5HDQH

Mntc co-structure with mab 305-78-7
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
213
Chain Sequence
QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVQQRPGQGLEWIGYINPSSDYTKYNQKFKDKATMTADKSSSTAYMQLSSLTSEDSAVYYCARKEDVGYWYFDFWGTGTTVTVSSAKTTPPSVYPLAPSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein/immune system
molecule keywords ABC transporter substrate-binding protein
total genus 49
structure length 213
sequence length 220
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqH02
3W0WE 5SX5K 3IKKA 1CZ8L 4JGMA 1JNLL 1U93A 4XCEA 4XX1G 4IRZH 1MH5B 1S7WB 3CXDH 5ERWA 1N59B 4Q9QL 3MOBH 4J3TA 2R4RH 1DVFB 1DLHA 1YQ2A 1YECL 1QOKA 4NQCA 2IMMA 1UCBL 5JW4M 4HT1H 4R2GB 5E24E 5DSCB 1LEKB 5GGSY 3UBXI 1BOGB 3FT2A 2FH6A 2PXYB 4X6DE 2NYYC 1A6WH 3PUCA 3RFZC 2NTFB 5HYQA 5LGKA 4OT1L 5JPNA 1DANT 3W9DA 2SEBB 4WWKD 4YBQD 5KVDL 3S36X 3KPRB 3EYFB 4OLZH 1CDIA 1OP3H 3L5XH 1J11A 4PJBB 1GAFH 4Z76A 2Z4QB 4HQQH 3E6HB 2ORBL 4X4YA 3EBAA 3MREB 3MV8B 3OGOE 1NUNB 3LN9A 3W39B 3WHXB 2V5TA 5CHNA 4R96A 3MRCA 2YPLB 1P7QD 3QNYA 4U1IA 3BRDA 3DETD 2QQNL 1JHKH 4JFPB 5ECJE 4QRQA 4S10A 3T3ME 1XAUA 2PO6B 4HS6B 2WBJB 4ODTL 1QSFB 1YN6B 4YLQT 3TYGL 5CEZD 4JY5L 2DWEB 2F15A 3EIFA 4HDIA 4KAQH 2R2HA 2VQTA 3DECA 5DD5H 3K1DA 3VH8G 4Z7VA 1BFOB 5D2LB 4PBWD 4GG8B 4Z7OE 3GEWB 5A3ID 5IUSA 2VISA 3JTSB 2IH1A 2P5WA 1G9MC 4JPWL 1B0GB 3LQAC 4JPIB 4U1GB 4MMZC 3WN5C 5J8OA 3ZKMD 3F6LA 3IETB 2E7BA 2F53D 3G04A 3G6JF 2OTWA 3RDTD 4UTBH 5DI8A 2NY0D 4N5UA 4PYHA 4TTDC 1CE6B 4J6RL 4O58H 3HE7A 5ID0B 2G2RA 5D7IB 4JG1L 3TYFB 3MV8D 5T1MB 4GKSB 3W11C 2O5YH 1JCKA 3TCLA 4KI1A 1NDMB 2NY5L 3B6SB 2V2WA 3HZKA 2P44B 4S0SD 4K23H 5D6DA 5HDBF 5CKGA 1I1AB 3HKFA 3B9KD 4L3EB 1IGYA 3ULVL 3FOLA 2ZCHL 4FOMA 4UT6H 2VUOA 5TDOB 3MZGB 4G6JL 4OZHA 1CBVH 5I8EB 5F3BB 2ZWLT 5F7UA 4G6KH 1GPOH 1YEJH 4LSVL 1S9XB 3TO2B 3C5JB 1GYAA 4R8WH 2ITCB 5HYFA 3JVGA 4EQ2A 