5DI8A

Fc knob-hole heterodimer t366w + t366s/l368a/y407v
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8A01
4P4RA 4JQXA 4JAMA 5C6TH 3SDXB 4Z7QE 5HXMA 1F8TH 3A67L 2D4DA 3TA3C 2KQNA 4P4RB 1QFUL 3CK0H 2F5AL 1XF5A 3TVMC 1BOGA 5HSFA 3BKMH 1IC7H 2MOVA 1PYWB 5GJTH 3V8OA 2AJUH 1OTSD 1XF5B 5F7LB 4KROD 4NKDA 3UCRA 3CSPA 1S7RA 3GJEA 3TM6A 5SX4H 2NQCA 2ZZUT 4G8EA 2A83A 3P0YL 4U6YB 3GSOA 2LVEA 1S7RB 3MLRL 2RGSA 4OF6A 5I1EL 4UILL 3GJEB 2BK8A 2VDMH 1OF2A 1ORQA 25C8H 4G8EB 3GSOB 4H25A 4LAQL 2B2XH 1E4XH 1KB5H 1RVFH 3GMRA 1OF2B 1ORQB 1P7KB 4H25B 3CXDL 1OCWL 3MXWL 1TITA 1G7LA 1FAIL 1ORSA 3GMRB 1KG0A 4PGDA 5ISZE 1U8IB 3SGDI 1S8DB 4X0KA 4EUPH 1G7LB 1ORSB 1JRHH 1KG0B 4OBSA 4F37F 4ACPA 1RZ8B 1KENL 5KVFL 2GJ6E 2HWZH 4DN3L 3TN0A 4DKEL 4S1SL 5D1QC 2IH1A 1LP9B 5JXAH 4YE4H 4YXHH 3OR7A 1U2HA 3LDBB 2UZIH 3TN0B 4NQCE 3QXDA 1I85C 2OL3L 1EA9C 4I18A 3R8QA 2HRPH 1VFUA 4IRZL 2XN9E 3QXDB 4XGZB 5D1ZC 5MHSE 1H3XA 1U8NB 3C6LC 3SO3C 4I18B 4JB9H 2HKHL 5IBLC 5IVXE 3GNMH 1CLZH 4IRSB 2EDEA 2BY2A 1I8MA 5HPMA 2GT9B 4UB0L 1YEGL 1FYTD 4WDIA 3ZHLA 4OFKA 1CU4L 5HPMB 2Q7NA 2Q8BH 3LQAH 2WWMD 2JLLA 3LB6D 4WDIB 4RGOL 5F8RC 4Y19A 3TP4A 3NIFF 3QG6B 2DB8A 2N4IA 1JGLH 2HT2C 1JZ3A 1I9JL 1MH5B 1TJIL 5A1AA 5JW4M 4DTGL 3AREC 3OJDA 4LAJH 1UM4H 4MWFB 3O8XC 2XWJA 1A7NH 5GHWL 3I9GL 4EDWL 3OJDB 3KLHC 2XWJB 3WFEL 3MRMA 3V5KB 2ZUWA 3DURA 1TDQA 3QQ3B 1M05B 1W0VA 3BH9B 5SWSA 4YEEA 5HI3C 1YNLL 5MEPB 5JW3L 3VWKB 4JFDB 3WNKA 3MRMB 4PRIE 5CEZD 3FQUA 5D7JA 4ODSH 1W0VB 4YDLB 3OF6D 5SWSB 5F1OB 4MQ7A 3GI8L 1IEAB 5D7JB 2MCPH 3CVHH 1BQSA 3EJZD 4MQ7B 5FV2A 4OUUA 2KH2B 3WHXA 1OTUD 3VXUB 4LCCA 2E8ZA 3H3PH 1QBMH 1R3JB 1QFOA 1NCNA 3WHXB 4EBQL 3N9GL 4IDLA 4R8WH 4LCCB 1W72B 5D7SL 5ACLA 5CBAB 1BQLL 4XPAL 4H5SB 1S7VA 3GBML 3RX7A 3C6SB 3G5ZB 3UJJH 5HDQL 3VGBA 4PYHA 1YMMA 1H0DA 4X4ZA 3VGHA 4M03A 4E41E 3Q6GL 4TUKH 2CKNA 4GRLA 5DUPH 2R9HD 5FGBC 3QDMA 3MGOA 3WIHH 2RAMA 3C09C 5IR1A 2WBKA 4GRLB 2CKBL 4K23L 3I6GA 3QDMB 4YXLH 5JNYA 5FB8B 1CDBA 3QPQC 3TZVB 4DQOL 3L5XL 2IAMA 5JNYB 2FX8H 3C8KA 4NRZA 2OMBA 1KPVA 4GG6A 1FIGH 5BMFL 4PV9A 3QR2A 5MEOA 3BQUA 2J5LB 4GG6B 4KK5D 4HWNA 1L0XA 3ORJA 2IWGA 4XNUH 5MEOB 3BQUB 4NC1E 2X05A 5IFAL 1UACH 2H2SC 3WFBL 1YYLL 4QOKA 2A6JA 3WE6A 2CGRH 1FVDA 4NQDD 1EFXA 4HLZH 4NHCL 5LG1A 1D9KA 2JTDA 3BPCA 4QOKB 3WXVL 2J4WH 2FGWL 5EBMA 2D0HA 2A6JB 3S97C 1JHLL 1FVDB 2B1AH 1EFXB 1H8SA 4Z7QF 1D9KB 4L9LA 3BPCB 4OTXL 1J7VR 1A4KA 5EBMB 5E9DE 4TVSa 3HE6D 3GRWH 1QOKA 5J1SC 2KQMA 4L9LB 4MLSA 4K8RH 3EZ8A 2X70A 3DVFA 4FQLL 3UMTA 4NBYB 4ONGH 4HS8H 1DBJL 3MREA 1YEKH 4ODWA 2V9QA 1ZWIA 3O2DL 2X70B 2LU4A 3AU1A 4QRRA 1J9CT 4U1KA 3SGKC 3CJJA 4ODWB 5GGTH 1U6AH 3EYFA 4KRNA 3SE8H 4MQTB 4J4PA 1VGEH 3AU1B 1MFAL 4QRRB 5D72L 4YQXH 3VH8G 5FF6A 4Q0XH 4XNXL 4U1KB 4NSKA 3F5WA 4FFYL 4GG8B 3EYFB 2DLIA 4FHBD 4M9PA 1OSPL 5EIIA 3KPSE 5FF6B 4HWEH 4NSKB 1YEJL 3CUPB 3V95A 4KDTC 1UJTA 3GI9H 5EIIB 4HJJL 1H3GA 3O6KH 1NAMA 5TF1H 1GGIL 4U1IB 5CJQL 3PP4L 4NFCA 3VXMD 1A7QL 1QFWL 1I3VA 2BCKA 3IDNB 1YC7A 3DX9B 1G7IA 3ULVD 1LEGA 5DHVA 2BCKB 1HIML 1VADA 4I0PD 4ODUA 1KBGL 4KK6C 1G7IB 4M4PA 1LEGB 5DHVB 1T1ZA 1PGRB 2XZZA 5DQDH 1BM3L 1MFNA 1VADB 4ODUB 4TSBH 3SJVE 1V3KA 4PRPA 4X6BA 5EO1B 4JPWH 1T1ZB 2Z8SA 3P30L 2W0KA 4Q9BA 5IFHH 4PPTA 1UH2A 2WMPA 4PRPB 4X6BB 5IVXF 2R1YA 1R3LB 5I1DA 3E8UH 4QEGA 3U2SA 5JXEC 4OD2B 4K7FB 5EOCH 1VACA 1E6JL 3S5LA 4WHYH 5I1DB 1FFOB 3MUY1 4EI5A 5FDWA 4MXQD 4X5WB 5IT2L 3TH4T 3S5LB 5I8OL 3BXNA 4JFOA 1QO3A 2HYMA 3TCXA 1G7JA 1A3LH 3SQOL 4PJ9C 3B9KC 3WJLA 3BXNB 4JFOB 1QO3B 1CQYA 1INDH 3QQ4A 1G7JB 4LCIL 4DWHA 4KKBC 5DHYB 1DE4A 1J12A 3QQ4B 5FYJE 3FN0L 4KHTH 4UT7L 4R26H 4JHZA 1KXVC 1BREA 4KROB 3BDXA 5DEGA 5GSVA 2FSEA 4A2MA 1JGEA 4YUEH 3IJHA 4AL8H 4FN0A 5DD5L 5DR5H 4XI5D 5E8DH 3RQ3A 2H26A 1MAJA 1MHPH 1JGEB 2FSEB 4PJAE 5DA4A 4J6RH 1N5YH 5ALBH 5DGRA 2H26B 1S5HB 1C7TA 1WZLA 5LCVH 2D2OA 3OTTA 3DVGA 3EOYG 2AJVL 4PJBA 2G60H 4B7LA 4ZYKA 1AGDB 3MV11 5EPMB 2ENSA 4MDIA 4PJHE 2JCCA 1KCKA 3DVGB 4JKLA 3MACH 4APQC 4FG6D 1TTUA 4PJBB 4ZYKB 1XGUB 4KVCH 2JCCB 1UWXK 4GAJH 1UB6A 2DJSA 4NC1C 3D39A 5HHXL 2BOCA 5C0IA 2BY0A 5K9QI 4HC1L 1NGXA 1SVZA 4HG4K 5C0IB 3AMLA 4OIIL 4P3CL 4FFWD 2GAZA 2P43B 4MAYA 5J12C 1NGXB 5FGRA 5LJYH 5DJ8A 1OAUH 1VESA 1MPAL 1ZLVK 4LCWA 3WN5C 1LK2A 4M7KH 1U91B 4Q6IA 1FNFA 4NP4L 1FYTA 4IMLA 5DJ8B 5GRYA 3U7WL 5ACZA 5J3HC 1N2RB 3SDXE 3T0EA 3GSXA 4Q6IB 4WO4D 5CILH 4YWGH 1FYTB 2OYPA 3O9WC 4K07A 1NKRA 3NBNA 3VI4E 2A9NL 2PYED 3HPLA 2OI9C 4P9HL 3B43A 3GSXB 4Y4KC 3OGOE 1NCTA 3CAFA 4OCMC 3UPAA 3HPLB 2XNAA 2FLRT 3PDOA 1N5AA 1XF2A 2VLJD 1J8HD 1A7OL 3O3DA 1N5AB 1J0JA 1QHOA 1YJDH 5D7KD 3CXDH 2F5BL 3HCVB 3SE4A 3RWIA 3NA9H 1RD6A 4P49A 5L88L 1P4LB 1FCGA 3TPUA 3BESR 2WW8A 3LEYL 4ZAKD 3RWIB 3OPZL 2LABA 4E42B 3W5NA 1DLHA 2FJGB 5I6XB 4HCRH 3INUL 2X4TB 4N5EC 4OM0L 4XRCB 2BSSA 4BSVA 1FVCB 4N8VG 1DLHB 3QDJE 3AS0A 4CL7A 1UVQA 2BSSB 3RNQB 2Q87A 3GUTB 5D1XC 1IMHC 2I9LA 5DRNA 2ICWA 3V52L 4OLXH 1Y6NR 4LIQL 1FGNL 4LGRB 1PFCA 1H3UA 4Q97A 3I02A 3U9UA 4ZS7H 2I9LB 3OWEA 4Y0GA 2LVCA 5DRNB 2ICWB 3ZT5A 4LPWA 1OB1A 