5DI8A

Fc knob-hole heterodimer t366w + t366s/l368a/y407v
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8A01
3GSQA 3NA4A 1JCKA 3QEQB 5IF0B 1NDMB 1VB9A 3KYMA 5H94B 4HK3N 5CKAA 3GSQB 1CD8A 2UWEB 5FYLD 1NDMA 2NY5H 4LQ1A 4ZUUB 3RIFF 3ZHKA 5BJTA 4U1HA 2NYYC 4D9RE 1WZKA 3G04B 4N1HB 2FD6H 3EOBA 3RUGB 1VENA 5EFIB 1HSBA 3VXUE 3IU3B 4GW5A 2CLVB 5JZ7D 4LOUC 3TBVB 4JFPB 5EU6A 4KKLC 3D5OF 2ICCA 4JFPA 4Z7UA 3EYQC 4Y16C 4S0TD 5EU6B 1AO7A 3EO9L 3ARBA 15C8H 1IM9B 3TA3A 5I1DB 2OP4L 1MHCB 5AZ2H 4EDWH 4YE4H 2EDYA 2R56H 5BW7C 1Q72H 4ZD3L 1I9IL 4GOSA 4QCIB 3UBXI 2FYYB 3VG0L 1OAUH 3BAEH 4P59L 4WCYH 4LRIC 1MCRA 3P0YL 4PGCB 5JUEH 4JQXA 4PG2A 3T0VA 2H45A 1XGRB 3GMOB 3V0VB 2PR4H 1IAKB 1PZ5B 5GS0C 3KDMB 5CEYB 4Y5YC 4UBDC 4OLYL 3LAFA 1NCCL 2R29L 5D2LB 4Y89A 5E8DL 1U36A 4PG9A 2YD6A 3GSRB 3LMJL 3Q5OA 1HQ4B 1EO5A 4PG9B 5C92A 5I30H 2BOBB 2DQIH 3CVHH 2E7LA 2FIKB 4UAOC 2FWOA 1BAFL 4RRPA 2FIKA 4JPKL 5EBLB 3BIBX 4MQTB 5DURB 4Y16B 4PJGA 4KK6C 3DXAB 3P4OA 2J4WH 3MRIB 4QRUA 4PJBF 3SJVE 2N4IA 4KI5D 4ODXB 3VCLB 5DEFA 3RVXC 3VI4F 3MXVH 2VZTA 2R4RL 1REIA 4RISL 1OL0A 4WHCA 1CGXA 4Y1AA 3FB6A 3WNOA 4XBPA 2NLJA 3F7YB 3CVHL 1J1PH 5HYIA 3I6LD 1WUNT 1WZMA 1OP5H 1S7UB 4ODBD 2Q7YB 3E6FA 5EZLA 3FQUA 5HHOE 2WBJC 1CE1L 1KJ3L 1FNSL 1YYMH 3OJDA 2YMXL 5DK2B 3RQ3A 1QPXA 2J8UE 1JGVL 3DX8B 3QWQB 4L4TA 1SY6A 5IBUG 2YEZB 1Z5LA 2B39A 2NXZB 1A6VH 3V6OE 5CEZE 2ARJA 3ZTNL 1GH7A 1XT5A 4JG1L 4LSQH 5D7SH 3V5KB 2OTPA 5DJAB 4KWUA 3EYVA 5EIIB 1FNEB 1EGJA 5F8QC 1FC1A 5DFWH 4YHNA 2NPLX 2J7LA 5TDNB 4B50A 5F6IB 4OF5A 1LD9B 2N7AA 3T2NL 4MS8C 4AH2B 2HTLC 1IQWH 3B9DA 2CIIA 4H88L 3O8XC 4K7FB 3CCHB 1MREH 3HZYA 5E2UL 4OUUB 3HZYB 2BSRA 4NNPL 1C7TA 5HI5D 3V2AR 1KJMB 1BD2B 1X3DA 5DURD 3DWTA 5C0FB 4HXBH 4Z95L 3QIBA 4BQ9A 3P4NB 1KGCD 1IKFL 4ZFOL 4Z7VB 4P4KB 3P40A 4WWKC 1KULA 4HG4J 3LZFL 3F7VA 4JPIA 3E8UH 1XH3B 3CFIC 2QSQA 2BVQA 4QWWC 3WN5C 2W0PA 3MJ6A 4ZOBA 3S35L 1JRHI 5KG9A 5IHUH 1WCQA 1MFBL 3L3DB 5IOPA 1Q0YH 1YC8A 1CR9H 4CVZA 3VXMB 1FFOB 3FB5B 1QVOA 4PJ8C 3O8XA 1EVTC 4N90E 1H5BC 3HG1E 4EIZC 1CFBA 4M7JL 2WUBH 5HHME 4GRWF 3U4EA 5HYQB 4NNXA 3GDBA 3G6DH 4QXWA 2DQHH 3QUZA 4ONHA 4GFTB 4N5ED 1QA9B 2YKLH 5JXEC 4G5ZL 2UZIH 1OWWA 3N85H 3VFSA 1NGYA 3UAJD 4N0UB 1PDKA 4EOWH 1MHEA 4N0UA 3SGDI 4QRRD 3R1GH 5F7KC 3HNTL 5KANI 4MDJA 1R0AL 4XVUD 3PWLB 5IROA 4UZGA 5F44A 1A6WL 4TTDD 3MLRH 2BMKA 1CXIA 2BVOB 3LH2H 4XNMB 5I1GL 2A9MH 4N1EA 1HH6A 2CKBB 3F7PC 4PJ7B 2H26B 4JDVB 1JWSB 4I2XE 5D1QC 3UJIL 1T4KB 3BT2L 3K1DA 3FONB 1PBYA 4P99A 4JN1L 4N0RA 2HT3C 3DYPA 2W91A 4JHWH 4F33B 2VTFA 1AKJD 5DF0A 4HAGA 2GITB 2LU7A 3S5LA 2R15A 2Z8WC 4ODVH 4UT9H 4LKXB 3GMRA 1T7XA 3MLXH 1IGCH 3SE9L 4UINL 3KYNB 1MWAB 1ONQA 1FVDB 4YIQB 1EV2E 4JCLA 3ET9F 5D1QD 3M17A 5E2WH 1EHLL 1L7IL 1OAKH 3H3PH 1G9EA 4M7KH 1DBKL 3AXLA 4CU8A 2QSCL 3QXAA 5FM8A 5T5FL 1HIML 3SCMC 5F1NA 1ZLUH 3GMPB 5I66A 3KPPA 5CMAA 5C09A 1KCKA 4I4WB 4RAVB 1NMCC 4IDJH 1U6AL 1ZTXH 3WUWA 1Z3GH 4LIQH 1MCOH 3OB8A 5SX5H 1M6OA 1MOEA 4DVBB 3TA3B 3HMXL 1WAAF 4NYLA 5E6IC 4PB0L 5IJVA 3U6RB 3P9MB 1MFCH 4GQPH 1UKTA 3VDAA 4AIXA 3RBSA 2QLVB 5C07D 3LQMA 1U95B 3HC4H 2FJHA 4L1HA 2XA8H 1HKLH 5L8KB 3V52L 4WW2F 4RFOL 2EYSA 1RURH 3BP5A 3ARQA 1AD9A 5C7XL 2GY5A 3ZYJA 4IOIA 2I07B 1F2QA 5CINL 4GKNA 3EOAB 3H9HA 2NY4B 4MD0A 2WAHA 4HKZB 3OR7A 3VD5A 4K55A 3S37L 5DEGB 2ZNWA 3FQWA 2FX9L 3PQYB 2Z91A 4LAJH 1IZKA 1VPOL 5AAMA 3MXWH 4LPXA 1OP9A 4ZUVB 4NWTL 3SCMB 1I8MB 3X3GH 3G6AB 1CU4H 3L3HB 1RJYB 3TN0D 5FYKH 1U2HA 2HKFH 4K94L 1ITCA 3S36H 2DLIA 4EQ2A 5D2NB 1CXFA 4IOFD 5E6IB 4QHMB 3SBWC 2XKSA 4U1LA 2R2EB 3ARED 4L4VE 4WW2A 2FDBP 1QRNB 2J8UA 1R3KA 4L29B 5I74C 5DMGD 4PRID 4P2RD 4L9LB 3LOWA 4HJ0D 1RK0A 1OTUC 5KZCD 1VKXB 1RV6X 4K3DH 2A83A 3QDJE 3O0RL 2WLZA 5JHLL 4Q2ZA 3P73B 1J8HA 1LWRA 1KSRA 3ILPA 1Q9KB 3N9GL 4ODTL 1EBAA 2XWBA 2Z31B 4IMKA 3S4SB 3FRUA 5CAYB 1AY1H 5ECJE 2IWGA 5GRJH 5CSZA 4K3DL 2A9NL 4UBDD 4JFED 5LXGL 2XZZA 5KW9L 1BLNB 4KRPC 1KELH 2WIIB 2J12B 4PJXA 2Z31D 4RIRB 1ZSDA 3T4YA 4MQXC 2YK1L 1VA9A 3FT4A 2HTKC 3DV4A 3NCBB 3JUZA 1CL7I 3JV0A 1FNGA 3MRNA 3BGFB 4KRLB 3U7WH 1M1SA 1AXTH 3RZCD 3MV9A 4GO6B 2AV7A 3FOLA 5DC0A 3PP3K 4ODWB 2UUDK 2DM4A 2ICWI 3DIFB 4M7LL 4P49A 3CUPA 1WWBX 5I74B 3CCHA 3UJJL 5CHNB 3RJQB 3TVMD 2VSDA 4I2XB 3O6KL 2Q8AH 5TE4H 1C5BH 3SQOL 3WFDL 1KENL 1RVFL 2KZWA 4R6UA 4UT6L 4XHQA 3ARTA 2XRAL 4NKQB 5FECA 4LOUD 1KB9K 1BD2A 1SM3H 4POYA 1LK2B 1AE6L 2F54D 4M5YH 2DYPD 4MA7L 1EA9C 3FO1B 3LRGA 5T1KD 1B0GA 3MLWH 3B3IB 3UYPA 2FR4A 2APBA 1ORQB 5JW3H 2QADC 4U3XA 3IXAA 1T3FB 2JCCB 3GJFK 2DBLL 1A3RL 2BC4B 5HBBA 4FQ1L 4PJGF 5TF1H 4HUWB 2BC4A 4JG1H 4LSQL 3WFCH 5BRZA 4F8TA 5I15H 1D5MB 4GRLA 4QGTA 2R1WA 4G9DB 4NJAH 5I1EH 5GSVB 2R1WB 4G9DA 4FOMA 5ISZD 5JPMB 3IDMA 5IOPB 2XG5A 3QUYD 3FB5A 2AAVA 2NCMA 1NJ9B 4YBQC 1U6AH 4WUUE 3HS0A 3STZB 1EAPB 1B3JA 3PIQA 3KPNA 2RR3A 1KIQA 2FX8H 5D5ME 3V6FA 3WFEH 3U0PA 3F7RA 1T1YB 4NHCH 3A0OA 3ZDXF 4PJGB 1A7NL 1DLHB 3BESR 3HI5H 3U30C 3NOIA 4OZGF 3ILQD 5HYJA 4KRMB 3VMPA 1VFAB 4CADA 5IMKA 3BH8B 1YMHA 3V5DB 2W92A 4UNUA 3RWDA 4IRSD 4OIAA 5HHQB 2DAVA 4ISVB 