5DCCA

X-ray crystal structure of a tebipenem adduct of l,d transpeptidase 2 from mycobacterium tuberculosis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
352
structure length
352
Chain Sequence
DLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
publication title Structural insight into the inactivation of Mycobacterium tuberculosis non-classical transpeptidase LdtMt2 by biapenem and tebipenem.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 89
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dccA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dccA02
4GSUA 4HU2A 4GSRA 3TURA 4JMXA 5E1IA 5LB1A 5DC2A 5E1GA 3U1PA 4QRAA 5E5LA 4Z7AA 4ZFQA 5DCCA 4QTFA 3VAEA 5DUJA 3VYNA 4LZHA 5LBGA 1ZATA 4K73A 4GSQA 5DZJA 5K69A 3VYPA 4QRBA 4XVOA 5DZPA 4HUCA 4A1JA 4A1KA 5DVPA 1Y7MA 3TX4A 3ZGPA 4A52A 3ZG4A 5DU7A 2HKLA 5E51A 5D7HA 3VYOA 2MTZA 3ZQDA 4JMNA 4LPQA 4QR7A 4A1IA 3U1QA
chains in the Genus database with same CATH superfamily
3KPRD 2H3NB 2TRHA 4LPXA 3ULSA 1DBJH 3H53A 3DOHA 4JG1H 1KJ2A 2WBJC 3SYOA 1VF5C 4YH6A 1CLOL 2NNFA 1OW0C 3Q8AA 4X7EC 3S7GA 3Q6FA 3ZK0A 2L8AA 4WFGD 4CNIB 3VI4A 1ACZA 2VDPL 4GRLB 4WO4B 4L8SB 2EH7H 5LGKA 1D2PA 5CJQH 1SFDA 2MOGA 3QORA 4GSDL 3WXWL 2WVSA 4C56E 1MXDA 4J1UA 1ET5A 1LO0L 4Y9BA 1KLFA 1Z5HA 2GK0A 3U4AA 4JRYD 3Q2CA 4O02A 4Y5XC 5EV7A 1ZLUK 3BUYA 4R90H 1TNMA 5DMKA 1U8LB 3H9SE 5E2TL 3TT1L 1ILSA 2W65B 4A67A 2WQSA 4XX1E 1B4JH 3V9FA 4D0BA 2AQTA 2NQCA 2UX7A 3JWOC 2WWMC 2NY0D 5DWUL 4FQLL 1K8DB 1SHWA 4AEHH 2UVEA 4O00A 3IDMA 1UOLA 1I8LC 2GSMB 5DZPA 2KI6A 3FO1B 1WBYB 1A2YA 4MDJB 4I1RA 1HHIA 5GS0D 3BVNA 4XZ4A 5FC9A 4PJ5E 1QSVA 1RSYA 3QO0A 1BBJB 1SXNA 3UMTA 2WIMA 1FN4A 4HEPG 5EIVA 3DI3B 4JAMB 1M7DA 3UBXB 4PD4K 3MRDB 4XNYL 1SQ2N 3VD5A 2OL3L 1CLZH 1F2QA 4G43A 2AANA 5BQ7B 4XXWA 2X9XA 2WMPA 5LGYA 3FH8A 5H37A 3ULVC 1KBVA 2AXWA 2VABA 2BY0A 2FJSA 1N4XL 4L1BA 4A1JA 2R69A 3BSGA 1XR9B 1N59B 4P3WA 3APNA 1UA3A 2NY4C 4Z7OE 3ZRCC 4JB9H 3JWOL 2ZSWB 4AQ8C 3V4VH 3F7QA 5EA0L 3BVXA 4OFYA 4KMLB 2GJRA 4K9EC 4YSDA 2AVFA 3HRZA 4FHBD 4NQCE 5GJTH 2JMRA 1DE4B 1F02I 5DK0A 1EUTA 3NCJL 5DFAA 3R4DA 2BSSA 1UKSA 4PJHA 1TZHA 3BAKA 2EIDA 1OF0A 2O26U 2C9SA 2XYCA 4KKLC 4B0MB 1ZGLB 5DGQA 4IKLA 5DS2A 5FCUL 5FYKD 3CCHB 2Q86A 3V6ZA 4FG4A 5DLLA 1NGWA 2QGEA 4NHUA 3LZQA 4ONFL 1XCQA 4M5ZL 1KTDA 2WOYA 5TQ0H 3N0AA 2YAQA 5PAZA 4NB7A 2E5EA 5IT2H 3T8VA 2XA3A 3RX7A 1CFTA 1UVQB 2OFQA 3MLZH 4J3OD 2ZUTA 4RCAA 1L7TH 5CP7A 4GG8A 5L0QB 1J87A 4PS7A 4JANB 3QR2A 3W11D 1DVUA 1XL4A 5DHVA 1GAFH 4YSOA 4FYTA 1LEGB 2KS0A 4JO5A 5E9DB 1VFAA 3ZXAC 3SO3C 1I53A 2VZTA 3MLTB 1TPXC 1JERA 2KLSA 4JHAL 2EDJA 3MRHA 1SOQA 2GB2A 2BVOA 2VM4A 4QF1B 1EXGA 2Q6WA 4YVUA 3ZZSA 4OLUH 3CSYA 3TURA 2CCVA 3M17B 1A7PL 5FFGA 2DQMA 4IU2B 1KPRB 2XN1A 4FQJH 4XVTL 2AJVH 4B9YA 4ALAC 3II1A 2V5TA 3RTQB 4H4NA 3SDXA 1IBYA 2AQQA 1OAYH 1JJUA 4RIRB 3V4PH 5ITFB 3LRSA 1VGEL 2DY2A 3NFSH 5D1XE 2H45A 5EU6E 1AXTH 5HVGB 4PRIA 3VXQA 2DKUA 4W9ZA 4F58H 4Z3IA 3F2LA 3FONA 2IPUG 1NCWH 1N19A 2OYPA 4KQ3H 1AGDA 1QHPA 2KPNA 5AL0A 3FU3A 3ZX1A 1P4LB 4NZFA 3KWUA 3WJLA 1HL5A 1DQVA 5BZDA 2E6PA 4XPBH 2JIXB 1FV1A 1T89C 4FQXA 3ULUH 2Y1YA 5CUSH 3RILA 4G42B 1S46A 1BEYH 4LZHA 3WU1A 1G9MH 2FX7H 3QUML 1CDBA 4ABQA 2LQRA 2HKHL 3EG9B 3KL0A 4PW9A 2HKFH 4FF9A 3AG2B 1RV6X 2OMWA 3DUSA 3O4LA 2E8ZA 3BVUA 5CWSA 2EDFA 3T04D 4B3VA 1P4UA 2AQSA 4PBVC 1H0DA 2G2NA 2Y2WA 4FQQB 2J55A 5DEJA 4XCCH 1H3PH 3T0AA 1FL5B 3T2OA 4XBPA 4R26L 2RGSA 3QR1A 1K2DA 3L17A 4OFYD 4OVUA 4UIKL 1N2RA 1YMMA 5D5MA 5C1MB 1QSFE 3CFEB 2MCG1 3MLPA 2YLHA 3HBGA 1DO6A 4NDMA 4CL7A 5M7QA 5EOQL 1FVCA 2BOLA 2VLMD 2YFNA 5BRQA 1BCIA 4JO1H 1JXKA 3NIFB 2B5IC 2NY1B 1FZOA 3KYMA 2Y6TE 4JL2A 5JOEA 4V1DE 3EF7A 1SN5A 3VTAA 3JTTB 4J39A 1E30A 3LZPA 4HJJH 2PCFA 2QGCA 4YBQC 5KBDA 4C4UA 4DTGL 5MENB 1MIML 3VFMA 4WKXA 3C5ZA 4KRPC 4MAUH 3FN3A 1LMIA 5DUML 1KPUA 5E94A 2I9TA 3KXFB 4AUYA 1J48A 5L2KA 2LV4A 3DX7A 3HI6L 1HHKA 3EYOB 1JPFA 4GW4B 4HUNB 2V9UA 2WXKA 3I9PA 3RL2A 1KCLA 2CIIB 2XCMC 4LKXB 4D9LL 3D9AH 1MCEA 3OM3B 5EU4B 1FNLA 1Q8MA 2FJFB 2QPUA 1PIGA 3S5LA 3BWUC 1NCAH 1DQMH 5E70A 1QLEH 3OMAB 1MHCB 2C3XA 1INDL 1LD9A 4IKNA 5TK2A 1B9ZA 2DEYX 2Q10A 5FKAA 3FHQA 3GJFH 2SODB 5B38B 1VKXA 4I9WD 3A67L 5LCVL 1X4XA 3T3PF 4ELKB 3BQUC 4OZGA 4WK0B 4KJWC 4Z7QF 1JSYA 3CJJA 4K5LA 2E7MA 1NTDA 5IHZB 3BD5A 4NC0B 4G1MB 3QDJB 2OPCA 4X83A 3EYSL 4G9DA 2OMUA 1AI1L 1R3IL 3BT2L 4AQEB 4BDVA 1JWUB 1N5YH 1OCWH 2RQEA 1YEGL 1NKRA 3P4NA 4MXVF 2ARJQ 5FGBA 2R2EA 1GZPB 4P2QA 2K7PA 2HFFA 2OSYA 4PRID 2ITCA 3OKLB 4AW7A 3GNML 3QFJB 4DN3H 2FBJL 1EEQA 5HGGS 3GMNA 5CP3H 5I75B 4ZRGA 4N0UB 4V11A 5AOZA 2DZEA 3W5NA 1PG7H 1V7NH 2PNDA 3SDYL 4FQXD 5KSBF 5DHEA 3TV3L 4NNXA 4TOYH 3VYPA 2VRQA 1J8HA 3H1ZA 3D18A 3H8NA 1E28A 4QKXB 1G7MA 3VVVA 1HSBB 4WW1A 3WUWA 3LN9A 1PKQB 2RACA 2BDNL 3KPLA 3RA7H 4U1HB 1KUMA 5FUZH 5IMKA 1AQDA 4AYFA 5BZWA 1ZHBA 1NBQA 2ITDB 5A2AA 4M9OA 3NPSB 5DZVA 4ABWA 2D7NA 2A4ZA 3SGKA 1JV2A 2D0GA 1TQWA 1ZK9A 3D87B 2JKJA 3QYCA 4P5SA 5E7FA 3T0EE 5ISZE 1UTDA 1BQRA 2Z31B 4JQXA 4MXQC 1A22B 1CVSC 1MRDL 1YMMD 1P9MA 3EDFA 2D4FA 2P45B 1KB9J 1IGYA 4OU3A 5BV7B 2DW5A 