5DI8A

Fc knob-hole heterodimer t366w + t366s/l368a/y407v
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8A01
1U92B 3O4LA 1YECH 1HINL 2ATKA 3WLWD 1TQBC 5FDWA 1HYSD 1INEH 1UQSA 2DKSA 3RX5A 1NGPL 3ZDYE 4GG6E 3BDYL 4JQXA 4R7NA 2Q8BL 3PL6B 2FEDD 5I1IL 5BOPA 4EXPX 1FV1A 3DBXB 1DLFL 3NFSH 3P9MB 1FH5L 3S37L 4EOWH 2A6KA 3BEWA 1N0XH 4LIQH 4OBSA 2V2WA 5DO2C 5FGBA 3KJ4B 3FFCA 4V2CB 4MD5A 3BI9X 4RNRA 5JLZB 5DURD 7FABL 3DRQB 1UJ3B 3T0WA 3P3YA 4MNGE 2W65B 3GM0A 1AXSB 1UH4A 3H42L 4PJ7B 1YPZA 3S4SG 1TXKA 3IFLH 5GISL 1C08A 5EO9A 2I27N 5C1MB 2EDDA 3OR6B 2GT9B 3RWDA 4OCMC 2HKHL 1NPUA 1DEEA 5C07E 1DBJH 2GITA 1KCVL 3FZUC 4AM0B 1N4XH 4WIQA 1YEEH 2XZCL 3VI3E 1RHHA 1ZVSA 3QJHB 3K74B 1KELL 1DDHB 3AMLA 4AMKH 1RHFA 5D7JD 5HDBF 5JOPD 2VDPH 1OT2A 1F4XL 4F9LC 4H1LA 4JZJA 1IGFL 2HG5A 3F7PC 3VXNB 3MJ7A 3HZYA 2RB8A 2QQLH 4PJ5D 3ALWA 3TA3A 3W11D 3IDXH 3IU4L 3MROA 3GJFH 2VE6B 2N4IA 5M95B 1T0MA 4XPTL 5LVEA 2LU4A 1DN0B 2AXFB 2EDRA 5IWLA 4EI6B 5GGQH 1N6QH 5JW4Q 2VQUA 1BOYA 2A74A 3DMMC 4HPOL 3QCUL 3EYUH 4L9LB 4OV6F 5J8OA 1TTGA 4LCUA 2XN9A 5FM5O 5I0ZA 3MOBL 5I74B 1HK6A 3P2TA 3OPZL 5AAWA 4XI5C 2ICEB 2JTDA 1MH5B 3LMJL 3AAZA 3NCYP 4JKWA 4JE4B 5DURB 5EU6B 3OKEB 5EOTB 1JRHI 2BOCB 3VW3L 4KK9D 1LVEA 3TN0A 3VWJC 4KTDH 4YDKL 5T1LA 4HIJB 1MCRA 1OLLA 3D2UB 3PV6B 3VFSA 1RUAL 1IM9D 5IW3A 5E2VL 3SGDH 4F58H 5JQ6L 1BQLH 3BRGC 4KDWA 4MHHI 3QIWD 2BFVH 4L8SB 1S9YB 3QYCA 4JZJB 5LKNA 3HNVL 5I1EH 4JVUA 2ORBH 4XBGB 3V5HB 4BFBD 4DGVH 5C0IA 4HWZA 4OD2B 3E6HA 4XBPB 4ZS7H 5IVNA 1CLZH 1F2QA 5BRZB 1LK2B 5BS0B 3C8DA 3QUYA 4ORGB 3I75B 3A0OA 4GXVL 1QG3A 2R1WA 1OB1B 2WQ8A 3ROOB 1RJZA 2R2HA 2DJSA 2X40A 4WWKC 5DJXA 2R1WB 3TNMA 5FHBH 2MFNA 1RULL 2EXYC 5ACLA 2R2CA 4I48A 5K9OA 1I7RA 4FXGA 3G9VA 2D7TH 3S5LB 4M5YH 1CR9H 3QDGA 1ZT1A 1NBZA 5B39G 2DQCL 3D85A 2EYRA 1I8IA 4JFDB 1MSPA 4WTZG 2E8YA 1TVBA 1WC7B 5DRXB 2Z4QB 4OD3H 2CIIB 3SOBL 1K8DB 4PJ8C 4KKBC 2XXMB 1XCQB 2DQFB 3KYOB 4XWOD 5C92A 2AXHA 1YMMD 4NFDA 3FQWB 3RDTB 3WFBL 2EDYA 5JXEC 5CD3A 4JANA 4YNYB 1T5WA 2PYFB 1FORL 4MDJA 4PLJC 4RGOH 1IVLA 2E9BA 2CSPA 5IB3B 1KEGH 3UPAA 4N1EA 4J6RH 4E5XA 2EXYD 4PPTA 3RWHA 3C08L 4YC2C 1EJOL 5JHDE 5KSAC 2EYRB 5DA4A 4I5BB 3PWVB 4IHOB 4NNYB 2VDOH 3QNXB 4EN3D 3TZVB 3O6KL 1J0JA 1ZXQA 2NY2C 4N1HB 3GSWA 3SO3C 4JRYB 1J1OL 1CICB 4DKEL 1BQUA 2YKLH 1V7MH 4LMQE 3RWGA 4P49A 4K3DL 3WXWH 4JHZA 4LCWE 1JHLH 2BP3A 2IAMD 9CGTA 5JXED 3SGEH 3V4VL 4PJIF 4KK9C 2XWJA 3CSYB 4I18A 2AEQH 3MODH 5EBLB 3H2WA 4J3TA 4QRTA 4KMTH 4NKMB 3V2AR 2G60H 3FB5A 5ESAA 3N1FC 5C0CA 8CGTA 4FOMA 5D7LB 2H2PD 3KJ4C 4PRNB 2VAJA 4X4MA 3KLSA 3RWDB 4LKXB 4AEHL 2P24A 2NW3A 4WI8A 4TNWK 2UUDH 5EDXA 1H8NA 1BECA 4JFQB 1BQSA 5DQ9B 5E8OA 2YPLB 1AXIB 1LEGB 3BPLB 4OD1L 1SEBB 2FECI 1RZGA 3W11C 1H3GA 1S9WA 2AV7A 4CUCA 3R4DA 2K1MA 1YA5A 2WIMA 3GSNB 4U6YB 5DEGA 1KJ2A 4N0FB 5IMLA 2XZQH 4X98A 1SJHB 4Z0BL 3PL6A 5D5MA 1QRNE 1MVFA 1ES0B 1WTGT 2GFBB 2XA8L 4XWGL 4EIZC 4EN3A 2EECA 1Z9OA 4OF0A 4QHNB 3UX9B 1OF2A 2HRPH 5GS1A 1A3RH 1A7NL 1GPOL 5SWSD 5DUML 1I8MB 1AR1C 4JVWA 4P2CG 4QXUL 2JB6B 4C55A 1A7OL 2VDRL 4QXGH 4NGHH 2UZIL 3UTOA 1QLEL 4PGBA 3Q5OA 3MV7E 2Y9RT 5K33A 3IJYA 3AS3A 3OAZH 4UU9A 4CL7A 1R0AH 5J1TC 4G6ML 2IEPA 4PUBH 2NY0D 4WW1A 4JO3H 4ZUTB 4YHLL 5MENB 4QOKB 3LRHA 4OQ1A 1A1OB 4Y16C 2AQ1A 1TVHA 3KPRE 1SJEB 5ADPH 1DEEB 2E9IA 2DQIL 3RL1B 4P4KC 2Y5TB 4RIRA 3QUMB 5I8EB 1KGCE 4MNQD 1MI5E 4L29B 1F4WL 3E0GA 3VXRA 3TVMA 3MRKB 5DJ6A 1FZOB 1LD9A 2FZ3B 2HH0L 5JHLL 5C3LD 1LNUA 5MERA 3WNNA 3OB0K 4G5ZL 2A6KB 2PTVA 4U1GC 2FJGB 3FO9B 1NEZA 3TIEA 4RAUB 4LARH 5T5NF 1D5MA 4X7EC 1QR1A 2FWOB 4Y4HD 4LQFH 3RWGB 1ADQL 4RQQB 4AJ0A 4QXWA 3L5XL 1XT5A 3MV7B 3IYLW 4JRYA 3OJMB 3R8QA 1RMFH 4YAQA 1U95A 3QEQA 4XPBL 2VXQL 4HKJB 3VXMD 1M7DA 1NGYB 3VWJB 4YBLB 1HHHB 2H2SD 2C1PB 1KCSL 1R3KB 1XCTA 5BQ7A 4XPAL 3DI3B 4E41D 4GLRH 3TN0D 4C54A 4JFED 4XCFL 4E5XB 3ZKND 4RGNB 5JORA 4Y1AA 5GGSY 1EFXD 4HKBB 4P5TD 4ZSOE 3GMQA 1T04B 2HT3C 1BX2A 5KSAD 3BKYH 4M4PA 1T5WB 3S37H 5HGAB 2JB5H 3REWB 5I76A 1PLGL 2WBJB 4LIQL 3R0NA 2OR7A 1CLYL 5I8OH 4J3WA 5DJCA 3DO7A 2LTQC 1K2DA 1X5HA 1P4BH 4ZNEE 1NMBL 3F58L 1AD9B 4XNZB 4XZUA 2W9LA 4TVPH 5IBLC 4MNQA 3SE8L 3V95A 2MKWA 3TBYB 2DTSA 3UPRB 4XNMA 1T0PB 3WXVL 1FDLH 2HKHH 1FZJA 1N4XL 2FO4B 4YX2L 2QADB 1GC1C 4YHML 3VRLE 1LILA 1SY6A 2ITCB 1FVDA 4JFEB 1A6VL 3AM8C 3WHE0 4CADA 4P46B 4LLAA 5GGRY 1DANT 3QG6A 4PG2A 5DC0A 3TNMB 1A6WH 1FPTH 4RFEA 4R3SB 4PJ8B 5HHQB 2JF1A 1G7QA 2HT3D 2AI0H 2F54B 2Q20A 3WLBB 1VB9A 4I0PD 4O2CB 2I25N 1N5AA 2IAMB 4Y5VC 1UA6L 3JV4A 1UXSA 1NDMA 3QXAA 4TOYL 2NCMA 4X4ZA 5DMYA 2HFGL 5JW3H 4GBXA 3DXAA 3SDXF 1F11B 3O4OB 2CKBB 5I30H 1AP2A 4MSWA 5J06A 4XT1C 4O2EB 4CVXA 1R6VA 3O11A 3UBXB 5IK3A 3D1MC 1E4XH 2CDGA 5M94B 5IVXF 2P5WE 4S1QL 4HHAB 1CGYA 2CDFA 4PGZA 5SWZE 1IZJA 4ZAKA 3QQ9D 3NIDF 1FCCA 4HZLA 1F8TH 5AZEL 3WIIH 4LHUD 5JPMB 5E2TH 2SEBB 3ZHDA 1VFUA 3AAZB 4MB4A 3S35X 4U1NA 4LSUH 5JDSB 2BY0A 2HJFB 4JY6B 4M1GL 5B38A 1CE6B 4X6EB 3FB6B 1A3LL 4G43A 4OZFA 2YPKB 3UTTB 2X7LB 1U58B 4NQXB 3BFOA 5CMAA 4HXAH 2N7BA 5F70A 3AXLB 4OM0L 4HH8A 5JO5B 4NPYA 