5DI8A

Fc knob-hole heterodimer t366w + t366s/l368a/y407v
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8A01
2JCCE 3M8OL 3WXWH 3RTQB 4OCYL 5GRVK 2AXGA 5D1XB 4BH8A 3QPQC 4EDXA 15C8L 1WZMA 3MGTA 4GRWE 3D6GA 5BZWB 3LKNB 4QWWC 4ZO9A 1I1RA 3QG6B 1J0KA 4K7FB 1VESA 1KXTB 4N68A 1C7SA 3UYRL 4NHCH 4OZHF 4IS6B 5ITBH 4LOUC 2WANA 4WFEE 4YDJA 3DSNA 4HLZH 3HAEH 4NRYB 4WFHD 4MVBC 3UDWC 3FB7B 5C0JA 3PDOB 3QIBB 4UILH 3QEHB 4OLVH 4G8EB 1YY9D 2GK2A 2GEEA 1YPZA 4PJAB 4PR5B 5HDQH 3TO2A 2FEEL 3MSPA 4K9EH 4Y2DA 2AJYH 3FB6A 4ZUWB 2WSKA 2YPLA 4WENB 1QVOB 1TZIA 1IEAB 1DQQA 2QHRH 2HH0L 1CFVL 3ZSTA 3NCYP 2DMCA 4JZNA 4PJFB 1GHFL 1QFWH 3WJJC 5ALBH 2M2DA 3KPOB 1U95B 1CYGA 4JFOB 4Z7VA 1P1ZB 4OGYL 4WHCA 5E4EB 4G9DB 4UT7L 1GZQB 3OKYA 4N8PA 3HPJB 1BD2D 1B6UA 4NWTH 4HWNA 5HSFA 3S88H 1HYSC 1MNUH 2FGWL 5EA0H 3V6ZA 1U8PA 3QUXD 2P7TA 1J5OH 3QDAA 4P46A 43C9A 4EN3D 1Q0YH 3VXSD 4XCFH 3PG2A 4KDWA 1WCBB 5DJYB 3EGSB 2K3TA 3GMPB 4GAJL 3V52H 3QNYA 2VXUL 4W4OC 3WIIL 4F7EA 3FT2B 4OLWL 5E5UB 1SMOA 4JFYB 4HKXB 3IF1A 2CGRH 3AREC 1N5YH 4YWGH 5DSCB 1AD0B 4N0FA 1CVRA 3L5WA 3SE3C 5DJ2A 2FJFA 5JXED 5L8LB 3C09B 2AJ3B 2ZJSL 1MIML 5L2KD 5D7JC 5H8DA 4Y5XB 3FRPA 3CDGA 2CH8A 3K4DA 1N64L 2BSTB 4PRNA 2OBGA 2ICWB 2VQ1A 1W0VA 4RQQB 32C2A 4WUUA 4XPAH 3OJDB 5CHNA 4AMKL 5BQ7A 2NNAA 1IBGH 1KXQE 3ARBD 5FCSH 4R6UA 3QH3B 4HFUL 3VFGL 4N0YH 4ZFGH 2IH1B 1NEZA 4GW4A 1X9QA 1G7PB 5A16B 4G43A 3MV9D 2AXFB 1FNHA 4UUJB 3OB0K 5GGUA 5I0DA 2IFFH 3MA7B 3NGBB 4EUPH 3FOMB 1NJ9A 3R1GL 3MROA 5FGBC 3OKOA 4OCXH 2LVEA 5B8CA 3VE0B 1KN2L 3TT1H 4BK5A 3C6SA 4NM8L 1T20A 1HHHA 3GFUA 1XH3B 2ZUXA 3IDMB 3WUZA 3JWDC 1UM5H 5EUOB 5JIHA 3ARFD 3RAJL 1A6ZB 3VXPB 4G6JH 1CI5A 1ZT7A 3OGCA 4JVWA 4YHKH 5I30H 5CD3B 4Z95L 3QHZH 4PJEB 5F1SA 4OD3L 4HBQA 5L8KB 2NQCA 3U4EB 2BSRB 4RRPG 1BLNB 1MFDH 3VXUD 5D7KE 1G9NC 3T4AB 1HIMH 1AHWA 1VA9A 5JHDD 1UCTA 4P3CH 2OJZH 5EU6D 4D8PA 2X10A 1FL6A 4YQXH 3HMWL 4U3HA 3ET9F 5I1KH 2FX8L 4TN9A 2LAGB 5I1GL 4ODVH 1WIPA 1U8OB 1XIWA 2DQDH 1BOGB 2IFGA 1J8HE 1OW0C 5ICXA 4KK5C 1MCPL 3V4UH 5L9DL 1EBPA 2DM2A 3LH2H 4EDWL 1AXTH 1ZLWK 2AXHA 4X7FC 1G6RH 4F58H 1ORQB 4UNTA 1KC5L 4PTUA 1FYTD 3LN4A 3RGHA 3BSZL 3TNMB 4KPHL 1CBVL 3GBML 4S1DD 5DUML 4AM0B 1UB6A 3I6KA 4BZ1L 4TVPH 5JHLL 4QRPE 5EU5A 5HYSA 4DFHA 1PKQE 1YEGH 3H9SD 4E41E 1CE6B 4IM8A 2CUHA 3HG1B 5C2UB 1V3JA 5I76A 3CPLA 1UH3A 2DDQL 1LO3L 2QBWA 4BQBA 1B90A 3UZVB 3PP3H 5K9JL 4YHIA 3RGVD 1IQWH 5C0RH 4MX7A 2KDGA 4HUXB 4WI5A 3SDDA 2C3VB 3ULVH 2PR4L 5DMKA 5AG8A 5SWSE 4ERSL 4O02H 1D5IL 5KW9L 4G6ML 2X40A 3EDFA 1ZKAA 3LEYH 1JZ3A 1N6UA 4KJWC 2EO1A 3NTCL 2JIXD 2BNQD 5I15L 2JB6A 2IAND 3OZ9L 4FQLH 2BHYA 4LF3A 4JZOA 2A6DB 1KJ3H 2MQ3A 1YMMD 3REWA 5HHME 1MFCH 5DGQA 2CDFB 5B4MD 1RJYB 3QCTH 3WFDL 3UTSE 4Q9QH 5T5NG 1I8LA 5BV7B 1EEYA 4FNLL 5JO5B 3WFHB 4JY6B 3X14A 4XC3H 2AJZA 4GMSH 5EU3A 2OJEB 5F3BB 5HHPA 2CLZA 1FL3B 3GO1H 3S97C 5IFJA 3PWUA 3UDWA 2O61B 3GBLA 4PREB 3JWDL 2HN7A 5GS2H 2HFGH 2XFXA 3P0YL 3M8OH 3LB6C 3MC0A 2HG5B 1MQKH 3D0VB 3RVTC 4PIRF 2MCPL 1BQSA 5E2WL 2P5WA 3TVMC 4KY1L 2ADIB 1S7VB 4NDMA 1G9NL 3UYRH 3CC5B 5F21B 4M6MH 3FQTA 2Z91B 3WNPA 3AGVA 2B1HH 3GSUB 4OF5A 5DVLA 3WJJA 1EFXA 1I75A 1DBJL 5TFSL 3IRPX 3O2DL 4AQOA 5BCAA 3ZTJH 3KPTA 3V5HB 1NFDA 3MV7B 3MFGB 4PP2B 1JGLH 2FWOB 2ZOKA 5J11B 4ZFFA 4PJDA 1DUZB 4TSBL 4ONFL 2R1WB 3LPWA 1NGPH 3QDGB 2X89D 1VFMA 4E0RB 3UJJH 3LN9A 3C5JB 1I3UA 5L7XL 3MYJA 2FO1A 1MIEH 4W4OA 5EN2A 1PQZB 1KCRH 3O9WB 2H2PC 3O2VH 4Q9RH 1NUNB 4UT7H 4AZ8A 2EDDA 3AREA 3IXTA 5CBEB 4OKDA 1VGKA 3L7FB 1MCWW 4IIQC 3SE3A 1C5BL 4LLMB 3RFZC 5I1HH 3AU1B 5FO9A 3P9MB 2BVEA 2ZCLL 3KYNA 4QCIB 3MRMB 5C3LD 2HT4D 1MI5E 4N1HB 1QLFA 5IBTH 4Y4FC 2UVFA 4M48H 3WIIH 3KYOA 1JGVH 1NCBL 4XXDB 3OQ3B 3V8OA 5E00A 2OTUB 5FGCB 3A0OA 4MXWH 2J6EL 2I60L 4JFDA 3H3PH 3SDXA 3NCMA 4LCWB 5DJDA 5ID0B 1JV5A 3UJIH 3KJ4B 1MWAA 5FGBA 4OIIL 1OAQL 3P11L 5AG9A 3UTPD 5EC1A 4AG4L 1R0AL 1Q94B 2F5BH 1FFPB 1MCSA 1HQRB 5DUBB 2R1YB 1IAII 3QEGH 4AMKH 1ZHKA 5C0BA 3I85A 4JVUA 3U4BH 1MY5A 2EZ0D 4L9LC 5E1AA 1ZTXL 2N56A 3HI1B 3O6FC 4XC1H 3KLDA 5HVWA 4KJYB 3DO3A 4GG6E 3CFEB 2J2ZA 3FB6B 2EE9A 2IBGA 4YIQA 3B83A 1CFNB 3RZCD 3UXFA 5JW5B 4HWBL 3VDCA 4MSWB 3QA3A 1TZHB 1U6AH 3EYVB 4FXGA 4B7LA 3LQZA 3F12A 1KN2H 2ADJA 4MNHA 1FJ1A 2WW8A 3EYQD 4G8FB 3S4SB 4Y16B 3MLSH 2NY3C 2Z92B 3O2DA 2RCSL 4LNVA 3ECBB 2A6KB 1U58B 3MRIB 4LSDA 1OW0A 2ARJB 1MJUH 3C60D 4XBPB 3TWCH 3VWJC 2GCYB 2RGSA 2C3XA 2KH2B 4LHQB 4UV4L 4W70A 4X99B 1C08B 1KXVC 2HVKA 2RJMA 3CLFH 4O2CA 4P46B 1QACA 3UAJD 3K81A 3FQNA 4F57L 1IAIL 3IDIB 2WV3A 4JG1L 3IF1B 3U79A 2O5XH 5INCA 4N0FB 1ZV5A 5EFIA 1HXYB 3KLAB 2A0LD 4S10A 5E0QA 2J8UB 4KRPC 1IGCH 5CJQH 4MAUL 3T8XA 5BXFA 4J3OC 3SHSA 2DQIL 5CGTA 3ZT5A 1JF6A 4PGDB 2D31A 5DD6B 3PL6D 2ZUYA 3BQUC 2VQ1B 5BQ7B 1RIHL 2NY4D 1P7HL 1SJEB 5JORB 1ZANH 1UWGH 2VLJA 2XY2A 3N1MC 4C57C 5DLML 4DCQA 4RRPA 3V4PL 4R96A 4MJ6A 1HZHH 5K9QG 4W6XB 4X6CB 3CZFA 3QQ9C 4NWUL 4L8SA 2G75A 1BZ7B 4OI8A 1F3RB 3DUUA 4FMFA 1YYLL 1NBZA 1HOCB 3QZWG 3VRIA 4WJ5B 2VXTH 1BBJA 1GSMA 2NMSA 5DWUH 5DTFA 1FFNA 4UU9A 2VQTA 1YY8A 2Y1VA 