5HDQH

Mntc co-structure with mab 305-78-7
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
213
Chain Sequence
QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVQQRPGQGLEWIGYINPSSDYTKYNQKFKDKATMTADKSSSTAYMQLSSLTSEDSAVYYCARKEDVGYWYFDFWGTGTTVTVSSAKTTPPSVYPLAPSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter substrate-binding protein
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein/immune system
total genus 49
structure length 213
sequence length 220
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqH02
3LQAL 5C0EB 4KTEL 5FYKE 4FZ8L 1QR1A 3WIIH 1DFBL 3L5XL 4XRCA 4HPOL 3ULVE 1MRDH 4OCYH 3MR9A 3C09C 1EEZB 1EX0A 1S9WB 4O51A 2VC2L 3IDYB 5EZIH 1CXFA 4JPVH 4TUKH 5HPMA 4PRHE 3QEQA 5D7LA 3HG1B 1RI8A 3VD7A 1SJVA 4DOHB 3L7EA 3PDOB 3MRFA 3SDXE 4R4FL 2CH8A 1ERNA 2AEQL 3FQRA 3NCCB 4G9FB 5IV2A 2Y23A 2J8OA 4C4KO 4P5KB 1VEPA 1LK2B 1H3PL 2E8ZA 2ZNWA 2H9GA 4XPTL 4JVPA 5TE7L 1YEDA 4KQ3L 5DA0B 1KENL 3CMOL 3MV7D 4AQOA 1TZHB 4Z0XB 5F9AC 4ONGH 5FUCC 4DK6A 3W81A 1GC1L 5BV7L 5KVEH 3RBSA 2GIYA 2OYPA 3MPCA 4JZNB 1NCNA 4Q9QH 5I6XB 2IFGA 4POZC 3ZE2F 3E3QE 3S97C 4XX1G 3D85B 3SGKC 2E7BA 1QQDB 4J7RA 3SCMC 1UACH 4TSCL 4LVOC 2VKWA 4OCNC 3SKOB 1HKLH 2J8UE 1FZMB 5A2LH 4QTHA 5HY9B 1WICA 5DJ8B 3VFWA 3GSNL 3PHQB 4ZFZB 5HGDB 5D7IE 4L4TA 1T20A 1OPGL 4NO5A 5D7KE 3QFDA 3EOTL 4NC1C 2O26U 1TVHA 4FABL 4PJDA 4OLVL 3B43A 1Y6MR 3SDDA 1LO0H 3FTGB 4WFED 1PX3A 1BPVA 4RBPH 1EGJL 1MCIA 2AJUH 2AXGA 2FDBP 2QQNL 2DD8L 4LBEB 2P5WE 3B9KB 2HA1A 1FE8H 4PUBH 4K7FB 4DN4H 2ITDA 2JCCE 3D3VB 4M1GL 1KTDA 3GMQA 1JGDA 1AI1L 1CFVH 4P9HC 1WZLA 3L7FA 4Y4HA 4PY7B 4WU7B 5EOQH 1KJVA 1YEEL 4TOYL 5CD3A 3GO1L 4F8QA 3TESA 5HDLA 4JM2A 1S7XB 3DMMB 1YNKH 4ODWB 4DAGH 2X7LA 2PW2A 5EU3B 5FOBA 5CLTA 5HD8D 3ZHLA 4IBLT 2FSEB 4JRXE 1RURH 4Q97A 3BZ4B 2ZCLL 4OLZH 4OZFA 1T7XA 3IU4L 4WV1C 5E70A 4P23A 1CD1B 1FL3B 2UWEA 2DICA 4M62L 4XP4H 4PJ7A 4RFOH 1ZVHA 2PXYD 1IC1A 2IPTL 2DLGA 1I8LA 2YXFA 3IXTA 4OUOA 1L4IA 1IARB 2BHYA 3HZKA 2QL1A 1XF1A 2D7MA 5EU6A 4MD0A 4D3CH 1Q94B 4NUJA 1R3LB 1FDLL 1KCRH 2CUIA 3RNKB 4P2RE 4H8WC 4HT1L 5CZVH 1F11A 3IFNL 5IESH 2OJZH 1FNSL 2XZCL 1QSZA 4WFHE 5M7QA 2B2XH 2JB5L 3GJEA 4G6AC 5H37H 3MRQB 4FQJH 2VISA 4R4NC 5FB8B 2AK1H 1K3IA 3PWPE 5DJCB 1EJOL 1MJJB 2FH8A 2HJLB 4ODUA 5HGGS 1EK3A 1TIUA 2F5AL 2I5YL 4HSQA 3QRFM 2QSTA 1L6ZA 1SJEA 4MXVF 3O3EA 4TSBL 1CWVA 4K8RC 3MA9H 4OM0L 4BH7B 3KPSE 1G7HB 2Q86B 4RMRA 4HJJL 4JFDD 4JPIA 1RVFH 1VADA 4G6MH 3GJFH 3RVVC 3B9EA 4S1SL 5CGYC 1IM3B 4FP8H 2ZG1A 2I24N 1G6RL 3FO9B 4ZTOH 2IFFL 2HJKB 5IHUH 5DSCB 2VXSH 4KAQL 1C16A 2ZPKL 2JJTC 1J1XL 5DQDL 3VH8G 2CD0A 2Z31D 5GS0C 5DRZA 4J4PD 4Y1AB 3P4LA 5IGXH 1MRCL 2IBZX 3T0WA 2GTWB 3EHBD 4YHZH 1MWAA 4R3SA 5H37G 1IEHA 4JB9H 3AREA 3D39E 5ALCH 4IM8A 1CVRA 5E8OA 3QWRA 3E0GA 1NSNH 5FO8A 1CDYA 5JR1L 1CQKA 1OSZB 1U36A 2V5TA 4NDMA 3ZSSA 4CVWA 2P5EB 3M17B 2DYPD 3SKJL 1X5YA 2LABA 4M7JH 4OGXH 3FKUS 4NPYB 4YDVB 3BX7C 5BOPA 3PUCA 5KANI 1MOEA 2BXYA 3EGSB 3HPLA 4X7EC 4EIGB 5EZLB 3GSUA 3P3YA 1NJ9A 4HC1L 4ZUUB 5JDSA 5JQ6H 1KCKA 3CDGA 1WWWX 2FO4B 3HNTH 5IVXE 3C2AH 3CMGA 1LILA 4QRTB 4ESKA 4JFYB 3RWEA 4M1DL 1A6VL 2G75A 2HT2D 4IOFC 5BVJB 2OK0L 3IFOB 3T4YA 1MJ8H 3L3KA 4UQ3A 4ZFFB 1RHHA 1DUYA 1X44A 2H1PL 2AJVH 5E6IA 3PL6A 3S36L 1NAMH 3TBVB 2EZ0D 3CH1A 2C3HA 3SOBL 2D7NA 3LN5A 4JZJB 5D96B 4S0SD 3QFJA 1PZ5B 2OI9C 4MVBC 1Q38A 2OZ4L 5D1ZD 3N1PC 4GRLA 4HS6A 4R4BA 3SDDC 4LDLB 1D6VL 3D69A 3G6JF 4FFVC 3L9RB 4KMLB 5KSAB 3WDJA 1HXYA 3T0ED 1U8JA 5GS1A 4KVCH 4YBLB 1LP9B 2NTFA 1FGNH 3EKCA 2M26A 4Y4HC 5F9OL 3VXRD 4GAYA 2JELH 3O0RL 1N59B 4D0BA 3HI1A 4UT6L 3NACL 5GGTL 2X4UB 2GFBA 4K55A 4XXDA 3ZKNC 3RZCD 1C08B 2VZ1A 1MHPL 4CAGA 4RQQA 2GJ6E 3U4AA 4OCLC 4U1NA 3KPPB 2YD2A 3EO0B 4UIMB 1YQVH 1H8NA 2QKIA 4G8GD 2VZSA 3JWDL 3DO7B 3VD3A 5KS9E 1CFQA 1UZ8A 2AP2A 4HIJB 4P23C 4UU9B 3P9MA 3BRFA 4WHYH 4YXKH 4Q2ZA 4ODHL 5D93B 4JFEE 1M6OA 1F4HA 1M71B 3BWUC 1QLFA 1X6LA 1PQZB 3RP1A 1AP2B 3AXLB 1CZ8L 3L3DA 3QDGE 3WFBH 4BQBA 3UTTB 4AK1A 1BZ9B 4OCSL 1CFNA 4M7KL 4LDEB 1DLFL 2Y06H 1OD7A 2VR5A 1DCLA 2BCKA 5E2JA 3O6LH 4J23A 4APQD 1NEUA 2CXGA 2P8LB 5ACLA 1I75A 1HINH 4LKCB 3UAJD 1CDUA 4J3TA 1YEFH 3WL9A 1OAQH 1YN6B 2A77H 4X6FB 1ODAA 2E6PA 2J4WL 1WEJL 4KJQD 3A6BH 4D9RD 4P0DA 5D2LE 4FQXB 2R4SL 1QBML 4HH8A 3JTSA 3R4DA 4YHPB 1T22B 3FFCB 3VH8A 5BQ7A 4JZOA 1OGAB 3QIWB 3ZDYE 5FGBC 5KAQF 5EUOB 3MNZA 3QNZA 1X4YA 3ULUD 2QADB 3TZVA 4Y5YA 1T5XA 2KUTA 4LLYA 1UKSA 5DEZA 2O5XH 4AEEA 5CSBA 5MERA 4NJ9L 2GK2A 3U2SA 1R3IH 4N0YL 2WP3T 1NH6A 4ZPTB 5I17A 3AS1A 1JPSL 2NY4B 5C0RH 3KYKL 2V2TB 3MRJA 4KK5C 4R90H 3IFPA 4OZHE 3UTQB 3LD8B 2NY1D 3RAJH 1A2YA 4HWBL 4MAYA 2V2WA 1Z6JT 5KSUA 3U7YH 1BF8A 4PBWD 1Z2KA 2VLME 5GGUA 5ISZD 1QACA 2DLHA 1NKOA 2XKNB 4XVSL 4LF3A 3EJJX 3P4OB 1MNUH 4ERSL 3GJFA 1DBBH 1BOYA 4UBDC 1KN4H 4JDTL 5GGQL 1IKNC 1LP9F 2BNUA 2VLKA 4ENED 2YPLD 4OF3A 2D2OA 3RPIB 3ARGB 2PKDA 1MY7A 4J12A 2X4NB 2FB4L 2R4RH 4O58L 5C0JA 1IEBB 1T7WA 1DVFA 1JWMA 1WTGT 3OBAA 3UTZB 1C8PA 3NCYP 3VXUE 1XIWB 3UJJH 5B3JF 1DP0A 3OAUL 4EOWL 2ADIB 4FXKA 2GJJA 4LCYA 2BVQB 2HRPH 3IU3B 4YGVA 3OR6A 4M93B 3VMOA 2R2BB 4GW1B 