2Q86B 1ZGLP 5KSBF 4M6NL 5JDSA 3O41B 4B5EA 3BIKA 1GOFA 3ARBA 5KVEL 2A2QT 4Q58C 1KXTB 1M1SA 3KVQA 3JTTA 1RJLB 3WUWB 1NGQL 5GGUB 1DDHA 4KAQL 5I1DB 3BHBA 4K9EC 3L5WB 4YHYB 4AYFA 1YQVL 5IB2A 3NN8A 1ZLUK 4FQXA 3SGKA 1WITA 3HZKB 5T1LD 5I1KH 2XI9A 4PGCB 3LQMA 1BVLB 3OKNB 5DWUH 3RTQC 5J6HA 4EJ1C 3GK8L 1F02I 1FLTX 3O2VH 1JHTB 4NZJA 3SKNB 1XF3B 4Z7UA 2BVOA 2VZ3A 3BGAA 3WJJC 2V5RA 2BZDA 3QG7H 3V6OA 1GGYA 3WFBH 3ARTA 5IEKA 3H8NA 1TVDA 2BK8A 3CU1A 4P2QE 4KHXH 4W6WB 4XMKL 1KN4L 5DUBB 1NUDA 4Y89A 4R3SA 2Z93A 4XGZA 2DKMA 1FZMA 3RKDC 3DYOA 4L4TA 2VITB 4D0DA 3HRZB 4MDIB 3GI9H 3C08H 3G5YB 4PJ9D 4LK4A 1NFDA 4S1RL 3VMPA 1FZJB 1U3ZA 1X4YA 3NCBB 4JFXA 1FFQA 1JYXA 5BV7L 4POUB 3VFMA 1EUUA 5J1AA 1YNLH 2E9WA 4NP4L 4Y16B 5C0NC 4HMEA 4PRBB 3G6JA 3GI8H 4FNLH 4WUKL 2VH5L 3KPOA 2YBRA 5I17A 3BYTA 3D0VA 1MEXL 2FBJH 2GTZA 5D96B 3LHPH 4RFOL 5FGBC 1F97A 5B38G 3OQ3B 1F58L 3V4UH 1MELA 1Q1JL 2DDQL 4ZFFA 3RP1A 3MBXL 1EEYA 4YHPB 4UOJA 1TPXC 4HWBL 4PGBB 3GMLA 2JIXB 1AQKH 3SJVB 4G42A 3W0WE 1V7NL 1QFWL 4JB9H 4WW2F 2R69H 4ZDHB 2V2XB 4FQJH 4MJ2A 4NZRH 4HW6A 2E7HA 2OTPA 1LGVA 4P9HC 4GMSH 3G5XA 5ANMA 1BJMA 3S36L 4J2XA 5INCB 4NO0B 3WDIA 4UINL 4NYLB 2VR4A 4JAMB 3RVTD 3MREB 5CEYA 4F57H 5KN5A 4TNVF 4UUJB 3G5VA 4DFHA 1OL0A 5ITBL 1KJ2B 25C8L 4L1HA 5IMLB 1ETZA 2KPNA 5KTEH 4MQ7A 4HIXL 2FJGA 2X4PB 3H9ZA 1UKTA 4Z95L 1XGPB 1EHLL 2EH8H 5MERB 5F7UA 3NACL 3DV4B 3UDWC 3L6FB 2VXTL 4NCDA 2ED8A 4W70A 5GJTH 1H8OA 5HPMA 4U7SA 2WNGA 1AD0B 3JSSA 3VGAB 2XFXB 5TPWH 4MJID 2IAMC 4YE4H 3BKMH 1LO2L 3IJHA 5AD0A 5BS0E 1XAUA 1G7MB 2J88L 3S96A 2AXGB 1D6EB 1Q9KA 2VL5B 2LABA 5DS8A 5IB4B 2UZIH 3QO1B 5FGCB 1FNLA 1BQHB 4NQVA 4Y19A 4U05A 2AQ3A 3L7FA 2W59A 5CP3H 5T3XE 4WFHD 3E1F1 1KG0A 1OGAD 4QRRE 4XTRC 5EBWB 1VFBA 4UU9B 5FCUL 2EKSA 1EGJH 1HI6A 1AGBA 3ES6B 4PUBL 2J12B 5TQ0H 1T6WA 4JFZL 2E6QA 1GXEA 2D7PA 4LEXH 4PRHB 2ERJB 3VGDA 3B5GA 4L8CB 3K1KC 4HBCH 3U0TB 1RJYB 1UXWB 5ALBL 2BSRA 3STLB 1NCBL 1P4LB 5EU4B 5BVPL 2D7QA 4BZYA 2Z91A 5IQ7L 2ZCLL 4OJFH 1NBYA 4PTTA 2Q76B 5F89A 4XVSH 5E8NB 2E7MA 3T0XA 5F6HJ 3MJ8B 5L7XL 2ICWI 3BGFB 4NDMA 5IBTL 5CD3B 4AENB 3CLEH 1IQWH 3BH8B 5IJKC 3QO0A 3D85D 4PGEB 4TNVK 1I3UA 1UB5B 3UC0H 3P4OB 5DEZA 3UTSB 4JFQA 1XR8B 4H8WL 3GSRB 3D0VB 1K8IB 1JJUA 5DRWB 3QIUC 3IFPB 3QHZH 3S8WA 2UYLB 3ARZA 1UEMA 1S7SB 4MA8H 4PJ9A 5D2NA 3SY0A 2X4SA 5D7JB 2RFXA 5GS0L 2XKNA 3MJGX 1CGTA 4PRNA 3QUKB 1OGTA 4Y8AA 5JZ7C 3CX5K 5SX5K 3F12B 4JKLA 4H1LH 3RAJH 4G8GD 4QRTB 1MF2H 5DTFB 1IEAB 2R29H 1JGUL 4X8JB 3UYPA 2OM5A 1LP9E 3QCVL 1TJHH 5IJVB 4P5TB 4LEOB 2EXWD 2M2DA 4MNGB 1YEDB 4D0CB 4LCIL 4NO3B 5SV4A 3NAAL 5CGTA 4JFPB 1EBPA 1N64L 1SMAA 1YEDA 5TDNB 3ISWA 4PJHA 3I75A 3V6FB 2NTFA 2X1XR 4KRNA 4K8RL 3VWJD 5J4MA 4QT5A 4GKNB 5F3BA 2WWKT 1EMTL 3OJDB 2RCSH 3O4OC 5IGXH 5MEQA 2OTWB 4ZFOA 5GSRB 4PP1D 4XXDA 5DA0B 1W0WA 4FQXD 3C5ZB 2G5BA 3LKQA 4YHMH 1FQ9C 4WI4A 1H3PL 4TRPL 4PGCA 3RVXC 2DMBA 4KK6C 5J6GA 1L6ZA 1GZPB 3WNOA 2HKFL 4C83B 3EFFB 3NZ8A 1MLBA 3KPNB 3CX5J 4X5XA 4JO1L 4YWGL 3RPIA 3TJEL 2DQTH 4XXCA 2GSGA 3DO3A 3L3GA 5DD6B 3I6GA 1NC2D 4ODUA 3Q5TA 5J7CC 4OI8A 2ZG1A 4M7LT 4WI2A 4S2SB 2DMCA 3C8KB 3QWRD 2PYED 2NY5H 2IANE 3EJYC 2H45A 2IFFH 1RIHH 4K2UL 4D9LH 1FNAA 5CSZA 2GJZB 4IMLA 1HKLL 4QF1A 4X6CE 1KB5H 5FB8A 5I30L 5J57B 3H9HB 2FB4H 3QHFH 3GHBL 3EO9H 2OXHA 4F7MB 1FN4A 1QD0A 2IAND 3KPSE 4JZOB 2OP4L 1Z9MA 1FBIH 3I3BA 3VG9B 3SE4C 1EK3A 4P3WA 5IVXB 3TA3B 2H1PH 3MO1A 4Y5VA 1QYGH 4JR9H 3D9AL 1H15A 4P5MA 5E2TL 2IMNA 3GMMB 3TBVA 3O6FC 4D0CA 3MXVH 4XAWH 5BS0A 1BQHA 3VD9A 4HHAA 1DQJB 3KPLA 2KL6A 2X89D 1FNSH 1NLDL 1HIML 1MRDH 4AL8L 1HHIB 1E0OB 2B20A 5GZNC 5GRVL 4BSJA 1KC5H 5FYLH 3QWOB 2DM4A 3IDMA 5GIRA 4R26L 2P4AB 1KPUA 1MFCL 3L3KB 3QO0B 4JFHE 2VLJA 1CD0A 4X7DC 3OAYK 3WDJA 4NQUA 4BQCA 2EICA 1SMOA 5EO0A 4Z8FL 4PRIB 3TNNB 2BVYA 3DMMB 5E0QA 1I8KB 3RVWC 1D9KB 2MQ3A 5CILH 4HUUA 4NQEA 2EYTA 3CVHL 2AEPH 2Z8SA 4WHDA 4YDJB 1X5XA 4OUUA 1I7TB 5MEPA 3HE6D 4XP4L 2R2BB 3ORJA 1JWUB 2EDJA 1P4LA 1EAPB 4H1LG 3ECBA 4MJIA 3ZDZE 3O45B 4AEIH 3GSOA 5DJAB 4XHJD 3VRIA 2BVUA 3VD4A 4OM1L 2P5WB 4TULH 2IMMA 4CKVX 3HZYB 4W4NA 1IRAY 2P8MA 3PF2A 4ZG1A 3C60C 5ACZB 4H1LB 5HHOE 1U93A 2X4OB 3MRLB 3OGCA 2APBA 4GOSA 1ONQA 1BX2B 5TE7H 3V6OE 5EU6D 3NFNA 5KW9H 3EOBA 1U8OA 3CMGA 2MPAL 3AY4A 1NFDE 1MJ7H 4KDTA 4YGVA 2BNUB 4R0LA 5IVZA 3SJVE 4DUXA 4X7FC 1ZGLB 4ZUUA 2HVKA 3U1SL 1T89A 1JGVH 2FYYB 5TE6H 4JFXB 3FN9A 1H5BC 3EZJB 3RKDD 3NIFE 4WDIB 2XQBH 4CN1A 5IP4A 1LE5A 4WU5B 1G9MH 4MD5B 5FKAB 1NGXB 5FA4B 3W0WB 1UWXH 1YMMB 5HI3C 5FYKD 5TE4L 3BVNB 4NZDA 1EXUA 1MHEA 4H88L 4PJFB 2HFEA 2DOCA 1HHJA 4HAFA 4OLUL 3U46B 1KTDA 4NYLA 4JM2F 1YEJL 4RSVA 3INUL 1S8DA 3QDJA 5I18L 2WLYA 4WDIA 5EH1A 2H2PC 4GRMB 3O4LB 1P7QA 1GIGH 2VSDA 2R56L 1X4ZA 5E8EA 4NUGL 2FYYA 1J11A 1JNHB 5EUKB 1UM4L 2E6JA 2AS5M 1KIRB 4ISVB 1VEOA 3K4ZA 3SGJC 1AR1D 4WFFD 3EOTL 3WS6A 4P99A 1QSED 3QDAA 3DIFB 4Z7VB 3UTZA 7CGTA 2ARJQ 1I8LC 4HGMA 4KXZH 4JREB 2YOCA 3U7AA 4F80A 3MPCA 1QFHA 4KJQC 2BSTA 1WLHA 3L1OL 4GT7A 1KEMH 4MJIE 2DWEA 1HHGA 4HIIA 5DEFB 1J1PL 4S1DD 3DX6B 4JVPA 4LNVA 3P40A 2HMID 