4M93B 1G7LB 1UH2A 1F90L 3L4YA 4M1GH 1HH6B 4LPUA 4B5EA 2PF6A 4W1TA 2VDKB 2UZIL 1MFCL 1MUJA 5IW1A 2QVMA 1V05A 2EO1A 2GI0A 2R9HC 4L3AA 3G6DH 3FCTA 1FHNA 4K7PX 3FU5A 3KYNA 3WMPA 1JGVL 2YQ3A 4GQZA 3ZDYB 3Q13A 4TQPA 4GAGL 3V9CA 4M03A 4HS3A 3OBAA 3C5ZD 3PREA 4ZPTA 3H7BA 4PJCA 5L2KD 2H3XC 1CU4L 4UDTA 2XZZA 4TNEA 3V8OA 2Z7UA 1ESOA 3IAPA 1T3FB 1KB3A 1CXHA 2BNQB 3GWJA 5I8CA 1J1PH 1Y1DA 3VXMA 3SZKC 4K8RC 4EUPA 5MHSD 2HFGH 3VXTA 5IHWA 1JCKA 1SBSL 4N90D 3RJOA 2IXQB 4X5WB 3O2DH 4Y8AA 5HHMD 1CI5A 1T22A 4Q2ZA 3D48R 5AVSB 4Z7NE 1U8NA 4JPVL 5A16A 4ZTPL 5CZVH 4I89A 2VLRE 2V17H 3WE6B 4P2CG 2H8PA 5CJOL 4K71C 3X1NA 2KDGA 3T3MF 3IMBA 2G5BA 3EYUL 3FQTB 2ZSVA 4ZBJA 4I18A 4P5TC 4B53A 3N1GC 3O6FB 2DBLL 2JK5B 4ZS7L 4Z9KB 5J0BA 5CAYB 1MI5E 4H25A 4WCYH 4PJ7A 4G8FB 3ERXA 4PJDB 1C08B 1DVSA 3AREC 1HEJC 3DROB 3UP6A 4P2QD 5EIIA 2E7HA 1DLHA 2BVPA 3KEDA 4LDOB 4HT1L 3MRBB 5FLVA 3GMQB 5H94B 4LOUD 2QQLL 3TEXA 3T1WA 3KNBB 4QAMB 5DMGC 5A2JH 4X6DE 1JWMB 4XO8A 4GRMA 2ICEB 1P2CA 4PY7A 1MHEB 3FB7A 4FULA 2KZWA 3TA3A 3BISA 1J8HD 1ET7A 1K8IB 3ARPA 3O6LH 2K6YA 4YZFF 1KNOA 4NQEE 1FL3B 1K4CA 1FO0A 5C07E 4OGXH 5AW4B 2CUMA 4WTWA 5AKTA 4BUGA 1XF5B 1U8JB 5HI5D 2IGFL 3U48A 3ARDC 3BLBA 4P5KB 2IQAB 3GMMA 3GSNH 4PJAF 4ZQTA 5ACZA 1R9FA 3BP7A 2C3HA 5TH2B 1F2XK 1G6RB 1SQMA 2NXYB 4PJGE 5LQBL 3ILPA 4OD1H 4H8WH 3NIGB 4N8CL 4Q52A 5LO7A 3HCVB 4F37F 4JZOB 4WY7H 2WKOA 4RAHA 5ABDE 1S7SA 4KAQH 5M95B 3ARVA 1D5RA 1CE6A 2IFGA 2YMXH 1M1XA 1UWFA 3LNFA 3LN5B 3PGFL 2ZYIA 1T1ZB 5LBSH 1JE6A 4AK2A 1H19A 5I71C 1BOGB 3RNKA 5D7KD 5F44A 1ZANL 5AW6B 5BVJB 3WFDL 4DAGL 3WS6A 2LAGB 4IIQA 2WANA 5F7FA 2G2RB 4K73A 3TNMA 5IM7A 1B2WL 4HWZB 5BXFB 4N26A 3V0DA 2ZG1A 4JFXB 1QW8A 5E8OB 4R8WH 3V95A 1RJYB 4CU7A 4NEHB 5JHLL 3H56A 1H8OA 3VGGA 2EVFA 1W80A 3EZ8A 3MJ7B 2WSPA 1INQA 1DJYA 1LVEA 2YD7A 4LFHD 4HLZH 3VXMD 1YY8B 1ZIBA 2JQAA 1OSYA 2J44A 1QHOA 2X6MA 3E8UH 3H9YA 4ZDHB 5IQMA 3EXJA 5FW8A 1YRKA 3CFCH 3BIKB 5IW3A 3FUFA 1KGWA 3F64A 3EFFA 4OQ1A 3NCWA 3KPOA 4KKCD 2BFVH 3L81A 4TL4A 3JTSB 1T5WB 1DBBL 3FYEB 4UF7C 3FRUB 4XH2B 4XVUD 1TLMA 3TEZA 2I26N 3E3QE 5ITBL 1CURA 1MRFH 1RULL 1Y1UA 1RSFA 3DJZA 3HFML 4KJYA 3AT9A 4YDKH 1W72L 3QS3A 4OCRH 1WA1X 4POYA 4R9HA 2YO3A 1LO3L 4GS7B 3TT3L 4CNIA 3G7TA 5DA0B 1YDPB 3CN0A 2F8VA 4XCNB 5B1JA 4L3EA 4GRLA 4C4KT 4L8SA 5C0DB 1T7VA 4M6AA 1UOKA 1KYAA 1NKGA 2OV0A 1SOSA 4H0GA 5HP5A 3NJJA 5D6CA 2VOTA 1YEDB 4J6RH 2LLNA 2BP3A 1U8LA 4WU7B 2XTJC 2W65A 3ZKNC 3WN6A 2W0LA 3L13A 4H2CA 5E1AB 4LZKA 2ALAA 1FZJA 2VDRL 3RBSA 4TULH 3U4BH 6TAAA 3TA3D 4MDJA 1QSEB 1WBYA 2VDOH 4X9IA 1MQKL 2YUWA 3SE8H 1OAZL 3ORJA 4JRXE 4UOQA 4UCFA 1BBJA 2FB4L 3ZHKA 3UBXA 1YJDL 3NJGA 4JAMA 4BCYA 3OB0H 3MRDA 4MA8H 1MREL 5KSVB 4HIPA 3U36B 1Q9WB 2GC4C 4ACTA 5J13C 4ODWB 1CDHA 2WVTA 3AGWA 5BQ7A 5L88L 1YZZA 3TH2T 3ZDZE 4QT5B 5GPRA 1A7NL 2Q76A 4NSKB 4FAAB 2QGDA 3QH3B 3EYQD 5EOCJ 1KENL 4XT1C 1JPTL 4NQDE 3BQUA 1XR9A 4N9GB 2XG5A 4OSUH 2EECA 4F93B 2WNGA 4M43H 4A2FA 2ZSWA 4GI6A 5JNYB 3QCVH 3VSQA 3F7RA 4PWEA 4KI5E 4YGAB 1KJVB 2ZE0A 3V6OE 3LSOB 2A73A 1EERB 3SPGA 3W0WB 3UTTB 3NAAH 4MJIB 5T33H 3W57A 5IJKA 2CCLA 5T5FA 3APCA 1R3KB 3CX5K 1R75A 3LPWA 3WL9B 1ZGLA 4JMNA 5L4IA 4G6KH 5BCAA 2O93L 3EBGA 4WWID 3CCHA 3QRLA 1T0PB 4X9HA 5B4MC 2K0RA 3FTZA 3B9DA 1G4RA 2MJWA 3N1MC 5D72L 3LZOA 4GRWH 5E99H 5C8JA 1EDHA 1AE6H 1SY6H 3DI2B 4JGNA 3F5WB 2NYYD 1UVQA 3AAZB 4N0CC 5AVUB 3TN0B 3AG4B 4OCNC 3UJJL 1QZ1A 1UWXK 2EDHA 5C6TH 5IHBA 4BELD 4JANA 1KIPB 4LLUB 1R19A 1VRSA 3QEGH 4YHML 5IB4B 2PW2A 4XCFL 1NAML 2X9YA 3SPIA 4MNGE 1S7RB 1LEGA 3JYBA 3MJ9A 5E9DA 3GUTB 3MLTA 1WZ1H 2R4RL 4OD2B 4ZMTA 1CIDA 1TQBB 4TQHA 4GRLD 4QF1A 3W38A 3W37A 2VDQL 4MRCA 4C58B 5DZOA 3C9NB 1FVEB 4EQ2A 1NUFA 4IRJB 4R7DA 3M17A 2C3WA 4JFEE 3LIZA 5I9QC 4HUVB 5KUMA 2LVCA 4Y4KB 2IBGA 1VCAA 2EYSB 1KPRA 2K9UA 3IU4L 5G55A 4A6YB 4C59B 4NP4L 3RPBA 4N28A 1OSEA 3RTQA 1I9IL 2E47A 3BE1H 3FUDA 4RIRA 5KJ7E 3EOTL 5ITFA 3DX6A 4S0SD 2VITB 1KTJA 4R2GC 3GO1H 1KB9K 1KXVA 2CKBL 4I0PC 4XN8A 3VG0H 4ZUWB 3X1GA 2I27N 4XO4A 7PCYA 1O9VA 2P7TB 3GSRB 2JCCF 1F4WL 2IO5A 1OCZB 1TTFA 4K5MA 3BSZA 1GCYA 1P4LA 4KVNL 4WI7A 2D31A 4DQOH 1MPAH 2EUWA 2QMJA 1KCUL 4LL1A 2JIXA 1MQ8A 2FO1A 2BK8A 2Y1ZA 2Y6SC 4G6JL 3N55A 1J5IA 4P9HH 1KB5H 4G42A 2FZ3B 1H3XA 2D7OA 1L4IA 3MKGA 1C9SA 5E08H 3C2AL 3SBWC 4ATTA 3BWZA 2PW1B 3EG9A 2KLRA 5HHOB 5MEOB 1HKFA 1EBPA 2QFRA 4F8TA 4MA1B 1FUNA 3OC8A 1CR9L 2I85A 4FQQA 1V3JA 3BQUD 4CBZA 2C4FT 3LQZB 1CO1A 1FL5A 3D5OF 4IBZA 1VEPA 4BFGA 4P5TA 1G9HA 4FKHA 3II2A 1WAAF 2WLMA 5F3FA 2GTQA 3TGXA 1J1XL 3QCTH 2QSTA 3H54A 5AW3B 3ULUE 5CLZA 2IH3A 3CFEA 3N3EA 4WWKC 3R7QA 5KW9L 1NFDB 3EGSB 3GMLB 4NUJB 1XF4B 1GGTA 5FEBA 2IPKA 4ZODA 4MBOA 4RESB 5SWSB 5IWLC 4Y1AA 5CBAA 3TESA 1IC7L 5TFSH 3JTTA 4ZSOB 3AROA 3MRFB 4ANWA 2G9HA 4QLWA 4N2MA 3VD4A 3ELAT 3G5YA 1MIEL 2GSIB 1EIBA 2HRHA 1IAOB 2BP0B 4YDIH 4P49A 4BCXA 4GW4A 1MWAB 4V2CB 3Q9QA 5DQJB 3IDGA 2CIIA 2DQTL 2DI7A 4GG6E 4LKXA 4XC1H 3BAEH 2Z7WA 5EU4A 4D8PB 1WGOA 5KVGL 2FJFA 3EH4B 1CICB 1EEUA 3L6FB 2FEEL 1MHCA 2FHFA 1FI8C 5E9DD 2YR3A 4WFGE 4FABL 2YD1A 2CUHA 1MFAL 3MBXH 5GS2D 1IEAB 2KQMA 2WQRA 4LNVA 4EDXB 4WTZA 4P8QA 