2VXQH 2FHFA 3TV3L 4IRSA 4YBHA 1CK0H 1F6LL 4M5ZL 4BQBA 3O6FB 4LCIL 1HNGA 4HLJA 3FB7B 1S7XA 3F62A 3GZKA 5FA3B 1MSPA 1FL5A 1U8NA 3BOVA 2JTDA 3PWJA 4ZPTA 1ZHNB 3EZJB 3C87A 3NCFB 3RWGA 3LKSA 4HFUH 2G75B 5CFHA 1A3LL 2DWDB 3O4OC 1L4IA 1IFHH 2BHYA 4UB0L 1KLUA 5DMKA 3C6LC 3DVGB 2A74A 2GI7A 5E8OA 2XXMB 4PBVC 1EEUA 2A6JB 4UT6H 3WFDH 5T33H 4E0RB 2YHGA 3VU2A 2EDFA 1WSST 4JFFD 4S1RH 2NW2B 3D3VD 3REWB 4YDIL 5F70A 2FJGA 5C08E 4C83B 4H0HB 2MTPA 5DR5L 2Q8BL 1OOAA 3O4LA 3VW3H 1CFVH 4G7VL 5C0IA 5AYQA 4X4YB 3V4VH 5E6ZA 1EERB 5MENE 3QO1B 5EB9A 2D7MA 4PJDA 4HX1A 1NMBL 1EEQA 4KK9D 4MA8H 1ONQB 5K59F 1ZT7A 4LCWA 1MLBA 3U36B 4XX1G 3QIBB 4LLVB 3VFTB 2FJFB 4KDWA 1W72A 1MLBB 1I1FB 3K81A 1CLYL 2FJFA 1I4FA 4X98A 3C60C 4U6YA 4HZLA 4JR9L 1NC4D 3R8QA 3S96A 1BQSA 4Y5YB 3ULVL 2X40A 1JI2A 1MHHA 2AV1B 2CR6A 4OGXH 5IG7A 3LRHA 3GSXA 1S3KH 1MHHB 2AV1A 1XF4A 1G7MB 2AK1L 1TTGA 2I26N 5EU5B 5C0CA 2BVYA 3L5XH 1ZWIB 2ZSWB 4ZSOB 1P2CB 5K9KA 1I8IA 6FABH 4O4YL 5CZXD 2E9WA 4KTDL 4ZFOB 1OGAB 2UUDH 3TBTA 3TJEL 1I8KA 1S3KL 1CDGA 4DEPB 5C86A 4PBWD 3ULVH 4K2UL 2VXQL 4A2LA 5HJ3B 4P5TB 4K94H 5DJXA 2OTUB 2OTWA 3EO1A 2Y7QB 1GHFL 3MV7D 5IW1A 5E4EB 1HSBB 4GMTL 4JKWA 4JVPA 5EO1A 1CIUA 5TE6H 3WJLC 4YHOL 3RKDC 1M4KA 1TNNA 3GJFH 1GJIA 5HYSG 3MGAA 1IEAA 2WBJB 1IBGH 4Y4KC 5IVZA 3VA2C 2EDLA 5SWSD 4MDJB 1CI5A 1S7VB 4JRYA 1BP3B 2VOTA 4DTGH 4TULL 1KIUA 2J88H 1YEHH 4LBEB 3R06B 4OD1L 1IAKA 1YEIL 3MOBL 4AZ8A 4DGYH 5GS0H 4GBXA 2B2XL 1RZKL 3QEUA 2IALB 3DVIA 5IFJB 2PYFB 4EI5A 2C3VA 1I9RL 5DJ2B 5LGHH 2IFFL 1UM5H 3RUGE 1JWUA 2IAMD 1KBGH 32C2B 2Q87A 1OTUD 2XFXA 2VC2L 4D0CB 2HVKB 5DDHB 2BRQA 1ETZA 1SYVA 5TH2B 1JZ2A 4HJGA 3DURA 3S5LB 3OR6A 2AJSL 3O8XD 3FRUB 3LSOA 4KUZH 3QDME 2FSEB 4TVSa 2NY1C 3ROLA 3VDBA 3ZE0E 1P7KA 3VA6A 4PJXB 4RIRA 4WWKA 1KTDA 4JLRB 5D5MB 3CH1B 3NFNB 4H5SA 1FV1A 1X5ZA 1JNHA 2Q7YA 3NFNA 4UB0H 5CZXC 4XNZB 3T0EC 4XPAL 3BMWA 3FQUB 1Q0XL 3SHSA 3VXOB 4HKBA 1E28B 2Q1EA 2YD3A 1DANT 4ZUUA 5BJTB 3SKJH 3DIFA 1C5CL 3PL6D 3H42H 3KJ4B 3NA9H 1BAFH 4JDTH 4ODTH 2ESVD 4MB3A 1CD1B 1N64H 5J6HB 2ZUQB 4XRCA 2VDRL 4WI6A 3V0AC 3FZUC 4NUJB 3RPIB 1GZPA 1NAMA 4EBQL 5C9KA 5E8DH 1K8IA 3LKOA 4PRBA 1FC2D 4JJ5B 3WHXA 5BMFL 5KS9F 3OKDA 2W9EL 3VD3A 3EYVB 2X4UA 3SGDH 4LKCA 2LFGA 1S9KC 3NIFF 4JREB 3BZFB 4X6EB 1J1OL 2YA0A 4M3KB 5CD3A 1JK8B 2NY1B 3SOBH 4LSDA 5EDXA 4U7KA 1UH4A 4XNUH 2R2BA 1NLBL 2IFFH 5L0QB 5KOMC 3BUTA 3G6JE 3VG0H 3QG6B 1OQXA 4EKXA 5JPMA 1Z6JT 3B5HA 3SJVA 4LSPH 1INEL 2C1OB 4GG6B 3HMWH 3OXRA 1WTGT 2D0GA 2X41A 4FFZH 4XAKD 5JDJA 3BHBA 4GG6A 4J3VA 1S9YB 2J2ZA 5HHNA 4DAGH 1MNUH 4JFEB 4RGNC 5JA8B 4QRPD 2L0DA 5TPWL 3RIFK 1YQ2A 1JGUL 4XWOC 5BV7B 3IDYB 4P3WA 4XNYH 5BVPH 1YN6A 3IF1B 3IDIA 2QQNH 3DXAA 3P4OB 4R2GC 3ZT7A 5JA9A 4WFEE 5JW3L 1BJMA 2A2QT 5EC1A 3VRJA 5SX4I 3ZKSD 4ODXA 1X6NA 4OKVB 1T1WB 4N8CH 4OSUH 1BOYA 1U58A 5E8EB 5J7CC 4YHLL 3IFLH 5AG9A 4D2NA 5GIRA 1HHIA 3IETA 4PJXE 2OXHA 1O0VA 4DCQA 1LO2L 4Z7WE 3DLQR 4KKCD 3LQZA 4NRZA 5A2LH 3V6OC 4LSUL 4OZGE 1KXQE 4ELMA 2WANA 1DE4B 1UH2A 2ICES 1QQDA 1HI6A 4QXTA 3BPOB 5JW4R 1YEFL 2B20A 3DX8A 4ZG1A 2WINA 4L4VB 1WICA 4QTIH 1CLZL 2HTKD 3HZKB 4MVBC 4X6BB 3CSYA 1RHFA 3RWHB 4F7PA 3TH2T 4XCFH 1J10A 1JPFA 3EBAA 5DTFA 3VFVB 1BLNA 4NNPH 1ZT4B 4TSAH 3ZDYF 4U1IA 4HCRA 3O2DH 1N5YL 4PRAB 4DK3A 2LTQC 3PQYD 3V5KA 4EBQH 4FFVD 2AJZA 5GGRB 5KS9E 1IC1A 2AK1H 2MWCA 3KPSA 4GKSA 3BGMA 3Q5YA 3DUUB 4R2GB 5I17B 1NH6A 3ULUD 1ZOXA 5FKAB 3KPRD 5I17A 1OARL 3TA3C 4R0LC 3TBWA 4EQ3A 4OZHA 4LVEA 3H42L 4QRSB 4U0QB 5F9JA 2CKBA 2IMMA 2P48B 2CIIB 1DCLA 4N8VA 4XC1L 4LQFL 4PJ8A 2EEDA 1EPFA 4MA7H 5EO9A 4OD2A 1MFAH 2QR0A 3OG4B 4JFHE 2ZPKH 5TF0A 1EAJA 4HWUA 4C56B 1D7FA 5DVMA 4ELME 2HN7A 1T2XA 1SBSH 4XGZB 5A43C 1XF2B 2VUOA 1UCTA 1INEH 4PJBB 2HT4D 3KNBB 4M00A 5AUMA 2NY4C 3MRKA 2Q8BH 1JMXA 4Y1AE 4YDLB 1A4JA 3MRKB 5L2KE 4LKXA 3STLA 5JHDB 4GBXD 1OAZH 3DX9A 5F7LB 2Y23A 3F7VB 1CE6B 1A6TA 1U8IA 4B7LA 2HH0H 3ULSA 1E4XL 1N7MH 2XZQH 2YRLA 5CEXB 4BK4A 4JM2D 1WZLA 4O2FA 2H8PB 1DBKH 5D2NC 1RY7B 4KFZC 1OARH 4JPVL 3GRWA 3K74B 1HYRC 2OTWB 3N85L 1E4XI 2DRUA 3KPNB 4URTB 5C3TA 3QR2A 5T3XD 4OLVH 4YXKH 3MRHB 3QUMB 1BF2A 3BKMH 3W0WA 3UYOD 1WLHA 5HYJB 3O0RH 1TITA 3QEHA 1AH1A 4Y88A 1A9BA 1U3HC 1N2RB 1ZANH 3MA9H 5LCVL 4DVBA 5GHWH 4MQ7A 2HRPH 4PRHD 4RRPG 5CEZL 4XCFL 3N1MC 2BOCB 5E8NA 4H8WC 2FIRT 3VGBA 4JFOB 4X6DE 1U93A 4OGZA 2EE6A 4JFOA 5BS0D 3TBYB 4YFLF 1NC2D 3WXWH 3GMNB 3RGHA 4KV5F 3QDAA 3TBYA 5MEOA 1JZ5A 5J11C 3HA0A 3KG5A 4ZUWB 5LBSH 4JFQB 3FFDA 2G5RA 4S11A 4XP4H 1OAXH 2HYMA 4HIXH 4DKEL 5HGAB 3BP4A 2DQUL 5CJQH 3QIUA 5D2LA 4WHDA 5K9QG 1JPTH 4YGVA 1FFQA 5INCB 3MLPA 3H0TA 4IJ3C 2JIXD 3BQUA 4Q9RH 2DTSA 1NANH 3UTPD 2V17L 3DTXA 5DO2D 4CNIB 4D8PB 1U0QA 1PKQA 1U3HB 5JW4Q 4FXGB 1NFDA 2XA8L 4LL9A 4TNVK 4YHPA 2W1NA 2A38A 4NGHL 1NFDB 4YK4B 5T3ZH 1RQ5A 2JJUA 1P5VA 3LN4B 4TVPH 2VZSA 1BZ9A 3WCYA 5GGVY 4NRYA 1BVLA 2Q8AL 1KCSH 4O51B 2VZ1A 5D5MA 2BVTA 4GAGL 1MCBA 2I27N 5IMMB 2A83B 3F7YA 4YLQT 4Y5YA 1NLDH 4FHBD 3TIEA 3AXLB 1FZJA 1VACB 4XCNA 1N6QL 4ZFGL 4KZEL 1GOFA 4NC1E 2OK0L 2A1WL 4G7VH 3IU4H 4LPWA 2GUOB 