2GSIA 4PRBA 4OV5A 1RFDH 5C0FA 2YHGA 4XTRD 5D7LD 1JZ2A 2CLVB 5HPOA 1G6VK 4MJ6A 1CE1L 1EAPA 4X6DE 2A77H 3I02A 2DI9A 4PJDF 4HWEL 3CH1A 3D3VA 4IOFD 4JM2A 3U0PB 5B4MC 3ZKNC 3A67H 3HRPA 1OTSD 1QPPA 3UO1H 3PGCA 5TF1H 1IAIL 1TZIB 2VDLL 2PYEE 4QRPD 5HHPA 4X6FA 5DVMA 1I3GH 2H9GA 4OFYD 1A47A 4ENED 1LDPH 4HBCL 3RY5A 5ABDE 3S34L 1CVRA 2VIRB 1NUNB 2NY1C 3V0VB 3L3HA 1T1ZA 3DXAE 2B8OT 1FO0H 1CLCA 3K2MC 5ID0A 4LLWB 3BSZL 2DWDB 1F4YL 5JW5B 3ARXA 2D7OA 1LO4H 4OF3A 4O4YL 3D2UD 2R8SH 5JXEA 5DD5L 3JWDL 4TN9A 5GGUA 1AGDA 2BSSA 1CK0H 3MA7B 3WUWA 1ORSA 2OCFD 4LSRL 5JPNA 3JV6A 2LVCA 4FFZH 5IBTH 1KPRA 2YSSA 2EE2A 3SKJL 1HQ4A 4GQ9H 4FHBD 3IDYC 2X4RA 1DLHB 5EULV 3VXMA 5LWYL 4ONHB 1JPGA 3EYSL 5IIEB 1B3JA 3S3PA 1KGCD 1FVDB 4MNQE 4MZ3A 5E95B 1G9NL 1J05A 5KOMC 1PEWA 4LP5A 3PP3H 4ODWA 1OCWL 2C3WA 5E7FA 3DSFL 2FL5A 4X0KA 4XP9L 3BD5A 4MB5A 4XB8A 1AO7A 3HHRB 5SWZD 4B7IA 2EO1A 1NGWB 1MCSA 2JJWA 3Q1SL 1B0GB 4IOIA 4MAUH 5IM7B 3C2AL 5T3ZE 3HLAB 4JFOA 4ZFGH 4YXKL 3RVUC 5E5RB 2YK1L 4LCCB 1M71B 2WBJA 4XAKD 5KSBE 4JANB 4YNYA 5FHAL 5CEZD 5I1JL 1NBVH 2OJEB 4K8RH 3MJ6A 2GJ6E 4GAJH 4X5XB 3WKNA 4PD4K 4A6YB 1VESA 2R4SH 5KZCB 3UBXA 1UCTA 2OSLA 1XCTB 5CEZE 3AS2A 3QDHA 3WJLC 2AJZA 4I8DA 3RNQB 3KXFB 1ORQA 1GSMA 3MLYL 4ONOA 2HKFH 1A7RL 2MOVA 3OHXB 3I84A 1RQ5A 5FF6A 3VG0H 1D5BA 5KVGL 1TQCC 2LAAA 2H26B 5DYOB 1MJUH 1JUFB 4HKZB 2IFGA 1UWXK 1M05A 2J8UA 4YPGA 5E4IA 3C6LD 3FO9A 1QRKA 3LEYL 4P5TA 3RY4A 4F15B 3EDKA 2Q8AH 4JN1L 1WBYB 3HTLX 4N5ED 5C2BH 3G6AB 1A6ZB 2UWEF 1V5JA 3WNPA 3FFDA 4P0DA 1UFUA 5EA0H 4GW4A 1WEJL 4XCNB 4JDTL 2B2XL 2W07A 1DUYB 4HIHB 1F3JA 1M71A 5J11C 3UYRL 4P5KA 4WW2C 2AK4A 4XCEA 2OP4H 2PCPA 3UJIL 4X7CC 4XZUB 2HFTA 3HZMA 3GSRA 5AWNL 4X7SH 2D31B 3VXSD 2J8HA 2AXJA 3QDJE 1T1XB 2XWBB 1CXKA 3D2UA 3PV6A 4JG1L 1I7ZA 4KI5E 5HGBA 4OCXH 2QEJA 3RGVA 2DQEL 2ZUSA 3T4AA 4OKVB 1HDMB 1H3WM 2Q1EA 2NLJB 1ULVA 3AVEA 4HK0B 3N1PC 5BXFB 2XACC 4LVEA 3P30L 4O58H 1NJ9B 4R8WL 4Y5XC 5J3HC 3VXUE 4HS6B 2BJMH 1ZHNA 4GH7B 3ZZ1A 4NKDB 4R4NC 1FNSL 1WWAX 5JOEA 1NLDH 4LCUB 4OFKA 3T2PA 5EG6C 3U4BH 1AY1L 2C1PA 4XNXL 5L2JA 1IAII 1MWAB 3HNSL 3P9WB 4JFHD 5EC1B 5T5FH 2VKWA 4OIIL 3STLA 3R1GH 3WKML 3FB8A 3U2SA 2JCCF 1KTDB 3HG1D 1AIFA 5HYSB 5EZJA 1IGML 1DN2A 1TJGL 1WICA 5LG1A 5KAQG 5HGHA 5CBEA 2J8UF 5HHXH 3QNZA 4IRJD 1C7TA 1MFNA 4UT7H 1AKJA 2NY3D 1LNUB 4HK3N 3TH2T 3DMMD 3OWEA 3WNMA 3VG9C 3MRKA 2QQNL 2X4NA 1EH9A 5F1KC 4M7KH 1IGTB 5SWZA 4I77H 2DM2A 5DVOA 3QQ3B 1RZ8A 3OAUH 3VGAC 4U1LB 1VGEL 2ZCKH 3LN5B 5I71C 2FX8L 2CLZA 4PJ7A 2P7TB 5C8JB 1JNLH 1U8OB 5I1LA 3QULB 3IAGC 2PTUA 3QEGH 3RPKA 5DK2B 1BIIB 1IL1A 2G2RA 3C09B 3THMH 3VFNB 2NR6C 4XVUC 4U1MB 4FRWA 3QIWC 1A2YB 2Y7QA 4LL9A 2X05A 3BPOB 4ZYKB 2W9DL 3MRMA 1S9XA 2CKBL 4R7NB 3FRUA 3IGAB 4M9PA 1KYOJ 3AB0B 4NO0A 3BKCH 1RI8A 4PJGA 5T33H 4JPVL 4WU7B 5E8PA 1ZHLB 2ATKB 2VXVH 2WM0A 1T6VN 5LCVH 1ZANL 2EIZA 1QLFB 3KPRD 3CFBB 5HD8D 1I7TA 4Y1AE 5MEPB 2V2XA 4PJDA 4UIMA 3STZB 3NCJH 3QEHB 4HKXA 1INEL 3U48A 4YHYC 1W72L 1Z5LA 1F3DH 1G7IB 4LAQH 1JF1A 3CFIC 4JQVC 1I8KA 4L5FL 3WCYA 4Y1AD 3X3FH 2MTPA 3V7MA 1FH5H 4JRYE 3DETC 3MV9E 2NQCA 3DVNB 3SGDI 3R0MA 5F7YC 4NCC1 1JPST 5H2BA 4U3CA 1DQQA 4Z7QF 1S5HB 2YS4A 2FBOJ 4JRYD 1E6JL 3MV9D 3GKWL 2O26U 4HULB 1JRHH 4FQHA 5ETUA 3F65A 4GAGH 4Y4HA 3CLFL 2RAMA 1MNUH 1VADB 3FB5B 4HCRL 1UB6A 1DQJA 4EUPG 3N1QC 5KVFL 1P7HL 4MDIA 3DURA 5DJDA 1DR9A 1OPGH 5ENWA 5FGCE 1A1MA 2X1QA 4GXUM 4OCNC 2BRRH 3L1OH 3T08A 5D7KD 4RAHA 1UEYA 2J8OA 2Y07L 3GMOA 3U9PL 3B9VA 3NPSC 4BYHA 1CF8H 3W5MA 5D93B 1D5IL 5INDB 1CDBA 4NUJA 4JZOA 1L4IA 3RVUD 2GUOA 4M5ZH 2ESVE 3QNXA 4IHOA 1GHFL 3PL6C 3MNVB 1S9YA 1BZ9B 3QH3B 2Y36L 4J3XA 1EO8H 3LRGA 2PW2A 4GKZB 3ZKQD 1QSFB 4Z77B 4HGWB 4ETQA 3BDXA 4D8PB 3QIUA 5LBSL 4S1DC 3UO1L 2GK0A 3VRIB 4L8BB 3LMJH 3RGHA 3ECBB 3HAEG 2YA1A 3P11H 4IRJB 3M07A 3L3OB 3MRCA 2FGWL 3S35H 2PW1A 4Z6AT 1IKFL 1XGYH 2O5YL 1EFXB 3HNTL 2FX7L 3RBSA 1FRGL 2OZ4L 3G9AB 4RISH 2Q86A 3IDIA 4WHYG 3W39A 3HMWH 1W72B 5DJ0A 4EBQH 3SDXA 1J9CT 2HWZH 2ZNWA 4O02H 3C09C 4EI6A 3ARDD 4Y4FC 3UTTA 5D7IA 3BZEB 2ORBL 4MB3A 3VA6A 1L0XA 3QIWB 1QSEB 5D7SL 5FA3A 1U3HD 3DNKA 3JZ7A 3RVXD 5DRNB 4OLZH 1BEYL 1NEUA 3CU7A 5AUMA 4X4YB 1D3CA 1KJ3L 2BMKA 4JY6A 4S11A 4DUWA 3CK0H 5DD0H 5EIQA 2VN7A 1NL0L 3O4LD 4JPWL 3IU3A 3LH2L 2Z8WC 3HC4H 5JR1H 1E6OH 4P23D 1I75A 2CR6A 3BP5A 4QHUA 1LK2A 3T8XA 3TO4A 4CW1A 4M48L 5H37G 2AJVL 4RMVA 4BZ2H 5EWIL 4RGNC 1K4CA 3LQAL 1W8NA 4Y4KD 3W0WD 3S37X 3MV8A 4QYOB 3X12B 1K8IA 1T1ZB 4OSUL 1KJ2L 1YEGL 4X4YA 5IT2H 2WWKO 3P4OA 2LFGA 1IAMA 3IAPA 4MWFB 3QA3A 1OAXH 5JDJA 1WZ1H 2VOTA 3W81A 2EH7L 2VLKA 5LJYH 5HHPB 2FRGP 1FE8H 4OGXL 1WISA 3V7AE 4P4KD 4J8RA 3UPCA 3IDGB 1UWGL 2OL3H 5FB8B 3V0WH 1U8IA 5GRUL 1NBYB 4PTTB 3LKPA 4RMSA 2QADC 4J6RL 2FX9L 1B6UA 2JKXA 3LS4L 1D5XA 1O7SA 2EDXA 3NTCL 5E6YA 5F9AC 5CWSB 3UZVB 1KB9K 3LB6C 4NHCH 2X1PA 3FO2B 3PWPD 1NFIA 1IM3B 3VMOA 1U2HA 3H7BA 1MLBB 2CH8A 4DKEH 5I16B 5EIIB 1RZIA 5BS0D 2WZPD 3VFUA 2I26N 1PGRB 4O9HH 5KVDL 3FN3A 2EKSB 43C9B 4OQTH 1KB5B 3QCTL 2GUOB 5GRYA 3K80A 2MQ0A 5I8CA 5E08H 1ZMYA 3OJDA 5C2BL 2GCYB 