5HDQH

Mntc co-structure with mab 305-78-7
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
213
Chain Sequence
QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVQQRPGQGLEWIGYINPSSDYTKYNQKFKDKATMTADKSSSTAYMQLSSLTSEDSAVYYCARKEDVGYWYFDFWGTGTTVTVSSAKTTPPSVYPLAPSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/immune system
molecule keywords ABC transporter substrate-binding protein
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 49
structure length 213
sequence length 220
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqH02
5JW4N 4FFVC 5FYKD 2YD5A 3JWDL 4JFZH 4JRYE 5DLMH 1J8KA 3EYFB 1QPPA 5F89A 3WD5H 1CE6B 1CLYH 1B0GA 4X4XB 5F9WC 4DVRH 5SWZA 3L3JA 3O4LE 4QLRA 3PWPA 1U3JA 1MCEA 4ZS7L 4U1NA 4WY7H 5DEFB 3RX7A 4PRPD 4X6BA 4Q9RH 3RWGB 4M7ZC 4B41A 5EBLB 1FFNB 3OKKA 2FO1A 4X6CE 2XZQL 4UT6H 3OKNA 4XMPL 1MVUB 3OAZK 4Q2ZA 3RIFK 1QR4A 3R0NA 5T5NG 4Y2DA 4KDWA 4DK6A 5A2LH 5EFIA 43C9B 1DEEB 1NBYA 5A2FA 1L7IL 4OIIL 3VU2A 3SPVA 4U6VL 2HFGH 3T8XA 4Q9CA 5J6HB 3F7RA 2J5LC 4DZ8A 4YC2B 1S78C 5EU3B 1ZGLP 5K9KA 1G7LB 4RMVA 3BKMH 3KPSD 4HCRL 3MLRH 3MSPA 2IPUK 4PTUA 3CFEB 4LHUA 4G8GA 4P4RB 4P99A 4OLXL 1N6QL 1WIPA 1N5AB 4RGOH 3O6FC 1JV5B 3Q1SL 2EIZB 3UTOA 3C2AH 1UG9A 4HK0A 3ESUF 3T2QA 1VENA 1XGTB 3CH1B 5JMOC 4I2XA 3GB7A 3IAPA 3N1QC 2VLJD 2YRZA 4NQSB 4PRHE 5EORH 3HE6D 4P57A 4MCYA 4KMTH 3MLXH 2EYTA 3RL2A 3VXOA 4ZFGL 2G60L 4GFTB 4ZNEE 3MMEA 4J1UB 4A2LA 1DQLL 4OD2B 3ULVL 4OUOA 3V4VL 5BMFL 3EO9H 4NIKB 1I8LA 4BH7A 4ZFOA 2CDEA 5CJ8A 5KSUB 3RWCB 3NH7H 4L4TE 4PR5B 1YEJL 1XGPB 1EAPA 5HHVL 3EYUL 3DX8A 4OZ4A 4X99A 4ZFZA 4Z78B 5B39B 3AS0A 3M07A 1CI5A 1QFOA 1G9EA 3Q2CA 3GBNH 4FS0A 5E95B 1RHHB 2PW2B 3C6LD 3GDBA 1N6VA 2VZVA 5HI5D 1N5YH 4LIQE 2HA1A 1YDPA 1DVFA 2E27L 4DKEL 3L7FA 5SX4I 1V5JA 3K74B 2NNAA 4PGCA 5DQ9B 1Q9LB 1EBPA 3MBXL 4GRWE 4OLWL 1U58A 1D5MB 43CAA 4PJBB 4M62L 2NY3B 4G7VL 4KGJA 3RVXD 2ZUQC 4KHTH 1NAMA 3HR6A 4TULL 1EGJA 4HIXL 3MGTA 3LDBB 5TPWL 2GK0B 4LLYA 4HG4K 4JZJB 3KLAA 4U1KB 4AEEA 2F58L 4NNXA 1P2CB 2EH7L 4UNTA 3WDJA 2AJZA 3P4OA 4Y2DC 1FC1A 5FYJD 4UQ3A 2APFA 4J4PA 3VXTA 4KDTA 1U0QA 2DL2A 4RAUB 1UM6H 1N2RB 3F8UB 2WBJA 2NXZC 4P2OA 4PJHE 5F9OL 4P5MB 2ZKHH 3PDGA 1FORL 3DMMA 3IDIA 5DJYA 1PSKH 3WNMA 3LEVH 3EDJA 3K4DA 3BZEA 4MA7H 4X6FA 4XP5L 4JB9L 4P23B 5IHLB 4IM8A 3BWUC 4NNYA 5F70A 2Y7QB 1F4WL 5KANI 2APTA 4K3EH 1W72H 3PHQB 5HGHA 3BESR 1LO4H 5GRXG 5HGBB 1RK1B 4KZEL 2FGWL 1Q1JL 1CGSH 3BP7B 2DBLH 1JGLL 3HE7B 3VFUA 1N3NB 4B7IA 4BQCA 2APBA 1RIVL 1NC2D 1SJHA 2J88L 3UO1H 1NUNB 2W1NA 3IXAB 3D85B 5F1NB 1S9WA 3H9SE 3PG2A 2JCCF 3B8SA 3MV9E 1OAKL 4BH8B 5EBGA 1A6VH 5MEND 4QHMA 3IKKA 2PW1B 2VDRH 5ABDE 1SJVA 4YDJA 4TQEL 4OZIF 1FE8H 4G5ZH 2ARJB 2OTWA 1EFXA 4JFED 2AQ1A 5EN2B 4O58L 4WI6A 3GSUB 2JJVA 5D71L 3BKJL 3P9LB 5EDXA 2H9GA 4GKZB 9CGTA 1A6ZA 5SWQB 2NQCA 3WCYA 1C5CL 5E4IA 1VADB 4HFUL 3E8UL 4TPRH 2VWEE 1NAMH 3UTZA 4H8WL 1EGJH 2FJGB 3SE8H 3GSQA 4MQXC 3HG1A 3IFPB 5FFLA 2D2OA 3IJHB 4Z7UF 4A6YH 1QSED 4X4ZA 1QBBA 2Y25A 2NX5D 1OP3K 2ZG2A 4JVUA 4OGZA 4Y4HB 3UC0L 1DVFC 1KIRB 1FNFA 1TVHA 1DDHB 3DV6A 4OCRH 1PEWA 1V3LA 4PY8J 3C5ZB 4MHHG 3Q48A 5T1LB 1Q72L 3BP6B 5CBAB 2XYCA 2JJTA 3S35X 4XP4L 4CADB 1DFBH 1UH2A 1TZGH 4UI2A 3JTSA 4ZXBD 2RCSL 1B0WA 3U82B 4Q6IB 4JRXA 2FEDD 4RA0C 5DD1H 1I8MB 3QO1A 4NQUA 1IZKA 4HUWB 2OZ4L 5EZJA 3H7BB 4WIQA 4KRMB 3RAJL 3SKUD 2A83B 1FZMB 5BO1H 4L4VE 2VDOH 3PWJA 1X7QB 2OYPA 1JPGA 4HKBA 2VR5A 1NUFA 1P6AB 3DOSA 4GKSB 4X5XA 5EC1B 4NP4H 1UXSA 4J4PC 1CXEA 4XP1H 12E8H 1T1YA 3L6FB 1XGQB 2NY2C 4Z77A 3E1F1 3WS3B 5E70A 5EUKB 1F4AA 2WBJC 1Q9OB 2FSEA 3HRZA 3DPBA 4RQQA 2PKDA 4D0DB 5CJOL 4L9DA 3TBYB 1QFHA 5ICYB 4BFBD 4Q0XL 1NMAH 2AK1H 3B83A 3HZYA 3ZZ1A 1DBJH 4IS6B 4YPJA 1S7VA 3FCTA 3QCTL 4HIIB 3DGGA 4NQCD 4XGZB 1A3RL 1R5VB 5C8JB 5L6YL 5DD3L 5EC2A 1XCTB 3DO7A 3D0VA 1NDGB 2YWZA 1VFUA 5JO5A 5DT1H 1S8DA 5ACZA 2N56A 4HWBH 4JFYA 1OSZA 4LSQL 4TVPE 1IC1A 4MA3A 1RZJC 2VJXA 3QI9D 2P5WE 1KCRL 4KVCL 2ATKA 2BSSB 5HHQB 4OZFH 4NUJA 3H42L 1YEHH 2ICEB 1I9JL 2FATL 5GGQL 2V2TB 4D9QD 2V7HA 2MMXA 4G80A 3U30C 2P4AB 3C8KA 2FD6L 3Q0HA 4JGMA 4ODHL 1AR1C 3WJLA 1ZE3C 3MV8B 3D39E 4PG2C 4LKXB 1YMHB 4PRPA 4LU5H 3MRRB 3UYPA 1JGVL 5E99H 3MXVL 2OL3L 2QKIB 4DFIA 1IC7H 1T1WA 1U95B 4DOHE 3QP3A 5EO1A 2VQUA 5C0BB 3SO3B 5JHDA 3R1GH 1UYWH 4JFXA 2WZPD 3D5OF 5I1DB 5D7SL 3SGEI 3QEQD 1NBVL 4OKVB 4LLMB 1IGMH 1N8ZB 1KELL 2W9EH 2R23B 3MLVL 3MC0A 4K8RL 3QDHA 1PW3A 3KPSA 1KJMB 3MOBH 4LPTA 1KIPB 3LH2H 4JFPA 1FGNL 3MBEB 1IEHA 3B5GA 4NJAH 3T4YA 2YD3A 3BAEH 2H2PC 3DSFL 5BRZD 3NN8A 4A2MA 3BD3A 2GQHA 2NTFB 4KUCF 2JIXD 5M7QA 2HYMA 2LU7A 4PJIB 3SQOL 4YHLL 2ZSWB 4Y16D 2HLFC 4NQED 4NFBA 3RWDA 1K2DB 2EE2A 1MHCA 2OLDA 3BKCH 2CRIA 4XTRC 2VLJA 2VDNH 5CEZL 1EXUA 2Y6SD 3OHXA 3TVMB 1K85A 2YKLL 4G8IA 3OR7B 1S3KH 4HS8L 1TJGL 5C0AE 3CFJA 1A0QL 4PG9A 1P4IL 4PJGB 4N90D 3GJFA 3U7YH 5GZND 5MP6H 3BH9A 3O4OB 2QSCL 3QIWD 4CN6A 1OCWH 1A3LH 4OLZL 3U4AA 2KUTA 3CJJA 4MNHA 4WW2C 5F7UA 4KJPD 1NCAL 3BJ91 1ZT1A 4JDZB 4JY5L 1GHFH 2QSVA 5CWSA 2AJUH 3G6JE 2HT2D 3ZDXE 4M61B 1LE9B 4LVEA 1OTUD 2FGZA 5IQ7H 3C6LA 1JZ7A 3PP3H 3SDCA 4NOFA 1G7MA 1G7HB 