3ZDZE 4M8VA 1U8MA 2FNBA 4HDIB 2JTDA 4I0PD 4N8CL 3X3FL 3DVIA 1WCBA 3TJEH 5GXBB 5SX4I 3K2UL 3ZT5A 1CGTA 1FL6B 4H5SB 5F3BB 2NZ9D 3O6FC 2XTJE 4PGBB 4KRPC 4KKBD 2IPUG 5BJTA 4WO4C 4GQPH 5EN2A 4F9LC 2X05A 1FVDA 1ZKAA 4JQIH 4LSTL 5C07B 4MA7H 2G60L 1IKFL 1IGJB 3MRDA 4NQVB 4P9HL 4OFVA 2QHLA 1JMZA 3S34L 2O61B 3GM0A 4HS8H 1RZ8A 3RUGB 3QA3A 1NQBA 5TDNA 5E6IC 1KIQA 4OZIA 5E2UL 5JHLH 1ZEAH 5L2KE 3VFPB 4OUUB 3PP3K 4L3AA 1I9IH 3QEUB 1FVEB 4KTDH 4P2QD 5DR5H 3V6ZB 4XCYB 5KVDL 1CCZA 2O5ZH 4GRLC 3GSNB 5EUOF 4PB0H 3NIDF 1P1ZB 3O2DL 5DGQA 4NKMA 5E4EB 1S9VA 4XMLL 3QNXB 3V8CA 3VXPB 1WWAX 4OT1H 4X5LA 4YEFA 4FN0A 3F12B 5GS1C 3C9NA 4NWUL 3I9GL 5LGHL 2VMFA 1BAFH 4X4YB 2DI8A 2YUWA 3G6JE 1KELH 3L1OH 1YYLH 5I1EL 3L3JA 2HFFB 2VQ1B 4BSJA 1R0AH 1HWGB 5DHVH 4AIXA 2KH2B 4HXBL 4X6BA 4LCWE 2A6IA 5ACZB 1N2RB 1I8IB 4L3CB 1MAML 3QXDA 4H8WL 3HE6A 5KOMC 3WHE1 1MH5A 1XF4A 5KSVA 2F58H 1NMAL 4YWGL 5JUEL 3QDMA 1AGFA 1WJ3A 5J89A 2BNQA 2DQUL 5B3NA 1A22B 4HUXB 3F7QA 3TVMB 1ITBB 1A7OH 1BQLH 4LEOB 5MENA 5CFHA 1I1FA 2FL5B 4LHUD 4NRXA 1IFHL 1HILB 1GHFL 4Z9KB 4PTUB 4NP4H 3VFSB 2A9NL 2EO9A 1KJ3H 4L5FL 4Y1AE 4YHOH 1R3JA 4AEFA 3RIAK 1UWXH 2AJZA 1HHGB 3GI8L 1P7QB 4PJ8A 2IPKB 1N0LA 4PJFB 2R39A 5I1KL 4JRYE 2J7LA 5DMKB 1OP5K 4F7MB 3QR2A 3EYUL 5E56A 5E00B 4OFKA 2ADFL 3FO0H 5FA3A 2EXWC 2OMNA 3HTLX 4BM7A 4YZFF 1OARH 1ED3B 4POZD 1EXUB 4PGEB 4N9GA 3OWEA 3VGAC 5D9SB 2FEEL 4D9LL 3DGGB 3VFVB 1FPTL 1WZKA 4EVNA 1AHWB 3TC9A 2HT3C 1AGBA 1P4LA 4O02L 1TMCB 3PWUA 3C08L 1XF3B 3PQYB 1CICA 1NGZB 4RMWA 5IB4B 2VUYA 4FFZL 1CXKA 3TZVC 4OQTH 1J05A 4Y5YC 1CL7I 2YD9A 1ZLUH 2EEBA 5DUPH 3EOBB 1GH7A 4N8VB 3RUGF 3ARQA 2CO6B 4ODSL 3ULSA 2X9XA 4XPHL 3VGBA 1JRHI 2VZVA 1IQDB 3GRWH 4GKSA 2ZOLB 2EDWA 2Z4QB 4G3YL 4LARH 3V6FA 1WGOA 1D5XA 3U4EA 4M6OH 4M5ZL 1J8HE 1QSFB 4MNQE 3BUTA 5JHDB 4MAYC 2UYLA 5LAXB 4TRPH 4NNPL 1OT2A 3GNMH 2NW3A 1ZGLA 1T5WA 4J3UA 5DUMH 4XNUH 3U0PA 4NO3B 1JGUL 4DQOL 1S7TA 4CVXB 2ZZUT 1PX4A 4G8FA 3VW3L 4BA8A 1WWBX 4HIIB 1CDIA 4HUUA 2R2EB 1KFAL 1MHCB 1PW3A 1LNUA 4NQCA 2PW1A 3TGXA 1E6OL 1EO5A 2D0HA 4LIQH 4X83A 4E5XB 4FMKA 1PYWA 3GKWL 3QI9B 4FFYL 3NZ8A 3J7HA 4WEUD 3VA2C 1NCBH 3T4AA 5J57B 4LSSL 1F3JA 3TFKC 2HYMA 5BRZE 5EO9A 5I73B 2ZG2A 3ZTJG 2ZWLT 5L2JA 2BJML 1U0QA 1JUFB 3VXMB 2O5YL 4GXUN 1Q72H 1T6VN 3AAZA 1X4XA 4PJXA 3MV7E 5I16B 1HXMB 2B20A 5GHWL 2OLDA 1G9EA 1OAYL 3HFMH 3SE8H 1J87A 4PJFF 3OKNA 1XFPA 4G6AD 2LQRA 2Z0BA 5D5MB 4P5MB 4R4ND 1RZFH 3VFNB 4A6YA 1OF2A 1R5VA 5DZLA 1KLGB 2HG5B 1YJDC 3M07A 4I3RL 2IADB 4JREC 3HPJB 5DUBB 1FC2D 5T1LB 2F5BL 1FFPB 1I3VA 4K8RD 5JW5B 2YPVH 2G5RA 1IC7L 3JUZA 3MJ7A 5DJ0A 4D8PA 1JPGA 2X40A 4P46A 1UEMA 1VB9A 5EZJB 3CXDH 2BFVH 4U3XA 4OFDA 4L3EA 4YEEA 3V7MA 4M1CD 4XWGH 1N6VA 3V4VL 4PJIB 4UZGA 2DIAA 2DWEB 3HC3H 3QXUA 4F37K 3H7LA 4WFEE 1MCFA 5IBUG 1ZVSA 5D4QA 3OGCA 3DX7B 2VAJA 3WNPA 2FX9L 4NHUA 5IW6A 1N4XL 5J13C 4HUWB 5GS0D 4RWYL 4XNQA 5F6HJ 4RRPG 1E4XH 3OJDB 3LEYH 4Y5XC 5D71L 4MQSB 5CD5C 1RJLA 4N90D 4HX1A 5FM4A 2P47B 3L95B 2YA1A 3QEQD 2Z8RA 4K71B 5D7LD 1B0RB 1QR4A 5EBMB 5J12C 2YZ1A 1A6TA 4KI1A 4XHJC 4QWWC 4XPBH 3QUML 4HKJB 4PRBB 4F2MB 2CKBA 2XY1A 5IEHB 5ETUA 2G2RB 1R3HB 4PRIA 3MSPA 4K23H 3VXTB 1NDGB 1WFTA 1BD2A 3HR6A 3BZFB 1MFEL 3SE9H 1U6AL 2F53B 5HGHB 1BOGA 4X98B 2ADJB 2J6EH 3L6FB 3U9PH 5BW7A 3GSRA 1S5IL 5EZOH 5CP7A 2L7UA 1LO3L 5I9QC 1DE4B 4FHBD 4PV8B 2RCSL 3SQOH 1EHLH 4GAFB 2XZZA 4ODXA 3E2HC 2X09A 1VGKA 3D1MC 4X5XA 1OAKL 2GEEA 4PPTA 3H42L 1KCSL 5CMAA 4IOFD 5C71A 1P2CA 3IRZA 5I1CH 1WFNA 1BEYH 4OI9A 1RZKC 3RDTB 3SN6N 3GBML 1S9YA 3KPQB 4KKCC 4NKIH 4Z8FL 3I3EA 1ITCA 4L4TD 4XZUB 4LPCA 1S7UB 5K9OA 1OW0A 2R0LL 4MQTB 5CUSH 3CVIL 4Y19B 3F58H 3BP7B 4GAGL 3C8DA 1YPZA 2HFEB 2Z35B 2X2YA 2D7OA 1CLOH 3LS4H 4MVBD 5E99H 5HI4C 1ES0B 5HHXL 4NRZB 3SDDD 1Q0YH 5FO9B 3HNSL 2XQBL 1TJGH 1F4XL 5LBSL 1OT1A 2WLZA 2YPKB 4JFXA 3KPRA 3QHZH 4WTWA 3SGJA 3BEVB 4WDIA 2FD6H 4OQTA 4XCFL 5EO1A 3X14A 4FRWA 1BLNB 1VPOH 3RUGE 3HMWH 1A6UL 4JJ5B 4KTYA 1B3JA 3D18B 4Y4HD 1YDPB 3SGDH 2YD7A 4U3HA 5FUOH 3V9FA 1F2QA 4PJIF 3RIAF 4GW4B 3GIZH 3CFDA 3ZKND 4W68A 5AD0B 3NZHH 4WW2A 4JM2D 3O3BA 3EFDH 3PABA 1FFNB 5BZDA 5AG8A 1HHJB 4YPJA 4CMHC 1D5IL 3QXAB 5JW3H 4HIXL 3KYNB 3X12B 4NN6C 2NR6C 3MMEB 3RU8L 3MBEB 4OM1L 3QG7H 4P23D 1NUFA 3NFPB 2DDQH 4P3CL 1QFHA 1FNEB 3NBNA 4EDWH 3K7UA 4MYWB 3HMXL 3VDCA 5CJ5A 5EU6D 5FO7B 2OTUA 2BZDA 5T3XH 1V7ML 3H9HA 3M1BB 5EC1B 3HC4L 2H8PB 3TBSA 3GMNB 1TETH 4WUUE 1QRKA 1F90H 4TPRL 1IZJA 2CRMA 1WV7T 3BQUA 5BCAA 4OV5A 4OLEA 1TTGA 3VFUB 2QQKL 1RZJL 3RL1A 1X5LA 3KJ4B 4OCXH 4PRNA 4RRPA 3LIZL 1GGTA 4N1EA 2ZUXA 1ZHKB 4FFWD 2X1XR 1Z9LA 2N7BA 4JG0H 5LQBH 1DBJL 3C6LB 1ZANH 1L7TL 3PHOB 3QQ9D 2BSSA 3DOSA 2B1AL 4M7LT 2AI0H 2CK0L 1KEMH 3S5LB 1ZHNA 2WSKA 1GGUA 5GRWA 3VRJB 1BBDL 4KK5D 3IDMB 4Q6IA 2NY0C 3E6FA 5EOCJ 1K2DB 4KROC 2C7UB 4JFFA 1JYNA 1FNGA 3BZEA 5DVOA 3T0EE 3INUH 4KRMB 1MFCH 1JNHA 3KDMA 3FO1B 2AJXH 2SEBA 5FKAB 4N0FA 4OIIL 2B1HH 3QG6A 4R7DA 4ISVB 4UBDD 3W2DH 3Q6FB 2Y36L 3BGMB 4G7VH 4PP1C 2VN7A 1QEWA 2IQAB 4MJ4A 5IF0A 3ARED 4YR6B 5SWQB 3QWRD 3QUZA 5I66B 2E3VA 1P9MC 3L3IB 3OL2A 1YEGH 5DJ2A 4ZPVA 2UUDK 4HQQL 4GRWE 4Z7NE 