1OY3B 3UTTE 1F45A 3RWCA 1CD1A 3O81A 5JOFB 3RVTD 1V7NL 2ZOLB 4YDKH 3MZTA 2OX5A 3QQ4A 1OP3H 5AWNH 4L1DA 4LP4A 3KXFE 5DI8B 3LKPA 1A0QL 1L6ZA 4H8WL 1P4BL 5D72L 5I71C 2YD8A 2D03H 3DRTB 4WJ5A 4OCRH 5J3HD 1ED3A 2EC8A 2VLRD 3VWKA 3GHEH 1JGUH 5JPNB 1R3JB 4YAQB 1LHZA 4M8QA 3FQRB 2P44B 3IFPB 5ICYA 4NQDD 4H20H 1V7MH 4JFFB 2YUXA 4Q97A 3VRIB 4JFFA 4HIHA 4MJ6A 4GMSH 2EKSB 1FNHA 2BERA 2JCCE 1LP9A 2EKSA 1A1MA 3KLSA 1D3CA 1GOHA 3QUML 4FQHA 4D3CH 5L9DH 3QT2A 1ACYL 4ZUVA 5DT1H 2UY7A 1IGTB 4ONOA 3B83A 3FT2A 1MJUH 1JGDB 4OV5B 2EXYD 2QBWA 1IAOA 4YFEA 3MUGB 1SJXA 4OV5A 2ITCB 3QDJA 5D5MF 1TCMA 3KPLA 1XIWB 4QHMA 5C09E 4Z76A 3VRJB 4UUJA 2LVEA 1QRNA 2J8UB 2O5XH 2YPLB 4NQVA 4A2MA 1JGEB 5J1AA 3OSKA 4X9GA 2YOCA 1ORSA 3CDGB 2M8XA 4HT1L 1U9KA 3C5ZA 2VISA 5F3BB 2MMXA 3C5ZB 4WU5A 2GT9A 2IANE 1FAKT 3QIBC 2R23B 5KJRL 4PJAB 1NKOA 2X1PA 1DVFC 1BVKA 4J8RB 4TSCL 3MLZL 3CVIL 1MUJB 3BUYA 4S2SB 4LLUB 1ZHKA 4LIQL 4ZUSB 5ADPL 4FQXB 4P46A 1CFTB 3DO7A 1JNHB 5EG6C 3DV4B 3P30L 5F7FA 3T0ED 3SDXF 3I9GL 2EIZB 4YQXL 5E5MB 3J8F7 5MI0B 2WZPD 4V2BA 2AEIT 4HDIA 5DUML 1TVHB 2GJ6D 3DSFH 4TUJB 2WV3A 3BO8A 4JRYD 4C4KT 5DMKB 2RJMA 4BFIA 1U3YA 1URLA 5HI4C 2A74B 2UZYB 3O2VH 4I2XA 5ISZA 5FHAL 3DVNB 3FCTB 1KPUA 4PJFE 4GT7A 4I0PA 3MV7B 4CBPA 1GC1C 5FECB 3KGRA 1UM5L 1MAJA 2VERN 4JJ5A 6FABL 4HW6A 2Z8VC 5DJ0B 3T09A 3VFNA 3B3IA 3M8OL 5AUMB 3GHEL 4Q7DA 3VFNB 3ARGB 1B90A 5C2BL 4NDMA 3I50L 1CLCA 4DGIH 3K4ZA 1JN6A 4HMDA 3V6OA 2HFTA 4A6YH 4WIQA 4X80L 5LGJA 4DZ8A 1NANI 3D39B 4FQ1H 4PJ5D 5TF1L 2YSSB 2DQTH 3OJVC 2NTFB 5M94B 4JZOA 3GSOA 1FFNA 4KZEH 4IDLA 4LLQB 3JBG7 3T4AA 2PNDA 5HHNB 4O2CA 3U9UA 3ES6A 1GZQB 1KIQB 2PCPA 3GMLA 2CRYA 1QFWH 2C7UB 4LMQI 4XB7A 1DLHA 5KZCB 2AK4A 2ZSWA 4N9OB 4ZSOA 5K9KB 4ZYKA 2VZ3A 3HC3L 4PREB 4CDGC 3T0XA 2P5EE 3QAZB 2IADB 4F7TA 4F9LA 4TVPL 4M62L 4X5XB 5DJ6A 4QY8B 1JWMB 1QPPA 2V7NA 4X5XA 4APQB 1A7OL 1G9ML 5I8EA 5GZOC 1FL3A 4Q9CA 1EEYA 1MLCB 5EC2A 3PXHA 2YK1H 2FL5B 4KQ3H 1BBDL 5A2JH 4N68A 1U8NB 1W2KT 5BCAA 5DQDH 4NNYB 1QQDB 4QXTB 3W9DA 3PHQA 1MJJB 4PJIE 4OGXL 4JY4B 3MYJA 3LKSB 2PTTB 2CDEA 1BJ1J 3SCMD 5C6TH 3KYOA 1L0QA 3OB0K 3MCKA 1HK6A 4D94A 1RUKH 3ULUF 1UWXH 4MD0B 2LQRA 3VXSA 3K2MC 1BGXL 3T04D 5JMRA 3MJ7A 3KJ4C 5MP6H 4DW2L 4I3RL 1HHJB 3LV3B 3G6AA 2H2SC 2PXYD 5LQBL 1D6EB 3VXTA 5E7BA 5KSBF 1FNAA 5F88B 3MJ9L 5EBGA 3P0YH 4CW1B 4GXUM 3CXHJ 3R06A 4OF0A 3QQ9C 4PJ7E 3C08H 4LVOC 5C07B 1LK3H 3LQAH 3D85A 3RIAF 3S36L 2DMBA 1DEEA 3L1OL 4ALAL 1CD9B 3DROB 3GI9L 1WISA 4OZGB 2VITA 2VLJB 5FV1L 4UILL 3DROA 3KLHC 4LCCA 4KROB 5IMMA 4P4RA 3OPZH 1IGYB 2B4CH 4QGYA 5L0QC 1MQ8A 3IDXH 3AB0B 1KJ2A 1GGBL 5HI3C 3ZDZE 4M1GH 1T83C 3MR9B 1QSEE 2CDFA 1G7MA 1RUML 3KPRE 3QDJD 2XWBB 3HC0A 3QULA 4BJLA 2CDFB 1OAYL 1IKNA 3FO9B 3ROLB 2XA3A 5F6HJ 2JELH 3MJGX 5F7WC 4EDXB 3FTGB 1GIGH 4XI5C 3GSVB 1CF8L 1E27A 4LSVH 4P48A 5FF6A 4W4OC 2X09A 3LIZL 5FF6B 5DI8A 4LIQE 3QEQA 2OR8A 5BV7C 1QLEL 2R8SH 1C5BL 2LAAA 2PETA 4QHNA 1N5AB 3I6GB 4X6FA 3MUY1 3K46A 4OT1L 4JE4B 1P9MC 3I6GA 4NBZB 4X6FB 2EICA 4E41B 2M2DA 5HVHB 1II4E 3OKLA 4HS3B 5F7MC 1NCDH 4APQD 4Y1AD 2VQUA 3CUPB 1Q9WA 4NBXB 3QEHB 1AI1H 2DMCA 1FL6B 4LHQB 2IJ0C 4LPYA 3AREA 3ZT5A 4CMMB 3HPLB 4ONGL 2ZUSA 1GHFH 1QTYT 5J56B 1TFHA 3BPOC 3AB0C 3QFJD 4KRNA 3UX9B 4NJAL 2L7UA 5I1EL 3UC0L 4N1CA 1CFNA 1SJHB 4W70A 3X14B 1ZGLP 3VI4E 5IBTH 1TJIH 3S8WA 1B0RA 1EFXB 1AGCA 4Y5XB 2AI0H 3U0WH 2GJ6A 1EFXA 4FNLL 5CEYA 1AD0B 5DUBA 5SWSA 4MXVE 4OLWL 3DV6A 3GKWL 5ANME 4HKXB 1FYHB 5GRUL 4WFFD 3TIDB 4LHUD 1MPAL 3OJMB 4R0LB 1MCWW 3TWCL 5D93B 4JO1H 4OLZL 1DQDL 3HCVB 2NXYC 4ZS7H 4EJ1C 2FWOB 4MHHG 1YNLL 5F3BA 4POZC 1CXEA 1JZ3A 3STZA 2ICWB 3FFCD 3TNMB 5EBLA 4YZFE 2F54A 1BEYH 4KTEL 3HZMB 1SBBA 2X70A 4HWZA 2E9IA 2GYSA 5GS2H 2KL6A 3VWKC 1AR2A 2Y36H 4Y4KA 4DZBA 2VL5A 3HUJB 3EJJX 1PEWA 1T21B 4PUBH 5FK9A 3SO3B 1QBLH 5HD8C 2OJZH 4WI8A 3UBXG 5E9DA 4PJDE 1JNNL 3E6HA 1SY6H 5B38B 8CGTA 2BHZA 2IAMA 5EBWA 3T77A 3BQUD 3ZLQC 3UTTD 3HNTH 4ORGB 1UB5A 4FP8H 5EULV 4S1RL 5IGXH 2AI0L 1CDBA 1FV1B 1DLFL 1N64L 1WZ1H 2BFVH 4K07A 4U7SA 1F6AB 5FA4A 4LSSH 3U48A 3PWNB 2D7OA 5INDA 5BXFB 2VR5A 2GAZB 5ALBL 1Z9OA 2VKWA 3CMGA 3WNKA 4H1LB 3QHFH 2HFGH 3NPSC 4WEBH 1T20A 1INQB 1KN4L 1IT9H 3VD4A 3DVGA 1N5YH 5DTFB 3EJYD 1RHHB 4I0PB 2R2HA 1UVQA 1CQKA 2ZG2A 3EUUA 5E8OB 1AI1L 3TM6A 2W9DL 1S8DB 5F7HA 5AZEL 4YC2B 3IDNA 5CP7A 5DJ0A 3PV7A 5F1IA 4JZNB 2AJZB 2X4PA 3AS0A 3A6OA 3QUXB 5JLZA 2VIRB 3E3QC 1CR9L 3VWKB 2FJGB 1RZIA 1GAFH 3R4DA 4P3CH 2OMNA 4YR6B 4PJHA 3CFDA 4UQ2B 1KUMA 5EU7C 4FQJH 3KLAA 3QWRD 2HJFB 4OUUA 5J57B 3MLTB 3FN3A 2GSGA 2D4FA 4OZFH 4QHUA 5J4MA 3MCLH 1R5VB 5CZVH 3P11H 4HUMB 3D39A 5F9OH 1ZT7B 1OB1A 5EWIL 3MUZ1 3WFZA 4JAMB 2VAJA 2Z9TA 2DKSA 5EOTB 4RQQA 1MY5A 3RWJB 1A9EB 4ONFH 4NKOB 4HULB 5F72S 5I1LB 3BKCH 1NFIA 2DQJH 3B2UC 1AGEA 2C7UA 4E5XA 1JPGB 1D9KA 5CIPB 5EU5A 1UCBL 3DJ9A 1YN6B 2E8ZA 2X5PA 1X4YA 4M1DL 5FUCE 2XKNA 4Z77A 4OF6A 4HPOL 3O9WD 1OGAA 3HMXH 5DJDB 4XPFH 5FM5M 5E4IA 1EHXA 1ZMYA 4KY1H 2JJVA 5J0BA 5H94A 1FNLA 3BKJL 5FV2A 3QH3A 5B3JF 3QHZL 4LSRL 1JHKL 2FHCA 2EDXA 1E0OB 1LO3H 1XR8A 3TT1H 