOTB 1C08A 5DMGD 5CCKH 5J6GB 1RU9L 1FWXA 5E94B 3WIHL 3EJPA 3QZMA 1OE1A 4PG2C 3UTZA 2ZXCA 3EBGA 4JRYD 1MRCL 1KIUB 1VAHA 3RVWC 1C1EL 1H9DA 3CVHB 4ANWA 5F9JA 3AAZA 3HC4H 4NQUA 3B9KA 5T1DH 3B7YA 3BPOB 3F01A 3MSPA 3CNKA 4K7PX 3VYOA 3F04A 3FB6A 4GSDH 3MUY1 2WSDA 1NC4B 2BRRH 4RAVB 1HQ4A 1BPVA 5F7EL 1I1YB 1DQDH 2YXVA 1KFAL 5EHFA 3GXFA 1G4MA 3KDMA 2D31B 2E27L 2QGEA 4ZUUB 3RA7L 4AV0A 2NUTB 2J2ZB 3QO0B 5J12B 1K72A 1LQSR 4XOAA 3ULVE 1MHCA 1KCSH 1NM9A 3D18B 2HJLA 4WW2B 3UG5A 2FEDD 4ODTL 2YOCA 2R4RL 3WUWB 4F9LC 4X0KA 4L1SA 3PGFH 3ASWA 4PJEE 1JMXA 3IJ9A 5DRZA 1OGSA 4HGWA 3VD0A 4ZTPH 1KYOK 2QVFB 4U1KB 4NX0A 4CUCA 3NSDA 2XYBA 4YDJA 3J8F7 3IDIB 3QB7C 3V6OC 2P8MA 3GMPA 3JWNC 3VTAA 2KQNA 5FW7A 2CH8A 4OIFA 1YJDL 5KZCD 2UZIL 4KOBA 5B3NA 3GUTB 1UWEL 4YFEA 2UUDH 4JBSA 2VLME 1RZKH 4MCYB 3OG4B 3V0DA 3QWQB 1FGVL 3MJ6A 2NXYD 3QXDB 4P3DB 1UFUA 1Q9WA 3MBXL 4N2KA 3O6LH 1C5CH 2UX6A 3WKYA 5CJXA 3Q8EA 4EIGB 3CWGA 1PYWA 5IT2H 4GSQA 1L0XA 2FQFA 5BRZE 2WLLA 7CGTA 2FJSA 1FAKT 2JCWA 2KHAA 4KMTL 4NSKA 5TE7H 4XNDA 4KAQH 1IKFH 2UWEA 3OJDB 1KTLB 6FABH 1NIBA 3N9GH 3KPNB 4PJHA 4BCXA 4AQ1A 1K9TA 4Q89A 4Q4EA 2EKJA 2AHIA 3NRPA 1K4DB 3F7KA 2CR0A 4G8IB 4PJFE 3WTWA 3NCEB 4PJ5E 1AIFB 1MY5A 1CLOL 3FL7A 1ORQA 4Q97A 5GS0L 1G9NL 4YXKH 1EO8L 4OCXH 4WZ9A 3TBSB 4GG6A 1ORSB 1XCWA 2VSCA 4W9IC 1JZ4A 5KBDA 2OXHB 3O8XD 4WTWA 4R84A 3WSQH 5LGHL 4U1GC 4ZMQA 5GSRB 3BT0A 3MOBH 3SEPA 4RMUA 3CU1A 1HILB 1AGEA 5GS2D 3JWDH 2DWYA 3VXRE 4G72B 3UTTB 5CEZE 1ZHNB 2C7UA 1KXVA 4N0YL 4LLYB 1KLGB 1NCDL 2ERJC 4KMQA 4G71B 4PS4H 2Y7NA 3VH8B 1U95A 2VW6A 1RJZA 5AKVA 3MLZL 3T2PA 1S7RA 1Y7VA 3OG6B 3L08A 3ULUF 3HB3B 4EUPG 1FNEB 3FQTA 3QQ4B 4N24A 4X7SH 2CXKA 1SN2A 1KF9B 2K4AA 1ZK9A 3QRLA 2X1XR 1SOSA 5EO0B 1J8RA 3BH9B 3MA9L 5J1TC 3DMMD 3V4PB 1EPFA 4PVBA 3VCLA 5JHMA 2XXFA 2OV0A 5FOBB 4GRLD 2HFGL 1OCOB 2HFTA 5BV7L 3HBGA 4XOCA 2Z8SA 4ICXA 1R3HB 4PRIE 4M6NH 1FLRL 1NIAA 3QCVH 2Y69B 1O6TA 3QPKA 3P69A 1ZDSA 4WK2B 