4ELKA 4F1SA 2DWEB 3QBTB 4MXQD 3UC0L 1KCWA 5F72S 4YHOH 1MF2L 2GT9B 3VE0B 5IHZA 2YEZB 1PIFA 3B34A 5FGCE 5HSFA 1JYWA 4E36A 5IBTL 2B1OA 3D0LB 4YN3A 4JRYE 4GO8A 3QDJA 3H2PA 3AFLA 3RTQD 1BQHB 4TRPH 2AF2A 3NZUA 1D6VL 4F37K 4AQEA 4QXUH 3N43F 3US0A 1OTUD 2X1PA 2AP2A 3IGFA 3CVIH 1YNLH 1GZPA 4A39A 4F3FA 1MCPH 2EADA 3LQAH 4NNPL 2FH8A 3OKLA 2CHXA 4JZJC 4EVNB 3QFJA 1JDAA 4LVOB 2TSBA 3AU1B 3DX8B 1T2JA 2VDLH 4N0UA 4Z3HA 4CC4C 5K9KB 2ISDA 4ZW3A 3QRGL 3CHXA 5AZEH 1USQA 2JIXD 3T2LA 3DO3A 2NNCA 4K3JH 1JF6A 2B1HH 1CGSL 5L6YH 3QPQC 3O2VL 1ZY9A 1TOXA 1OEZW 3MLXL 5A7EA 3KS0H 2A9BA 4KVCH 1Z6JT 4E68A 1HSBA 4U0RC 4JHZA 5FYJH 2B3RA 1X3DA 3UZVB 4D3CL 3KPSB 3N85H 1PKQA 1CMOA 3PFQA 4LLQB 1THCA 2HYMA 3LH8A 1NDTA 5HDRA 2PTUA 5EHFA 4HC1L 1X5MA 2ITDA 3A47A 3C08H 3PYCA 2YN5A 2NY6B 3HZ3A 4NFCA 5B39A 4OFIA 5DTFB 4DKEL 3HFFA 4PSRA 4NJ9H 4LRNL 3IFPB 2Z31A 1QAWA 3CXDL 1A6UL 1E4KA 1OVZA 3FO0L 1G7LA 4X6CB 1GHFL 3N91A 2XV6B 5HDWA 3OXSB 3S35L 1G5AA 1HH6A 2GUOB 4QJ3B 4PJEB 1X9RA 4BBWA 2F58H 2NY1D 4IJTA 5IJCC 4Y1AD 4DT2A 2XIBA 3APMA 3P3RA 3Q9PA 3B6SB 1ADQA 4JQIA 2UXGA 3QEQE 5C7XL 4GXVL 3DETD 2AK1H 2JKXA 2P9RA 3BZFB 2YQBA 1T1XA 5D4HA 4XP6H 3SOBL 2YLKA 3QP3A 3VMPA 3UO1H 3KXFD 5JHDE 1WD9A 4DK3A 3GBDA 1TCMA 1T3FA 1TJGH 2BVUA 4HAGA 4JPQA 1JGUL 3VRLE 3PXHA 5AW2B 4S0TD 5T3XE 5E4AA 2V0AA 4XHQA 2IXQA 4X5WA 4ZS6C 4BK5A 3RVTC 5LHDA 4YE4H 1N6QL 4R4BA 2EDNA 4FTVE 3BN9D 4HBCH 3WE6A 2FX8L 2HXAA 4U31A 5F6HJ 3ARXA 4O4YH 1JV5B 3FQTA 2AXGA 2BH0A 4E9TA 4EXPX 4XNDA 2YK1L 3NACH 1IC0A 1ODAA 3O6FA 3ZO0A 1WISA 2JK5A 4XC3H 1HHGB 5A6MA 3QDJD 4N1HB 4ZK8A 4LEBA 4P05A 2CNZA 4POUB 4XPAL 3GZQA 3IPEA 5HJDA 2MCMA 4EI5C 1C08A 1RUQL 2P44B 3DROA 1T2QH 3O9WB 1FAKT 4Q8BA 2CJ3A 5AENA 1JPEA 3QFJD 2I69A 1ZWIB 3MRBA 4JKPH 3GMQA 5H94A 4TLTA 1ZS8B 3X1FA 5T3ZD 4X80H 3O0RL 4OIFA 3KNBA 1N8ZB 2GBUA 3V9EA 3WKYA 1B3JA 2BIOA 1U8KB 3SQOL 4BRVA 3D3VE 3MGTB 4MD4A 4PP1D 2OCJA 1KLGB 3MV9A 4QYAA 4HGMA 1P7HL 3SKMA 1X44A 4HCIA 4QRTA 4XNBA 3RZCC 3DWTA 4PGJA 5AG8A 4PS4L 4UB0H 1K8IA 3S8WA 5I28A 4Z3GA 1PKOA 3QRFM 1JGIA 1FL3A 4XAKE 4BCZA 4EZKA 5K9JH 1I31A 6PAZA 4MVBC 4FZ8H 2W1NA 1OP5H 1U8JA 2BXYA 2JVUA 3MUY1 3ISWA 4P5KA 3L5WA 4NN6C 3OMIB 2EAEA 4G83A 2Z31D 2NZ1A 3VFUB 1G6RA 3MLYH 3FTSA 1R24B 3VNYA 2CUIA 3L54A 4LOEA 3TBWA 1XCXA 1AFVH 3FU7A 3HCVA 4JZOA 2XTLA 4FS0A 3HA0A 3LHAA 4JY5L 2VLME 1BQLL 2D8KA 2IH1B 2DTML 3ZT7A 5EUOE 2FQEA 3LN5A 5D7SL 3SKOB 1T1ZA 2ORBH 4J12A 4W9IC 1KPVB 3OHXB 1M3JA 1BOGA 4Y4FB 3MODL 3BUIA 1UG9A 5BVJA 3QIWC 4NAJA 3GJFK 1LK2A 2NTSP 2XTJD 3ULAB 3A6BH 3EDEA 3OZLA 2G60L 3GSVA 1CBVH 2G2RA 2V3EA 4XXCC 4Y5VB 1S5IL 2AJ3B 5BXFA 2D3NA 2RALA 4BYHA 2C9QA 1U9KA 4JFXA 4UT6H 5E8OA 2NW3A 1RJYA 1G9NL 3RVUD 1QFWI 2YN3A 2VGLM 3MJ7A 1T66C 2GJ6E 4TN9A 3F7YB 2BNQD 3L9YA 4AGMA 5CN2A 4NAQA 5DQDH 1YY8A 1P6AB 4PHXA 2WGXA 4ZDHA 1I8AA 2G30A 3CLFL 3NJNA 5GS1C 2EDMA 3BAWA 4M5SA 4CKQA 1DJZA 3BIKA 3ECQA 3JTSA 5F9WC 1T5WA 4XH2A 1KCRH 4DFIA 4TQIA 5F71A 3V0IA 4Z7WB 1OT2A 5JDSA 3E7JA 1JZGA 2DIBA 3HNVH 4FXGC 3VXRB 3K71B 3O6FD 1CG9B 3UAEA 4NKOB 3ZGHA 5HJGA 1YDPA 3MV8B 3NK3A 4IOSA 4XCNA 4L48A 1OPOA 2QQKL 5C0CB 5KWYC 3GKZA 4JRLA 4N5UA 5C0DA 2WHVA 5FXCH 4FFVD 4JN1H 3U0PB 5MEQB 1KGUA 4ENED 3S3DB 3DBXA 2EIZB 4FXKB 5E4IA 1DQDH 2HG0A 5CCHE 1JZFA 4OV5B 2EUZA 1YEDA 3LZLA 3QPXL 3UBFA 1WWWX 2CJSA 2W38A 1XDTT 4HHWA 2DI8A 4X7SH 1HOCB 3TIDB 5T1MB 3IN2A 1SRDA 1V5JA 1AHWB 2R56H 1AQKH 1EHAA 4QTIL 1ZDSA 4J3SA 3MSPA 5E1AA 3GB7B 3ZE2B 4D0CB 3L7FA 5JW4Q 1MEXH 2ICWB 2MIZA 4WFHD 1BGXL 2C9RA 4KBPA 1B3IA 4OCSL 5CINH 5FM5M 4PWJA 3PJNA 5DUJA 3CFKB 1RZ7L 3FCSA 2OL3B 4FMFA 4B9GA 4WWPA 4U6HB 2PR4H 2XXMB 4GUCA 5KBLA 1Q9LB 1EQWA 3RY4A 2HWZH 4P2OC 1SJVA 3IETB 1NCUA 2OMBA 4UTBL 1FA4A 1I9JH 1KWGA 1Z9MA 3V10A 3ARGC 5D93B 5KSVA 3U36A 2RR3A 1Q9WA 4ABVA 4ODWA 2AGJL 2H1PL 3RWCA 3D25A 2EQDA 3KHQA 3QZLA 1X4YA 4WEUD 4U1GB 3UTSB 4HEPA 4QT5A 3RB5A 4LBAA 1ZGLM 1YMME 4KDVA 5DYFA 1OP3H 2DYPB 1HU8A 5SWQB 2QR0B 3GI8L 4N9GA 1QBBA 3FN9A 1A7BA 2ZYHA 4W9CC 1QNIA 1RVFL 5D1QC 5INCB 1MJUL 5JNYA 4K07A 1HNGA 2ARJB 4XOEA 2GKIA 4PRPE 1QEWB 4WGKA 4B9KC 3PQYE 3LSOA 4UT7L 2Y5EA 4HFUH 2QSVA 3MRRB 4Z0BL 3W0WA 3P69A 3WXVL 2Q7NA 4MJIA 3UTTA 2HLFD 3IMTA 1MWOA 2EICA 1SVBA 3ESVF 3NRQA 3O8XC 2WBKA 4TNVF 4OFPA 3WL9A 1M57B 1UH4A 2ZICA 1ZJBA 4DJMA 1XGYH 2CRIA 3WUZA 5IJVB 1CN4A 4OJAA 1K5WA 2QPFA 1MHHB 1QBLL 3F83A 4NQTA 4JO4L 5GGTH 1JXDA 4ZFFB 4LLMB 1ODUA 3RDJA 2CA4A 4FZEH 3ZKSD 4Y4HC 4A1RA 3BMVA 4EOWL 4A63A 3S2CA 3F5WA 5CO1A 3AAZA 4X4XB 3TFKC 1JFQH 1QFPA 4LB8A 3ARBB 1GC1H 4GYBA 3OJVC 2EDXA 4LOFA 4LLUA 1KIPA 4ZMOA 3TJEL 5HVHB 5IB4A 5HY9B 4WW2B 1GOGA 2X4RB 3FCGA 2UX6A 4NJAL 1JGDB 1A6PA 4KZDH 3DUHA 5D55A 3U9UB 3QHFL 4OD2A 3FQNB 3KHOA 1OP9A 4LLDB 1WEJL 1XMWA 3POHA 5KVEL 1FAIH 1K3IA 3C9NA 3W39B 3B7SA 4GRWE 1L9OA 4IRJA 2X0UA 4FI6A 4HUVA 3DGGB 5FA4B 12E8L 1OV8A 5EB9A 5I5RA 2EYSA 5I1DB 3BIBX 1BD2E 1B4RA 3CU1A 4M02A 4XVSH 4Y9EA 2HMID 3KJ4B 4FHKA 4N5EC 5EPMB 1E4HA 2VITA 4XN4A 3FT2A 3QUZB 4WVRA 2PXYB 4X5RA 4WV1B 5ALBH 2NY5C 5LN4A 4YJZL 3NESA 4ZMPA 5IFJB 1YN7A 4ZUWA 1JHKL 2NNAA 2P7TA 2Z6FA 1NBZB 3GLAA 3OKDB 3OPZH 4KKBC 1M7IA 3FFCA 4PCYA 