2JJVA 4WNQA 2H45A 3GSWA 4B7IA 3DBXA 3EYQD 3ES6A 3WFDH 4CW1A 1YMMB 4O2FA 4R2GC 4XNZB 2DTSA 5JA9A 4L9LA 3FJTA 4XAKE 5E8NB 5INDB 1FAIL 1BM3H 3HZYA 3I6GA 3HB3C 4KGLA 4QCIB 3RPKA 3IJSA 2XA8H 1H3WM 3FQNA 5BS0B 4XAWL 3OZ9L 1U2HA 3BIKA 3BH9A 1CXEA 3WJLA 1N5AB 1N7MH 4KRPD 4KMTH 4K9EH 3SEPA 4M6MH 2GK0A 1KB9J 2AEWA 1FH5H 3CFCL 2J6EA 1EFXB 4FOMA 1JHTB 4MA3B 3RTQA 4F37F 1C7SA 1UM5H 2MCG1 1XR8A 5TPWH 1PG7X 3VXME 1MIML 5E6ID 5JLZB 3PL6D 4PYGA 3VJ6A 1RK1B 2ED7A 1MEXL 3PJSA 4MJIE 5ENWB 2F19H 2CRZA 4XC1H 3G5ZB 1A1MB 3K46A 4ELKB 1A6AB 1OW0C 2XWTB 5KW9H 1PKQA 3HI6L 5A3IC 1U8LA 1MPAL 3DV6B 3QFJD 3VG0L 1T83C 1J10A 3FOLA 3BPOB 1FCCA 3QIUA 4GRLD 4NOBA 5I74C 2XWBB 5L7XL 1AD9A 3RX7A 3ESUF 4L8SC 5FECA 4PG9B 4IHOB 4IDLA 1UXSA 5F7UA 4HKZA 4FQQA 1VEOA 2QR0B 5MEQB 3CPLA 2W9EH 4X99A 1K8IB 4U2ZA 1NFDE 1S5HB 5AZ2H 2P1YA 3O3AA 3LPGA 3LH2H 7CGTA 3ROOA 1AQDA 5GGVH 2R15A 2WBJB 2WZPD 5DQ9B 1UM4L 3UPRB 5IB5A 1S7RA 1I85A 4LVHC 4MXWH 1FBIH 4QRPA 5CEZD 3VGDA 4H1LB 5I1LA 1OQXA 3QIBA 4GS7C 1YY8B 3TIDA 1SYSB 4WFGE 3MXWL 5IFHL 2HLAA 1V05A 43CAB 3IDXL 2BHUA 3O8XC 4GG8B 4RGNC 2DQTL 1B6DA 1A0QH 5EH1A 5E94A 4LQ1A 3GI9L 4WTZG 4L8DB 2EIZA 1FG9C 2G5BA 4MLSA 5HVWA 3OKKA 4QT5B 1L9NA 4RGMC 4ZS7H 4OB5H 1RZIB 1DEDA 2OP4H 1AQKH 3OKYA 4XVTL 2AKRB 1E4KA 5HGBB 2WINB 1QA9B 1T0MB 2FEEI 4UOW0 1V3JA 3QPQC 4TVPL 3MRCA 3BQUC 4JN2B 2KQMA 3TV3L 2Z91A 1BIIB 2GJZA 3U46B 2AQ2A 1C12B 1CD9B 1SM3H 1IGCH 1EV2E 1IGYA 3KWWA 1J11A 2H32A 5JW4N 5IVZB 4PRDA 3TZVD 1SJXA 5E0QA 1DQTA 4O9HL 4NO0A 3CLEL 1UWEH 1PJ9A 4FQ1H 4PRPA 2EDJA 5FYKH 3MRMB 5FAAA 2D7TL 3ULVH 2X4RB 1WBXA 3VFGL 3GMLB 5B38G 3EIFA 3LZFH 3UCRA 4MNGA 4P2QE 3V0VA 1NLDL 1IAIL 2PYEB 2DWDB 5GRUH 2IANB 1QNZH 5HYQA 3P11H 2Q8AL 3V4UL 3O45B 2YC1A 4MAYD 4P57B 1I8KA 3QJFA 2DQEH 4UUJA 3OGOE 2EC9T 4Y7MA 5DD3L 4BFBD 2VLKD 3I85A 4XMPL 1BVLB 1BJ8A 3MLUH 1EVTC 1W2KT 2W1NA 1KEGL 2FBOJ 4J8RA 1DVFD 4LLVA 1TQBB 1J0ZA 2KBGA 3QUZC 3BKYL 1LK3L 1T1YA 2VDPL 3OR7B 1RZKL 4Z7VE 3CUPA 4XCNA 4FTVE 4O5LL 4Z7UA 3ARSA 3MRNB 3MXVL 2X1WL 5ANMB 5D7JA 4BZ2H 4Y2OA 2HVJB 4ZTPL 3LV3B 1T1ZB 5IT2H 1OAUH 3QUMB 3QXWA 4L9LC 1YNLH 2QQLH 2V7NA 1R3KA 3W9DA 2DN7A 3G5XA 2CRYA 4KUCF 5TFSL 3WJLC 1HIML 2I26N 1AGDA 3PGCA 5FUCE 3NFNA 5TQ0H 2HMIC 1NFIA 3QEHA 1UXWA 3AROA 2XN9B 3B3IB 4U0RC 3RTQC 4OFYA 3ROLA 5E9DA 1NAKL 3LKOB 1I9RL 2ICEB 2VXTL 4X4MA 1MHEA 5TH2A 4PJEA 1NGYB 3TN0B 1A3QA 3OXRA 2RIKA 4EI5B 5JOEA 1CGWA 5TE4H 1EUUA 4I9WD 3F7RA 4L4VB 1ZLWK 5ESVA 1VFBA 5FK9B 4PJHE 4Y8AA 5IM7B 5BOZG 3BDYH 1J12A 2C3XA 4JGUA 5E4IA 4NC1E 1D5BB 4MHHI 4HPYL 4P59H 1KBGH 4YO0B 3X13A 3BP6A 3HE7C 4PD4K 1NDMA 4ONHA 4PGCA 4OTXH 2I9TB 1YEJH 3P0YH 4H25A 4KK8D 4IDJL 4IRJB 5KVMC 1A1NA 4V1DB 4U1IB 4KZEH 3O3DB 1RK0A 3QUKB 4Q9RL 4AENA 2HLFD 5CD5D 5I1DA 2E6QA 3HE6D 2QSCL 2DQGH 5IQ9B 5I8KH 2ICWA 5ALBL 1DQDL 3QDMD 1I85C 3ARUA 4XHJD 2BNQD 2K7PA 3LHPH 1G7JB 2FBJL 3FT4B 1EHAA 4A6YL 1S7QA 4P4KA 4NT6A 1A3LL 3QPXL 4JAMB 1EBAA 1DLHB 3GIVB 5MEND 1Z9SA 2CLZB 2KKQA 3QIBC 1Q9OA 5MI0B 3RGVB 2R69H 4HS3A 3D5OF 3B2VL 4C57C 4PJ8D 1LE5A 2GTZA 1JYXA 4YHLL 2W65A 3MCLH 1CDGA 1IGMH 4L8CB 3VG9C 1ZK9A 5I8OH 1HZHH 3BSZL 5B38A 4FQLL 4F15C 2X4OB 1JPFA 2P45B 3GHBL 1HE7A 5HHPB 4M48L 2VXUH 1E4KC 1RIUL 1X9QA 2H2PC 3VFTA 4HG4J 2DS4A 4R96A 3EZJB 1HQRB 2DQJH 3K8LA 4YNYB 4U1SB 5JXAL 2P24A 2IAMA 2OL3B 4I13B 4OGYL 3FB5B 5HSFA 3WFHA 3WS6A 4KKCD 3DX6A 3DRTA 5AUMA 5EIVA 2CSPA 3SO5A 4HZAA 3QAZB 1CICD 1X5JA 4YUEH 4EKXA 3CC5A 2M8XA 3IDJA 1VESA 3OX8B 1G9MH 2OQJA 3MRKB 3P9LB 3QUYB 5FGCE 3SDAC 4K3JH 2DOCA 5FHBH 5IHZB 1CF8L 3GSVB 1U95B 1JHKH 5T5FH 3A67L 3PNWA 3TBWB 1A6ZB 5SWZA 4NQSA 1TZIA 2CKBL 3MJ8B 3VFOB 3DSFH 1RQ5A 3TBYA 4KUZH 4DFHA 2EICA 1HNFA 1HHIA 2HN7B 5FV2A 4X0KB 5E8DH 5F7LB 3H8NA 4WI2A 1MJUL 1XEDA 3I6KA 4LVEA 1IEAA 4FQHA 1E4WL 5H2BB 2ZOKA 3KAAA 2CDEA 4J3OC 5FYJL 1T7VA 2ZUSA 5IIEA 5CLWA 4G6JH 4ONFH 1SJHB 3V5DB 1MI5A 4K94H 5FKPA 3WIHL 5IB2A 2AJSH 3NGBC 4X6EA 4HCRH 4NQCD 4RMTA 4EDXB 5IW1B 3VGGA 1XZ0B 2BVYA 3ETBF 3KNBB 2NR6D 4MQ7A 3SDXA 4HV8A 4MX7A 2VLLB 1B2WH 3NN8A 2VWEC 2XXCB 3VCLB 4N5ED 3U36A 1DBAH 5JA8B 1T1WA 3HI5H 5D7JC 5C3LD 3JTTB 1NCTA 1YEHL 2EDFA 2FH6A 4R9HA 5F1NA 3UYRH 4N68A 4D9QD 1IBGL 4NM8H 1YEKL 5E1HB 5GRJH 1AFVH 1CR9L 1PSKL 5LWYH 3JWNC 4LK4A 1A6WL 1Z5LB 3T3PF 4AEIL 35C8L 5CSZB 4R8WH 4Z95H 1T6WA 3MV8A 3R8QA 4UIKL 2NY2C 3QCTH 5TQ2L 4ZUWA 4G9DA 6FABL 4CNIA 1MFAH 2J8UA 4UDUB 4QYOB 2KZ1B 4DGYH 5IFJB 5I8EB 4U6YB 4WI8A 2X4QA 4PJ9B 2Y07H 1QKZL 4KK9C 3FONA 4IRSA 3LKQB 1U9KA 4CGTA 5DVKA 3OKOA 4BK4A 4P46D 3TBTB 1Q9LB 2EDLA 2VERN 4L3ED 1UA6H 4XPGH 5E2VH 4YXHH 1QOKA 1AXTL 2AJ3B 4ZS6C 3K0WA 4KROD 4L29B 1T89A 1ADQL 3EFFA 2BRRL 1A8JH 1FLRL 1KT2B 4EUPB 1LEGB 1NGPL 1JYVA 3RVXC 2GI7A 2W9DL 5J6HA 5EORL 2DLFH 3CXHK 4KHXH 5F1SA 2OSLA 3RKPA 4AL8H 4DKEL 4ZXBB 1QTYT 1TJIL 3MRPB 1A7NL 5C6WH 5HHQA 3JV4A 5AYUL 2PYEE 5IHBA 2F74B 1V8HA 4XBPB 1OCWH 3B2UC 3O9WA 1T3FA 4Y89A 1R6VA 5ICZA 4PRID 3DRQB 3IJYB 3AS0A 1BD2D 1J5OL 5ITFB 5T3ZL 1LEIB 4R2GD 5M94B 4M5YL 4JY4B 3QULB 3HB3D 5ILTL 4OLUH 4PJ7E 4CADB 1CIUA 2RAMA 2ERJC 1XR9B 4LLWB 1LMKA 5I0ZA 3IB4A 4DW2L 1TNMA 3OQ3B 4RGOL 4LLUA 4P2RA 3SHSA 1TNNA 5EU6E 