4K3JH 3BH9B 4AG4L 2G60L 1X5KA 1MHHA 4FN0A 1KF9B 1JK8A 1UH2A 2JJTA 1AI1L 4F3FA 2BNRB 2BVQA 4QEGA 1MJ8H 4IDJH 3MC0A 3T1FA 2DBLH 3VE0A 5BV7C 2EIDA 1ZHKA 5C0BE 2ARJA 3TJHD 1A21A 4GAFB 3A6CL 4M1CD 1EEZB 3TYGL 3WJLA 5CEZL 3TIEB 4KWUA 5I1CL 1CGSH 1UM5L 2FD6H 4G7VL 1DVFA 5IFJB 3SO3B 1WIUA 5L6YH 5IMMA 5DJ6B 1DBKH 5FFLA 4XC1L 3RVVC 3U4BL 4GRLD 2BVQB 3C6LC 5JTWA 1NGZA 1HINH 1A7NH 5DJ2B 3LKOB 3BKJH 4M7ZC 1ZGLA 1H3XA 3ZDZF 4Q2ZA 1TJIH 4XC3L 3R8BB 2Y06H 5DSCB 4MAYA 1HOCB 4XNUL 2QHRL 4LRNL 1IGJB 4PJAE 1W0VA 3STZA 2VZSA 1ZA6A 2A9ML 3D39A 1A0QH 4KPHL 3EOBB 4DTGL 2AK1H 5HI3D 1UWEH 1T1WB 2HTLC 4EOWL 3ZE2F 4KZDH 4WWKD 2FO1A 2P46B 3S9DB 3HMXA 2XV6B 4M61A 4I3GA 1NCWL 5D9SB 3RUGF 4DQOL 3K2UL 3MLWL 3KPRA 2GAZA 4ZOCA 5I16A 3H42H 5IQ9A 1L0YA 3GSOB 4P23A 2PTTA 4U1MA 3SDDD 3C8HA 4U49A 3JXAA 3S4SB 4FQXC 1ZLWK 1KG0B 3VFNA 3VJ6B 4M7ZB 1MCOH 5CP7A 4WV1C 2X9XA 3HPJA 4KHTL 3BRDA 2XKUA 4M4RA 1INQB 3QULA 5HVWA 1Z0NA 1DUZB 1KELH 3HE7D 4E0RA 2M8XA 2EYTB 4P4RB 4NRZB 4LHUA 3ILPA 3U4EB 1G7HB 2B4CL 5D5MB 4G5ZH 2YPVL 4WFGD 4L4VE 3HB3C 2V17H 1KTKE 4MVBD 3UMTA 1J86A 3JV5A 1R3JB 3OR7B 2QKIB 5F88B 2O61A 4WFGE 5CBAB 1TZGL 4OGAD 3TT3H 5F7KC 4FQCH 2X89A 1S7VB 1MCBA 1RK0A 3FN0L 4LOUD 4JDVA 3X14B 5D1QD 1OAQH 2H32B 4GG6A 5HYQA 4HUXB 4LLQB 1EEZA 3RRQA 2XG4A 2EDHA 5IFAH 5CZVH 2H8PA 5DD1H 2H6PA 3GGWA 5C0CB 5CSBA 5DJZA 5IESL 4BKLA 1VCAA 3B8YA 4NT6A 3OZ9L 2J4WH 1QBLH 3EYQD 1CDCA 1HXYB 1F90L 3OF6A 5JA8B 3BP5B 3WO3B 4EDXB 5DZLA 4K7FB 5F7DA 4F7CB 3TC9A 5KAQF 3WSQH 1KOAA 5L2JB 5GHWH 5A2IH 1JZ8A 2IANA 5DR5L 5DLMH 1YEKL 1VACA 1P2CA 4NPYB 2XWTB 1YYMH 1FSKB 3L3IA 3RVVD 5DRNA 4V1DE 4ZUSB 1J8HB 1I1YA 3SE8H 5CEXA 1DL7H 2NLJA 3EIFA 5I1EL 3FT4B 4PJXF 3CLFH 1NH6A 4QRUA 5FYKE 2E27H 1YEHL 1MAJA 1ZLUH 5DHYA 5LGJA 1EHAA 1JTPA 4LGSB 4X9BA 3TO4D 4W4OC 4JN2B 2JELL 1YUHB 3PHQB 1IM3A 3RZCB 3IDNA 4P3DB 1DBML 1MCQA 3P4NA 4JO4L 3FRPA 5HD8C 5IKCA 2AI0L 4N8VG 4WI6A 4ODUB 5DD3L 3OX8A 5DD6A 1NFDB 5DJYA 4GW4B 5A3ID 3RDTA 5D2LF 1GGUA 3KWWB 5HVHC 2X4TA 2V7NB 2GK0B 4NKQB 5IHBA 1ZAGA 1CBVL 4KJWD 3BZFA 5L2KE 4PTUB 4LHJB 4O2EA 1F45A 2IPKA 2FIKA 5H8DA 3RI5K 3X17A 2Z4QA 3QFJB 5DUBA 2P8LA 3VH8G 1JYWA 2IADB 2G5RA 4WO4B 4OD3L 1IC5H 3E2HB 3B5HA 4E41B 1DQML 1WIPA 4MXWL 4X80L 3Q6FA 4WVRA 1BIHA 3O2WH 1OT1A 5INDA 1I4FB 1OTTC 3KJ6H 4NSKA 3W9DB 1JHTA 5BZWA 4UIKL 2BHUA 4HAGA 1OW0A 3JWOH 3RA7L 1T89C 3ZE1F 3TPUB 4J4PC 3OKNA 4LSSL 2XXCB 4LFHG 5B39B 2H3NB 4R7DA 5GPRA 2R2HB 5C6WH 3U7YL 4FQXB 4P48A 4YJZL 5GS3A 1IC4H 3QUML 1QFWM 1XR9A 4NM4H 4YHOL 4U6VL 4ERSL 4CU8A 2NY0C 1BREA 3X3GH 2OZ4A 5FOBA 3TCLA 4ELMB 4HFUL 4P46C 1U8HB 2G75A 1URLA 3JTTB 4QHLA 5DI8B 2VDOL 4JREC 3L95A 3WFHB 3RWFB 5IKCB 2P42B 2XKNB 1MCWM 3C9NA 4UI2A 4MQSB 3ZE0F 4MCYA 4Y2DA 5D1ZD 4OLZL 3TBTB 1S5HA 4U1IB 2ICWB 3WEXB 2DI7A 3G6DL 1OTTD 4XNYL 4KROD 4NQXA 1GAFL 3C60B 1K3IA 3GIZL 4HF5H 1OP5K 1GOGA 2CO7B 1NGQH 2IQ9L 4FMKA 2PO6B 5CGMA 2I9TA 4RZCA 4L9LC 2AJVH 5B38B 3TO2A 1G7IA 4BFGA 3HE7C 1QLRA 1YQVH 3NCMA 4NJAH 1EGJA 4HV8B 1QHPA 5A16A 5FYJE 2A6JA 4DGIH 1XIWB 3HUJB 5GS1C 3CVHA 2XICA 4BJLA 5ITFB 3I50H 4RQQA 2QADD 1GJIA 2X4QA 3BRFA 5KG9A 3Q6GH 4HUXA 4LLQA 5K93A 1YNKH 4TTDC 4U2ZA 1PZUB 1G9EA 4KU1A 2YC1A 3EGSB 3O2DL 5ICZA 2D4DA 4MS8D 3TVMB 1WWCA 2YA0A 4QNPF 3S3JA 3HZVB 3KPSA 3MGAA 3T3MF 5TJWK 1DQDL 5L8JB 4S1RH 4UNUA 1FYTB 4NO5B 1GPOH 3SO5A 5BV7H 3L5JA 1G7MA 3S96B 3QBTB 3S88L 5IHLB 3OKDA 3PGCB 2R4RL 5T1KD 3OL2A 2DYPA 3H3PL 3DWTA 5C0AD 2OQJB 3LHPL 5E00B 4PLKD 3VFOA 3D69A 1P53A 5C70A 4OLXL 1KCLA 2QSVA 4YR6B 2RIKA 4YDIH 4LKCA 5ID1B 3CFCL 2PTTB 4G6MH 4WO4D 4N9GB 4ZPVA 2AJSH 2GSIB 3M17B 4HS8H 5CEYB 2HJKB 1AD9A 2W0KA 1AQKL 2JB6A 5EU6E 3FB8B 5DZOA 4TUOA 3DVNA 4XP6H 5HY9A 1SHMA 5FO7B 4Q7DA 3T4YB 1T04A 4M7JL 1DQLL 2DI8A 1ZA6B 2ZOLB 1JBJA 5F1IB 5EU3A 3K46A 3RWCB 2OR9L 4DN4L 3K7UA 2CRIA 3QEHA 4MJ5A 3EFDH 5F1IA 3AS1A 3TWCH 3AROA 3JTSA 4PJIA 4Y4FB 1C5DB 1WZKA 4ZFFB 4BFEA 1EHLH 4F7PB 3VA2C 5HGBB 4NC2B 3GMPB 2HRLA 1J8HD 1TQCB 1S7RB 2PR4H 5E4EB 5IFHL 1QPXA 4EXKA 3T0VA 1B6DA 1HQRA 1HSAB 3ULSA 1TNMA 4U1KA 1FSKC 3UJJH 5GQBA 4EVNA 3V4PL 5GGRB 2DICA 1L0QA 1RURL 1JGDB 4BM7A 3K0WA 3Q3GB 1YEFH 2OQJA 3GSVA 3QIBB 2AK1L 3BX7C 2IALB 3BZ4A 4L4TB 4FTVD 3QZWA 1MFEH 3HCVB 1BJ1H 1LEIA 2C26A 5I8OL 3RGVD 3OKOB 3HI6H 4MA3B 4WWID 3JUYA 3KR3L 3I2CL 4DQOH 4LF3B 3TYFB 5F93C 3K2UH 3MLWH 5MENA 3QUXA 1FZKB 2F53E 4HBQA 3OKKA 3LSOB 1OP3K 3WXVH 4OF5A 3OJVC 1ORQB 5JW4N 3QISA 1IM9A 3HE6B 2P47B 5HJ3A 2CQVA 3FT2B 1ZE3C 2OTUB 1P5UA 3C6SB 2A9NL 5GGSB 3D25B 4A6YA 5B3JE 3FQNB 5ERWB 1MCPH 4RBPH 2WBJC 4NOBA 3BXNA 1CL7H 4OCSH 4L3ED 1OF2B 1FYTD 4PR5B 1N0XL 1U2CA 3OKMB 1IQDA 4XNZC 2BXZA 4AY0A 4U7MA 3B6SA 2VLRA 3C2SA 2KBGA 4N5UA 3VFGH 3MRIA 3TVMD 4LVOC 2FHFA 5E6IB 2HJKA 1IGYA 2PF6A 1FYTE 4HS6A 4NO0D 1RJCA 1NSNH 1R3IH 1OAQL 3V5DB 4OT1L 4KUZH 4R97B 5GZOD 2BVEA 5I1AB 3RGVB 2E9JA 2IC2A 2YPLA 4R96B 1N3NA 3O6LL 3TIDA 3WNKA 4N0UA 3NPZB 1JPGB 1TJHL 1BWMA 1ROWA 3VXMB 2Z9TA 5FYKH 4BA8A 4ZTOL 5D7LA 4OCWH 5DLML 1ZGLM 1IC7L 3T0EB 2X4UB 5T3XL 5AG9A 4KUCD 2NZ9D 2DIAA 4NKIL 4PYHA 4OD2A 3UDWA 4MGXA 2V9QA 