1MY7A 3I02B 3VGAC 1CU4H 1UZ8A 5IF0A 2Q20A 3O4LD 4L3AA 1OB1B 3MO1A 1GOGA 4WFFE 3MXVH 3QIWD 3RGVA 1UZ8B 3OKYA 3T08A 3B5HA 3MO1B 5IKCA 2PF6A 4IS6A 5DVMA 3S88L 3KDMA 1VFAB 2R29H 5HBBA 4UIMB 1N3NA 4GKZA 4R97C 4IS6B 1FFRA 1K2DA 4HAGA 3VDCA 3EO9L 4Y19E 1N3NB 4GKZB 1AXSB 2J7LA 1K2DB 5GHWH 5DVNA 3BJLA 1D3CA 1EERB 3BKCH 5DJXA 2R0LL 4Q6YA 4N0UA 2XRAH 4LPYA 4G7YL 1D6VH 3ARWA 4OI9A 3RIAK 1YNLH 2YHGA 2CJUL 1AGCA 3KGRA 4XP9H 5DT1H 2YUZA 4NQDB 4NO5A 4X6FA 4PRAB 2OCFD 1RZFH 3KYKH 3QCUL 5SWSE 3TYGL 4FFZH 2DI9A 3H9HA 1WTGT 4WVRA 2K7QA 1MCFA 1Q1JH 4NHUA 3T0XA 3HE6B 2HJKA 4HIHA 1CGYA 2EYSA 2BNRD 4PJ7A 5I1AB 2P4AB 3H9HB 1LVEA 4POZD 3ROOA 2Z8VC 4Q7DA 2HJKB 5HHNA 4P57B 2YD2A 4L1HA 5D7SH 4PJ7B 1Q9LA 3QP3A 1TJGH 1EH9A 3K8LA 3ROOB 2DD8L 1B0GA 1BQLH 1X5FA 3GBMH 1MCDA 4YGAB 3VXRD 5FKAA 4TVPE 1CF8H 1HH9A 4PJAF 2PTUA 4HPYL 5HI4C 4LRNH 4B53A 1RMFL 3GFUA 3I50L 1HH9B 4LRIA 1YMME 2FB4L 3MRFA 1IEBB 5JZ7C 1IGMH 3SCMD 4X98A 3CDGA 5GIRB 4OF0A 2FATL 3QDME 3VXMA 4PB0H 3NCEB 4DQOH 3L5XH 3EFDH 5FIEA 4PJHF 4X98B 5BMFH 3VXMB 4UTBL 4YR6B 3DXAD 3OAYK 4HGKC 5BO1L 4G8GA 3DRQA 1YDPA 5IHUL 3U9PH 4I0PA 3VG9B 2V7NA 1PZ5A 3LKNB 2L7JA 5DUMH 4N5UA 3QZWA 2O5YH 2R0KH 2DQUH 1KTLA 2IPKA 4GG6E 3TBVB 1MHCB 4CADB 3QNYB 4XP5H 4Y2OA 1PZ5B 4PD4K 4F7PA 2VNCA 4J3UA 1JUFA 3ZSTA 3QUZA 3WJJC 1KTLB 3LCYA 3EJJX 1MCBA 3QA3A 4F37K 2B1HH 3MOBL 4F7PB 1CFVH 2QQKH 2H32H 4YBQC 1IAII 2XZQL 4LKXB 3QA3B 3NCYP 3VFOB 4QOKE 3MA9H 2FEEL 1AIFA 3GSWB 4AIOA 2C4XA 1OP3H 4H88H 4XHJD 3UJIH 3SDXF 2ZUXA 1ITCA 2BC4A 3Q3GA 1A6WL 1AIFB 3MNZB 5T3ZE 4NZRH 4JVPA 1BAFH 3VI4F 3Q3GB 2BC4B 5TDOA 2PXYD 3D25A 4UMGA 1CLYH 1TFHA 3VD3A 1GIGH 3D25B 5EC2A 4ZUWA 2GY7B 2D7TL 3DV4A 1BFTA 3TN0C 5K9OA 4GW1A 2I07A 1U93A 4WV1C 4HK3J 4JFFD 5EC2B 5ADOH 2I60H 3EO0A 1PG7H 2P8LA 1PG7X 4OLYL 3X14B 2Y4SA 1C12A 1DVFD 1SJHA 5K9OB 4GW1B 2I07B 4I18C 3MODL 3FMGH 3VH8A 3OG6B 4Z7WA 2QL1A 3EO0B 1LMKA 1YQ2A 5IROA 2P8LB 1JZ4A 4BSJA 1C12B 1Q0YL 5C1MB 5MEND 4LLMB 3VXTB 2DQIH 3VH8B 5JHDE 2GK0A 4Z7WB 2O93L 4Y1AD 2QQQA 4KDVA 1LE5A 4JLRA 2OM5A 3QFJD 1KIRA 4LSVH 2O5XL 5HI5D 1OAKH 1HIMH 4JLRB 1KIRB 1BQUA 4QYOA 4IDJL 1H8NA 2W59A 4BFIB 1VKXA 4WI2A 4NN6B 4QYOB 2B20A 4JHBA 5HGAB 4OCRL 4KK9D 5C3LD 5I1JL 2ZG2A 3P30H 1F90H 3BUTA 5F7MC 2VMFA 3DSNA 4KQ4L 3MRNB 4YDIL 2XIDA 5HJ3A 3G6AA 3GSVA 5DMGD 1ZTXH 1NCAL 5HHOA 5I75C 1RZJC 4WHYG 5HJ3B 3S6CA 1T2JA 4U6VL 3G6AB 3PNWB 1C5CH 1P84K 1FHGA 4U31A 5JW4Q 3GMLA 5I8OH 1PSKL 1GZPA 3IDUA 4GUPA 5KOMC 3RTQD 3QXTA 3GMLB 4WO4A 5CJ8A 1BLNA 5KS9A 4M3KB 5D7JC 3CMGA 1GZPB 4GRWE 32C2A 2UY6A 4Y5YB 1KT2A 1OM3L 4WO4B 1BLNB 5KS9B 4BZ2L 4YPJA 3UYRL 5I17A 1G6RL 1AGBB 1N4XH 1KEML 32C2B 4IHOB 5IJVA 1CK0L 1KT2B 2PYEB 3REVB 3WO4B 5I17B 4OGZA 5CIPH 5IJVB 2EC9U 5IMLA 1C08A 1J8HA 2VLJA 3JWNC 4OJFH 4J3OC 4KJQC 4Z5RA 3W9DB 1TENA 1DUYA 5IMLB 1C08B 1J8HB 2VLJB 4JJHA 2DQHH 3VFRA 3T77A 4Z5RB 5IK3A 5FXCH 4BZ1H 5KN5A 1DUYB 4MA3A 3FONA 4JFYA 2YPKA 1Q0XH 4GRLC 5IK3B 5KN5B 4MA3B 3FONB 15C8H 1KJ3H 4HQQH 4JFYB 4ZAKA 4YAQA 5H2BA 3FL7A 2VQTA 4TYUA 2ZCKH 1AGEA 4L3CB 4FTVE 1NCDL 4ZAKB 1QLEL 2J5LC 4OGYL 2IAMC 4PJBE 3PHOA 1MFBL 1AGEB 5DXWA 5D9SB 4MSWA 4R90H 4HC1H 5DEFB 1H3WM 5ECJE 1NL0L 3PHOB 3BJ91 2A77H 2VXQH 5B3JE 5DVKA 1Q72L 1BD2D 4MSWB 3D39E 4U3CA 3OKKA 3O0RL 3TT1H 5BJTA 1MLCA 1RZIA 2IPTL 2R69L 4NP4H 2HMID 3C5JA 1I1AC 5BJTB 1G7QB 3LKOA 1SEQL 1MLCB 3O4LA 1RZIB 1ZSDA 1NANH 4LCWE 5ENWA 2OR9L 3QIWA 4XPFL 3VJ6B 1SYSA 3LKOB 4L9LC 5BV7C 3BSZH 4FS0A 3VWJD 3O4LB 4Z7UE 3NH7H 1ZSDB 1EAJA 2HH0L 3T0EE 1WV7T 2VLLB 3Q6FA 3QIWB 5EU4A 4PJXA 2FIKA 4GG6F 5KTEL 2R2HA 3BKJH 3Q6FB 3SY0A 4Q74A 4PG2A 4JFED 4NT6A 1IGIL 3SY0B 5IHBA 1G7PA 3RRQA 2PTVA 3WL9A 1YEFL 4J4PC 3GM8A 5K9KA 3UO1L 2ED8A 3PQYD 2NZIA 2R56L 4BYHA 1P5VA 3BO8B 4NT6B 2F5BH 1G7PB 4P2RB 3WL9B 1F4WL 3QH3A 5K9KB 3ZT7A 4Y4FC 1KB5A 4KAQH 5E5MA 4M6ML 3DROA 1RUPH 4QY8A 2HLFC 5C7XL 3QH3B 1RV6X 1X5ZA 1KB5B 5J57B 2UZXB 5E5MB 4MS8D 3DROB 4QY8B 1JWSA 1CGTA 3T1FA 4AY0A 3B9VA 3PP3H 5DRXB 2OP4H 3RWDA 2NY3C 3T1FB 4D2NA 4XTRC 4X6DA 4MA7L 1EFQA 4BA8A 3RWDB 2BNRB 2A9ML 4ZO8A 2H3NA 4M43H 3E3QE 3S96A 5F8QC 4LIQH 1KJMA 4G5ZL 4OZHA 2EEDA 5IB3A 3VXRA 1HWGB 2H3NB 4QCIA 4N8VB 4MJIA 1DTUA 5T5FH 1J88A 1KJMB 4OZHB 5DJDA 3V4VL 2V5SA 4KZEH 1QSZA 5IB3B 3VXRB 4WCYL 4QCIB 5EO0A 3LQZB 3RVVC 4Z77A 1JYNA 4MA1B 1M4KA 2YZ8A 1P84J 5EO0B 3SCMA 4WEBH 1HILA 2PW2A 5KVMC 4NQXB 4EI5C 1C5BL 4Z77B 2JK5B 3EOAA 3SCMB 3WCYA 1KCUH 2PW2B 2VXUH 3DXAA 4K2UH 4NN7B 5C0JA 3BIAX 2X1WL 1MY5A 3IU3A 3WD5L 5GISH 3OKLB 3WJLC 1OPGL 4TSCH 2IEPA 1WJ3A 2B0SL 3RI5K 1JPSL 4HPOH 2G2RB 3DXAB 5C0JB 3MRHA 3L9RA 1D6EA 1ZA3B 5F7WC 4UBDD 3NPZB 1F3JA 4KROC 4OD3L 2BNUA 1OAYH 5TGBB 5IB2A 5GRUH 3L9RB 3RAJL 4HFUH 1RQ5A 2BNUB 1PW3A 4YXKL 4U3HA 1DP0A 2XV6B 3R1GL 3JV6B 4N0UE 1RURL 4R4FL 1NBVL 3QCUH 4N8CL 2FO4A 5C6WH 2I9TA 4GRWF 1DCLA 1LGVA 1RK0A 1B0RA 2Q6WB 1A9EA 1CG9B 3DSFL 4JG1H 4KMQA 2FO4B 5E00A 2PXYA 2VB5A 3CVHA 3ZKMD 4LCYA 2APWA 2ZPKH 3MA7A 5DQ9B 1P4BL 3K4DA 4IJ3B 2PXYB 3WXWL 1W8NA 2R4SL 1GC1H 3N1MC 4RNRB 2G75A 5F88A 3QQ9D 3X3FL 1BGXH 1WBYB 3VCLA 1Z5LA 5EU3A 