1BQUA 3BEWB 1A1OA 1DTUA 2NW2B 4YPJA 1FFRA 5ERWB 2VXSH 2O5ZL 1PGRB 5SX5H 4CJ1A 5FYLE 3MMEB 3OGCB 4ERSH 4F3FA 2VL5A 5D6CB 4G6MH 5ACLA 4OJFL 2EE3A 3BAEL 2BVUA 1IGMH 4ELMA 4TUOB 4DVBA 1MCCA 4EIGB 4BQCA 1PX3A 4TRPH 5F7NC 5KSAD 5GSRB 4TPRL 4YFEA 1OAKH 3D18B 4WU5A 3IU4H 3ARSA 3WO3B 3HZMA 1E6JL 1V7NH 4QHMA 1KF9B 3CNKA 1EJOH 5E5RB 3FB5A 2A6IB 3O4LA 4OV6F 1MELA 3O8XC 4QXUL 4U1LA 2YD2A 2I9LA 3TVMA 2ESVA 4P23C 2EEDA 4LSUL 3GB7A 4NGHL 4XWGL 1ZS8A 3CAFA 2R9HD 4QOKA 5IJVA 3WFDH 1A1NB 5EZIL 4MDJA 1AC6A 4FNLH 4FQIH 1X5GA 4NQVA 1CXHA 2VUYA 1NGYA 3B9AA 4QLRA 3U0TA 5F89B 4PTUB 2CRIA 4EXKA 3GHBL 2FX7H 3FCTA 5HGHB 43CAA 1KJMB 3QEQE 2FGZA 1YUHA 3P0VL 3BZEA 4KKBD 5HHXH 1FNSH 2PN5A 4HLZG 1A6VL 4M9OA 3HAEG 3OJMB 3E6FB 5ACZB 4GMTL 4E9LA 4Z8FL 1IQDB 3RVWD 4XT1C 1XF4B 2OK0L 1YA5A 2YUXA 1LE9A 1JZ8A 5IB1A 1R3HA 3U7YL 5TDPB 5KS9F 3MLYL 4OFVA 1P9MC 3QCUH 3BWUC 2GIYA 1P2CB 3VGEA 2VITA 3DGCR 1OP9A 3CLEH 4NCDA 1X4XA 2BMKB 4IIQA 3GSRA 2F54A 5I73B 1R5WA 1RZGB 4TSBH 1J1XH 1NGQL 3SKOB 2NY1D 3GMNA 5ECJE 4HJJH 2DICA 2ICEB 1IC7L 3DV6A 4Y19B 2GI7A 1YQVH 4EN3A 3VXSA 2B4CC 4NC1C 5JIPA 4PRIE 1CGVA 2F9BT 4CVXA 5EH1A 1JPFA 1RFDH 2JB6B 3MOBL 4Y4FA 1CDIA 1VKXB 2XTJE 4BKLA 3V7MA 4RFOH 4OCWH 4XPHL 4HC1L 4LLUA 2X1QA 1H5BB 4PP1D 1IGYA 4A6YA 3TM6A 1RAMA 4L3ED 4WFFE 1I1AB 3V4VH 4FQ1H 4YDIL 3KPNB 1EMTH 3L5HA 5I8EB 3CFDA 5EZJB 2W9LA 3CMOH 5HHPB 1AKJB 2EE6A 4IOIA 1D6EA 4WEUD 4OLYL 1JN6A 2GQHA 1F4XL 1FRGL 4HPOH 4GRWH 1H0DB 3ZKND 4G9FD 4L9LA 5HGGS 1ES0B 4PRDA 3O6FA 1RMFH 3MYZA 5BS0E 3LDBB 2X4TA 3MV9A 3TA3D 5F7FA 4H5SB 2H41A 3DYMA 4ODUB 1BFOA 5K59E 3PWPD 4HWUA 1BP3B 4NYLB 5I0ZA 4P2QD 1SY6H 4YUEL 5SWQB 5I1IH 1OAZL 3RVUC 2DQJH 4GSDL 1TJGL 4Y8AA 5I9QB 3KG5A 2OR8A 4AEFA 1I4FB 4FZ8L 4KROB 1RJLA 3M17B 3OV6A 5HYJD 1AGBA 5JOPE 5HI3C 3HRZA 2DAVA 4O2EB 5TF1L 4Z6AT 4Y5VB 4EUPG 3RNKA 3ILPB 3G5XB 3KPSD 4OQTH 4XCEB 4IJ3C 3FFCE 4XMKH 1URLA 1JNHA 3VWJA 1YN7A 2D7QA 1GAFL 2DTML 4JHZA 4U6VL 4OLZL 3MV8A 1S9WA 2NPLX 4HWBH 4F7TA 4G8GA 3MUZ1 1P7QA 4OD2B 1IKNC 3DMMB 3P2TA 1E4WH 4JFZL 3HE6D 4UB0L 3VRJA 3OKEB 3RBGA 3P9WB 4NCC1 3P9LB 4P99A 1SVCP 1I1FA 3CH8A 4V1DE 1OAYH 1UWEL 2BOCA 3CXHJ 1IGIH 2AJUL 3IS1X 3SBWC 4ZUTA 1T0NA 3T2QA 4MQXC 1MHEB 2BFVH 4H26B 4LSTH 4R0LC 5F97E 3FO9A 2AI0L 2VDPH 2EECA 1SEBA 3BQUA 3QUZC 1ROWA 4MGXA 2DQTH 5KANG 3FB8A 1XGYH 5A2LH 5TE4H 4HC1A 2DIJA 1MPAH 5DJZA 4KKAC 2HRLA 4XVSH 3U0PB 1MF2H 5KSVA 4WV1C 2AK4A 1KGCD 3W82A 2B4CL 4WFGD 4G7VL 5INDA 4JRXD 1Q0XL 5DA4A 4X4XB 3IDJB 4MAUH 3GUTB 4QRSA 2BRQA 4XAWL 4P57B 1JYXA 4X4MA 2P47B 4QHNB 4AIZA 3RRQA 2C4FT 2NR6D 3SGJA 5CJXA 2DQFA 4LLDA 4XXCA 3SGDI 5TQ0L 1BQLL 3TO4B 4PYHA 2NY5C 1RSFA 1L6ZA 4XNZB 4F80A 4M3KB 4JFQB 3QA3B 2B2XL 2JIXA 3UTTB 4PGJA 2ZKHH 4Q74A 1CFSB 1YYLH 2DLEA 5C8JB 5L2JA 5EUOF 4LLVA 2FHBA 4AT6A 4XCYB 4QRUB 4ZFZB 2Z0BA 4U7SA 5GXBB 3O8XA 2DOCA 1ZOXA 4M7LL 1CICC 4PJEF 4K94H 3TN0C 1ZSDA 3RNQB 3ESUF 2DD8H 4P23A 1R3KA 3A6OA 3N85L 4NRXB 5ESAB 2COQA 4MA3A 3ZMRA 1TCRB 3MRKB 3ZTNH 4NQCE 5DJAB 4HUUA 5HVGB 3CVHL 4FABL 3GJFK 4XH2A 3UJTH 5T1DH 4MCZA 4QRRD 4XMLH 4L1HA 1S3KL 3HUJA 3MLXL 2ATPB 1E6JH 2DMKA 5GSVA 3LKQA 4K2UL 2R2EA 3KPRD 1CFBA 1F45A 3HE7B 4ZSOA 4YLQT 1M7IA 3PWNA 1KJ2L 4MAYB 4CJ0A 1ZA3B 4X83A 4NKDA 4PJ5A 4HPYL 3NA9L 4YO0B 5INCB 1DBMH 3FQXB 3QZWA 3VXME 2XZAL 4HK3J 4RGNC 3MLZH 4EI5D 4WI4A 4BQ8A 2LU4A 5EOQL 1QO3B 4X9FA 1CQYA 1A7PH 4JHAH 3BJ91 4I48A 3LQAH 3DV4B 2XZCL 4I3RH 1ZVSA 1ETZA 3N1PC 4PY8I 4X6DA 2R0KL 4FOMA 5JQ6L 1P9MA 3B43A 4ISVB 1U3JA 1KSRA 4I2XA 5TQ2H 3JTSA 5IV2B 5KAQF 4DWHA 2A1WL 1U2HA 4HKJB 1HINL 4QHKI 4XNQB 3RJDA 1A3RL 1S7SA 3DGGA 3ULVC 3IFLL 4UQ2B 3MCKA 3BPNB 4L8SB 4ENED 1AO7D 4ZNEE 3FN0H 4GMTH 5HPOA 3W2DH 2XPGB 3V0VB 3ZTJG 5I2IB 5JQHC 2R2HB 1SJHA 4R2GB 2CUMA 1OQXA 3U7YH 4LSPL 3O81A 5IHLB 2OMNA 4X98B 1C5CH 3RQ3A 2VZ3A 3E0GA 1INQB 5FYLL 4JN1L 1HNGA 4OLUH 5IT2H 4FQPA 1ZT4A 5JMRA 2EDRA 1S5HA 3RWDA 4F3FB 5D5MA 5KSUB 2D03H 1Q9WB 4ODXB 1DN0B 1WC7A 5FO8A 2XZZA 2VDLH 2X7LA 5JR1L 3VA6A 1TCMA 4GW5A 3GJFA 2DKUA 4HD9A 2VLLA 3MGOB 4CGTA 2A6JA 3HAEA 5IGXL 1PEZA 2CRYA 1LE5A 2I9LB 3IU3B 4PJXB 4I0PD 1O7SA 3UO1L 2NY5L 4MA8L 1ZHBB 3OAYH 1E4KC 4MDJB 2CRMA 5ADPL 5MEQA 3BIAX 3SJVE 5C0CE 1PZUB 1F3JB 3DSFL 4XPTL 1CDCA 1NDGB 3MREA 2A38A 4LVNB 4RISH 3QYCA 4OB5H 3PHQB 5T5FL 4Y5YB 1RUAH 3T0EE 43CAB 2OYPA 4YXKL 1YUHB 2F8XC 1KJ2A 4ZFOB 3BGFB 4JKKA 5IB3B 1OCWL 5KN5B 2PTVA 1AGDB 3V5DA 5EO1A 2F19L 5EBWA 3SDCD 3VG0L 4O9HL 2PTTA 1A9EB 5I1EH 3WNMA 3Q5OA 4OZIE 3BP6B 3DURB 3MR9B 4M7KL 1IKNA 4RAUA 1TJGH 3PE9A 4YBLC 2DQCL 1NGZA 1Q72H 4OF6A 4LLWA 1X4ZA 4IRSC 1UH2A 2BVPB 1YMHB 2EC8A 1BD2B 3GRWH 5FOBA 4ZO8A 2YMXL 3FQWB 5F3HA 1PJ9A 5GRJL 2BY0A 1N7ML 4BFIB 3C60A 5CKAA 1I7TB 3F58L 1A8JH 3EYFB 3QUXB 1JTPA 3SBWA 1D5BB 3WFEL 1J86A 1Q9KB 4U6VH 3V5KA 2BNUA 3DV6B 4EN3B 2ITDA 3C8HA 2EDWA 4R0LA 3VXSB 4GS7C 3ZKXC 2EYRA 5FDYA 1SBSH 4CVZB 1CD1B 3T3ME 4U33A 4MXQD 4JQVC 4UB0H 2BVQA 1LILA 3CDCA 3UMTA 4KI5F 3DBXA 4U1KA 5I1CH 1GC1C 3KLHD 5EIIB 2YOCA 3OR6A 2AJUH 4WV1A 4HGWB 1I7RA 4WNQB 3OF6A 4HMEA 4ONHA 3O3EB 4LEOB 4DGVH 1FLTX 5L2KB 2CIKA 