3DROA 1NLBH 4R4ND 1JI2A 2V9RA 3VXUD 4K07A 1ND0B 4U1GB 5GGQL 2FGZA 3KYMB 2CJUL 3MLXL 2WANA 2CKBA 3ARDC 4Y4FD 3FONB 3IJSB 1H3PH 4TRPH 4IJ3B 4XVJL 4K71C 3ZL4H 4LCCC 3BUTA 1AGEB 1C5BL 3W9DA 4XPGL 4JO1H 1CDJA 5IB5B 4YDLC 1MIML 3FRPG 1WWBX 5H35B 5EO1B 1ZEAL 5HDOA 4JPKH 2GHWB 4BQ6A 3EO0B 2EO9A 4JO2L 4ELME 3QFJA 3KXFE 4APQC 5CSZB 5KSUA 3CZFA 1U0QA 2UZYB 1X5IA 2PO6A 1MY7A 4RFNB 3KWWA 3I02B 4FFWC 5F71A 3MRHB 2FB4L 4G6AC 1AFVH 5CZXC 3QUZA 4PRPD 3NIGF 4WTZA 1VFOA 4PJAA 4LVHB 3MFFB 4K94L 2ICWA 3OKYA 2D2OA 2L7UA 2LTQB 3NZ8B 1C16A 4L3EA 1U8KB 1UH3A 3RWIB 1LK3L 5C09D 5J6GB 3UZQA 5CCKH 1S7WB 2B4CC 1BZ9A 3D9AH 4DCQB 4OF7A 1ZA3B 4XCYB 1XGQB 3GB7A 2ZCHL 2VWEE 5I1GH 1CN4A 4AQOA 2X1WL 1I1YB 3N1GC 1DFBL 4KC3B 1UYWL 2HVJB 3SQOL 5HYFA 4JM2D 4MLSA 3WN5B 4Q6IC 2AEWA 2DD8L 5GGVL 1ZHBA 4P3CH 4MA3A 4YXHL 2FLRT 5D1XA 5C08B 5GXBB 3LOWA 1BBDH 3VWJA 2ITDB 3EOYG 5ESVA 1UADC 2EKJA 1MCJA 4R26H 1S8DB 1PJ9A 1UB6B 1M7IB 4V2BA 3MYJB 3SKUD 1P84K 3VXTA 1V3JA 4TUJB 1BAFL 3VXSE 4XPHH 3FT3A 1AJ7L 3QB7C 4MA1C 1HSAA 3ULSB 4KZEL 1FORH 3RTQA 2JE8A 4KTEH 5GRJL 1A4JB 4BFIA 4JHWL 3ZDXE 4ODXB 5CILL 5ICXB 1OP5H 3B9KA 4J3VA 4XNQA 2VWEC 4PBWD 1UZ6F 4ONGH 1K6QL 4YHIB 3T65A 3GBNH 4KY1H 1JL8A 3KLDA 5B4MD 4LSVH 2X44D 3OX8B 3OV6A 1Q9OB 1P6AB 1EAJA 3E3QC 5CZXD 5I8EA 4C56E 5C0RL 2EC8A 3DUHA 4HQQH 4DGIL 3PQYB 4XBEH 3U6RB 3P0YL 5EZOL 1F3RB 3QDJD 1YJDH 1BFVL 2HTKC 4YGVB 3BMVA 4IRZL 4FTVE 3OF6D 3QIBD 2F53A 5LGJB 4L9LA 1FO0A 3QAZB 4XP1L 4JZJC 4HSQA 3MZTA 4PFEA 5E2WH 4ELKA 2OBGA 2DQDH 3MLVL 2EIZB 5D1ZB 5IV2B 2CLVA 2MCPH 1HXMA 3BJLA 5KJRH 1I9IL 2R23B 5SWSA 5IW6A 2AJUH 3NACH 5IQ9B 2ZPKH 4KMTL 5JIKA 3LEVH 3M45A 3CSGA 3VDAA 1MLCB 1SVZA 4NZUH 2LV4A 4LVNB 1YZZA 3SBWA 4QTIH 2RGSA 3ZLQC 2WIIA 4I2XB 4MJIB 3EBAA 4KVNL 3PL6D 12E8H 4QHNA 3F5WB 4LPXA 4NQVB 4Y19B 2WSKA 4ONFH 3D39B 4MXQD 1NUGA 4NHUA 3OKLB 4LLUB 4UNTA 1BBJA 2DLGA 1YDPB 2OMBA 5I73C 1S5IL 4YDIL 5DQJB 3MBEA 5T1DL 1EGJL 4BQBA 4PJIE 3GJFB 3BAEH 4HS8L 3LZFL 2HLAB 1FL3A 3KS0J 4X5WB 2O61B 3O9WA 4GS7C 35C8H 3MLRL 1PX3A 3T0EC 4LSTH 3KPMA 4JY4A 4NN7C 3MRQB 4ODXA 3BEWB 1S7XB 2NTSP 1O7VA 4OZ4A 5A2KH 1WBZA 5DUMH 2VO5A 1X6NA 4N9OB 1IKNA 5DMIL 4PJ5A 4F9PA 1NGXA 4L4VD 4NQCE 1LE5B 2CUIA 3LN4B 3U9UB 5EUOA 2MWCA 2HYMA 3WFEH 1PAMA 5CUSL 5J89A 5HYJA 1S7UA 4N8CL 1JNJA 1Q9WB 2FLBT 3IXTB 1T5XA 4FQLH 1KEML 2XZZA 5IUSA 5K9JL 5J0BA 3ZYZA 1ZHBB 4K7PL 1BZ7A 1VGKB 3FCTB 3KPPB 4WHCA 1AGCB 2DJUA 2I9TB 3UZEA 4APQB 1CICA 5BXFA 5GS2H 3O6MH 3SDCA 3NA4A 1Z9LA 2CRMA 5IMKB 4B0MM 1Q0XL 2JJSC 1T20A 5C0DA 1IEBB 4XH2A 5MI0B 3H9HA 2OL3B 2EIBA 4IIQA 1MF2L 3C5ZC 1VERA 5GJSH 2R29L 3E6FA 5FGSA 1U8KA 2W1NA 5F9OL 3H7BB 4ZD3L 3G5ZA 3IRZA 5L8KB 3NPSB 1JYVA 4FP8L 4NIKB 3NABH 4I13B 5H37H 4Q6YA 3FQWA 1H3UA 3FFDB 3PGFL 3RWEA 5IFJA 1MI5A 2QR0B 3A6OA 3B8SA 3GBML 3T0ED 5I2IA 1T2QL 4TSCL 4JY5L 4ZNEA 3O8XB 4JFEE 2YN3A 5J13B 1JPFA 2J8UB 1DBBH 4P9ML 3SDDA 3L3DA 4OZGB 1RZKH 1BQHG 3KLHD 4NSKB 4L3EE 4V1DB 1H5BA 3QUXC 1FJ1B 3P4LA 2EDWA 4D9QD 3QDMD 1JZ4A 2B0SL 1AGEA 1NGPH 4H0GA 5IHUL 1CL7L 4OCSL 1UM6H 2VSCA 4HUKB 4IOSD 3IJSA 4QYOA 3X12A 5I1IH 1PLGH 1KCKA 2F74B 4FQIH 2Y6SC 4N0YL 3TH4T 1CDGA 1HH6A 5CINL 3BZFB 4OZHB 3X13A 1CTOA 1WVZA 4U6XA 2P43B 1KNOA 2ESVD 3DLQR 3VXPA 4XBPA 1SM3H 3QHFL 3GHBH 2MHAA 1RK1B 3FQTA 2FSEB 4PB0L 3VWKC 3DSFH 1MFDL 3OXSB 1BJ8A 4CJ0A 1XF2A 2XTJE 2IGFL 4KQ3H 3KYKH 5DFVC 1SJXA 5IVXA 4NJ9L 3MXWH 2HJLA 3BH8A 4YXKH 4X0KB 1QFUH 1QBAA 1IC7H 3HR6A 4OZIE 4ZFOL 4L8SC 2DTMH 1G7JA 4GAJL 3CPLB 2DQGL 4G9DB 4N68A 5E6IA 2R4SL 2VZUA 2ADFL 2IANB 5DVLA 5T1MB 2R0LL 2Z91B 4FQPA 3MRCB 1NC4B 2AJYH 5EO1A 2GSGB 3L3GB 5CHNB 4HZLB 1OAYH 5IW1A 3VG0L 4W6YB 1RIUL 1F42A 3QEUB 2XTJC 3O4LE 2P5EA 4FMFA 4QOKE 3CFKA 1JF6A 3PWJB 3WIIL 2OJZH 1J8KA 5HYQB 3FT2A 4J23A 2IPTL 3OXSA 1MRFH 1KBGL 4M7LL 3GRWA 2KZ1B 2Y6SD 3HG1E 2AV1B 3GMNB 4I3SL 1G6RA 4RWYH 1RZ7H 4OI7A 3HUJE 1FNEA 2NX5A 3FB7A 5F88A 4GW1A 5LGHL 1IGIH 3IU3B 3HC0A 2ZSWB 1QFPA 5D7IF 5CKAA 1N6VA 4OM1H 5C08E 2IF7A 3D5OF 3U0PA 2ITCA 4M8QB 1BOGB 5EORL 2BC4B 1ZT4A 4PJCA 3LD8C 4PJBB 3QUZC 5C9JB 4MQ7B 3JWNC 5L2KD 2AERT 2CRZA 3TBYA 2W60B 3WO4B 1PY9A 5KW9L 1UYWH 4MXQC 4KUCF 3QDMB 2JCCA 2MPAH 1Z0MA 2NY2B 1Q8MA 3L9RB 3FO0L 2JJUA 5BRZD 5KZCD 1UB5A 4O51B 5E2UH 2HA1A 2PW1B 5E6ID 4QCIA 2BNRE 3CH8A 3REVB 2APFA 5H94B 1DBAL 5C0AE 2K7PA 1YN6A 3WUZA 1JE6A 2ENYA 1B4RA 5HYSG 1HOCA 1YY9D 1EFQA 4HUWA 2YMXH 5GGSA 3GMLB 4UV7L 3EYQC 2CMRH 4KTEL 2GJJA 2YD7A 2GTWB 1BVZA 4ODTH 3LSOA 1GC1H 4WW2B 4YLQT 2A6DB 4U0QB 4O51A 4ONGL 4C56D 1UGNA 4G6FD 4LSVL 2D03L 4H0HB 1RIVL 2ESVA 4FFYH 4ZYKA 3LQAC 4PJFA 1YNLL 1NEZB 4UTBH 1FP5A 2VUYA 4WUKH 1PKOA 2NW2A 3VFVA 5FA4A 4XVTH 1JNLL 2ZUQC 3G5YA 4ZO7A 1JGDA 4EI5D 4XP1H 4RGMB 2UZXB 1HSBB 5I73B 3DECA 3TZVC 2ICES 3WXWL 2CK0H 1MHPL 3DVGB 4JJHA 3RIFK 2ZWLT 3F7VB 3G6JE 4G8GA 2ZJSH 4NQSA 1JWMA 5AD0B 3NGBB 3QXDB 5HBBA 1UACH 5FYKU 2UVEA 1CL7I 1ZWIA 3T0EE 1JPTL 3SCMB 1XGUB 2XZAL 3TGXA 5CLWA 5F6IB 3KPSB 2PO6D 2VTFA 3LDBC 5EBMB 4XCCH 3VXME 2OK0H 4A6YL 4OLYL 5F3HB 3HI1A 3BWAB 5ELIA 2EEDA 3RU8H 1U8LA 1Q72L 5J6HB 4ZTPH 3QDME 2P8MB 