2W91A 2G75B 4Q9RH 4HBQA 4F7TA 1HHGA 5GRXG 4JFFB 3VCLB 4HX1A 1FP5A 1Z5LB 5EU3B 2A6DA 5DD6A 1J1XL 1DVFB 5IHZB 3UPCA 5MENA 1I3GL 5FK9B 5DJ0A 4MAYC 4F7TB 5J7CC 1HHGB 1XAUA 4LKCA 4BQCA 4HX1B 1MI5D 1NUDA 3LEVL 4Y1AA 3WIHA 1VERA 5DD6B 5FM8A 5ICYA 2K3TA 5MENB 5DJ0B 2YWYA 1YEDB 3QFJA 4LKCB 3BAEL 4Y1AB 3DUUA 5ICYB 3T0EC 3QEGH 5IHUH 2X44D 4O58H 1KLFA 1QSFD 3VXME 3QFJB 4HT1L 3ZKNC 5IFJA 5AWNH 3GMNA 3LB6C 4PJBF 3DUUB 3NGBB 3R0MA 2JB5L 4TTDD 1B9ZA 4DGVL 4N8PA 4EXKA 3ULVE 3D6GA 2Q86A 2ZG3A 2ILLA 3S34L 3GMNB 4G8GE 2NXYC 2B4CC 5B3JF 4EKXA 1Y6MR 4FQ1H 2Q86B 4XVSL 1RFDL 1UWEL 2HFEA 4YDKL 4X4XA 1JGDA 4EN3A 5CCKH 4C57C 4LLDB 2HFEB 2BXYA 2XY2A 2ED7A 2XG4A 1JPGB 4X4XB 1JGDB 1EZVX 3MLYH 4XAWH 2D7QA 4KTDH 4X7TA 2C9AA 3LIZL 5H35A 2IC2A 1KOAA 5GS0C 1IC1A 3CNKA 3SE4C 2KUTA 4X7TB 4QXUL 3MGTA 3UTZA 2VLMD 3T4AA 5I1IL 1CLCA 3AY4C 3RTQB 3CDYA 3EYUL 4R6UA 3MGTB 1UJ3B 3T4AB 3OG4B 1CR9L 3EJZC 4HH8A 3U0TA 3JWDC 4MZ3A 2CLVA 2CLRA 1I8KA 2Y7QA 3E3QC 3WSQH 4HGWA 5GGTA 4OLYH 5IM7A 1FL5A 5LXGL 5DZNA 4F58L 3CVIL 2CLVB 3VE0A 5DJ2A 3RWFA 2CMRL 4HGWB 2N7AA 4QTHB 5IM7B 3W11D 1FL5B 4D0DB 1VPOL 1Y18A 3VE0B 5DJ2B 3RWFB 4QXGH 4ZUSA 5J1TC 4X9GA 3PWVB 4Z7WE 1Y18B 5E4EC 1DQDL 5CZKA 1P7QD 3FQWA 5EBGA 3NFNA 4ZUSB 2XA8L 3FT4A 4JGMA 5D6CA 1WBXA 3MOAH 1MNUL 1V5JA 4GS7B 3NFNB 5B8CA 3RGVC 1J87A 1GPOL 5D93B 2RCSH 4DK6A 5DC9B 4PLJD 5D6CB 1TVBB 1WBXB 1RJYA 5DURD 3NCMA 4Z0XA 2PTTA 5EU6D 4IEFB 5B8CB 4IRJA 4WU7A 1RJYB 4KQ4H 4Z0XB 4XC1L 4HV8A 5KW9H 2PTTB 3MV8D 1D5IL 4KK5C 1ETZB 4WU7B 2VRAA 1NCAH 3EYSL 5F9OL 4FFVD 4KTEL 5TQ0H 2H8PB 4LOUD 1AJ7L 3ZLQC 1QSED 4C58B 1BD2B 1DSFL 4N1HB 1FH5H 3FQTA 4EEEA 3EO1B 5E6ZA 5HHOE 4KGJA 3TBYA 1E4WL 1CICC 1MCCA 3FQTB 4JO4H 5FOJA 1RUKH 3WLWD 1OM3H 3VWJA 1FC2D 2BVTA 1G0XA 1C1EL 4Q2ZA 4OV5B 5CHNA 3VWJB 3K1DA 3BPNC 3UYOD 5KS9E 5E4IA 4Q2ZB 4S11A 5JTWA 5E2TL 2FD6H 2ERJB 4U4BA 4X4YA 4X7DC 1DQLL 1XR9A 4JFEA 4GT7A 3OKEA 1J1OH 5KVGL 2ZJSL 3PQYA 3BP4B 3H7LA 1ULVA 2NCMA 5DQJB 1QKZH 1XR9B 2VLJE 1J8HE 4JFEB 5H94A 2BVOA 5ETUB 3OKEB 3PQYB 2DLFH 4JDTL 3BE1H 4Y5VA 2NW2B 2OX5A 2W9LA 2YOCA 5GS2H 1WZMA 2GSIB 4CW1B 2VL5A 3QHZL 4OGXL 5FYJL 4E0RA 4AIXA 4Y5VB 1IGJB 3D0VB 2BNQD 3M1BA 2R2EB 1L9MA 8CGTA 1EEUA 3IDYB 5I8KL 4UZGA 4E0RB 2BMKB 1FSKB 1BVKA 4OGYH 3M1BB 1MFBH 3KS0J 2VDRL 3MLUH 1HHJA 2P8MA 3ULVC 3BZEA 1BVKB 4YPGA 4LVOB 3VFTA 4I0PC 4K9EH 1AQKL 4XNYL 1KCRH 5I8EB 3DYMA 3VG0H 1HHJB 2P8MB 2WANA 1HYSD 3B2VH 2VDLH 2C4FU 1FRGH 4U1NA 4YPGB 3VFTB 5DMKB 2DIAA 2B5IB 2MQCA 4M7ZB 4LLQA 3QUZC 5JUEH 4TUOA 4Y16D 2R39A 3HA0A 4EJ1C 4DK3A 3G9VA 3VGEA 3K4AA 2AP2A 5D7IA 4TUOB 3ZYJA 4XPFH 1PY9A 1CTNA 3HRZA 2XXMB 4KKLC 2ZUQB 2AK4A 4OAWA 4MNQD 2A6KA 4V2CB 2HH0H 4OZGA 2WP3O 4P46D 5D7IB 2E5EA 3O4LE 3MSPA 3HRZB 3G5VB 5C9JA 3VFNA 4OAWB 4OZGB 3LZFL 3ULVF 5B4MD 1ZANH 4OFVA 1FZJA 2X4QA 4PGEB 2A73A 4BQ6A 2VOTA 5C9JB 3VFNB 1NFIA 1BZ7A 4QRUA 4PJXE 3RA7L 3ECBA 1OD9A 3VGFA 2X4QB 2A73B 5F7EL 1ZGLP 1NFIB 2R56H 2AK1L 4QRUB 4GO6B 5DA0B 1CE6B 3EHBD 2C3GA 3ECBB 4MX7A 4ENEC 1IL1A 4QXTA 1AFVH 3RVUD 2DL2A 3CLFL 3DVIA 5FECA 4MX7B 3CMOL 3QPXL 1IL1B 2HJLA 3FB8A 4QXTB 3RKDD 5IROC 5IOPA 4MD4B 1FG2A 1R5VB 1N59A 1DANU 2HJLB 3FB8B 3RWGA 5DFVD 4OF3A 4XXCA 4L4JA 4HK0A 1T7WA 3RVTD 1N59B 1F58L 2YA1A 1KEGL 3MNVA 4KPHH 1NDMB 4HK0B 4M00A 1IAOB 2NPLX 1MAMH 1XIWC 5JMOC 2MTPA 3KPLA 2A9MH 4R3SA 4HCRA 1MCSA 4N0CD 4LSTL 5AG9A 4G5ZH 3KPLB 4R3SB 1SM3L 4DUXA 4L9DA 4X6DE 1CD8A 1OWRM 1WUNT 4D9RD 4FQXD 1QD0A 4D9QD 3UZVB 4HUUA 4OZHE 1FDLL 4MQXD 1RUQH 1F4YL 4PGBA 4Z7WF 1NMAL 4MJIE 4D9LH 1GCFA 1S7SA 4HUUB 1MI5A 1WFNA 1XFPA 3CFCL 4PGBB 4ZFOA 1F3DH 2YN5A 2JIXA 1BEYL 4CAGA 3K0WA 4H20L 4XB7A 1MI5B 4HMEA 4QRQA 1BJ1H 4ZFOB 3VD5A 5IWLA 4HKXA 3WD5H 3MX0A 1QSFA 2WIMA 4WO4C 4EIGB 5IQ7L 2YD9A 5M7QA 4QRQB 1JPSH 5FHAL 4F7EA 4HKXB 4JO1H 3V4PL 3E6FB 3RKPA 4U1MA 4Z8FL 1QSFB 4P3DB 2I5YH 3K74B 5I1GH 4FZ8L 3DXAE 5DD3L 5GGRA 3WO4C 2C1OB 3P0VH 4U1MB 1T5WA 4NNYA 2HTLD 3BISA 5GGRB 4OGAD 3D85D 1J1PL 3NTCL 3PHQA 4GXUN 3GO1L 1DBKH 1OLLA 2V5MA 2V5YA 1NEZG 1Q94B 5DLMH 2AJ3A 3UAJD 5JIPA 1AKJD 3PHQB 2NY7L 2O5ZL 2D0FA 3TIEB 3PWPD 4LEXL 3BD5A 4WRLA 4HIXL 2VDQL 2AJ3B 2DDQL 4GMSH 4M1GH 3DHJA 2DM2A 5DD1L 4X9BA 5C0AE 5DI8A 1DJSA 4ZAKC 5KS9F 1P4BH 3Q2CA 4O2EA 1DZBA 1JI2A 1RZJL 1YEEH 4XPGL 5KJRL 2YD4A 3DETC 4M6OH 3SE9H 4O2EB 1RUMH 1LD9A 3U0WL 4MJ5A 4J7RA 4TNVF 4DOHB 3SKOA 1GAFH 1A6VH 5IEKB 1LD9B 1I1FA 2XXCB 4M48L 4MJ5B 3ZTNL 1I3GH 3THML 1PZUB 4F80A 4XNZB 3IDIB 4P4KC 4HUMB 2EO9A 1KFAL 1RZ7L 1RULH 3FO9A 1NLBL 1I1FB 2VAJA 3GHEL 4U7KA 5FUOH 5D2NB 1I8LA 4P9MH 1KCVL 4NZDA 4ODVL 3LN4A 1ZLSH 3FO9B 5ACMA 4BH8A 4U0QB 1QSVA 2P24B 1ZA6A 1TNNA 4JFZL 4HT1H 4Y1AE 4X6EA 2V7HA 1P7QB 1I7RA 2VDNH 4TVPL 2FZ3A 4BH8B 5GRJH 3MMEB 3QFJE 4UDUA 1NGQL 4KXZH 1A0QH 3QI9C 4X6EB 2V7HB 1ZLWH 3S34H 5EU6A 1I7RB 3S7GA 5C07D 3H42H 5C0BD 3G5YA 4R4NC 1LO4L 5I71B 4I77H 2AI0L 5DURB 5F89A 4JO2L 1AXTH 2OTUB 1UWEH 2Q76A 3D48R 5EU6B 3K4ZA 3MV8A 4UINL 3FQXA 3G5YB 4CVXB 3HN3A 4HKBA 3T4YA 4U1LA 3MV8B 4PG2C 5KANG 4OCNC 3BP7A 3FQXB 2H32A 3HMXH 3QDHA 1S7WA 3T4YB 2EDNA 4OLVL 4NC2B 4NO3B 