1N5YL 4H20L 3MRNA 1U3HA 5EWIH 2R1XB 3U2SB 5F1NB 2VOTA 3P4LA 3FONB 3ARQA 1AXTH 5BCAA 3MV7D 3QDJE 5HDOA 4HPYH 1JHTA 4N1CA 3T08A 3SY0B 3S37H 5ACZA 4MA8H 1XIWA 5E5UB 4L4JA 3QNYB 4TVSa 2GSGB 3IB4A 2OL3B 4FXGB 1YEFH 4XBEH 3WFCL 2FJGA 2AS5M 2WBJA 2CJUL 2EDYA 3MYZA 1OAYH 1YMME 1NANI 4HLZG 1CG9A 1TFHA 5SWQA 3VFGH 3UZEA 1K4CB 5J0BA 1P69B 3WFBL 2RIKA 5F8RC 1YEKH 1SMAA 2AJVH 3QUZB 3LS4H 4LQFL 1ZGLM 3BZFA 2XZAL 2WANA 1RVFH 4KZEH 3SPVA 3RWJB 1OAQH 5BOPA 2CKBH 3BZEA 2DIAA 5EG6C 3MCLH 3BD4A 3INUH 4KGJA 2IG2L 4XHQA 2OQJB 3ARDB 4K3DH 4NO0B 5L7XL 4HIEB 3DARA 1UXWA 1Y18B 3HNTL 3OXRB 1YEFL 3T09A 1NCAH 4BFIA 1QSEE 2R2CA 5IJKC 2D7TL 5CD5D 4OGAC 3VCLA 3U4EA 1C08B 2CKBA 3KYKL 4OD2A 5DMKB 4OLWL 1ZVYA 1F58L 3B2VL 4O2CA 2ZCLL 5DVNA 2DYPA 2EDOA 2ADJA 2F5BL 2WK2A 1QSVA 1ETZB 1G7QB 1HYRC 5KS9A 2H3NA 1S5IL 4MNGA 3O2DA 4QHLA 3ZKND 3HLAA 4UV4H 4XI5C 3OKNA 2DBLL 1I8IA 4BUGA 1LO2H 3JWOL 2AJSL 1R5WB 3HE6D 3PGCB 5F1NA 4LLVA 2BVQA 4LCUA 4D0CB 4XB8A 5FKPB 3S3JA 3HPJB 2QTEA 2MHAB 5CKAA 1UA6H 1F90L 4DGYL 2ZG2A 3RNQB 2VE6B 3UTOA 3V7MA 5IJVB 5JOEA 2I60L 3NIDF 2B5IB 4I4WB 2B4CL 4X4XB 3O3AB 4HUVB 1KC5H 4P5KB 5IT2H 2WLZA 5DLMH 2X9XA 3M1BA 1JNJA 5GJTH 2X6MA 5IMOB 3MC0A 4PJEF 1GPOL 2JJSA 1XGUB 3EYOA 1DQQA 1JGVH 5DHVH 5K9KA 1N6VA 3UJIL 2UWEA 4PREA 4XAKD 3GSUB 2DD8L 1T83C 3JV6A 2P42B 5KSVA 5DZOA 3AXLB 3VRLE 4NBYB 3F58H 3HI5L 4D3CH 1AE6H 1FLTX 4LLYB 1EO5A 4Z78A 5IV2A 3BOVA 3QIWA 2X4NA 1A1MB 4S2SB 3ARDA 2VLKD 3SJVD 3EOAB 2QSTA 5T3XH 3QIUA 1CXHA 3VXMB 2YN3A 3IAPA 3UDWC 1R0AH 4ODXB 3AMKA 3OJDB 3TT3L 4LF3A 4XMKL 5IBUB 4BQ9A 5MENB 3CSYA 1KTLB 5F97E 5HD8D 2FX9L 1D5ZA 4MAUL 1OCWL 5IG7B 2ZG1A 4F57H 4O2CB 2PYEA 3LQZB 1OB1A 1N26A 4R26L 1ZAGA 4CVWA 3WFZA 1RV6X 4HKZA 1ROWA 3HUJB 3ORJA 5SWSE 1EPFA 5SX4H 2NNAB 4H0HB 2NX5A 4OF3A 4J12A 1MY5A 2DMBA 2Q87A 1A7QH 5A40E 1ZKAA 3CDFA 1MIEL 1RHHB 2AABH 2YPVH 2EKSA 3GMRA 4L9LB 1B6DA 3T1FA 4RGND 1CFTB 3M8OH 