2WLYA 2PYEA 1ZHNA 2LE9A 5BOZG 3NAAH 3PP3K 1LP9B 2GFBA 4WFED 3QCVL 1ITCA 1JUFA 1S9VB 1RVFL 3QRGL 1W72L 3ARBB 3EO9H 4HF5L 1U8HB 2DI8A 4I3SL 4K7PL 1KB5L 1P6AB 1BX2B 4UIMB 4X4ZA 5IHZB 3MJ7B 1NCNA 3MV9B 4HIHA 2ERJC 4BZ2L 3WE6B 4PJHA 1QLRB 2FDBP 1H3VA 5F7MC 1TZGL 4I0CC 5CP7A 3EJZC 3PABA 1C8PA 2VR4A 5A40E 4MD5A 5DRNA 1F58H 4TOYL 3UZEA 1WWWX 3ZKQD 3ARFB 1DQDL 2WINA 3SKMA 5K9OB 1W2KT 1INEL 2AV1B 4MJIA 5HGDA 4P4RB 4ZAKD 2BSSB 2P8LB 4KK9C 1OARL 2C26A 4FQXD 3PP4H 3KPPA 1M6OB 2EIZA 3VXUB 3RIFF 5F8QC 1TITA 4NC2B 2VIRA 3RPKA 5JHDB 1F6AB 5GRWA 4Q0XH 5EU6B 5F7HA 4OV5A 5JZ7C 3NABL 3VGBA 2YA0A 3E6HA 3H0TB 1Y6MR 3NIGF 4LKXA 1T21A 4M1DH 1WT5C 1D9KC 3CSYA 4M7LH 4PY8J 2XA3A 4OZFG 3LIZH 4Y4KC 2SEBA 2HJFB 3ROOB 3O2WH 3ZZ1A 1MJ7L 2J5LC 3UP1A 5IM7B 3BXNA 3DNKA 3TBTB 1Q9LA 4GXUN 3CVHH 2EDYA 4FABH 4LU5L 4Z9KB 4LP4A 4POUB 3ARWA 1FYTB 4HAFA 4U49A 3MLXH 3BPOC 1YNTA 3QDGE 1TETH 5DDHA 1KPVA 3U1SH 2IJ0C 1T4KB 2J8UF 3H9SB 3P77B 3SGDH 3ALXA 4DGYL 5HYFA 4WHDA 4M7LT 3VFTA 1T03H 3B2VL 3KYKH 5F6HJ 4YNYB 2YN5A 1SQ2N 4OGXL 1A6TA 5INDB 3MUY1 5E95B 1CT8A 1IARB 3NA4A 2CDEA 2BRRL 2IPKB 5FV1L 3RY6C 1TPXC 2G60L 4JO2L 4KI5E 1CGSL 3RGVB 1WLHA 1W72A 4NQEE 4X6CF 1GC1L 2Y9RT 4LCIH 2Q8AL 1PAMA 3KWWB 4U6YB 2JK5A 1VPOL 4WI7A 2DYPA 4HCRL 3MRBA 2IAMC 3ARRA 4WO4D 4ZOAA 3WKMH 5B3NA 1H15B 2BHUA 3TYFB 3PGFH 2W65B 5FGCE 4D0CB 2BNQB 1CGUA 5D7KD 2WWMD 5D1QD 1QLEH 4XHJD 3JV6A 1E0OB 2AABH 4M8VA 2IANB 3SCMC 5IFAH 2YZ1A 4JZJB 4PJGA 2IEPA 3RUGA 4ONOA 4LCWE 2Q6WB 3QUMB 3LKRA 1BMGA 5TPWL 4JHWH 5L0QB 1YMMB 2YD7A 5FYLH 4IRZH 3P4NA 1ZSDB 1FHGA 4HXAH 2FLBT 5LWYL 2GSGA 5AUMA 5FM5M 1J8HD 1E4KA 3EO1B 4HZLA 3AROA 3MRHB 3VXOB 2XA8L 2P5EA 3V8CA 4ONGH 1B0RA 2W9EL 1SYSB 4U05A 4XP6L 4G42A 5DQJA 4Y4HC 1QRKA 5D7LA 5BVJA 4K3HA 1HDMB 4AL8H 4DTGL 5JDJA 2FO4A 3OX8A 3TA3A 1QEWB 4MS8C 1XF2A 4YDKH 3TBYB 4QRPD 4ZPVA 3W39A 1JYNA 3PV6B 4P2RA 4JJHA 4HGMA 3BPCA 1FNGB 3HR5B 4XVTH 4ZTOL 5C86A 1E4XL 2P8MB 5HGBB 5FO7B 3DSFH 4PG9A 1JHKH 5GS1B 2YKLH 4IRSA 3ILQC 4M4RA 1FIGL 4TSCH 1U8LA 3MUJA 5TGBA 4XI5D 1X5XA 5SWSD 3WDIA 5HBBA 3WLWD 3MCKB 3WFZA 3R06A 5EU7E 3RWHA 3S34L 3UTZB 4YHYC 4N5UA 3TJEH 1DUYA 3K2MC 3CUPB 5F7WC 5F96L 5E9DA 5CEYB 3EOBA 3UTQB 1HHIA 1UACL 2J8UE 4I1NB 2E6QA 1EHXA 1J18A 4XVJH 1RZ7L 3SO3C 2W1NA 5HHMD 3LD8C 1NC4A 4HCRA 1OT1A 1IGFH 1M05A 5TE6L 1LO5B 3UTSD 4KMTL 3BE1L 4GKSA 3VXQA 5MEOA 3WJLA 1LEKB 1QD0A 3TFKD 1MUJB 1AQKH 1MCFA 4JFFA 4PRPD 4Q2ZB 4GAGL 3RI5F 4N8CH 1BEYL 1G7HB 1JWUB 3EJJX 4ZYKB 5D7IB 5GZOC 3UBXI 5F70A 2DF3A 2I07B 4KTEH 3VH8G 1A6AA 1PY4A 3PF2A 2OQJA 3FOLB 3TZVD 5F9JA 4YBQC 4GKZB 3GM8A 5JXAL 3WL9B 1YNLH 2VYRE 2QTEA 4NQDE 4XNUL 2WBJC 3CIQA 4AENA 3MV01 3CMGA 1EHAA 4RAVA 5T33H 1PSKL 2B5IB 2Y5TB 1GGYA 4GT7A 2D7TL 4LLQA 1ZGLA 1WWBX 4L4TA 2V7NB 1RVFH 1IM9A 4NP4L 1H3UA 4I3SH 3REVA 1CXEA 1HH6B 5EORL 5SX5K 2JJVA 4HV8A 3A6BL 3VDAA 1KIRB 1NFIB 5BO1H 3BDXA 3V5DB 4WIQA 1N8ZB 3RZCB 2UWEB 3OWEA 4HIEB 4KVCL 1LEIB 1L0QA 3WIHH 1YEJH 4RFNC 1YEDB 2ZPKL 1W0YT 2DKMA 3NH7L 2EEAA 2FBJH 4M02A 5FM4A 2HFEA 2OP4H 3AMLA 2EYTA 3C5SB 3MUGB 1WT5A 1D9KA 1HKLL 2FECL 5FOBB 4L3AA 1FO0B 1U93A 4Y4KA 2WBWB 1BBDL 4JGJA 3TNNA 4X5WB 2V7HA 3H9HB 5IB4A 2EO9A 3V5KB 3CX5J 3PGCA 5GS0L 3WO4C 3D3VA 3MRPB 3RWJB 1IC1A 4OZGB 4X8JA 1CU4H 1A02N 1GZPA 4Z7WB 4U1NA 3T65A 3MRQB 1MI5D 4R7NA 5L8JB 4EVNB 2BVQB 4D0DA 3EFDL 1FV1A 5E8NB 1KIQA 2CLVA 1IT9H 4RMVA 5HI5D 1AFVL 2XKSA 4ZNCD 1F11B 4NO5B 3DX7B 1DQJB 5A3ID 3C8KB 4ONHB 1MCLA 1RIVL 4X6FA 4QRQB 3NOIA 4OT1L 2X4UB 3RY6A 2CIKB 3TPUB 1T2QH 4EUPB 3PL6B 2XNAA 5FA4B 2QR0A 3MLUH 2NY4B 5CP3A 4XP1L 5DMIH 3EDEA 5IUSA 1J1OH 4YZFF 5EU4A 4KUCF 2IAMA 1DBBL 2C1OA 1QFUH 3PQYA 4WDIB 2FX9H 5HHQB 3L3GB 1LO2L 4LMQE 1ZK9A 1ORSB 3SCMA 5DRNB 5E7FA 4DN4L 3MLPA 4OZFA 1J0HA 1B6DA 1MLBA 4R7DA 2WIIB 3RKDD 2YWYA 5C0FB 2JB5H 5FUOL 3QUKA 3BKJH 4J3UA 3WN5B 1CXIA 3LRSB 5I17A 4J1UA 5HGDB 2YSSB 2I25N 3DX6A 1OPGL 4QXWA 4JPVH 4PRHE 3B9VA 1KPRB 4X6EA 3GMRB 2FZ3B 2ICWJ 3I50L 4PLJD 1UVQB 2OMBA 5KSAB 1JTOA 3HPLA 3ZT7A 1QBLH 1EXUB 1FZMA 2N1KA 3MRDA 3QDJA 4P3DA 2EYSB 4LK4A 3BH8A 4Y4HA 1TLKA 4N0CC 5IVZA 4H1LA 4YXHL 3PNWA 3EYUH 4R26H 1G6RB 2HJLB 4D3CL 4QGYA 2YRZA 4P2OC 3WHE0 4XP5H 1TTUA 5DRWB 2JJUA 5J1AA 4P5MB 1A7QL 3L3OB 2FBOJ 2EIEA 4Z7QE 2IADA 1BIHA 1G7LA 2UZIH 3G9VA 1ZVYA 3U7WL 5J89A 4WHTB 1FPTL 1QSEA 4WVRA 4KC3B 5GGQL 2VZSA 2FATH 4GFTB 3TBVB 4PJIB 4JM2C 4L29A 4OF0A 1M7XA 2VWEC 2YD8A 8FABA 4NZUH 4H0IA 1A6WH 2R2CA 4DTGH 3VG9C 2NY7L 1RHFA 1NL0L 4JDTL 2H8PA 5IMLB 3S5LG 4QF1A 3UPRB 1MAKA 2IQAB 4NUJA 4G6AD 3VD3A 1FE8L 4YAQB 5HI4D 3LHPL 4HK0A 2PCPA 2WUBH 4OFYD 1IC5L 3C08H 4FP8L 3VFNB 3T4YA 2XKNB 1S9YB 3FFDA 4RSVA 4ZXBC 4OTXL 1UXSA 2RAMA 5JPMA 1C5DA 5F7EL 3VFSA 2NY1B 1LK2B 3K1DA 5E6YA 1RIUH 5HPMA 3S7GA 5FYLD 3T0XA 5JLZA 3GMMA 1FZJB 4MA1C 1GPOL 1CZ8L 2XQYG 4Q9CA 1C16B 4LCCC 5DJCA 3JV6B 4TULL 2QSCH 2A74A 4YZFE 3RUGB 3BGMA 1WZ1L 1N2RB 5L6YL 1CS6A 4HS3B 2BVOB 4L3EB 5D2LA 2QKIB 4WWKD 2M8XA 1U8IA 5DJ8B 4YK4C 3SPVB 4CN1A 5CJOH 3EKCA 3TH4T 1I8IA 1AI1H 3D85D 3RL1B 4IMLB 2WBJA 1Q9OB 1U8KA 2CLRA 1MSPA 3CFCH 2EH8H 3T77B 