3LYRA 2XWJA 4HIQA 4JJ5A 1YVLA 3VXOB 2VLKB 3ZU8A 4R8WH 1ZLVH 5KSBF 4IKIA 2ZUTA 1KGJA 2Y1ZA 4D8OA 2A83B 1P4IH 4XWGL 2BZDA 1Z0NA 1PKQA 1OKEA 2GT9B 3ZE2B 4X6EA 1HDMA 3KLSA 3ZDZE 3L7FB 4S2SB 3VQ2C 3ZT5A 1XZ0A 4NHUA 4OCRL 4NUJA 4HCRL 3LHPL 5BZXA 2FDBP 3DVNB 4DOHE 1EFXD 5HVFB 3DX6A 4FQQB 4H2AA 1JYNA 3DX1A 3TIDA 3W0WB 3A6OA 3FU5A 3RDTD 4OFKA 3WY2A 5D1QD 1GGCH 3FT1A 5J57B 3IMBA 4HX1A 3D39A 4X5XA 4PWGA 5E7BA 2NY5H 1YNKL 4IKNA 4LIQH 3U36B 3GSNH 1CYWA 2WLKA 1H3TA 5FGBC 5DDHA 4RH4A 1JN6A 5LCVL 2VQTA 5LXGH 2VT0A 1N7ML 4AEIL 3QIBA 2AK4D 1WA0X 5AG9A 4N85A 3UTSE 4UNVA 1CD1A 1I7TA 4GXUM 3ZSSA 4OIAA 4ZX3A 2YJLA 1TETH 4H0LC 4JL1A 4R96B 5F70A 1KPRB 3IEAA 4F3FA 1QHPA 1MNUH 4PVLA 4WI9A 1OP4A 3GJFA 3OF6A 4LLUB 5DMJB 4EJ1C 1BX2B 5HHXL 4Z76B 2Z0UA 2R1WA 1ADWA 2IXQB 2X6MA 5ICUA 1NCHA 2HWZL 4AKQA 4ZMVA 2OMXB 3NIGF 4I5BB 4TQEL 2K8MA 2F54E 2WIIA 4S1QH 2ORBH 5MEND 3WOVA 3NJNA 4FQHB 4TRPH 1L3WA 3CDCA 4QHMA 1HHIA 3AG4B 1R3KB 5IFAH 4MA1C 4CADB 2WWKT 1R3LB 43CAA 1ERNA 3NA4A 3V4VH 4A7SA 2PYEE 2CE6A 4PW4A 4HWBH 3BUQA 4LVHB 1IEBB 3FMGL 4K71C 3VFRA 3KGTA 3TA3B 4P0DA 3I6LD 3MXWH 3AB0C 4RGNC 3OR7A 5F6IB 5D1XB 1HN1A 4KTYA 4PREB 4JFEA 1NOAA 3LX9A 4PV9B 3OAZK 4QAMB 1R17A 4PFEA 4E2OA 5MENE 3GQFA 1F58H 4J4PA 3GO1H 3VWJB 2PTTB 3ILEA 1JV5A 1NAML 3MODL 3SE8L 2H9GA 3ZSTA 1CI5A 4Z7VF 3S88H 1WEJH 2B9BA 2FSEA 4RZCA 1EHNA 4ZFOL 3W11C 1L9TA 2X4QB 3EZ8A 1P6FA 4P23C 4U1IB 1I1AB 3N3EA 5GIRA 2VDRL 3L95A 1WT5C 1IVLA 5ABDE 5L6YL 2ZP8A 3JZYA 3RVWD 3FO2A 1F18A 2BIIA 3S96B 4Q9RH 4F8TA 2EH8L 3MNWA 2KERA 3CLEL 5T1KA 3HZVA 1AOHA 3QFJA 1T1YA 5E8PB 3DROB 2CBTA 2DQFA 1YQVH 1K4CB 1MFBL 3QCTL 4NQEA 1KIRB 2DBJA 1N5YL 3QDJE 3PHAA 4YHZL 1AQHA 1Q9OA 1MFMA 4LCUB 2RCSH 3QR2A 3P0YH 1EAPA 3EF7A 4BSVA 4CC4C 4POZC 1X4YA 4KX9A 3U2SA 5HPMB 1I7ZB 3Q2LA 4PJAA 1D9KC 1HKFA 3QK0A 4QRPB 1X9LA 4WSGA 4X8XA 1KYAA 2BMKA 1OAXL 2KZBA 3QJHA 3VD3A 2O6EA 4OLWH 1QUPA 5M7QA 3QIWC 1DDHA 5ID1B 3M7OA 1NSNH 3DVGA 2WQAA 