5IROC 1RPQA 4YE4L 4PRIA 4XXCA 3G5ZA 3IDGB 3VXMD 3C8DA 4HZAA 2VC2L 4PUBL 1A6WL 1CICD 3RGVA 1J1OL 2Z8RA 5FECB 2A38A 3U82B 2EC9U 3C6LC 1WZKA 2H2SD 2ZJSH 5DS8B 3WFHB 3LHPL 2FIKA 2ZUQB 1QP1A 3ULVD 3PHSA 2R4RL 4H1LH 5FM5O 1WZ1L 4LOUC 4E41A 4JHWH 4X9IA 3H3PH 1A1MA 4XMPL 4GRWB 5EULV 3QUYA 1YYLL 1GJIA 5KN5B 2FBJH 3EJZD 3OJDA 1SEBB 3IFLL 3HCVA 4NJAL 4D8PA 2AEQL 3WHE0 1JF1A 3OF6D 1FAKT 1IGMH 4N1EA 1UGNA 3IDJB 5C0EA 1YJDC 1D5ZB 4UMGA 4JRXB 1IBGH 3ESUF 5T33L 3QIBB 1J1PL 5JORB 1MUJB 3A6BH 3C60C 2X4UB 4HWNA 2V5SA 1XGQB 4PJIB 1G6RB 1OHQA 3ZE1F 3PHQA 3OWEA 1OWRM 2R15A 3SE3C 2FZ3A 4AG4H 4FQJH 3QRFM 5D1XB 1KXVC 2G5RA 4XP4H 2IEPA 4NUJA 3L3KA 4H88H 4QYOA 4AT6B 4KI5C 1WFOA 5F88A 1KB5B 4GAFB 5TPWH 3FO0H 3KJ4B 2EKSB 2IAMC 3GMRB 4YGAB 1NC4B 4N5ED 2H45A 5DRZA 2B2XL 3CGTA 4S1QL 1I1AC 1F4WH 1V3JA 3SN6N 4I18A 3PE9A 3KAAA 1ZVSB 1CICB 5F7WC 3MUY1 4OFVA 1M71B 2GJ6B 3CXHJ 4RAHA 5DUML 3ARDD 2FD6L 4ODSH 3OZ9H 3FO9B 4FQ1H 5GGVH 4L8BA 1H8NA 3BKML 1XF3B 1R5IB 1QFUL 2BFVH 1MRFL 1WFNA 1KEMH 4QEGA 3SDAD 1ZE3C 1BJ1H 4LVNB 4F2MB 4P5TB 3WIHH 5E2UL 3RIAF 3A6CL 2V5MA 4N0CC 4P3CL 1QG3A 1FE8H 2DI8A 5K59F 3MV01 3Q6FA 2NZ9C 2Z8WC 3K8LA 3WJJC 4G8GA 1WBXA 2QADC 5JDJA 3L3JB 1WBYA 4JRXE 4LHJB 4YAQB 4PD4J 5DVLA 1MQ8A 3CVHH 1RJYA 1LDPH 3NN8B 1WBZB 5I18L 1CTOA 4N9GB 2N1KA 4MQXC 1MFAH 4YHLH 1NBVH 2VXUL 1E28B 3TWCH 2XIDA 3W11D 4LCIH 4OZFB 4AK1A 2W60A 1DBKL 3CC5B 2JIXA 5E8EB 5MEQA 5K9OB 5LQBL 1LP9A 4ZAKC 3TEUA 4EN3B 3CFJA 3S4SG 1RZGB 3I75A 3KWWA 4KRPB 3VG9B 3AROA 4P48A 3TFKC 2KZ1B 4H26A 3O2WH 2I9TA 4RAUA 3DROB 5GGTL 3MXWH 2EDEA 4RRPG 2HFTA 3CDGB 4K7PY 3H6JA 1JHLL 3ULUD 1MWAH 1QLEL 3PWNB 3O6FA 1X4ZA 4U1MB 1CDYA 4AZ8A 3KPSB 3FO2A 3KDMA 4UIMA 4NOFA 1V7NL 2YRLA 3BQUC 2PXYC 1DEEB 3GKWL 3B9KB 4NZTH 1UH4A 1LHZA 4P9MH 3BZDA 1U91A 3S96A 5ICYB 3W9EB 4YDVB 4OZFG 3SKMB 1E6JH 1GGYA 3OAUL 4QRUB 4YEFA 1LEGB 1ZLUK 3TVMD 4O9HL 1YMMA 1MRCL 4PRPE 3U0WH 4EUPG 