5DJAB 5HYQA 3BP7B 5C0GA 5I76A 1ZS8B 2H32B 1QSEB 1S7WB 3ULUD 4QHMB 2YRPA 3FKUS 4PG9A 1U8PB 2EYTB 5C0GB 5I76B 4HZLA 1UA6L 2PN5A 3OAUH 2GJZA 4I48A 5J1AA 3D87B 5CZXD 3EOBA 1NSNH 4PG9B 3CFEA 2H2PD 4HZLB 1JNJA 1MELA 2GJZB 2AQ1A 4N0YL 5J1AB 3V7AG 2R1WA 3G5XB 1HZHL 1DN0A 3CFEB 4PJXF 4NYLA 4HXBH 1MCQA 3LH2L 1BMGA 4POZC 5ITBH 4AENB 5EZJA 2R1WB 4JN1H 5MI0C 5T3ZL 4NYLB 1KPRA 3LN9A 5EZJB 1JPFA 3IJSA 2HG5A 4LMQE 5FO7A 4S2SA 1F45A 3ROLA 3MV01 2NY1C 4Z95L 1JPFB 3IFNH 3IJSB 2HG5B 4WIQA 1YEHL 2ENYA 5FO7B 4S2SB 3MV7D 3MRQA 3QRFM 2XA8H 3IFPA 5JOPD 3ROLB 1VSCA 3S36L 1MRDH 1HOCA 2UV3A 3MRQB 3IFPB 2BNQA 1CD0A 35C8H 3SCMC 4NKOB 5FUCE 1FNEA 2DICA 1HOCB 2E27H 1EEZA 1A5FH 2BNQB 1MJ7L 2IMMA 3LQAC 1NH6A 4FZEL 2WV3A 4NN5C 4AJ0A 4DKFL 4NZJA 3LHPL 2W0LA 1FNEB 4XBEL 1IGTA 5TDNA 1EEZB 2M8XA 1MF2H 4F3FA 4X6DF 5KAQG 4Z7VE 3MRLA 1IGTB 5TDNB 2IQ9L 2NR6C 1NAML 4F3FB 5EU5A 5HDBE 3WV0A 2EECA 4ODTL 4OZHF 3MRLB 5AD0A 2NZ9D 1MEXH 3WHE1 2F9BT 2YD6A 1P6FA 5EU5B 1DQML 1MWAH 4Y16A 5HVHB 5I15H 5TQ2H 4Y16B 3S37L 5IQ9A 4RMRA 5C70A 1M7XA 2XQYK 4HJ0D 4X80L 4XHJC 4ODHL 1C1EH 2Y06L 4MNQA 4P46A 3IDXH 2Y5TA 5IQ9B 1CXLA 3VD9A 3QJFA 5BVPH 1EK3A 5M95B 4MNQB 2DQGL 4P46B 3PXJA 4PJ8D 3P4MA 2Y5TB 1TLKA 4OLWL 4EDXA 3QJFB 1A6AB 5F3BA 4RCAA 5IW6A 2GEEA 1JZ5A 3O6LL 3BW9B 2VDKH 3P4MB 5E6IA 4ERSL 5KVGH 4OLUL 1CDHA 1CFTA 1MFCL 2DMKA 5CIPA 3FT3B 4UUJA 4HWUA 5ADPL 3FN9A 4P3WA 1CFTB 4NZUH 5CIPB 3VA2C 4UUJB 4JFEE 1KJ2A 4H8WH 1AO7D 3PQYE 4OT1H 2W9DL 3ZYIA 2G5BA 1KJ2B 1NDGB 3GDBA 1E4XI 3SKUD 1MCWW 2I25N 5ESQA 1T22A 1EV2E 2FBJL 5C6PB 2DLEA 4NO0A 1IGFL 2VYRE 1ZHKB 3QIUD 5L0QC 5ESQB 5K9JH 1EJ6A 4G9FA 1T22B 4U1JA 3KYOB 1T89A 3BZDA 5HI5C 2AV1B 4AEHH 1JYXA 1F97A 3V6FA 4R0LA 3MCG1 1JIBA 2N7BA 4H26A 2NYYC 3V0VA 3TIDB 1BVLB 3V6FB 3P3YA 2YK1H 3QXAB 3HI1A 3KWWA 1U95B 4H26B 1CD1A 3V4UL 4U1HA 5ALCL 3V0VB 3BI9X 4FQXA 5J4MA 2IALB 4PV8A 3P9MA 4UQ3B 5TFSL 3KWWB 3M8OH 1CD1B 1JCKA 4U1HB 3L7EA 4MDJA 5C0RL 4FQXB 3S4SG 4EN3C 4PV8B 3WIIH 2ZCHL 4UV4H 5ESVA 2DQTL 3RZCD 4L8CA 5FYLD 3IFLL 3V0WH 2W0FA 3OB8A 4MDJB 1NEUA 1WWCA 5BZWA 4XZUA 3T65A 4PREA 2OBGA 1T66D 5ESVB 5D7IE 2BVUA 5BZWB 4XZUB 3AAZA 4PREB 2AK4E 4RMVA 1UENA 3M17A 2E6PA 4ALAL 2BJML 4K8RC 1S9VA 5HYJA 4NQVA 5SX5H 1V3MA 1N7MH 1KLGA 2FCBA 3K80A 1JTTA 4PGCA 1O5DT 1S9VB 1GHFH 3CIQA 3QNXA 1KLGB 3D85A 5JQ6L 1JNLH 4PGCB 4K7PH 2EXWC 4K7PX 1PBYA 1Q9KB 2IGFH 5I1KL 5J9PA 3MLPA 4PJCB 4HH9A 1NC4A 1T1YA 1T2XA 1X6NA 2EIZB 3D85B 5AZEH 5GXBB 4L8BA 1IE5A 1AKJA 1GGBL 4FP8L 4M9OA 4RDQG 4HH9B 3WDJA 2Y6SC 1T1YB 3GSNH 3PV7A 4WTZA 5GS2D 1NGZB 2B4CL 1XF1A 1A64A 3CC5A 1KEGH 1X6LA 3EDJA 5GQBA 4G3YH 4PBWD 5BW7A 2VAAA 5FUCC 2X4NB 3PWPB 4RMQA 2OXGA 2WNGA 4KHXL 4U6TA 3CC5B 5TE4L 3D9AH 2VUOA 2F54D 4K94H 2OJEB 2VAAB 5DZOA 2V9TA 5B8CC 2YD5A 4LSTH 4R96A 5ESAA 4OZIB 3T1WA 2IPUK 4PB9L 1SM3H 4HF5H 3RHWF 3LRHA 5AYUL 4R96B 5ESAB 3MBXH 3SHSA 4IRJC 3RUGA 4PY8I 3SGEI 1RU9L 3QFDA 2FECL 4NM8L 5GS0L 3WKMH 4J23A 5I30H 1MREL 2J3SA 2BVEA 1V7MH 1IT9L 3NFSL 1HQ4A 2VIRB 3RUGB 4TNWF 3QFDB 3K2MC 4NUGL 1V7NH 1FVEA 1FNSH 3L3DA 6CGTA 1V05A 3CFCH 1M71A 1FVEB 5H8DA 4L29A 4F8QA 3L3DB 3JWDL 3QUMH 1ZEAH 2EE3A 3P9LB 3KPMB 1A7PL 1M71B 4PJDA 2VE6B 3DX6A 3MYZA 4X9HA 1T04A 4AEIH 1MI5E 1YEIL 5IQ7H 3MJ8B 5T1DL 5IB5B 4FMKA 5EC1A 4AM0B 2AV7B 5EZOH 2C5DC 2P47B 1V3LA 3T09A 1HXYA 5C07A 5C0BA 1QSFE 4Z7VF 4XP1L 1A02N 3HI5L 3NCYS 5KVEL 3O3AA 2DS4A 1F6LL 1HXYB 5C07B 5C0BB 5HDBF 4BK4A 3GO1H 1X3DA 4KMTH 3O3AB 1QA9A 4X7SL 4ETQA 2O5ZH 4YHIA 1QA9B 5D5MA 1FPTL 1IKFL 2DDQH 2A74A 4ETQB 5GGVH 1NEZA 1HN1A 4G6MH 4NOFA 2UUDH 3U83A 4YHIB 4Y5VC 2JB6A 5D5MB 1MAKA 3P77A 2F58L 2PUQT 5DD1H 1HSBA 2A74B 1NEZB 1LDPH 2AW2A 3RIFF 1IFHH 2JB6B 5EWIH 4R7NB 3P77B 1HSBB 1NQBA 4DW2H 4YHZL 3B83A 2DL9A 2VLKD 3MBED 5FYKD 4N90D 4UNTA 4LVOC 5LQBH 2R0WL 4C56E 4JY6A 1A14L 1LDSA 1OAXL 1D5MB 2B5IC 4PJIA 4M7ZC 2PO6C 3MYJA 4M48H 2YMXL 4JY6B 1NJ9A 3F8UB 4X6CA 1KFAH 3C9NB 4PRNA 4PJIB 3MYJB 1G84A 2HVKB 1WFOA 1I7TA 1K3ZA 1OARH 1NJ9B 4X6CB 3KXFD 4PRNB 5I9QB 3MV7A 1W72H 5J13B 2AAVA 5E8NB 1WCQA 2ZUQC 1B3JA 4GLRH 7FABL 4OM1H 3MV7B 1VEPA 3EYVB 2ZUSA 1NGQH 4NWUH 3DI3B 4X7EC 4M6AA 5GRVK 1GGTA 5J11B 1LO4H 1YMHA 1N64L 1NMCB 4L4VE 3GKWL 3KPQB 4FRWA 2FX7L 1ZLVH 2BXZA 1IZJA 3REWA 6FABH 1FZMA 5EU6E 5LGHL 1BF8A 5EO9A 1ACZA 2XQBH 5EIQA 3GIZH 1CXHA 3REWB 1FZMB 3SKJL 3UTSD 4O4YL 4MJ6A 4JPVL 4ZFGL 1NFDA 2ORBL 4K71C 2MHAA 1FZOA 1P5UA 3NAAH 3ULVL 1ZHLA 3HZKA 4MJ6B 4ELKB 3WUWA 4N9GB 1YJDC 2MHAB 1FZOB 4WW2B 3RL1A 1AD0B 5D7IF 3DJ9A 1XCQA 1ZHLB 5ID1A 1JYVA 3HZKB 1ZGLM 2ZSWA 3G6DL 3MLWL 4N0YH 1XCQB 2ICWJ 2QR0A 1HZHH 1HH6A 4P2OC 3SBWC 3MRBA 4PJ8A 1IJ9A 2ZSWB 5CGYD 5KSBB 2QR0B 1X5IA 1HH6B 5GRVL 3ZKMC 3FO1B 4PJ8B 4AEFA 3P9WB 2XPGA 5KBNC 4JKPH 3IAQA 1RZKL 4W4OA 1A4JA 1TQCB 1T20A 1N26A 2XPGB 1BWWA 3ZKXB 5E08H 4ZMAT 1RIVH 1A4JB 4DKDC 1T20B 4OV6F 1K4CA 3ME0A 4YBLB 3FRUA 1AO7A 4JCMA 3QUKB 2YKLL 1K4CB 4KGLA 3BDYL 3AVEA 4JFPB 1KIPA 3BT2H 1AO7B 4C4KO 1TTFA 3KPNB 1T83C 4X8XA 1VGKB 2H1PL 4TPRH 1GYAA 3QIUA 1KIPB 3MLSL 4DKFH 1K9TA 4XBEH 1AI1H 1T6WA 1DUZA 3IDGB 3JTSA 2A0LC 