5LGJB 4OCLC 2N7SA 3HAEH 5ICZB 1G43A 2VDQB 1G7LA 3DHJA 3K74B 4UT9A 1SPDA 3H3KA 4ZMLA 1XGUB 1W72L 5BVPH 3DURA 5C0AE 2BRQA 2BK8A 4PGDB 5ELIA 3NCFB 4BFFA 3F7RA 5D5MA 1AD0B 1U8LB 5E1QA 1AGFA 5F7KC 2XXMB 4HD9A 4P46A 1DBAH 1URIA 4IIZA 5DWUL 4X4XA 4X4YA 3DPDA 3DDGA 2AJYH 3JTTA 5B4MC 4GQ9H 4HJ1A 4NT6A 1TDQA 2P48B 3RPBA 1LGVA 3UYPA 1KB5A 1U8PB 4PJ7E 2VABB 3P3RA 1ES0B 3OPZL 4Z0XA 5SWZA 5B3JF 4AGNA 3INUL 2J20A 2V9UA 3MX0B 5IBLC 1DSYA 1DUYA 5HHME 1A64A 4UIKL 3U7YH 2FZ3A 4NNPL 3BZFB 4W9JC 5AAMC 4F7EB 5LVEA 1BQSA 3ARTA 4N86A 4AJVA 1JRHI 2VW4A 4LKXA 2P8PB 4P4KC 1SQ2N 3EF4A 2WZAA 4QHKJ 5D93C 5IBTH 4TNWF 3NAAL 3ZRSA 2UXVA 4PY8I 4PWKA 4X6FB 4G6KL 1XSIA 4Y9CA 1J8SA 4D8PA 4Y5XA 3PJSB 3TPKA 2GW5A 1LWRA 1CL7L 1S3RA 3ESUF 2VLJE 3QORC 5I2IA 2XG4A 3WO4B 1XSKA 1G6RB 5GGUB 1D5MA 5H37A 1AJ7L 3VGGA 3U79A 5E2JA 2XN2A 3TNNB 3QWOB 1X7SA 4R4NC 2JI2A 2HMIC 3IMUA 5TQ2L 2DD8L 3BP6A 3VGEA 1THAA 3LKRB 5I0VA 3ZO0A 1ZPLA 4M29A 4LGPB 4GFXA 1A02N 3QJFA 4B3VA 2IO5A 2VDOL 1NFKA 4EIZC 1BEYH 3AS0A 4QTHB 3K6SB 1DVUA 3IPEA 3O6KL 3WN5C 3BI9X 1IM3D 5DVPA 1YEEL 2DKSA 3RGVB 2XBZA 2H26A 2MH4A 3VUAA 3SDCB 5IHBA 2ICWJ 4S1RH 1EANA 3F05A 1N0LA 2YXWA 4IOFC 4ATTA 4U1HB 3IJ7A 1JE6A 1ZT7A 4MKTA 4P2QE 5L7XL 4XPGH 1U9KA 2CG9X 2DKMA 2ZP0T 4IBZA 6CGTA 5KTEH 3CIQA 5L0QB 2XPZA 1MZYA 1R3JB 4QT5A 1UOWA 1V3MA 2YMTA 4L4VA 5EBGA 1WZ1L 3AG2B 1XXFC 2WTRB 1BLNB 1UACL 2UY6A 3G5XA 3PFQA 5FGCB 2G75B 5J06A 4E41B 4HJJH 2YGNA 5AVWB 1A7PL 1DQJA 3DVFA 5I82A 3VXTA 4JPKL 2Q2LA 2O4EA 1NGQH 4OGXL 5LNDA 4AGMA 4JDZA 3TCXA 5BVJB 3CZFA 1SUHA 5EZOH 4M1GH 1T04A 2FX7L 1E28A 3K2MC 4YSTA 2Y3NA 4GG8A 1ADQA 3WI9A 3TBYB 4AK1A 3K4ZA 4YXHL 4N68A 3C09C 3IU3A 4NNYB 2Y7QB 2EDEA 3KXFA 1Q94A 1S9KC 5HHOD 2FECI 4L8CA 1JHLL 4HPYH 3ZR5A 1WAEA 5E5LA 5DEGA 1QQDB 3NH7H 2YQGA 4JM0A 3LNDA 3BUBA 3IGAA 2OXGB 2MPVA 3FULA 4RX4D 4JVUA 1Z32X 3FTUA 4P2AA 4NBYB 4JAMB 2NLJA 5EMYA 1TSRA 4MJJA 5GGTH 4WVRA 1AKPA 1BQLL 2DTSA 3FF8A 2FT7A 2EQDA 