2VDKH 1MHCB 1NMAL 3EJJX 3DV6A 5ADPH 3CAFA 2HTLD 3WS3B 3NCFB 3WFDH 5C07B 5IGXL 2HG5A 1KYOK 1II4E 4KQ3L 2H1PL 1UG9A 1EJ6A 1C16B 3E6FB 2HTKD 3QULB 2JB6A 4YC2C 4TRPH 1H3VA 1SJHA 4L4TE 2H6PA 1K9TA 3QWRD 1OTSC 2G5BB 4S1QH 2DMCA 2EYSB 2DLIA 3N1MC 1EUTA 1NSNL 3PQYD 2W60B 4OZGB 3QDME 5HGHA 2EECA 1F45A 5CZXD 4ZODA 3EDFA 4I77L 1HKLH 3R4DA 4B5EA 2HFEB 2W07A 3ZDYE 1AI1L 5EIIA 3F5WB 4P2OA 2D03H 1RZKL 5IFAL 4BKLB 5D6CB 4WV1A 1DQDH 4PV8A 2CUMA 3P9MA 4BSWA 1MFBL 2WUCL 3BEWB 3H7LA 4Y5YA 1PBYA 4KUZL 3O11A 3STLA 5IB3A 5GHWL 1FDLH 3RWIB 5KSUA 4NNXA 5T33H 4WWKB 4XP6L 1RMFH 3RKDD 4NHCH 5I9QB 5TE7L 3ALXA 3NIDE 4DW2L 1KELL 2ZPKH 3QDJB 1CFVL 1J0JA 5IB5A 1CU4L 2WBKA 3O4LB 1U8QA 1L6ZA 4OZHE 2PCPA 3ZE0E 4UT7L 3UAJD 1V7ML 4YDVA 5MI0C 1P7KB 1HIML 4MJ4A 5CBAB 4QRRD 5IMLB 4IRJB 2BSRB 2CO7B 4LSTL 5CJQH 1NLDL 3B9DA 4GLRH 3MLSH 5L7XH 5EH1A 3HE7D 2DQCH 1X3DA 1H15B 2ORBH 1I7ZA 4MXVF 3NA9H 4Z7NE 2NMSA 1UM4H 2DIJA 1ZTXH 1EAJA 3ARGB 3P4OA 3IAQA 1OW0A 3VDBA 1H8OA 5FGBC 2FSEB 4M6OL 3FKUS 5DJXA 4OI9A 1SMOA 2CDGA 3DIFB 4GLRI 5C0IB 1YUHA 1YJDL 3MLXL 4KH2A 5J6HA 3BUYA 1R3IH 2P46B 3BZ4B 1KF9B 4BELD 4G8FA 5B38G 1J88A 5D1XC 2VQ1B 5GSVA 5CEZH 5HGHB 3P77B 1OTSD 4KI5E 3VJ6A 5IIEA 3TT1H 3I6LE 3V0VB 5EIIB 1JBJA 5C0GB 4NN5B 1NL0H 4W6XB 5DXWA 1A7QL 1X4YA 3KJ6H 3EYVA 1YEJL 1MWAB 4R7NB 3MLSL 2AJ3B 1ZS8B 3CJJA 3PV6A 4KRPC 5AWNL 1MCPH 5TE6L 3EFFA 2XRAH 3K80A 4FQ2H 4NRYA 1IE5A 1P1ZB 3OGCB 3GSNB 2AXGA 5EWIL 1FFPA 1DUZA 2GY7B 3UTSB 1KPRB 4NO2B 5B39G 3GJFK 5DMGD 4ZPVA 4KWUA 5ETUB 5HYJA 3HC3H 3VE0A 3GSNH 3RDTB 1RI8A 1F6FB 2AJZA 3BW9B 3LRGA 1KCKA 5CCKL 4DTGH 3MCKA 5AZEL 1FGNL 4HWEL 4RMSA 2QKIA 5DJ8B 3HAEG 2AK4A 1T7VA 4NQCD 1UACL 1INDL 4XAWH 5GGRB 1BBDL 4OCWL 5JHLL 4GRLC 2IGFL 2B20A 4K71B 1IM9B 3RZCC 3QFDB 1HEZB 3BP4B 2EH7H 4OBSA 4IHOA 2JTDA 3VRLF 2EIZB 3DYOA 3O6KH 1V3LA 1QO3B 3KPQA 1CFSA 5T1KA 4X4MA 4OZIB 1QKZH 4KKNA 2V2TA 1FGNH 1OP9A 2GIYA 1IARB 