1BGXL 4OFIA 1IC4H 2HTKC 4XP5H 4FZEH 5K9KA 4JO4H 3W11D 2CIIB 3V4PL 1ACYL 5CBAB 4MJ5A 5F89A 3V7AE 1RAMA 2R0WH 3WS6C 4DUXA 4TUOA 3MLRL 5CINH 2H3NB 1NLBH 3DROB 5JTWA 4P3DB 5A3ID 5IR1A 1FG2A 3QEGL 4Y4KA 3KPSA 3PWJB 2MMXA 4BKLA 4QXTA 2BXZA 3RVWC 3CVHB 2XN9E 5KZCB 2H26B 4JFDB 3KPRD 3MBXL 2ESVA 1S9XB 4IMLB 4X9GA 3ZL4L 3C5ZA 1IT9L 3Q0HA 5C0FA 5I19H 5ID0B 1N6UA 3EYVB 1IQWH 2IBBA 1OGTA 3MCG1 3P4MA 5IROA 5A2JH 4M8QA 4PYHA 1E27A 1TCRB 5D7SH 5HDOA 4F7PB 5JPNB 2FECI 3ARBA 3LS5H 4QHMB 3FOMA 1KPRA 3THMH 3LKSB 1UFUA 3MV11 2DAVA 2YRPA 1MREL 3OSKA 2VE6B 1KPVA 2HJFB 1CGUA 3WO4B 1ZLVK 2OX5A 2QJDA 3FB8A 3D39A 2CMRH 1DSFH 1GGBH 3TYGH 4RAVA 1N5YL 2DMCA 2HWZH 3FQXB 4Y4FB 2W0FB 2X70B 3UTSA 4QHLB 3MLVL 4XX1E 1AE6L 2AEPH 4NGHL 2VABA 5CWSA 5DJZA 1J88A 5FCSH 4YBQC 3CFJB 1CDJA 2D3VA 4YHMH 4CN4A 4HCRA 4RGND 4L1HA 4TUJA 2MKLC 2OR9H 5MEPB 1KB5H 1AY1H 3BOVA 3F7YB 4AEHH 4DCQB 5DDHB 5I18H 5HHNB 1MIEH 2EDHA 4NN7B 1CT8B 2DQIH 2EYSA 2NCMA 3K1DA 5IMOA 5E1AB 1PDKA 1MCSA 4LLDA 5D1QA 4QXGH 1KNOB 2IJ0C 4NHCL 2EH7L 4YK4B 1ORQA 4XBEL 3Q1SL 1F6AB 3LQZB 4G6FD 3BQUD 4YDIH 3EO9H 4RWHA 1MCOH 4E42A 3BHBB 1OAXH 4UT9H 3CZFA 4PR5A 1BQHG 3MCKA 4X80L 5C86A 5JPMB 1LD9B 3CDYA 5T3ZD 4U6VH 1MVUA 5SV3A 3RWIB 2F54A 2PO6A 5EA0H 4IRSC 1NL0L 25C8L 5GRVL 2VDKH 3RWHB 1IAII 1HQ4B 2AQ3A 4NZTL 3LRHA 1CLZL 2R2HA 4LOUC 1Z0MA 4P5TC 1G7MB 5L9DH 3SE4A 4JFFD 1T89C 2FX7L 5KSBB 3DYOA 1EA9C 3I2CL 2A6JB 1ZSDA 1OSPL 3E8UH 4RDQF 1EO7A 4X9BA 1U8PB 1DN0A 3HRZA 3F7VA 2VUOA 3SDYL 2IGFH 3BZDA 4PS4L 3QHTC 1JHLH 3RHWK 3MGAA 1CE6B 5CBEA 3MRLB 3C8KA 3ARFB 4ALAH 5HHMB 3RZCB 1YUHA 3R0NA 2R1WB 5LXGH 1X5GA 3QUZD 4U1MA 1NCUA 1RJZA 1UVQB 4G42B 4I8DA 3RA7H 1MCWM 1HSBB 5KANG 2XRAH 3V52L 5CEZE 5C0EA 3E6HB 4G8GB 1RD6A 5JIHA 1DQQB 2YWYA 4JFEA 5FFLA 3V8OA 1EEZA 3O2WH 1S9WA 5IOPB 2NQCA 2VDOH 2IMNA 3QWQB 4LRNH 4OF6A 1CG9B 3V6OA 1MQ8A 4JCLA 3TPKA 4I5BB 3BT2L 3T08A 3TH3T 4GH7B 3MODL 3U1SL 3HG1A 3MZTA 4X7DC 4KDTA 2Y6SC 4LSUH 1AIFB 1IAIM 5MP6H 4NJAH 3UTPD 3RTQD 1DEEA 2V2XB 3NCJH 2R0ZH 4G80B 4P5KA 1MF2L 1LK2A 3VWKA 2APTA 4LSQL 1T7ZA 2GT9B 1I3GH 4G43B 2JKXA 2A83B 2RGSA 2HAZA 1JL8A 3KPMB 2WK2A 3S36X 1P6FA 1KACB 1WBZB 4GMTL 4Z0XA 3I3BA 3K4AA 4G8IA 4HHAB 4KZDL 5EDXA 1ZTXH 4LNVA 2BMKB 3NCYS 1JK8B 4Y4KC 4RFNC 1RIHL 4TTDC 3BE1L 3QIUD 1G7QB 1DQJA 3DJ9A 1MLBB 4JZNA 3EDKA 3L3HA 3D85A 1QQDA 4G5ZH 3UO1L 2C26A 3BJ91 1P4BH 1KOAA 1XGTA 4OZHA 4QTIL 3SKOA 4E0RB 4PIRF 1FZMA 5HHVH 3C5ZC 5HY9A 3BDXA 5DJ8A 5F93C 1ACZA 3PHQA 4ZFZA 4XWOC 4WY7L 3FQWB 4M3KB 5ISZB 4Z77B 5J1SC 2W59A 2IH1B 4ZUSB 3UTOA 4LEXL 5F7YC 4JFPB 1NGQH 3ZHDA 3FTGA 2NX5E 4YIQB 1S9KC 1JNLL 4MDJB 4Z18A 2VLKE 2YPLB 4QRPD 5J3HD 3LEVL 4LBEA 3VXUA 5L88L 3ALWA 3B9KA 5KAQG 2BC4B 1NGXB 4X7SL 3D3VA 1EDQA 2ZSVB 3QIBD 4QRQB 4X4XB 1BQHA 3T0AA 3ZSTA 3ZTNH 4HJGB 4Q0XL 4PY7A 1JE6A 1ND0B 2CGRH 4WU7A 5LG1A 5BVPH 2HT4D 2DKUA 1QHPA 5EBWB 1FFOB 4HBCL 2NY6C 4RMSA 2V5YA 5TE6L 1S7XA 3DMMA 1DBKH 1MCDA 5EU3A 3UROR 1BJ1J 3K3QA 2VKXA 2W9LA 2FSEA 4WI7A 2Q76B 4XMKH 3NIFE 3KYOB 5D1QC 3BZ4A 5DD0L 2D0GA 2Z93B 2DKMA 5C2BL 3T2NL 4AMKH 4OD3L 1FL3A 5TJWK 1RJYA 1V3MA 4WWKB 5D72L 4BZ1L 3WKMH 1B0GA 5T3XD 1KTRL 4FXGB 4DKAA 5L2KA 4NO0D 1Q94A 5SX5K 3TT1L 1GAFH 2VIRB 1R3LA 1T03L 3H9SB 4PRPD 3RNKA 4JHWL 3NAAL 1S3KH 2KQNA 1ONQB 1JJUA 4RIRB 2X9YA 4UMGA 3WNKA 3MRQA 1FGVL 4ZNEA 2WBWB 3WFCL 5DJCA 3VWJC 4OGZA 2KPNA 2DQDL 2L4OA 2VXQH 3QUXB 3SE4C 3SJVB 4RFEB 3G6JA 3MFFA 4BK5A 5J9PA 5DD5H 1NGWB 4F9PA 3BJLA 4NQXA 2PYFB 1DTUA 5C0CE 1N64H 1W8NA 1G7HA 3EUUA 4IMKA 4LCWA 2Q86A 4I3SH 3C5SA 1LGVA 2PN5A 3EYOB 1F4YL 1MFDL 4XXCA 4WHTA 4LVNC 4GMSH 1AJ7L 1FL5A 1K6QL 4ZQKB 5F7HA 4JO2H 1IM3A 3MLZL 3LQAH 4HWNA 5D1XB 3FO9A 4KTEH 3MACL 3QDME 2HJKA 32C2B 1DFBH 3L5XH 3OMZA 5DSCA 4HPOH 2AGJH 5D7JD 2VC2H 2WUCL 4Y1AA 4KJYB 5MENE 4M9PA 3IDYC 2ATKB 2NW2A 3V6OC 1Q1JH 1T2XA 1HNGA 2RB8A 5GRVK 3NPZB 4P2OC 3RY5A 4OAWB 4KDTC 3UJIL 3WCYA 2AEQH 4C54A 4HLJA 3O6KL 3M17A 1WT5A 3C6SB 3ILPB 4OFYD 3QH3B 2NY2D 5E9DD 4OKVA 1H3PH 1WFUA 4XPTH 3UZVB 5TE7H 4HAGA 4KQ3H 3I6LD 1KENH 4NYLB 3CMOH 4MXQC 4NPYA 4YDVA 2FYYB 2MCPH 3EGSA 3MLWL 1MCRA 1HI6B 3K80A 1DBML 5EZLA 5F88B 1GC1H 3RHWF 5BV7H 3ARRA 4KK9D 4ZUUA 3MTRA 2FO4A 1RUPL 4NBYB 2DIJA 1JFQL 4U6HB 4QRTA 2J88L 5I6XC 4JFYA 4JY5L 5B21A 4TSCH 4OI8A 2VLJB 3CU7A 4OZGE 3GSNH 1A7PL 3O6ML 1HKFA 1J8HA 4X7FC 4MNQA 4YHKL 3TBVA 3EOTH 4LQFL 3IGAA 3TH4T 3RVXD 4PJBF 3AM8A 4I0KA 4HXAH 4FABH 5ADPL 4OLVH 4PREB 4QRUB 1PZ5A 5EOCL 4YAQB 3MO1B 4XPAL 1EGJH 5DYOB 2DTML 5EOQL 2QQNH 2VDLL 2DD8H 4U1LB 1D6EB 1U8KB 1F00I 3L9RA 5KSAA 1J0HA 3GB7A 4ETQB 2QEJA 1YZZA 4M1GH 3B9KC 4U3CA 4P4KD 4HWEL 2D7PA 1AI1H 1BQUA 4QGYA 1LP9A 3MOQA 4PP2B 3R8BB 3PV6B 4TOYH 1A5FL 3GO1H 5BRZA 3LKPB 1MCBA 3RKDC 1UYWL 5DJXB 1FP5A 1C08A 3BAEH 1S8DB 3DMMC 4XP4L 5HHME 1YQ2A 4LRIC 3OAZK 5IWLC 3GSXB 2ZCLH 3KPPA 4CVZA 5ICYB 3JWOC 3IU4H 1BFVL 3T09A 5HYJE 4PLKC 1ROWA 3KLHD 4PJXE 2HTKD 3GK8L 1GIGL 5GGRY 1HYSC 3O4LB 5HHOE 4M62H 4TYUA 4HIJA 1J18A 4I3GA 2IPTH 3B6SA 2OJZL 2IAMD 4JHAL 1DR9A 1PQZA 3KJ6L 1AP2A 3AXLA 1D9KA 1Y0LB 1BZ9A 3CFIC 2AK1L 5C0ND 1BVKB 1QO3B 1JGVL 3Q5YA 3TM6A 4D0CB 3IFNH 3IXAA 1FNSH 2XZCH 