4XMXA 1E7UA 4GW1A 5BOJA 2YQ3A 3APMA 4ABVA 3QUMB 4PRPE 3FT0A 1F4XH 4RWYH 3R7RA 3TBBA 4E36A 5J13B 3X1BA 4GO6B 4ELDA 1JXKA 2MPAH 3MACL 4GIPD 4JHVA 4JN2B 5IVXA 2YPLE 5CBAB 2J21A 2G2RB 3CX5J 3NCXA 1INEL 3HLAA 4I3SL 5CR8A 3WEXB 2ICWA 2NT0A 3AUVA 5IQ9A 2EVHA 5DHVA 1KBPA 1AD9A 3O6MH 1KV7A 2EEBA 4HUXB 4PRNA 3OKOA 3BKMH 1NFDA 3MKKA 2I9LA 1MKFA 4MASA 2CHNA 1Y07A 4MMZB 2BPBA 5LAXA 4XMKH 5JW4Q 4RETB 2YBRA 5K59E 1JGUL 2DEXX 1PS3A 2DBLL 5D7LB 4PRDA 4LQFH 2JIXB 5TDOA 2JFCA 2AJVH 3T0XA 1L7IH 3BPLB 5EIQA 2VWEE 1QWHA 1DVFC 4WK0B 1H8LA 1SEBB 1LP9E 1RMFL 1UKSA 2PPAA 3LKSB 4KHTL 4RVBA 3SBWA 4EMZA 5GGVL 3SY0B 4UT6L 3EGXB 2OMWA 1J18A 4PM1A 5GGRB 4PJ8A 3SGJA 4IEFB 5BXFA 1VZGA 1KJ2A 4OZHA 2JKJA 3VVVA 3WTXA 1DJIA 3DBSA 4GUPB 2IPKB 1E9PB 1THCA 5GISL 1KLFA 1U93B 1HESA 3KYAA 3RVXC 1EERB 4HIHB 2IH1B 3TASA 5AWNH 4Z3GA 3QNYA 3JWOL 2WAQA 5TH2B 4D9LH 1F0LA 1IL1A 4W4NA 3W11D 4PH8A 1QEXA 3THMH 4NN6C 4P23D 3VI4B 4WUKL 2NZ9C 2HVJB 2UWEF 2Y6SC 3UG3A 2W65A 5A2FA 5TPWL 4O00A 1YCSA 1OGAD 1VLXA 3NN8A 4PJHF 1OAJA 1F4WH 1RZ7H 1JHKH 1T5KA 3DWTA 4JRYB 2AMUA 3ZDYE 3QPQC 4I1PA 3DOSA 2W0PA 4LT7A 1L0YA 5IVZA 1IAKA 4NM4L 4UU9B 3QEQA 4QO1B 4WW1B 1JG9A 3AT0A 5E8DL 3CDGA 2DF3A 1ECYA 1BZDA 4O2EA 4POZD 5EF3A 1R5IA 1X5AA 1CR9H 1IIIA 5LBSH 1KJVA 3H0TB 1IU1A 3HPLB 1BSIA 1HE8A 3O3UN 3DHUA 4OZ4B 4KZDL 5EORH 4PU2A 1U8JB 3LPWA 3BVUA 1RHFA 3QIWD 3CFEB 5DQDL 2IDSA 1A1MB 1UT9A 5JUEL 3GXTA 2J1ZA 1QSED 1OF2B 4DGIH 1QBBA 3UIYA 3UPAA 2A9AA 3BGFB 4OB5H 2XG5B 4HXAL 3TM6A 4BZ1A 1SM3H 3FFDA 1NUDA 1ZHLB 5DURD 3TJEH 1SXSA 2VN5A 3FQ1A 1VFBB 3BP4A 4C8XA 3MNVA 1T4WA 4APXB 3T0EA 2V3DA 3VMPA 1U2CA 1YY9D 4AEHH 1BOYA 1FIGH 2C3VB 3RWFB 1PD6A 1HHJB 4TYUA 2PKDA 1N8OE 3WE6B 1FVEB 3ECBB 4NFCA 5E70A 5B4MD 1WBXA 3REWB 4DKEH 2RQEA 3H2QA 1FL5B 2P5EE 2GHZA 4PCYA 2WSPA 2MKWA 2FL5B 4FEIA 5KZCB 1NMAH 2W88A 3HC4L 3A4FA 5T1DL 3CXHK 3WBDA 1SYVA 1EEQA 4J8QA 3SPVB 2NXYB 5TE4H 5KSAC 1EHAA 3ENEA 2DYRB 4JGNA 4PGCA 5IQMA 