3P4OB 1UT9A 3CMGA 4HG4J 4OCYL 4UUJB 1FLRH 3IDYB 1CD8A 5LAXB 2YZ1A 4NO3B 2OTUB 1PQZB 3MLZL 5C0AE 3IFPB 5EU6E 2ZOKA 1YMHB 4KKLD 4G8FB 5CILL 2V7NB 3IFOB 4OV5A 2I60H 2FYYB 2BDNL 4X98B 3MV9D 3LKSB 4KJWC 5AZ2H 2B0SL 1OGAE 3V0VA 4WUUE 3U46B 3V6OA 1J5OH 5IQ7L 3VFUB 1HNFA 1I1CA 3VXRB 2B1AH 5FA4A 3FQTA 4GAJL 3V5HB 3ARRA 2BZDA 4TRPL 4PV9A 1IVLA 4MMXC 4X99B 4YHZL 3C09B 5IW1B 4GBXA 4Q97A 3HI6L 3GSNA 3VXSB 1FH5H 3ZE2F 3QQNA 3QQ9C 1QR4A 4NM4L 3WSQH 2F54B 3U7YH 3VXUD 5FUOH 4NO2A 4E9LA 1MIML 2LTQB 5K93A 3PP3H 4OQ1A 2M8XA 3FRPG 1T4KB 3BAEL 3C5ZB 1EO7A 5T3ZH 1Q0YL 1QLFA 3KS0H 3O6FC 5KANI 1KGCD 5IB2B 2YPLE 3IKCB 3BXNA 2HA1A 3U0PB 4KGLA 1CLYH 5E5MA 2NY7L 3CXDL 4DJMA 3WFEL 4NKIL 3V52L 5KAQF 5B8CB 2D0GA 3AAZA 2CRIA 3MFFA 4WEUD 3PHOA 4AJ0A 1ZXQA 1I8LC 2EIZA 2EEBA 4JZOA 5C0JB 2QR0B 4WCYL 4K94C 3L3GA 3BGAA 3RZCD 1FL3A 5E2JA 5A2KH 5HHXL 3T77A 3V52H 2YC1B 3HFML 4NO3A 4Q9CA 1HINH 4CN4A 4ALAH 1XF5B 1N64L 1HDMB 5MENE 1UEMA 3IFPA 5HI5C 3OBAA 1MHHA 4R7DB 2ARJA 5I6XC 2Y07H 4HIIA 3WJLA 3FOMB 1R0AL 2P5WD 1XF4A 4G9FD 1NUGA 4FQQA 4TSCH 5JHDA 1YPZA 3CDCA 3OG4B 3UTPD 3HRZB 3V5KB 1D5IH 2XN9D 1JPTL 5J6GB 5L9DH 1QFUH 2EDLA 1CI5A 5FA4B 2J8UA 4GRWE 3DWTA 3NFSH 2X40A 2EO9A 1A4JA 3HZMA 5D96C 5HPMB 2OMBA 2VDLH 5SWZB 2DQTL 2W9EL 1LO0H 4LPYA 2EE9A 4PLNC 2IQ9H 1B9ZA 2R56L 3KNBA 4WU7A 5C08A 2YD3A 4JDVB 5HGAA 4XWOD 2D3VA 3BP7A 4IDJH 4YPJA 2A6DA 2VJXA 2F74B 4PRNB 5GGUA 3FT2B 4NWTH 5T3XD 1HXYA 4AIXA 5GGVL 2IQ9L 5K9QG 5ENWB 2XKSA 3L95A 3DUUA 1RK0A 1JRHH 4KU1A 5CS7A 2W9EH 5EOCL 2EDJA 3PXHA 1GIGH 3QEQE 4WW2A 3DXAA 4U1KA 3PWUA 2ZSWB 5EU6D 2CDFB 3W5MA 4LIQH 3MFFB 4FMFA 5TQ0H 1SY6L 5DUPH 5C0BA 5CZKA 4ZOBA 3QQ3A 4XPFL 1ZWIB 1MREH 4CVZA 5JIPA 4H8WH 2YPLA 4HSQA 5ERWB 3DV4B 3T77B 1HI6A 1PJ9A 5JHLH 1FGVL 1DN0A 2HMID 5EUOB 2NXZB 4EUPB 4ODUB 1UWGL 3TJEH 1W72L 3PWVA 3P40A 4LKCA 4HIIB 2XY2A 5IMKA 2GYSA 3MLWH 4FXKA 4JFOB 4KTEH 5JO5A 1MJJB 4FQQB 5I1KH 