3DO3A 2P8LA 3SKNB 1ZMYA 3RVWD 1F4WL 4LKCA 2JB5H 5F7DB 3U0WH 3CNKA 5SWZD 1YN6A 4X6FA 1EJOH 1GPOL 2B0SL 3N85L 3MA9L 1IGTA 4QOKE 1GOGA 3QB7C 4YHPA 2F5AH 1RVFL 1OP9A 3FFCA 4L3EE 3DUSA 1OGAA 1W72H 2Y5TA 5KN5B 3AY4A 5EUOA 1MCHA 1YMHB 1FNLA 3GSQB 4OM0H 3IFLL 1PFCA 4HFWB 4UQ2A 4GRWH 1UQSB 5IHUL 4IMKC 4XRCB 1WFOA 2VXSL 1MI5D 4XXCC 2IG2L 4ZPTA 2MSPA 4S1SH 4WI5A 3TT3L 2JB6B 1G6RH 1S78C 2IFFH 4LPTA 3UTQA 3VG9B 4JJHA 4KAQH 4JB9L 4TULL 1J1XH 5DQDH 2FATL 2F8VA 4YBQD 4CJ1A 2XKNA 1MRCH 3BD5A 3P4OA 2YD5A 1QFUL 2JE8A 1NCAL 3I3DA 2WWKO 1BD2E 1B90A 3M8OL 3Q5OA 2ATPA 5CAYB 4JN1L 1U3JA 1YEDB 3RPIA 3ARGA 1NCCL 2B4CH 5DJAB 2X4NA 5JR1H 4N8VG 3L5HA 5F21B 4MSWA 3TF7C 4G6KL 2QV2A 1JYWA 3SKJH 4UT7L 3MV8D 2EYTA 1WT5C 3IDIB 4GG6B 2BVQA 3IU3A 3HNTL 3PGDB 3VDAA 3ALPA 2R2BA 4GW1A 3WXVL 5CILL 2R1XA 1KJ2B 4URTB 2D9CA 4ZOAA 4WTXA 3MRGB 4HDIA 4QTHB 3DWTA 2J12B 4HC1H 4LPUA 4OD1L 4NQDB 5C6PB 2AJVL 1FL6A 4H5SA 5DD6B 2Y4SA 4L4TB 1T20B 3L5IA 4IRSD 5FHAL 1NAML 1SEBB 3TO2A 4NO5B 5CCKL 4PGBA 3QFDB 4M1DH 4M9OA 5GZNC 1A6VH 2R56L 2XY2A 1TVHB 4YQXL 4PJDB 1CU4H 1YC7A 5C07A 2BY1A 5F1IB 2W0KA 4NQVA 4HKBB 5HDBF 2H1PH 4LOUD 3ZE1F 3OJ2C 5CHNB 2O61A 4PTTB 4KJPC 3KPRE 4LCUA 5FDWB 2E5EA 3RUGA 5FCUH 5GGRB 3SOBH 5EBLB 5DS8B 3VFPA 3WN5C 2ITDB 2YK1L 3RZWA 3GMQB 3QRGH 4TVSa 3QEUA 1FVEA 1OP5H 3L7FB 4JZJC 2OZ4H 5D96C 3V6ZA 3BMVA 4KGJA 1D6VH 1JGEB 4XCYA 1DJSA 2EEDA 4AIZB 3GSNA 3O11B 1P1ZA 2DBLL 1AR2A 5E5RB 4A2MA 4JM2B 5T5NG 5KSAC 3QHFL 4PJBE 1TZGL 3VXPA 2X7LB 3O9WD 1Q9KB 5FOBB 3F12A 3TWCL 4YBLC 3SJVE 2X44D 4X4YA 1Q9WA 5F9OH 5J11B 1UEYA 3O0RH 4OZFB 4W4OA 1A14L 4UT6H 3NACH 1EGJA 5GGTH 2DJUA 2HFFA 1LQSR 3QXVA 2VQ1A 1IRAY 2UWEB 1MHPH 1N2RA 3K2MC 1I8IA 4L3CA 2VSDA 4PGZA 3P9WB 5F1OB 3RY4A 2X6MA 4RGNE 1RUKL 1AGEB 4EXPX 5C2UB 4P2RD 3BGFB 3H2WA 2EO1A 4GAJL 2Y6SD 4NUJB 5GJSH 4C56B 4HUXA 4LEOA 1NCWL 4WUUA 3O6LL 5D2NB 2FL5A 1HINL 1HILA 5D93C 4PTUA 1CZ8H 5J4MA 2FIKA 3U4BL 3WV0A 4M7KH 1HHGA 1BFOA 1DLFH 1FO0H 2IPKA 4PJFA 3REVB 5DMKA 5C0AB 4GG6F 3IDUA 5E00A 4K3EH 5AWNL 4Y4KD 4HKXA 3KPSD 5T3ZE 2DQHL 5B39B 4PJCB 2J4WH 4W6XB 1WEJH 1ED3A 2BK8A 4MCZB 1EXUA 4PGEA 2OJEB 4NKOA 4UDTB 2R4SH 3FB7B 1QBMH 3W9EB 4JPIB 1K3ZA 2ESVD 4PLNC 3DGGA 4OCWH 3VFVA 1R3IL 4QEGA 1JWUA 4FQXC 1AHWA 3C5ZD 1GCFA 1I8MA 5C0RL 3QIWC 4XWOD 1H3VA 1XF5A 1XF3A 5IUSA 3AY4C 3PQYA 2PCPB 5IB4A 4PJDF 4R90L 2VAAB 2QADC 3BD3A 3I84A 1U42A 4JFOA 1MCQA 3ARBD 4LGRB 1F6FB 4MJ2A 4NJ9H 5JQHC 4I1NB 3U7YL 4N0YH 2VITB 2NZIA 2BVOB 1U8QB 4DZ8B 3HZMB 4N8VA 1JPSH 5T33L 3KYKH 3B9VA 3TO4B 1UB5B 1MWAB 2NY4C 1IQDA 5F6HI 3D39D 1AO7B 2ARWA 1UM6L 5CIPB 4HWBH 3AREB 3LD8C 1OAZL 1QSFA 2H2SC 3UTSD 5JHDA 4WJ5B 5LAXA 4XVSH 3PDGA 4ERSH 4NO3A 3H6JA 4E41E 1KB9K 5GGQH 4JDTH 3DVGA 5E5UB 2NY6D 2OTWB 4HIIA 3DLQR 2R2EA 2HRPL 3R1GL 1PY9A 2FB4H 4O58H 4ZAKB 5TDOB 3ARGC 3HPLB 1MHCA 1H0DB 1BWWA 3DV4B 4E5XA 3GSUB 3OAUH 1IILE 5D1QD 4EOWH 2UWEF 5C6TL 1XIWC 2ENSA 1JZ8A 3QI9A 3S3SA 5JDSB 1UC6A 3HA0A 4KK6D 1CTNA 4JM4H 2BVEA 1PZUB 4KDWA 3IDGB 3EOAB 5BXFB 4I77L 3DUUB 3RWDB 3P4NB 4M93C 2G75B 4A2LA 1JUFA 3VXMA 4MA7L 4MCYB 4N8CH 1HEZA 3X3FH 1T4KB 2NXYB 4Z7WB 3LPWA 4MJIA 3K2UH 3PL6B 3DI3B 3PP4L 1T1XB 2F54D 2PO6D 4HS8L 5I16A 3CH1B 1GYAA 3LN5B 2BY0A 4LSTH 2X89A 3DURB 2G60H 1IKFH 3VGEA 3QFJB 2WW8A 5HYSB 4P9HH 4P5MA 3S34H 4R4BB 2BSRB 2EDEA 3VFMB 3KPNB 1KLGA 3CAFA 4UV4H 5AAMA 1I3UA 1JP5A 3D6GA 2A0LC 4HC1A 4PB0L 1GC1C 5E2UH 4HGWB 4PJCF 2IADA 2R29L 3HPJA 4I48B 12E8L 2E8YA 5DUBA 4NZUL 2NTFB 1K5NB 1FFPA 2GY5A 3DIFB 5JW5A 3ZE1E 4G8EB 5F96L 1CFBA 5KVDH 1OTSC 3RVTD 3HI1B 5TF0A 4YGAB 4DVBB 1Z0NA 3JWOL 1GGIL 5EZJA 1JWSA 1R0AL 4XMLH 5T1KB 5E4EC 4PJIA 1I3RB 3CFBB 2YD8A 2DWEA 4NWUH 3I9GH 5LGHH 1RUML 4NO2B 3EJZC 1G6VK 3MGOB 2Z8SA 3DX7A 4QRPE 5I1EH 2OZ4A 2IQ9H 1LO4L 4QRRB 3Q3GB 3H0TA 5DD1L 2A74B 4HUWA 1P7KB 4HXBH 4JFED 3QDJE 3L3OB 1MFBL 5F7EL 1MAMH 2LAGB 4H8WH 3OJDA 5FYKU 2W07A 2N56A 1QLFB 4S1RL 2YRLA 3NCMA 1W0YT 5C3TA 15C8L 4M6NH 4YWGH 5JUEH 4MB5A 5ADOH 1B0RA 2CDGB 2DQUH 4ZD3L 3HG1D 1A7QL 5EBMA 3VMPA 2MHAA 4HK3J 3ARVA 1A9EB 2BCKB 1LO5B 5GGTA 3PWLB 3S5LG 4IOIA 3TVMC 1SMAA 5IEHA 1IFHH 1OQOA 2G2RA 2XACC 1GHFH 3FB6B 3WL9B 4L5FH 4NQEB 1NDGA 2ZUVA 5C7XL 2NXZB 2HTLC 3BZFA 1WBYB 3GI8H 3VXSB 4E9LA 3VWKD 5HGHA 4BQ8A 2ADJA 2CR6A 5I1KH 4MJ6A 1KLFA 4O2CB 3EYUH 2ADFH 1DE4A 4BYHA 3GGWA 4KWUA 2C4FU 4WU5B 5I15L 3QO0B 4ZO9A 4OFPA 4Y0GA 5ECJE 2LTQB 4PRPE 4Z7WF 4F7EA 4OD2B 4D9LH 5MERB 1INEL 1LDSA 3D85D 4GG6E 2APFA 4ELMB 5GS0H 4O02H 5E8PB 1UH4A 3MRHB 1AHWC 1TFHA 3EYFA 3KPQA 4OF0A 2X1QA 3FO2B 3TPUA 3AB0B 1BECA 4FFZH 3GRWL 2YMXL 4ONOA 4XP9L 2JLLA 2VLMD 3FFDB 4XZUA 1S7UA 1FVCB 4LARL 2PETA 4JFZL 3BP7A 2AW2A 3GSOB 2HFEA 4ODSH 4LF3B 4XPHH 1SHMA 2Q8BH 5DUML 4NRZA 1NMBL 4NM4L 3BP5B 2YPKA 4WFFE 4G3YH 3VXUD 4G7YL 4M5ZH 3B9KD 3DI2B 1DVFB 1FAKT 2QQQA 4NNPH 1BLNA 3D3VD 1F8TL 2P48B 1M7DB 3NCEB 4FTVA 1OM3L 4JJ5A 4LIQL 1JGUH 1YDPA 4DQOH 4Z7OE 4FXKB 4GW4A 3VW3H 2VWEE 3RKDD 4YGVB 1KFAH 4NNYA 3BEWB 3DMMD 4HWBA 1FFNA 2MQCA 3T3ME 4JPWL 5K9QI 3GKWH 4HMCA 3QXAA 3KYNA 4X6CB 2XTJD 3X12A 4PLKD 3QI9C 4LSSH 5I71B 1HYSD 4KXZH 3MBEA 5GRXG 2XQYK 3W0WE 3U0TA 2BJMH 3NFPA 4U1KB 