3QH3B 1L6XA 5TH2A 2NR6C 1CGVA 1R6VA 2DQJH 2HAZA 3DROA 3ZSTA 2PYED 4QNPE 5AYUH 4OF0A 2AVGA 1CICC 5I6XB 4HKJB 2B1AH 5E8NA 3AB0B 5GS3A 1A22B 1R3HB 1J1XL 4U1HB 3WFBH 3VWJD 3WJLC 3STLB 3SGJA 5AD0B 2AK4B 3DV4A 5CJQH 2UWEA 1RJLB 4JM2D 3CPLA 5DO2D 3PV6B 3B2VH 1CFQB 5SWSD 5TGBB 1EFQA 1Z3GH 3MGOB 3ARSA 1T5XB 3MTRA 1A6TA 5L8KB 2Q86B 3KPLA 1CLZL 1EZVX 5DJDB 3GMRB 1VCAA 4NQXA 3QWOA 1KCVL 4OI7A 2A9MH 2BP3A 4CVXA 4IRZL 5LCVH 1S7SB 2WIIB 2B2XL 3I2CL 4HMCA 4BFGA 3OKEA 4GQPH 4P4KD 2YD2A 2VMFA 4Q9BA 3V0VA 2BOCA 3FONB 5ACLA 2N4IA 2DQEL 5FB8A 1YQVH 3FQTB 2B1HH 4D0BA 1U3HD 4K7PH 1AE6H 4W6WB 3QUYD 3RWHB 5JW4M 1MIMH 2JK5A 1ZGLM 3U79A 4UV7L 5JW3H 3LKOA 3K7UA 4R97C 4EOWL 1YYLH 5J1SC 1VPOL 1KJVA 3TO2A 1NC2A 3UBXB 5DSCB 3KAAA 5IHUH 2X4TA 4XVTH 2W9DH 1QFUH 4DGYL 1NGPH 3QAZC 4YFLI 4LOUC 5EULV 3WFEH 1CFBA 4YBQD 1MFBL 1XF4B 5E5UB 4H1LG 5MENA 1A1MB 3HE6C 5JIKA 5HYSA 4ZO6A 3LN5A 5ECJE 2FLBT 1TPXB 3VFTA 4HFWB 5FYLL 4JFEA 1AFVL 5GGUA 4ERSH 2MQ0A 3MOAL 1DBKL 2OXHA 3OKOB 5JZ7D 3L7EA 4TSBL 2GSGA 5E1HB 4FQXD 1A7BA 1DUZB 4I18B 3X13B 5J13C 1HQRA 1LP9F 4MXQC 4KQ4L 5AZEL 4C56E 5D72H 3QT2A 2EDBA 3C6LC 4G6KL 4O02H 3IJYB 2NX5A 4LQ1A 5C09D 3VGAC 2VZSA 5HI5C 4FFYL 2DD8L 4YUEL 4I77H 5FYJH 3GNML 2L7JA 1EZVY 1ED3B 4N0CD 2DKMA 4J3WA 2KQMA 3FB6B 2VXVL 3QIUD 4OCWL 5JW5A 3U1SL 5HYFA 5L2KB 2CK2A 3ORJA 4EZMA 5LQBL 2XWBA 3P11L 2YMXL 1PBYA 5J11B 1HINL 3RVXC 4ZXBA 4ALAH 1J1OH 8FABA 1XZ0B 4RZCB 2MTPA 4UV4L 4P5TD 2P48B 1KGCE 2UVEA 1F11A 7FABL 1U8HA 5F9DC 3QISA 4FQJL 1U8KB 3MRFA 1GGIH 2NYYD 4MB3A 3P0GB 1ADQA 5EU5B 4Z9KB 4BFEA 1DE4A 2XPGB 5C07B 1BAFL 2VISA 3HC4H 3GMQB 3DLQR 4XNYL 4YO0B 3LRGA 4X6EA 1KT2A 2A9NL 1JTOA 5GJSL 4KJYB 4OT1L 5J06A 2ZOLB 1MHPH 2F19L 1KC5H 1MCDA 3LKSA 4GG6F 4CRPA 2A2QT 4PJXA 5GGVY 1TMCB 5HVHB 5EA0L 1TITA 4LSRH 4E5XB 1ACZA 3IB4A 2BNQE 1F4YL 5D1XD 1UWXH 2X6MA 3S36L 4NQCA 4NZRL 5I19H 3EJZD 4ELKA 1DANT 3D25A 3JWDH 2YSSB 1XIWD 2NY4D 4MA1C 4WDIA 2NY0B 3O8XB 4RIRA 4CW1B 1ZGLB 1MCJA 5HYEA 4L3CB 3PABB 3N1GC 4N1HB 4X6CF 4X6DE 4M4PA 5ESVB 2NW2A 3MNZB 4OFKA 3QI9A 2BRRL 1VSCA 3HAEB 1LO5A 2M26A 4V2CB 4ZS7H 5I76B 4NPYB 3KDMA 5DK0B 4WI8A 5DJ2A 1SJEA 2Q6WA 5EU7E 2XZQH 1Y18B 1G9MC 1URLA 1LILA 4XMPH 4NM4L 4WFEE 1OGAD 1TVBB 4KV5E 3VW3L 2NW3B 1INQA 3Q5YA 5DJ6B 2C1OB 4MAYB 2VITA 3AMKA 4QXTB 1S7XB 1LDPL 5FKPB 1L7IH 2IH1A 4OIIH 1EERB 3A6CL 4JDVB 1QVOB 1A6PA 1C5BL 1BLNA 5FUCE 1NEUA 3W81A 1ORQA 5GRJL 3T1FB 1CYGA 1GZQB 4NNPH 4NRZB 4I8DA 5GRVL 5B21A 5IMOB 2ED7A 3QXAA 2DQFB 5D7IA 1QSFD 5D1ZD 2JKXA 5C2BL 4HCRH 1I3UA 4N5UA 4UAOB 1EBAA 1T21B 4AEHH 3DVGA 2F5BL 1G9NL 1FAKT 3ZO0A 1KPVB 5L88L 4OLXH 4L3EE 1N6QH 3VFMA 2DJSA 5LWYL 4KPHL 5HYJE 1H3UA 3Q1SH 4PUBL 2YEZB 4JZOB 4UBDD 4H20L 4XCFL 4ZXBC 4WI7A 2FEDC 4L9LC 4IRJB 4OZGB 5E00A 3NFNA 4W6YB 5BRZA 1CDHA 1LVEA 4NKDA 4R26L 4XCNA 2JIXA 1A9BA 1AD0B 4JFDE 1HILA 1CDUA 1ZANL 32C2A 4Y16A 5DVNA 2G60H 4NQEA 3HMXL 4I0CC 4ZFGH 4NYLA 3ULUE 3P30L 2R56L 1DQLH 3RTQB 3V4VH 3ULVH 2YN3A 4L8SB 3RY6A 2VDMH 2VL5A 5BS0E 1SY6A 4K9EL 2Z0BA 3O3UN 4WUKL 5HHVH 5LXGL 5GS0D 3ZTNH 3V7AE 1HSAB 4V1DD 5J9PB 4RISL 3IGAB 4UT9H 4GRWF 4PJCB 3GI8L 1K5NA 3QIWA 1N7ML 1R5IA 3MUGA 3DRTA 1AQKL 1NLBH 5IF0A 4JFQB 2ZUSA 5EZLA 4DKEH 3RUGB 3BPLB 3KPRD 4XMKL 4NO2A 5ALCL 1Z5LA 3NFSH 1MQKL 3IDXL 3FFCA 4ZS6D 4OLWH 5KVDL 5TF1L 5ESAA 2F74A 4HHAA 3CGTA 4OM0L 4BFIB 4UQ2A 1LDSA 5DMYA 2X2YA 3QI9C 1DUYA 3VE0B 4ODXB 2PYEA 2Z92B 4PV8B 4TULH 5IB3A 1EH9A 2HVJA 4HIXH 3INUL 4P48A 1BVLB 4PGEA 1X5ZA 2X4QB 1W0YT 2F58H 4IDLA 4WI2A 3PWNB 3S98A 2EH7H 3IKCB 1C5DB 3ARDD 3VWJA 2LFGA 5F7FA 5I1KL 1RZGB 4JM2A 5DURD 1FLRH 4GG8B 5SWSA 4G7YL 2R1XA 1AGDA 3SDXE 3REWA 2NY5H 5EU6D 5F9OH 1FORH 5FF6B 2CIIB 4J3TA 1FFOA 4XC1H 2DYPB 4XP5H 3TT1L 2D7OA 4JB9H 3L95B 4D0CA 3DUSB 5CSGA 4OV5A 2APVA 1XCQB 4WFHE 3U4BL 1F4WH 2BNRE 1MY5A 5E8EA 3B9VA 5E4EB 4QGTA 1SY6H 4G6JL 4P4KA 3A6BL 3RI5K 2FGWH 1Q1JH 4KZEH 4CKVX 1RIVH 4YDVA 5FM8A 3MREB 3AVEA 2XQYK 3BVNA 5I74C 5C0FB 1U3HA 3KLDA 5DUPL 1ZHNA 2FO4B 5C0IA 4F33A 3QUYA 1QZ1A 1MHHB 1UJ3A 1HDMB 1G1CA 2NY5C 3X14A 3H7LA 3EOBA 2O26U 3FQWB 5T3ZE 2RB8A 3MRLB 4JZNA 4M6NL 2XFXA 1KTRL 4QCIA 4Y16C 3VFOB 1GC1L 1VFAB 3QA3A 1ZA6B 4O58H 5DMKA 2C3XA 5D71H 5IEKB 3BKJH 5EBMB 4C83B 5F3HA 1FL3B 3D3VA 4GS7B 5IW6B 3RY6C 1T3FA 1JGDA 2Y6SC 5DD6A 4BYHA 1C5CH 2CGRH 3SJVD 1OARH 4HFUH 3E8UH 4HJ0D 4N9GB 1ZVYA 5C92A 1UXWA 3JSSA 1J86A 1F02I 2R29H 1XGUA 2HVKA 1I1AB 1KPUB 2HJKB 2VRAA 5C3TA 4HUVA 3FO9B 1LD9A 1FCCA 1OAYL 3TZVD 4PJEA 5MHSE 5GZNC 1RK0B 3QIWC 5ADOH 3RFZC 4FQXA 2B0SL 4M7JH 3UC0H 4HD9A 1OD9A 4KJPC 3DI2B 1PZ5B 4R0LA 3KPOA 1JZ2A 4F7MB 3OKMB 4AMKL 1U8NB 2HT2C 3TESA 4LARL 1Q72H 1OTUC 5F8QC 3L3HA 3LPGA 5AAMA 5C09A 5BCAA 4M5YL 3FO1B 4XPBL 3QDMA 4M00A 5DTFB 4WTWA 2MQ3A 4Y1AB 4I3RH 4U6HB 2D0FA 3TJHC 3QIUA 1RURL 4DCQA 4NQVB 5IOPB 2OZ4H 1MUJB 2W9LA 4I0KA 3RAJH 3SKNA 3MLSL 4ZPTA 5H37G 1U8JA 2E9JA 2DI7A 4YHZL 3V79C 3MYJA 3DYMA 3T77A 3HS0A 4GUPA 3SDYL 4N8PA 3D2UD 3VWJC 1C08A 2VDLL 2ZUYA 2Y07H 5D4QA 4JM2C 4P5TA 4FXKA 5DO2C 3WO3B 2O61B 2ZCKL 4QT5A 1TCRB 3VXRD 2PR4L 4I9WD 4N8CL 3I6GB 3UPRB 3PP3K 3G5YB 5CJOH 1AXIB 1OLZA 4ZUTA 2DLTA 4M1DL 4Q0XH 