2Y2TA 4O5LL 3T77B 4PJIE 4XP9H 1O5DT 3CXHJ 2FCBA 5FS5A 4FFYA 1ZV9A 3CFNA 1EMTL 1AJ7H 4J8QA 3VMNA 3FB5B 4L9LB 5E6SB 3IAGC 1NCCL 1S9KC 3HMXA 1IQWL 2DRUA 2X2HA 2FZ3A 4PW4A 1EAPB 5KANI 2PW1A 1VDGA 2VLKB 2DLFH 5CKAA 1SYVB 5HHOA 3UAFA 1EHNA 4A2GA 3UBGA 5K5YA 1ET8A 4LHQB 5D70H 4BSWA 3L7EB 3AWFA 4LL4A 3APFA 1NWOA 1ZT7B 5HD8D 4MQTB 2GBVA 1D2OA 2A6KB 3LQZA 2E7LA 2ZQKA 3SDCB 4G3YH 3HG4A 4I88A 4LSRH 1H3GA 2VDMB 5AVVB 4PPTA 1UKQA 5DFTA 2C1OB 2WO3B 2H0JA 2C3GA 2D3LA 3HLAB 5GISH 3O0LA 3W0WD 4A2MA 1NFDA 3UTTD 4MJID 4FG6C 4P9ML 3CZUB 2AS5M 1MRCH 3EGSA 3GMLA 4NUJA 1XF4A 1YSOA 4AYGA 2RFXB 1F8TH 4R97C 1KDJA 3N6YA 3KZ8A 5GGVY 3BSHA 4HCFA 2J5LB 2BSTA 2W0PA 2VM3A 2P80A 4U4BA 3RPIB 3MRGB 1A47A 5AZ2H 2V33A 4NQSB 5LAXB 2EVJA 4RFOL 4ERSH 2MHAA 1R3LB 4FMVA 1Q0XL 4Q6IC 2PWFA 4ZSOA 5DD5H 3MRFA 1E5CA 3GDCA 3S88L 1XH2A 4H8HA 4EKXA 1V3LA 4RMSA 2GSIA 2J4WL 4MMXC 1IAOA 2BP0A 1N5AB 4ZNCD 3LH2L 3QIUB 4TSCH 4U7MA 2Z0UA 3N50A 3NOIA 1OSZB 1MWAA 3TN0D 2WWNA 2XN0A 4XX1G 1N7ML 4D8PA 4FLOA 2OCFD 4LIQL 4UV4H 3KVQA 4MTMA 4AEIH 1J8SA 1JNNH 3W56A 2I07A 2HVJB 1CICA 3LS4L 1NPNA 4LPCA 3T65B 2BHUA 1CGWA 4R6UA 5TJWK 3V52H 2YRZA 4OJFL 1IEAA 4D7PA 5CIPB 1T0NB 4MCZA 1HXYB 4PRNB 5CZXC 4EDXA 2K4AA 4G8EA 4L1DA 2DKMA 1AXIB 2Y7LA 2GT9A 1YN6B 1OTSC 2GCYB 4IRJD 2YEZA 3GKWH 4JG1L 4L4VB 4XOCA 4NKIH 3FPYA 1RZKH 3D0LA 1EJFA 2HSIA 1EHKB 2VMJA 3D0AA 2I60H 4RLDA 3A3YB 3VVWA 4JE0A 4ZAKB 4Y5YB 1I8MB 3AS1A 2EH7L 1XV8A 3QG7L 5CJQL 4EVNA 2KC0A 2CGZA 3AU1A 3H2WA 1NA8A 1U6AH 3FFCD 3DX8A 2WK2A 3L3DB 4KC3B 4R90L 5K9KA 4I87A 3L95B 3OG4B 1EWHA 1LJMA 2YSSB 3QFDB 1DCLA 4OF0A 4FXTA 4ZUTB 5JHAA 1B4JL 3KCPB 2EVIA 3UACA 4MAZA 2Y23A 2M8XA 4R4FH 4AEHL 4HWBH 2OR9H 1W15A 3PPSA 5D2NB 3NA4A 1N3NB 4MJ5A 4QRQB 5HHOD 3UZVA 3KPSA 4BWTA 4MYPA 4HJSA 1EGJH 4F33A 2B14A 1KULA 1ZA3B 3OKNB 2YBRB 1KCVL 4N0YH 3H0TB 5DTFA 4HHGA 5DURB 1I7ZB 4MDIB 5JPMB 4NZ8A 4U2ZA 3IFPA 3NEXA 2V9QA 5A2KH 1CLZL 2OA9A 2ZKHH 4X6CA 4DQAA 2HT2D 1GYWA 3MCG1 5KAQF 1J8KA 2LW3A 3OXSA 3C5XA 4QJ4B 1QX1A 1JI2A 4PJEA 4G7QB 3A4DA 1MHPH 2WINB 4JB9L 1IE4A 1OE3A 2P80D 3V4VL 4L8BB 3NSFA 2X2IA 4DEWA 1ORSB 3B6SA 3RFZB 1JZHA 2AJYH 5GJTL 1UZ6E 3EO9H 2X41A 3BZFA 4R4ND 4U1NA 5LVEA 3HAEG 5IB3B 4YC2C 2O6DA 2UUDK 1ROWA 2FQFA 2AQ1A 2VM9A 1FWXA 2DYRB 4QRSB 3T09A 1EAQA 1E3XA 2GHZA 1FG9C 3LMJH 5I1HH 3S48A 1RJCA 3EBIA 4P2OA 1KXQE 4EN2A 4Y19E 3L5XH 1CICD 2D7PA 4MVBD 3LEVH 4OZFH 3O3DB 4XP1H 3EAKA 5TQ0L 4XX5A 5IT2L 3N5AA 1QFWH 5C71A 3MLZL 1NMBH 4W81A 1NCNA 3CBKB 5AVQB 4BE6A 1L7TL 4EZLA 2XWRA 2WBWB 1JV5A 4FQHB 5DHMC 3HKZA 1BQUA 4H88H 1HHGA 1GAFL 2DF3A 3HI5H 1BXXA 1PSKH 2E27H 3KDPB 5EN2B 4PH8A 2VC2H 5AB0A 1BPLB 3P54A 4TVUA 2DEWX 5CN3A 5IQ7H 4KK9D 4UT9H 2Z35B 4WWNA 4OLUL 3O9WA 5DU7A 3QHZH 4PIBA 1NCTA 3DRQB 5FK9A 5JOPE 1ZWIA 5HI3D 5CR8A 3O8XA 1LWRA 1ZS8A 4FQJL 3PRZA 2AJVL 2QGBA 1LL1A 1A3ZA 3BGFC 1N8ZA 4WQOA 5GHWH 4N8VG 3I84A 1U8KA 5HGBB 4AG4H 3MGTA 4TNVK 2DJMA 3V4PL 2B16A 1JF5A 3PDOB 4PJBF 3VI3E 4BZ2H 3I3BA 3NFSL 3EOYG 3MNWB 2R29H 3C5SB 1AXTL 2BNUB 4JFFB 4F58L 3UYRH 5ID0A 1LP9E 2ZUYA 3KPSD 3GI9H 4BD4A 4Q4EA 4DKTA 4PLNC 1DVFC 1F41A 2D3VA 4XPBL 3GIZH 1T4WA 3ULUL 1ZV2A 3UX9B 4NQXB 2NY6D 1WAPA 5C6PB 3HC4H 5CUSL 3WN5C 4I2XB 1ZHNB 4YHYC 1JF1B 3T5WA 5D6DA 4DEPC 2H0FA 1I85A 1G9ML 3VFUA 2FX7L 1G0DA 1BXAA 1EPFA 2IVFC 1R24A 1IAIM 3BWAB 2HKFL 5FO7B 2DI9A 1NGXB 1EAOA 2BCMA 2HG5B 4KUCF 4MKMA 2IWFA 2D7MA 2IH1A 3IXAB 3WGUB 3O45B 4XCCL 1H3PL 1T0MA 3ILQD 3PL6C 1AGFB 3CFQA 3SKOA 3RJQB 2DM3A 1KPVA 3OHXA 2OXGB 2JKTM 1FP5A 1UCBH 2IG2H 4Y5VA 4A7QA 4G82A 2AJ3A 1BHGA 5DJCA 3KM2A 5IROA 4UWQB 4JPSA 4NC2B 4L3CB 3AITA 3G5XB 3CZKA 2KKQA 2MQCA 2P5EB 2D9QB 1DQQA 2DOCA 4GQPH 3F7YA 5DFVD 5J3HC 5JW3H 2L7UA 2CU9A 4TVPD 2OW7A 2ATKB 3QI9B 1LNUB 1TTGA 4Z78B 4P2OD 3AMLA 5FDWB 2GFBB 4K2UH 1W72B 1WITA 3OKKB 5JHBA 4HJJL 3U6RB 2EXWC 4Y2DB 4NO0B 3PJSA 2JKWA 4MAUL 1II4E 2XJLA 1NM4A 1S3RA 4PJFB 4ODTH 3I6LD 3FUMA 5IQNA 4Z7WA 3A6CH 3D9AL 3Q5OA 3S35X 1E8WA 2ERJB 3K71A 3LD8B 1XO8A 1FG2B 4YHLH 4ODXB 1NCAL 1CG9A 1DQML 4NKOA 1QLEL 1NIFA 1NANH 5FV1L 3L3OC 3INOA 1EV2E 4MB5A 5C0CA 1A6VH 2VSCA 1CDIA 4PJGF 4OM1H 1W6WA 3U0PA 3OTTA 4LARH 1HS6A 1G5GA 3IKKA 3O9WD 2EIZA 4FXKA 4OV5A 3A4FA 1FE8H 2G4GA 5FYKH 2XZQH 2YPLE 3BPLC 5GS3A 5JIPA 3SD5A 2X12A 1HOCA 4GEIA 3TIDA 3PV6B 5T1MA 1T5KA 3IMVA 4HQQH 4MB3A 4N1CA 4HV8A 2XV0A 15C8H 3FTUA 3GB7A 4D0CA 1N5YL 4NUGH 3UABA 1OCWL 2ICWA 5AVYB 4RMUA 5I5IA 4XPHH 3CFKA 2OL3A 4DN3L 5DJ2B 4GFXA 3SZ6A 1DUYB 4U6HA 2IV8A 1KJ2H 1QBAA 3MN8A 1TU2B 2CZNA 5FO8B 3K6OA 3IETA 3NJMA 3TFKD 4NO2B 3CK0H 4XVJL 2DM2A 2A74B 3G6JE 3MLUH 1PG7L 3P4OA 1V7NL 2Z8WC 5SWZA 5TTRA 1RK7A 4CJ0A 4OGYH 3PHSA 4ORGB 1TJMA 3K4DA 5BRZB 4TOYL 2DQEH 4AL8C 2LU7A 4FG0A 2WZ6A 1PZ5B 3UTSA 1R5IB 3EKCA 2FNBA 3TV8A 3ZMNA 2DYPA 2NY7H 1KV3A 2IDUA 3RA7L 1J86A 5FUZL 3BAYA 1SVZA 5E6RB 3VTMA 2VAJA 5I6XC 1HYSC 1KBKA 3QISA 5INCA 3U7YH 3CIQA 1ZK5A 4FI8A 1TYEB 2ARJA 3ESMA 4D0DB 3ISRA 2X1XR 4Y4FD 5D4IA 1AO7E 2FUQA 4JDEB 4OM0H 1BJ8A 2HRPH 4Y8DC 1HC1A 4PJAA 3MRRA 4CVZB 4E41B 4XWGH 2PO6C 4WWOA 1ECYA 1TZ8A 5MENE 2CPUA 3NK4A 5IROD 1ITBB 4OGZA 3O4OB 1QLFB 3GMRB 3KXFE 4M1GL 3L3JB 3WKPA 