4YX2L 1EAPB 2W38A 2WQ8A 3GJEB 5SWZD 4I2XB 4Y7MA 3QUMA 1DTUA 1I85C 3VD4A 2PXYA 1CDJA 1VFOA 5FYJU 4PP1D 4OGXL 2XN9B 2UZIL 1MNUL 1A6TA 1IGCH 3PDOA 4PJFB 3KPRA 4J3WA 5DRXB 5C86A 2VAAA 3VA2C 3U7AA 1WIUA 3IYLW 3TN0D 5MEPB 1A7PL 2Q6WB 3T8XB 2PYED 4LCCA 4N0YL 3FMGH 5J13C 2Z4QA 4YDKH 3WXWL 3ALPA 1BQUA 1HHJA 4MX7A 1YY8A 4HLZH 1FFOA 3C60D 5ANME 3UTZA 2J8UE 3KXFB 2EDNA 5GS1B 1AC6A 4I5BA 3ZDXE 4JFPA 1RZJH 4GXVH 1KCUL 1GGBH 1YN6A 3IDNA 5EU5B 3VXPA 3K8MA 3DGGA 3WBDA 5JUEL 3QG6A 4U6TA 3HNSL 1CL7I 1FNGA 4Y0GA 1U3HB 4DKFH 2NY1B 5DDHB 6CGTA 3OAYH 2OP4L 5C0BB 2AI0L 1DBJL 4MSWB 3PP3K 1QSEB 3ARGD 4QO1A 5E03A 4R8WL 5J1SC 2C3WA 4FP8L 3RVUC 5DVKA 5L2KA 1VFBB 5EO1A 3ECBB 3NA4A 3HE7B 3BGFB 5ID0A 2XICA 3T0ED 1IC5H 4LBEB 2FX8H 1KTDB 1CG9B 2OK0L 5DJYA 4Z7QF 4FXKB 4GS7B 4XP1L 3K46A 3VXSD 2CRMA 4LDOB 2Y23A 5FHBL 4U0RB 3RU8H 4JY4B 2M2DA 4RISH 1I1AA 5HGBA 4AG4L 3QDJD 1MFCL 2QQKL 1VFAB 2F54E 1IQWH 2IQAA 1I1FA 1X5AA 1I85A 1L9MA 3C5JA 3H9SE 4U1SA 4GG6B 4GW5B 4DEPC 3QFJA 2D0FA 2YPKA 3GNMH 4RWYL 1CR9H 5MEPA 3MRPB 5KVFH 2CR6A 3GI8L 4TUOB 3OXRA 1B3JA 3MJ8A 1YYLH 2I9LA 4K94H 2Z92B 3ZE0F 4WI7A 3T04D 1FZOA 2CKBB 5EU7C 3WKMH 3UJIH 1K6QL 2CGRH 1MI5E 1A7NL 3D39D 4RGMC 3ZTNH 3D3VE 3U0TB 5I1AB 3D9AH 3H0TB 3SGDI 1JGLL 3VDCA 2UUDK 1P5UA 4M6MH 3K1KC 1U41A 1NBZA 3DJ9A 2VZSA 4PB0H 3BPLB 3LN4A 5D9SA 1VCAA 4XGZA 4Z7NF 5HBBA 3CXHK 5EBMA 3V6FB 5DHVA 5IQ9B 2ZZUT 3KPMA 1MCLA 2VE6A 1MFEL 1B2WL 4FFVC 3WIFB 3ZHKA 2GSIB 3DO3A 3MMEA 3C09C 3VMPA 3RWCB 2X4OA 5DRWA 3L5WB 1W0VB 1G9MH 3OAYK 2J8UF 4YEEA 4M5YL 4HIEA 5F7YC 3MRIA 1OAKL 1UCBH 3QJFA 4UNTA 5E8NA 3RHWF 1MCBA 5HHOD 1HCFX 4QRPD 5C09B 1FNLA 5CWSB 1TQBB 2V5YA 5IB1B 3BJLA 1L7TH 4M1GL 5I73C 3S9DB 3UPRB 2QQQA 3T2OA 3M07A 5HHNB 3HI1A 3O6MH 4RFOH 5KSAA 1MCQA 2O5ZL 1A0QL 3G6AB 4TUKH 2X09A 4W68A 4XZUB 1U8LB 4OLXH 4CGTA 1DBAH 3T2NL 1UEYA 4K7FB 4NQXA 1GRWA 2H32B 4P46C 5FKPA 4LF3B 3QHFH 5E00A 2MHAA 1YQVL 