1Q9KA 4WJ5A 3X3FL 3CFDB 4DAGH 4AIZB 3RNKA 3BPOC 1K6QL 3L3DA 4AL8L 2NTSP 1DBMH 1QTYT 2HLAA 4TUKL 5DGRA 5EWIL 1A3QA 4QXGH 3V52H 4P4KC 1A3RH 4LASH 5KSVB 4HGWA 5IQ9B 2CDGA 3V7AG 1HHGA 5DD3H 1ND0B 4YZFF 1P5VA 3W2DL 1VESA 4HZAA 3GHBL 5SV3A 2WMPA 3HI6H 2HRPH 5D1XA 1KXVC 3AREB 3QUYC 3V5DA 3K80A 4L8BB 1UJ3C 3G04B 1CDGA 1KCRH 4YHIB 2DQCH 1FVEA 1XIWA 3FOMA 2JTDA 3ARZA 3Q3GB 1X44A 1YNLL 1WJ3A 1I9JH 2E6JA 4ODUB 5GGQH 4LF3A 5E9DD 3FKUS 5BZWA 2I26N 3UZQA 1NEZG 1VEOA 1WZMA 2XTJB 3O2VL 1CU4L 4IIQB 4ODHH 4PB9L 1I7RA 2AGJL 3UTQB 1XH3B 3TIEB 3IVKA 1R5WA 4P46B 1JGVH 4JREB 2OL3H 3QHZL 1E4XL 2CJUH 4PY7A 1HHHA 2EKSA 1YYML 5LJYH 1OGAA 4XNQA 2G2RB 3PDOB 4R4ND 2E9BA 4NO0D 2BJMH 5JZ7C 4LP4A 3AUVA 3QQ3B 1BD2D 5D7SH 2YN5A 3QULA 2X05A 5C0RL 3LIZH 3S96B 2PXYD 3VH8A 4ZNCD 2IG2H 1H3PL 3O3DA 2ICWJ 1RUQH 1GGYA 2BVPB 4W4NA 3SGDH 1KELH 4K23L 3F65A 3FTGB 1QSFA 3MLVH 4K8RH 4P2QE 5D1ZA 5D7JD 1IMHC 1ONQB 3EOAB 1AHWB 3A6OA 4FXGA 1CFSA 1CQYA 4N8VA 3QIUC 2OX5A 5D7KD 1ZTXH 5D93B 4LVHC 3OJMB 3DYOA 5CD3B 1JWUB 2C3VB 5ISZB 3VXSB 4PJ5D 5FK9A 4YHLH 2GITA 4ZTPL 1Q94A 4JO1L 1NCCH 3NPZB 4PJFE 4P5TC 3GHEL 3PWUA 1K4DA 5CEZH 2XA3A 5DRNB 2YKLH 3O2WH 4LBEA 4HS8H 2AQ2A 1TJGH 5F7DA 5F89B 4Q9QL 1IKFH 1A0QH 3KJ6L 4M1CD 3IU4H 1SEBB 4TUOA 3NBNA 1NDMB 5HI4D 3PWPB 1UVQA 2QSCH 4OLZH 1F3JA 4NHCL 1FZKA 2AJVH 1EEQA 5DMIH 4V1DA 4QNPF 3PUCA 1JWSB 3G5VB 5E1AA 3OKNB 3AAZA 4OGAD 3KPTA 1WGOA 4M03A 3KPQA 4LRNH 4Z7OE 5IVZA 4MNQE 1LO3L 5D1XC 4WGWB 4DVBB 2FZ3B 5EO9B 3QIBB 1KJ2L 3EJZC 3KPRA 1XIWC 2NY4C 1TJHL 5CFHA 1U93A 1YPZB 1NBQA 4S1RL 5D9SA 1IGFL 3MUY1 3T8XB 5D6CA 1CF8L 4BA8A 2UV3A 3QZWA 1BZ9B 1HI6A 2NY1B 3TYGL 5IB4B 3MFGB 3OR6B 4N0UA 2ZSVA 4BQ9A 1QQDB 2DI8A 3MLZL 4LHUB 4G8GB 1W0VA 4MJIE 5L7XL 4OF5A 3ARDA 5DD0H 5BXFA 2P7TB 2EEAA 4F9LA 1AGFA 3ET9F 1UWXK 3BH8A 1KCVH 1FFPB 1QP1A 4I2XB 4IRZH 1GGBL 5EU6A 1V3MA 3ARTA 4OLYL 5ALBL 3AY4A 4P57B 4XPAL 2B2XH 3I2CH 4U1JA 3RWEA 4IOIB 3T0WA 3PJSA 2UY7A 5DRXA 15C8L 1J1PL 1QKZH 4JG0L 4BZ2H 5JA8B 5EIQA 3DIFA 4CMHC 5D1ZC 3CC5B 4BH7B 1A64A 1W72B 2QADC 4TNWK 1PY9A 4ZUWA 1C1EL 3E6HB 1KB9J 2FX8L 1EAPB 4UV7H 5GS0H 4OZ4B 5IB5A 5TE6L 3UTTD 2ZJSL 1KCKA 2C1PA 4ZFZB 4MX7B 1VPOH 3SGEH 3EFFB 1DCLA 4UBDC 4PJAA 5I1CL 2IPKA 4DGYH 1UH3A 2WP3T 1V3JA 4YFLF 3HCVA 4NC1C 2CRZA 1P7KB 1YDPB 1MFBH 5F7EL 4Y5YB 3TEUA 5DUBB 3WSQL 1IGTA 3L7FB 4G9FD 2NNAB 3UCRA 1RIHL 3S9DB 2W0FB 3QIBC 5BJTB 3TBSA 5FO7B 1AFVH 2YD8A 1JE6A 3FFDB 1QG3A 2X1XR 2X4UA 1P7QB 1UADC 1DBKH 4GKNB 3MV8E 4LLDB 3O11A 1D6EA 1JL8A 1HEZB 3QG6A 5HI3D 3SJVA 4KKAC 1NAMB 1P9MA 1UB6B 3UTSB 3MGTB 2H45A 3TNNA 1BM3L 1R3JB 1NFDA 3TH3T 1NJ9A 4KQ4H 5FYKE 4A6YB 5AZEH 3L3KB 1EJOL 5C0BE 3TZVA 1A1NA 4HIJA 4G6KH 3PWVA 2AJZB 1KN4L 4FFYH 1LO0L 2DD8H 4YUEH 2DQGL 3GNMH 4M6ML 1P4LA 4XBEL 2BCKA 2IAMB 2IMMA 4LFHG 2Q20A 2VXVH 5IMMB 4OCWH 4P2OB 3U1SH 4ZS6C 2JB6B 1I85A 1IAMA 5LQBH 3DMMB 3IDIB 4HF5L 5DJYB 4TN9A 1HINH 2WUCH 1JZ8A 3GI9L 5EBWB 3NZHH 4NT6A 4K7FB 4NNYB 4UV4H 4N9OB 5HGGS 7FABH 4TNVK 4PJIE 4BSVA 1S7UB 3V4UH 3SE9L 2HKHH 3D2UA 2OP4L 1BAFH 1SJHB 4ZOAA 3BIKA 3FL7A 4C4KT 3ZDZF 5C0GA 4XNYH 5KVGL 1EEZB 1S9WB 5E56A 1TZHA 3ARGB 2A9NH 3VXRA 5KAQF 5GJSH 4OT1H 3AY4C 2I07B 4PRIB 2F19H 2AKRA 3H0TB 1P5UA 4PJGE 4P3DA 2OTWB 1YJDC 2NXYB 3JV5A 5J4MA 5IFHL 2V2XA 5EA0H 3IDMB 4LLQA 5LKNA 4IOFD 4X6DF 1F4YH 4U1LB 4DUXA 3S36H 2YK1L 3LN4A 4ZDHA 5I71C 1ZSDA 3UTZB 5MEQB 4FRWA 2HG5B 3T0EB 1IEAA 1QO3B 5F7KC 5SX5H 1FYTB 1E0OB 2R8SL 4OZFB 3TPKA 1I8IB 2YPLB 1KLUB 5E9DA 2Q3ZA 3I6KA 5L2JB 5FYKU 3WFZA 3DHJA 5DMJB 4V2BA 3VW3H 5C0DA 3JTSB 2BVYA 1SYSA 5I73C 5ADPL 1LDPH 4PRBB 1I9IH 2WAHA 4HJ0C 1JIBA 2R2BA 5EZJB 1J18A 3A6CH 4HZLB 4JKMA 3SKOA 1Q0XL 1C5BH 1TVDA 1MCSA 1K4CB 3P77A 4F7TB 4LHJB 3C8HA 5GRJH 1E4WL 3HLAB 4NO0A 3HNSL 4IBLT 4OCSH 1UXSB 1BD2A 1X5XA 4KI5F 1NLDL 3NIDF 1OGTB 4HSQA 5LBSL 1YEGH 5T3XD 3P40A 2DQDH 3BW9A 4OB5H 1BFOA 2F5BH 2PXYA 1G9NH 5KN5B 4K7PX 5L88H 1QHPA 3HRZB 3S4SG 5GGSB 2WBWB 5LWYH 3UDWC 3UBXI 1I3VA 4PUBH 3MGAA 4JN1L 4H20H 3HZYB 3ULUF 4Z7UB 3SO5A 4H88L 3DGGB 2ZCHH 1FZJA 4X98B 2IANB 4U1MA 2XIDA 2OJEA 5IVXB 3Q5OA 4NN5B 1OPGL 4PJ5A 2ZPKH 3F5WA 1BZQK 5EC2B 4LAQL 3DO7B 1ZANH 3D0VB 4LKCA 1KB9K 4K94C 4HS3A 5TDPA 2YUXA 1N4XL 3ZKMD 1OSZB 1XR8B 3VXMB 5KG9B 3QCUL 2ATKB 1M71B 5LXGH 1KACB 3BWAB 2DI9A 4JRYD 5C9JB 1A2YA 1FFRA 1IEBB 3GGWA 2FBJL 3FZUD 2B5IC 1NCUA 1F58H 3PP4H 3GI8H 3O4LD 3KS0J 3TA3D 1DQDH 1N7MH 4NGHL 1PGRB 5E8PB 3RBSA 1AQKH 4XBGB 2OQJA 3WV0A 4WU5A 2V5MA 2CUHA 1L4IA 3VFNB 2HTKD 4JFFD 3FRUA 1MQKH 3IDXH 1DN0B 5KVDH 5I75B 5TF1H 4LGSB 5EOCL 3WE6A 2P42B 2CKNA 3ZKQD 5JHDB 1BPVA 2W65A 3F7VA 1RZ8A 5GS1A 3V0WH 5FM5O 4OD1L 4Z7VF 1FZOB 1EMTL 4TRPL 1WK0A 1FH5L 2YRLA 1U8OA 5L2KE 3NA9H 3INUH 3SDXF 3OJDA 1XAUA 4FQIH 2GFBA 3I85A 3NIFE 3K81A 2HJLB 4WHCA 3HZMA 1NBZA 3MRCB 4O5LL 2DF3A 4PJ7B 4PTTB 5I1KH 1IT9H 1XGYL 3ARXA 2V5SA 2QHLA 1QSEE 2Q7YA 4G7YH 1KNOA 5GSRA 2GW5A 4ELMA 3T4YB 1NCNA 3NN8B 5DJAB 4OKDA 4R4NC 3MR9A 4W6XB 4GRMB 4I1NB 3L5JA 3OQ3B 4UINL 1JK8A 4EKXA 3TT1H 1A47A 2FH6A 25C8L 3OSKA 3MCG1 3LD8C 4PJDF 3WXVL 2FH8A 5EB9A 3U4BH 3BN9C 1BVKA 1NCBL 3RDTB 1CGWA 4PRHD 2PXYC 1U8PB 3EDFA 3A6BH 3C6SB 