4P2RA 4ZSOA 2VXSL 4N8CH 3OMNB 5HDOA 2DQDH 4BIKA 4DP9X 1A9VA 5GS1B 4MWFA 4FQLL 1PGRB 5ITBL 1GRWA 4Z7NF 3LXAA 3UP6A 4ANKA 3DX7B 2DWEB 1IO4C 1Y6KR 2VLRD 3UBXI 2OJ1A 2DM2A 3NEEA 2WINA 3OSKA 2BM3A 3FTGA 1EIBA 4RIRA 4L0YA 5JPMB 2R23B 4JPQA 4CSSA 5DO8A 3F8UB 5HYIA 5ISZD 1TKWB 1SN0A 3DKHA 4Z5RA 2OLDA 4ZTPL 4GKNB 3KYOA 3Q7JA 4R4ND 2HT2C 1Q9LA 1FVDB 1JZ2A 2HMID 3O8XB 2MNWA 3KPPA 1RVFH 2BLFA 4X9FA 1N4XH 2XNAA 5IWLA 1A6ZA 4BCYA 5DD6B 4PJIA 1SXCA 4RRPM 3H6AA 4JDTH 1P84K 1MG2C 4OW6A 2CUAA 1BFTA 2G4GA 3AXIA 5EUOE 4UCFA 3S4SA 4NXKA 3NJXA 2XC8A 5CCGE 2ENPA 5B7MA 1SEQH 4KZEL 3WTTA 3HMXL 4OFVA 4YGAB 5AYTA 1VA9A 4R90H 5JHLH 4XI5D 2ESVD 3P30H 2ROYA 5FW8A 1RZQA 2OW6A 5TE7L 4IOFD 4KAQL 1INQB 1QRND 4HDIA 2VERN 3HBZA 4Q9BA 4QJ5B 4E9XA 4ES8A 3N9GL 4Y4FA 2DJSA 4DUVA 1AO7D 4HKJB 2E4FA 3FQXB 5EPMB 4L37B 3JV6A 4MD5B 3FT9A 4X6DE 4JRXE 3DHMA 3H3PH 3TO4C 4GRLB 3AXLA 4XTRC 5J11C 3L6FA 1B2WL 1LVEA 5DJ0B 3L1GA 4YXKL 3CQFA 1PZAA 4ZPVA 2DQIH 4JUSA 2ADIA 1MLCB 5LN8A 3QG6B 4QTIH 3WSQL 5E4IA 3MOBL 1P5UA 2HG5A 4BGLA 3JWDL 5JIPA 2OP4H 3CAFA 2I7SA 1A6AA 2PPCA 2WLNA 3NTCH 4YIQA 1WBYA 3OZ9H 2L7JA 2Y06H 3LPOA 4YHNA 4FXGB 1BZ8A 2W0KA 3C5JB 1D7DA 4L48A 3PLYA 1CGSL 5DK3A 2ZOUA 3SQOH 3NGBC 4AKOA 4XP6H 1EFXB 1L9SA 3DECA 2XN9E 2A6JB 4PJEA 1HOCA 3RDTB 5D1QB 3T0DA 1JXDA 3U6XA 4J8RA 1I7RB 2QSTA 2X0WA 4WV1C 5KEZA 1L7TH 3LKOB 3JBG7 2DMGA 4BWWA 5EU6E 1RK1B 2AK4B 5F9OH 2BIHA 5ACMA 1RZGB 3CFUA 2ATPA 2ARJQ 3UC2A 1AGDA 4M6NL 1A6UH 3IJSA 3QCVL 4NDMB 4BZ2L 2IG2L 4G8FB 2MQCA 2YUWA 2ODHA 4AH2A 2A9DA 1OO2A 4R8WL 1BIIB 1CDUA 2X6VA 5JDSA 2E56A 1P4IL 1S46A 4N0FA 2VMFA 3LKPB 4GIOA 1FZJB 4XVTH 5BRZA 4FJYA 5ICYA 4HKZA 3FHAA 3NK3A 2C4FU 3WNLA 1KTRL 2WCSA 3TVMA 1QA9A 3G6JB 2WKGA 3BKYL 3D50A 1U6AL 5FYLD 5MENB 1DVFD 3HN8A 5D5MF 2I5YL 3S5LA 1G9HA 4BSWB 5EU3A 4NAMA 4D0BA 2H8PB 4ABWA 3SE3A 2YK1H 3O2WL 4PJFA 2ISDA 4ALAH 2ZAIA 3BSGA 4PJ5A 2NY5L 3IMRA 4LIQL 4Y9EA 5I1AB 1E5UI 2EDQA 3V55A 4OQTL 