4PJ5B 1RUQL 5IB3A 5I73C 2O5YH 1WZ1L 1FNEA 3NFSL 3A6CL 5E9DE 3SCMA 5DFVC 1P5VA 1RZ8B 5L2KD 1HDMB 1KLUB 3HR5B 3QA3B 4X4ME 5FO7A 3TEUA 4OZIB 4DGIL 2Y9RT 1WQVT 2V9TA 1OAYH 4W6WB 2W0PA 5EC1A 3M1BA 4PJEE 2GY7B 2H8PA 2WNGA 3BP4A 3GMPB 3GMNA 3Q5TA 4U7MA 4H1LG 4XPFL 2UUDH 5CJOL 2FGZA 1ZWIB 4LAQH 1OY3B 4I3RH 3VFUA 4NKMB 4LKXB 1NAMB 2F5BH 3LB6C 4NOFA 1ZHKA 3I02B 1AKJA 4DKFL 4ELMF 3BPCA 2ZJSH 4UOW1 4LCWD 3C6LA 2WIMA 4X6BB 2A6IB 3V4VH 4BH8B 1CBVL 1MCPL 4MAUH 5FGRA 3S5LA 3QXDB 3HE6B 1S78D 1WIOA 1XF4B 1T7YA 4YDKL 4C58B 2WWMC 1I4FB 1K2DA 4OF5A 3OAYK 4PJAE 1N4XH 2FLBT 2NY7L 4RWYH 4XPBL 5DGRA 3FO1A 3O2DA 2DJSA 3AS3A 5D71H 5FKAA 1II4E 4Y1AD 3PE9A 4HG4K 2JIXB 4K23L 3D2UB 1R3JB 2IQAA 3CFEB 2AJZB 1GZPB 1MLCB 4K71C 4PJ8B 3U9PL 4BFEA 2ILLA 4LLAA 2Q6WB 5EC2A 5I66A 4MA1B 2P43B 3L3IA 1U93B 3FRUB 2HKHL 1FIGH 3UZQA 1BX2B 1FFRA 1EHLL 5FA3B 2GITB 5C8JA 1MFEH 4IS6B 3FT2B 1OWRM 1U6AH 2Q3AA 1ULVA 4PY8J 1FLTX 4N9GB 4AT6B 1MVFA 1YMMA 4X6CF 1S5IH 2ORBL 3S8WA 5CGTA 1LO3H 2C1OA 5INDA 5E8NA 2RCSH 5I1CL 3JWDC 4MNHB 4U0QB 1INDL 3FMGH 3CD4A 4U1GB 5AEAA 3VI4F 5KTEL 3WYRA 3MJ9L 4ZSOB 1FYTB 3T77A 5BS0A 1CICB 1OAKH 5ERWB 1N5AA 5CS7A 3RNQB 1KXQE 3H42H 4M7ZB 5CZKA 5GZND 1KCSH 2AV1B 5DXWA 5CUSL 4NUGH 1FJ1B 3F58L 4MA3A 1EFXA 1JHTA 2DM2A 3ULSB 4LSRL 5EO0B 1J0KA 3G04A 3GBMH 4Z8FH 4ZODA 5SWZE 1Q0YL 3RDTC 4I4WB 4GKSB 1HSAB 3VRLE 1U3HB 1J8HD 1IM9B 4MNQD 1RK1A 5D6DA 5ENWA 4AG4H 3CVIH 4LPWA 4GAGH 5DK0B 1UH3A 3G5ZA 1A1MA 4ELKA 1A6AA 2XWTA 4ETYA 2NW3B 1VPOL 2OS7A 3DV6A 5IW3A 3HNSH 1UWXK 2JJTA 1XCTB 2XQBH 5F7WC 5GISL 1X5HA 1F4XH 2XWBA 4ZG1A 1TITA 2YRZA 4XCCH 4YDLB 2ZCKL 5KSAD 1MI5E 1PVHA 4IHOA 4X6DB 4LMQE 5C08E 4NSKB 4NQCB 2HVKB 1A6UH 3QDHA 4P2OB 3ZHKA 3X17A 3RFZC 4Z7QF 1K8IA 1S5HA 2ARJB 5BRZD 1F3JB 5IJVB 5BMFL 4NZDA 5AAWA 5DQ9A 1D5IH 3UPRA 2DDQL 5JW4R 5E7BA 2R23B 5T1MA 3VE0A 4NFBA 3T0DA 3A0OA 3QT2A 4H1LA 2AABL 2KL6A 1ZLUK 2X4SA 3RU8H 1H3XA 2YZ8A 5F6IB 4OM1H 3OTTA 2DM7A 3MBEC 1CK0L 1XGRB 4JE4B 1CGXA 3OKNB 1SYSA 3EDEA 4P3CH 1MAJA 2E7LC 4GKNB 1OF2B 3MV8E 2XPGB 1D9KD 2I60H 3HMXH 4GG8A 1MUJB 3LN4B 5FXCH 3GKZA 1KCUL 3K8MA 1J8KA 4JO1L 2C4FT 2WQRA 2VDRL 4L8DA 3HC4H 3KS0J 2MPAL 4X8JA 3LAFA 3SGEH 3D0VB 2AKRA 4TPRH 2WINA 1T0MA 1CL7L 4P46B 2QQKH 1FZKA 1ZANL 4JN2A 4HIHA 2E7MA 3LIZH 5F3HA 3T0BA 1BIIA 3FFCD 5FUZL 1FC1A 3U46A 5GQBA 1C12A 1OGAD 3DX9A 1JRHL 3KJ4C 3GMOB 3UZEA 1S7WB 1IZKA 2H6PB 3HHRB 3SE3A 1MCWW 4HFUH 1DBJH 3O2VL 1ZT4B 1HH6A 1L7TH 5CEZH 3PGFH 2B1AH 3C6LC 4MGXA 2CK0H 3S4SB 4TSAL 5E2TL 3GMLA 1BBDH 2NY4D 4HX1B 5DO2C 3HNVL 2LVCA 3V0WL 1K4DB 2CRIA 2PYEA 2DWDA 2R0KL 3QWOB 2IANA 2IF7A 5HDQL 4XVJL 3O45A 1A6TB 1G7LA 4P57A 2W92A 3V2AR 2NMSA 3MRIA 4OIIH 5DHVB 4YX2H 5ETUB 5F7FA 4PRIB 4X6DF 2Y36H 1UKQA 1IAMA 3CXHJ 1ZLWH 2EYRB 1BVLA 3ARGD 1Q8MA 1NUNB 3WFDL 4H88L 5CP7B 4EN3B 3ARPA 4RZCB 2GSGB 4HQQH 5KVGL 2AK4B 4ODXB 5B4MC 4M61B 2XYCA 5HVFB 2VH5L 4HUVB 1N7ML 3LSOA 4YFLI 3MRNA 1KF9B 2RHEA 5IG7B 4K9EL 2HVJA 4AH2B 1P2CB 1H9VA 3WLBA 3LV3A 1FAIH 1T1ZA 4JKLA 4XNZC 1KULA 3QUMA 4L1DA 1S9YB 4YJZL 4XAWH 3OZ9H 5FGBA 4KRNA 4X6CE 1L9MA 4PRAB 5JIPA 2B7DT 2FR4A 1CTOA 2EE6A 1A4KB 1YPZB 3QO1A 2XN9A 4Z6AT 5C07D 3B3IA 4P2YA 2N1KA 3I50H 3LKOA 1MIMH 2A0LD 2ICEA 4YFLF 1AC6A 1MEXH 1WAAF 2ESVE 5EUKA 1I9JL 5D6DC 1NGYA 3TN0A 3HI6H 4EI5A 1EHXA 1JGLH 2VDML 3VG0H 3PV7A 3AGVA 1F58L 3OJMB 5FK9A 1SEQL 3FL7A 3P73A 5L7XH 4F57L 5IM7A 3LCYA 3BPOC 3CFDB 1D5BA 5AZ2L 5F9JB 4WW2B 4YO0A 1IKNA 4YPGB 5GGVL 5F8RC 2I9TA 3EJZD 4Y16B 4YHYB 1FBIL 4V1DA 4U1IA 1VFMA 3WUWB 3UTSE 1CXHA 3NA4A 2UY6A 1EAJA 1UM4H 2WMPA 3BGAA 5TGBB 1PBYA 2Q20A 5F9WB 2WBJC 4UB0L 5IQ9A 4QF1A 1WC7A 1L0YA 2E7HA 2A6KB 3RWCB 1XF2B 2FCBA 1A0QL 3K74B 1G7JA 1YJDH 1M05B 3FT4A 2DI7A 3H9HB 2XT1B 4KI5C 4JAMA 1UG9A 1Y6KR 4WUUD 3O6FA 1DLHA 3GIVA 2CLZA 5L6YL 3K4ZA 1QD0A 4WO4A 3RGVA 4F9LA 2DQTH 5IBUB 4OV5B 3T65A 4KVNL 1RUAL 4EUPG 1GRWA 3WSQL 3D9AL 2VL4A 1OL0A 4L8CA 5E5MB 1Q0XL 4HGMA 2JK5A 3CIQA 3ZE2E 4XVTH 5GS2H 1IGCL 2XWJB 3WN5B 1UWGH 1U3ZA 5K33A 1G0DA 1H8SA 1NUGA 5HHPA 2F54E 4MWFB 5C0IA 1UWEL 1HHKB 3HMXA 5EWIL 1HQRA 2CO7B 3TV3H 4YNYA 5FYKL 3HUJB 4RSVA 4U1SA 4WRLA 1KN2L 2OL3A 1ZHNB 3ULVL 1HCFX 3N50A 4F7TB 1WWCA 1YPZF 4Q6IB 1JBJA 1RIVH 4O9HH 3PQYD 3CLEH 1QNZL 3SE3C 4NCDA 4JFFB 4UNVA 1F45A 2APXA 5DTFB 3BZEB 3OX8A 4GLRH 3MRKA 3P9LA 4IIQB 4UINL 5I75B 2D7TH 3KDMB 1JTPA 5IHZA 3UBXB 1HK6A 3GSVA 1U95A 3TBWA 1NLDH 2Q7YB 1LO2L 1A6ZA 2HFGL 4WW1A 1Y18B 4HH9B 3MJ8A 3VFOA 3TLRA 3V4UH 4W81A 3KYMA 4TQEL 1I1RA 3QNYA 5FV1L 2HN7A 1QSFD 5JHDD 2WIIB 3CSYA 2LV4A 1G0XA 5DJ2B 1NCDL 5H2BA 5AYQA 1BBJB 1PAMA 4FA8A 5DD3H 3GSWB 4LLQA 1SJHA 4XMPH 3V5DA 3T0XA 4R97B 4XAKD 4U7SA 1KEGH 4O2FB 2GSIB 4NCC2 4FQPA 4DFIA 3RY6A 4JVUA 4ORGA 4EDXA 3BKYH 5IT2L 5IW1A 2NPLX 1TQBC 1XZ0A 3IJSB 3V6OE 2AXHA 2VDPH 1QUNA 1RZKH 3FQNB 3LMJL 4O5LH 3QI9D 4RDQG 3BIKB 3HG1E 1BZQK 2VLLA 4DOHE 2DQCL 3MXVH 1YN7B 1XT5A 3REWB 5B22A 3WLWD 5TQ0L 2CIKA 4JO3H 3JTTA 3VXMD 4Z0BL 4G9FE 1T21B 4S1QH 5DFVD 3WDHA 1B4JL 3ECBB 4MJID 3MREA 4S1DC 5JDJA 1Z5LA 2FIRT 2Q87A 4Q7DA 1PKQB 1A3RH 4JHBA 4PJGB 5CSZA 4LCCB 2X89D 1U8LB 5F70A 3CU1A 4N0CC 1QHOA 1I9RH 3P30L 1S7VB 