3BXNA 4JY6A 4TTDD 3PXHA 5FO8A 1O7VA 1JZ3A 5D7JC 2DJUA 5DUPH 1F13A 3VGGA 1R3LA 5EZOL 4L4TD 1AC0A 4MNHB 1FLTX 3UPAA 3UTTA 4M8QB 4O9HL 3UJJL 4C59B 4M6NH 2ZUUA 2XKUA 4EI5D 4KAQH 1GC1H 1DQQB 3SDCB 1E6OL 3QNZA 1RZFL 5H2BA 3MQIA 3QHFL 4WUUE 3RWIB 3TP4A 2FBOJ 1FBIH 4PFEA 3DYPA 3HNTH 1G7QA 1TDQA 2A0LD 5TDOB 4O2FB 4G9FA 4Y4KB 3H6JA 3UYRL 1SQ2N 4YFEA 5T1MA 2FHCA 5I1LB 4M1CC 4F3FB 5HI4C 3BFOA 5I17B 3VWKD 2B0SH 3VRLF 4JFHE 3CH8A 3CPLB 5I16A 3EHBD 4LHQB 4XX1G 4F15B 1CXLA 1EPFA 3V5HA 3MO1A 1BF2A 4OGAC 4AYFA 1WLHA 3KPLB 4LARH 1YEEL 3WNPA 4M5YH 1M7DB 4NQXB 5J6GA 4S0SD 3LKQA 3V6OA 3QXUA 4MNGE 1FSKB 1RURH 4YNYA 4YHNA 2ATPB 2X4RB 5L9DL 3PV7A 5JDSA 3MLSH 5I1AA 1LQSR 4RFEA 3SDDC 1JNHB 3V0VB 4YHZH 1QSVA 1XMWA 2VOTA 4RBPH 4OZGE 5ERWB 5KTEH 4M9PA 1GZPA 5BVJA 1CDCA 1U91A 3VCLA 1T4KA 4X9HA 4CUCA 3H9HB 2ZCKH 4GLRH 2PR4H 3BUYA 2I5YL 4RAVA 4N8CH 1WCQA 1KJVB 3TO2B 4JR9L 3QEQE 2X4TB 4XNZC 1NUGA 4M1DH 3ES6B 3X3FH 5A2JH 3EDKA 2DMCA 4H5SB 4YDLC 4ODWA 3H9SD 4X83A 3BPNB 3NGBC 3T3ME 3ZE2F 4AL8H 1FAIH 3MV9D 4TUKH 3VMPA 1ZV5A 4YE4L 3JZ7A 4FNLL 3U0PB 2ADGA 3MJ9L 1I4FA 3VXQA 5KVMC 3VFVB 1H0DA 4BSJA 5B8CB 4R8WH 2YOCA 4JJHA 4PJCE 3I50H 4P9HL 3BQUD 3VXPB 1UT9A 3GHBH 4PJBF 4YGVA 3QUZD 2R0LH 3L7EB 4LEOA 3FT4A 4LSVH 4XXDB 2F9BT 1HSBB 1CL7I 3U6RA 4WCYH 4G6AD 2GY7B 5E2WL 1YNLH 4OAWB 5D2LB 4WO4D 3VRIB 4AENB 4Z0BL 1OF2B 4I48A 1CU4H 2RHEA 2AGJH 1UZ8A 2Z4QA 3ZKXB 4EN3B 1CBVL 4L8CB 1YMMB 3QHZH 3MX0A 1E4XH 3CX5J 2WINA 2R4SL 1QNZL 2PO6A 5KZCD 2B4CL 5HVFB 4QHLB 2EDYA 3EYVA 4HIHA 3Q6GL 1Z9MA 5HI3C 4FG6D 3O3AB 3MRMA 3KYAA 2DQUL 1ZHKB 4HQQL 2ERJC 4IJ3B 1F2QA 3FT2A 4KROD 5GGVL 2H32B 1F11B 5C0RH 1MLCA 1MHEA 1J8HB 3ARWA 3MRFB 4L4VD 1H3PH 5DRZA 4IMKA 5BQ7A 4K23H 2Y4SA 3LMJL 1CLOH 3IFLH 2M2DA 1LEGB 3WFCL 4X6EB 3VFRA 4NZDA 4JHAH 3H3BC 1DEDA 2G75A 3U7WL 4TSAL 4X5WB 4QRTA 1ORSA 3DWTA 4R6UA 3N1PC 1P1ZA 1VACA 4NRXA 3LKSB 2GUOB 3JTTB 1BJMA 1RMFL 1ZWIA 4CVUA 3BE1L 4ZTPH 4MAUL 1BF8A 4LGRB 4JO1H 2GJJA 1L6ZA 3BX7C 5CP7B 4HPYH 2C3WA 6CGTA 3GHEH 4GW4B 4LCCB 3IETB 2YBRB 5HSFA 2R1YB 4ELKB 3JWOH 1KN2H 3OB8A 2X7LB 4QXWA 4Y5XB 5DC4B 5IFJA 4Q9QH 2A73A 1T2JA 2UYLB 5DS8A 2NW2B 3RP1A 4LVOC 4KY1L 3BO8A 4TVPD 5HPMB 3SDAB 2P5WD 4NHCH 4Z7OF 3QXTA 3TWCL 1YNKL 2H41A 4APQD 5BVPL 4E0RB 3IDYB 2VAAA 4Y0GA 4JRYA 1A7OH 2X1PA 3M17A 5DJ2B 1SJEB 5D5ME 5IB2A 5CKGA 5HHMB 4RGMC 3O4LA 3TA3A 1MRDL 4XT1C 3NCCB 3OXSA 3PXJA 3QRGH 3NZ8B 3D39D 3V2AR 4EDXB 2VITB 4Y8DC 1N64L 2N7BA 3MXWH 4K71B 3TPUA 2AV1B 1BJ8A 4RWYL 4X6CA 1AJ7L 3CLFL 4S1RH 3DBXA 1AGCA 1EIBA 1BLNB 1IGFH 1QSZA 1ORQB 3LHPH 1CF8H 3P73B 5I8EA 1K8DA 1MCPL 1KCSL 5D7IB 3DX9A 1RVFL 1IAOB 3TYGH 3HZVA 2IEPA 2FYYA 4Z95H 4U1SA 2QSTA 4KMLB 1S7RA 4OCLC 1ZT7A 4JPKH 4ODSH 2OJZL 2R2HB 3VFMB 4BSWA 2BVQB 1SBSL 2ZUVA 1S7QA 3GJEB 4X7DC 5L7XH 3OKDA 3EO1A 3STZA 1CL7L 5CP3A 3O2DA 4PY8I 3ARFD 1QR1A 2CKBA 1SVZA 2X4SA 4POYA 4NKDB 4OLYH 3QXDA 3QBTB 2HP4A 4HDIA 4HUNB 1A9BB 5KSBB 1SBBA 1HILB 5E0QA 1J1PH 4JG0H 2BFVH 2Q7NA 1FNLA 1T2QL 3FQRB 3K4AA 1F6AB 2C3GA 3U2SB 2MHAA 4P9MH 1TQBB 1H15B 4JPWL 2H6PB 5DR5H 4PRHA 5HVWA 3L3GA 5D1QD 1D9KD 1JUFB 1R3KA 3BP4B 2BC4A 5F7LB 3MLTA 5HHPA 2ZJSH 2A6KA 4ZNEA 1GAFL 3QJHB 5F6HI 3ZDYE 3ROOA 3CIQA 3EJYD 4GQ9H 5C1MB 5JDJA 5GRUL 3MUGB 1ZA3A 4L4TA 3D18B 2RBLA 2VLRE 3DRTB 3BEVA 1IARB 2CUIA 5F7EH 5IF0B 3RZCD 1AIFB 3WSQH 1HXMA 5EZLB 5E2VL 1FNEB 3HC0A 3I75A 1OB1A 5GRVK 3FFCB 4EI5A 4BQBA 1IFHL 1JN6A 4OD3L 3OTTA 1MWAA 2J4WL 4XMLH 3KYMA 1FNSL 1WZLA 1S5HA 1DUYB 4PGBB 1I8KB 2PYEB 3OPZH 3PL6B 4GJTB 5IB3B 2VL4A 3L1OL 3O45A 3TNMA 2ZWLT 5GISH 1BM3H 4N0YL 5TFSL 1X5HA 4FP8L 3DHMA 3FZUC 1WFUA 3TA3C 1WC7B 4CU7A 4EUPA 1KEGL 3CX5K 3C5SA 4I4WA 3VWKA 5JTWA 2Y06L 1KN4H 2FJHA 1LO0H 2DQGH 3F12A 4M6MH 5JNYB 4XBEH 4BK4A 3O2DH 4X0KB 2CKBH 2HTKC 4YHYB 1HWHB 5EZIL 1NGZA 4OLUL 1NC4D 4HF5H 4XHJD 3CVHL 4YEEA 2OI9C 3GI9H 4XNUL 1CDJA 4FTVB 3WL9A 3L5IA 4KWUA 4DW2L 4PJHA 1W2KT 1UACL 1MFNA 4FQHA 5E8EB 5CMAA 4WU7B 5ISZE 2AXJA 2MCPL 3ZTJG 1GGTA 2IH3A 1B6UA 3SE9H 2OP4H 3BVNB 2XN9E 3O6LH 3U0TA 4PJGF 1U3HB 2VABA 3FOLB 1ZHNB 1S9YA 3DX7A 5KVGH 5JOPE 5A3ID 4M8VA 4U0RB 4HBCH 2DAVA 3T2NL 4ONHA 2AXFB 2XY2A 1VKXA 4PP1D 3EOBB 4W68A 2UVFA 4LPCA 2X40A 2XFXB 2COQA 4QCIB 1KBGL 2R0KL 4UDUA 4R2GD 3RPIA 1I3GH 3GUTA 4NUGL 3H9SA 1MWAH 4XCYA 5F3HB 3D3VB 3OAUL 3MV9A 3AM8C 3RHWF 3IXTB 1OT1A 2YK1H 4JHBA 1V7NL 1WQVT 3GK8L 4JQXA 5CSZA 4TTDC 1XGUB 3GMPB 2JJSA 4MA8H 4HLZG 3CDFA 1IBGL 4RX4D 1V7ML 4H8WC 2Y1VA 3J8F7 3QUZA 1JYWA 4HUXB 2R8SH 2R0WL 4FQXB 4LNVA 5JA9A 3CFBA 4MD4B 3HZKB 4R0LB 1YPZE 4FA8A 2WK2A 3JV4A 4WO4A 2EYSB 4WNQA 5ITFA 1T22A 4EI5C 3BT2L 4C56D 4YHOL 4HV8B 5DXWA 5C09B 1F42A 5IG7A 3QDMB 2PTVA 5DLML 3DVNA 1IL1B 1S9XB 4F7CB 4QRRB 5ADPH 4RCAA 1CLYL 1PKQB 2X10A 2OL3B 2Z93A 4MXWH 1T5WB 3OB0H 4AT6A 2DM2A 1TETL 4XPHH 1HH6B 3BYTA 5EPMB 1Q0XH 5GS2H 1UWGL 1IQWL 3HS0B 4GUPB 4DTGL 5IGXH 1E4WH 3HNSH 1C08B 3VWKC 3KR3H 4DEPC 3RIFF 2PN5A 4FXKB 4NN7B 1FC2D 5IKCA 1KGCD 3CDYA 3EHBC 1T80A 1GGCL 3SHSA 2XWJB 4L8DB 5LBSH 4J8RA 1B4JL 35C8H 4L4VA 4YQXL 4BZYA 1EO7A 2FWOA 3DVFA 1Y6NR 3H3KA 5E6YA 3W0WB 1BBJA 1QFWL 4U3CA 3MFFB 3NPSB 4EIGB 4GAGL 1QRKA 3REVB 5LG1A 