3O2WL 5CD5D 1D6VL 2ED7A 4L9DA 2XTLA 5EFIA 2HLFD 3DX6B 4KU1A 1C08B 4M03A 3S4SG 5F7UA 3RVXD 2CLVA 3QCTH 2PYED 1K2DB 1LQSR 4M7KL 3TESA 3V4UH 3MCKB 2R69H 4AJ0A 4GQ9H 3ARFC 4XPFL 5EO0A 2X2YA 2R56L 4MJID 3EO0B 5D7LE 1M71A 1AXTL 4AY0A 3P0VL 4M93B 1F4XL 4MJ4A 4U1IB 5ENWA 4MNHA 1T1ZB 5L7XL 5GGTL 4ETYA 2W9DH 2GKIA 4JZJC 4FQLH 1U93B 1X5GA 3C8DA 1LEIB 1FP5A 4TTDC 2R0KL 2Q3AA 2HMID 3EFDL 1WFOA 3HRZA 2CLZA 4FZ8H 4G42B 4DQOL 5FFLA 1F2XK 3ULUL 2WQ8A 3SE4A 3FCTA 3QIWC 3W2DH 3L3GA 3NCJH 3RAJL 4FQCL 4OD2B 5DK3A 1CQYA 1NMAH 2XZAH 3OBAA 4RGOH 3EOYG 4X0KA 3L5WA 5K33A 3H8NA 1P53A 3O3BB 1RZJL 2ZOKB 3L5WB 2X6MA 2PYEA 1L9MA 5IMLB 4TSAL 1ETZB 4KI5F 3W5MA 1J0HA 2BY1A 1NGQH 3AFLA 4OZHF 2H2PD 1FYTE 5KSUA 3EHBD 3ARFB 3PWPB 1A4JB 4Z8FH 3V4VL 3MRJB 5MERB 4NQCE 1FG2A 5EPMA 5MERA 4R97C 4R8WL 2D0FA 3H9SA 3HNVH 4JZJB 3DX7A 2DQDH 4OLZH 4EZMA 1CF8H 4JKMA 4WO4C 1I7TA 3N1QC 4EI5D 5B3JE 5BS0A 5IIEB 2GW5A 3S37X 3BIAX 4LGSB 3CX5J 2P24A 4AEIH 3IVKA 2EZ0D 4U1NB 5MEND 3LKRA 4M1GL 1CCZA 5TDPB 5FO7B 4TSBL 3P2TA 4RGMC 3CFCH 3X11B 3MLVL 3RWCB 3WIHL 2FGZA 5CCKH 5L6YH 2ZOLA 4GUPB 2R1YA 2XTJC 3FHAA 1NUGA 2DQGH 4HC1H 4KJQD 3T0EE 5D7IF 2R1YB 4GUPA 3U6RA 5IJVB 2EDWA 3L3IB 3I02A 4JY5L 4V1DB 4LDEB 5E2TH 2XTJE 1L0XA 1MHCA 3KLDA 1KLGB 4UDTB 5C71A 1KXTB 1C16A 3AMKA 3WKMH 1WQVT 3RNQB 1YEJH 1YYML 4DFHA 5D9SB 5GZOD 5BO1L 4XXDB 3CDFA 3IKCB 3LCYA 5JW5A 1YEDA 4PR5B 1ZHLB 3W0WD 5JW5B 5I9QC 4MNGA 1BPVA 4LF3B 1MCSA 2FH6A 3F58L 1DQJB 3T65A 2R0LH 3KWWB 5E08L 3QG6A 5IROC 1NAKL 4GW4B 1TLKA 5IT2L 1IEBA 4XVTL 4I5BB 1RZJC 3LEVL 3NFSH 5C0EA 1VEOA 4WWKD 3K8LA 1EHLH 3RVTC 5LCVH 1FORH 2BOBA 1MREL 4JQIH 4P4KA 3BKML 4KK8C 1LO4H 3U4BH 3DTXB 12E8L 3GO1L 4Y19E 1U8JB 4X8JA 3UEZA 4G6MH 1T0MB 2YRZA 4S1SL 4WVRA 2VRAA 5B21A 3QNXB 4HUUA 1T21A 1PVHA 4NM8L 2VXVH 4UUJB 3TJHC 2F15A 3GJEA 4Y7MA 3ZTNH 4OFDA 1E4XH 2A6IA 4NRYB 5D1XB 3QCTL 4YHIB 5EBMB 3ELAT 4L8DB 4YXHH 2V9QA 4YBLB 1OT1A 4OCSH 1A1NB 4HIEA 1QR4A 4YDVA 3A6CH 2GK0A 1H3TA 2ICEB 3F5WA 1OM3L 3GI8L 4UQ3B 3ARBD 4NBYB 5D7KD 1HCVA 4KJYA 4ONHB 1J5OL 1QRNE 2FBOJ 3SE3A 4OZ4B 4ZAKC 4YXLL 4PJDF 2CLRB 4ODUA 4I77L 5EUKA 1IEHA 1I8LC 4R4NC 4P2QB 5GGSY 4BFBD 5ITFA 3UZQA 3UTSD 5K9OA 1MHEB 1N8ZB 4ZTPH 4P46B 1MF2L 3T3PF 2YS4A 3K2UH 2DQGL 4XC1H 4GBXC 4UOJA 4X6DF 3QUXA 3VD7A 2AGJH 4OZIE 4MB4A 1LE9B 3WL9A 3S9DB 3S97C 1U8LB 1LEKB 4E41A 5EU4A 1LD9A 4OFPA 2D31B 5CWSB 4R4ND 3VGGA 1ACZA 1P4LA 4YFLI 4JB9L 3VXSE 1KPRB 5D1ZC 3W82A 4OI7A 1AE6H 4F80A 2DQIL 4M7ZB 4G8GE 1KPRA 2WWKT 3LB6D 2XQBH 5FXCH 4YBLC 4PRDB 4BKLA 4CMMA 4MZ3A 3RP1A 1YPZB 4OLUH 1A64A 2HT3D 3U7YH 2UYLB 3IU4L 5GSRA 4ZFZB 5HPMB 1L7TL 2H9GB 3U0TA 3W39B 2BY3A 1BQHB 1ND0B 1F58L 4ZAKB 1BQHA 4C56D 1IC5L 1XF2A 4WFFE 4WU7A 2ITDB 1I7RB 2F53B 2OI9C 2I9LA 5SWQA 3UBXA 5AZEH 1D9KB 1IRAY 1TZGH 1AD0A 5DUBB 5B8CB 5I6XB 4LP5A 3TPKA 2DBJA 4JGJA 1YEEL 4I48B 3OZ9H 4GRWH 5DHYB 4NZUH 2VDML 3KPRB 1CZ8L 4HHAA 1I3GH 3OKMB 5SX4H 3V0WL 2WM0A 1FPTH 3QRFM 5CP3A 4LSTH 4LVOB 4M61A 4PLJC 5GS3A 4LVHC 1KJVB 4OAWA 1ZLVH 3T8XB 4CUCA 2HFFB 1QYGL 4Z95H 2V17H 2GIYA 4IRZH 2AJYH 1FHGA 3U9UB 2KKQA 4EN3D 4DQOH 4ZO8A 3ULUH 1X5AA 2H41A 3UZVB 5HHXL 4XX1E 1WTLA 1S5HB 1INDL 2R23A 4LSTL 4KROC 5DMIH 4PJAA 4CADB 2Y6SC 1BFVH 1G9MH 5E9DB 1OAXL 3VXUD 1TZHA 4ISVA 4XMPL 2H1PL 3EYSL 5TQ0L 3VFSB 3EO0A 4APQA 1JNLH 3WDIA 1D5BA 3O3UN 3IDUA 5T1MB 4LLAA 4AL8H 3HR6A 2NYYD 5FA3A 3MBED 3NFPA 2R39A 1A7PL 5K59E 1Z3GL 4WUUD 2P42B 2YZ8A 3GSNH 2NNAB 3MGTB 5I8KL 2G75A 1AP2A 1MQKL 3BEVB 3MYJB 2VABA 3QCVL 4OD3L 4LHUB 1ZLVK 4KZDL 2CO7B 3RX7A 2NY2D 3BO8B 3KDMA 3VGHA 1LO3L 2X7LB 3VH8A 3WKNA 5BMFH 4XP6H 5C0AA 3VFGH 5E9DE 1UVQB 2APXA 2C3GA 3C6LD 3CDYA 3TGXA 4IS6B 2XQBL 3HLAB 5DQ9A 2YPKA 4P46D 5C6WH 1D5XA 1U8OB 5GS0D 1OWRM 1D5XB 1U8OA 3KXFA 5ADPH 5DD5H 5FYLE 2K7PA 4CW1A 3CMOH 1SQ2N 1CYGA 2DQCH 4GLRI 4L3EE 2HJFA 2R2EA 3P3YA 4LHJB 1FO0L 3Q6GL 3VFMA 2JB6A 1EO8H 1RZFH 1LP9F 4NQUA 2P8PA 5C0GB 3BKYH 2ADFH 1YMMB 5HPOA 1HOCA 1RK0B 4KI5E 3O2VL 2IFGA 4HZLB 1IGYA 1J18A 4ZXBA 1NFIB 2R69L 1EMTL 1VFBB 2VQ1A 2DLEA 4K3EL 5DHVA 3MR9A 5SWZA 1U42A 3IFOB 5FDWA 3B2UD 4MX7B 2PXYC 3RA7H 4FQQB 3IDGA 1OT2A 1KYOJ 2NXYB 3X11A 3O9WB 5GJTH 2X9XA 5KVDL 4X9BA 3BPNB 3RY6C 1FBIH 1X5HA 2YUVA 3BAEL 3QJHA 3S37H 3P4MA 3E2HB 1IAIH 3FT4B 4Z7UF 3ABZA 3ZYIA 4HMCA 3WJJC 3OG6B 3SDXE 2GJJA 1AO7D 1R24B 2VLKA 4LEOB 4G6ML 3ZKXB 4F37K 3FJTA 3VMNA 5IWLC 1KIPB 2I60H 1IM9D 3OPZL 4M6OH 1JF6A 5EA0H 4OGAD 3BISA 1ZHLA 2BSTA 4K7FA 2BCKB 2VLRE 3GGWA 1MCFA 4HWBH 4LPUA 2JJTC 1DQJA 4WHYH 3RWEB 1DLFH 4YEFA 3UTQB 1JRHH 2ATKB 4MAYB 1NBVH 5EO0B 4PJIA 5AEAA 4I9WD 2WBKA 1NGPL 1A1MB 4LLYA 4Z8FL 2VUYA 2FX7H 1QBML 2L7JA 1P4IH 3IXAB 2C4FT 2PXYB 1YJDH 2OR9L 1AHWB 4LPCA 3RHWK 4X8JB 3JZ7A 4WDIA 1TQBC 4FTVE 3VXRE 4WDIB 1G9NC 5SWSB 2VLLA 1D5IL 1YEGH 3DUHA 2DMKA 5IFJA 1F90L 2KH2B 4CJ0A 2DM3A 4JQVC 3IJHB 4K71B 4LVNB 3O2DA 2VXUL 4M4RA 3QO0A 5I1HH 5HHOB 3BKYL 1FFOA 3KJ6L 2BVEA 3MV8B 3EYQD 4Y4FB 4FQ2L 2PYEB 5IMLA 4Z18A 1IQDB 3GJFB 4DAGL 5H2BA 1PYWA 4W68A 5GGTH 3T1WA 3LKNA 4O5LL 3BGAA 1IL1B 4MAYC 3LKNB 1QNZH 5I1HL 3MRJA 1U91A 3QUZB 