1CIUA 3VFWA 4A2LA 1B9ZA 1ACYL 1Z9SA 1NFIB 4EUPA 2J7LA 5F1NA 1OAUH 3O3DB 3G5XB 5DVKA 5ANMB 4L5FH 3RTQD 25C8H 5CKGA 5FO7A 5CHNA 4NWUH 3E8UH 4FZ8H 4PRHD 1ZSDA 3DX8A 3PWPA 3REVA 3SQBA 1G1CA 1NDGB 2WBWB 1J0HA 1LQSR 2NNAA 3VFTA 1T4KB 1CGVA 1OGAB 2C1OB 2UWEE 5E6IC 1FAIL 4W6XB 1FO0L 1M7XA 1NJ9A 3IDGA 3FAWA 3GKWH 3LV3A 4LKCB 1PG7X 5I8KH 3HNVH 3BSZH 2K3TA 3MV9A 4YHPA 4PJBA 2N56A 1D7FA 1BIIA 3AREA 2ZOKA 1BOGA 3L3KA 3O3AA 3RHWF 3S6CA 3WL9A 2GTZB 2FIRT 4PY7A 4GXVH 1T83C 2A83B 5CUSH 1HKFA 4H26A 5D5ME 4L3CB 3KPQA 3MCLH 3ARBD 5C0AA 5IMOB 1RULH 3SGKC 5J3HD 4LLMB 5DUPH 4RWHA 1MREH 3T8XB 1S78D 3HE6C 2R0WH 1G9NH 1TNNA 1HH6B 1X5LA 2WLZA 1F6LL 1FNGA 3CFKB 5KG9B 1L6XA 1JV5A 2ZNXA 4WEMB 5ITFA 3K4DA 1K9TA 4LDEB 5JUEH 3GNML 2RR3A 5JHLH 3EAKA 2IAMA 5FEBA 1YYLL 2F58L 5L7XH 3GJEB 3VH8B 3P11L 5ADOL 1R5WA 5IR1B 2IH1B 3P4MA 5JOPE 4PJXE 1MPAL 4RFEB 5EUOE 3L5XH 4NKDA 2PO6C 2EEBA 1MQ8A 3E2HC 4X9FA 3QUXD 1G7LA 1YN7B 3QHZL 5TDPB 4NCC2 5E7BA 3MGTA 5IHZA 2VKXA 2VN4A 3BOVA 3VCLA 1JNNH 3MLYH 4LCCA 1KCSH 3AB0C 4QCIB 5DMJB 4OZHE 1QKZH 3IDJB 4YDVB 4XPAH 3T0BA 2FEEL 1KLUB 1P7KB 1S7WA 3IFOA 4NBZB 3VGFA 3SCMC 2DQJH 2IBBA 5B8CC 3WJJA 2PCPB 3B2VH 4IIQB 1TVBB 4K3DH 4HH9B 3X11A 5CMAB 4U3XA 3QJFA 5C9JA 1A9BB 3O2DA 4PBVC 4K3EH 1JTTA 2MHAB 1NMAH 1WCBB 1U8QA 2A6IA 2XY1A 3ULVE 2JJSA 1JFQH 5EU7C 3BYYA 4OFDA 1P4BL 4ORZC 4D3CH 3GMOB 3L3IB 4M48H 5IIEA 2AK4E 1PFCA 3WFCH 5F9JB 1JHKH 1RUMH 3QIBC 4JDTH 4ONHA 4RMTA 1JWSA 3GEWB 3IKCA 1X6LA 4HCRA 2BNQE 1I9JL 2IH1A 3DRTA 3GSQB 1NGYA 1M7DB 3QNYA 4BUHA 4OSUH 4QTHB 3QEQB 1GGIL 1FLRL 3MR9A 1IGCL 5DTFA 5KSBB 4NC1E 1H5BB 1I7UA 5F7MC 1V05A 4OCXL 4BKLB 1OP9A 2VC2L 1TCMA 2ADJA 2H8PB 1QR1B 5KSAA 4MSWB 2DLFH 4C59B 2XZQL 4JDVB 3CDYA 4HS3A 4UZGA 3KLHC 3KNBA 3V0VA 3DUUB 3RUGB 2IFFL 1RIHL 1PKQE 2V7NA 4WY7H 4XWGH 1FFNB 4PGEA 1WZMA 4P2RB 2ADIB 5E9DE 3K8KA 1KB5L 3VXRB 2HFGH 5JW3L 3QPXL 1NANI 1VFAA 1OARH 2BX5A 2X4UA 2AJYL 3R1GL 4C56A 3OG4B 3RL1A 1J87A 1NMCC 4BH8A 4CMMA 2Q76A 4P9HH 1MWAH 4NM8H 3HPLB 3CPLA 3WYRA 4P4RA 4S1QH 1QVOA 5DHYB 2VZOA 4UIMB 2OJZL 4GW5B 4PV8A 4PJCF 2IPTH 4HJ0C 2VZTA 5I1AA 1KACB 1T0MB 5I15H 3WO4C 4PJGB 1W8OA 1EIBA 4NWTH 5ICYA 4PRPA 5GRVK 4S0SD 4ALAH 5JHDD 2PXYC 4J7RA 4LBEA 2V2TB 4N0CC 2DWEB 2PYEB 4KJPC 4O5LH 4M8VA 2R23A 2ZCKL 4YHZL 4H5SA 4UTAH 1J18A 1FVCB 4JFDD 3LN4A 3ARFA 4GRWF 1J1XL 2A73A 3FQNA 5EN2A 1NAMH 5IB4A 4M6NH 1U8PB 2GITB 2VDQL 2VXUL 2NY0B 4J3SA 4JHBA 2WBJD 1Z6JT 4GBXC 5HJ3B 5I19L 4N0RA 1IZKA 1BFSA 5E5UB 1CGSL 3ULUE 4F2MB 1I1AD 4ODHL 1Z2KA 5EOQL 3FO0H 3MRPB 4RNRB 1EJ6A 5JLZA 2AEPL 4Z7OF 4DUVA 1AHWA 1UT9A 2DL2A 1DBAH 4HXBL 5FM4A 1A7PH 3MBEB 1OHQA 5KN5B 2HLFC 3BKJL 1T7XA 3BVNA 4KK5D 5FM8A 2R0ZH 3U4EA 3NCJL 3VI3F 4LLUA 2QLVB 4YFLF 5T3XD 1N8ZA 4ACPA 1BP3B 4UILH 2MSPA 1QFWI 2P5ED 4H5SB 1JVKA 1FNFA 2O5ZH 4X6CA 4K9EH 3I85A 4ODTL 4KZDL 4MXVF 2ICWJ 4G42B 3BIBX 1O5DT 1P4IH 1KTLA 4ZUTA 3MNWA 3PWUB 4F9LA 5EZLA 3SDCC 3MUGB 1SBBA 2QQKL 4QHKJ 3MCG1 5DC9B 1XGQA 3GB7B 4D0BB 1I3RB 4V1DD 3PHSA 4G9FB 4Z78B 4HG4K 2XTLA 1BZ7B 4QRSA 2VQ1B 2YD5A 4LMQI 3MUHL 4TVSa 5E94A 5DSCA 5TE4H 1RZFH 2F8VA 1MFAL 3G6JB 2B4CH 4OB5L 3ZO0A 1RZJH 1DLFH 5C6TH 3FZUD 4NN7B 3DTXA 1JPTH 4MAYD 2ADIA 3P9LB 1N8ZB 3MX0A 5HYIA 4XCCL 3LIZH 4DJMA 5C71A 3SE3C 3HRZA 1TZGH 1QFWH 4OLYH 1XCQA 3ZE2E 4LLYB 4U0RC 1FZMB 3M1BA 1CS6A 1NEZG 3AMKA 1UM4H 3IFLL 4P57A 5GISH 4NZRL 1D9KC 4MQXC 3FT3B 3O8XC 4PGDB 1CFQA 4Y5YA 3RVWD 5L0QC 4B7LA 3O9WC 1E4WH 4P2OC 4NFCA 2VLJB 3PE9A 1KXQE 2XZCH 3QI9D 5I1HL 5LXGL 1OQOA 5CJ5A 4UINH 3VFPB 1JMXA 3VD3A 4BH7B 4M3KB 5GIRB 5F21B 1SEQH 2VLRE 4CDGC 4WNQA 5DJXB 1E28B 4M6OL 3W5NA 3IKCB 2C9AA 5C09E 4Q9QH 4KXZI 2EH8L 1J1PH 2QQLL 3GRWL 2DLHA 1SVCP 1KXVC 3CSPA 5BRZA 2GCYA 2A73B 3O3UN 5MI0C 1JZ7A 4Z7WF 5JQHC 2R1YA 4WJ5A 1A4KB 1HHKB 5EIVA 2E7BA 1XGTB 2A77L 3CXHK 5ACZA 3BIKB 4KV5F 4ESKA 4HPOH 1FFOA 5EU5B 3QWQB 2B1HL 4LBEB 4HXAL 1A6TB 1P7KA 3VFSB 1U41A 5TF1L 5DHVA 3CXDH 3CFDB 1F00I 5GGVY 3LH2H 3HC4L 5JR1L 2YRZA 4ZSOB 4ELKB 1WCQA 1CXEA 5EOTA 1AO7D 3V5DA 3LPFA 4QF1B 5J1SC 4WHYH 3UJTH 3IVKB 2R1XB 1OSZA 3Q48A 3HPLA 2YD8A 1CGXA 1DZBA 4ODVL 4UMGA 4BH8B 1NCUA 3B6SB 1CU4H 4CN4A 5C0EA 3SDCD 3ZKMD 3MRFA 1NCBH 3GSUA 4ZOEA 1KPVA 1Q0YH 2ADGB 4YDLB 3O8XD 5GGTL 4EDWL 4JQIH 2YZ1A 1DSFH 4UT6H 4WI9A 4P2OD 4XNQB 1F2XK 1KPUB 4KDVA 1NAKH 3QG7L 2X5PA 1OAXL 2ZCLH 4OJFL 3RUGA 1WZ1L 2DQFA 3KYOA 3DPBA 2DWDA 1GZPA 2XN9E 4EI5B 4ZO9A 1ZTXH 1WC7A 5C7XH 1YEIL 4MMXC 2WMPA 1ZT1B 1EZVY 4Q6IA 4LSDA 4X4XA 4NO2A 5L88H 4CNIB 3QXAB 2P8PA 2XN9D 4QHUB 4BSVB 4U31A 3TYFA 1C1EH 1YY9C 5IMOA 3M8OL 4LDOB 2PETA 1FFPB 1OOAA 2D7TL 1I1CA 4JGUA 3GSQA 3ARRA 1A02N 5B39A 4OLEA 2XNAA 4G8EA 4PLJD 5E99H 1QKZL 1S7QA 4WNQB 5T3ZD 4I0KA 4NP4H 4YBLC 1I85C 1H9VA 4OUOA 4IRSB 4QOKD 2MJWA 3IS0X 3RAJL 3VXUB 4R96A 3DX9A 3UTQB 3FFCB 4M9OA 2P5WD 4NO2B 3F12A 5C0IB 4WUUA 3ZMRA 4GSDH 1Q1JH 2DDQH 4JDZA 3KXFD 1KUMA 1ZS8A 3QCTH 3ZYOA 5FK9A 1ZKAA 2X4SB 1KB9J 5D7JA 3FOMA 2YRPA 1N64H 2Z31B 3H9SA 5DJ0B 2FIKB 2IQ9H 5FUCE 4I3RL 1AC0A 1T3FA 4KK8D 3ZT7A 4JQXC 5E8DL 3OAYH 3O3EA 1EJOH 3P73B 4WGWB 3RIFF 3PWPB 