4MD4B 1MELA 1AD9B 2VXTH 4Q9BA 3UBXI 4ACPA 1IC5L 3BDYL 3ZKSD 4UDUA 4MXVE 1NANH 1KBGL 3LB6D 5I8EA 3TN0C 1I1AB 4OZ4A 4U6YA 2J8HA 4EI5C 3HUJF 4PJ9A 3IAGC 4X99B 3LKQA 4KZEL 4HPYH 1KSRA 1E4XI 2X4TA 4LP5A 3TBTA 1PLGL 2XKUA 2NX5A 1EEQA 3KXFB 4CRPA 1H5BC 2WUBL 4DJMA 2WWMD 5IB5B 4IDJH 3BYTA 5EFIB 4K3DH 4FG6C 1FRGL 4IRJC 4Q9RH 3LHPL 4WFGD 1KT2A 4EUPA 1LEGA 3D3VE 3TIDB 2Q3ZA 1JZ5A 2QSCH 4WCYL 2YOCA 4ZXBA 1DQDH 1DDHB 3WEXA 3MLTB 1KIPB 2YN5A 1GGYA 1QSEB 4A6YH 4FXLA 1FIEA 2F74A 2LFGA 3QPXH 2EIZB 1OWWA 4XBPA 3GHEL 1IGML 3OKKB 1A1OA 2FZ3B 1RZGB 1QPXA 3DRQA 5KOVC 4F3FB 3IJYA 5JOPD 1XMWA 5MI0C 3RGVC 5ICXB 3EAKA 3B2VH 1LEIA 5HI3D 4DVRH 3MRCB 4YHLH 3LN9A 2DQJL 3QULA 2Z91B 2GJZB 3DYMA 2P8MB 3BSZH 3C60C 1XR9A 1X5AA 4LLWA 4FQLH 3KWWB 1P7HL 4PRDB 3GHBH 3X3GH 2E7CA 1EPFA 1ZLVH 4M48H 4NO0B 1IGFL 4YUEL 1RIUH 4BSWB 1CGSH 5EIQA 1OTTD 1HOCA 5JXAH 4K3JL 5CZXC 4OGYH 3SDCB 2CIIA 2OR8A 3B8SA 5CBAA 3WDIA 4CVUA 2VDQL 4HIEA 1JHKL 4MNGB 5GGVY 3V0VB 5HBBA 5TF1L 4ZNEE 2V17L 4PJGF 3CDFA 1AGCB 3NPSB 4ZUVB 3QAZC 5IQ7L 2H3NA 3DROA 5K9JL 4P3DA 5DI8B 1CF8H 3QUYC 4JG1L 3L3GA 4JHZA 4YLQT 3SGDI 5C0CA 3A67H 4OGAC 4C4KT 1RZJC 1M7XA 3D25B 3CVHA 1KUMA 2CKBH 4Y5XA 2H26A 2BNRB 4JPKL 2IMMA 1S9XA 3KPOB 4K94L 4IMLA 1QBAA 4J8RB 4LLVB 1LHZA 4O4YL 1JTOA 3B9DA 3H7BA 4FTVD 1E4WH 4XNXL 2E27H 1H3TA 5FYJH 1TCRA 4F7PA 4WUKH 4XCNB 3FT3B 4Z7UB 1NUDA 4DN3L 5JPNA 2C4XA 3SO3B 5I1GL 4QHMA 4RMVA 3RIFK 3WIHH 3CCHA 3ZKMC 4QXWA 1EAPA 3U79A 2YBRB 2FJGB 1OLZA 2HJFA 3S35L 1A7BA 3RY6C 4DZBB 1R3KB 3UYRL 5DJ6B 5DA4A 2XTLA 3FQXA 1KC5L 1F3DJ 4NZJA 4Y4FA 1EJ6A 2CDFA 2X70A 4QHLA 1WISA 1A6PA 3MBED 1NFIB 3FN0L 1UXWB 3QEHB 1YEHH 3CFJA 2P5EE 3P0VL 3BO8B 1RMFL 1IBGH 3SCMD 1C5BL 5MEPA 1YEKH 3F7YA 4DCQA 1PSKH 4DTGL 5DDHA 4PLOB 5HHNA 3M45A 5TH2B 1A6WH 4AEIH 5IMLA 5C92A 3OXRB 5DURD 35C8H 5E1AA 2YEZB 3R06B 3GMRB 3OKLB 4Y8DC 4ZUTB 1VFBB 3ZTJH 5DQJB 5TQ2H 1F6AA 3LQZA 2EDRA 6FABH 3NABH 2EDYA 5A2IH 2OTPA 4OZGA 3CZJA 3FHAA 5DWUL 3NCBB 4LCIL 2HH0L 3BP6B 3OV6A 1LD9A 4PGCB 4R0LB 3B5TA 3MV01 4UAOB 4U31A 4KDVA 5FA4A 4NRYA 1AKJD 3RWIA 1NC2B 4B41A 1BIHA 4WEMB 1D7FA 4PJ9C 2IALB 3C6LD 1RK0B 4AZ8A 1CQYA 4AENB 3BIBX 1D5ZB 3ARDB 2VJXA 4KKNA 2LAAA 4LSPL 5T1DL 4RA3A 1G7MA 5J7CC 1V5JA 1A4JB 1OB1A 1FLRH 4JANB 2YUZA 4YC2B 2Q7NA 2A6JA 4P4KB 1NGPH 4GUPB 2YSSB 2W9DH 5EORH 1OCWL 1U8PA 1AD0A 1LP9E 3MV9B 1BHGA 3ZYJA 2AS5M 1Q9OB 3GBLA 4DKEH 1QFWH 1TJIH 5K59F 1CE6A 1A7NH 5LKNA 2AJYL 3CLFL 4ZXBC 5AYUH 3T1FB 3ARFA 2A1WL 5A2KH 3U7WL 1LE5B 5B3JE 2R1WA 4Z7UF 5F9DC 1R5IA 2Y7QB 4G42A 4PFEA 5H94B 5HYJA 2EDXA 1HSBA 4LDOB 1Z3GH 5B4MD 5HD8C 1KIRB 1LEKA 1J5OH 1JPFB 5HHOA 3E6HA 5T3ZH 3WXWL 5ID1B 4M5YH 1DQQA 1YMMD 3HZVB 4Z78B 5ILTH 2NY3B 4QY8B 4GW5B 4JO4L 2IAMB 1CG9A 3DX6B 3DRTB 1V7NL 1L7IL 3KPLB 4I5BA 4DW2H 1A9BB 4RGOH 4XP6L 2R0WL 5BS0D 3UTTE 4OBSA 1AXSB 1TLKA 2UVEA 4U6XA 3GFUA 4PGDB 3JV0A 1BGXH 1U8HB 5IMMA 3WE6B 1D5MA 1AIFA 4FQ2L 2GKIA 5JNYB 4NN5C 1ACYH 1EFXD 3ARTA 2HKFL 3PNWB 1K4CB 3HAEB 4QOKA 2I9LA 5D70L 4G80A 2Y5EA 1MHHB 3HC0A 3MLRH 3BPLB 3BWAA 3RVVD 2GT9A 4G43A 5CGYD 4MLIA 5F72S 2NTSP 5C0BB 3KPMA 2DLEA 3FFCE 1DQLL 2OBGA 3QEGH 1OGAE 5E7FA 4I0CC 4HHAA 2B39A 1NMCB 1G7PB 5GIRB 1OD9A 1VENA 5INCA 2BMKA 5EUOE 1JK8A 2BHZA 3NIDE 5A1AA 3OKDB 4EI6B 4J3WA 1MLBA 2A73A 3MBXH 5EIIB 5FKPB 5IB2B 4ZYKA 5FYLL 4X6EB 3S37L 3H3KA 1JNNL 3ZL4H 1IT9H 4PRHB 4OJFL 3IETB 2R1YA 3K4DA 2GUOB 4E0RA 3OB8A 3OXSB 1ZOXA 1QYGL 2KZWA 1P9MA 3SDXB 3V79C 2EE3A 1RJCA 3FQWA 5I1HH 5JW4Q 1KPUB 3STLB 5GSRA 4U33A 3U36B 4Z77A 5SX5H 1MREH 3QQ3A 2IH1A 4JFPA 4J4PC 3AS2A 2DJ4A 5F1NB 2UZIL 4YIQA 3WO4C 4RAUB 1N5YH 4U1HA 4MDJA 1RFDL 1QRNB 5I18L 1NGXA 2VNCA 4U49A 4Y4FC 3WIHA 4HZLA 2QHRL 2ZSVA 4QRQA 1TJHL 4KUCD 4HJGA 1ND0A 3MYJB 2FO1A 1XGPB 4O2EB 5EBWA 1FFOA 4LP4A 4ZUWB 4XCEB 1FZJB 4NN7C 1GZQA 1YYML 4UT9L 2VB5A 4YZFE 5JO5A 5D7IB 3IYLW 3BDBA 1FFQA 4NHCH 5D5MF 2Q76A 2EH7H 4XBEH 1FORL 3EZ8A 4OBRA 3Q1SH 1FYHB 4KHTL 4XC3L 4YK4C 3FONB 2Z93A 4JY6B 1T83A 3FCTB 4MB3A 4CBPA 4H26B 5E2WL 4X80H 2BOCB 4WWKA 5DLML 4FFVD 5C07E 2HT2C 2NLJB 4L8SA 4YH6A 2P5WB 5DK2B 4XP1L 4KFZC 2P49B 5BZWB 2E9JA 2JCCB 4QHKI 5L9DL 3RIFF 2VIRA 3SKMB 2LVEA 3H9SA 3H3PL 4NFDA 4GXUM 2EZ0C 1NL0H 25C8H 4YXLL 3LVEA 1ONQA 2GAZB 5CJ8A 4RIRA 1ZLSL 1EEYB 4NZTH 4MA8H 1MAKA 4WI9A 1CLZH 5I2IB 1RU9L 2MNUA 2CJUL 2PYED 3TP4A 4PJBA 2IAND 3G6DL 2EC9U 4U1JB 2FX7H 5HHQB 3ULVF 4MD5A 3QUXA 3I2CH 1OSPH 3SJVA 4JRXB 5HVHB 2XZQL 4RFEA 3O9WB 3SDYH 5IB1A 4M43L 3QDAA 4PS4H 5KVFL 5F7MC 2FLRT 2Z92B 2PYFA 4M03A 4CMMA 1QG3A 2JF1A 3VU2A 2RR3A 2JJWA 3QJHB 4JQVA 1ADQA 3WS3B 4YE4H 3O8XA 3ARFC 4XNYL 2BNRE 4NKDA 4N1CA 3RZCC 3TNMB 2VTFA 4LRNL 5DJYB 4XH2A 3V52H 5D1XA 2YUVA 5FYLD 2OL3L 1JI1A 32C2A 3STZB 2ZKHL 4PB9L 4F58L 2BSTB 2H32H 5CEXB 1MCNA 4K7PL 3QXTA 5CSGA 3MLYL 2EEAA 5K9KB 4KJYA 5C0GB 4NJAL 3PWPB 2ATKA 2MQ0A 3BT2H 3JUYA 4YFDB 3U1SH 1TTUA 3MRRB 4TUOB 4X5WB 1MQKL 4S1DD 3F6LA 4OF7A 4PJFE 2XNAB 4OAWA 1ZS8B 4Z5RB 3MUGA 3KPSB 4N0CD 3U83A 2XN9D 5ESQB 1ZTXL 3C6SA 3ILPA 3QH3A 3MOBL 3UAJC 1ORSA 1QVOB 5D7IF 4LSQH 3LPFA 3IRPX 4KJQC 2FYYA 3N1GC 1VKXB 3QQNA 1EO8L 3TN0D 1HI6A 4EI5D 4KZDH 5C0FB 2ZCHL 