3RPKA 4H88H 4C54A 3TV3H 1NGYB 1MJJA 3BKML 5T3ZL 4HGWB 1HHGB 2GCYA 3PGDB 4LAQH 3GSXB 1PLGH 1QYGL 1N4XH 4M7LT 2BNQD 3ARBD 1FG2A 3LN9A 4KKLC 4JO2H 1I1YA 1IZJA 2RQ8A 5HJ3A 5D96C 4ENED 3FOMB 2XXCB 4K55A 5DFVC 1V05A 3OAYH 4ZODA 5EORL 1LNUA 3DRQA 3MNVA 4KMTL 4H1LA 2P5WA 1QEWA 4NGHH 3FO2B 5AG9A 1T04B 4GBXB 4H0IA 3IVKB 1H5BA 3UTSE 1R5WB 5T1KD 1T20B 3NCMA 4RDQF 2JJSC 3NH7L 1HHHB 3BQUC 5EOCH 2YC1B 4XNQB 1KPRA 5DC9B 3QUZC 1YY8A 3ILQD 1O7SA 1T1XA 3D39A 1ETZA 3VI4E 4OD1H 1EMTH 1WT5C 4RA3A 3EKCA 3RNQA 5B38G 2VWEC 1FH5H 4Q58C 1EEYB 3QULB 1NGWA 1OTTD 4G6AC 1PAMA 4DGIL 1N5YL 4B5EA 1UH4A 3VH8B 1HHIB 4S2SB 4D9LL 3MV01 3O3DB 5LGJA 4RMWA 4PIRF 5EO0A 3PIQA 3VRJA 2P8LA 3DURA 5CS7A 3MRPA 1QSFB 2D4DA 2Q87A 4O5LH 3SCMD 3UJTH 2HT4D 1V8HA 1XGYH 4FXGB 1CFSB 2DN7A 3QNYB 3MLWL 4J6RL 2YHGA 3ZE1F 4WFFD 5A40E 1XT5A 4L3ED 2E7BA 3QFDA 1W0WB 3CU7A 5HYJD 5FK9B 3MJ6A 3WKNA 3VG9C 4KI5D 4JAMA 4FG6C 3BGMA 3ARFA 3W39B 4GOSA 25C8H 1EUTA 4KROC 3WXVH 3MLYL 2X5PA 3CSGA 3T3PE 3QUXD 4KJWD 1JWMA 3AROA 1A1OA 1NCBH 4PRIE 5ELIA 4PJ9D 4F37F 3OL2A 2BVTA 3S36X 1UGNA 3ULUD 3BUTA 5CLTA 1YNTA 5DHVA 4LMQE 3TF7C 3EAKA 4JANA 1OAZL 4XCEA 1CDIA 5MERA 3LV3B 4UTBL 2I9LA 3LEVL 4H1LH 5F8RC 2CO6B 5BS0D 5EZOH 2PTTA 4LRIA 1F3JB 4KKBD 4MA7L 1D9KA 5D1QA 4AH2A 2K7PA 4J2XA 2EE3A 1T03H 3MRDA 1IQDA 2A6JB 2GJZB 4O9HH 3T0XA 5C0AA 5E1AB 3DX6A 3T0EE 3UJJH 4ZFOL 4PLNC 4YK4B 3FQUB 1QBAA 2VLKB 5FXCH 1OT2A 3SKMA 3LKRA 4KTYA 1FYTE 4S11A 1CGSL 1RZFH 2IALA 2HFEB 5I1JH 2AJXL 5HGDA 1CG9A 4WW1B 3MRNB 1FG9C 4R96B 3RZCA 4QKXB 2YPLE 4IDJL 2AI0H 1T0MB 5FECB 3ZT5A 1PG7W 3G6JA 1FP5A 4HXAL 2ZUXA 1A6VL 3DXAB 4GW5A 5D6DA 1S5IL 5KS9F 4I5BB 3GSOB 4WWKD 5EU4A 2ITCB 1G7JA 4O2CB 4X8XA 4APQC 1H5BC 2UZIH 1MCBA 2JCCE 1BOGA 4MDJA 4QRQB 2P1YA 4JJ5B 4PREB 1W0VB 4OZIE 1NAML 3ARDB 1EGJL 5E8DH 3WLBB 1AGFB 3SE8L 5JUEL 3BH8B 3ZYZA 1NMCB 3VDBA 5L8LB 4OZGF 4YDIL 2DTSA 3EYOA 5F3BA 2V7NA 5JLZA 1ZAGA 4Z5RA 3G6AB 5L9DH 2J7LA 4MWFA 2OSLB 2LTQC 1NC4A 3RWEB 3L9RA 5DRXB 1DQTA 2DQIL 3OKYA 2QR0A 4ODVL 4Z7UE 2XNAA 3DIFB 2P24A 4ZOCA 3WIFB 1OP5K 1E27A 3QJFA 4WFHD 1DFBL 1FJ1A 3IDGB 2BNRD 2IANE 1CFNB 3FRPG 5C0JA 4ZUWB 5IVXE 5CSBA 4IEFB 2I5YH 4JQVA 5DD1L 5IB5B 1T0NB 2VKWA 2NZIA 3WHXB 1UWEH 4GMSL 1FNGA 4JR9H 1WBXA 1AD9A 2Z8RA 4PJAB 4Y4FB 3BGFC 5BO1L 2IPKB 4PJCF 5TDNB 2GKIA 3ARFC 4QWWD 4YK4C 3VXME 3OG6B 3H9ZA 4OUUB 4LVNC 4G8EA 6FABL 1A4KB 3U46A 1IGTB 4NP4L 4N0FB 4FNLH 3WXWH 3HI5L 3RUGF 3TBSB 12E8L 1RZJL 2VZ3A 1UCTA 3PHOA 2X4UB 5HDOA 5IJVA 3DJ9A 1HQ4A 1QFPA 5IHZA 2NY7L 1D6EB 4LRIC 3SJVB 5D1QC 4RGNB 2AK1L 3IU3A 3OJ2C 3OMZA 2HJFB 2F54B 1VFBA 5E2WH 3IDUA 3L5WA 4HX1A 4RX4A 3HR5A 2UY6A 1NJ9B 3LEYL 3TZVB 1A1NB 4G6FB 3EJYC 1VGKB 3R8BB 1LEKA 3ECBB 1S9VA 2WLYA 2JJUA 4L5FH 3RZCC 2BCKB 1CBVH 5BZDA 2AABL 3MRQB 3TCXA 1NCWH 2DM7A 4QRSA 4C56A 4DJMA 3TBWA 3I9GL 3TN0B 1D5BB 2FECI 4TVSa 4XC3H 4PLOB 3Q6GH 4PJ7E 3OWEA 1NCDL 4LCWB 3O41B 2DQUH 2AV7B 4HQQH 5E2JA 3F6IA 2UZYB 1MRCL 4WV1C 5EOTA 5IIEA 3PF2A 4M93B 3QEUA 2EZ0D 2LV4A 5J12B 5FM4A 1HNGA 3OGOE 4G8FA 5E99L 4BSVB 1FL5B 4HJGB 1VB9A 1H9VA 1Z0NA 2K3TA 5DI8A 3LMJH 4YHKL 5GIRB 1SVCP 5C0GB 2XG4A 4GAYB 2A6IA 1TZHB 4NDMA 5E6IC 2O93L 5DVMA 1AP2B 3I3BA 5JPNA 4TSAH 3ZYOA 5KVEH 1FVDB 3TCLA 4PJ8B 3TBVB 4GKOA 5I9QB 5MEPB 5FCSH 4H0HB 1RMFH 4XHJC 2V2XB 1U36A 4QHUA 4XB8A 4JO4H 2I9TA 5EOCJ 2CRMA 1BQHB 1JNNL 2H2SD 1DR9A 3ZLQC 4RFOH 3WS6A 1IC4H 3LN4B 5ETUB 5JW4R 3F6LA 3I3EA 3MOBL 1L7TL 1II4E 1RUAL 4OSUL 1FN4A 4R3SA 1UCBL 1WICA 3WFDL 4UILH 5JPMA 5TE7H 2C5DC 4UB0L 1DQJA 2BNQA 3ARBA 3MOQA 5C3LD 1XEDA 4KY1H 5CIPH 5A3IC 3S97C 5IMLA 2RIKA 4PP1C 3TWCH 1YNKH 1JGUL 5ESQA 5BVPH 4QOKE 2CIKA 2PETA 1WAAE 2BXZA 3BKCL 4FABL 4YHPB 4CNIA 1OWWA 3I6KB 4R2GC 5FYKL 4X6DA 3VXUB 2NY3D 1XF2A 3FT3B 1QRNB 2R9HC 1MRDH 2XQYG 1S3KL 4YWGL 3NOIA 4MQXD 2AJSL 4ORGA 5DQJA 3ILPB 1N64H 4E41B 5IROA 1BJ1H 1GPOL 3CFKA 3KJ4C 1HN1A 3U7YL 5IUSA 5M95B 5MP6L 4XXCA 3CLFH 1NGXA 1OCWL 5DMGD 4JHWL 2V2WA 5F1IA 1BX2A 3P77B 3ARQA 4UOW0 1GHFL 2BX5A 5E2UL 4ZO8A 5FM5M 5DGQA 2WWMC 3H9YA 5IQ7L 1MFAL 5FDWB 3B3IB 2EC9T 1ZT4B 2OJZH 4FQCH 4CU6A 1SBSH 3CCHA 5EIIA 5AYUL 2X09A 4P23D 4HUUB 4P2QD 1YC7A 2B1AL 1J12A 5IW3A 4DKDC 1JHLH 4UIKL 1ERNA 5E03A 4MQ7A 4L3EA 4U1MB 3HE7D 2E3VA 2YPKB 5HYJA 5A16A 5JR1L 4LKCB 4WEBL 4HS3B 3D85D 5TDPB 1T2QH 3S6CA 3RWFB 3ZDYF 4TUJA 2ID5A 4JPWH 1ZLUH 3QUXA 1ES0B 2FECL 4PJ9A 5AZ2H 4MS8D 5DD5L 2EDKA 4JFDA 1MRFL 3BDXA 1A2YB 2DL9A 1GAFH 3L3OA 2HKFL 3BP5A 5F7NC 1YEKL 1I7ZA 2RAMA 5BS0A 1Z9OA 5GRUH 1BQUA 4EEEA 3WS6C 4LPVA 2G5BA 3RGVB 2L7UA 2OQJB 5DJZB 4WU5B 3NACL 2VIRA 3U48A 5E2VH 1SYVA 1AE6L 1MLBB 1WWCA 3FRUB 5D2LE 5J89A 3AFLA 4CVZA 5DJ8A 1IFHH 2D7PA 3QRFM 4OD3H 1BMGA 4JKKA 3ARBC 5GS1B 2J4WH 4Y4HD 5I8CA 4PRAA 1YY9D 3C60B 1YMME 4XVTL 2W9DL 5C08E 1NGPL 3IF1A 3C5ZD 4GW1B 4R7NB 3L1OH 1U8OB 3O9WC 3WFEL 1F3DH 1KIQA 3KHQA 5T1LD 3PHSA 3D87B 3IT8D 4N0YH 5TFSH 2ADJA 3KG5A 4FP8H 1NEZA 3OJDB 3NFPA 3RU8L 3V0AC 1UQSB 4O4YL 4WWKA 3BRFA 1HH9A 2CK0L 1KEGH 5FKAA 3HZMB 1NBZB 2NY6B 2Y06H 3DTXA 4S1QH 4F9PC 5IW1A 1J05A 5IROC 5GGRB 4FXLA 4EJ1C 4LSSH 2BHUA 1KNOB 5GSRB 5ICXA 1J8HE 3C5JB 4JQIL 2LVEA 1CXIA 5EU7C 5H37H 