2YSSA 4LGSB 3QIUB 1ND0A 2VKWA 3UC0H 4CJ0A 4ZUUA 2FJFA 5SWZD 1OOAA 1DUZB 3JTSB 2YSSB 3B9AA 2Y23A 2X4OA 4ZUUB 2NY5L 2OTWA 3U30B 1U8HB 4ZQKA 1X5XA 1GJIA 2EDLA 3CSYA 4M4RA 1DQMH 2X4OB 2OTWB 2QQLH 3CX5J 5EOTA 4LDOB 3TCLA 4NNPH 3CSYB 1ES0A 1GXEA 4DVRH 1T1XB 2ADFL 2IFFL 4I3SL 4B5EA 5EOTB 3RZCA 4KK8D 2Y06H 1YNKL 1ZHBA 3CFBA 3CU1A 3SGDH 5D8JL 5T3XH 4WFGD 2P5WE 3RZCB 4LBEA 4WUUA 5TPWL 3CFBB 1JTPA 2DQGH 4AG4H 4LLYB 2X2YA 4JRYA 4OLWH 4LP5A 4MNQE 4IM8A 4LBEB 1I9IL 4RFOL 4P48A 1HNFA 1CZ8L 4ERSH 3BVNA 2EH8H 2NY0C 3WNNA 2VR9A 3BVNB 2FYYA 4P2QA 1JV5A 3O2VL 2AGJH 3DVNA 5B39G 4RRPG 4WWKD 5SV4A 4D3CH 4FXKB 2FYYB 2VKXA 1JV5B 2A6IB 3W11C 3MTRA 2AERT 3UTOA 3T0AA 3GK8L 5IVZA 1HNGA 2W38A 2V5TA 5F7HA 1A6ZA 2GFBA 4OF5A 2VDOH 1GSMA 5DO2D 3Q5OA 4P59H 5FFLA 5TF0A 4NM4L 5IVZB 1I8LC 2J8UE 1A6ZB 2GFBB 2R4RL 1GGYA 2DJ4A 4YGVA 1IGCL 2DYPD 2UY7A 4ZFFB 5IG7A 5DFTA 2F54A 1MJ8L 4TULL 4K55A 1FV1B 3MZGB 3QEQD 4IMKC 4YGVB 3TT3L 1AR1D 2EDBA 5C0CE 4G9FE 3E2HB 5IG7B 2F54B 2V17L 3C60C 1UG9A 1EAPA 5IP4A 1INQA 5JHLH 1XZ0A 2KL6A 1XH3B 1QLRA 3TO4A 2P49B 3N85H 1EAPB 1NMBH 1IAKA 1RHHB 4PP1D 4I8DA 1QLRB 5FCUH 4IOSD 4OCWL 1N0LA 1CXKA 2NX5D 1CE1H 1IAKB 2ZCHH 3OAYH 4LOUC 5C0NC 5J6GB 1BPVA 1DLFL 4WFED 1LO3H 4G6KH 3FQRA 3IYLW 1S7TB 4KQ3L 4X99B 4XCFL 1HI6B 3ARDD 3WS3A 4D0CA 5F71A 2SEBB 3HNTL 4JHAL 4F8TA 5C92A 1DBAL 2NY4C 3ET9F 3FQRB 5FGCB 4M6NH 4GQ9L 1EJOH 1BFVL 4D0BA 3S4SB 3TNNA 5L8KB 4GSDL 2BJMH 1HE7A 3BP5B 3G08A 2BRRH 4HUNB 5A16A 1M6OA 1QVOB 3IS0X 4FABL 4NQEE 3UBXG 3IETA 2VDPH 4K3EH 4C55A 5JQ6H 5MP6H 1M6OB 4RAVA 3T8XB 5HYJE 5I1KH 2QQNH 3VFGH 3BN9D 3IETB 4Y5XA 1R5IB 3U4EB 5A2FA 3HHRB 4RAVB 5C6TL 1P6AB 4HUKB 4Y5XB 1AE6H 3W82A 2NY6D 3CK0L 2H45A 5BOZG 1VB9A 3BKML 1IC7L 2YRLA 5GJTL 2Q8AH 2K9UA 3ARUA 2AJUL 2QSVA 3LS5H 4ESKA 3SDYH 5GPRA 3L3OA 1FO0B 3T3ME 1AD9A 3HPJB 2H41A 3BPLB 5ELIA 3OGCA 1MIMH 3R8BB 1CDUA 4IOFD 4PB9H 1NAKH 3G04A 2VLKA 3MZTA 4WHTB 5C8JA 1AD9B 4F7MA 5AYUH 2VDML 4NM8H 4KJYA 4PIRF 25C8L 5IB1B 4UNVA 2VLKB 5C8JB 4XPHH 1Z9OA 3MBEB 2E7HA 3ELAT 4F7MB 1KB5L 1EXUA 3NCJH 5CEZH 3KYAA 1RVFL 4KJYB 1EO8L 1JHTA 1HYSC 3U36B 2HA1A 1EXUB 1JHTB 4LIQE 4OCYL 1UZ6E 4WI3A 5D96C 3KXFA 2P45B 3LKQA 1EO5A 2ZOKA 1AHWC 1YEIH 3KXFB 3KYMB 2HWZL 5JXAL 3LKQB 2ZOKB 2FX9H 3MJ7A 3C8HA 4EVNA 2UZIL 4PJDE 4P46C 2FEDC 1YNTB 1OT1A 1WCBB 3AXLA 5LAXA 1JFQH 1VCAA 3MJ7B 2HRPL 3VFVA 4EVNB 2OZ4H 2E9JA 4LHJB 5CEYA 2Q7YA 1X5KA 5ABDE 4S1RH 3FOLB 3AXLB 3RL2A 5B4MC 5LAXB 4PJFE 4JB9L 3FRPA 3VFVB 3GNML 1CLZL 5C0BE 4XCCH 5CEYB 3RL2B 4LSUH 5E6IC 1S9WB 3UTSA 2X4RA 3LQAL 4XPBL 4LSQH 3UTSB 1EHXA 4LQFL 2R2BB 2WK2A 2X4RB 4H1LG 5DJ6A 3L6FA 4ODXB 4WW1A 2R0ZH 4M93B 3FFCE 3CX2A 3RY5A 5CUSH 3LEXA 2DBJA 2CXGA 4XP6H 3L6FB 3U7AA 1I7ZA 1JGLL 2Q1EA 1QTYT 1PY4A 5DFVC 4LCUA 3RDTD 3LEXB 3RVTC 4ZNCD 2ZUTA 1R0AH 1UM4L 4R4BA 1BP3B 1I7ZB 5ITFA 2R0WH 4JM2D 1T89C 4W68A 4CNIA 4ZDHB 4R4BB 1ONQA 3EFFA 5L2JA 5BZDA 2E7CA 4R0LC 4GMTH 3NPSB 1CBVH 3L3GA 2VQUA 3EFFB 3JV4B 3UTTD 5L2JB 1DDHA 5BZDB 2YUVA 3S35H 4KKAD 3S35X 4EIZC 2HFFA 4P2CG 3GMOA 3SKMA 4ODSL 4DUWA 1FG9C 1DDHB 1J0IA 1YY9D 1NCBL 5EG6C 2HFFB 4MQXC 3GMOB 3GSRA 2MCPL 3CVHL 3CLEH 2J8UF 3C08H 4U33A 1BIIA 5F97E 3H3BC 3GSRB 3MV7E 4DZBA 5JOPE 3B2UD 2EKSA 4QTIH 4KZDL 1QFWI 1QBML 1N64H 3PGDA 3PABA 4XAKD 2FX7H 2EKSB 1AQDA 1BECA 4GW5A 4OQTA 3BEVA 3MR9A 2C3HA 1JZ2A 5SWZA 3PABB 5IIEB 1KPUB 2EEBA 3UJJL 3SQBA 1AQDB 3KNBA 1JL8A 3BEVB 3MR9B 2HTKD 4TUKL 5DUPL 5GSRA 5SWZB 3ALXA 4O4YH 3OXSB 2CR6A 3WIHL 2IG2L 4ZNEA 4MAUH 4RMTA 2BFVL 1A21A 4XHQA 5GSRB 1IAIM 1HK6A 3MUZ1 4ZPVB 1HINL 3AB0C 4TSAH 1JTOA 3RHWK 3HMXA 4L8SA 2ITCA 1U92B 3G6JA 1BFOA 4WHCA 1BJMA 4ZFZA 4XNMA 1NFDE 5JW4R 5SWQA 2FX8L 3UAJC 3LRGA 4L8SB 2ITCB 3G6JB 3QAZB 4I5BA 1BFOB 1FIGL 4LSRH 3G6DH 4TNWK 2OR8A 4ZFZB 2X40A 4XNMB 1L7IH 5SWQB 3KLAA 2OL3B 4CU7A 5ICZA 3R4DA 4I5BB 5A3ID 5KOVC 3QDAA 3SPVA 3KLAB 1CDYA 1UACL 2ZOLB 4HS3B 3SPVB 1RZKH 2CGRL 2DLHA 1I4FB 4R2GD 4ODBD 5L2KE 2J4WL 2F8VA 2B1AL 5C09D 1KTDA 4WWKA 3E6HB 2EDWA 3BDYH 4WUKH 5F6HI 3V2AR 2XTJD 3FB5B 1X9QA 4K8RL 4PBVC 4WWKB 2VXVH 2MPAH 3W5MA 3I6LD 4GAGL 4HS8L 1YEKL 4NQUA 4P23A 3MLSH 4J3TA 3T3MF 2EYRB 2DYPA 5GGTL 1U6AL 4JN2A 3SE8L 3BZFB 1VGEL 3TO2A 3U79A 1A9BA 2EDJA 3QEQA 1W0WA 1VDGA 1CDGA 1JVKA 1T2QH 2DYPB 4JN2B 1YN6A 1MRFH 3TO2B 2PNDA 3DECA 2NY5H 3CCHB 3ZMRA 4RSVA 2BHUA 2IBBA 4HWEL 1A9BB 3VMPA 3QEQB 1W0WB 4MQSB 3HC4H 3HLAB 4OCXH 3GI9L 1T0NA 3ARBA 1Q38A 4M8VA 1TQBC 5TF1L 3NACH 3CFKB 2NX5A 1UZ6F 1ZT7A 1VA9A 1MWAA 4RISH 2RR3A 2ED9A 5GRWA 3V9FA 3T0WA 3BPOC 1MWAB 5L8LB 1CTOA 1CWVA 1XGRA 3QULA 4WI4A 1FFQA 1BBJA 4PJDF 2ZUVA 3ARDB 5F7NC 3RPIB 4TSBL 2VN7A 1KELH 1XGRB 2V6HA 2ESVD 3D69A 1C8PA 1CZ8H 5CZXC 1BBJB 4WUUE 2WWKT 1ZVSA 4L4TE 3SDAD 4BUGA 4JRYE 2WLZA 5IFHL 3D2UD 4KKCD 4YO0B 3GIVA 2JJUA 4PJFF 4HKJA 4AMKL 3D69B 3PGCA 5I16A 5E8PA 2DI8A 3ESVF 5EOCL 3GIVB 1E4JA 4HKJB 1D7FA 2ID5A 1KLUA 1MCJA 3QG7H 1GC1C 4W6WB 1GL4B 3BIKA 2P46B 3GK8H 4WI9A 4Z78A 2GTZA 4OSUH 4P2QE 1KLUB 3UJTH 3BGAA 3IKCA 5B39A 4RRPA 4Z78B 2VSDA 2R4RH 3KHOA 3DWTA 1FL3B 3IKCB 1INDL 5B39B 3LPGA 5I73B 