1RJZB 1FSKB 1MREL 1UCBH 4F15B 4CU7A 3ZLQC 4G9FB 3CFKA 1J8KA 2P44B 2H2SD 3THML 1IC4L 2FO4B 3UTTE 3QEQD 3TA3B 1QA9A 3RU8L 4K3GA 1KTKE 3WYRA 5H94B 3PWPB 5C71A 4TNVF 1MCBA 2FEDC 1MJ8L 4P2QB 2NYYC 1YN6A 4MD4B 3ARYA 3QO1A 4CRPA 2PW1A 2Z9TA 3QJFA 3U6RA 4JQIH 3MNWA 2AJSL 2Q7YA 2P24A 1J0YA 5I1DB 4PG9B 5HYJB 4MMZC 1N0XH 1DDHB 4DKEL 1LO4L 1UXWA 1YEHH 3WIFA 3WLBB 4PG2C 4U4BA 4WEBL 2R23A 3KPSB 5JNYA 4G8IA 4J8RA 4AEIH 1F4WH 4K07A 1KN4H 4CMMA 1RZKC 2NX5E 5ITFA 3NACL 1A2YA 3X13A 2VLME 4LARL 5EORH 4HUMB 3TIDA 5IFHH 4KK8D 5DFVC 1EHLL 1NPUA 4YHLH 1ERNA 1GGTA 4EEEA 4LHUD 4CDHA 2BK8A 5CD5C 1PDKA 1AY1H 4LLAA 4HKBA 3HE6B 3KNBB 5FF6A 4ZMAT 1AGCA 1U8MB 3VH8A 3DROA 2XTJD 3B3IB 2X70A 5J3HC 4XP4H 5DQDH 4L8DA 1KEGH 5CSGA 1PYWA 1FVCB 4UNUA 2MMXA 5T3ZE 3BH9A 3BP7B 3IDXL 2HFFB 4Z18A 1FZKA 3K1KC 5GGVL 3U9UB 1T7WA 4U1JA 1NMCC 3JV5A 5GS0H 2AJVL 1A0QH 4MHHI 4FG6D 3BP5A 3OMZA 3F7VA 2HVJB 1EO7A 3QIWC 4HWZA 3QXAA 4JPWH 4OZ4B 5CIPH 3M45A 4JRYE 4P5TC 1KPUA 1SMAA 2DBLH 3BPLC 1JWMA 3W81A 1HXMA 1QSFA 1FCGA 5HI5C 5C0GB 1G0YR 1FYHB 3VGGA 5BS0D 2B7DT 1MRFL 4JG0H 2ITCB 4ZDHA 1CFTB 3U9PL 4JRXB 2YWZA 2NY2C 2Q86B 1PZ5A 4R90H 2NCMA 4OT1H 1NCDH 5I18H 1KLUA 2YK1L 4NNYB 1JFQL 3HCVA 4GQ9H 3V0WH 1S5IL 5ETUA 2X4QB 1ZGLB 1GGUA 1X6NA 5DZLA 3S36L 1BQHG 3GKZA 4PJCE 3IFNL 5CZVH 2ZUQC 4PJ8D 1NLBL 4EI6B 1Q1JL 4JDZA 4OZHA 3WS3A 3FFCD 2CSPA 1E28A 3GNML 2XY1A 2ZSVB 4WTZG 4XCCL 4N0UA 2W9DL 3BZFA 1ZE3C 4GXUM 5B38G 2VZTA 1YEKL 1F4AA 5F72S 1WQVT 4P2OA 2DRUA 2R56H 4R4FH 1MAML 5E99H 5GJTH 2XTLA 3CFJB 1LEGB 4YXLL 2VZUA 4NQXB 2H6PA 2GAZA 4V1DD 1OPGH 2D7PA 2MOVA 3OAYK 4LMQI 5J6GA 3AAZB 3MRFA 4XB7A 3X3FH 4QRRB 5D1ZC 1T0MA 5B39G 1GZPB 2NTFB 1TDQA 3KPRB 4NFDA 2MQCA 3GGWB 4YXHH 1QSVA 2NY6D 4D0DB 4HKZA 2CLVB 4PJBB 3HZKB 1KCKA 2EKSB 3S3JA 3SKJL 2EICA 3T04D 3W9DA 1NCAL 2YD9A 1PKQA 1WAAE 4E41A 4EI5B 4GOSA 3ZKSD 4P59L 1BD2E 5GGQH 4M61B 5ESQB 5HDBE 4LQFL 1F97A 3QQNA 3RVXC 4OCSL 4R9HA 2XQYK 3MLVH 1UJ3B 1UWXK 1YC7A 4ZXBA 4GLRI 1NL0H 2X6MA 4FZEL 4JDTH 4ODHL 2GTZA 1RZJH 1UM6L 3WV0A 2A83A 4JRWA 1T2XA 1AO7B 3F7YA 2YS4A 3BT2L 3IAPA 5D8JH 4X5XA 2WP3O 1MLBB 1JI1A 3I9GH 5DI8A 4Z7UA 5ICZB 3OTTA 1I3GH 5D70H 1QRNA 1DVFC 3W0WA 4FQQA 1QFWM 3UTSA 4AEHH 3RPIB 4NQCD 5SX4H 2NXZD 4HX1B 1GOGA 4LVHC 2J1KA 3HPLB 4YDVA 4R4BB 1PKOA 4KJQD 1T83C 5IVZB 4TULH 5CWSB 3DTXB 3S5LA 2XIDA 4B7IA 4FN0A 2ZSWB 5EWIH 1ONQA 3U36A 5KOVC 5GISH 4I0PB 1BM3H 2ZNXA 3ARDC 4KU1A 3SDYL 1Z9LA 1OGAD 4KTYA 2VABB 1PLGH 3VXMD 2XG5A 3SE4C 1JGDB 5J1SC 4XCNB 3STLA 3NCJL 4LSVH 4W81A 1BVKA 3WEXA 4XAKE 3BVNB 5E8EA 1F00I 4OGAD 1H3PH 2VC2H 3QXTA 3VXRA 1Z0NA 1G84A 1BGXH 3MX0A 3DJ9A 4PG2A 4KKNA 3VXUE 5EC2B 3RWIA 5ILTH 4NN7B 2WQRA 1A9BB 4LGSB 4EQ2A 1WFTA 2X4PA 1NMBL 5EO9A 4TTDD 4G6FD 4EZMA 4U1SA 3KGRA 4QF1B 4Z77B 3Q6FB 3GRWA 3A67L 2V17H 1UM4H 3SDCB 1NBQA 2W0KA 5F9WC 5T3XL 1FVDB 3G08A 2DLIA 1M1SA 3GSOA 4PB0H 3S96A 3DXAE 1JF5A 4H8WH 5IROA 4O2FA 3SKNA 4BUGA 4DKEH 1RURH 2HA1A 3G04A 2CO6B 3D9AH 1DEEB 4GBXC 5E2VL 3GI8L 3CCHA 5E1HB 4GRLD 4RWYL 5I8CA 4I5BB 1C5DB 2HKFH 3DIFA 1U8NA 3QWQB 4JFHE 3S98A 3EOAB 1K4DA 3KS0J 5DMGC 4YPGA 3C2AL 5A2FA 3EO0A 1P5UA 1U92B 1AR1D 2VDOH 3VWKB 3WSQL 3GIVA 5IMOB 5IJKA 3F7QA 3X17A 3QIWA 4N8VB 1OM3L 3ULSB 2X4RB 5IW6B 1OSZA 5TH2A 1MI5A 1OLZA 3VFRB 1G7IA 3E3QC 3TBSB 1OQOA 1ZEAL 3QUYD 5C0DA 2JCCB 1J9CT 4S2SB 5I8KH 2J8OA 4XX1E 2W92A 2AQ2A 4GRWB 4WRLA 4J6RH 1QR4A 1RZIB 1JHTA 3BOVA 5IB5B 3B4NA 5DHYA 3QQ3A 1I8IB 3KVQA 1N5AB 3CFBB 3C5ZD 4X9BA 5I66B 1TQBC 1JGUH 5I75C 2AJVH 4OF7A 5GJSL 3SJVD 5C0CD 5D7IF 5DVMA 3Q3GA 3MBXH 2A9MH 2A9NL 5F1IB 1T04B 1SM3L 2VDNL 1CFQB 1TJHH 1WTLA 4P9HC 1G7JB 1KT2B 1CLCA 2BNQE 3HNTH 3T0ED 3G5YA 4DGIH 1GIGL 3L7EB 2V9QA 1U3HC 2IANE 4HFWB 5EOCJ 1IILE 3LZFH 1VFOA 4UT6L 1XF5B 2R0WL 1CLOL 1XGUB 5CLWA 2X4NB 1PD6A 5ISZD 3QDMA 3CDYA 2RQ8A 4RMTA 5C08E 5D9SB 2O5YL 3MXVH 2YK1H 3O6LL 1Q8MA 1S5IH 5BW7C 3WIFB 3HC4H 3S35X 2HLFC 5JA8B 5J0BA 3SQOL 4E42A 4ZAKB 3RWEB 4DVRH 1X7QA 3VGAB 2UWEF 4FQXB 4MQSB 1Q1JH 1VGEH 4RMSA 3P4OA 1HI6A 2VISB 5IK3A 1JNNL 5E8OA 5D1ZA 2AV7A 2XICA 1A7OL 4JFPB 1BECA 5C0IB 3WHXA 3L3KA 2OSLB 3ARGC 2DKSA 5AYUL 3HNVL 5MHSE 3BYYA 5GS0D 3W9EA 5CMAA 3L5JA 2F58H 3KS0H 4IOSD 4JR9H 1BAFH 4KDTA 1FG9C 3K2UL 2EDFA 4J3SA 4DN3L 4RDQF 1PYWB 3I2CL 3B9KD 4OZGF 5JW4Q 3OJ2C 5C09A 4LPTA 4Z7WF 5F7YC 2HP4A 3CGTA 5CLTA 4UQ3B 3G5VB 4C59B 3IDYC 1BQHA 1DL7L 3BP5B 3MCLL 1CGWA 2VB5A 3CZJA 4JREB 2GITB 5FKPB 4A2MA 1XZ0A 4YHNB 5E56A 1G6VK 1S7WA 1ADQH 2GKIA 4EIZC 2DLFH 4WTZA 4HS6B 1WFOA 1NCAH 1XGQA 3MACH 3NCYS 1KELH 5L88H 1IEBA 2CMRH 5B38A 1NAMH 1T3FA 2IALB 1PZ5B 4UAOB 3QJHA 2ZCHL 3GM0A 1X5FA 4F37F 3MRJB 3GJEA 1K4CB 1MFEH 3FMGL 5EOCH 1OGTB 5J1TC 4MD0A 2MQ0A 3DPBA 1RUML 5AD0A 1MH5B 3ROLB 2EEBA 3D87B 1LDSA 4E5XA 2E7BA 2V2WA 4C56A 1U36A 3D39E 1AJ7L 4JFEE 4LRNL 5B39A 1NCCH 3DVNA 4WO4B 9CGTA 5D7IE 3QFDA 5GGTL 5ID1B 2DB8A 2DWEB 1P6FA 3RTQC 5D1XC 2YEZA 5D1QB 2R0ZH 3BKMH 4R97B 1HCFX 2VDMH 1T83A 2NXYD 3D2UB 5KG9B 4KKLC 1FLRL 2EKJA 4P9HL 3MV11 4L8BA 4JN2B 2J88L 1Y6KR 4M43H 3UTPE 5KTEL 1CR9H 4ZO6A 3T0WA 3ARDA 3LEXA 3IKCA 