1QO3B 2H41A 3I6GB 4Z7NE 1MJ8L 5I75C 2NY7L 1KIPA 2YUVA 3MGOA 3O6KH 1A7RH 5C2UB 5LGKA 1GGIH 5C0EB 5C86A 2BCKA 1PYWB 2BSED 2ZG2A 3WLWC 6CGTA 3UTPE 3T2NH 2VQ1A 5E94B 3FQXA 3EYFA 2R1XA 3I50L 3A6CH 3VFRA 4Y2OA 2EE6A 1N2RB 5EUKA 3EO0A 4XPFL 5HY9B 4Y2DD 2QL1A 5FV2A 1BVKB 5E03A 1S7TB 3RIAK 4PP2A 1FZKA 3QUXB 3RIAF 1GCFA 2R39A 5EA0L 3LS5L 4F33B 5GJTL 5TGBA 4XWOC 3QXDA 1RUKH 2AJXL 4P2QA 4YE4L 4NQDB 1LEIB 2Z35A 3UROR 3ULUF 1A3QA 4KJYA 2WUBH 4M1DH 4R4FL 2Y06L 2R4RH 3BPNB 3DROB 1NAMA 3U9UA 1HSBA 4HT1L 2XT1B 2AGJH 43CAA 5D8JL 2ZSVA 4DTGH 1IMHC 2DQEH 4OD1H 3TV3L 1S3KL 2NY5C 3QI9B 4N8VB 5I15L 4RIRB 1M6OB 1HQRB 4OZ4B 3A6BH 8FABA 2UYLA 2BNUA 3QQ3A 4NWTL 4L9DA 5EBGA 4OBRA 1CICD 3GMPA 3O0RL 4OTXH 4X5WA 3EJZC 3NFNB 4O5LL 1R3JA 1TZHA 4XP6L 1AKJB 4HJ0D 3H0TB 5HHVH 1RU9L 2OXGA 3EHBD 3IJYB 5I0DA 3P9MA 1QSEE 1OGAA 3D0LB 1F5WA 1G7HA 2P5WA 4LAJH 1PY4A 3NVQA 4K8RC 3RVTC 5D71L 2Q8BH 5D72H 4XVSL 3HS0A 2BNQB 4OZGF 3T4YA 5CLTA 4HDIB 3WHXB 5C09A 1CXFA 4ZUWB 3P0VH 3N0PB 4YXLH 4PJ7F 4RA0C 4UAOB 3OMZA 2VDKH 5TFSL 5ADPL 4OZFH 2W60A 4PB9H 5GRZA 1AGBB 1DANU 5ICYB 5IW6B 1U8LB 4D0BA 4U6YA 5DEGB 4KJQD 3AY4C 3EDDA 3MLZL 1QSFE 5DK2A 2F5AH 3V4PH 4HIEA 4M8QA 1L7TL 1OSPL 2VUOA 3VGHA 1QBLL 3QFJD 2HH0H 5DS8B 3IDMB 1TTUA 4TULL 2D31A 4I4WA 2O5ZL 3LKRB 4XX1G 2PN5A 3WDHA 2Q6WB 2D7MA 5BCAA 1N7ML 3Q3GA 5FO9B 2JIXD 4JRXA 4X6DB 1G6RB 4OLVL 1NCAL 3B9KB 4QY8A 3SCMD 4QRQA 4I2XE 4IMKC 4PG2C 4XPTH 4LSQH 2X1OA 1I1AB 4OCRL 3CZJA 1H15B 2E27L 4H8WC 4P5MB 1JGVL 4UDUA 3QCUH 2R2EA 4MD4B 3TEUA 5TGBB 1GYAA 1X5JA 1M7IA 4XCFH 1ZOXA 4YHNA 3IT8D 1OGAE 1XF1A 4QRRD 3U2SB 3WIHA 3GSWB 2ZUUA 4U6TA 4Y16D 1RZJL 3BKYL 2Q7NA 4WHTB 3KXFA 3WS3A 1AGFA 4R2GD 1H3VA 1TPXB 2MQCA 1CFSA 3LIZL 4HUWB 5A2LH 4H20L 4JHAH 5JQ6H 3WN5A 5EU3B 4X7TA 2Y4SA 3NBNA 7FABH 4OZFG 3L7EB 3LKNB 2IH3A 1JRHL 2PYFA 3SDYL 1FDLL 2C4FT 3N85H 3P73A 4FABH 4YX2H 3RPIB 4KVCH 3ARBB 5I1HH 3PHQA 3ZSSA 1C16B 4XMPL 1F6AA 1BGXL 2FR4B 1IAKB 4XMLL 2J1KA 2KQNA 3BEVA 5D2LB 3VFMB 2FEDC 3HAEA 5B8CB 4QRUB 5F7EH 4HUNB 2IG2L 4KQ4L 3T04D 2IH3B 3BP6B 3TCLB 1MQKH 3DGGA 4YQXH 4Z5RB 5FOBB 2H32H 4GKNA 5F3BB 4U6HB 1YN7A 3G6AA 4GRLA 4HFUH 2DYPB 4FZEL 2BDNL 2YXMA 4CMMB 2CR3A 3BPOC 5L2KB 4KI5F 1AGFB 1SYVB 3UTPD 3NGBC 4PG9B 5FYLL 4KK6D 3DJ9A 2H26A 5J9PA 2OI9B 3AC0A 5LBSH 1FFNA 1YC8A 3DUSB 1XIWC 2CDGB 5ICZB 1AO7E 3OPZH 3CUPB 5EU7E 1JV5B 4KDTC 1D6VL 1D5ZA 3GHEH 3SY0B 4Z8FH 1KJVB 5DJ8B 4GG6B 5KSAB 1FCGA 2V5YA 3MBEC 3IFPA 1D5ZB 3VW3H 1HILA 1MVUA 3QI9C 2VABA 1FG9C 3ZT6A 5I1DA 5F44A 5KSBA 4G6KH 3VRJB 4PYGA 1PSKH 5DFWH 2ZUTA 1A5FL 2KDGA 5A16B 1GGBL 2NY2D 4UNVA 2CIKA 3KAAA 3PP4H 3BUYB 1SJVA 2QSCH 2FATL 4ZUVB 1NAKL 5GGTA 3GSXA 2BMKB 5I6XB 1KJMA 1WAAA 1IKNC 4GRLB 4P46A 3CK0L 1CG9A 4WFEE 1G7JB 1ZTXL 5KVEH 1IEBA 1C7SA 5EPMA 4LSRH 3IDUA 4GQ9L 3MROB 1R5VA 3BEVB 3MODL 4MNQB 3EYSH 4BZ2L 4FXKB 1DQDH 2NNAB 5SX4I 3BUYA 4ODSH 4Q9BA 1Q9WA 2J5LC 1YMHA 4G80B 4MMZC 4NN6C 4IRJA 1TETH 3LD8B 3KPTA 5HGAA 4QHLB 5DI8A 4EQ3A 2BNQA 3G6JF 5D93C 3SPVB 2W0PA 1ZLSL 1UJTA 4NQDD 1G9ML 4FQ2L 3X13B 4F37K 4XI5D 4J4PA 4LLWA 5AYUH 3D0LA 4GG8B 1BAFH 3OR6A 1R3KA 2XPGB 2YD2A 3PDOB 1IFHH 1RK0B 2DKUA 4ZMAT 2VZVA 2D7NA 2ZUXA 4MLIA 5IBUB 1P7QB 2I5YL 4RGOL 5D1XC 3L6FA 4KKNA 5GRWA 5J9PB 4V1DA 1K6QH 1OAKL 2CXGA 1ED3B 5IROA 1XH3B 1ZV5A 3L3DB 4OZGA 1UC6A 3WIHH 5C0CD 1W0YT 1FV1B 2P8LB 4NQSB 4NHCL 1EXUB 4OFVA 3AM8A 1A1MB 5J12C 1RSFA 4PTUA 3EDEA 4NGHL 4E0RB 3EFDL 4X6DA 4Z5RA 1XF5B 1QTYT 2ED9A 5CGYD 5CP7B 4M43H 5E24E 5GGRA 2VERN 3SDXE 1RVFL 4ZQKA 1TLKA 3MLTB 5E08L 4NQDA 3D3VD 3G08B 3LN9A 1F6AB 1X5GA 4HC1L 3LS5H 2ED7A 5H2BB 1X44A 5F7WC 4PP2B 1XEDA 4JPIA 2NR6D 2ZOKB 4XVUD 5I76B 1A6AA 3ZT5A 1ONQB 3ULVL 3MUGA 3UYRH 1HYRC 4IRSD 3BZDA 3GMQB 3BT2L 3UTZB 1WJ3A 5D8JH 3VRLF 1CFBA 2JK5A 2FHCA 2NYYD 1MJJA 2BCKB 4UB0L 5F6IC 3LEXA 1ITCA 3MLUL 1HNFA 4HKJA 3I2CH 3BAEL 4Z95H 1ADQH 5FV1L 1JWUA 3O3EB 1AE6H 5IBLD 3PABB 3VI4E 4CU6A 1XIWD 2WP3O 4MD4A 1P7QD 2YD9A 3TZVD 1D9KA 1AY1H 2I60H 4N0FA 1E4KA 2LVEA 4G6AD 5CD5D 1CXIA 4OZIA 5D1ZC 3CD4A 4OIIH 1KCRH 3MYJA 4JCLA 4EIGB 4PGJA 1J10A 4P5TC 3B3IB 3PNWB 5D72L 1BF2A 3OGOE 4NRYA 3BDYH 4RMQA 3BE1L 3RBGA 1JP5A 4KRLB 4ZFZA 4PP1C 4ZUUB 1BLNB 5JIIA 1WFNA 1VHPA 4UT7L 3HC0B 4XHJC 4U1SB 1B88A 5D1XD 1NMBH 3U83A 3B9KC 4R2GB 2HAZA 4OF6A 3HPJB 3S4SA 5J13C 4WRLA 2WIIB 5HI5C 2C3XA 2A38A 1OD9A 1T1YB 4MNHA 4OIBA 1OSPH 5K9KB 2CPCA 3O6LH 4HFWB 4L3EB 3QEUA 4MAUL 5AUMB 2WV3A 1UZ8B 2GW5A 5C07A 1A6WL 2NYYC 3T2QA 3C6LA 4LFHD 2VDPL 2RHEA 2VB5A 2MCG1 1HCVA 3QAZC 4EN3C 1D5XB 4HV8A 3AFLA 5I1JH 1NBVL 3SDXB 4IMLB 1KIQB 4ENEC 1KT2A 3EYFB 1KJMB 1PZ5B 4FQCL 3QPQD 4H8WH 4WTXA 5D7LE 4XX1E 1MCCA 4WEBH 1KLGA 3VXOA 1YN6B 4PRIA 3RDTC 4HK0A 2BVPB 1KSRA 4RFNC 1D9KD 2VDNL 1KYOK 4XVJH 5IWLC 1LEGA 1E4XL 2HJLB 1P1ZA 3DVFA 3QWOA 3ULUH 1F8TL 3EDFA 1QSFA 1ZEAH 1UM6L 1EHXA 5EC2A 1K8DA 1QQDB 3AU1B 5ILTL 3RY6A 4JM4H 3SN6N 1IAOB 3BISA 4P5KB 2BY1A 4NNPL 4N8VA 2JB5L 2FDBP 4WJ5B 3FQTB 3RHWK 3PXJA 2R1YB 1IBGL 4KKLD 1C8PA 1AC6A 4I18C 5M7QA 1QBBA 1ZLWH 3UTQA 5LQBH 3DYMA 3DXAD 4KGJA 4HX1B 3T1FB 2VLLA 3BQUD 2GY5A 