4EUPB 3LMJH 3RVXD 4UNTA 4L8SA 1XF2B 1F3RB 5LXGL 3PHOA 4WCYL 3U6XS 5HJ3A 3NA9H 4QHUA 4J1UA 1TETL 1LO2L 4P04A 4BFJA 3EADA 4EVNB 1MNUL 4CKVX 4M7ZB 5FWRA 5F1IA 2APSA 2ZOKB 5T3XH 4P3WA 1RZ8A 4ZNEE 3R8BB 5AW5B 1KEGH 2ZWSA 5ENWB 2PUQT 2YEZA 1AXSB 3BAEH 4F24A 2XU9A 3VVWA 3FTYA 1QFUH 3DDFA 2BY3A 3MNDA 3MA7B 3PXLA 4LGSB 4XNYH 3QS2A 2V5SA 2CDEB 3NJFA 4HKBB 4MB1A 5E9DE 1YEKH 2BHFA 5EZLA 1QVOB 2BSEA 1HQRA 3CG8A 5IFAL 1IGYB 1XDTT 3P9MA 1YAIA 1YPZE 5HYJD 5IROA 2FJFB 4OGAC 3D2UD 2D2OA 1I9IH 3FT4B 2CKBB 3RILA 3WTSA 1OZTG 2K9UA 4PRIA 3H42L 4Y19E 3MXWL 1PEWA 4N0CC 2V5MA 2VDKH 2M83A 5HY9B 1N67A 2FBRA 5EOQL 2EIZA 2HKAA 4HQQH 1YYML 4WFGE 3KR3H 4C47A 4MBOA 1QYGH 4XWOC 1FZMB 2VN7A 1MAJA 1BJ1H 1WH0A 2XN1A 1WEJL 4KKRA 1EWHA 4ZTOH 3MYJB 3GZQA 1AYOA 3K72A 5AW3B 1JWMA 4YDMA 1KGYE 4WWKA 4L9LA 2HYMA 2R0LL 1NGPH 5L2JB 3F3HA 5C97A 1F5WA 4AQEA 1H6UA 3IJYA 2QVIA 4HT1H 4A38A 4YAQB 3TPUB 5EOCH 4I48A 3HUJE 3IGUA 2KC0A 3QEUA 3PV7A 4QGYA 5KSAD 4A6YA 4JO3H 1I3RA 2BFVL 2WMPA 5DZ9A 1KV3A 5B8CA 2WBJA 1I9EA 1PY9A 3UTSA 5IK3B 2PCPA 1D7CA 1YDPA 1JGLL 2DICA 3CVCA 4GLRI 1HYSD 2OMYB 2YPKB 3VU1A 5E8EA 3X11B 5EEXA 3T6VA 4TXVB 4OLWL 2ZOLB 2IAMC 1ZHKB 4JG0L 4YEEA 3VW3H 2MCPH 3V7AG 1NSNL 2XWRA 4C57C 1GGTA 2R9HC 4LCIH 5CIPA 1S5HA 1D5BA 3N85H 1BMZA 2UZYA 2XPYA 4XXDA 3K6IA 1MHPL 4AX3A 2VH5H 4F20A 1UD4A 3ATAA 2F54A 4CN1A 1FG2A 3C8HA 1XCQA 2EDDA 4X4KA 4F7PB 2XTJC 4XE0A 3GK8L 4OZFG 5JOPE 3L5WA 4MAYA 5C0NC 5C09A 4TQHA 1DBAL 4BUGA 3NABH 3PHQA 1DJXA 5C0IB 2Z8WC 1ITCA 3HNSH 3ZZSA 2PYEA 3K71A 1E5CA 3SZ6A 1GJUA 1RPQA 1EGJH 1OGTA 4MXVF 2ERJB 5EC2B 5D9SA 3OKEA 4Z7QF 1RD6A 2B15A 1KIQB 2X70A 5CD3A 5K9KA 5C08B 4DGWC 4MDJA 4MZ3A 5KOVC 3QJTB 3RWDA 2YUVA 3JV0A 2NDFA 2YSTA 1GGBH 1KGCE 2VDLB 2AMGA 2A73A 3I2CH 3TZVA 1E27B 1SDYA 3HTLX 4F8NA 1FC2D 3IAPA 3AACA 1IM3B 3V5DA 4F7CA 2GSGB 3TIEA 3U7YL 1NFDF 5DHYA 1N5AA 3CC5A 4N2NA 4I1RA 1QWUA 4I4WB 4WWPA 3ECUA 1YJDC 3I3DA 2B9AA 4HF5L 2AVFA 4B9KC 3TO4D 