3G08B 1QLRB 4MJID 4OLUH 2ENSA 3BEWA 5JOFA 1UM4H 1JHTA 5TJWK 1IGJB 5J1AA 4M3JA 3V5KA 1RJCA 3MRGB 3HI1A 4K3GA 1SJXA 3SDXA 1UA6H 4O02L 1OTTC 4DW2H 5IMKA 1UACH 3OAYK 4I77L 5FYJL 1JMZA 4NWUH 2NZ9D 5L0QB 1N59A 4HWUA 1LP9E 3BD5A 3BXNB 4JY6B 2MCPH 4HIEA 3X11A 4ETQA 3SCMC 1YEDB 5GJTL 4D8PA 1A6UH 2HT4C 1LEIA 1G1YA 2BNRA 5IBUB 1A9EA 1IC5L 1GYAA 2HLFD 2AJ3A 1KTDB 1U8QA 4UT7H 2AXGB 4F2MA 5HHOB 4XTRD 2WQRA 5T3XE 4MD5B 1KBGH 3ULVE 4ISVA 4KI5C 5K9QI 2V9TA 2DMKA 2DRUA 1RFDL 2Q8AL 4Z7WB 4NUGH 2XRAL 3C2SA 1DBBL 3UX9B 4KJWC 1G7PB 2IBGA 1G7QB 1RUKL 3HC4L 4X4YA 2WQ8A 3RHWK 1P69B 4C58B 2K9UA 1V7NH 3EYFA 3GK8H 1CE6A 1JGEB 3ULUC 1YPZF 4KDVA 4X4XA 3KPMA 5HHME 1IBGH 1RSFA 2OM5A 1B6DA 3HB3D 1WBZB 2HFFB 3HC3L 1MHPL 3GMMA 4JGJA 1MELA 3MV8D 1KC5L 4OFVA 5DEFA 5ID1B 4KKBC 3RWGA 1G9ML 4HBQA 5EBLA 1FFNA 5I16B 3FAWA 2HH0L 3HUJB 3V5HB 3MO1B 4LPYA 4X9FA 2NR6D 5C0BD 3BT2H 3ARRA 4XPTH 4YHOH 5I19L 4GG6E 3TYFB 1DEEA 1CICD 3LKQB 5C0EB 2K1MA 3O3EB 2IWGA 1PG7H 5BV7C 4YNYB 3A67L 5J6HA 3MRBB 3VI3F 1TETH 5JDSB 4F57L 5I1AB 2BDNH 1UWGH 5EU3A 1IQWH 1G7LA 2MWCA 4DTGH 4K3JH 4WWKC 1G6RL 1K8IB 4JFFE 1D6VL 3JUYA 4HH8A 4MSWB 3UXFA 2ADIA 3MBED 1ZLSL 4BK5A 3QO0A 5BVJB 1U91B 1GGCH 1XF3B 2XKNA 1JV5A 1B4JH 4RAVB 1K3IA 4YQXH 2EIZA 2GJ6E 5KSBE 5F1SA 4QXUL 1XGTA 3CH1A 2IQAB 3MRKA 1QFWH 3NCBB 3BZ4A 4NO5B 4NQSA 4GAGH 3RWJB 1ADQL 3WN5C 5TF0A 3TVMD 4NNPL 4FQ2H 4P2RB 3P9MB 4CAGA 1BJ1J 4GAFB 4QRUA 5T3ZH 5FA3A 4AEHL 5J0BA 3AU1A 1QYGH 1F4XH 3Q5TA 4YGVB 3RWCA 1BVZA 4NSKA 4OIAA 4PR5A 1XGPA 2I60H 3KYOB 4LSPL 4Y5VB 4Z7QE 4U1GC 4XVUD 1U3YA 4MVBD 2EKJA 4EI6B 5J57B 4X7SL 4Z78A 5B39A 2Z35A 3U6RB 4LSDA 4LOUD 4LCUB 3VFSB 4F8TA 5CHNB 2PW2A 3VMOA 3E2HB 4P5KA 5DJXB 4QWWC 1EA9C 1M7IB 4I48B 1EO8H 3FB5B 3LRSA 1UZ8B 5DQ9A 3VI4F 4JY4B 3WFHA 3SGKA 4R4BB 1D5MA 2VDML 2PO6B 4HKZB 2KL6A 1A8JH 4FQLL 2IGFL 3VGEA 3BD4A 3B9DA 2VUYA 3ZTNL 3RVWC 5E5MB 4WVRA 3TM6A 2AK4D 2BNUB 3QR2A 4PJDB 5HHNB 4MXQD 4UT9L 1KJ2B 1MI5B 2GK0A 1Q0YL 4U1KA 4DGIH 1MHEB 1S7WB 4D9LH 1NLBL 4N0RA 4S0TD 5BQ7B 3QG7L 4NBZB 4DQOH 2A6DA 4QY8B 1HKFA 4FTVE 2GI7A 3NFSL 1QLFB 5M94B 1CQKA 3VFRB 2X41A 1X5GA 4P5MA 3VFGL 4Y19E 3MLWH 4J6RH 3KLSA 3T3PF 1ORSB 1VACB 1OAUL 4YC2C 3CK0L 1RZKC 5DZOA 4P23A 4P2QA 3B6SB 3V8OA 5GRWA 3PHQA 3MLYH 1RK1A 3PQYB 2IFGA 1X4XA 3BP7A 1YECL 2EZ0C 1N3NA 4K2UL 1EO5A 1FLRL 1OM3H 4FOMA 3ZYIA 2YD4A 3MACH 4F37K 1AKJD 3IXAA 3D85A 5F1NA 2NY5L 1OAZH 2RFXA 4PJFA 3BO8B 4BH8A 3CZFB 4UTBH 4PS4L 2PW1A 3GIZL 1CK0L 4XC1L 2KQNA 3P4NA 3VFWB 2EYRA 1O0VA 3B9KB 2J6EA 2ARJA 2VAAB 4M6AA 3M17B 5EN2A 3GSUA 3GO1H 5DYOA 5JHLL 3RI5F 3P9LA 1SY6L 1WZ1L 4GKZA 4Z76B 3OXSB 2H2SC 2VXSH 3CVIH 2AJXH 2XZAL 1GOFA 2CSPA 4WHTA 2FJGA 3HMWL 4WHYH 1O5DT 3S37L 4FN0A 4IDJH 3TPUB 4OF6A 2QL1A 3IFPA 1AGCB 3N85L 3W9EB 4HXAH 3GSNA 4LLWB 4OF8A 5CCKH 4JCLA 1S5IH 3V6FA 5I8EB 2OR7A 4Y4HA 4MNQA 1K8DB 1KIRA 3LS4L 4HWEL 2BVOA 3NMEA 4QRRE 1DDHA 1PKQE 2ZCLL 3HFMH 3ESVF 1U8MB 3C5ZA 3ME0A 1INDL 4AM0B 1I1RA 3SGKC 5L2KD 1S7RB 4G6ML 3Q6FB 5CBAA 2N1KA 1ZT7B 4PG2A 4HUMB 4BSWB 2OR8A 2NY3C 2CGRL 3SGDI 1OARL 1S7QB 3STZB 4Q6IA 2R29L 1I8MA 5JUEH 2WIMA 4HUWA 2YD9A 5KW9H 5DHYA 3QQ4A 4YDIH 1HK6A 4M9OA 1P6FA 3LDBC 1FZMA 5F88B 2BZDA 4JZJC 1UB5A 5DMGC 5ADOL 2ESVB 3CSYA 3QXDB 4M7JL 1N0LA 4MJIA 5C07D 1D5XA 1NQBA 5IVXF 4OZHA 3W0WE 1M7XA 5EC1A 3KWWA 1A6AB 2DQIH 1KUMA 4ODVH 3L6FA 1XGQA 5EUKA 4KQ3H 5E2TL 3S3JA 3S4SA 5KJRH 4EDWL 4I3RL 2EDXA 1R3KB 1ZEAL 2FX9L 3TO4B 5HHPB 2J6EH 4KKNA 4RMRA 3VGDA 4GMSH 4HEME 2D7TH 3LQAH 4YXKL 4IS6A 4P23C 4PRDB 1FIEA 3ROOB 4BZ1L 5K59F 5ILTL 3B8YA 1A5FH 1ZA3B 5C0CB 3JWNC 3BEVB 2E8YA 1R5VA 6FABH 3OGCB 2Y07L 2NY0D 3HE7C 3O8XD 4K3DH 4UUJA 1XCTA 2QEJA 4KGLA 5C2UB 5F6HJ 3EO0B 3HC0B 3HI5H 3C09B 2XACC 2Y5TA 1RZJH 4MLSA 3GSNH 1JN6B 1UZ6F 4DN4H 4WUUD 1XR9B 5IESH 3KPNA 2BSSA 5HHQA 2NY7H 4YXLL 2ICEA 4MS8C 2V2TA 4DAGL 4K07A 2EDQA 2FX7L 1DQML 2BY3A 3LQAC 1DBML 1HXYA 1B9ZA 4WW2A 3LEYH 4QXGL 1MFCL 3V52L 3MV8A 4LASL 1JVKA 4MAYD 1A4JB 3MRRA 3F12B 4PJ7F 4JFHD 3QDGE 2O5XL 4DUWA 1CT8B 2AABH 2V5TA 3S5LG 3HI6L 2HRPL 5C70A 4MJ5B 4ZOBA 5C0BA 3CMGA 1MEXH 2DQCL 3I9GH 4LNRB 4YZFE 1ZLUK 4Y4HC 5I1DA 3CDCA 4OI8A 1CICA 1KTLA 2FR4B 1NCDH 1YY9C 1M1SA 3WL9B 4OKVA 3C5ZC 1MRCH 4PJHB 2DIAA 1X9QA 1B0RB 5CMAB 1JNLH 2AP2A 4EUPG 1N8ZA 3KYNB 2V5RA 1KJMA 2OS7A 2CJUL 4Q6IC 3T09A 4IRJD 4YHKH 1IKNC 1PDKA 1U8LB 2BJML 4ONHB 2NTFA 2EDTA 1VKXB 2F53B 4PJIA 1K2DA 3LIZL 4X9GA 4UDUB 3RTQD 2DLFL 2IG2L 3CLEH 1RUQL 3NCYS 5D2NB 1AGEB 1JNNH 3MV9B 2CLZA 4LLVB 2KZWA 3QDJB 2NZ9C 4HAGA 2BHZA 5I66B 1L7TH 1RUAH 5F9JB 3MUJA 1MCOL 4OSUH 4PJGA 1EVUA 1UCBH 2VLKE 3TGXA 1WAAF 1WITA 3WFDH 1PYWA 3BZFB 3RL1A 1ZTXL 5FDYA 4UB0H 1ZLVH 1NANH 4ZTOH 3WNNA 1MCWW 4KUZL 1NCCL 4ORZC 1A7RL 5GQBA 1IGCL 1JGUH 5FYLE 3TIDA 2GSIB 1LE9A 1JTTA 4M61A 4FABH 3DXAE 4WO4B 3L5XL 5FYKH 1ZMYA 3HE6A 1G7HA 2D03L 5GHWH 3QH3A 2D7MA 3RJQB 4LLAA 1RZIB 2FL5B 5LGHL 3O2WL 2EEBA 4YWGH 2H8PB 2AJSH 5K9OB 1IKFL 2J8UB 4YGAB 5KBNC 1GPOH 2Z93B 4HKJA 3IU4L 3VG0L 1RJZB 5EG6C 3N50A 4AT6B 5KZCB 4JHWH 1R3HA 3HB3C 3LAFA 4U1HA 2AJVL 5CGTA 5DMIL 5MI0B 5AD0A 3MRIA 5E2UH 2GT9B 3PV6A 5TGBA 1JMXA 1MFAH 4LRNL 1T5XA 