4YPJA 2FSEA 5HGBB 4U6TA 1T6VN 5DJYA 3MBXH 3B5TA 4O02H 4IMLB 4LDLB 3HC3H 5IGXL 5ID1B 1T7WA 1S9VB 3O4LD 4U05A 1OGTB 3DHJA 1AHWC 3CH1A 2IEPA 1MAKA 1FBIL 2ZKHH 3S88L 1S7TA 1FL5B 3QPQD 3DMMB 5DQJB 5DRXA 3M1BA 2EZ0C 1S7TB 3WL9B 3FFCB 5A2KH 4F9LC 5I76A 1F6FB 4Y4HC 2AV7B 5GXBB 4PJIF 2W59A 4D0DA 1UGNA 3SGJA 1YY8B 4X6CA 3NAAL 2WMPA 4PJ7A 1MRDH 2Q76A 4CVXA 2WW8A 1CS6A 1GGIH 2ORBL 4K9EC 1OVZA 4PIRF 4MWFA 5JXAH 2WWMD 3NA9L 4XP1L 1WCBB 4JO1L 3X12A 3TWCH 1B0GB 1NC4B 3JWOC 5JLZB 4L8CB 3VG9C 4CMHC 2VIRA 5FYJH 3CZFA 4DN3H 4WNQB 3SDXB 4OZIA 1INDH 3HE7D 2GITA 1LEGB 1CLOH 4HFUL 4XCEB 4M93C 4CDHA 4MCZA 1NCBL 5EWIH 4MNGB 3HB3D 4JPKH 4QHUB 3N1FC 4R4FL 4S0SD 4Z7QE 3N0PB 1W0WA 4I48A 3DMMC 2LU3A 1XGQA 3KPRA 4JQIL 5KTEH 1BFOA 1I9JL 3GSOB 3BHBB 5DUMH 3QDGB 1AJ7L 1S9YA 2HFFA 3P77B 4NP4H 4NOFA 4MJ2A 3QIWB 2CR3A 1K6QL 5ADOH 1J87A 3LKQB 1AGEB 1GZQA 4KUCF 1CTNA 4FQXD 2F54B 2H6PA 3HRPA 5CIPA 1TPXB 4AENA 4ZDHA 2X70B 4HWZB 3F6IA 1FSKC 1FVCB 2XICA 4NQDB 2FO4A 3PE9A 5J8OA 4KY1L 4JO2H 2CIKB 1IT9L 4M48H 3IRZA 5D7KE 4PJFA 5ADOL 1RZKH 1T1WA 4KJWD 4A6YB 4WV1C 5EOQL 2PW1B 4YHIA 5KSBE 2AJVH 1HHHA 1CICC 4A6YA 4HWBL 3JSSA 1WAAA 4PJ7F 3B2VH 1UZ8A 3QCUL 1SHMA 3AAZA 5T3ZD 2P5WA 2FL5A 1T2JA 1PKOA 3MSPA 1YC7A 4WI2A 3W11C 5IP4A 2EYSB 2DQJL 5F8RC 3V7MA 5LWYL 1S7QB 1EUTA 1X44A 2X4QA 2V2TB 3ZKMC 3ARDC 1QYGH 1RJZA 4BZ1L 3MRDB 2BP3A 2W38A 3QIUD 1MCJA 4NJ9L 1A8JH 1QFPA 4OBSA 4U0RB 3JWOL 5GRVK 8FABB 3GM8A 1Z9MA 4X7FC 3T3ME 3TPUB 4UNVA 2NW2A 4HUKB 3REWA 3OKEB 4XPTL 2IANA 3DUSB 4R7NA 2FZ3A 4OFKA 4JM4H 5F9WB 2XQYK 2XT1B 4JFXA 4I77H 4OGYH 4UIKH 5D7IA 4F7MA 2UZXB 1M7DA 2XN9E 3WLWD 4P2RB 3SDCB 3W81A 3U46B 4D9LL 1X5LA 1QLRB 1UKSA 4L8SA 3QFJB 3QUZD 4AMKL 4QHKJ 2X89A 4O4YH 3QXTA 2HTLD 1HQRA 1R5VA 5JOPE 2HJKB 3I75B 2R4RH 4G3YL 3TLRA 1OB1B 4HAFA 32C2A 3BRGC 2DICA 2EDEA 3W39A 1V3MA 2JIXB 3ZSTA 2MHAA 4W6YB 3IFLL 5K9JL 4YDJB 4X98B 2JIXA 1CT8B 5LXGH 4PRIE 1CG9B 5MEPA 4NT6B 5JIKA 5C6TL 1J12A 4JRXA 4JR9H 5I2IB 1ADQA 1A7BA 4WENB 4DGIL 5F6HI 4U2ZA 4NZUL 3MC0A 5HVGB 3L9RB 4U31A 1ZWIA 5JQHC 1KCUH 4PG2C 1FQ9C 3TN0B 2EO9A 4P23A 3FTGA 1NC2B 2IBZY 1I8KB 5KVFL 2OJZL 4XC3L 4XMKL 4OLYH 5EORL 4PJFF 4F57H 5D7IE 5B38G 3QNYB 5E00B 1N0LA 3MGOB 2O93L 4PJBE 5BQ7B 5E00A 1NLDL 5E0QA 2Y7QA 2V9RA 4JO4H 2OL3A 4GAGH 1WFNA 1C08A 1WK0A 2OL3B 1T2QL 4KROD 5MEQB 4G8GB 1XR9B 1F4WH 2R0ZH 3SGKA 5AZ2L 5GRZA 4EDWL 5BZWA 4FMKA 3OKKA 3L3IA 3VE0A 5T1LA 4WTZA 25C8L 3BN9D 1IKFH 2VXVL 1GGBH 1IMHC 1A22B 1YNKH 1I75A 3DI2B 5LGKA 1Q1JL 5CD3B 3BYTA 1KC5H 4FRWA 1K9TA 3MGTA 4W4OA 2YUZA 4MMXC 1MF2H 1G1CA 2ZUWA 4F58H 4NRXB 4RMVA 4GBXB 5E5RB 5HY9B 4KK5D 4P2QE 2VDLH 2VNCA 3SKMA 4XZUA 3VWJD 4HH8A 5C0BB 1U8QA 2E6QA 4M1CC 5IQ7L 2VMFA 3TIDA 4I5BA 4HV8B 3S3JA 1IBGL 4HGWA 2V2WB 1NJ9A 1NLBH 5D7SL 4YPGA 4NKDB 3HG1A 5IFHL 1MFDH 4P23C 3HPJA 5FM5O 5L8JB 3SOBL 4HJGB 4Z7NF 4JM2F 2A6KA 2VXSL 3C5SA 2A6KB 4KKLD 2J6EA 5JQ6H 1KB5B 3MA9L 5C0BE 4BUHA 1ZVYA 5CJXC 1MWAH 4KKAC 4MGXA 5FDYA 5HHQA 2CDGB 4JY5H 5E2TL 3B9KB 4NKIL 2NLJB 1PEZA 5M7QA 2CDGA 2Z0BA 2YA1A 1NAMH 4WUKL 4L8DA 3RDTA 1OTTD 1HDMA 3MMEB 4RFNB 5E1AB 1RIHH 3QUYC 5B8CC 2H2SD 5I6XC 4Y5VA 5I1KH 3C5ZD 4JGMA 1I7TB 5E6YA 2E27H 1FO0B 2AJ3B 5DRNB 4Y4HD 3IYLW 3K8MA 1HI6B 1G7IA 2DJUA 3SKNA 2WQRA 2X4OA 4M5YL 2GUOA 2XXCB 2R4SL 4L4VD 5KN5A 5C0CE 5FKPA 4QYOA 3RY5A 1HINH 2QJDA 2IQAB 1INQA 4PBXA 2ARJB 1ZLWK 4XVUC 1T2QH 2YD1A 4HIIA 2J8HA 5FEBA 1J0ZA 2P4AB 2ZCKH 2HJLB 1WIOA 1CFSB 5F1IB 3DOSA 2QL1A 1YYLL 2GTZB 3EDEA 1FZOA 3EGSA 3IB4A 5B39A 1JL8A 3O4LB 3F8UB 5JO5A 3CK0L 4DKAA 1I1AA 1JUFA 4XCYA 4XNQB 5FGCE 1CFVL 1N4XH 3LHPL 4N8VB 3HNSL 4PJEB 4EXPX 3FO0H 1IC4L 5J6GA 2FB4L 4BFGA 4FQPA 4MAYA 3GKZA 2BNRB 5GRJL 4TSBH 3A6BL 1ZGLM 1KCSL 1C1EH 5L88L 4PJCA 4RMSA 3MRLA 2HRLA 1JPSH 4TOYH 1I1FA 1YNTB 3UDWA 2G9HB 3OXRB 4LAQL 4PJCB 2X4RA 4R2GD 5L2KA 4IIQA 4U4BA 1T0NA 5IHZA 2X4RB 1JGDA 1ES0B 2PW2A 5KSBB 5F71A 3R8BB 5KVFH 3EFDH 4JPIB 4Z7QF 4CU6A 3TO4C 2R1XB 3ISWA 2HKHL 3G5VA 3CD4A 3SPVB 4P4KD 1FIEA 5KG9B 1PG7H 3UTSA 3BE1L 5IV2A 3BN9C 3VJ6B 4M6NH 1P4BH 1TMCB 2VSCA 4OGYL 3ZTJH 3UJTL 5FO8B 2VISB 5BRZE 3D39D 3HE6A 1RJLB 3S35H 3HAEA 5JR1H 4MQSB 1VDGA 3U4EB 4J2XA 1IC7L 3HFML 1DE4A 4MAYD 2YWZA 5ANMA 3R0NA 2ZJSL 4U1GB 3QZWB 2O5ZH 5D6CA 5DJYB 1N2RA 2VDNL 2NR6D 4MNGE 1IM9A 4F9PA 4JO3L 1MCWM 4U33A 1NL0L 3VFRA 4XNXL 4NPYB 1I85C 5T1MA 3EJYC 3H9YA 4X80H 3K80A 5IBLD 1XIWD 3S35X 3TPUA 1S7VA 5GGVL 1JZ4A 3O3AA 4N0FB 3H6JA 3QCUH 3CFKB 4EUPA 2Y06H 4NKMB 5BVJA 5IM7B 4N0FA 5L7XH 3GMOA 3V0VA 1M7DB 5FKAA 4EUPB 1WAAE 5IMOB 1ZAGA 1UQSA 1A3LH 2BX5A 1CLYH 4XTRC 3TO2A 3MREB 1MI5A 1P69B 3TZVB 4X4MA 1I7ZB 1ZTXL 4IS6A 4MWFB 2FB4H 1BZ7A 3FO0L 4LPVA 3X12B 1D6VH 3MZGB 4LNRB 2ZOKA 4ZAKA 2ADGA 4QNPF 5C0AE 3OKNB 2PO6B 2NY7H 3Q5TA 4GH7B 4QRUB 4QXUH 3WUWG 2RGSA 4MCZB 1F3DH 5F89B 4X99A 2EDQA 1WT5C 5E2JA 2MNUA 5CBEB 1U8IB 1A1OA 2QQQA 5DVKA 4YIQA 4ZSOE 1DQDH 1UCBH 2XQYG 3LS5H 2NTFA 4GJTB 1AQKH 4OV6F 3D3VE 1HOCB 1MELA 4LCUA 5CEZH 2NY2C 4NC0B 4PLKD 2R4SH 3PGFL 4LFHG 5IF0A 1I1RA 1ZANL 1ZVSB 2NTSP 2YBRB 4WWID 4RAUB 5HDQH 3RL2A 4GXUN 5KVGH 