1QTYT 1KLGB 4HK3N 4JY5L 3PWVA 4R8WH 1J8HB 3U2SB 4MNQD 1KEMH 5FIEA 3D85A 4RGOH 5J6GB 3B8YA 3MRFB 3QIBC 5K9KA 3IGAA 5F9OL 3SE4A 1TVDA 4JO1L 3SGKC 3VFUB 1T0MB 2J7LA 4KJQC 3PJSA 1ULVA 2VE6A 3VFWB 4BK4A 4U1MA 1I9JL 3OGOE 3QEQA 3HS0B 4K55A 4ZUVB 4GLRH 3N9GH 4YX2L 3D48R 5C7XL 4QRPB 1GVIA 2R0LL 3W9DB 1P4BL 4RA0C 3STZA 5EBMA 1IGJB 2FIKB 2KUTA 2N4IA 1V3KA 4PJIF 5T1MA 1I9IL 3QWOA 3S3SA 3O3DB 4KKCC 3EYSL 4PGCA 5E4EC 4LKCA 3VMNA 1OAXH 4GXVH 3AMKA 4HGKC 5I16B 1QOKA 3QHFL 4KI5D 4TVSa 3IXAB 4Z7VF 4O51A 4GBXA 4NBXB 4NQED 5D96B 1IRAY 4OZGE 3BIKA 2L7JA 3MGAA 1QKZH 5LGJA 4JB9H 3EZ8A 4ZPTB 3EDJA 4RMQA 1B0GB 5SWSB 1TJIL 3TBWB 3MRGB 3L95B 5IR1A 3OXRB 5DD3L 5D2NE 1A1MB 3X3GH 3SDAD 4PRIA 2RFXA 4NN5B 4FTVE 3X11B 2PYFA 5AYQA 3HC0B 3V6BR 5CGYC 3FO0L 4HUKB 4K3JH 2VNCA 1Z5LB 3TV3L 3C09C 5DYOA 3GMQA 1CF8H 1ZMYA 5FUZL 1ZGLM 1J0IA 5HHMB 5J4MA 4RWYH 4Y5XC 4PS4H 1N26A 3UTSB 2KQNA 2DJUA 4IEFB 1PFCA 2QHLA 3TPKA 2VAAA 4PRPB 3MODL 1GH7A 5J13B 4RIRB 4BSWB 5A1AA 5T1LD 1N4XH 1NLDL 1U91A 4CW1A 2X9XA 1FZOA 1DJSA 1U41A 1AGEB 1N3NA 2CPCA 2OM5A 3BDYL 3BGAA 3NGBC 4ZQKB 5DUPL 4QXGH 3FQRB 3OPZH 3U36B 3P30H 3V6OE 1KENL 1G7QA 1U3HA 1CCZA 1WV7T 3TZVB 5KAQG 2VLRA 1ZHLB 5D72H 2HT2D 3QPXH 5CILL 2Q3ZA 1JNJA 1R3IL 4O58L 5BW7A 4KZDH 1HEZA 3WIHA 1CK0L 3RWIB 4XBEL 3OL2A 4U2YA 2HWZL 1OF2B 5DK2B 5LJYH 1OVZA 2I9TA 2V2XB 2Q7NA 1MEXH 4QHLB 3KDMB 2VZ1A 5GGSB 3O11B 5E6ID 2VH5L 4U1SB 4HDIB 5JIIA 4NSKA 3BN9C 5KVFH 3B6SA 1OB1A 1YEEL 4LRIC 3DX8B 5DEFB 2KZWA 4M62L 4X9IA 2NZ9C 3ARGA 3PXJA 3GSOB 1YPZE 1FN4A 2APXA 5M95B 5MEPB 5FYJE 3VW3H 3ZDYF 2YPLE 3CX5K 4V1DA 1ZA6A 4U3XA 3FZUC 4Y7MA 4N0RA 3OKMA 4NKOA 5HGAB 2R8SH 1K4DB 4HJGA 1JMZA 3V6FA 3EO0B 3DI3B 1IKFL 1JNNH 1KYOJ 3BHBA 4Z0XA 5KS9A 1ND0A 4MWFB 4ODSL 5LBSL 4Z7VE 3O0RL 2VLKB 1OSZB 1MI5B 4MB3A 4XBGA 1LMKA 1KCVL 4PGBA 3HNVH 4GAYB 2CK0L 4M5YL 4DW2L 3QEUA 1MCWM 3WXVH 3L6FB 2YPVH 5T3ZH 1V7ML 2BNRD 4WY7L 2GJ6E 2D7MA 3DVGB 4XNYL 2HRPL 3QQ3B 3IVKA 1CGXA 1DANU 4LBEB 3VFOB 1XFPA 1NMAL 2FSEA 4NQDD 5F88A 5AEAA 1ZLVK 4AJ0A 5DRXB 4MMXC 4JJ5B 3UX9B 3FHQA 5D6DA 2YHGA 1SEQL 5K33A 2L7UA 1ZT1A 1KCSH 2Q76B 5TE7H 2Y07H 2VDRH 2I5YH 2PF6A 5CBAA 4K3EL 3JUZA 5DJ0A 4J4PC 4GG6B 3SY0B 2ED9A 4B50A 1VEPA 3RTQA 5D1XA 3H7BB 5JUEL 2QV2A 2G9HB 3KPMB 3LKNA 5CS7A 3QG6A 4K23L 4K7FA 4OQ1A 5BV7C 3DETC 2MKWA 4IS6A 1OT2A 5C3TA 2E6JA 2QSTA 4NQUA 4JE4B 4U6XB 4JO3H 4NRYA 2KPNA 1B4RA 3FB7A 4G9FE 5I74B 3QIBA 3QEHA 5IK3B 4G8EA 3SGKA 4X6BB 1EAJA 5FUCE 1OTUD 4PJAA 4JVPA 4PR5A 4GG8B 5BMFH 2DQEH 3WHXB 1DFBL 3CVHB 4U1GB 1DLHB 5D93B 1TVHA 4ZUWA 1G9MC 5ESVB 1QVOA 3TLRA 4LASH 4NQSB 4YFDB 1IEAA 2NLJB 5DC4B 4WI6A 4C83B 2PKDA 1X5AA 4ZO7A 1K6QL 3OKDB 2ADGB 1KIPB 1S78C 2FD6L 4S1RL 1G9EA 3KPOA 1U95A 3KJ6L 4JFOA 1P1ZA 4G9DA 4XVUD 1GZQA 4OM0L 3HPJA 2APTA 3HMXL 1BQHB 1ACYL 1C1EH 5J11C 4ZOBA 4KQ4L 4PJBF 3F8UB 1LD9B 4OCNC 3JWOC 3C2SA 5E2JA 3TCLB 2IBBA 1NFDF 1I9JH 4JKLA 1BIIB 1A5FL 3AS1A 3ZHKA 1WCBA 5DJYA 3EGSA 3GMPA 1UG9A 2BC4B 5C0ND 4G3YH 1EV2E 3FT2A 1T22B 3O9WC 4M7ZB 3EOTH 4JFYA 4HKXA 5IHUH 3S4SG 4HXBH 5DSCA 1AD0A 3W11D 1DBKH 3QQ4B 5HDOA 3BRDA 4YDLB 2X4SA 2AJ3A 1B4JH 1GGBL 3QUZB 4WW1B 4M1GH 2V2WB 4Y5XA 3G6DL 1N6QL 4Z7OF 3WMSA 2BSTA 2ICWA 3U0WL 4PRHD 4RQQA 1AD9B 1JRHL 3OJDA 4JHBA 4OSUH 3TJHD 5EO0B 1NUDA 4NN6B 5DD3H 3QH3A 2B8OT 3MXWH 1A14L 1E6OL 5I19L 3F6IA 2VR9A 2IH1A 2ZUSA 3IETB 3EBAA 1G7PA 3RWFB 5LG1A 5A16A 2AXFA 2Z93A 4UUJA 3HC3L 3MA7A 1YQ2A 4RMUA 2XRAH 3FOMA 3TV3H 1QBMH 3KJ4C 4M1CC 4WWKB 5IBLC 1KTDB 3VE0A 3MJ9L 1NAKL 4OAWB 7CGTA 2R4SH 3DECA 4QTIL 3PWVB 1KG0B 2EDXA 3D85B 2ARWA 1XH3A 3IDMA 3KPLB 4X7SL 5AZ2L 1JZ6A 5GHWL 1VACB 5EUOA 2QQQA 2DL2A 4NJAL 4X7CC 1A6ZA 3VXPA 5E2TL 1N59B 2X2YA 5CD3A 3PJSB 3ZE1E 4PJEA 5BV7L 2OXGA 4YHZL 3VJ6B 2CKBL 4RBPH 2BSRA 3S35L 3KXFD 2EDKA 3QEQB 4HIIB 3T4AA 7FABH 1EPFA 2XKUA 4U1HB 5FYKL 1ZLSH 1BZQK 1KCUH 3TN0B 2IQ9L 1IAIM 4LRIA 2QADD 4Y16C 1CLZL 3MLRL 1IM3B 2YD6A 3TT3L 6FABH 4OFPA 1U8OA 3MA9H 4KHTL 1BOGA 5FHAH 1G9ML 2ADFL 5KVDH 2QQKL 2QSVA 3LS4H 2P5WE 3Q1SL 3T0VA 4PGEB 2HWZH 4P46C 3L5XL 3DX9B 2WUCL 5LGJB 2YRLA 3TNMA 1P4IL 4LHUB 5FM8A 4YE4L 3L3JB 1YEEH 4AM0A 4JPKL 1EUUA 5DVOA 3GSXB 1MY7A 2R1XB 1NFDE 2JELH 2DQGH 4MB4A 2BOBB 5DHVH 1CE6A 4PJDE 4L5FL 4ZS7L 1UEMA 1KCLA 2XTJB 5EBLA 3HG1A 2E7CA 1HSAB 4KUCD 4IRJD 3L3IB 4LCYB 4NBYB 4MHHG 3ZT6A 2FB4L 1AE6L 5GRUH 3Q2CA 4HUXA 4OUUB 1IKFH 2OL3H 2C3VA 2G5BA 2JCCF 1HN1A 3U46B 1MRDL 1U91B 2PXYD 4NZTH 1LNUA 5J6HB 4PUBL 4ZTPL 4Z7OE 1GGIH 4O5LL 5BS0B 4J4PA 2H3NB 3P73B 4O4YL 1KB5B 5ALCL 3PGDA 2HRPH 2OR9L 5JOFB 5DD1L 3GK8H 2A6DA 4F7CB 4FXLA 3UROR 1HILB 1ZGLP 2Y6SD 2CDFA 1OL0A 1I8KB 3HZYB 2FR4B 3KPQB 4GKOA 1SEQH 2VSCA 4N5ED 2J4WL 1KB9J 2XN9D 1PEWA 4JY6A 3SDXE 3TYGL 3WFHA 5JO5A 1OOAA 3IFOB 4DJMA 2OJEA 1YDPB 4PJ8B 1FL3A 5BVPH 1PG7X 3LS5H 5MI0B 3FFCB 4XPBH 2NX5D 5DHXB 2UZXB 3LPGA 4NSKB 4XNXL 2O61A 4PREA 1JZ4A 4FQ2H 4V2CB 1S7UB 2HG5A 1UZ6F 3D0VA 1RUQL 5FYJL 5C0BE 2AQ1A 1JYWA 1ACZA 5F6IB 4M5ZL 3KYMA 4TUKH 3C6LD 4M93B 2ADIA 4HG4J 1S7VA 5I6XB 4IOFC 3CC5A 3C9NB 2O26U 4V1DB 1FGNL 2HKHH 4MZ3A 3GSUA 4P9MH 5C07D 