4B9FA 4ZO6A 4D9RE 1CYGA 1E43A 2ITEA 1MHHA 4WUUB 3Q2LA 3VFOB 2PYFA 3G6DL 2F19H 5C70A 2V7HB 3WKNA 4ZFFA 1JPGB 3U4EB 2LGNA 3APDA 3I50H 5I1CH 1NAMB 1T20B 3BUTA 3OZ9H 1HE8A 4ZX6A 3K8LA 1TTAA 5DQ9B 4AIZB 5AW1B 4X4XA 3WMQA 4F20A 1C7TA 1G7IB 3ARBA 3PS6A 3PY9A 2VDQB 3K6FA 2BY2A 4TTDD 4AKOA 5ADOH 2EE6A 1ZHKB 1J1PL 5HY9A 4WW2A 4ZT1A 1PNCA 1DFXA 3DURB 1IKNC 5ADPL 3D85B 2X4RA 2HFGL 5JQHC 1EZUA 4K7FB 5TE6H 2QFPA 4HWEH 3O2DL 3MV8D 1OCCB 4XBMA 4A2LA 3FQNA 4HS6B 4IJ3C 5C0CD 4AX3A 4NPJA 4LLDA 2EKSB 4Z7VE 3CMGA 1JZ4A 3W39A 2H2PD 2V17L 3Q8FA 4YS4A 1AMXA 1L9TA 4F9LC 5FA4A 2VN5A 2CKBB 5CEXB 3ZQ9A 1OP5K 1P7KB 4X9GA 3KBPA 4YEEA 5JPNB 2RJMA 3KM1A 4NZJA 3WEAA 1GS8A 3RVXD 3VA6A 4AWJC 5EPMA 4WCYL 5CSZB 3QUZA 1G7HB 3BJLA 4WV1A 1HIMH 5IFJA 1C8QA 3LS5H 4MCYB 4BHUA 4OQTA 5F7DB 4BKLB 4RMTA 3OKDA 1NBZA 4WI9A 2N0KA 5J1SC 3T77A 5FOJA 2XBDA 1Y0LA 5FHAL 4UI2A 1A21A 1TENA 3SKJH 4L8DB 4XMLH 3FB5A 4L9LA 4L4TB 4RGNB 2P24A 2V5YA 2A9MH 5SWZD 4JM2F 2ESVA 1JHTB 1NEUA 1SOKA 3UFIA 3E6FB 1L6ZA 3DXAB 4LF3A 4ES8A 3P4LA 2VLKA 4QRUB 3QJZA 2C9VA 2F0CA 5ANME 3UTSD 1PX8A 1AC0A 1U2HA 1J0JA 1D3CA 3ZRFC 4E9QA 4ZI8A 3L7EA 3O6LL 5IKCB 2DYPD 2R7EB 3V5HB 1KN4H 4OGXL 1A3RH 3NEOA 2A6KA 1SJXA 3SDCA 4E9VA 1IGTA 1NCJA 3EYFB 3MZTA 1GYAA 3OXRB 4AYMC 3GSNL 3MREB 1UEMA 5F1NB 3UBXI 4EPSA 4NGHH 4QGTA 4LVHC 2CLVB 3Q6GH 4WHTB 5KS9E 5E0FA 3HLAA 4LEOB 2HA1A 4OD1L 1C5CH 3PDGA 4H8WL 5CD5D 1SF5A 3ROLB 5TGBB 4J4PA 4KY1H 3QUXB 4WY7L 1ANUA 3R8QA 1AC6A 2FATH 3CVHH 3FCBA 4KAQL 3IWUA 2YMXL 3RPIA 1J5CA 3D69B 3IJEB 3MRGA 3QG6B 5LAXA 4DKFH 1GYCA 2BNQE 2LTQC 3HS9A 4OJCA 5FO2A 2IANB 2GHWB 2ZX8A 5JLZB 5JIKA 1B90A 4Z3JA 3GRBA 1WFMA 2Y3AA 3KH4A 3QIUA 1L0XA 2AJZB 1H3UA 3MMEB 1OSZA 4R8WL 4BKTC 1NL0H 2FD6H 4C56B 5JDJA 1TFPA 3ARBD 3CN3A 5LGHH 4QNPE 4UZUA 4PI0A 3IM1A 5E6YA 1E5AA 1GVIA 2B9AA 4PTUB 3IF1B 3E9UA 3D2TA 3WE1A 5IFAH 1DVFA 2HVJA 3E8UL 2EXTA 2UY6B 4LVEA 3T4AC 3T65A 2CM6A 3W9DB 4LVNB 2ICCA 3CFCL 4TYUA 5LDSA 3AJ7A 4B9CA 3FU6A 5CIPA 2BFVL 4LAJH 1HXYA 4PRNA 2R0ZH 2NR6A 1UFUA 5GSVB 3B9KC 4PJDE 3FQRA 1YN6A 4X0KB 2GCYA 4Z7IA 1MRFL 2XICA 3HB3C 5JTWA 4L4VA 2XY2A 1JZIA 2BO0A 2XRAH 3N40F 2VSDA 3FAXA 1GOHA 3LEYH 5DHDA 3GDBA 1WYJA 4NENB 4OF3A 3TBYB 1CL7I 4BV1A 2W95A 1U8CB 4PJ8B 5K59E 1KN2H 4B6ZA 4ZAKA 1WVZA 1I8MA 3HPLB 3OLGA 1UHVA 1NMCB 1VHPA 3QUZD 1OP3K 2GSGB 4DP2X 3FULA 4KK6C 3PNWB 2HVBA 2UY7B 4PBDA 1PYWB 5CZRA 1J0YA 1AOHA 2IF7A 1Z3RA 3VB9A 4JCWA 4Z7OB 2YSSA 3VX0A 3C60C 1JHLH 1DANT 1A9BB 4F24A 3QT2A 1LO2H 2XIDA 4UNUA 3GYRA 2RAMA 1QEXA 4NQCB 1VZHA 4Q6KA 3NA9H 4TULL 2VLKD 1IBGH 4WI4A 2FLMA 5D2NA 1N3NA 4AMKH 2VDOL 3RL1B 3SE8L 4AQ1B 3FF8A 4YBLC 5CM1A 3RUGE 2W9DH 5IVXE 1V27A 2F7RA 3HMWH 3DIFB 3NIGE 4CA4A 2QKIB 2X4PA 4NOBA 1PLBA 1ZA3A 1DBAH 4MS6A 3OKNA 1EVTC 4JO3H 3H0TA 4OIBA 5F8QC 3B2VH 3SDCD 2ZUXA 4MDIA 4MA8L 5JPMA 2OMZB 1W0YT 4JFVA 3G9AB 3HBZA 5C09E 4AJWA 1R0AH 3BWSA 4AZ8B 2ZJSH 1UFGA 1NGZA 4OLXH 1T83A 4AYEC 3QNYB 4KK5C 2AEPL 2VDPH 3V55A 4Z7UF 2XYBA 1INEH 4J4PD 4OSUL 1EFXA 1Q90A 1ND0B 2QSCL 2WINA 1A1MB 4N24A 2PYEE 1WTLA 5GZNA 4M43L 3WXWH 3QCVL 3KLKA 4L8BA 3THMH 2J1KA 4KOBA 1ORSA 3BAXA 3RFZA 4KGJA 2ED6A 5D4QA 2RA1A 1WAAA 5I1IH 4W9FC 3NAAL 5C97A 1IAKB 5TDOB 1KYOJ 4L37B 1CI3M 3TEUA 3QIUD 4Q9QH 4QRSA 3UZEA 2L7EA 5CJXC 5ERWB 2FIKB 3US1A 5AEAA 4G6KL 4MQXC 3TJHC 2Q2EB 4UZGA 2PN5A 1SFHA 1NAKH 3QR0A 3MGOA 4TXVB 4BH7B 3BPNC 1ECZA 4PJXE 5LB1A 4U33A 3LJ3A 4NXSA 5FYLE 3O3DA 4DK5A 4XAWH 5B3JF 3N41F 2Q3ZA 5E99L 2J2ZB 3SPCA 1SY6L 1AE6L 5CMAB 2DH3A 5EBGA 4XBGB 5D1XB 3RGHA 3RWDB 2IQ9H 4BM7A 2NR6D 4KK8C 3O11B 4IIZA 1ZATA 5CU5A 4HXBH 2CRYA 2FEDD 3PWPB 5C6TL 1BYOA 5D4JA 4HZLA 4QCIB 3TO2B 3QEGL 1X7SA 1CDCA 3VFWB 4FQHA 4L4VD 4LHUG 1AQMA 4ELMF 4FNPA 1N4XH 3QEUB 4AH2B 4PGEB 5F3HB 4JPKH 1WZ1L 2WV3A 2YKKA 4DKDC 3JWOH 1H5BB 3BD4A 4P9HC 4ZAKD 3KYOB 4Q9CA 3DPDA 5EULV 2FECI 1EX0A 3ECVA 3DRQA 4WHYG 4E5XG 4F7CB 1HZLA 1DDHA 4F5CA 3L4ZA 2YGVA 1QSEE 2O5NA 3VRIA 2D7TH 2DMBA 5HDQH 1JPSH 1CVRA 3BE1L 3DK2A 3IBOA 4M7ZB 4UINH 1BVLB 1YEIL 3PE9A 3HS0B 2WZ5A 4QRPB 4X6EB 1A8ZA 5J3HD 3FFDB 4JKKA 4JX0A 3RIFF 4JFFA 3C5SA 2BNUA 3GO1L 4MKTA 3VG0L 3BZ5A 1LHZA 1QSFB 3RHWK 5I6MA 1CK0H 3ULVH 2Z92B 1Q0YH 3TP4A 5DRXB 4HU8A 1THAA 4J3OF 5E4EC 2DLIA 4OGAC 2VN4A 5A2LH 4OJEH 4DQOL 1MPAL 3T0BA 1MW3A 5DMIH 1HSAB 1QFUH 5D7IE 4NQXA 4P9HL 4W6WB 5DURD 1PNDA 3V4UH 4I2XA 1ZHNA 1KB5L 4V1DB 3EBHA 2Z1KA 4K9EH 3TH4T 2XLLA 3OPUA 5E08L 1NIAA 4H5SB 3QDGE 1TVHA 5FO7A 4JRFA 1PY4A 2HG5A 2GW5A 1UYWH 1DJXA 3IMSA 4GSUA 5BQDA 3IXAA 3FPXA 1EFXD 3O45A 2FDBP 1LE9B 4HGKC 2IV9A 1AGFA 1JG9A 5GZND 4CW1B 5JHLA 1X5XA 2PCXA 3CUPB 1I8KB 3AXLA 3QCTL 1NEZG 3SE4A 2VYRE 1E5ZA 2OXHA 3BGAA 1CD1A 3D50A 4X9YA 4L3CA 2P1YA 1FO0H 4OI9A 2WZPA 2P5EA 3DOIA 4M6OH 1K72A 3VD7A 2ATKA 3QI9A 1LNUA 4Z78A 4Y0GA 5TFSL 2GFBA 5FDWA 1IIIA 3OKKA 1CFNA 3U6RA 4F2ME 3SBQA 4NO0A 4W9EC 1U4EA 3AMKA 4YDIL 1P7QB 1S9XB 2J6WA 3H3KA 5J6SA 3K5SA 3T1FB 3MBEC 3QUMH 1UB5B 3RZWA 4XC1L 3BAEL 3DX9B 5G4MA 1FNGA 4QOKA 1WBXB 1FG2A 1IO4C 4ALAH 1CGYA 3X11B 4NHCL 2XVBA 2VR6A 4EAEA 1KEGH 5EC2B 3V79C 3WJJC 4WRLA 1LO4H 4KWUA 1OANA 2DKSA 2YZ8A 3MRKA 1A0QH 4YHOL 2DEXX 4LCIH 1S6NA 