1T03L 2WBJD 4K8RC 3MRCB 4GAJL 5IW6A 4Q6IC 3ZHLA 5ESVB 4MVBD 2EDKA 1NCBH 2CIKA 3VXRB 3BP7A 1T03H 5IB4A 4LCWD 3BWUC 4FQJL 4WHTB 4V1DA 3KAAA 3V6BR 5AG8A 1CWVA 1M7IB 4BSWB 5JDSB 4BSVB 3VRLE 1UWGH 4JY6B 1NSNH 3QFDA 2JF1A 3QI9C 5HD8D 4CU7A 2XTJD 3IFPA 1JK8A 5TE7L 2CXKA 4X5WB 1J05A 4X5WA 3KYOB 4NRXA 5HY9A 2DD8H 3O6MH 3FFDB 4WO4A 4ELKB 2VDPH 4G43A 4XAWL 2DN7A 3SDAC 4DGVH 2VL4A 3MOQA 3X3GL 4DUXA 1W0VB 1BBJA 7FABL 1HXMB 1FLTX 2VDLL 4XI5D 4QRQA 5FYJU 2SEBB 4JFZH 5DFTA 3RI5K 2B1HH 4H20L 4JFYA 2ZCLL 4HFWA 2ADJA 5T3ZE 2AW2A 2V5TA 3RPKA 4D9QE 1UM6L 5T3XL 1U3HA 2P1YA 1QR1A 3KPQB 4PTUA 3KPLB 3FT3B 2AJXH 1KB5A 3C8HA 1DEEB 4OZIF 1FPTL 3FQXA 3I75A 1JGEA 2OJEA 5I18H 1XCTB 2F53D 3CIQA 3QI9B 1SYSB 4PB0H 4PJGE 5SWSE 2IQ9L 2CUIA 1KIRB 3WXVL 4FTVB 1OSPL 1V3KA 4ONGH 3GB7A 1JTOA 1MIEH 5FYLH 5IK3A 3OAUH 4U1JB 3RGVA 5CGYD 3ARPA 1RUQH 2ICEA 3RU8L 3MRRA 2AKRB 4K2UH 5F21B 1NL0H 3ECBB 1BIHA 5I1CL 5DHVB 1NGWB 4PTTA 2CLRA 4ODUB 4NZTH 1NBQA 5DWUH 2VH5H 1X4XA 3UZEA 3PL6C 2R8SL 3HAEG 4PY7A 3QP3A 2C3HA 3SE8H 3PP4L 1U3ZA 2FO1A 3D25B 3ZDXE 1FLRH 1TPXC 1CFSA 1RFDH 1AY1L 3NCCB 4LGPB 3PWLA 3PDGA 3UTSE 1KTLA 2HFEB 2LVCA 3WIFB 4MCYA 4UOW1 4ODWA 3RAJH 2QQNL 5HI5C 4JPWH 3SKJL 3TBSA 2D31A 4OZFA 2DQFA 4AT6A 1CICB 1TCRB 1MJ7L 3K0WA 1XF3B 3DVNA 4G8GA 5HHPA 1M7XA 1UB6A 3VFWB 3PV6B 1WC7B 2DQEL 1QBLL 3CSGA 3FRPA 4P2YA 4K3EH 5A16A 5ESAB 1JTTA 5A16B 1MIMH 2ENYA 3A67H 2AK4D 3WYRA 1B0RB 2PXYA 4MNQB 1R5WA 1X4ZA 1LEGA 1SBSL 3TYGL 1I7RA 2A9ML 5TE7H 1AC6A 5GS2D 4MQXD 4QKXB 1T5XA 5IB1B 3FQTA 5ABDE 2BVQB 4XVSL 2B4CC 3VWJB 3BP6A 1BIIB 4XWOD 3HNSH 4MA1C 2OSLB 3VFUB 2LV4A 4R0LA 4HWEL 1BHGA 4PGBA 3EYOB 4NSKB 3S3SA 2CGRH 1WWAX 1EMTH 5FM4A 3FOMA 4YFDB 5CKGA 5DA0B 4P9ML 3ZMRA 3C2AH 1EHAA 3GBLA 1PYWB 4N5UA 4PJCE 3CFEB 2I24N 3T2PA 1I7UB 4GW5B 3BQUC 5JHDD 1IGCL 1R3LA 1SEBB 4PD4K 5AYUL 4H26A 4FQ2H 4CRPA 1MRFL 2EYRA 4LLMB 5HGHA 4XAKE 1MQKH 2F5BH 5FGCB 5H35A 4NHUA 1RULH 2BJML 2AXGB 1HDMB 2FJHB 4P5MB 2XG4A 3ROOA 1FO0A 2ORBH 4K23L 4NQED 4ZPTB 3MYZA 4QRPB 4HKJB 2GAZA 4IOIB 5F93C 3DARA 4QRPA 2ARWA 4IIQC 3CSPA 1CTOA 2OL3H 4IRJB 3WNLA 4UTAH 1RHHA 1EVUA 3DBXB 1T4KA 4MAUL 4S10A 3X13A 2GTWA 2P46B 5FUCC 2JELL 4G8FB 3L7FB 5CJBA 1YEKL 3TJEH 1DVFD 3NCYS 3BQUB 1XCQA 4XPGL 1S7RB 2DM7A 4G9FD 4WNQA 3ARGA 1K5NA 4HUXA 3CVHB 25C8H 3C8KB 4YHKL 3CVHA 1H5BB 3UPRB 1FZMB 3BD4A 4GW1A 2D2OA 2UVFA 4J23A 1FZMA 3GI9H 1F11B 4MD4B 4PRPE 5EOCH 2ED9A 4IM8A 4LLVA 3VFTA 3WNNA 1HH9A 5IQ9A 1ZV5A 3G5ZA 3RVWC 1YEKH 3LEXA 2QQKL 5DD0L 2X1OA 4MXWL 2MHAB 3VMOA 1YNTA 2BRRL 2ESVB 4DUWA 4P2OC 4FXKB 4IIQB 1IC5H 5DRWB 3NN8A 3QXDB 4IRJC 3BYYA 3KPSD 2J3SA 2ID5A 3WEXA 3GMLB 4FFWC 4UU9A 4FG6D 5IB3B 3RUGF 4R26L 3K4AA 5CSZB 1EGJL 4QHLB 43C9A 2W0LA 3MNWB 4I0KA 4GAYA 1U8MA 2XKNB 1NCWL 4Z77B 1FVCA 43C9B 4GAYB 5DMYA 4P23B 3VXRA 1KFAL 4OI8A 3NH7H 1ZSDB 1BQLH 1JPST 1YZZA 2ENSA 2DI7A 3BIKA 3G5YB 3MBEC 4GXVL 3MO1A 1ZA6B 3WN5A 4FQCH 5HJ3A 3VGEA 4PJ9A 1V8HA 5IW3A 1MJ8L 3MGOA 4G8IB 5EC2B 1QEWB 2I9TA 1R24A 3HUJF 1HILB 2DQCL 2RB8A 4O58L 4WW2C 3IAQA 3G04A 1KIPA 4M8QB 3O41A 3OKOB 1BBDH 5L2JB 4IRSC 1NBYB 1NGXA 1PAMA 1C8PA 4WI4A 1OTSD 3RGVC 4E9LA 4JHBA 3C6SB 3P0VH 3AREB 2UVEA 5ERWA 1LK2A 1IVLA 5GS1C 3ARRA 4P2OB 5DSCA 3GMMB 3UC0H 2AABH 3OAYH 4OLEA 1D5IH 1YEGL 1OF2A 5CIPH 4PY8I 4OKDA 3CU1A 4Y0GA 5DFVC 2YA2A 5BRZD 3FQNB 3O45A 3IJYB 5GJTL 3K1KC 4V1DE 4U2YA 5I8KH 3N50A 1CXLA 3MUGA 1IM3B 3T0BA 4RFEB 1I9EA 3EDFA 5GSVA 3PXJA 2IALA 2YR3A 1PLGH 1MI5B 2DIJA 3QPQC 4X6CE 5HI3D 3TFKD 4G6JH 5KVEL 1A14H 4QOKD 1O7SA 4FTVD 1AR1D 4MSWA 4DVRL 1J0JA 3QJFB 3AMLA 2JKXA 4OD1H 2BNQE 4L9LA 4MSWB 1AKJB 1OCWL 3MV01 3GB7B 3MRGA 2ZP0T 3HI1A 2CUHA 1AKJA 1MHPH 3PIQB 2Y07H 1CGSH 1WFTA 5T33L 1W8OA 5C2UB 1U41A 2IPKB 1EX0A 2FGWL 3HPJB 4ZTOH 4KHXL 5HDLA 2CKNA 1V7ML 3I50H 3NABL 3UCRA 2GT9B 3UTZB 2CD0A 2GHWB 4ZUTB 5K93A 4IBLT 2YPLE 2KUTA 4B7IA 1KC5L 2P7TB 4KV5E 3BKCL 1BJ8A 5CBEA 1W8NA 4YUEH 3H9SB 3WFHB 6CGTA 2VZUA 1MUJA 1U8PA 4EI6B 1ZHKB 3O6FA 1OGAD 1NUNB 2ERJC 1UB5B 3MMEA 3QUXD 4KUZL 2ZUYA 4Q9QH 4WGWB 4ALAH 3LMJH 1YUHB 5CEZD 4PLKC 5DQJA 4HKBB 5DUPH 3REVB 1MH5A 3NFSL 4PGEB 2BVPA 4TTGA 4JRXD 3NGBC 4PGEA 3ZO0A 3HI5L 3D9AH 4R4BA 3I9GH 4L3ED 5DK0A 4ETQA 1FYTD 4KUCD 4WW1B 2BHUA 2V7HA 4BM7A 1OLLA 4FQIL 4P0DA 1R5IA 4XRCB 2IQAA 4R4FH 5MEQA 5ISZB 2GJ6E 1XR9A 5GJSH 2EH8L 2IBGA 3AY4C 4M7LT 3VFWA 5IQ7H 2CK0L 1CDUA 4YWGL 1PFCA 5D71H 5T1LB 1DBJL 5K9QI 3HG1D 3TF7C 5D9SA 3X14A 5TDNA 3MV8D 3INUH 3DYMA 1NDGB 5E7FA 3MACH 4F9PC 4PR5A 2R2BB 1I1AB 1NDGA 4S1DC 3TYFA 4F7EB 5FYJE 2ERJB 1YNKL 1H3PH 2O5XL 3QQ3B 4Y5VC 3U1SL 1BBJB 4NN5B 1XGQB 2BSSA 4RBPH 2O5ZL 5F7NC 4KXZI 1I8LA 1MCHA 4FMFA 4RQQB 3NGBB 1LE5B 4HV8A 4OCXH 2LU4A 5DJZB 3CLEH 2IH3B 4NCC2 3GSNA 5DR5H 4Z7UE 2ICWA 4KRPB 3U0PB 2IH3A 1FFPB 5GPRA 3LKQA 1YNLH 3SGKC 2XZAL 1LO0L 4MJIA 3G5VB 3ESUF 3GIVB 3FT3A 3BGFC 5JW4M 1VFAA 3W0WE 5IMKB 4NQDA 1K4DA 4YXHL 3ARWA 1MCNA 2ZG3A 2H1PH 3EYSH 4U1SA 5TQ0H 4DKDC 3MXWL 4UNTA 1XCTA 2PO6C 2V7NB 2O5YH 4ZO6A 5EZJB 5HDBE 4NJ9H 3VXMA 3S34H 2W9EH 1RD6A 5E2VH 4NZJA 4WI5A 5IK3B 3U7YL 1OSZB 4U1JA 3EJZC 