2NY6B 1L7TL 5TDPA 4Y4HD 4J3VA 5JIHA 4KHTL 1T1WA 1URLA 4R26L 5J11C 5TDPB 5K59E 1G0YR 4JQVA 1NMCC 5CGMA 2IANA 4LPUA 3KR3H 5BXFA 1T1WB 2F54E 4AL8L 2AXGB 4YUEL 2MSPA 2NTFA 4A6YH 1QP1A 5DR5L 5E8DL 5MERA 1MHPL 1Z0NA 4XWOC 4ZTOH 3PWNA 5HTSA 1N5YL 3UTPE 5CEXA 5ALBL 4WJ5A 5HYSA 1F00I 4YJZL 1BF2A 4BJLA 4CUCA 1AP2A 3MRGA 5LCVL 2VISB 5CEXB 4G7VH 2NZ9C 1E0OB 4XCFH 3H9YA 2G60L 1AP2B 3MRGB 4HAFA 3GEWB 3RWJA 4PS4L 2PR4L 1U8KA 1T03L 3VGDA 3MACL 1BFVH 3WFDH 3BWUC 1AC0A 4HIEA 5T3XD 4F33A 4KVCL 3RWJB 3FTGA 5EN2A 2NY2C 1U8KB 3WS6A 1U3ZA 4JDVA 4YHMH 4F33B 3FTGB 5EN2B 5AEAA 4FABH 4KY1H 4YHPB 5T33H 4JDVB 4N1CA 5HGGS 4Q9QH 4L5FL 1EDQA 3UZEA 2I24N 3MROB 1LO2H 5CP3H 1OAUL 4B7IA 1F5WA 4M5YH 4Y8AA 3UBXA 4LP4A 4M7KL 4FQQA 4W4OC 1PYWA 1Y0LA 5GZOD 4YX2H 2APFA 1FFNA 4DGIL 1WWWX 3TJEH 3UBXB 3RWCA 4J2XA 4FQQB 1CL7L 5CILL 4YWGL 1NFDF 1Y0LB 5E99H 1FFNB 2X6MA 5DJYB 3RWHA 2YXFA 3RWCB 1OT2A 2MCG1 3B5GA 4G6JH 3GSNA 4U6YA 2CDEA 3RWHB 1OP5H 4G9DB 1JHKL 3GSNB 3RDTA 2CDEB 3VFPB 1BFSA 2Z31C 5I19H 5BCAA 4MVBD 1P7KA 2AKRA 3LSOA 4JM2A 3RDTB 2VWEE 1B4JL 2KKQA 3LKSB 2CRIA 1YJDL 2VLKE 1EO8H 4M62H 5EOCJ 1OD7A 4N90E 2AKRB 4DEPC 1U8IA 3LSOB 4JM2B 1S8DA 5A43C 1PQZB 1IAIH 1UCBH 4OCYH 3UTTA 3NA9L 1N8ZA 4JRXE 4C83B 4MCYB 2EDYA 1RZ8A 3TESA 5CINH 4NKIH 2R8SH 1LP9A 3UTTB 1N8ZB 3F12A 4DGYH 3QUMA 3F12B 4HCRL 3RZCC 2HN7B 4HWBH 3TA3D 4XGZA 4I2XB 5IGXH 2FO1A 4LQ1A 1A22B 1U8NA 2XA3A 3O6MH 3QUMB 3LD8B 5DFWH 4FQJH 3QXWA 4IRSA 4N0FB 2ICEA 4JZOB 3D0LA 3U7YH 4BH7A 2GT9A 4OLXL 2BOBB 3FQNA 4V1DD 4IBLT 5LBSH 5C08D 4JR9L 4DFIA 2ICEB 4ZS7L 4WFHD 1YQVH 4WTWA 3D0LB 4LF3A 4BH7B 1AY1H 4ZO7A 3FQNB 4RFNC 1N6VA 1G7HA 4KV5E 4Z0BH 5CFHA 2JJSC 1V3JA 4ZFOL 4LF3B 4GQPH 5HHMD 1IBGL 4NKQB 3O3EB 4XPBH 5DC4B 1G7HB 1S5IH 2LTQB 4LQFH 3MXVL 3QG6A 5DS8A 1L6XA 1U3HC 1JGVL 3UTSE 2EC8A 3SO5A 1MH5A 4PJGE 1J0HA 2FEEI 3LMJL 2R29L 5DS8B 1OAQL 4MWFA 2IBZX 2YPVL 4M02A 4H1LA 4J3WA 3DGCR 5EUOA 3GMMA 4XPTL 4ZO6A 5JDSB 3BGMA 4HKZA 1CD9B 4UQ2A 5E24E 2WQ8A 2NXZC 3B4NA 4H1LB 5EUOB 2UWEE 3GMMB 3V5KA 3GHBL 3E2HC 4OFDA 4OFYA 3QQ3A 3BKCL 1M05A 3BH9A 5D1QD 3BGMB 2QADC 4HKZB 4JFXA 4UQ2B 5MEPA 3VWKA 4JFDA 2XRAL 3L5HA 4U1GC 2RHEA 1D6VL 1Z9MA 4JFXB 5GGUB 4K9EC 4XP9L 5DT1L 1IEAA 3TO4C 5JW5B 4NCC2 1WIOA 5D1ZD 4R2GB 3C6LD 3K81A 2D31A 3BP6B 5IBLD 5E2JA 1NCBH 1RZFL 3KYKL 3SN6N 4WEMB 3VXUA 4FFZL 1AGFA 5C09B 1TZIA 1R3JA 2D31B 1Q1JL 1IRAY 5CSZA 1W72A 1AGFB 2W0PA 1MCHA 4KZDH 1TZIB 1TZGH 2VR5A 2XTJB 4RGMB 5HHQA 5CBAA 4H5SA 5CSZB 3C6SA 3G5ZA 5K59F 3PDGA 1T3FA 1TJGL 5HHQB 2Y07L 2Z8RA 2DF3A 4HWZB 5GGQH 1T3FB 1NFKA 2HT2D 3HC3H 3BHBA 5CSBA 1CF8L 3ZO0A 4JZNA 4HDIB 3U46A 2IG2H 3ARED 5CZVH 5FB8A 4LRNL 5SWZE 2BFVH 1LEIA 3BHBB 3TZVA 3MJ9H 4JZNB 5L8JB 2EZ0C 2Z4QA 3U46B 1HINH 5FHBH 4GBXC 1H15A 1IGML 1LEIB 3H9SD 4PB0L 1IKNA 4WTXA 4ZNEE 4NKMB 1IM9D 1DEEB 2Z4QB 1SBBA 3EFDL 1H15B 3QHFH 1FCCA 5HI3D 2FL5A 4Z76A 1OQOA 4Z7OE 1T7VA 2EH7H 1GRWA 3U9PL 3G6JE 3FN3A 5DUML 2FL5B 2O5YL 2R0KL 1F4HA 2DQUL 2F53E 5HDLA 4Z76B 5F6IB 3O2WH 1R3IH 4XP5L 1K5NB 5CKAA 1K85A 5E0QA 2ESVA 4MB5A 2RBLA 3SDAA 2VWEC 2FWOB 2B1HL 5K9QG 1EIBA 1CFVL 2ESVB 1OGAD 2QQKL 3SDAB 3D2UB 3F6IA 2QV2A 1QBAA 3MA9L 2WZPD 2VZOA 3I6KA 4QGTA 1HCVA 4LVNB 4H88L 3UJIL 4XVJH 3MRRB 3I6KB 4NZRL 1WZ1H 1ZT4B 4JFHE 1BAFL 4GAGH 5F1NA 2OK0H 3MRIA 4QO1A 4CVZA 3VXPA 5F1NB 1CLYL 5ILTH 3SDDC 3MRIB 4GG8A 1FL6A 3QPQD 4JY5H 2AJXH 1GIGL 3I75A 1S9YB 3VGGA 4CVZB 4RDQF 3VXPB 1S78C 3ZDZE 3CUPA 1D5BA 2EE2A 1FL6B 2ZP0T 1WQVT 3I75B 5ADOL 4Y4HB 2I60L 1MFEH 1PG7L 2E3VA 4R9HA 1D5BB 3LN5A 4DZ8A 4U1IA 5IBTL 2ZKHH 3FMGL 1IM3B 1E4KA 2AEPH 2YRZA 3QEQE 3AC0A 1R3HA 2HT4D 4FNLH 5CD5C 3BZ4B 3W39A 3CD4A 1UQSA 3LN5B 4EQ3A 3IDNA 4DZ8B 2DQIL 1KTRL 2CPCA 4OLZH 3DX9A 1R3HB 3W39B 2QHRH 1UQSB 4LSVL 5TE6H 1OAKL 1EHLL 4HXAL 3V7MA 1AXIB 2NX5E 1U8QA 4M93C 5EO1A 4NUJA 4CMHC 3JVGC 2A38A 3H6JA 3HZVB 4JG0H 1T6VN 1U8QB 4NUJB 1HQRB 1R3LA 1F90L 3MFGB 4WWID 4OD2A 4GKNB 2DIBA 4Y88A 4K7FA 4AMKH 5EA0L 4KJPD 3MNWA 1FFOA 3TH3T 3N1GC 1ZTXL 4X5WA 2CQVA 3MNWB 3NPSC 4KV5F 2XN9D 5LWYH 5MHSD 1C5CL 1FN4A 2Y36H 1G0DA 4BQ8A 2HT3C 4BM7A 1Z2KA 1FN4B 4OZFH 4PJGF 1YN7A 5DHYA 1QNZH 3MLXH 1L7TH 1QRND 4PR5A 1CXFA 1YN7B 3VXSB 1N4XL 1DN2A 4PR5B 1NLDH 4ZG1A 5C71A 4JFQA 2UWEF 2I26N 4ZOBA 3P4LA 2B39A 4KK6D 4RX4D 2AEIT 4OJFL 3VU2A 4JFQB 2ARWA 4X4MA 4PGZA 1S5HA 3L3IA 4FQIH 1KJ2L 2IANE 2DQHL 1HYRC 1HSAB 3OR6A 5DD0H 2DN7A 4BZ1L 5JLZB 3L3IB 4M5ZH 1JNHA 1AGDA 5EPMA 1Q0XL 5ICXB 5IEHA 3OR6B 4NO2A 3FOMA 4JGJA 2ARJA 2HRLA 3EDDA 5GZNC 5JXED 1JNHB 1IQWH 1XGUA 15C8L 1KJ3L 4HQQL 4PS4H 5IEHB 2VZSA 2PR4H 2M26A 4NO2B 1T03H 3FOMB 2ARJB 3BRGC 2ZCKL 4L8SC 1S3KH 3SKNA 4WI8A 5CJOH 3KPTA 3LKRA 1FNAA 4KUCD 4PJ9D 3SKNB 3B9KD 1IARB 4R90L 2YC1A 3GZKA 5FDYA 1ZLUH 4U2YA 3F62A 3LKRB 2A77L 2VXQL 1ZMYA 4N0RA 3TA3B 4L5FH 2P48B 2XZCH 2GSGA 2YC1B 1U91A 2YA0A 5C08A 1N2RA 3NOIA 3L1OH 3TT1L 5DHXB 3F7YB 2GSGB 4QRTB 1T4KA 2WUCH 3A6OA 3RZWA 4NJAL 4V1DB 5C08B 4I9WD 4OBRA 4DGIH 5L7XH 3DO7B 4W6XB 1NGPH 1T4KB 1ZE3C 1CL7H 5HD8D 3L7FB 5K33A 3PP3K 5EBLA 4FQ2H 1I1YA 3UDWC 3BSZL 3PF2A 4JQIH 3NH7L 