2WWOA 4PJHF 4C54A 4F80A 3FSWA 1QTSA 3UEZA 1LM8V 1RJLB 5EOQH 3PV6A 5I5JA 3PCYA 1J5OH 4TRPL 3WNMA 4WKZA 4LHJB 3D39B 4QXUL 3T0EB 5ISZB 1MZYA 5E6IB 4GQQA 4PB9H 4D2NA 3CVIL 1YNLL 4LE8A 1ZVNA 4JFFD 1MCPL 5TE4H 3TZVC 3LQAL 1QI5A 3ZYOA 4GQRA 5DJ2A 4PJ9B 2E9WA 3D4ZA 3ZIYA 4LLWB 1TU2A 3RDTC 5FO8A 3GTNA 5IR1A 2VDLL 5D2LE 4CUCA 1L0PA 4NO2A 5JW4R 1RHFA 1XH1A 2A74A 5AZEL 4N0FB 1UXMA 4FFWC 1E3FA 4K3JL 1A6TB 5L6YL 2B1HL 3HOGA 3R4RA 4D9LH 5BRZA 3T4AA 1NFIB 2ZKMX 3EJJX 5AOJA 1BZ9B 3ET9F 5JYLA 4J3OG 5C2UB 4KVCL 2IEPA 4QHKI 4GKNB 4X7CC 5FYJL 5DD3H 3N85L 4U6VH 4DP7X 4AIXA 1OE1A 3NH7H 3A23A 1OB1A 4NZDA 5LCVH 1VLXA 4B9PA 5H4YA 1TQCB 2AITA 4D0DA 3EDJA 3DOSB 1HTYA 4BSJA 4NJ9L 5SWSE 3U83A 4AI7A 1A7OH 4L1HA 2HT3C 3QA3B 2X42A 4CVZA 1Y6NR 2EDDA 1Z66A 2H26B 3EYSH 4Z7NB 1RUAL 1FFPB 1ZT4B 2JE8A 1QLFA 3GMRA 3L3JA 3ZR6A 2WZPD 1PFCA 1AHMA 3JYCA 2P5ED 2N4IA 4TQ8A 5DJYB 3K80A 3OR6B 1W0WB 2F58L 1T7ZA 4WUUA 3VFOA 1URIA 4M7LH 4NUQA 1WPCA 2V7HA 3QI9D 1JPGA 1U3HC 5DDHB 3U4EA 1XGTB 1MI5B 1XZ0B 5I1LB 2W8CA 1NAMA 1T20A 2AK1L 4IK7A 2XNAB 3EBAA 3T71A 4NO0D 4XP6L 1T0OA 5DQ9A 3ZTNH 3F6JA 4UQAA 4AIZA 3UO1L 1WC7B 1JZ3A 3U9PH 3IDUA 1HHHA 3B43A 1CLVA 3Q06A 2APFA 4GBXC 4XCYA 1TJGL 1ZHKA 2CRMA 5CLYA 1X5FA 1PD6A 3DURA 3D85A 4KPHH 4K7FA 4X6DB 3KPPB 3P73B 5HGAB 2GPZA 3MRPB 4YE4L 4DHLA 5H37G 4HS6A 1BIIB 2C1PB 5D5MF 4LSDA 2IOIA 4MDRA 4PGBB 5T5FH 1NFAA 3QRBA 1NDMB 4HBCL 2NNXA 5G5DB 3EO0B 5F7NC 1HCYA 4HUXA 1KOAA 4KTDH 4I8DA 4NQEB 2Q9OA 4O4YL 4XTRD 4J2QA 5CEXA 1P7KA 3QAZB 1GSMA 1I9RH 4XC3L 1F90H 4IW4C 3M45A 5E5RB 5IEKB 5CSZA 3UC2A 3QB7C 1C5DB 5H4ZA 1G7HA 3ECWA 1PBYA 3GT6A 4A2DA 4ZFZB 2CO6B 2ZCZA 4FDWA 5F7DA 2VO8A 5AG9A 3ZHFA 1T2QL 3QUYC 1UQSB 2CWRA 3QDAA 3ZOAA 2J12B 1OM9A 4XMZA 3CC1A 2CD0A 2P8MB 3B83A 1CL7H 4JKPL 2BZDA 3QZBA 5DRZB 4X80L 2CGYA 2YJQA 3WO4C 3ATBA 4PHZA 5J6GB 4BZ1H 2H32B 2VWEE 3FBKA 3MJ9H 4L4TA 4FNSA 1P84K 1JYXA 4KFZC 1AAJA 1JHTA 2VW7A 1KYUA 3E6FA 1CGTA 5E51A 3OHMB 3CFUA 1NUNB 5BRZD 4XI5D 3G3LA 5DJ6B 4QRUA 3OKMB 4NZRH 4UB0L 1MG2C 3A6OA 4MJ6B 1DZBA 3LIZH 5IKCA 3KMDA 3V5HA 2R7EA 1ID2A 2OMYB 3PLYA 5K9JL 4BXVA 3SCMB 1SGKA 1JFHA 4FZ8L 5EU7E 4APQC 2CXGA 1IB5A 2IAMB 3EYFA 3KYKH 4OT1H 5JO5B 3OXRA 5F1NA 2JI3A 3H2QA 2CLVA 2DBLH 4WHTA 2NQDA 1RZFH 4LEOA 4FA6A 3N1FC 4LOVA 1MDAA 4NFDA 1AFVL 3ROLA 1FH5H 5AUMB 3QUXA 1Z3GL 4O51B 3F3HA 2YKLH 3KPQB 4NO5B 4WF7A 4MA3B 3EFDH 1RURL 1D6EB 1TMQA 1E6JH 2UZYB 5BOJA 1DBMH 3IJEA 3QG6A 4XZUB 4HKBB 2ORBL 5HYJE 5IMMB 4LGSB 3FO2B 4WUUD 2E8YA 3MTRA 2DIJA 1IVTA 4U0QB 1LLAA 4K8RH 1PG7X 4L3FA 4RFNC 1T5XB 5KYUB 2IANA 3A6BL 1D9KC 1CBVL 3EOAB 4M8RA 2E56A 4JDTH 3TX4A 2AJZA 5DZLA 2QPSA 2XFXB 3IYLW 3MMEA 4N8PA 4UT6L 4YLBA 4CAGA 5CKGA 1DN0B 4C56A 3C8KB 5TDPB 5F7WC 1LWJA 1TG8A 2V37A 3L4TA 3IF1A 1KTRL 4GXUN 5DQDL 5A40E 3H9SA 1D5XB 2UY6A 2MTPA 3D85D 1E50A 3W9DA 1O7SA 1H6TA 1WUZA 4TM9A 1CYWA 1RUPH 4J3XA 4JG0H 3RTLA 2ZKWA 2FO4B 2Y5TB 3DYMA 5GSVA 5JIQA 4HKZA 4DIXA 1GKEA 1KCRL 4MD0B 4JN2B 2K9FB 3K1KC 3WTVA 2IDQA 4F2FA 5CLWA 4PJ5A 4AE0A 3HNVL 1VCBC 2MKWA 4MAYC 4NENA 3TBYA 3WIFB 4OV6F 3WNPA 1U8CA 2WB1A 4ZMYA 2DLTA 4HS8H 3ENEA 1IT9H 4PJ8A 3SE3C 3HPLA 2X4NA 3BUPA 5EUKA 4JN1L 3ZDZB 3LZRA 2AAVA 1JIBA 1U92A 5AKSA 5EZPA 3WDHA 1WCBB 4DAGH 3DRTB 1DQDL 2UY7A 4WK2B 1PYWA 4XNQB 5HGHB 1CQKA 4PJCF 4H1LH 3VTTA 4NQDB 4X7SL 2QBWA 3J8F7 1OALA 2Z7YA 2R56L 4V33A 1AQKL 2YPVH 1XSIA 3RGVC 1CFMA 1M7XA 4L4TD 4RGND 3U1SH 4MQXD 3ZE0F 4HFWB 3TJHD 4DK6A 4AMWA 1MEXL 4W9DC 3P02A 4NQCA 4G11A 2GYSA 3SE6A 4K7PY 3GLEA 3RL1A 2OX5A 4AQ1A 1I7RB 3CPUA 3MCYA 2PR4L 1GPOH 3M6DA 1U0QA 3DIFA 4D9QE 2HWZL 2QKIA 4WJ5B 1DBBH 3H6JA 4NWUH 1Z7JA 3S5LG 1I9JL 3AC0A 5HHNA 4XBEH 4B41A 3ZKMC 4F7PB 3WLWD 2OMZA 3EUDA 3HC3H 2APXA 3RJDA 4OR1A 4HJ1A 2HX8A 4AZ8A 3QWRA 3V4VB 1E9QB 4BK4A 3BT0A 5DLMH 1N64H 4PJ7F 3TT3H 1CLYH 2ENQA 3NJIA 3ZHLA 4PGDB 3IFOB 4ZMVA 2Q7AA 4DW2H 3FN0H 5T3ZH 1GGUA 3QUXD 3WFEL 2F15A 4F7MB 4WI0B 1ND0A 2GITB 1A1MA 3FCUB 3SO5A 4RAVB 2J8OA 3C09C 3GEFA 2QHLA 1NZRA 2VR7A 1QATA 4MNGB 2CDGA 2IAND 2LVEA 2BC4B 2YFOA 2N0MA 1VEOA 4TLSA 1IAKA 5TDOA 1JD9A 4L37A 4RFEB 3Q2NA 2WSDA 4OLYH 4KQ0A 4JY4B 2EEAA 2VDRH 2FIKA 5ERWA 1XGYL 2B39A 5J1TC 4C56D 1SBBA 1QUPA 1IC4H 4JGJA 1MQKH 3RDTA 4B7IA 5KOMC 1OAZH 4Z7WE 5GGTL 4UAOB 3NJKA 3UG4A 3QJOA 4XMTA 4BH7A 3H9SD 3VXRE 5K39B 2LU4A 2YEVB 1A5FH 2NSQA 2WYHA 3K2MC 5F7BA 4CSZA 4FZEL 2J2ZA 3O2WH 3MV8E 3U9WA 4UQ2A 5CMAA 4KMTH 4XBGA 5D1XA 3HR5B 5EU6A 2Y7MA 1JTPA 3RWDA 43CAB 3O11A 1U21A 1JFQL 1FGVL 2KBGA 1ETJA 4CVWA 1GC1L 3K1DA 3KDMB 3BH9B 2NT1A 3TO2A 4D8OA 2J25A 4QCIA 2WKOF 2YEQA 5MI0B 3VG9C 3VFWA 5KSAC 2JB5H 3QS2A 5DC2A 1TEFA 3QEUA 4MMYB 2YD4A 4PGEA 5F3HA 4KZDL 4NLHA 4PJ8D 1B0GB 4RA0C 1H5BA 1ZLUH 4YQXL 3ILEA 3KYOA 3ES6B 3QQ4B 1F3DJ 3PPEA 2RQ8A 3ZE2E 1OGAE 3V4PB 4X9BA 3IK2A 3VXOB 4F7CA 4J5VA 4YK4B 4G8IB 5IHLB 2VLJE 2ITFA 1HN1A 3ALWA 2A6DB 3GRGA 1ASQA 2BVEA 4P4KB 4XVSL 2WUCH 3WELA 4FKEA 2RCSH 1BVLA 4KJPC 2KHAA 3HS0A 4X6EA 1UZ6F 2FHCA 5E1GA 1T4KB 3G5WA 3FFDA 3MV7B 5ALBL 5IF0A 5JIDA 4NQCD 4FCAA 1QSFA 4G7VH 2Z4QB 1JNLH 2XBZA 4S1RL 1BZ7B 3IDIB 3LH9A 3OPZL 3UTSE 5DRXA 4JBSA 1OAUH 2BJML 4XP9L 1S78D 2A77H 