4TOYL 4DQOH 4LCYB 4FFZL 2OR9H 2DQDH 2KBGA 3WNMA 4EN3D 5KVGH 4WY7L 5IW3A 4JO1L 4E5XA 2G9HA 3C8HA 1NC2D 3QEGL 5HHOB 1A6ZA 4XPGL 3NCJL 3F7YA 4UNUA 2QV2A 4OKDA 3Q5TA 2MOVA 4W81A 4F58L 3MR9A 5J1AA 4HJGB 2BHZA 2NNAA 4DAGL 4F3FB 4X7TB 1KGCE 1ORSA 3QNZB 3ETBF 2PTVA 3V6FA 5IQ9A 2XG4A 5DQ9A 4ETQB 1A6VH 4KTYA 4ESKA 4O51A 3D39E 3MMEB 5BS0B 4LLYA 5C0BE 2P7TA 5DRWB 4Z7UA 2A74B 3L3IA 1BZ7A 1I7RB 1U8PB 5GS2H 2DS4A 1ZT7A 2YHGA 4JFDA 3OJVC 2OI9C 2XXMB 4M7JH 2CSPA 1FZKB 1VENA 5MENA 3TZVC 2HWZL 3DUHA 2IADB 4WTZG 1A5FH 2YA1A 3OQ3B 2WNGA 3FHQA 4OCNC 3OKLB 1QFWH 3U48A 1QEWB 3I84A 3PQYB 2YD8A 3DETC 4Z9KB 4XP5L 3V9FA 5HDQH 5D1XD 4O00A 4NQXB 3W2DH 1QBLH 2IPKA 1ZOXA 3ARVA 2RQ8A 3R1GL 4NKDB 3IDJA 4O4YH 4X80L 2Y7QB 4TVPE 5DFVC 5IOPA 5L2KE 1X6LA 2XQBH 3FT4B 5DK2A 4KKAC 3WE6B 4KAQL 1ZGLA 3G5VB 1W8NA 4KVNH 2DF3A 3SE9L 15C8H 2ADGA 4JM2C 1MCJA 2FZ3B 5ICXA 1SJEA 3O2VL 4HKBA 1YC7A 5SWZE 3RPKA 2KUTA 4BM7A 3B43A 2C3XA 1MFAL 2P8PA 5IHZA 4KV5F 1IGTB 1RFDL 1ZT4A 3U6RA 4JFZL 4PBVC 5KSBB 3MSPA 1CYGA 2P7TB 4K7PX 3GGWB 3FN0L 3CU7A 4N5EC 4RFNC 2W9DH 1ZT7B 3SGKA 4XTRD 4QRTA 2PYEE 2VQUA 4TPRH 5EZIH 1FFRA 4M6OH 4NFCA 3ZMRA 5BXFB 1FZKA 1LDPL 3HCVB 2IFFH 1OSZA 4CADB 1JF1B 2XA8L 1G1YA 5DFTA 4NJ9L 4GBXD 3TNNA 4EIZC 3D69B 3OV6A 1ZVHA 2RCSH 4QXTA 4YXHL 1J86A 5JW4Q 4BFGA 3VG0L 4EDWL 3QAZC 2H32H 3GI9L 5FHAL 3S34H 4G43B 5EU3A 3SKOA 5IB4B 5LG1A 4CJ0A 1WBXB 5BMFL 2NZ9D 1GIGL 1BHGA 4G8IA 1JN6A 4K23L 3RBGA 5SV3A 4NUJB 4OCXH 1G1CA 5IW6A 4NT6B 5EBLA 5J4MA 3ZZ1A 1KJ3H 4Y8AA 2CLVA 4FQCH 4XP6H 2YKLL 3GMOB 1WCBA 2XZQL 2FHBA 1BFVL 3EHBC 1N7ML 2RAMA 4Y1AD 5JXAL 2NY3C 2V2XB 2BNQA 1PLGH 1F8TH 1WICA 3Q48A 4I8DA 4LSUH 5KTEL 1KCRL 1HOCB 4RIRA 1INQB 1X5FA 2MQ0A 3G08A 2IWGA 2GFBB 5IM7A 3HC4L 1CGUA 1AD9B 3MRDA 1INDH 2X1OA 5DRNB 4F9PA 2BVPA 5DUPL 5KVGL 2R69H 1R5IA 4NQUA 4F37K 1GCFA 5FEBA 2DD8H 5EZLB 2ADIA 1QA9A 5DHYA 2Q7YB 5AG9A 2PW2B 1H3GA 2AEWA 5DJ2A 1YYML 