4EOWH 5T3ZD 2Y06L 4XP9H 4RFEB 1K8DB 5DEZA 4FA8A 2RB8A 4NZRL 3MJ6A 3V5HA 3BHBB 3WCYA 3MV7A 2B0SH 4GJTB 4NO3B 3EHBD 4PP2A 3VGDA 2FWOA 3IS0X 1FC1A 3QXVA 3AXLB 2YXMA 2QQNL 5E2UL 1J87A 3RIFK 2NY6B 4LSQL 2R1WA 3PDDA 4K3DL 3ISWA 3QDGA 4JRYD 3OG6B 1BREA 2XQBH 3ULUL 4E0RA 4MDIB 3WDJA 3C5JA 4OD1H 1R6VA 4YEEA 1K6QH 1PQZA 4WUKL 1EO8H 3JSSA 5MP6L 3O9WA 4YHMH 4APQD 3NFNB 5C2BH 1A7NH 1GJIA 5C9JB 2OTWA 2C3WA 1RU9L 2DQHL 1BJ1J 3L7FA 4LLMA 4KQ4H 5GRVL 3IFPB 4ELKA 5I73C 5CCKH 2GK0B 3GHEL 1E27B 3KHQA 3AU1A 1F4YH 1RUKL 3P9MA 3VFVB 3K0WA 4FFYL 4QCIA 1IFHL 3MRMA 1CDUA 2R39A 2AEIT 3H6JA 3BUYB 2ZP0T 4F8QA 4XXDA 2EDLA 2Y36L 5DR5H 3TEUA 5AAWA 2OTUA 1X5HA 1H5BC 2GTWB 1I1AC 1UQSB 2VLJE 2BDNL 4PJ9D 4UMGA 4LCWA 5ID0A 1I8LC 3GSVB 2XZQL 1GL4B 3HLAB 4LVOB 2BERA 4P4KD 3O6KL 5DD5L 4YHOH 1L9MA 2EDOA 1Q94A 1FFPA 1HQRA 1Z0MA 1TQCB 5IESL 2VDQH 5DUBA 3D0LB 2R1YA 4NQCB 4P2CG 4K8RL 2NXZB 4YGAB 4OLXL 3GSNH 5HD8C 4MA7L 2LV4A 25C8H 3S37H 4GAFB 1A14H 4MXVF 5T1LA 4KRMB 3HI1A 1YNKL 1IEHA 3LDBC 4KJYA 3CFEA 1TVHB 4HJ0D 1CFNA 1K3IA 4ACPA 5JW5A 1UKTA 4PLKD 4MSWA 4Z0BL 4LPCA 1TZHA 2K1MA 5E8PB 3EYVA 4FQHB 2HLAB 4XB8A 4ELME 5IVOA 1FL5B 1OGAB 1RZFL 2Y72A 3NCEB 5I9QC 5IQ7H 1UZ6E 4KROC 3VXMB 4G8FA 1JJUA 4Y16A 3S4SA 1S9KC 2Z92A 4JKPL 2IPTH 4Y5VC 5LKNA 3ECBA 2D2OA 1CIUA 1HQ4A 2A6KA 1U58A 3MRIA 4NC0B 3PUCA 1DLFL 2ARJA 3MOAH 1K5NB 4XBPA 2GCYA 3VFPB 5DO2D 1MRCL 2ESVE 4X99A 2CKBH 3RA7L 1C08A 2RIKA 3OAUL 3B2UC 3KAAA 2Y7QB 4G6FB 4N9OB 1INDH 4X80L 3LKPB 1Y18B 1EHNA 5FYKH 5LQBL 2IPUG 3DMMC 3FKUS 5E4IA 1BJ1H 3IDIA 1FO0H 3ZO0A 1LK3L 1TMCB 4RNRA 4C4KT 4HWEL 4NT6B 2EIBA 1JMXA 1VHPA 5EPMB 1YJDC 5FDWB 2CJUL 1HXYA 3KLAA 2IG2H 2X4SB 3T2NH 2J8UA 4JPIB 4X4YB 4GRLB 3U48A 1UZ8B 2HTLC 1IAMA 4QXTB 4PGDA 4KHXL 5DD6A 2CKNA 4N90E 5EG6C 1YEFH 4DQOH 1P4IH 1OY3B 1SJEA 5JORA 4XWOC 3RDTD 5LXGH 5A43C 3ZL4L 5TF0A 3UC0H 1YYML 3K74B 2BCKA 4X6CA 4H88H 4PD4J 3A6CL 2Z93B 4NUGL 3QUYB 5HXMA 2ZCKH 4M6NL 2F54E 1FFQA 1YECL 2W60B 3MLTB 4PBXA 1BZ7A 4UT9H 1QNZH 1HOCA 4HQQH 1CL7I 1JWSB 3GI9H 3KR3H 1F6LL 4WJ5A 3DVIA 1A7RH 2AEQL 3BEWA 3C5ZB 4M7JL 2NW2A 5ERWA 4DKFL 5H37H 4P49A 3SJVB 1FAIH 5C0CB 5F93C 4I18B 3RL2B 4NNPH 3FONB 3DRTA 4TSAH 4XAKD 4CBPA 4KK6C 3MMEA 3BKYL 3TO4C 5D6CA 2V2TB 5TDOA 4TUOA 3WD5L 4XNZC 3T0EB 1FP5A 5GSRA 4S1SL 3D18A 1HH9B 3RI5K 2AP2A 4MXVE 1IGTA 1FBIH 4J3XA 5ISZB 2A6IA 1I9RL 1NBVL 3RWGB 5FECA 4DOHE 4OZIB 5DT1L 1G7MB 4JANB 2HT3D 3DUSB 1J88A 1A1NA 3DXAD 1L0XA 4OIAA 3NVQA 1NC2D 3N1GC 2J4WH 4DUWA 1D5ZB 2EC9U 1HHJB 3FT3B 1CL7L 5F89A 5FCUH 3UBXB 2VDKH 5DRZB 4MNGB 2ORBL 4JFHD 4EJ1C 5HGHA 5EZOL 1KJMA 3HE7C 3FO1B 1PX4A 4MAYC 1RUQH 5FYJH 1S7XB 3D69B 1WISA 1VFBA 3RJQB 4M5ZH 4MYWB 3BIBX 2RBLA 3E6FA 2FHCA 5EBLB 5ACZA 1UYWL 5CIPB 1IQDA 3TCXA 3BKCH 3C8DA 1XF4A 2VXVL 3MV8E 2MHAB 3B9KB 4TQEH 4Y1AE 1ADQA 5TDPA 3QXWA 4G8GE 4Y89A 3LAFA 4KQ3L 3BEVB 2A77H 4GUPB 1P2CA 1YJDL 2R4RL 2G5BB 2BMKA 4RGMB 1RZGA 1LNUB 5BJTB 2QQNH 3SKOA 3SKUD 3MRNB 4K3DH 4H25B 2ICEA 1JVKA 4Y19A 3BPNC 4L8SC 1JPSH 1MCOH 5C6WH 3QIUD 4OCRH 5E24E 4R2GC 3IAQA 35C8L 3PGDB 4H0HB 1AGFB 1VKXA 2PNDA 2X9WA 3OAZH 1H5BA 2DM3A 2EXWD 2DM4A 3VD9A 5DZNA 1X4YA 3QG7L 1I1AA 4NZJA 4LSSL 1A3LH 3HI5H 3KPNA 5C08D 2P4AB 4BFEA 5E94B 1NDMB 1JNLL 1MWAL 5I8EA 1YEIH 4QYOB 4GG6F 5EZJA 3MLWL 1RUKH 4QTHB 2AK4E 1AKJA 3R0NA 4PRPE 5T1KD 1LDPL 1IVLA 1XGTB 2DLGA 1JPST 5EOTB 5E08H 3B9DA 4OCLC 4FQJL 4RX4A 3TIEB 1H0DA 3GMOB 4X4ME 1ES0A 4OCYH 4S0SD 3MBED 2B1AL 1KV3A 4ZD3L 15C8H 3NFPB 2NXYB 1GGCL 4H5SA 4U1IB 4ODUA 3KYMB 2DTSA 3QI9D 3P4MB 4NKMB 1MVUB 4NYLA 5MHSD 3QBTB 5SWQA 3L1OL 2GUOB 2XZQH 4G6KL 1YC8A 4Q6IB 1T7ZA 2YUVA 3PWLB 2LTQB 3MOQA 1UA6L 1I4FA 4MNQB 3M17A 4LVNC 4YHPB 1BZ9B 3BN3B 4O2EA 4Y5YC 4WCYL 4Y5VA 4KJPD 1YY9C 2NY0D 4MA7H 3ILPA 3G5XA 4XCEA 4LLYB 2W0LA 2IPUK 3BGFC 5BRZD 1HHGA 3TF7C 1IMHC 4QNPE 3UYOD 3NCFB 3MRRB 2VAJA 1I1YB 4OD2A 2HH0H 3DMMA 1CFVH 4HUWB 4UTBL 3SEPA 3OKEA 1GHFH 4CAGA 3P9LA 5KVGL 1FG2B 4M6OL 4ZS6D 2CR6A 4PJ7B 4OGYH 3V79C 2OTWB 4ORGB 3WO4B 1CXKA 1FORL 3QWRD 5MENB 4ELKB 3QUXC 2FGWH 4PJ5E 2E8YA 5JOEA 4NQEB 5DJXB 3RA7H 4EN3C 1MHEA 4H26A 1ED3A 3Q6GL 2VLKE 5IMMB 4PB9L 5LCVL 3FTGA 3HKFA 4GAJH 5DD0L 3D39D 4JFED 2VXUH 4NO2B 3QNZB 1NCUA 3SDAB 4KTDL 5AZEL 4OLWH 2Z8WC 4I2XE 3R8BB 4QRTB 3U0PA 3MZGB 5JXEC 1NSNL 1QG3A 2CJUH 2EXYD 3TGXA 5EDXA 3DO7B 4UOW1 2ZJSH 4NPYB 3ARVA 4X4XA 1MIMH 3IDJA 3OB0H 3GUTA 3ALPA 3T0AA 2ZOLB 1QHPA 4NC1E 3AM8C 3CK0L 4P57A 4YR6B 4QHNA 1N64H 4ESKA 3GDBA 3ARBC 3UTOA 4HIXL 2HMID 4DZ8B 5I8OL 4HFUH 1FFOB 3VFGH 5T1LB 4UBDD 2PXYA 5MERB 1RUPL 1TTGA 2Z31D 3TO4A 3I75B 1FH5L 2K7PA 3MRCA 4UDUB 5D5ME 3R1GH 4JFQA 2OX5A 5IF0B 3UTTA 1CFSA 1OTSD 5C8JA 1JPTL 2D0GA 4XTRD 3T0DA 4DEPB 4M8QA 4NM8H 1CG9B 4XCYA 3P0GB 4QRUA 4ZFZA 2X9YA 3ARFC 5FYKD 3CH1B 4C4KO 1HQ4B 4F2MB 3RNQA 3RAJH 3VU2A 4NRXA 3FO2B 4FQCL 5ESAA 1DQLL 1TCRA 3MRKA 2G5RA 1D6VL 4Z95H 5DJAA 4OD3H 5KBNC 2EIDA 2AEPL 1JL8A 5E6IB 4HIJB 2NX5A 4S1SH 2F5AL 2IGFL 2ATPA 5DK0B 1ZLWH 2AEWA 5F7LB 2W0PA 3HMWH 3HE7A 4RNRB 2FX8H 2YBRB 4ZFOL 4MAYA 5I1GH 1ZA3A 3VXTA 3BWAA 4NO0D 3OBAA 4LVEA 5DT1H 