1H9VA 2P5PA 4LFHG 4FEIA 2A0LD 1AJ7L 1ED3B 1HSAA 1J8RA 4EUPG 4PLOB 1UJ3B 2OSXA 1UZ8B 3NFNB 3GRWH 4V1DA 4BQBA 3ZYIA 4GT0A 4OBSA 4PY8I 4H5SA 2WLJA 2DLFL 5PCYA 2IH8A 3QWRD 3VDAA 5KVFL 5J11B 3RWEA 3L1FA 5D70L 4ODSH 4DP9X 5IMLB 4HX1B 3DYPA 3FBQA 3GSUA 2WJ7A 3J07A 3ULVE 4GG6B 1LE9A 2KPWA 2VXTH 4G3YL 2VL5B 5EO0B 5EBLB 5T1LB 1PVHA 4LSRL 1P6FA 3CUPA 3IU4H 4YUEH 1I8KA 1NC4B 1RPUA 5C3TA 5DRNA 3RB7A 3SIKA 3LPPA 4YIQB 5GISL 5IBUG 5C08E 3VGBA 4H0IA 4TUJB 2EZ0D 1MRCL 1XSJA 5JHMA 1E42A 1N26A 1NSNH 2ATAA 1F8TL 2HRLA 4ZZFA 3CHRA 2YUXA 3LQMA 4PR5B 5IUSA 4LPVA 4F7TB 3D0VB 2HJFB 5AZ2L 4ERSL 4I77H 4M1CD 1NIBA 5C9KA 2IALB 3V6OC 2AEOA 5DD5L 3KG5A 5INDB 2VJ8A 2EIKB 1GS6X 1IEBB 3LN4A 1QLEB 4BFOA 3WD5H 1T03H 4TSCL 1P7QA 1S9XA 5D1XD 4PFEA 5GZOA 4ZTEA 3RX5A 3C2AH 3T1FA 3GJFB 1UB5A 3DVIA 3QUKB 3MAWA 4UV4L 2X10A 4AEIL 5EEUA 1P1ZB 2F2HA 1JNNL 1WBXA 4PV9B 5JIIA 1MFVA 2J8UE 3GXUB 3GZOA 3X11A 4JM2C 3ZT6A 4Q7DA 3V52L 4M8QB 3IFLH 1BJMA 2VR3A 3AY4A 4N20A 2IDTA 1Q1PA 1J1XH 2CBTA 1KY7A 1F86A 7CGTA 1UM6L 4PRAB 3OKEA 1TTUA 1O9ZA 3VNZA 5KW9H 1E67A 4NKIL 1RJLA 1RZKL 2HN7B 1EFQA 4LCWE 3VB8A 3P4MB 2HTLD 2ADIB 5L2JA 2I60L 4YOKA 3FXIC 3GSXB 5J1AB 1NOLA 3T0EA 5ISZA 5E6IA 5DRWA 4N2LA 3WFZA 3CHOA 1M56B 1QSFD 1X9LA 2FX9H 4QI3A 1NINA 4PJ9A 2ZYRA 4P5MB 4A7GF 4GFTB 1W6LA 2XN9B 1M2VA 2XPZA 3DMMB 1U6AL 4LLWA 1B0RB 3K7UA 1WCQA 5E23A 1E5UI 4J3BA 3ARZA 5MP6H 4N0FA 2JXMB 4QIRA 1A6TA 1WF5A 2AKRB 4IBTA 4KDTC 3GHEL 4V1DD 1SF3A 3EJYD 1ZV5A 4R4FL 4TSAH 4HWBL 2VE6B 2OR9L 2AZUA 2BIMA 3MFFB 3QEQB 4HSAC 3VQLA 1XR8B 1CFQB 4MZ3A 1F13A 2CLRA 2VH5H 1ETB1 1DFBH 2F53E 1L7IH 2AQRA 5T1JA 3CPLB 5JHDB 2XZCH 2TSAA 3WJMB 4LLYB 1MF2H 4HP5A 4N0YL 5TE7L 3LXCA 4MAYA 5IBTH 3IJ9A 5JXAL 1QA9B 1NOAA 1VGKA 3I75B 3E80A 3HE6B 4NUPA 5EZIH 4RH4A 2ZKHL 5AVXB 3NBNA 3RKDC 1ZT4A 1HX0A 3JV4A 4X99B 2WCPA 1MHPL 3L3KB 1S7TB 3RAJH 3TO4B 3OR6A 3S97C 1W0WA 1TVBB 1IC5L 2X1WL 2WN3A 4NWTH 3RVWC 4YFLI 2H2SD 5DDHA 1XGTA 3ECBB 1MI5A 1XZ0A 2AJYL 4MMZB 5ABZA 5I1LA 5DSCB 3EO9L 2GTWB 2DMHA 2XNAA 4BA8A 4G5AA 3DPBB 1X5GA 4BH8B 4XODA 3BEVB 4W6YB 5D1ZB 2V5SA 1P7QD 3HE7B 9PCYA 5GZOD 2WN2A 2YZ1A 4DEUA 3UBXG 3ME0B 3LMJL 3WAKA 4LCCB 3DHUA 1RU9L 4FJYA 5FPIA 5HPMB 2BFGA 4EIUA 2Y06H 3EGDB 3L5XL 4X6DA 3LEVL 2CHNA 2ZOWA 3KPPA 4HC1H 5HGAA 2N59A 3MRPA 1GW0A 2OSLA 1RAMA 4XP1L 2X1OA 2ZOLB 1BIIA 2WB7A 3ZSSA 5DVPA 4PGBA 5J9PB 2O61B 1QFWL 1IFGA 1NDMA 1NMBL 4LRNH 4W9LC 5F0MB 3EO0A 5G5DA 4IDLA 3EYVA 2APWA 2PP9A 1KSRA 1CFVH 2F7IA 2O5XL 4NQEA 4R5VA 1CDJA 2CNYA 5C07A 1WG3A 4JFUA 1WAEA 3KWXA 2A9NH 3HI5L 1JZ6A 1PSKL 2E76C 2E27L 5IEKA 1IFHH 2JJVA 3S8FB 3NFPA 1FFRA 1M3IA 3T0ED 5ISZD 5IQ7L 5E6ID 4ZFZA 2CO6A 1DJGA 5DYOB 4UT9L 3WEXB 4PJGA 1UQSA 3QHZL 2WLIB 2MNJB 3ESPA 4PJ9D 2NZIA 1M6UA 3OLDA 2DQDH 3GSWB 5F8RC 3WNLA 5DRZA 4WFFE 1X5AA 3DVGB 5EUOB 5B8CC 5J6GA 1ACYH 1RMFL 3AT0A 4AG4L 2ENYA 5ICYB 2VJ0A 1BOYA 4BZ2L 5I73B 4OZHE 1IGIH 5GGRB 3BPCB 2NY0C 3MVSA 2R29L 2V5MA 2ZWSA 5DJ6A 4GUOA 4XO5A 3UYRL 2EDOA 3GSNB 1R3HB 2ICWI 4EN3B 4H8QA 1UXLA 2WXLA 4MJ6A 1PZUB 5GS0C 2OMYA 4X8CA 1BP3B 4YSRA 1FYHB 1SXBA 3K8KA 1W8NA 1HEHC 3GIZL 3IJ8A 1NQBA 2CH8A 3RY5A 5HYEA 5JO5A 4IOFD 3HC4L 4FL4B 4P59H 2XWBB 4GP8B 2K3HA 2WPGA 4YSQA 1NCBH 4MAYD 4U6YB 3AGVA 1VSCA 2XQBH 3IKCB 1PZ2A 4N2AA 4XN7A 2CO7B 2D7QA 3FJTA 4QGYA 5HVWA 5AUMA 2AXHA 4Z0XB 4O51A 5I8KL 3KPQA 4NO5A 4HIIB 4FFYH 4UOW1 4MA3A 1RUQH 1D6EA 4ZXBB 4POZD 2W9LA 1RJZB 2JB6A 3BW9A 4XZUA 4HKBA 4PIRF 1SPDA 4M8UA 3FO2A 3IFNH 4K3GA 5I74B 4HEME 5B7MA 3VFVB 1J11A 2ZG2A 3NGBB 1T5XA 4W4OA 4PYGA 1MI5D 1J1OH 2Z9TA 1NEPA 2WW8A 1CXKA 3TPKA 3EOAA 4BEIA 2IG2L 5GS0L 5DO2D 5JW5B 2VW4A 4KKAC 2XFXA 3GXTA 1J88A 4JHWH 4MQSB 5T1DH 4YHIB 1DN0A 2XVKA 5IHHA 3C8KA 5TDPA 3AU0A 5KBMA 4M6NH 4DN4H 5JW3L 1TZOA 1WRFA 5FLUA 2VZ1A 1D5XA 1GZHC 3BRFA 1FNAA 5DC0A 4K2UL 5F3BB 1KBPA 3JXAA 1S9WB 4JLRA 4KGLA 5A2FA 1I1AB 2EXYC 1BVNT 2ZP8A 2GY5A 2FO4A 2Y5TA 3TVMB 3QXDB 1ZLEA 1VAHA 2OW6A 5DVKA 4J3OC 4MD0A 4JN2A 4ODTL 5ELIA 5A2BA 1EO8H 3CFIC 1D5BB 5FO9B 5LNDA 3D1MC 3KLSA 4HIQA 1M7UA 2WXIA 1I1RA 4NQED 1V8HA 3CN4A 3P2DA 4UQCA 3S3SA 3W11C 2Q1EA 3PWVB 1N8OE 3A24A 1WA2X 3MFGB 3WIFA 4JY5H 4JL1A 4MS8C 3GK8H 2X7LB 3UPCA 5IK3A 1A6VL 1F00I 1CIUA 2QVIA 4U1LB 1JZ8A 4OM1L 4RGMC 4RVBA 5F88B 3WLBB 3ZDYF 2DQJH 5DO8A 4LARL 4OGQC 1WCBA 2YMOA 2AMGA 3DRTA 4YSTA 2G60H 1W9XA 4XNQA 1A4JA 2XZQL 4O9HL 5FYKL 5HGHA 4NQDA 2VDOB 3GLZA 5HHQB 3PWLB 4KHTH 1USZA 5I23A 5DD1H 2LABA 2C3VB 1MNUL 15C8L 4PRPB 4HFWA 2FO8A 4G7YH 5KSUA 4KZEH 2CR3A 4NUGL 5L8LB 1MVYA 4I2XE 5J12C 1NCOA 4DP6X 4XPHL 4XRCA 2EDQA 5FWQA 2VXVL 5EF0A 4N6RB 1UXWB 3BVTA 4XVOA 1I7RA 2Y2YA 2ZP0T 3K4ZA 4TNWK 3TFBA 4BHUI 1KJ2L 2GC7C 3QO1B 3JQOB 2XC8A 2EIJB 2XWTB 5K93A 3CK0L 3TIEB 3MLUL 1IGJB 3HUJE 5E5MA 4B97A 4OGYL 1VIWA 3B1TA 3KVDD 4YBHA 1CPUA 3MOAH 1IBDA 3CFJB 4LESA 4X4ZA 2Q8AH 2YBGA 3V4VA 1E9QA 3N0PB 5B38G 2DLEA 4P23B 4G5ZL 4XXWC 4PJDF 2QHRH 1CFSA 4PGDA 3X1EA 3IFOA 2QQKH 5HYSG 4F7MA 5HGDB 4WI0A 1WV7T 2GITA 3EJQA 2WXPA 3OWRA 1Y7MA 4HAFA 4ILDA 3U7YL 3VFSB 4QHKJ 5BJTA 2FWUA 4PCTA 2WXMA 3RNQB 4MNGA 1R5VA 4OM0L 2HRPL 3U25A 3Q48A 2BC4A 3HRZC 3U1PA 4UILH 5CEZH 3B8SA 4ZOCA 