2WO4A 2FHCA 4IMLA 4J27A 4OFIA 1MUJB 4IK6A 1SF5A 2QFRA 4WWID 1MCFA 5I1HH 4TUOB 2B8OT 1HCYA 3L2LA 4GRWF 3D7PA 3KVQA 4X5QA 4IBSA 4WJ5B 5J8OA 4WHDA 1HEJC 3QDJA 4HV8B 2CRZA 4KVNL 2Y7MA 5CILH 2Q8BL 3B9EA 3CX2A 1S4IA 3EJCA 3OKKA 4XXCC 4PWFA 1FF5A 4IU2B 5INCA 4H8HA 4RGMC 1NDGB 2EKSA 4UQ3B 2QSCL 1F1DA 2HT4C 1W0VB 4HUUA 3LAFA 3VFSB 3SJVE 1N2RB 4UV4L 3BEVB 2E5EA 2Q1EA 5CGBA 4HZLB 4FJ6A 2YQ2A 3ME0A 5G4NA 3QRBA 5HHOB 3COOA 5GS0C 4GSUA 1G9NC 1PSKH 4LZKA 3APNA 5CLZA 4JPWH 4P3CH 2H6PB 2R29L 1XB3A 2Z7YA 5C0AA 4S1RL 4Q74A 1EUUA 1H5BA 1WTGT 3IKCA 1T4KB 1FO0B 2EP6A 2R8SH 3LIZA 4ZPTB 3WNMA 2WQ8A 4N8VG 1HK6A 1JGDA 3UMNA 1J0HA 1A5FH 3ZBMA 2GTWB 3D2TA 3LVTA 4B0MM 3LRKA 3FHQA 3FO0L 5LWYH 1UD2A 3CSYA 4HJJL 4LLMA 1KJMB 3QE5A 5IIEB 5KYUB 4L4JA 4GH7B 5DK0A 5IJCC 3PAVA 1NGQL 5HI5C 2NY7H 3U46A 1I1FA 3GSUA 1A2YA 1Q72L 2KLSA 1QTSA 5C0BD 2ZCZA 3UTTE 4FDWA 3M07A 2R0WH 1BZOA 4M1GL 1K5NA 5EZOL 4X83A 3MLSL 1FFPB 5D70L 1J5DA 3HRZA 2CO7B 3K6OA 3MRJB 5I1IL 3VFVA 1GMEA 4HPYL 5BV7C 4JRFA 4M6OH 5FKAA 5FECB 1IV8A 2AJUH 5CP3A 2ICCA 2CHDA 1UJ3B 1K5WA 3PU7A 3G5ZA 5IR1B 5BPPA 3EZJB 1I8UA 3DK0A 3EOBA 3NH7L 4K71B 4B41A 4IU3A 1CFTA 3UEQA 32C2B 4XAKE 3AU1B 3AB0B 3RI5F 1ZE3C 3SOTA 1SDAB 1MQKL 1MF2H 2VN6A 3R06B 3OKMA 2VLJA 5GRUH 1GY1A 5GGTL 1JNLH 1OM3L 2P5PA 3UDWC 2EYSA 3FAXA 4U1SB 2WLZA 2EVGA 2LW3A 1UCTA 5CBEA 4MQXC 3OMAB 1D5ZB 1K3ZA 3QC6X 5FYKE 4L29B 3VACA 1PIGA 1DQVA 1JXFA 2X7LB 2FHBA 4TSCH 5CD5D 2VLKE 1QOKA 2G0LA 1JZ3A 4TOYH 4NQDD 4L1LA 4QRTB 2ZE0A 5FA3A 1O9ZA 1JVKA 4TTGA 3M88A 4Z7AA 1F4AA 5EO9A 4JY4A 2OCJA 3I6KB 1OGAB 2FT8A 5K9QG 3OF6D 1CVSC 3WCYA 1MVUB 1NDTA 3DI3B 4LARH 5D96C 3BKML 1Q0XH 5E4EC 2QR0A 3V9CA 2O5XH 4Y1TA 3N41B 4HS6B 4QHPA 2PMZA 3W0WE 4CVXB 3E8VA 1IILE 1DEDA 2DQ6A 2AJVL 4OGAD 4U6HA 1U8OA 4P2QA 5BQ7B 2YD0A 4DEPC 4OLVH 4AYID 2VOTA 2R2EB 1FNGA 5IM7A 2IDFA 1T21B 4N2BA 4KJPC 4PJIF 5JW5A 3MI6A 2CLVB 1NGWA 4Y1AD 3UZVA 3GI9H 3QIWB 1M3JA 3GIVA 1QSEB 1PW3A 1WPCA 