3C6LA 3CXDL 4YO0A 3FQXA 4FTVD 4PRAB 5I71B 5C0AE 2PO6D 2MNUA 1MCPH 5FOJA 5L9DH 4EDWH 2B20A 4JFXB 1QO3A 1AP2B 2A73B 1VENA 4R3SB 1KYOK 3DV4A 3ZYZA 1KC5H 5IVXF 4UTAL 2H9GB 5EUKB 3BSZH 3CSPA 1Y6NR 4S1DC 3MZTA 4ISVA 1MFAL 4KPHH 1CBVH 1T1XA 1U3ZA 3GBMH 3CU7A 4OM1L 5DUMH 5EZOH 1UKQA 1NGWB 5IBUB 4BZ1H 4CN6A 5IV2A 5JHLH 2BCKB 4HKJA 3BJLA 4XNQA 5CEXB 3K46A 4UQ2A 1C12B 5I2IA 2VN7A 2XPGA 4JKMA 2BNRB 2J3SA 3V0VA 5IEKB 2R2HA 2DDQH 1LO3H 1BVZA 1FDLL 2AKRB 1WICA 3RGVC 3GSWB 5K9JH 4X98A 3KLSA 1BVLB 1CE1L 1INQA 4NQDB 4O00A 3SGJC 4A6YL 5CJXC 4S1QL 3HFML 4HBCL 1RHHB 2PR4H 3N50A 1T5WB 4HS8L 3DRTB 4XXCC 3IDGA 2OI9C 1D5IH 5KSUA 3T1FB 1WIOA 5TDOB 5KW9H 4IMKC 4S11A 3JUYA 2R29L 1Q9WA 4ODXA 5SV4A 1DN0A 3IT8D 5KVEL 5K59F 3FN9A 2CIIB 3NTCH 5I15H 4L4JA 2C4FU 4JZJC 2PYEE 1WITA 35C8H 1IGTB 3FT4B 3OZ9H 3MNVB 3CD4A 3MGOA 3E8UL 2AQ3A 5CUSL 5L0QC 5FECB 1NQBA 4F7MB 2X1WL 3IU3A 4PJXA 2G2RB 5B4MC 1JHLL 3ES6B 2BHZA 1ZHBA 4Q58C 1I8MB 3NZHL 4L3CB 5IW1A 5FYJD 4PJHE 4Y2DD 1F3JA 1LO0L 4U6HB 1MLCB 1NDGA 2YPLD 4XPFL 2ID5A 5F1OB 3PHQA 4Y5YA 5GGRB 3JWDH 4FQJH 2VQUA 3EIFA 3P0YH 1VADB 1VFAB 1MQ8A 4BQ9A 2P8PB 1UH4A 4ZFOA 5DMYA 2B1AH 4DAGL 5IB3A 4Z5RB 2ED7A 2MCPH 4EBQL 5KN5A 1VFBB 5E2WH 3QNXB 1AGDA 4XNMB 4PV8B 1MFBL 4MJIE 3F7RA 4KY1H 4RBPK 4AK1A 3L3HB 5FGSA 2C3GA 4OI7A 4KGLA 3MO1B 3NPSB 3PIQB 1A9EA 1G9NH 3DI2B 3BP6A 3DURA 3MR9A 5D71L 4H20L 2EDEA 2E27L 5AWNL 5GS1C 2XOTA 1DBJH 3AB0B 2GJ6D 3MRLB 5TFSH 2BVPA 3O2DH 3WFCL 4WCYH 3U82B 4NJ9L 1YMHA 1BD2A 5LGKA 3FQWA 1EK3A 4BFIA 4G7YL 5FFLA 1I7TA 1NAMB 4NKIL 3EYFA 3QUXA 4LEXL 5TDNB 5EIQA 1D5BA 4HEME 2AJXL 4ONFH 4F7PB 1Q9KA 1UC6A 3O4OB 5IVXE 4RGNE 2HJKB 1NCWL 2D7NA 4F33B 4CVZA 5L7XH 1CD1A 3VRLE 3NFSL 3OHXB 5EBGA 4J7RA 4OF8A 4WW2B 1EGJL 3O3BB 2HTKD 5D7SL 5EIIA 5GZND 5JXEA 3RZWA 1C5BH 3VXNB 4HGWA 1JZ5A 4WNQA 1A4JB 1B88A 3I3EA 3O3EA 4LEOA 5FA3B 2X4OB 5L2KA 3RKPA 2ZCLH 2OZ4L 2HT4C 3AM8A 1LP9A 2H26B 4PB9H 4PRHB 5LCVH 1S9VA 4RDQG 5K9QI 3ARBA 3J8F7 1IE5A 1XCTB 5J9PA 1U8HA 2AERT 4JAMB 4KTDH 1NCBH 3NZ8B 5AZEH 4POZD 1BX2A 4UIMA 5IHZA 3MJ7A 2X5PA 1KTLB 2P42B 3EJYD 4K8RD 2J6EH 2I60H 2XYCA 3OKLB 4A2LA 4CKVX 2XWBB 3WE6A 4ETQB 2XWJB 3SE9L 1QLRA 4K9EC 3INUL 1Z6JT 1QQDB 4OIIH 1OAQH 3I84A 3P11H 5HHNB 3QFJE 4R4ND 4ODTL 1QYGL 4AG4H 4D9LL 1R0AH 5D4QA 3K3QA 2B5IC 3QUML 2FJGB 5C6TL 4PJGE 2BY2A 3ARFA 2EZ0C 3I6GB 1HHKA 5K9OA 3RWCB 2AV1A 4P4RA 1DE4B 1ZTXH 2BSSA 2P8LA 3EZJB 1A6UL 1XF1A 1DSFL 1HHGB 1M6OA 3KXFB 3RZCC 3VXUA 1XIWD 4FFVD 4NM4L 5JHDA 1F6AA 2JLLA 5EU6A 2P5EE 5H2BB 3VFMB 1RPQA 3H0TA 2QADB 3EYQC 3DOSA 1M71B 2C7UB 4XMPL 4UINL 5D7LE 2RCSH 3BISA 4L4VE 3C60C 2HJFA 12E8L 3ROOA 4NOBA 4PV9B 4FS0A 2DQUL 1NC2A 1T66D 5ANMB 2MFNA 5IM7A 1W8OA 1B2WL 3M07A 4LIQL 4UV4H 3TBTA 2VZVA 4G5ZL 4P2RE 3UAJC 1ED3B 1NCTA 2AEPH 1ZXQA 1FYTA 4Z76B 1WWAX 2AGJL 3GBNL 2R69L 2WMPA 3ARZA 3FTGB 4F57H 1IAIH 4OUOA 4FHBD 4AH2B 1D5MB 4JG1H 3AUVA 1EGJA 3H9SA 1F2XK 1T4KA 4P0DA 3P77A 5DJ6B 3JVGA 3BD5A 1F02I 1P7KB 2A0LC 3SDDD 4JLRB 4YNYA 3HB3D 4IRJB 2IPKA 1WBYB 2OZ4A 4FFWD 3PL6C 1ZWIB 2DQIH 3RGVA 1BWWA 3CX2A 1CD0A 2NY4C 5E9DE 1RIHH 1OD7A 3ZKMD 2E9BA 2XWTB 2XXCB 1F3DJ 3KWWA 3LSOB 4U6YA 4V2BA 5DLMH 3N0PB 3K7UA 3V4PH 3WXWL 2PXYB 3QPQD 3S3PA 4IMKA 3U30C 1RJCA 3I3DA 4QWWD 3NN8B 5DQ9B 1TXKA 1H15A 4NWUH 3MRCB 3TYFA 4MJ2A 2W65A 4D0CA 2BNQA 1KOAA 3V6OC 4NHCL 5CJBA 4BH7B 5ITBL 2IANA 5J8OA 4JZJA 4DUVA 4M8QB 3J7HA 4LOUD 1S7RB 2Q6WA 1MHHB 4JFFE 1FGVL 3QUMA 4GO6B 5B3JF 1YMMA 4MVBD 1FIEA 3AY4C 4A6YH 1KULA 4UILL 3WN5C 4OLVL 4QHUB 5C08A 3HFMH 2O5ZH 2C4XA 1LHZA 2A2QT 2APVA 2ICES 2XN9B 3EO1A 4OJFH 2AJYL 3BAEH 3MRHA 3VXOA 2P5WD 5KSAC 1BFVL 5KSBB 4TPRH 2NX5B 2CK2A 1SYSA 4K71B 5JMOC 4XZUB 2QHRL 2W38A 2MCG1 4OZIF 1HDMA 5IB2B 3VCLB 4HG4K 1V3LA 4WU7B 1NBYB 1QFWL 5ALBL 4L4TE 2VZOA 4I13B 1QEWA 4DZBB 1EFXD 3VXTB 3BWAB 4QXUH 1EAPB 1IJ9A 1OGAE 3TBYA 3C6LB 1J05B 2R9HC 4NWTL 4LSUH 4NGHH 1T1ZB 4XWGH 2ICCA 3PV6A 3NZHH 5EZIH 1S7QB 1MNUL 1FNGA 3HR5A 5EA0L 4L9DA 1HYSD 1A4KB 5C1MB 4NKQB 2P8MA 5HGBA 1J5OL 5FO7A 5DXWA 3N1QC 4RZCB 1IL1B 3VI4E 5C07B 5GS1A 4XCFL 3GHBH 2Q8BL 3V52L 1T1XB 3AFLA 1AIFB 3NCCB 5H35B 3T3MF 3P0VH 3O41B 4KKBC 4DAGH 5IMKB 1D5XA 2CGRL 4JRYB 2KBGA 2X89A 1A6VH 1N5YL 4NIKB 3ARED 3UTZA 3QAZB 3RVWC 2Q87A 1XR9B 4Z8FH 3CUPA 2OK0H 5CEYA 3D3VE 1F3DH 3F5WB 3GSQA 3MLYH 3UTQA 4APQB 2YC1B 5D7JD 5I1LA 3ZE2F 1JK8B 2AK1L 1X3DA 4XPAL 4U0QB 4L1DA 4Z7NE 4UDTB 1IBGL 4PBVC 4ZFGL 1FNEB 3IDGB 2NY1C 2GSIB 1NGQH 1DANT 3WFBL 2VKWA 1LO5A 1EEZB 1EX0A 2IFFL 4PJCB 1IC7H 1LEKA 4JY4B 4JFDD 3H3KA 5KANI 2D4FA 1IAKB 1MUJA 1WIUA 4Q2ZA 1H3TA 4OCXL 3MOBH 1G7HA 1JWUA 4ZYKA 3TT1L 2FYYB 5D7IA 1OWRM 2X09A 3E2HB 3V95A 4XPHH 4HC1H 4PP1C 2I07A 1UM5L 3GSNA 1MAJA 1U3YA 4PJ9B 3FOLA 4YDIH 1T7VA 1TNNA 5C0BD 1FVEB 4GW1B 4G6JL 4GKZA 1XGRB 5IW1B 3WL9A 4YHKL 5I30L 4P4KB 3QHZL 4BSJA 4X7TB 3PQYE 1XAUA 5B3JE 1MFDL 3OKNB 4F37K 2Y5TA 1HIML 1FSKC 4KDVA 4OLYH 2V7NA 4F15C 2BVTA 4P3CL 3ZKNC 1F4XH 1FRGH 3ZDXE 3G6AB 4YQXL 2P43B 1HH6A 3TA3C 4PLOB 3FRUB 4ODVL 1KIRA 4HSQA 1NFIA 1N8ZA 2YXFA 3RZCA 2DQDL 2UWEA 4LPVA 3OSKA 5ISZE 1LVEA 