1RIHH 3MNVB 1XGQB 3BE1H 4M8QB 4DKDC 3PQYE 3CJJA 3MFGB 3ULUC 3OAZH 1ZT7B 3ARBB 4M3JA 4IJ3B 3FOMB 4U6HA 3UO1H 4KKLC 2RBLA 3EYSH 4OCRL 2JCCF 5I1AA 4KRLB 3NCFB 4NBXB 4QTIH 4YHIB 4YFEA 5DMGC 3IKCA 2VLJA 3G5YB 4CU7A 1TPXB 1BFTA 5GSVB 3D39B 1VEMA 3MC0A 1F4AA 4FG6D 4WY7H 4RAVB 3FQTB 3NA9L 4V1DD 1QSFE 1R24B 4E41A 3GMMB 4IRZL 5JHDE 4ZFOL 5CWSB 5DJZB 4LEXH 1N8ZA 2VSCA 4UV7L 4PBVC 4PREA 4QRUA 3ZTNL 4YAQA 1QLEL 3MO1A 3DXAB 4TUJB 2AV7B 1IAOB 3LEVH 1D6EA 4U1LA 5L88H 2P44B 3ARXA 1N3NB 3HRPA 3TYFB 2V7HB 3TNNB 2XOTA 2EYSB 3O3UN 2WP3O 4OKDA 5IMOB 2Y1VA 1OVZA 3O6FD 4LLDB 4Q0XH 3IT8D 5IVXB 2W60A 3PV6A 4WO4D 4XMKL 3RGVD 2XV6B 1RPQA 4GXVH 4HBCH 1I1YB 3LKPA 4GBXB 2P7TB 5TE6H 2W91A 4PG2A 1G9NC 1FNFA 1S8DA 3OB0H 2BOBB 1J1OL 3WKML 2WANA 3TIEB 4LASH 5DD0H 5ICYA 1NEZB 4ODTL 2PO6B 4F7CB 7FABH 5C2BH 3T2NH 2NZ9C 4I18C 4OD3H 3O4LA 5CZXD 5D72H 4BZ1H 4P4RA 5F97E 4Y5VB 4QXUH 4WWKC 5D5ME 3VXOB 1Y0LA 5EU7C 1OP3K 3HE7A 2FGWH 3S96A 1T03H 1C1EL 4MDIA 1BVKA 4JHWH 5FGSA 4D0CA 2CLRA 2FX8L 4OGAD 1DN0B 5DRWB 3G5VA 1IAKB 2PR4L 3P2TA 3MX0A 4JVWA 1FGVH 4JR9L 3VFRA 3WFCH 2NNAB 5CBEB 2C1PA 2FECL 1TQCB 2VQUA 3B5GA 1O7SA 2DQDH 2LU3A 3C8KB 2V9QA 5AZEL 5C09B 2GJ6B 2V9RA 5A40E 2D31B 3QUXC 4HAFA 4PJIE 1AR1C 5KN5A 1JZ3A 5SWSB 5C0BE 5KG9A 3CX5K 1YMHA 3GSQA 5IJKA 5KS9B 3QDJA 4HFWA 1UQSA 1ZE3C 1SYVB 1F4YH 1MFDH 4JFEB 5DJDB 2AGJL 3ZKMD 3LKNB 2YN3A 4JQVC 1AJ7H 1K6QH 3QDGB 2RQ8A 3MLZH 5B39G 5E08L 2JB6A 1XGUB 3MACH 5C9JA 5D1XC 1Q1JL 5A16A 4D2NA 4BQ9A 1CIDA 2EXWD 2WUCH 1U8NB 3WNOA 2ZUQC 3AC0A 1DEEB 3C5JB 3S6CA 4FNLL 5GGSY 5D2LB 5JOPE 2D0FA 2VZOA 4LPXA 2X5PA 5HGAB 3VWKB 4TN9A 3CK0L 5IVXF 2HT3D 2F53E 5DJAA 3CVHL 2C3WA 3UJIH 2MCPL 6CGTA 1H15B 1JPTH 1QRNE 1X5FA 3O6KH 3F5WA 1DUZB 4G8IB 4Z76B 1ZA6A 3SDAA 1IL1A 3IDIA 1GGCL 2AERT 1DQJB 4GG6A 4BJLA 5DHXB 5L0QB 43C9B 3PGDA 1P4IH 3L3HB 3MLWH 1TVDA 1KJ2A 3WD5H 2YA2A 4BQ6A 1XGTB 1DBMH 4OZHB 3MRGA 4OLYL 4NQDA 4PJ9D 4QLRA 1RUPH 3C2SA 3IJHA 4UTBH 5DD6A 1CYGA 4UTAL 1JFQH 1SEBA 2J88H 3LEXB 4JY5H 5F7NC 4WEBL 4Y19E 1S7SB 3LDBB 3QSKB 3KG5A 1CXIA 5DRXB 1LDPL 3IVKB 2NX5D 4HXAL 5F1IA 1A7PH 4HKBA 3O6MH 3S88L 3T04D 5CHNA 4PTTA 4YHKH 5FDWA 5GPRA 3VXUB 1UJ3B 4LQFH 5GGRA 5EBLA 5DS8A 4F8TA 2XZAL 3C87A 5ADPH 1SQ2N 1E6JL 4K7PY 3OPZL 2A9ML 1BQHB 1LWRA 5HYEA 4JFHE 5EOCH 3WJJC 4XPAH 1NBQA 4UILL 2DTMH 4OSUL 3TFKD 2VDLH 1JGEA 4KQ4L 4LPYA 4ZXBD 1KG0A 4AIZA 1C5CL 3O11A 4ZOBA 4KI5F 4M7LL 5KS9F 4HWEH 3MLXL 3ZDXF 2OXHA 3BAEL 4W70A 1Q9KA 5HYSG 1IGIL 5EULV 2XTJB 1A5FH 3UJTL 4PGJA 3W0WA 3SY0B 3HN3A 1UYWH 3WUZA 1JPST 1KB5B 5CJXA 2VXVL 2F8OA 5IFAL 4PG2C 1RJYB 1ZT1B 2WBKA 2DMBA 4HK3N 1B0GB 1CS6A 4S2SB 3NMEA 1EERB 4NZRL 1AGEA 5IVNA 4J3VA 2G9HB 1BFVH 5L2KB 5DHYA 3GK8H 1GIGH 4C56A 5D2LF 2VZUA 3MGTA 1XH3B 5D2NA 3ZDYF 4JHAH 3BKML 3KJ6H 1NBVL 3U0WL 1X7QB 1UB6B 5I1IH 3RX8A 1H5BB 4GJTB 5GS2D 1JGVH 3REVA 3TA3B 3IS1X 5C0AA 1T0NA 4TVPD 1F4WH 1W72L 3G6JB 5C0CD 2DQFB 3DETC 3MFFB 5J9PB 4WWID 5GGSB 1E28A 5B39A 4NQXB 4PJCA 4GRMB 1I7TB 1GPOH 4RAHA 2B0SH 3N85H 4OZHF 4LCWB 1ETZB 4MCZA 3D48R 5KZCD 2D03L 1PG7W 4WTZA 3C5SB 2OJEA 4UDTA 3JV6B 3FB7A 3W9EA 2VLRB 1K8DB 1WIUA 4WHTB 4XHQA 3BISA 2PUQT 4M00A 1FL5B 1F97A 4M1CC 4PJAA 4NWTL 5C0DB 4QWWD 3IFLH 2PCPA 4OLWH 1JZ7A 2VAAA 5IJKC 4J6RH 3I75B 5K9QG 1NPUA 1RHFA 4DEPB 2ITCB 2VITA 1ZHLB 5JW4M 3HS0B 3W5NA 2BVOA 2IG2H 1U8QA 4KH2A 4DZ8A 3HZMA 1CLYL 3KR3L 2VR4A 3TO4A 3TT3H 1UB5A 1QZ1A 2NW2B 5DMYA 2VN4A 1AO7A 4JRYB 2ED9A 1U58B 5CIPA 3C60B 4TULH 2B4CL 3U6RB 2FATH 4Y4FD 5KJRL 3ZDZF 4WJ5A 2YD4A 3KYAA 4FQIL 4N8PA 1QFUH 5DF0A 1NCAH 4EBQL 8FABB 4YBHA 3M8OH 4LU5L 3J8F7 1XAUA 4GFTB 4JN1H 4OKVB 4P9ML 2OTWA 5EG6C 1NCCH 3V0AC 3ULUL 1CFSA 3DXAE 3SBWA 1YMME 4ZAKA 5TDOA 2DLIA 2XFXA 2ZNXA 1H0DA 4EXKA 4G6KH 4EEEA 3DV4A 1YECL 1CFTB 1J0YA 3MNWA 3GBNL 4UT7H 5IK3A 5BS0E 3VGHA 5HI4D 4Y2DB 1WVZA 3ET9F 1ZVYA 3IDGA 3WXVH 3EOAA 5CILH 5BXFA 3ZKXB 3DUUA 3RWDA 3P4NA 4LFHG 5DT1L 2ICCA 2NY5L 4XGZA 1CU4L 4MCYA 1T4KA 4AIOA 4Z7WA 4OD1H 2DM3A 1J8HB 1U8OB 3V5KA 4MNQB 3RL2B 5FHAH 1T1XA 2VZ3A 5CCKH 3C8HA 2EE2A 5FCUL 3IGAB 3OHXB 1YC8A 2R56H 4YQXH 2P4AB 3DURA 3QRGL 4K2UH 5HYSA 1I1CA 2BSRA 4KY1L 5DEGA 3VFMA 3KPNA 5C08A 2ZP0T 4RCAA 1QFOA 3GB7B 4HGWA 3RVUC 2YK1H 4I48A 3CFKB 1G9NL 2FJHB 1FV1A 1K5NA 4C59B 3SQBA 1P53A 3DIFA 4GQ9L 4G8EA 3WIFB 1F6LL 1SY6L 1IE5A 2HRLA 1HHHB 5BRZB 2DBLH 5FDYA 3PWVB 4DVBA 1VSCA 3ARFD 1T2QL 3QHFH 3U9UB 5HHMD 1TZGH 5T1KA 1I7UB 4JM2C 4MQXC 1I3RA 3CFBA 5DZOA 5C09E 3TWCH 4ZFOB 2V5MA 5HYJD 4NO2A 3MGOA 3MV7B 4CVZB 1YEIL 4R7NB 1A14H 5SWSE 5HHOD 4NQTA 1UCTA 5J6GB 5J11C 2P8PB 4QRRA 3Q3GA 3LRSB 2A74A 1P7KA 4KI5E 4TNVK 5GJSL 2VL5A 3MRBB 2F15A 3KHQA 1DZBA 3L3OA 3ZDXE 1KXTB 5CJXC 2YKLH 3B6SB 3DNKA 1RUKH 5M95B 1MJ7L 1I8LC 1D9KB 3BPNB 3BESR 4HJ0C 2CDGA 3NH7L 4GAJH 4DGVL 1U91B 2MFNA 3AVEA 1FO0L 3BGFC 4HEPG 1A9EA 2B5IB 1LE9B 1F3RB 1LO5A 1NCWH 4OQ1A 3PWLA 3IXAB 1AH1A 3MJGX 4K3EL 3NTCL 3FB6A 2N7AA 5D2NC 4LHJB 4NQEA 2DKSA 3U4BH 4QOKD 1U8IA 5DMIL 5ITBL 1WBYA 3VXSA 5CJQL 1IGTB 1JN6A 1UENA 3OKEA 1PG7H 4L9DA 1W0WB 4O2CA 2NY0D 4P5TA 4OCWL 5LCVL 3DUSB 5AWNH 2Y5TB 4CL7A 4JKWA 2DQHH 4MMXC 4WU5A 4XB8A 3FN9A 3QO0A 2FJFB