5HHMB 3TYFB 4Z7OF 5EBLB 3G6JF 1FIEA 1I1YB 2V2WA 3ILPA 2EIEA 1F4XH 1PD6A 1JHKH 1GOFA 3U4AA 1ZVYA 3QO0B 5E5UB 5I1HH 1QPXA 3P4NB 5DO2C 3BKJL 1OWWA 2V2WB 4P23C 3ILPB 1R3KA 1TMCB 2BVQA 1B4JH 3HCVA 5D1QA 1R3KB 2APVA 2VSCA 2BVQB 4HW6A 1DBBH 1P4LA 5D7LD 5D1QB 3HAEG 1RIHH 4KAQL 3DIFA 1RUPL 2E7LC 4O51B 2JF1A 4E42A 2FJGA 1JWMA 3OF6A 3ARBC 1XGTA 1F02I 3ZKSD 1U58B 4LFHG 4XRCA 2X4TA 3DIFB 4PP1C 1FVCA 5D1ZB 1JWMB 1XGTB 3C6LB 3BKYH 1AR2A 3NABL 5DTFB 4JPKH 3RNQA 5CBEB 2OP4L 5E9DD 1T7ZA 3GUTA 1LP9E 5CJBA 4NWTH 4GRWH 3BRDA 5EFIB 1MOEA 2W65A 4FXGB 3ZDZF 3O9WD 1ZGLA 4TRPH 4M43L 3M07A 2W65B 1ZGLB 4JR9H 3B9DA 3I84A 3WFHA 3QUYD 4Q9CA 1DQJB 1PAMA 5T5FL 4XAKE 2OZ4A 1KYOJ 3VXNA 3WFHB 5ID0A 3ZYOA 1NCCH 4HUWA 5KSAC 1EUUA 4KZEL 4MCZB 2IH3B 1IBGH 3KPSD 4MD5A 3VXNB 1VFAA 5ID0B 3OZ9H 3Q5TA 3AREB 4HUWB 4LEOA 5D4QA 4UIMA 2PW1B 1JGVH 3B5TA 2C3XA 3H9SA 4UU9A 4WEBL 5C86A 4MD5B 3LMJH 4LEOB 5F1KC 1OAQH 2WIIB 1AXSA 2RB8A 1KCUL 3H9SB 3BYTA 2VXUL 2YPVH 3FO0L 4UU9B 1PG7W 5HVGB 3U1SH 4K2UL 4H8WC 1IM9B 1OLZA 4CN4A 2NY6C 4XPTH 4F9LA 3IRZA 5GISL 1I9RH 2OR7A 3VFUA 1G6VK 4TSCL 4HPOL 2HFTA 3TNMA 3GHBH 4P2RD 3NMEA 3VFUB 3JUYA 2QEJA 4HEME 1OAYL 3TNMB 4ONFL 3LPWA 5GRUL 4NQDA 4HFUL 3DV6A 4IOFC 4JQVC 3CH1B 1OGAA 4FQCH 4ZPTA 4PRAA 5BS0D 3NZHH 5D1XD 1LILA 3DV6B 3GJFK 4JFDE 1OGAB 4ZPTB 1X44A 1RY7B 3KVQA 2Q3ZA 4PLKC 3RNKB 3HE6A 3DARA 3K8MA 5IV2A 5I1AA 4X5XB 4XBGB 5I18H 4YHNA 4P57A 2VTFA 4JG1L 2JJTA 5IV2B 3MCLH 4LFHD 1NBYA 4P5TD 2WQRA 4U6HA 3ULSA 3VXUE 4YHNB 4Y8DC 3A0OA 3OKMA 2ZPKL 2XWBB 2Z0BA 2WSKA 2XTJE 3C09B 4YNYA 5ERWA 1NBYB 2DQJH 3EYQD 5T1LD 2Y07H 4PJEA 4U6HB 3ULSB 4J12A 1GC1L 1TVDA 2VXSH 4LVHC 3OKMB 4YNYB 5E5RB 5ERWB 3SOBH 1A1NA 3N1PC 3ZE1E 5I8CA 1BGXL 2JELH 3WS6C 2LQRA 3JWOH 2CH8A 4L1DA 4PJEB 3HG1D 3CDCA 5FYJD 4Q9RL 5I8CB 1A1NB 1IEBA 1YECH 4RWHA 5GIRA 2NW3B 5I66A 3Q48A 3BD3A 4NQSB 5DRZB 1ITBB 5FYKU 1WLHA 3P40A 5FO9A 1QZ1A 4YR6A 2X4UA 5I66B 43CAA 3QRGH 4JQXC 1JK8A 2BX5A 3LKNA 5FO9B 2X4UB 4ZUTB 4WGWB 5MEQA 5F96H 3TBVA 3QEGL 1MHCA 4JM4H 1NUNB 3QNYA 43CAB 4CADA 1JK8B 4O58L 5AWNL 3PXHA 2X1PA 5MEQB 2V2TA 1FZKB 3QCTH 4DKAA 1IC5H 2X10A 3QDGD 2V2TB 4LKXA 3VFOA 2ZG1A 4FQ1L 1S7UA 4LDEB 4XX1E 3GSWA 1QHPA 1JPST 4ZTPH 1ACYH 1KN2H 2WINA 4K94C 3SGKA 2ESVE 4P99A 2GJ6B 3ZE2E 4M1DH 1S7UB 2WLYA 5CCKL 3MNZA 4JM2C 3ARVA 1MCIA 2WINB 3O11B 2HAZA 3QCVL 2ITDB 2XN9A 4NQCB 3UX9B 3MLYL 4XAWL 2ZCLH 4KTDL 5IVXA 2XN9B 4YHOH 2FR4A 5HI4D 2DM7A 3ARYA 4CKVX 2PCPA 1TCRA 3MRPA 5IVXB 2FR4B 4J8RA 1QRNA 2BVYA 1R5WA 1TCRB 2PCPB 1CDJA 3LDBC 3MRPB 3P11H 2E6QA 3X14A 1S7XB 4J8RB 3MUJA 1QRNB 4QRRE 1R5WB 4R7DA 4NNXB 4X9FA 3WSQL 2AVGA 3RVWC 5IBTH 4LLMA 3VXTA 4RX4A 4R7DB 3FO2A 4G42B 4IRSC 4CVWA 4LLWA 4JM2F 3FB6A 3FO2B 3QHTC 3BFOA 4QXGL 4UTAH 3CZJA 2GHWB 4LLWB 1FJ1A 4ZODA 3FB6B 4XVTH 1MFDH 1KNOA 4UOW1 1EHLH 1FGVH 4HXAH 5GGSA 4BFIA 1FJ1B 4G8FA 3MOAL 5HGAA 1KNOB 1LP9F 5GGSB 1JPTH 2RCSL 2X1QA 4G8FB 5FM4A 3MRNA 5FEBA 2X1OA 4PRIB 4WI5A 2MQ3A 3TWCH 5EZIH 3B9KA 5EA0H 5KW9L 1D5ZA 2DQEH 5T3XE 1CYGA 1F3RB 3PNWA 4PJ9B 4PRPE 3B9KB 3QDJD 5TQ0L 4C54A 1D5ZB 3EDEA 1SJVA 1CFQA 4XWGH 4EI6A 4X8JA 3VWKC 3TEUA 1FH5L 3IF1A 4MXVE 5DK2B 4NDMB 1KTKE 1CFQB 4R2GC 4YDLC 4EI6B 2YZ1A 4Y5YA 2DIJA 4X8JB 1IVLA 4OZFG 3IF1B 1J5OH 4JO4L 5F70A 1AGBA 4IHOA 3JBG7 1RUKL 3AS2A 4CVUA 2PYEA 1CDCA 2EC9T 3HB3C 4B50A 1WEJL 3REVA 1MLBB 3KJ6L 2XTJC 4GAFB 5I1CH 1LO0H 2F19L 4U2ZA 4LCCC 3W9DA 2FD6L 2CK2A 1L0QA 2LU7A 3OV6A 4J3SA 1KJ2H 1J1OL 2DQDH 4Y19D 3V6ZA 3ARTA 3ILQC 1DFBH 1QKZL 3G9AB 3C2SA 5D7LA 1CLOH 1NCUA 3KPRD 4A6YA 4LPXA 4XXDA 1FLTX 2DLFL 3CXHJ 3V6ZB 3BE1L 1XGQB 4NJ9H 4LASH 3O81A 4FQPA 3S8WA 5D7LB 4O9HH 3H8NA 5DK0A 4A6YB 4L3CA 4XXDB 1WT5A 1MHHA 2BSED 3TZVC 5IBUG 1A6PA 5J6HA 2C3VA 5DK0B 5D9SA 4MHHG 1MHHB 4F7CA 5LVEA 2J12B 5J12B 5DEFA 1IKNC 3ALPA 2AJYH 5E9DA 5J6HB 2C3VB 1RUAL 3DPBA 1VHPA 3WN5B 2JCCE 3MLUL 4F7CB 5HHVH 3QISA 3HNVH 3BQUC 3P4OA 2JE8A 5E9DB 3SEPA 4K9EL 3O9WA 4P5MA 4RZCA 1KCRL 3ZE1F 3VG0L 2CO6B 1NGWA 1RJCA 1ROWA 3B2VL 3P4OB 2VDLL 1FRGL 4L8DA 1X5LA 2XACC 4LPVA 1K6QH 3O9WB 4P5MB 4RZCB 3QUYA 1G7QA 5JQHC 2OQJB 1NGWB 1WFTA 3W0WD 5FUZL 4G6AD 4L8DB 3ZYZA 3KLDA 4NJAH 2J2ZA 1U8MB 2D7NA 5JUEL 3AS1A 4HUVB 3QUYB 5HHPB 3VJ6A 1D9KC 5E70A 4OD1H 5CP3A 4HMCA 3BUYA 2CRMA 3KPSA 4TVPD 2VLLA 1P7HL 5D71L 1FYTE 4Y89A 3T3PE 3BUYB 3KPSB 2YD1A 1MRCH 4S10A 2KBGA 5HHME 4O5LH 2DKMA 2X5PA 4H0GA 5C2BH 4CBPA 5CJXA 2DM4A 4UT9H 1ZANL 4KJWC 4CDGC 1L9NA 3DO3A 4YFDB 3BO8A 1I8IA 4P2RA 5DC0A 3RX8A 2QJDA 3ARXA 2EDHA 1I8IB 3ZE2F 3ZL4H 1AFVL 5CS7A 5BS0A 3RVXD 3EGSA 3I3BA 3KJ4B 5A40E 1MCNA 5BS0B 5DRXA 3T2NH 5D1XB 3EGSB 4YHKH 4XMLH 1MQKH 2C26A 1QPPA 1UGNA 3NABH 5CEZE 4RFEB 1I1AD 5DVOA 4HULB 3HAEB 2BNRA 5SV3A 1G9MH 1PEWA 4KPHL 4EOWH 4P5TA 5T3ZD 4S0TD 5FYKL 3VGAB 1MAML 4YHLH 4TUJA 3HI6H 1EHNA 4P5TB 5T1LA 3RU8H 1UWGH 4N8VA 1DBMH 4HWBA 1ADQA 4TUJB 2AABH 3F6LA 3UTQB 3JUZA 5T1LB 1CT8B 3HG1A 3F7QA 4K3DH 3LQZA 5CKGA 4R97B 2XQYG 1F2QA 3HG1B 4NQXA 1RUQL 3JSSA 4HJGB 3ZT6A 1INEH 1CGSH 3JV0A 4D9LL 4J4PD 4OFPA 1TETL 2JK5A 2VZVA 3A6CH 3IDMB 3OKLA 4LHQB 3FO0H 4Y4FD 