4XWGL 1SXAA 1KDIA 4OKVB 3U30C 5CF3A 4RFEA 1NKOA 4QXVA 4GRWB 3UJIH 4JY4A 1YMHB 4OCSH 4JFEA 1XHHA 4PJFE 5HPOA 4KX7A 4JDZB 1BD2B 2F19L 1NCDL 2YA0A 5K39A 1KJMB 1IEHA 4UTBH 4YDJB 3I50L 5I1CL 1KXHA 5IY5B 3OZ9L 3IU3B 3LNIA 1COBA 3HR5A 43CAA 4H0HB 1WWCA 3FSZA 5L4MA 2AGJH 4CN4A 2JLLA 3DHJA 3VWKB 3CNKA 3KDMA 2A99A 3NIGF 3X14A 3BH9A 3QIBB 4PJIB 5DJDB 4YDLC 3GZPA 4AY0A 1CF1A 1IKFH 5IJBC 3VD3A 1JP5A 5TE6L 4HWEL 3IGKA 1MJUH 2TAAA 4ZOEA 1HL8A 3ES6A 2UXTA 3QQ4A 1BFVL 5K9OB 3VYOA 5IUCA 3V4PA 4LP5A 3VXOA 2R0KH 1XB3A 3LB6D 2FWLB 1FF5A 1OT4A 5HJBA 3SDAB 4G8IA 4KHXH 3WXVH 4TVPH 5ESAA 5HDBE 1JXFA 2A6DA 4NQDD 1RUKH 3TF4A 4P4KA 1BYPA 3ZTDC 1DANU 1BECA 2OQJB 4HBQA 2DH2A 1FZKA 3LKOB 3LHPH 4KI5D 3MXWH 4HMEA 4CC1A 2D9CA 1IGMH 1HIML 3CSPA 1HKLH 1LEKB 3LS5L 4FE9A 2Z4QA 1KB5B 4XB3A 2VTFA 3V5KB 1BZ7A 3IDIA 1E2WA 4F15B 4ADJA 1FJ1B 3WTSA 3VWJC 2ZXAA 3GXNA 3HNTH 5IB1B 3SKJL 1YPZB 1ED3A 4XMLL 2NSXA 2F68X 5KJRH 1T04B 5E95B 3ZR5A 5IB2B 3NFNA 2DWYA 2A9ML 4FQXC 2EDRA 4O2FB 5DVNA 4IQHA 4XP4L 5DHYB 1YEJH 3N42B 4KRLB 5EU3A 1WWBX 4NLAA 1QHQA 2YARA 3TCXA 9CGTA 1GJIA 1G1CA 2D2OA 3PXJA 4E41E 1QASA 5I0WA 1EHXA 2X0WA 5IMLA 1KN4L 2CPCA 4Y1TA 1A3RL 1PD0A 3FU0A 2B0SL 3MJ8B 4GG6A 1LEIB 4QTHB 3OJ2C 2PWHA 3BO8B 2VL5A 5EO0A 5EBLA 5T1LA 1BYNA 2GI7A 3QQDB 4F7EB 1MSPA 4FQCL 2WUBH 4DGYL 4OCYH 3Q6GL 1Z9SB 4YIQA 3SGDI 1RH8A 4TNFA 1C5CL 2BY1A 4TUJA 5I1JH 1XMEB 1W0VA 4KY1L 5CHNB 4NQQA 4LKCB 3EJSA 3WHE0 2FATL 3CVHL 3SB3A 2I24N 2D03H 4JFED 1DEDA 1KF9B 2DJSA 5IBUB 4F7TA 3D0VA 2HJFA 4S1DD 3HC0A 4MLSA 3F7LA 4JKLA 32C2B 3NJHA 4DKFL 4DO6A 2IALA 5B8CA 3L45A 1KBGH 1SUJA 4NERA 4NOFA 4AXWB 5LG1A 1K6QH 4WLCA 1KGIA 1Y6KR 5I17B 3OGCA 5F9JB 1IEBA 2JKIS 2XSKA 3GEWB 4RGOH 4S1QL 2DIAA 1UXSB 3C5ZC 5LUMA 2OI9C 1NL0L 3GJFA 1YQVH 1DZ0A 2FD6L 5JORA 2YWZA 2BM3A 1PJ9A 4Q9BA 3T6ZA 1KZQA 1JGEB 5IFAL 4FADA 2KYIA 1PL3A 5F7UA 1PAZA 5EG6C 1DJIA 1BJ1J 4M8QA 1H6UA 5EMYA 1XZWA 3M7FB 2L4OA 4YHNB 4QWWD 3AQXA 1R3JA 2R0ZL 3M86A 4LQFH 5CILH 1NGQH 2NY5H 4BQ8A 3BPOB 3B7TA 2AC0A 4WJG3 1S7XA 4PRAA 3GTVA 5LGJB 1SUHA 3MUGA 1OIOA 4FQ1L 3F8UB 2FJGB 2XRAL 1NDGA 3PIQB 3P4MA 3LEYL 2ADIA 5C0EB 2APVA 4UBDD 4P4KD 4HXAH 1AZUA 4ADGA 2VDLB 4CBPA 3GSXA 4M1DH 1KN2L 5J1AA 2AXFB 4G6AD 3UP1A 4GAAA 3RVWD 4GP5B 4ZO8A 3ULUD 3ATDA 4NP9A 3DXAE 5FGBC 4M4PA 1V7MH 3DBSA 4NBZB 4P5MA 1FORL 5A1AA 3DMMA 4AIOA 2XPGB 1U41A 1B0RA 1O5PA 3HG5A 4Y2LA 2N7SA 4GPVA 4LOUC 2BW5A 3BKYH 3I85A 4KX9A 2XWJB 1JHLL 1OLZA 1PZCA 2JJSA 4XGZB 2ZF9A 3BVWA 3GZKA 2AKRA 1HEZB 1LO2L 4P0DA 4HUWB 3EH3B 3QUGA 2VE6A 2EDEA 3ZTCC 3QEQA 3NA9L 3UH8A 1IBGL 1U58B 1R5WB 3J2PA 4XWOD 2R1XB 4AMKL 1CFQA 4CN6A 3KLQA 3K0WA 2ZCKH 2CO1A 2AEIT 1S7QB 4M61B 2W9DL 1L9RA 4HISA 2NUPB 5TK4A 4C83B 3HMWL 3CPLA 5EFIA 4CC0A 5JHDA 4F8NA 1OARH 4DCQB 3ABKB 1DBAL 4L29B 2ZWZA 4LLYA 5KVDH 1EHLH 3N9GH 4JO3L 3FNKA 2BIQA 3B2VL 5HI5C 1NC2B 1U2YA 5T1LD 1GMIA 4Y19B 3FAWA 3SGKC 1R0AL 1BXUA 4GW5B 1QA9A 3I75A 1JYNA 1EJ6A 2ZJSL 3HE6A 4JQXC 1HILA 3RWIB 4OLXL 1P9MC 2IANE 2CA3A 4FTVA 5KVGE 1VERA 4K9JA 3L4XA 5JZ7D 1OK0A 2GAZB 1INEL 1NPUA 3DTDA 3V5DB 3QG7H 4X99A 3L3KA 4X5PA 1AD9B 3TO4A 3ML8A 5FA3B 1ZLWK 2E9IA 5CJ5A 5B22A 4DP0X 1TVBA 4IGBB 3THML 2PPFA 2GBAA 1RZPA 1TZAA 2JLPA 3JVGA 4WIQA 2AZAA 4MMZA 4F92B 2NY2B 5DSCA 5FHBL 4ZG1A 2GTWA 1S7VB 3FU9A 5I1IL 2R1YB 1BLNB 2OMXB 3DPBA 4BH8A 5ID1B 5C0BB 5KYWB 5D1ZA 3O2DA 2QT6A 4Q9QL 3HE7A 3LOWA 4MD5B 4H7VA 2J20A 4IRSB 3NABH 2XT1B 2PPCA 5D2LF 1K5NB 1L9QA 1PU0A 3W1ZA 4OI7A 1HE7A 3AWEA 4Z77B 2APTA 2E9JA 3WIIH 3G04B 4UOJA 2O5YH 4LCCA 4GIAA 5EH1A 1NAKL 2Y5QA 4NS0A 5HPMA 3P9WB 3EGDA 5JA9A 1ZTXH 5MEPA 2WIIA 5I82A 4XAWL 3D3VA 4BQ9A 2HUHA 2ZOLA 2AJXH 1BQ5A 1KCVH 3VI3B 2DTSA 3IDYB 5J9PA 4KKCC 3WIHH 2IQ9L 5GSRB 2W91A 2XQYG 3OL2A 3NCYP 5D96C 1LP9B 4XVUC 4HXBL 1NFDF 4MB1A 2ZOKA 3TCLB 4NRXB 3EHBB 1FSKB 2AQ2A 5FKPB 4XOBA 3WY3A 4I18C 3MR9B 2EVGA 1TITA 4A1KA 2CO4A 2UXFA 4XNZC 4JPKL 5CCJA 4M7KH 3MRQB 5DYOA 1PZSA 3C8HA 5FFLA 3ZLQC 3UAAA 4QYOB 3VU2A 3U82B 4O2CB 4Y16B 3DMMD 2LHAA 2D7TL 1A7QH 3GSWA 4KKAD 1CTMA 1U8OA 2HFEB 2B77A 3DVGA 4JEGB 5EUOA 5CEYB 5HDQL 1JPSL 4IBUA 4UINL 3LKRB 3MRIB 5ICYA 3L48A 3S4SB 1IILE 5GGRA 4QRBA 1HFUA 3BPCA 1GSKA 4KROB 1DQLH 2OMVB 3QEQD 2FWSA 1HINH 3GSNA 2X70B 5F6HI 1CK0L 3TA3C 2EP6A 4EN3A 3ULVL 3UPAA 1Q0YL 2EXYD 1U42A 4Y1SA 1TT6A 2ZUVA 3W81A 2BXZA 3UADA 1TMCB 1UB6B 4NN5B 4PVMA 1HXKA 5JHDD 1L9MA 1FBIH 1QFUL 4UM8B 5DMIL 2GJ6A 4CVXB 1HJBC 1AH1A 2ZXGA 1WO2A 3B5TA 3FO9B 3FTGB 3RY6C 3VFTB 4ZMZA 1N18A 3K8MA 2YAEA 2XWBA 5T3XD 3V4UL 3WTXA 4K9EL 1T6BX 4URKA 1E27B 4U6YA 3SPJA 4DZBB 5LBSA 3WG7B 4MS8D 3IKCA 3HE6D 3KCWA 2CO7A 2ZUQB 4OUOA 2CJUH 3MOBH 3LVEA 4FTVD 4Z0XA 1UYWL 1E6OH 2CBMA 3EYQC 4C8XA 2IWKA 2GTZB 1KXTA 3RRQA 1PCXA 1RJZA 2V2XA 2G4EA 4PY8J 4RETB 2IDSA 5DJZB 3TO4D 2VRKA 4IHOB 1D7BA 2PUQT 4GLRI 2YUZA 3OJDA 1EANA 3UTOA 3VFVA 1UM5L 2F5BL 2BOBB 4R3SB 5CCKL 3HPJA 1TO4A 4F8OA 2R0WH 3OB8A 4N2DA 3WS6C 2EUVA 4IIQC 4KO9A 4RMRA 4LSPH 35C8H 4H13C 2ARWA 4N2FA 4RDQF 5F89B 5JW5A 3MRCB 1G7QB 2QL1A 3LV3B 4JREB 5D1ZD 4IKKA 1FO0L 4YHIA 3HE7D 2IOOA 3GC3A 3FQXA 4Q4IA 1JVLA 2K4WA 3MJGX 2YPLB 2GIXA 4M6OL 3BD3A 3PWPE 3VWJA