2Z35B 4HIEA 4KK5D 2AXJA 4YUEH 3LH2L 3V4UL 1LEIA 1AXTL 1OAZH 1R24B 1NGXB 4GSDH 4NZDA 1YEDA 1MCNA 4FZ8H 4F58L 1QBBA 1MCRA 1SVZA 3C5SA 5DFTA 3MUGA 1N0LA 5TF1H 1HSBB 5C6TH 4DUXA 1FO0A 3BW9A 2C9AA 4TVPL 4MNGE 3BESR 1HCVA 4X5WA 1GAFH 2DTMH 3H9HA 1YEGL 4OLZH 3VWKD 3MRPA 3RWJA 4OZGA 1QSEE 4Z7WA 3HE6C 4PJ7F 3MRQA 4JFZH 3S8WA 2UYLB 5LAXB 4EVNA 4P2YA 1K85A 5GIRB 3CFIC 1FC2D 5E8NA 4LFHD 1IQWL 3L9RB 6CGTA 3LN5B 2BX5A 3EFFB 4P3WA 1UWEH 1F11A 4NO5A 3DX7A 4FTVA 1DQJA 3ULVL 4LCUB 3DHMA 3C8KA 2VLJD 5F7DB 2DQUH 2W0FB 5FGRA 4QEGA 4H0GA 4QRQA 4GQPH 3WJLC 2X4UA 3LEYL 4MCYB 3TPUA 3ZE2E 4FMKA 3PL6A 4EUPA 3OKKB 2AI0H 5FA4A 4KJWD 4DK3A 4I77L 3LKOB 2N7BA 3RDTB 5J9PB 5HY9A 4FQLL 2CQVA 1T1WA 1KJ3L 2CDGB 1MFCL 3WS6C 5HVHB 4WDIA 2B4CH 3QCTL 5HHQA 3L3GA 4G7VH 4Q9QL 3QDHA 1Q0XH 2E7HA 3T09A 1IAOB 1XR8B 3V6OA 1ORSA 4XC3L 4GMSL 4XAWH 1D7FA 2DWDB 4XRCB 3GO1L 1MHCA 2WIIA 3OAZK 4HH9B 4ZUUA 2GYSA 2JKXA 2NR6C 5C0FA 3AY4A 1HHKB 2HFGL 3WN5A 3JTTB 3LRSA 2YSSA 1R5VB 3LB6D 1MQKL 4Y88A 4WGWB 5D2LE 5TQ0H 1BQLH 3O4LD 3RVTD 1KPRA 4PTTB 3GMRA 2FZ3A 3IAGC 1F4HA 1UVQA 4CMHC 5KSAA 3TVMD 2ESVD 3EYOB 1EXUA 2B2XH 2VL4A 4QOKD 1SJXA 2EYSA 1UADC 2VRAA 4HUVB 4M6ML 3GJFH 4CNIB 1G6RA 1WBZB 2HJLA 2B1HL 4QO1A 1FGVH 1GOFA 4YGVB 3WUWB 5DRWA 1KFAL 4P5MA 5DS8B 3L3OA 4MB5A 1VEOA 3MJ8B 4MNQE 1M7DB 3N85H 3DXAB 3B5HA 1JGLL 2IF7A 3IJSB 2H32B 1NC2B 4WHTA 1EJ6A 3O3AB 4M00A 5DHVB 2XT1B 4QHKJ 1NGPL 3TBVA 1BFVH 4PJIA 1TFHA 2BXZA 3UJJL 4IBLT 1S3KH 2C1PB 4K2UH 4N90D 1MIEL 4U6TA 1KCRL 4JM2F 1KJ2H 3O2VL 5IMLA 3UPRA 4Q9RL 2XACC 2H2PD 2IQAA 4HPYH 2OL3B 3NA9H 4QGTA 4EI5C 2XZAH 3Q48A 4U0RB 4YAQA 4PJ7E 4HUNB 5EOQH 2F54D 2FJHB 5I1HL 3RY5A 2K9UA 1JP5A 2XZCH 3D25B 5CSZB 4ODWB 1Z9OA 5MENE 2GJ6A 1R3JB 1JF1B 1FNAA 2R0KH 5JQ6H 2V5RA 3VFNA 1T6VN 1UJ3C 2Q8BH 2XKNA 4I8DA 1S9YA 5IBTL 4M48L 2YUWA 1WFUA 2ZUUA 1JGVL 4Y4FD 1LK2A 2A1WH 1HINH 1A3RH 3QT2A 4MXWL 1W0WB 2PETA 3ZE0F 1FZJA 3IFLH 3H3PL 4ENEC 3LKSB 4L8CB 3UJIL 1C16A 3QIUB 1E4XI 1J7VR 4CVWA 3B8SA 1XGPB 4J3TA 1H8NA 2F5BL 4LSPH 3D2UD 4JDVB 1N2RA 4UNVA 4HS3A 5C6PB 2APFA 2BVOA 2AK1H 3QEGL 2Z4QB 1BOYA 1P53A 1WJ3A 2ZG2A 1FCCA 2QKIA 4JN1H 4L3EA 5EULV 5C08B 5DJ8A 3U4BL 1QSFE 3SPVA 4XC1L 1QPPA 3O6FD 3WFBH 3RL1A 4IMLA 4Z7UF 5T1KB 4LHJB 1Q9OA 2NW3B 1CDJA 3T77A 1RJZA 1HYRC 1U6AL 2YD1A 3HN3A 4NHUB 5JR1H 2DLTA 4G9FA 5IEHA 2HFTA 1MJJB 3MBEB 4FXKB 4N8VG 3MLSL 5IGXH 4I0PC 2NY3D 3QI9B 5H94A 4LFHG 3PWPA 3UO1H 2NY5H 4MA8H 1S8DB 4P2QA 4J3VA 1MJUL 3QO0B 4MD4A 4OZHE 3TWCL 5F71A 3VWJD 5ADPH 3BO8B 4D94A 3CLFL 4XPTH 5I1DA 5HYJA 3MV8D 4XGZB 4N0UE 2EDHA 4Y1AD 1DDHA 5T5FH 3WLBA 2NY0B 5ENWB 4G8GD 3KPSA 1P7QD 1S9XB 4NN7C 1EO5A 4YXKH 3BD3A 5BRZB 4YFLI 3OXSA 1D5XB 5CEZL 1OCWH 1T5XB 3SDCC 2O5XL 4NFCA 2FRGP 2F19H 4TTGA 3VG0H 4O9HH 2L4OA 4M3JA 2WM0A 1IGCL 3PV7A 3DWTA 5CJQL 1OP5H 5DEGB 4M7KH 3HE6A 3KNBA 4KRPD 3K4AA 4W4NA 2DQCH 1U8MA 3GSQB 2VWEE 2LVCA 5I1LB 3NIFF 4U31A 3CVIL 3B3IA 1DBAL 3BQUD 1CDGA 3M1BA 1ZANL 2YMXH 1UWGL 5SWZE 4PRBB 5GRJH 2OLDA 1N7MH 4ZUSB 3F58H 1FVCA 3DLQR 3BP7A 2HFFA 1HZHL 5DA0B 1I7ZB 3WFEH 4DFIA 3LOWA 3U9UA 1J0ZA 3VWKC 2YUZA 3O45A 2AK4D 3QQ9D 1SBBA 2HVJA 3D39B 2R2BB 3N1FC 4JFEB 4KMLB 4OZ4A 3D1MC 4PYGA 4MXQC 4WW2F 4U2ZA 2VXTL 5DWUL 2AVGA 3WDHA 2BNRE 5JDSA 3KLHC 5C0GA 3ZE0E 2FECI 1JPGB 3GSNB 1L9NA 3WS6A 2VXSL 2ITCA 4ORZC 1CFTA 1JTTA 2F53E 2GT9B 4JRXA 2GY7B 1T80A 2Q86A 5IQ9B 3X12B 1IGML 5HTSA 3H9YA 4NNYA 1R5IB 4HMCA 4TRPL 4OF3A 1OAKL 2X4QA 2YPKB 3QCVH 3IU4L 4I77H 3QRGH 3V7AE 1W72H 2YA2A 4NCC2 1V7NL 3JWNC 4HF5H 5HYEA 4Y8DC 1EJOL 4K7PH 5IKCB 1II4E 1KB5H 2Z31B 4Z7UE 4EI6A 2D3VA 4BZ2H 3O8XD 3PWJB 4QY8B 1QRNE 2ZSVA 4P23D 4Z7QF 3T2OA 3W0WE 1RK0B 1TZGH 1EVTC 1T1YA 5ADOL 3G5ZB 4FQIL 2CKBB 5J7CC 5HYQB 4TOYH 5FKAB 3IJYB 3UZQA 2FX7L 1DQDH 2CRZA 3CFJA 1LEGA 4ZAKC 4NQXA 1INEH 3VGAC 4MJ5B 4FQXC 3BW9B 4Y2OA 1OARH 2CXKA 5FK9B 1H3XA 1Y0LB 2VJXA 3AAZA 5HHXL 1FNSL 4PJ5D 1B3JA 3BZ4B 3T08A 4QRRA 2NTFA 3NABH 1WBXB 3P4LA 3KPRA 4TUJB 2VLKD 3GGWA 1R3LB 1CVSC 3VXRE 5D2NB 5EZLB 4PJBA 1KFAH 3HZKA 4NO0B 3QCUL 2YD5A 2EKSA 4PGZA 5JW4N 4FTVB 4QT5B 3CLEL 2PO6B 4EI5A 1TVBA 1J0JA 1MJ7H 2GJJA 4KFZC 1J1XL 4UV7L 2ATKB 1KNOB 4M61A 5ESQA 4BELD 1RZ8B 4HJJL 4LU5H 1YQVL 3NIFE 3L5IA 3DUHA 3GMLB 1RFDL 4JREC 1UJ3A 1LWRA 2XG4A 5HY9B 4RFOL 4OCWL 3RX8A 1T1WB 3ZSSA 1QZ1A 4DKDC 3WNOA 4DGYH 3V4VL 4FQ1L 1AO7A 1TTFA 3B2VH 3BFOA 1EMTL 4OGXH 4P5KB 5DURD 2BRRH 4UAOC 3CDFA 2G60H 3BUTA 3CMOL 4N1CA 1VCAA 4JO2H 1CGSH 5BOPA 5D7JA 1UJTA 1MHCB 2VXQL 2K7QA 4I9WE 4ZUUB 1EA9C 1U8QB 4EQ3A 1GC1H 4G80B 5ICZA 2QQLL 4HPOL 1M4KA 2Q8AH 4U7KA 2AXGB 4BH8B 1RMFL 1VPOH 4EDXB 5E6ZA 4HCRH 3MGTB 4K94C 4WO4C 3WNKA 3RPIA 4HX1A 1RULL 2WWMC 5D1QC 4XHJC 4R97C 1SY6L 2F8VA 5I1IL 4R4BA 5DK3A 4I4WA 2DQJL 5CWSA 4AYFA 4B53A 3DTXA 1CD9B 4YDJB 3RVUD 4AEEA 3ALWA 3OJVC 5TPWH 2ZSWA 5C0JB 1MOEA 5HI3D 4I0PA 4JO4L 1JCKA 4OQTL 1WGOA 1GRWA 5LWYH 5LVEA 1YPZB 2VABA 5KSBF 4XMKL 3TO2B 5HHVL 4Y2DB 2M26A 5C0AD 1PY9A 2XA8H 1JGDA 2D9QB 2YPLB 4XCNA 2DMBA 1TZIB 5C0EA 2JF1A 3BVNA 2W9EH 3QDME 1DQQB 4XP6H 3LQAC 3E1F1 3KXFE 5EC2A 5CJ8A 1E4WL 1A9BA