4Z7OE 1U95A 4TPRL 1U3HD 2YRPA 3CX5K 1YA5A 2F58L 4RMRA 1FRGH 2ARJQ 1NGWA 3MRBA 4LCCC 3NTCL 5EUOF 3FN0L 3MRBB 4R3SB 4IRJA 1HN1A 1T20B 4HIXL 4X8XA 5HDQL 1KFAH 5K9OB 2PN5A 3QISA 4Z7WF 1XGUB 3VFRB 2A6JA 2PUQT 3WE6A 2O26U 2ZUTA 3GUTB 5GGRA 1JJUA 4KPHH 4NHCL 8FABA 1S7WB 3HN3A 3BGMB 4C83A 3KS0J 1VGKA 5DHVH 3Q6FB 2D9CA 1RZIB 4K7PL 5HYSB 1B2WL 3CDCA 5F88A 5TDOB 5IB2B 1YEFH 2DIBA 1P4LB 1RZ7L 1AGBB 2FECI 4CL7A 1MAMH 1UWEL 5TDOA 5IB2A 3HE7C 4F3FB 4PRNB 1CICA 3QEUB 5LKNA 3U46A 1L7TH 4HPYH 4PJEA 4PB9L 3GMQA 3IFNH 4PRDA 4PRHB 4BKLB 4YHYC 3IKKA 3O4LE 5EUOA 1TXKA 3U36A 4X4XB 1RJCA 3WMSA 4HC1L 4OFYD 3MX0A 1UJ3A 3QEGL 5L6YL 4LCCB 2CQVA 3CFBB 3PNWB 4OFYA 2EIDA 3WJLA 3T1FA 4YBQD 5FOBB 4J6RH 2ADGB 5IG7B 4YUEL 3SDAB 5IHZB 4K9EH 1R5WB 4J3OC 1Q9KA 3W5NA 1XGTB 2PW2B 2OXGA 3O6FC 2BNQB 2MCG1 1XGTA 2J6EH 3HC0B 3VD9A 1BIIA 4ELMF 5KVDH 2NXZD 1FJ1A 2CRMA 2EXYC 5TFSH 1HNFA 2DLGA 1IARB 3O6KH 4HHAB 2R0WH 3HTLX 1NCAL 1CXKA 2HP4A 3VI3F 1MFCL 2VDKL 1GVIA 5FO9A 4YHML 1XF1A 4YGAB 9CGTA 3RVVD 5BOZG 1ZVSA 2C9AA 1NAKH 4P5TA 3QNYA 1QG3A 3WHE1 1GXEA 3C08L 4JVWA 1FNFA 4QXGL 3MRMA 4ORZC 4RWYH 3UTOA 1FCCA 5F1NB 3PDDA 5I1GH 5DLML 3ME0A 5F9OL 3TBVA 3VGAB 3P11L 4UAOB 5SWZE 2FEDC 4LDOB 1BOGA 4NN7B 4F7TB 1TZHB 2J1KA 3S88H 4MDIB 3N1PC 4F2MB 3BPLC 2H32B 3O11B 5FAAA 1J8KA 3QHTC 3O11A 3SDDA 3WHXB 1QLFB 3DXAD 1QFHA 4DUVA 1CDCA 1UG9A 4D3CL 5L9DL 4F58L 3SDDD 4IHOB 1TZIB 3DGCR 1M7IA 5JDSA 3PF2A 2DLFL 3I2CH 1T7YA 3STBA 4NN6C 2J6EL 2GSIB 3D2UB 1KEMH 2MQ3A 4G6FB 1FIGH 5IM7A 4U1KB 4PGCA 5DMJB 5GZNC 1XGRA 2CUMA 2P5ED 1BQUA 1T7VA 4L3CA 2I07A 1W0YT 5IFAL 4WEBL 1C12B 2P8LB 4G43B 1DQLL 4O58H 5EIQA 4FABL 3TZVA 3BSZH 4HKZA 1W0VA 3X13B 5ILTH 2VXUH 1AQKL 2C1OA 3H0TB 3RHWF 4P2QD 5E1HB 5DD5L 1AGFB 4GQ9L 4OFIA 1C1EL 5L88H 1VCAA 2CMRH 3GSWA 3MFFB 2PF6A 4H0IA 4MLSA 2OMBA 5BO1H 3MNVA 4HCRH 3FB8B 5D96C 1ZK9A 4X4ZA 4PJ5E 3RTQA 3LSOB 2FEEI 2XI9A 5IJKA 3UDWC 5DEFB 4P5TC 4OIBA 1JHKH 2VL5B 3QA3A 3SQBA 4M02A 1KCLA 1KELL 4M9PA 2WNGA 4EI6A 5E4EC 4XBPB 2RCSL 3QI9A 4OCYH 4PV9A 3UXFA 1J8HE 1FE8L 1KYOK 5GIRB 3CFCL 2Q86B 3E6FB 3TVMC 1S7XB 3MACL 2DWEA 3E0GA 3HC4L 3NN8B 5EU7E 4MA1B 3QNZA 3QUKA 2B2XH 4EN3A 3QEQD 1AXIB 2UZIL 2P24B 2CRIA 3IVKB 1UXWB 4H0GA 2XWJA 1JP5A 4PRPB 3DNKA 3WLBB 4P2QA 5HSFA 5KN5B 3SE8L 5ALCH 5IVXF 3QQ4B 1N8ZA 3BIKB 4X7SH 4AEHH 2FLRT 3W9EA 3LKPB 4YX2L 3WN5B 5C0CD 4L4TD 4C4KO 4D9LH 4O9HH 1ZXQA 5D96B 3THML 4EUPH 1IGJA 1P1ZA 4XXCC 1QBBA 2YD4A 4XPBH 3CFDB 4JFDD 1JV5A 1P1ZB 3OAUL 4L5FL 4GS7C 2E8YA 4MS8D 1GGYA 4G8EA 4NWUH 5A2IH 4KI5C 3T0AA 3LZFH 4Q9QL 4JN2B 4MJ6B 4NO3B 4X7DC 2AQ1A 2PTVA 3OL2A 1BX2A 1GGUA 3OX8B 5J6GB 1J1PL 2FX8L 3MLSH 1P4IL 3P4NA 1WC7A 4G9FA 2HN7B 4NO2B 5D1XD 3UO1L 1OF2B 5CUSL 1I4FB 4P57A 2FR4B 1RZ8A 1G1YA 2VLKE 3F12A 4QNPE 5C0DB 5E70A 4U6HB 1ZHBA 3D0LB 3D2UD 1FFPA 4X9IA 2Y1VA 1XF4B 1ZHBB 1MNUL 2JE8A 2IBBA 1HEZB 5E2UH 4QWWD 2VLLB 2W9LA 4JFZL 1HEZA 2VJXA 3V5HA 2R1XA 1V05A 4DVRH 5EC1B 5ELIA 5GGTA 1EHNA 2OSLA 3GHBL 1RUMH 2BVUA 4HF5L 2K1MA 2W60B 5I1JH 3QO0B 4YXLH 4PGBB 1QVOB 3EYOA 3UO1H 1GGCH 1EDQA 4K7PH 3VFGL 3VFOB 4AG4L 1I3UA 4NCC1 3T8XA 3O8XB 5DJXB 2DI8A 2P5WD 3LQZB 4NRZB 2EDBA 4ZTPL 1W72H 5DC9B 3KR3L 1CGWA 3UTTA 3ZDZF 3SDCD 3W0WB 4PB9H 5JR1L 3D39E 1GGCL 4N9GA 1K2DA 1HCFX 5EUKB 3C09B 1JGVH 1G7PB 3DGGB 4IMLA 3B5GA 4P4KC 1JGLL 1CFTA 1QSZA 4RSVA 4NPYA 2X4NA 4NHUB 2G2RA 4F7CA 5DQDL 4ERSH 4AEHL 3V9FA 4P5MA 5D7JD 5EUOE 1RU9L 1VEMA 3DUUA 5L2KD 5KVGL 2G60L 4OIIH 3DSNA 1LEIA 3DYOA 2VABB 3RWGB 4HC1A 2W0FA 3RX5A 4NM8H 5ALBH 5IHUL 4Z7NE 3PGCB 4TRPL 5JXAL 4CVXB 1TCRA 1SVCP 4PJ8B 3MREA 1Y6MR 1FG9C 5HHPB 4EI5B 5IHBA 3GO1H 4MD5A 1CZ8H 1NMCB 3PWPD 3ARFD 3IDYC 4MD5B 2OS7A 1V7NH 3L3KB 1SY6L 3DETC 4GG8B 4NO5A 1NBZB 2FEDD 4QTHA 2CK2A 1BZQK 2H3NB 5GS1B 3EDKA 5DWUL 5I16A 1JZ7A 4MHHI 3CK0H 1E6JH 2W65B 1A7NH 5JHDA 4OD3H 4XH2A 1UA6H 4F7EA 4MB5A 4FFYL 4OJFL 4Y2OA 2NY3C 4KTEH 4KTDH 1FVDA 4AEFA 3WDJA 5EU6D 4MXWH 4H25A 3BZEA 4LCWB 3KYNA 4LSUH 2NY6D 4IOSD 2ADIB 4RGND 3VXQB 4YE4L 2D4DA 5DHYA 1BFOB 1JNLL 3ARDA 3LEXB 3SJVD 4BZYA 3IJSA 3B8SA 1NUFA 1T04A 2Z92B 4XMPH 3ES6B 4JB9H 2IMNA 2JB5H 3D0VA 5J9PB 4PP1D 4U6XB 4JQVA 3KPPB 5CMAB 3IU3A 1J88A 1VERA 2LTQB 2YD7A 1ZS8B 3L7EB 5BVPL 3KJ6H 5HXMA 5IW6B 1M6OB 3NIDE 5C09B 3CNKA 5DJ6B 1D5ZB 3MV7E 1KN2H 4PJFB 3TBTB 2NY1D 3TH4T 4LLMA 2VDNH 1F90H 5ICZA 2PYEE 1E4KA 2GCYA 1D5BB 4F37F 3PHOA 1DBJH 5E8NB 1U92A 1Z2KA 1QEWA 4BSVA 4ZMAT 1CE1H 5FGBA 4DGVL 4HBCH 4DKFH 1TZGL 4LCWE 2NY3B 4PJHF 4JKLA 3UJJH 4KAQL 4LASL 1UJ3C 4JO4L 1NQBA 3BEWA 5J06A 3QRGL 4IDJL 3WXWL 5DLMH 1YN7A 2JJWA 4RISH 2X4TB 2ZUXA 3C6SA 3Q1SL 4PGZA 1NGPH 1OLZA 4JG0H 1DBAH 2APTA 4GKNB 2VWEC 4NO0B 2WBJA 4P2OA 3FQWB 3L95B 3DBXA 3RY4A 2FECL 3L3JA 4OCMC 3IGAB 1G6RA 3HLAA 5DQ9B 1I9JH 3PQYA 1T80A 2O61B 1G6RB 2MKWA 2FNBA 3L7FA 1S7WA 2IANB 3DUSA 1KG0B 1F4YH 3V7AG 1EUUA 4JM2A 1JHTB 2EH7H 3LRSA 4JM2B 4Y16A 4XWGL 2CO6B 4BK5A 2NW3B 3T0EA 4QRTA 5FHBH 3UP1A 1QO3A 4ODVL 3VCLA 2ZUVA 2LE9A 3MOAL 3GJEB 4NQCB 2FGWH 4I13B 4LRIA 1CXHA 1UJ3B 1FH5H 1FYTB 2CKBL 2MPAL 3PWVA 2IG2H 4M4PA 3T1FB 4NT6A 2EDHA 