1P4BL 1U58A 2Q20A 1MWAB 3ALPA 3OVUB 4EE2A 4HWBA 1BFVH 1P1ZB 2G5BB 4JO2L 4XWOD 5AWNL 4DVRL 3SDAD 5DURB 4ONFL 4R3SA 4GT0A 3QHZH 4D9LL 3D0LA 3MUGA 4IYKA 4KO7A 5FEBA 3THML 1NAKH 2IADB 5GRXG 3TN0A 1WZMA 2ZKHL 4M1CD 4WFHD 2ZCLL 4G9DB 3ARGA 4OZGB 1RZIA 1A7RH 5IB4B 4I18A 1I1CA 1RZ7L 3CXDH 2LR4A 4JM2C 1JHKL 3G5YA 4UAOC 2CGRL 1RJLB 1LE5B 3FOMA 1IC1A 1AR1D 5E6IC 1P4LB 1QX1A 1AI1L 4JGJA 5F8QC 4N2GA 3KLQA 2XKNA 4LCCA 3RUGA 2GSMB 3U4BH 4POYA 1Z3GH 1PG7X 1JVOA 4M3JA 3HNTH 1CR9L 4H25A 3ZTJG 3U48A 4F9PA 1JPGB 2X2JA 4B5EA 2SEBB 1HH9B 5I1DB 3AGVA 1HL5A 4PRPA 4MX7A 3ESPA 1ZVHA 3IJHB 4ODHH 1DCLA 2WXRA 1RAMA 4DGIL 4BBWA 1CTNA 2ZKWA 5AYQA 5IFHL 3F7YB 4PMFA 2YPLA 3S7GA 3VFPB 4N2IA 4GQPH 2VLRB 4UQAA 4Z18A 1SM3L 1KNOB 1N19A 2J44A 4ICWA 3VFMB 1AXTH 1HI6A 4FI6A 4J5VA 2V6HA 4PJEF 5ISZB 4XP1H 1FRGL 4MS8C 3ARBA 3FUIA 3RIFK 1CQYA 4AEHL 4XNAA 4ES9A 3R4DA 1I8AA 1O7SA 3LKNA 3N91A 4E9SA 2NNAA 4M7LT 3QR0A 1LP9A 4P46D 2ZWYA 4DKEL 4P49A 2CA4A 2EYRA 3CTTA 2XTLA 4OF3A 1CXHA 1NMAL 5GRVL 2J7LA 1NDMA 4YZFE 3ZIMA 2JE8A 5DI8A 3L3GB 1N68A 3QFGA 2NT1A 2BVQB 1VKXB 5E2VH 5TE4L 3DBXB 1S78D 2JV6A 4QRPE 2KYIA 3IU4H 4UT9L 3CZKA 5C0GA 4N8CL 1PQZA 4H7VA 1MCRA 2ESVB 2DQDL 5HPOA 1IBGH 1Z5HA 2VDMH 3AREC 3IDYB 4JQVA 1QRNB 5D2LA 1E6OH 1BF5A 4O02L 4LDEB 3WIAA 1K2DB 4OIBA 3KWXA 1AO7B 3E6FA 4UOW0 3O3AB 1GTFA 5BOPA 5LN4A 2HLEB 2Y1AA 1KFGA 2HUEA 4HSCX 4NN7B 5FUOH 2EIMB 3FFOA 1E65A 1V10A 4KVCH 2IWEA 2UYLB 4H8VA 4FQXC 3QSKB 1P7HL 8CGTA 5B1CA 3DGGB 1IUZA 1YEIH 1XH0A 3WNNA 4L0PB 4ETQB 5EZIH 5IHZB 3VXNA 1KB5L 4PTUB 1BVKA 3L4WA 4DAGL 1RVFL 2HT4D 1N4XL 4Z7OB 2B5IC 4HJIA 1SXBA 3IETB 3LS5H 3LZFH 2ZAGA 4DNLA 3L1FA 1X6LA 4DVBB 3C09B 3QRGL 4PIRF 4OFYA 4JDTL 2XKSA 4QXWA 4PLKC 2DLTA 3TU6A 1KY7A 4QHLB 2OL3H 5I18H 5CN1A 4JHAH 1GZQB 2YZ8A 1M7IB 1C5BL 5JQIB 1LEIA 5CFHA 3V5HA 5JLZB 1SEQL 3UO8B 3LZPA 4HC1H 1B0WA 2QLYA 3QUXC 3W5NA 3P30L 5D7JA 1T7YA 2P7TB 4OF0A 3U0PB 4E9QA 3M1BB 4Z7WE 1YEGH 2WKOF 3SBRA