4M6OH 4PGDB 4ZFFB 2AERT 2ZOKB 4HPOL 1WVZA 5D7LB 1JRHH 5DJDA 3GMRA 1X5IA 3SO3C 1OVZA 1MCFA 3TJHD 2DYPD 2QQLL 1MY7A 4XNMB 3K8KA 3WO4B 4U49A 1MJ8H 2W60B 1S7SA 4EXKA 2WIIA 3LB6D 4UIKH 3GMLB 2KBGA 3V4PH 1MJJB 2G5RA 2IBZX 4KK5D 3FONA 2NPLX 3QUKB 5DEZA 5JR1H 1W8OA 5J3HD 4WEBH 1PEZA 1ROWA 1IAIL 3RWHA 1AR2A 3MBEC 4GT7A 1N0XL 5DD0L 1I1YB 5K9JL 3GRWA 5DD5H 5DSCA 3UBXA 1MRFH 1AKJA 2BSRB 2HKFH 4UU9B 5IVNA 5D2LF 1YEKH 3IFOA 3CXDL 3OZ9H 3LZFH 1LNUB 5EUOB 3DRQB 3MNVB 5BOZG 4HKXA 2EDHA 4LPWA 1IM3A 3TVMC 1QKZL 4RGNE 3MPCA 4XAKE 4BZ2L 3E6FA 2O5YH 2F54E 4HFWA 1C16B 1I1AD 3NACH 2FIKA 3MA7B 4TNWF 1QA9B 3GJFH 4JPIB 4HH9B 1L0XA 3LS5L 1XGRB 1F6LL 4JKPL 3O4OC 5GS0L 2HWZL 3D39B 2W0LA 3MROB 2C7UB 4I18A 3X13A 5DK2B 3MV7B 4XVJL 1KLFA 4XVUC 5MI0C 4MVBC 3RNQB 1YN7B 1J0YA 1NGWB 1T2XA 3C9NA 3N0PB 3QUML 4XI5D 2OTPA 3B9AA 2VSDA 5LGJB 5FA4B 2C26A 3DO3A 3RU8H 3VRJB 4O4YH 3VFPA 3MRPB 2CK0H 4Y1AD 5D70L 1A14L 4LCWE 5CEXB 1HHJA 2MFNA 3FB6A 1CN4A 4NQDB 2MSPA 1FV1A 5I6XC 5L2KA 2D31B 5KVFL 3CSBA 4OFPA 3AB0C 4JQIH 1HZHL 1LK2A 3QFDB 2YD1A 2J12B 4ZSOB 1XZ0A 4RZCA 4PJXF 2IBZY 3HKFA 5ENWB 1LE5A 1BBDL 1D5ZA 2OTUB 3TFKD 1QSEA 1JWMB 1A1OB 4HWZB 1JPST 4XH2A 5EU5A 4PD4J 2XPGA 2IFFL 1G6RA 2P45B 3LKNB 3GMQA 4YO0A 2C4FT 3ULVF 5GJTH 3WUWG 4KJYA 4YPGA 4AH2B 1NKRA 3BPCA 4X4ME 1D9KB 1YJDL 1IC5H 2WUCL 4HLJA 3MRDB 4L9LA 1IQDB 3NZHL 3ULSA 3VA2C 3KVQA 5C0AB 5I2IB 1X5KA 4TNVF 4MXVE 3LKPA 3PGCA 3L3IA 4U7SA 3DUUB 3ARED 1RFDH 2Q8AH 3LQZB 2XRAH 1CG9B 1DBBH 3V4UL 2VLRD 2HKHL 2AEPH 3FQXB 3OXRB 2YSSA 5FAAA 3QPXH 3O8XA 4CW1A 1ZGLA 1RUKH 3BDYH 3SBWA 1A21A 3PABA 5FUZL 3G6JB 4LGPB 2XKSA 3VXUE 4U6XA 5ESVA 3TBTA 2GYSA 1QRNE 2IF7A 5D8JL 4GW5B 3U83A 2ORBH 3MNZA 3AXLB 3HC3H 4QYOA 4WUUA 5EU4B 2MOVA 4NPYA 4J3UA 4E41E 5D7IF 4P46D 3ZDZE 5DK0A 3CAFA 1G9MH 5F97E 1KV3A 1TPXC 3GSVA 2HH0H 1Y18A 3KXFE 1JPTL 1TVBA 2NW3A 3HPLB 5DJ6A 2C1OA 4MAYA 1S7XA 2FRGP 1H3VA 1U41A 1Z2KA 1BZ7A 4I18C 1FDLL 4U1IB 4DZBB 4XBPA 5DEGA 1QVOA 3T1WA 3EYOB 1VHPA 5F3BB 3A67H 4Z5RB 3CUPA 3T1FA 4F57H 1GZQA 4HXBL 4NRZA 5IMOA 3GSWB 1FL6B 1MREL 2DQFA 4M48H 5KSBF 1C12B 2XI9A 1CXKA 3HPJA 1G6RH 4OQTA 1GL4B 1D6VH 3KPPB 4QF1B 1T21A 1E27B 4MNGA 1OP9A 1ZLSH 3KGRA 1HOCB 2IADB 1TQCB 1KPVA 3LOWA 5JIIA 4IRSB 5FV1L 3THMH 5ISZD 3T0AA 3VXSD 5B4MD 5J11C 4JZOA 4ZUUB 1I9IL 2CPCA 1A7PL 4QXUH 4XCCL 1FNGB 1WBXB 1AD9B 4WTXA 4OZGA 3EGSB 2EDFA 2XN9D 4KRPB 1ZHBB 3UEZA 5KS9B 5JOPD 1U8IB 1ADQH 4GRLB 1AH1A 4K94L 3U46B 5DK3A 4OCSL 1AD0A 4Z7QF 2Q8BL 1IM9B 2W59A 3QEQA 4HMEA 1YEGL 2DQDL 2QADD 4OB5L 3RTQA 3VXNB 3PHOB 2NLJA 1X3DA 4WFFE 5T5FL 4L8SA 5IJVB 5IHZB 4P9HC 4ETYA 1KXTB 4LSPH 5EIVA 2UZXB 4UDTA 5F6IB 4KI5E 1HSAA 3NIDE 4X7SH 5J9PA 1RU9H 3IGAA 4O2EA 1VFBB 3MNWA 3L5WB 3HR5B 5HVHC 4PJCA 2ZCHL 3EOTL 4U7MA 2VR9A 5CIPB 3W9DB 2ZPKL 3QIBD 4JFQA 2XTLA 3LQMA 4JM4L 4KC3B 4YHML 1M05B 2NY0C 3O8XC 5TQ2L 4EBQL 5BZDB 3SBWC 3TH2T 5DZLA 1K3ZA 1KTKE 2FEEI 2GTWB 4NZTL 2EXYD 4BFIA 2IBBA 1WBYB 3TBWB 4FQLH 2IGFH 4KKAD 4M7KH 5I15L 2DWDB 2NY1D 4ODXA 2R1WA 1EK3A 2Z92A 3AS3A 5I0ZA 1F58L 3PP4L 5IIEB 1BVLA 4G8GD 1Q0YH 2E7LA 1DQDL 1RJYA 2R0ZL 3IKCA 1JHKH 4PV9A 3TT3H 4G8FB 3QG7H 2ED9A 5HDBF 1RZGA 4MAYC 3K8LA 1AC6A 4GG8A 1JF1B 4NDMB 1GH7A 2A6IB 3WNOA 4GLRI 3VFGH 5FF6A 3V0WL 2CIIA 4NN6B 1NGQL 3TCLB 1S9KC 1IAKA 3JBG7 2DYPA 1OAUH 3CK0H 4Z7NF 2VDPL 3NA9L 1CIUA 3DUSA 4LCIH 5HPOA 5FCUL 2OR9L 4PD4K 4UAOC 4MZ3A 4WWID 1BQHG 4FQIL 5K93A 4AK1A 4ZAKB 2ZNWA 4Z7VE 1YECH 1IT9L 4K2UH 5ICZA 2ADFL 5HHOE 3MREA 1FN4B 4R3SB 2BOBA 3X3GL 4R7DB 2RR3A 5C0FA 4IRJC 2D0HA 2FO4A 3QPQD 4NKOB 4Z7WE 4Q97A 1HDMA 4JE4B 1U6AL 4PJEF 2F15A 5GPRA 4PRNB 4PS4H 3ZL4L 4I0PB 1M6OA 3GIZH 1CK0H 4E42A 2EEDA 3FQWA 1B4RA 1KG0A 3MRLA 5ESQB 1AGBA 2CIKB 1UFUA 3VFOA 5FGCB 3LVEA 1VFAA 3MRHB 1ZA6A 1P7QD 4OCYL 5EBMA 3RTQC 5GXBB 1FL3A 5JHLH 2Z31B 4L8SC 3UMTA 1WZ1H 4HC1A 4ZO7A 2G9HA 4YIQA 4NO3A 2XZAH 2VB5A 1XF5B 3UTSD 3HMWH 4PJDE 3HUJE 1I1AA 1KPUA 2A74B 2HJKA 3S37H 1E4XI 3FO9A 2VTFA 3FB8B 5D5MA 1PG7X 3T2OA 3N85H 5KAQG 1YUHB 4JFOB 1I7TB 1RK0A 2VR4A 5IK3A 4YAQB 4WI3A 4HWEH 3LS4H 1PZ5A 2IAMD 2ZG3A 3ROLB 2ZCLH 2OXGA 3BPLC 4KAQL 4F7MA 3DVIA 1INDH 2VN7A 1RD6A 1L9MA 1DBAH 4G6MH 2Z91B 1FBIL 3DMMD 2J2ZA 3FO1A 3HNTL 5DTFA 5B3JE 3OX8A 4U6HA 5DDHB 3ARUA 5IOPA 3FN3A 1MUJA 5IV2B 4XHQA 4MQ7B 2W0KA 4PPTA 4KTEH 2E7LC 4ZPVB 4MJ2A 1QFWM 3ZTJH 5A16B 3D1MC 5CJ5A 1ZLVK 1HCVA 2P43B 4OV6F 3CVHB 3WIHA 5INCA 3ABZA 4F7PB 4WI5A 2O61A 3ARGD 2FEEL 1AO7B 3QUXB 4DFHA 5GSVB 4P2RE 5E2TH 1T1ZB 2ITDB 1JF5A 4R9HA 2MKWA 3VRLE 4PRID 4PJ9B 3G5YA 4EDWH 2BRQA 1WCBA 1ZEAH 2FX9H 4KZDH 4JFDB 4P59L 5AUMB 5IVOA 2OK0L 1AXTL 3DNKA 2NXYD 3CFDA 4L4JA 4YXKH 4AIZA 1I7ZB 4BZ1H 5ILTH 3LB6C 5E4EC 1FVCA 5KSVA 5IQ9A 4KK5C 5E94B 1BFSA 1A6WL 1ND0A 1F3RB 3ELAT 5DJ0A 5KTEL 4Y8AA 1X5JA 3KLHD 3T0ED 5J3HC 3GEWB 1WWBX 3DARA 3AREA 4HK3J 1CD1A 1FYTD 4L8BA 2PCPA 3G04A 3DUHA 5I8CB 2VLRA 3D0LB 5DFWH 4YXLH 2YD6A 3Q3GA 5F9WB 2YPLD 4NFCA 3IF1B 4BJLA 3O3BA 2CMRL 1EHAA 3JUZA 2FX7H 5CBEA 1RUML 1DQMH 3LEXB 1FAIL 4AEIH 1S7TA 1NEZB 3G5XB 1R24B 4IIQA 4RAHA 4BUHA 4GS7C 4M7ZB 1MFCH 3T0BA 3QFJB 3UTQA 1HH9B 1XH3A 3TIEA 1MI5E 1M4KA 4P46A 5DWUH 4R8WL 