3MV9D 5TH2A 4NC1C 4NN5C 4XCNB 4HCRL 1EJ6A 2Z35A 2XN9D 2GJZB 3RWIB 3C2SA 2WINB 3IFOA 4L4VA 2HVJB 2Y5TB 2YEZA 3NCEB 4KMQA 2HVJA 2Y5TA 3BUYB 4S2SA 3NIDF 3GSVA 3WFHA 3RJDA 5MENA 3BRFA 3LDBB 1NUDA 1UC6A 2ESVE 3GNML 3LVEA 4QF1B 1MFAL 1FNEA 4AG4H 3SE4C 2UWEA 1CDIA 2HT2C 5C0AD 2CSPA 5DJCA 4HDIB 4S1SH 2D03L 1TVHA 1E28A 5EU4B 3RUGA 1I1AD 2DOCA 4NQCD 4AM0B 4G8EB 3OF6A 1YEIH 4DGYL 5GS0L 3QG7L 4AM0A 1FAIH 5BZDB 4NQTA 2AS5M 5D7LB 4L9LC 4NO3A 1FORL 3MCLL 3QQNA 1LO4L 4RA0C 4C55A 5J12C 1HYSC 4XVTH 3FO2A 2YD9A 5JQ6L 2OZ4A 3DVFA 4YK4C 3G08A 1CLZH 4M48L 5SV3A 2V9TA 1CFNB 1SJHA 4ONFL 5I1CH 4LU5L 5DGQA 4Z9KB 4PJBA 3SDXA 1Q9LA 2IAND 3T2QA 4WU7B 5BRZB 3HR5B 1T3FA 2JCCA 2ZJSH 4KAQH 5LQBH 1N3NA 3FMGH 3LPGA 4ACPA 3QRGH 3RKPA 3LDBC 5CZVL 3HMXA 4XMLL 3B4NA 1DR9A 3TCLB 4QRPE 2OP4H 4PV8B 5HYJE 5CEXA 3QHFL 3CC5B 2D7TL 3ARUA 2YPLA 3MLUL 3O6FD 4BH8B 2FX9H 4M6NL 1LE5A 1A6AB 3V6FB 2APFA 1KN2L 4S1QH 2D9QB 3HS0B 2ZCLH 5DZNA 5HYQA 5FCUH 3BPCA 5DJ8B 3AU1B 1QKZL 1MCIA 3JXAA 4FZEH 2BNRE 4QY8A 3BD3A 3MODH 1BM3L 2VZVA 1CDYA 3B9KD 4HEME 5HHMD 2QADB 4K3GA 3B9KA 1DQTA 3BH9B 3FB6B 4YWGH 2HT2D 5HHVL 3CAFA 2BOCA 3AM8A 3DO7B 1OPGL 3LN5A 2DD8L 2RFXA 3O6ML 2C1PA 2WP3T 4DCQB 4YJZL 3RL1A 3ROOB 5B39G 4C56E 3RL1B 4FFYH 5GGUA 2BVOA 4OBRA 4PD4J 3C60B 1VPOH 4D0DB 5MEOB 1DFBL 5CJ5A 2GFBA 5DK0B 1RUAH 4X6BA 2DF3A 4G80B 4E41D 4G7YL 3VXSB 5HGAA 1JPFB 1MEXL 1H3PL 3CFJA 4XP5H 3MJ7B 3ORJA 1YQVL 4Q6YA 2C5DC 2NX5D 4I18C 3CFJB 4XP9L 3VXSD 4RGOL 3BVNB 4O02L 5EIIA 1JFQL 2GEEA 4R7NB 4YHNB 1EIBA 4DEPC 4CNIA 4RWHA 1S7RA 4FZ8L 5E03A 4X4YA 1G9NH 2APVA 4CAGA 3I6KB 4TSCH 2VLJD 4J3SA 1AGBA 3CZJA 1BJ1H 1MRFH 3GMRB 3M8OH 4AQOA 3QEQE 1UXSB 3GKWH 5KAQG 4ENED 35C8H 3CMOL 1PJ9A 2VLRA 4C57C 2VR9A 1RU9H 4PJDB 4H25B 3OGOE 1LO5A 2O5YL 4Z0XA 4G9FB 4X6DA 2X4SA 3GBML 4O51A 4WUKH 1QBAA 4RMUA 3IJSB 1RZ8B 5L2KB 3VXNA 3DRQB 5DJZA 2VYRE 3NAAH 3VXNB 4E42B 2HKFL 3C6LB 5KSBA 1L7IH 3H3PL 2B5IC 1A7QL 3U9PH 5IHLB 3QZWG 3WEXB 3QULB 4I4WA 4RAVA 4UU9B 5IB3A 4LCYA 4ZFOA 1A6TB 4QHLA 1LILA 1P2CA 2GY7B 3BKJH 5MI0C 5DJDA 4U1SB 4Y19B 1ACYH 2GCYB 2FATL 1DP0A 1JE6A 1N5AA 2AEPL 1U92B 4P2CG 5IEHB 2YD5A 4HPOH 1EK3A 1FLRL 4NFCA 4HS6A 3TJHD 3BEWB 4HH9B 1YEHL 2BFVL 2B7DT 1KB5H 4HH9A 4YHZH 1T0PB 2X4TA 3TVMB 3GGWB 2Z93A 4ZNCD 2EDRA 4XNXH 3MA7A 2KBGA 3QYCA 5BZWB 1WBXA 1QSFA 1M71B 1E4WH 5ID0B 5EZIH 1RZ7H 1QLFA 3Q1SH 3ZDYE 4PS4H 4IHOA 2B5IB 4PJHE 5TE6L 3GRWH 5FYKE 1Y6NR 3QEGH 4JGUA 5DS8B 4B5EA 1J0KA 2B0SH 3CFKA 5LBSL 1F4WL 3VXTB 1EO7A 3H3BC 4Z7WB 1AHWA 4D0BA 2BMKB 5D7IB 4F7MB 4Z7WA 5D2NA 2OR9H 3T0EB 1LVEA 4X7TA 2YMXH 3DV6B 3TO2B 1RUAL 3THMH 1DQQA 5CBAA 4WHYG 1PG7L 4PRHA 5F6IC 3IJHA 4M8VA 3JTSA 3QIUB 1TQCC 2C3VB 3VXUA 1DUZB 4GS7B 1VKXA 1SYVB 2ZUQC 4Y4FA 4NC2B 4OLWH 4YDJA 2XZCL 2WIMA 4XVJL 1AFVH 1BVZA 3MBEA 4C59B 5GS1A 3JTTB 1KN4H 3VXME 3QG7H 4APQC 1IAII 1UYWH 2W65A 4KKBD 5I2IA 4JREC 3UTZA 4Y4KB 4YHKH 4KHXH 3RWIA 4P5KB 4DZBB 4GG6E 3QDHA 4X9HA 4JVUA 4JN1H 1A4KA 2FATH 1VHPA 1FE8H 1QFWI 3NACL 1UM6H 3DX7B 4WWKB 1A4KB 1IAIL 5F3HA 2MQCA 4FA8A 3WLWC 1F00I 4HJJH 5E1AA 1PX4A 1JPTL 4PP1C 1T7ZA 3D3VB 1T04B 3DMMA 4NQSA 3QXAB 2D7QA 1J1OH 3BWAA 4BA8A 2EXWC 3DMMD 5F9AC 4DN4H 2R9HC 3Q0HA 4CKVX 3ZL4H 3OJ2C 3P9LA 1T1XB 5I66B 4HJJL 1YY8A 4PRHE 1TQCB 1DQMH 2IBZX 5D7LA 4OFVA 3WS3A 1Y6KR 2ZCKL 2ZCHL 1RIUH 1JZ6A 3ZKMD 2Y25A 3MLYH 1HSAB 4Z7UB 4ZO7A 5TGBA 1S8DA 2ZPKL 3FO2B 4GAJH 1C5CH 5I1DA 5JW4N 1K8IB 2J8OA 3BZFA 4X6EA 2HT4C 1WCBA 5D1ZD 1BFVL 3C09C 3CLFH 1ED3B 4HQQH 4LKCB 3MPCA 4CN1A 5JO5B 5CGTA 4K94C 4HUWA 3FQRA 4FQLL 1KCRL 5DD1L 4M7JH 3B9EA 2FLBT 2BSRB 1CK0L 4OQTA 3WUZA 2DIAA 2IF7A 1WEJH 3CC5A 4XNZC 4GW4A 3DHMA 5DEGA 1G7LB 1I3GL 5C0EB 2F5AL 2CGRL 2EE2A 5C09D 4Q0XL 1EAPA 1IGTA 1CVRA 5I75C 1DFBH 4YPGB 5D1QB 5I0ZA 2NQCA 3FT2B 3D0LA 4K3JL 4EI5C 5ISZE 2PCPB 4O2EA 4RGNE 3HZMA 2DTML 5GZND 2NW3A 4PJXF 4LASH 3IXTA 1OAUL 4LU5H 5FGSA 1QO3B 1BF8A 1BECA 4ZYKB 1AIFA 1XIWA 4KQ4L 5I1JL 3IXTB 4NQDE 3QA3B 3HB3C 3U4AA 2OJEB 3UMTA 1SVZA 2F54E 3MV11 3DETD 3JV4A 5I8EB 3T77B 2P45B 1HHIB 3GM0A 3P30H 2GK0B 1ADQH 1EEYB 1MLCA 2VC2H 2Y07L 1KGCE 4YXKL 1MHPL 3OHXB 1H15B 4Y16D 4EUPG 4WU5B 2FRGP 5CSGA 1ZHNA 3QUKB 5INDB 2V5SA 2DWDA 3OAZK 4JO3H 4UIMA 1BVKB 4R3SA 4J7RA 5FKPB 4YDLC 3HZKA 3EYFB 3K2UL 1AO7E 2IC2A 5I75B 2J88L 4JHZA 1G9MC 4NWUL 5CSBA 1YEEH 1ADQL 4LGRB 3RA7L 1Y0LA 4HPYL 1I1YA 4QRRB 5LG1A 1Y0LB 1U8LA 3BX7C 3GBNL 4NKMA 1NFKA 1VGKB 2QKIA 3CSBA 1LMKA 4UQ2A 3MCG1 5HYSA 5C0IB 1J5OH 5F9JB 1MI5E 5J1SC 4TUJA 3OAZH 5C07A 1B2WH 2DQEH 2GSGB 2E7CA 2QR0B 2F8XC 1KJ2L 3FONA 4PJCF 1T66C 3D6GA 5KW9H 4X0KB 1R3HB 3I3BA 5GQBA 2IQ9H 4NO2A 3MRLB 4LNRA 3L6FB 1KCUL 2DL2A 2E6JA 5JOPD 1RUKL 1UM4L 2XPGA 3W2DL 1JPSL 2I9LB 3C6LA 4TOYL 4YEEA 3UBXB 5SWQB 3QB7C 5A40E 3SDYL 1QSVA 5C0CB 4XH2B 1S9WA 3H9SE 3O6LL 5EPMB 3HI6L 5CJOH 4XPAH 1FFRA 1NCWH 3EOTH 5A1AA 1K4CA 5CLWA 4PFEA 1P7QD 4JM2C 5I73C 1YY9D 1VADA 1JGLH 4PP2B 4LLQA 4HGMA 3NPSB 2YBRA 1OQOA 4KK5C 5BS0B 1PQZB 4WUUB 5D7JA 5FYKU 1UFUA 1BD2D 3BDXA 4ZOEA 2COQA 1I7UA 1LO2H 4JJHA 4YC2C 4HIJB 3H2WA 1Q72L 5ANMB 3TVMA 5DVNA 2IG2L