5GZOC 5JHDD 1CGWA 2G2RA 5T5NF 2HLFD 3H9SE 1ZA3A 4PJAB 2FLBT 2OLDA 1CVSC 1JGUH 3JV5A 3K2UH 1JF1B 1PX4A 5TGBA 5KSVA 1OTSC 4JO1L 4F57H 2I5YL 5I1GL 5JR1L 4O00A 1RSFA 2VH5H 3QDGA 3SGJA 3X13A 4M7JH 1UM5L 5KSVB 4ONFH 1RI8A 5JA8B 1KCSL 2NY3D 3P0VL 3JV6A 3IJYB 2W9EH 3UEZA 1GOHA 3QDGB 4PJHB 2H9GB 3X13B 1KC5H 4BQ9A 1DBKL 3IT8D 4MXVF 1EEYB 5I0DA 3ULUH 1Q9OA 4JO3H 4NQDE 5DLML 4JGUA 3GBLA 1PX3A 2Q6WA 5CD3A 1CG9A 1OGAE 3Q1SH 3T2QA 3PIQA 1IC4H 4QHKJ 4MHHI 3V5HA 1Q9OB 5CD3B 4GMSL 4M1GL 5DJCA 3DGGB 4RAHA 3PIQB 5DQ9A 3EIFA 3V5HB 2VZUA 4PJ5D 3U4BH 4RNRA 5DJCB 1XCTA 4DFHA 3L5JA 4N68A 1WBYA 1UEMA 5K93A 4PJ7E 2VQ1A 4PRBB 1YEEL 4EI5D 4GAYB 1XCTB 3SE9L 4M6OL 5IJKA 4JFFA 1SBSH 1RUML 2VQ1B 1Z9SA 1TPXB 4S1QH 1DVFA 5IHZA 4JAMB 5FK9A 4PJEE 1B6DA 3GSQA 1GAFL 1A6VL 1QYGH 4ELMA 1BOGB 4XVUD 1YEDA 4I0KA 3GSQB 1RULL 1UM6L 4NGHH 1FAKT 5FUOL 3WJJA 4ELMB 4I1NB 4XH2A 1J05A 4P9ML 5BQ7A 4Q6IC 2N1KA 1ZLSL 4BK5A 3MJ9A 4NKDB 4XH2B 4LHUG 3PL6D 1UH4A 4LSPH 2JJWA 3DMMD 1J05B 3S3JA 5BQ7B 2A83B 2WWMC 2APXA 4M7LL 1HDMA 2VDNL 5GRJL 1LK3H 2PKDA 2JCCF 2YPLD 4OQTL 1A0QL 1JI1A 1HDMB 1HKFA 2YEZA 3H42L 5E2VL 4YFEA 4I77L 4LLVA 3F7VA 4FTVD 1AXTL 4HLJA 2YEZB 1SY6H 4LLDA 4W6YB 5CP7A 4DN4H 1JPGA 4ZD3H 4LLVB 3QDJA 3F7VB 4PGDB 4BZYA 1QFPA 1CXIA 4QHNA 4U49A 3QCVH 5CP7B 4X0KB 2D3VA 4BFBD 4TQEH 3HMXL 3QDJB 3ZZ1A 1N0XH 4MGXA 4WV1A 1FFPA 4QHNB 5F9WB 3D39D 2CIKA 2IH1B 3T3PF 1F3DJ 3EOTH 3RTQA 3OR7B 4WV1B 1FFPB 1T5XA 12E8H 4YLQT 5J89A 3QWOA 1UJ3A 1B2WH 2CIKB 2ZNWA 3U6RA 1BJ1J 3W81A 2IPUG 3OAUL 5I6XC 1LO5A 4MAYD 1NSNL 1T5XB 3W2DH 2AXJA 2FDBP 3QWOB 4LCWD 3U6RB 2CIIA 1LO5B 1WC7A 2YD3A 4LU5H 5F7FA 4ORZC 1ERNA 1OTUC 4QTHA 2CIIB 4HXBL 4D0DA 3T0ED 1I8MB 1QRNE 2CDFA 4MA8H 5ITBL 2FRGP 1WC7B 3ZKND 4JN1L 4Z9KB 2WAHA 3H2WA 2CDFB 2G9HA 5DJZA 3PWVA 5L9DH 4RMUA 1GGCH 2NXYD 1CQKA 5DF0A 3VI3E 5AAMA 4GXVH 5FAAA 2G9HB 3KPRA 5DJZB 3IFNL 4Y19B 5C2UB 2R9HC 2LU3A 3ARFD 1OHQA 1WGOA 3KPRB 1TVBA 4NPYA 4Z7NE 1FE8H 4LVEA 1MRDL 2DQCL 3QEHA 2X89D 2DTMH 3NZ8A 1JZ8A 3VW3L 35C8L 4NPYB 4LHUD 5I75B 1QEWA 2E27L 1A5FL 3QEHB 5GS0D 3NZ8B 1ETZA 1I75A 3PGFH 1QEWB 2H8PA 3DURB 7CGTA 4F9LC 1MF2L 5E2WH 2WUBH 4PFEA 1BD2A 4LSSH 2LE9A 3FQUB 4KRLB 3GBNH 5L6YH 3EO1A 4HUXA 1Z6JT 3W0WA 3SGEH 1MEXL 1TJHL 5FYLH 1MWAL 2DLTA 4HUXB 1U41A 5I15L 3W0WB 3ISWA 4OUUB 5TQ2L 4OV5A 2BHZA 2A1WH 4WEUD 1WEJH 5E1AA 3HE6C 3QYCA 4I9WE 3IDXL 1EVTC 3KJ6H 4OZFA 5BVPL 2J6EH 2NTSP 3RBGA 1S7VB 5E1AB 2F19H 2JJTC 4XP4H 2PYEE 4OZFB 1YMMB 1H0DB 5LGKA 1LNUA 3BP4A 4OI8A 5DQJA 2VDKL 3MGOB 3MJ6A 3RGVD 4HZAA 5ETUA 5IR1B 1MJUH 1LNUB 1CCZA 3I6GB 2NW2A 3QZWG 3QIBD 2GSIA 4CW1A 4NZUL 1YY8A 1IGJA 2AJSL 2IAMB 3D0VA 3C8KB 4H8WL 4NRZB 1EVUA 1KPVB 2R2EA 5D7KE 3D1MC 4A2LA 4PV9B 2FECI 1YY8B 2UVEA 3JXAA 2HT4C 4OT1L 2BMKA 4LRIC 5D7LE 3PWJA 3FB7A 3PWJB 1I1AA 4NCDA 1A7RH 1RUAH 2C4FT 2CUMA 3VG9C 5K9JL 3PWLA 5I8EA 3BGFB 1CICD 4PJ7F 3FB7B 3WE6B 5SX5K 1I1AB 5DMKA 4AEHL 3PWLB 5IBUB 5D70H 3PV6A 3ZTJG 1WITA 1WK0A 1KSRA 1MCRA 3OAZK 5BV7B 1X7QA 2QSCH 4PJEF 1A4KB 3PV6B 2YK1L 5FUZH 1F11A 1H3PH 2ICWI 4MJ2A 1X7QB 1U3YA 1U8JA 4KJPC 1F11B 3M8OL 4K3JH 3MREB 1ZWIB 5D71H 3WIIL 3G5VA 4UV4L 1RZKC 1U8JB 3V0WL 4KRPD 1MCPH 4MXQC 4AH2A 4YHYB 5TE7H 4PGEA 4Y4FA 4KI5D 2EDKA 5JHDA 3F5WB 4AH2B 5KVDH 3TV3L 2EIDA 2IF7A 4KKNA 4Y4FB 5JHDB 5IESH 3DUHA 1CE6A 1EMTL 1GZQA 3I85A 3DI2B 1N7ML 1NAMB 5FA3A 2ZUUA 4E9LA 1GHFL 1GZQB 2BDNH 1DANT 4ZS6D 1JNNH 4MD4A 4G8GD 4P2RE 1JNLL 1R5VA 5FA3B 4K7PL 2NY3B 2IGFL 1FO0H 1HWHB 1XGPA 5AZEL 4XMPH 4XI5C 2P8PA 4M8QA 5E94A 2NY5C 4KFZC 2DBLH 5BS0E 3QUZD 3GSNL 1XGPB 1NDMA 2P8PB 1IAOA 4M8QB 5E94B 1I3UA 4G3YL 2FBOJ 1RIUH 5FYKH 4PJ5A 2G5RA 3D9AL 4K94L 4I3RH 4NN6C 4S1DD 4U7SA 4TOYH 4WNQA 2UYLA 2R1YB 4KKLD 4LPTA 3U2SB 4PJ5B 4FG6C 2BNRE 3AMKA 4F2MA 4HF5L 4WNQB 1VACB 2UYLB 3A6BL 3IKKA 1U0QA 4XMKH 5D6DA 5JPNA 3MBXL 4LARH 2AEQH 4Z18A 4EI5B 2ZNXA 5FDWB 4GRWB 3VXQA 4F2MB 4HIIA 3WKML 2I27N 1HHHA 2KZ1B 5I30L 1K8DA 2XZAH 3VI3F 1V7ML 2OTPA 5JPNB 2Q3AA 3VXQB 1V7NL 3VXRE 4HIIB 4XNQA 2IBGA 2YD8A 4FFWC 1HHHB 5EZLA 1K8DB 1FNSL 2ATPA 1TETH 3HG1E 2UUDK 4UOW0 3RY6A 2YUWA 4XNQB 1MCLA 3HNSL 5EZLB 4Z7NF 4ENED 2ATPB 3AUVA 3QUML 1DE4B 1ZEAL 5JMRA 1WICA 2XY1A 4Y5YC 2CDGA 3PL6A 3DMMA 3E6FA 4AEIL 4OCLC 3EUUA 4P3DA 1G9NH 5HD8C 5J0BA 2J1KA 1IILE 5DEGB 5GSVB 2C1OA 2CDGB 3PL6B 4RMSA 4YH6A 3IJHB 3DMMB 5DYOA 2YPLA 4PTTA 5JR1H 5EZOL 2CXKA 2VLRD 3R06A 1UM5H 1HCFX 3RI5F 1KCSH 5DYOB 2YPLB 4PTTB 1KCLA 4FTVA 4KUCF 4MXWH 5GGRY 3R06B 1Q94A 4RMWA 1XIWD 2FHFA 2J8OA 4KMTL 3QDGE 4FTVB 4URTB 1TXKA 3TIEA 5E6YA 2L0DA 3VXOA 1NBZA 5HGDA 4MDIB 3VXOB 2AXHA 3MLVH 1NBZB 5HGDB 5GGVL 1OAZH 4G6ML 5IHLB 3ABZA 1UB6B 4JVWA 4RBPH 4G43A 3D39B 4WY7L 4UT6H 2BOCB 2NLJA 2CK0H 1WT5C 2J88H 3MFFA 5HHOD 1LDPL 5ANMA 1IFHL 5EWIL 4G43B 4OB5H 1GH7A 3OXRA 4JY4A 2NLJB 3MFFB 4DW2L 2GAZB 4MAYB 3HMWL 5ANMB 3A67H 4Y2DD 4Z7UA 5IEKA 3OXRB 4JY4B 4LCWB 1QFUH 1LK2B 1QFWM 2F5AH 5LQBL 2VJXA 5FV1L 3IDIA 4IMLB 4Z7UB 5ACZB 5E03A 3RFZC 2DKSA 3T0EB 5D2NA 4JFFE 1UM6H 5BVJA 1KGCD 2BY1A 3QUYC 2P24A 1OARL 3P0YH 4ELME 2Z93A 2NXYB 3QWQB 5BVJB 1P7QA