1MPAL 2P49B 2V17L 3I50L 5ANMB 3ZE2E 1CGUA 2O5XH 1I1AC 3UTPE 2R0LL 3ZMRA 4LSVL 4JLRA 1NMBL 3UJIH 4M5ZH 4G42B 4W81A 5C6TL 4QRPB 4WCYL 1WFTA 3QQ3A 3BSZH 4HK3N 2CXKA 5B38A 5CKAA 4PJBE 2B7DT 2J5LB 3EZJB 3S96A 2VE6A 3BIAX 2P5EB 4NCC1 4JPVL 4KMQA 3U9UB 4XI5C 3UYOD 1IRAY 1G0YR 3FTGA 5ACMA 3EOAA 4HIEB 3X11B 5E8OB 4F7EB 4D8PB 4LPXA 3O6FB 4YR6B 5JXAH 1LEIB 2EC9U 3ZHDA 4U4BA 3PQYE 5KSAB 2IAND 3GJFK 4MQSB 5CD3A 1JWUA 1SMAA 5ISZA 2AJ3B 1U8QB 1I3RB 3AS2A 3QEHB 3BN9D 2XN9A 3WYRA 2DLFH 3TFKC 4RNRA 3VXMD 2V6HA 3FQNB 3AGVA 5DRNA 4Z0XB 2A1WL 4IMLA 1IE5A 1GVIA 1CLOL 3IFLL 3PNWA 4X4YB 1U9KA 2DMBA 1MCOH 4JHAL 4U6TA 4AIXA 3KPMB 1SEBA 3QCVH 1NDMA 2DS4A 1EEUA 2BY1A 4CDGC 4BUGA 3GMMB 4P2CG 1DLHB 3DI3B 2P8MA 5HGAA 4LCYA 2D0GA 3D69B 4JDTL 4KUZH 1JWSA 5ITBL 1A7RH 3G5VA 1IGCH 1FPTH 4GXVH 4HPYL 4MHHI 3FB7B 1EHLH 2Y36L 3QHTC 5CZVH 3L5XH 5JHDD 2D03H 3UROR 3JWOL 1KN2L 3AREC 2CXGA 4DVBA 2FZ3A 5EO9A 3QIBA 2L0DA 3ZHKA 5LGHH 2DOCA 3P3YA 5I1IL 1CWVA 3NABL 1NFIA 1B0GB 1YPZA 5SWZB 5TQ0H 3EDDA 2LAGB 3VG0H 3L3JB 2YR3A 3OKLA 1CGXA 5C71A 2ZUQB 4U1NB 1BZ9A 2XTJC 4X6BB 4IIQC 2X9XA 2H1PL 2EDJA 2AW2A 1A7OL 5CLWA 1MH5A 3OKKB 5IB4A 3OR6A 4P46C 2ADIB 4JREC 2EXWD 1QQDA 4I3GA 1P7HL 3QO0B 4Q2ZB 5CJBA 1KLGA 4LEXL 2ESVE 2XKNB 2MPAL 3QUMA 3QRGL 4Y2DB 3RVUC 4HPOH 5EFIB 5KSAC 2P7TA 2KKQA 1NBYB 1VGEH 1JBJA 4XRCA 3MXWL 5I0DA 2QQLH 2NXZB 1FFPA 1FYHB 4PJAF 2R2EA 3MRKB 3SPVB 3BZ4B 1MJ7L 3SDDD 1VERA 3LHPL 3RDTD 3O0RL 4DZ8B 1WIUA 1HNFA 1SEQH 3AS1A 3RIAK 5K9KB 4IOIA 1NL0L 2BY2A 3K3QA 4QRUB 4D3CL 2FNBA 4ZUVA 5FA3B 4Z95L 3GZKA 4PTUB 5T3XL 3AU1B 4DK3A 3CC5A 1AHWC 3VDCA 4ZYKA 4XVSL 4JPKL 1W72A 4ODSL 1IAIH 5FO9A 4NSKB 3DGCR 5C0CE 3FRPA 3E6HA 1N0XH 4GXUN 5D93C 1MCKA 3W11C 4HK0B 5K9JH 4MX7A 3HNVL 5B4MC 3F7PC 3EFFA 2PYFA 2Z35B 2X4OA 3GB7B 1NFDF 3SDCD 3K2UH 3CXDH 4P5KB 2X44D 1P7KA 1TTGA 4JVPA 4NKQB 4MCYB 3B9EA 2EYTB 3KYKL 4Y5YA 5DUBA 3RL2B 3TLRA 3VXOB 3LRSB 5C6PB 4Y4KD 2W0FA 2BFVL 3MMEB 5BJTA 1AQDA 3WFHB 1LO2H 4QOKD 5FO7A 4P9ML 4ZFOB 3FFDA 2CDEB 5DR5L 1P7QA 4MQTB 5E6ZA 2E6QA 4GKNA 4KUCD 4LLDA 5DVOA 3LS5H 3F62A 3QQNA 4JKPH 1B2WL 3DX8B 4X99B 1HEZA 2HWZH 2H3NA 5B39G 1UB6A 3UTSA 4XVJH 2VKXA 1DL7L 1R3JA 4GQ9L 5FHBL 4A6YA 3L3KA 3QUMH 4PLKD 1DVFB 3VGBA 2YXFA 1MCNA 2A6DB 4PGCB 1CTNA 5D70H 1A14H 2IAMA 1PX3A 5GZOD 4X7TA 5IMMA 1U58B 4OIBA 43CAB 2QV2A 3IDJA 4XMLL 5HYQA 2JB6A 5KVFH 2X42A 1HZHH 4KXZH 2EXYC 3OPZL 1VEPA 4OLVH 1ZS8A 1EVTC 2NY1C 4P2QB 5EBWA 2APWA 5GISL 4K7FA 2CLRA 4LLYB 4LSUH 1BBDH 3KLAB 4Z8FL 4NNXB 4NKIL 1AI1L 4GSDH 2DLIA 2JELH 2FB4L 1AXSA 3W5MA 3P4OB 2F53E 5CILL 1CR9L 4UQ3B 1S7UA 3VXTB 3B43A 2IFFH 2YD7A 3O2DL 2NY2B 4XZUA 5F96L 2CKBL 2WBJB 4GH7B 1EEZA 5FV2A 3WHE1 2RFXB 4PJFB 3ARGA 5D2NE 1SHMA 4MXVF 4U0QB 1RZ7L 1MCQA 3UDWA 4OTXL 3QDJE 2I07A 3MCLL 3P4NB 4PRIA 4X6FB 3BZEB 1YJDH 2EYRB 3SKJL 2MKLC 5IM7A 1YEFL 1YZZA 3H0TA 3ALXA 5ID0A 4IHOA 5BW7A 3IDMA 1UKQA 5HGHB 2W91A 5DYOB 1I8LC 2DIJA 4U1LA 1KIUA 3VFUB 4WHTB 4G9DA 5MEQA 1RUPL 3O6LL 2HG5A 1GGUA 1WWWX 1JTPA 3T0EA 5FUZH 1QO3A 1FIGL 4HBCL 4HWBA 3GSNB 3QPQC 4TTGA 5D8JH 4QHMB 4L1HA 1FYTA 3V6FB 1I9RL 4MNQB 4YDJB 4Y5YC 2BVOB 4OZFA 3OG4B 2J8UE 5AG8A 4EN3D 3IJSA 1EFXB 3HN3A 1I8IA 3U30B 2YPLA 1YMMD 5I1EL 1HKLL 1I3GL 5C08D 1KLUA 3I6LE 1BIIA 5L2JA 1MWAL 5B3NA 4LIQL 2H9GB 3S34H 2OMBA 1JPTH 1A6ZB 2EDNA 4YDKH 5L8JB 2CR3A 2WANA 2YPVL 4MA8L 2I24N 3GSQB 3HG1B 4PRBA 5E7BA 3G5ZA 1FDLH 4HZLA 1JCKA 5DHYB 3QQ4B 4CMMA 2JCCA 5C0ND 1PQZA 2R69L 5D7LE 4I3SH 1J8HD 1UB5B 1K4CA 4QTHA 3CSYB 4F7TA 1YA5A 2FLRT 3HLAA 4MJIB 1D5XB 2QQNL 4HXBH 1TVHB 4OZHB 1P84J 4OZIA 3DV6B 1MREH 1N6UA 4FMFA 3KWWB 4KDTC 4RMTA 2IAMC 1I7UA 1OGTA 3GMNA 4P2OC 1F97A 5KN5A 4RSVA 3RY5A 2AK4E 3S4SB 5GGSA 1OAXH 2CDFA 3R4DA 3DMMC 4JRXB 3QO1B 1A7PH 4MXWL 5JORA 4XCCH 2JE8A 1P4BL 4ONGH 4Z7UA 2V5YA 4XPHL 2IC2A 4M4RA 3KNBA 3PWJB 5FGRA 4X98A 2IANA 4Y89A 1JPGB 4HKBB 5IGXL 3RVTD 5IVXA 4QHKI 4CN4A 3EJJX 2WP3O 4K94H 4X5XB 3KR3L 4UUJB 4AEFA 2HN7A 2VQ1A 4YXHL 4O00A 1T1YB 2Q8BH 1OY3B 4Z77B 3BIBX 3ULVD 2Y5TB 3IFNL 2FSEB 35C8L 5EUOE 5DA0B 1XR8A 5T5FH 3VXMA 3ARGC 5KG9A 3FMGL 4XAWL 4RQQB 3SDAD 3KPNB 4HWNA 1M71A 3BWAA 5D7JA 5C9JA 1IEBA 5I1HL 4MMXC 1S7VB 3FCTB 2NXYC 3TV3L 5HHMD 5BW7C 1HXYB 4F80A 4WW2B 3EOTH 5EH1A 2VDKL 2VLLA 5E8PA 3MV7E 4XBGA 3FAXA 1PLGL 3WMSA 4JM4H 3VFNA 4YHMH 5JO5B 5TQ2H 4EBQH 1S8DB 5ACZB 1DN0A 4ELMF 4JFYB 3KLHC 3T0EC 4TOYH 4MA3B 3P4MA 4JO2L 3PWLA 4NZTH 5F1OB 4MDIA 1JI1A 5I15H 1FZOA 4NUJB 1WEJH 1MAKA 1CICB 1KTLB 4NQDE 5I18L 2V7HB 4G80B 5CINH 1JJUA 2A77L 2D7NA 3C8KB 4PP2A 1J87A 3ETBF 4PGZA 4FZEL 3LY6A 2JJTC 5F7WC 5CZKA 4PRPB 2R0ZH 2HJLA 4ZSOE 3O6ML 3MRCA 4PJ7A 4PTTA 1MF2L 4M1GH 5DVKA 1T1WB 2W0PA 5EO1B 4YEFA 5DJAA 4FQPA 4JO3L 4C4KO 3ZE0F 4JFXB 4ONFL 1NGQH 3SOBH 2GJ6D 1T6VN 5HDQL 3NCJH 4GRMA 3O81A 3GKWL 4DKFL 3M8OL 4PB0H 2VDPH 3CXHJ 5FCUH 2CLVA 2OR9H 3WLWC 1F8TL 2VXQL 2E8ZA 3SDDA 3RDTA 4Z7WF 4NCDA 4N1EA 1G0XA 1U8PA 2CLZB 3D6GA 5AWNL 2J8HA 3C6SA 2YXMA 3UJTL 3KPSB 5I1GL 4JFPB 4BQ8A 2ADFH 1KJ3L 3X3GH 4CJ1A 1WIOA 4XP9L 1PYWB 1KOAA 3RL1B 1WTGT 2YZ1A 4X80L 1Q38A 4R97B 5C07E 4FFZL 1U6AH 8CGTA 2DWEA 4XNXL 3ZL4H 2BVUA 4M8QA 5A2KH 4NN5C