2MNUA 1HEZA 4OM0H 2DN7A 4ORGA 4FXLA 3CIQA 2J5LB 3MRGA 1BGXH 1A6VH 2P8PB 4DKDC 1QSEA 4YWGH 2Q3ZA 4JFDE 4U1HA 1BVKA 1OPGL 3FHAA 2CD0A 1A8JH 3TJEH 3TESA 4X6BA 2DQTL 1J0ZA 1FGNH 1FPTL 1OGTB 2G9HA 4NNXA 2WAHA 2NXZB 1NCDH 3RZWA 3BP4A 1Y0LB 3ARFD 4YFLI 5DMGD 3RWIA 4LLYA 4HD9A 1ADQA 1D5IH 1HZHH 2NY4B 4K2UH 4HUVB 4TOYH 5DJCB 4P3CL 4MYWB 3BW9B 4JKMA 3GK8H 2DQCH 2BVPA 3MRHA 5DDHA 4ZPTA 4XHQA 3L7EA 3SOBH 5BRZE 5ERWA 4RMRA 1TCRA 1JF1B 5F89B 4BZ1L 1U8JB 1T3FB 2QJDA 1AJ7H 2EE3A 2OL3A 3I9GL 3MRBA 4XH2B 4LSSH 1R5WB 3ETBF 5IR1A 3D39D 1MRFL 1WF5A 2FL5B 3FT4A 3PXHA 4POZC 1CGUA 5F96L 2E8ZA 2FGWH 1IC4L 1P69B 3QUMH 2F19L 5EZLB 3BIAX 4F8TA 2AK4D 2NY6D 1FRGH 4F7EB 3MRGB 4RAVA 1PW3A 5DQDH 1AHWC 1A5FH 3GO1H 3FONA 4AEFA 2RJMA 4BK4A 4RAUA 1A6PA 1NFKA 4HZAA 1VGEH 5T5NG 1OTUC 3P0YH 2AABL 3U82B 2FX8H 3RWJA 1P6FA 3T77A 5DJDB 2DL9A 3K8LA 1FZOA 1LD9B 2FZ3A 5D70L 2WUCH 3BGMB 3ZDYF 4U6XB 1V7ML 1RHHB 3CCHB 1ZVSB 1CFNA 1XZ0A 15C8L 2LU3A 5EORH 5EOCL 2P7TA 1Q9KB 3MLVH 3VD7A 2Y5TA 3WN5C 1SY6H 1K3ZA 3DYPA 1RZ8B 3V4VH 2A83A 2AJUL 3SGJA 2EDKA 4PY7B 3O81A 2B7DT 5DGRA 3DOSA 1UVQB 1PQZB 3B3IA 4ODSL 4WI3A 1P1ZB 2R15A 4NQED 4QTIL 2HLAA 4M1CC 4KVNH 3G04B 1ETZB 2DQUL 1FG2A 3U0WL 4MJ5B 1I9RH 5HYSA 3VFTB 1FIEA 3IVKA 1BPVA 1W72H 2VLRB 4LAQL 4N8PA 4F8QA 2F8XC 1CFTA 4AH2A 1ACZA 5T1DH 3MJ9H 4LASH 5EC1A 3SBWC 1IFHL 4RRPA 4HDIA 3WHXA 4KHXL 4XMKH 2VLJE 3LEXB 1GC1L 3U0TA 5TE7L 1T22A 5E4EC 4KI1A 1KLFA 4D8PA 1YC7A 4NZTH 1JIBA 4QRSB 4Z77A 1FFOB 4QXTB 4C58B 3RX7A 2W92A 1G9NC 3PQYD 3GSNA 3MNVA 3FOLB 1N6UA 3BDBA 4NRXB 4R2GC 3T09A 1GGTA 2DBJA 1U8MA 2GI7A 1QLEH 3NFPB 4XXCC 1PG7L 4L4VB 1RVFH 1MHPH 1QBMH 3HCVA 3ULUD 5J1AB 2AEIT 5E1AB 3K3QA 3W82A 2PXYA 4NRYB 3DRQA 2ZSVB 4JO3L 2XZAH 2X4NB 2DIBA 2XWJB 3SKOB 4Y4HB 3QWRA 3QXTA 3VGEA 1LP9B 2R56H 2R69L 4FQJL 2ESVB 4PJBF 5IQ7H 5J11B 32C2B 1UENA 2MMXA 2Z92A 4MA7H 5AZ2H 1EO8L 1F4WH 1I1RA 3BMWA 3PABA 3CVHB 4F7PA 1E4JA 2I07B 3O6FA 2A6JB 1OAZH 5CJQL 3JTSB 4PJIB 4UBDC 5BMFH 3RNQA 1EEQA 3DX7B 3V8OA 5CD5C 4HIXH 5DQJA 1U3HA 3ESVF 5KSVB 5T3ZL 4NQCD 5ALCL 4XP5L 2OZ4H 1OTSC 1QA9A 5EN2B 1DBKL 1KFAL 4K23L 5IFHH 4PJ5E 2EIEA 2XRAL 4Y4KB 1JYNA 1QLFA 1A6AB 1BFOA 1Q94B 3FOLA 4BUGA 4GG6F 4G80A 1B0WA 3MNWB 1TJIL 3MCKA 3ELAT 2V2TA 2XWBA 4HWEH 3DVIA 3IFNL 2UV3A 3QFDB 1T7YA 1YEFL 4ODBD 3FRUB 3IGAA 1BEYH 3NIDE 1MLCA 1HYSC 5MHSD 3MRMB 4TSBL 4CVZA 4BSWA 1MFEL 2B39A 1T22B 5SWSB 2NXZD 1CZ8L 3GMRA 4X6CB 3WFDL 4NC0B 5D1ZA 2F53D 3MLPA 1P5VA 3CFJB 4LNRA 4G8IA 1NCWH 1FO0B 4JFZH 1EMTH 1LDPL 1CCZA 4J1UB 5IGXL 3LKPB 2F54D 4ZUVA 3ULVD 4MQTB 2Z93B 3PIQA 5HGDB 2XYCA 4C56B 3H3KA 5ALBH 4PJHE 1JN6B 2GJ6D 1KPRB 5BVPH 1Q9LA 3V6ZB 4ZNCD 5MENE 2VLKB 1F4YH 4LRIC 1PDKA 3QUYB 2Q7YB 3QHTC 2NX5B 1KTRL 5JUEL 4GRWB 4JKKA 5A2FA 5ICXA 4OAWB 5T1KB 4WWKA 1QFUL 3O11B 4X9IA 3CFEB 5IBUG 2W91A 3MRJB 5D6CA 1E4KC 1KJVA 5DJ8A 4DWHA 3BO8A 1INDL 2X4QB 4X9GA 3VXTB 2VIRA 4WCYL 5I66A 1R3HA 3BHBB 5FKPA 4LGPB 5T1LB 3UC0L 3DGCR 4PJGF 1B2WL 4LVHC 4OT1H 4FQQA 1I85A 3EO9L 2VLMD 4QWWC 4PG9A 2VDNH 3B43A 1X7QB 5EU6A 4PJ8A 5HHQA 3O41A 4PD4J 1M4KA 3QUYC 3Q1SH 4KKLC 1DVFD 4JRWA 2J4WL 4IS6A 1MOEA 1I8LA 5D7JC 1QZ1A 1CXLA 2NY1D 4MVBC 2AVGA 5JMOC 5D7IB 3BZEA 1LO3H 1HH9A 1BD2A 4P23C 3LV3B 3GSNH 4KRPB 5T3XH 2LU7A 5D2LA 4LSUL 5E2JA 1CE6A 4K3JL 2RQ8A 3KS0H 2VXSL 4RMWA 3IDIB 1WSST 3GSXB 1NLBL 2A1WH 3DX6A 4Q9RL 3WFCL 4AG4H 4MZ2A 3PWNB 4AL8H 3D87B 2NMSA 2HG5B 3VXNA 2V5SA 3DO7B 1X7QA 3TFKC 4TQEL 1HQ4B 1VSCA 2QTEA 5HHMD 4LVNC 1I9JH 1F3JB 4F7CA 1N6QL 1AI1H 1HE7A 1PD6A 1C5BH 1J7VR 1IT9L 4YGAB 5FKPB 5F1NB 1R3HB 1G0DA 1H8SA 2FHBA 2VLJD 5JW4M 2VC2H 2E5EA 4Z7WA 3V52H 4QRRA 3BQUC 5KSVA 1DBMH 3UBXI 4CVWA 1ZLVK 5DGQA 1JUFA 1HHHA 4LPUA 4LQ1A 2IQAA 3BWAA 4FS0A 5HHNB 4U7KA 4KTDL 3OKKB 3DUSA 1HZHL 3QDJB 1FJ1A 4PRPE 1RUAH 2Q7YA 2R9HD 1EDQA 2V2WB 4XC1H 1PG7W 3EJYD 3SCMA 1Q9LB 3QQ9C 1HHJB 3RL2A 1OVZA 4JGJA 4LP4A 5HVHB 4UBDD 1AH1A 4NO3A 3M1BB 2OSLB 3QG6B 4DGVL 5IJVA 4I0PA 1UQSB 2EDLA 4LRNH 4DKAA 3TBWB 4LNRB 2H1PL 5C9KA 3I9GH 2CDEB 2FJHB 2NW2B 1T03L 5HYJD 5C0AB 1KV3A 3BN9D 3QJFB 5B8CA 4XNMB 5L8LB 2APXA 4H26B 5DRZA 2Z8VC 3O6FD 1S7SA 5FHBL 4NFBA 3F6IA 4XAWL 1B0GA 4RMUA 4ERSH 2DD8H 5GGVH 4HEPG 4TUKL 1U8MB 1RIVH 3JWDC 4PBXA 3IDJA 4YDVA 3RNKB 4YXHH 3CVIH 4HIEB 4Q0XL 1UCBL 1CR9L 1Y6NR 2AP2A 4YHZH 1WUNT 4UTAL 2AABH 3TLRA 1KC5L 1V3KA 4DN3L 1G7LB 1MCKA 1GRWA 1AGCA 4FG6D 1JZ6A 4RFOH 1A9EB 2W9EH 3UP1A 1F58H 1JGEA 4LU5L 3MLSH 3D3VE 3LKOA 1LE9B 5HYJB 1SY6L 1JNHA 2X42A 4GUPB 3CFBA 1CTNA 5C09B 1ORSB 2I07A 1FHGA 2BSRB 4M3JA 1YEJH 1JF5A 1U91B 1LO0L 4P2OA 3L9RA 2OS7A 5I18H 3U46A 4K3GA 2R2EB 4I77L 3PGDA 2HFEB 4QNPE 4ZPVB 4HQQL 5FUZL 3QSKB 1A7PL 1IM9B 2A0LD 1LP9A 1MIEH 1S9WB 4RGMC 1DBJL 1YJDC 4QY8B 5F9DC 3S36H 1ACYH 3K8MA 4LRIA 5E00A 1FL3B 1OAUL 3WNLA 3VE0B 3THML 1NBQA 4U1SA 5A43C 1EVTC 1F4XH 2RBLA 1BLNA 3B9EA 5TDOB 5FYLD 1NCNA 3F7QA 2GKIA 4NRZA 2F54E 5ISZD 1AD0A 1RUQH 5HPMB 5EFIA 4NKMA 1P4IL 1DVFC 4WW1B 3NCEB 1BMGA 3BKCL 5D7KE 1BZQK 5T33L 1DL7L 3RWJB 2N7AA 5HHMB 4ZOAA 3QZWG 4OZIB 3OGCB 1ZANH 2X4PA 2J88H 4KJYB 2QQKH 3GBLA 5HSFA