3MPCA 3ILPA 3K3QA 1C1EH 1URLA 4JFYA 3NVQA 3L3JA 1N6UA 3GHBL 5B4MD 3W9EA 4MDJA 5TF1H 1EJOL 2BOBA 3IDIA 3DX9A 5EOCJ 3VW3H 3HE6A 1K5NB 4XVTH 1OL0A 3FB7B 1GZPB 4XMPH 3JSSA 5MEQB 3IFNH 1JPTH 5F44A 3WS3A 2XTJD 3BPLC 1GC1H 1NCBL 4GW4B 1HQ4A 3L7FB 1NL0L 4JRXD 1U8OB 2A6KA 3EW3B 4BH8B 1U6AH 1JZ5A 3ZHDA 4LLWA 4WHTA 3OKDA 5FOBB 1X5KA 3DOSA 4NQDA 5TH2A 1P4IL 3HE6C 2DDQL 4PGDA 3GIZL 3VWKC 5FDWB 4JPKL 5KSAC 4L8SC 4PYGA 1CDUA 1NCTA 2IFGA 2HFFB 5DC9B 1I9IL 1T1ZB 2CLVB 3FB5A 4JLRB 4FFYH 3CH1A 4JRYB 1EXUA 4KVCH 1OP5H 5EC1A 4NNYB 1DEEA 3F5WA 3ILQD 1ZTXL 2BNQB 5CIPB 3WMSA 1UCTA 2IBBA 1MHEB 1X5ZA 4WFGD 4X0KA 2AP2A 4HXAH 4LASL 4BSWB 3VI4E 5JXEA 3SKMA 1FFNB 4JM2B 4KK9D 4K8RL 2IH3B 4WW1A 3TO4C 5BS0E 1T66D 3UYRL 2R2EB 3HB3C 4KZEL 3NH7H 4OCRL 1G7JA 4K9EL 2X70A 3MLRH 1YDPB 2P8LB 2E7MA 3QCUH 4EI5C 1PKOA 3GSXA 1PX4A 2VDRH 5IB5B 3MBEB 4M5YH 4MNQA 2XZCL 3ESVF 3QDMA 3R06B 5J11C 4U7KA 3I2CL 2PNDA 1KCRH 3VXOA 4CJ1A 1PD6A 3O4OB 3X3GH 3DBXA 3TH3T 1PLGL 4GXUN 5C9JB 1BLNA 1FE8L 3QUKA 3CX5J 4OZGF 2HAZA 2EIDA 4EI5A 2AKRB 4POUB 5FM4A 4LHUA 5DD1H 4OZGA 3THML 2H26B 3FQWB 2J4WL 2XG5A 4LPCA 1HQRB 1DQDL 2ZOLB 2PF6A 2FHFA 2ERJC 4D9LL 3WJLC 3F7VB 5F9WC 2O93L 3MV7B 1KG0B 1AH1A 5C2BH 2O5XL 1YA5A 4C83B 1EZVY 1KPVB 4NGHH 1YUHB 4Q6IC 2A73A 5CJ5A 4U7MA 5I71B 2XZZA 5F7HA 3OAZH 5IJKA 3CLEH 3VXRD 4Y4HA 1BVZA 5FYKH 2Q7NA 1KT2B 3AB0C 4NGHL 1DBMH 2XTJE 5B38A 2O5XH 1Q8MA 1OARL 4YIQB 4OUUA 3RIAK 1IC4L 5D2NC 5GZND 3CVHB 4X4ZA 2AJ3A 4IRSA 4YHPB 5IEKB 4ZUSB 4D0BB 3MRQB 1C7SA 4JPVL 1Q1JH 5DEZA 4PTTA 4DFIA 1K2DB 2KQMA 3WL9A 1BIIB 1F5WA 1CD0A 4S1SL 4YQXH 2QQKH 4HX1A 5C92A 4I1NB 3KPNA 1G7JB 1H15A 2NY0B 4ZO9A 5E1AA 1T20A 1R3LB 4R90H 4YFEA 1A7OL 1YDPA 1BM3L 1I3RB 3RL2B 4G3YL 2IANB 2B4CC 1IM9D 1R3IL 2AJZB 1RURL 4QXGL 5B8CC 3QEQD 2AQ3A 1KLGB 3O6ML 1NFIB 4PRDA 3QXAA 4U6VL 5D2NE 1YN7B 3QUKB 4OGXH 2IAND 3OG6B 1JJUA 2A0LD 4OLXL 5D7KE 1UENA 5F1IA 5HXMA 3DGCR 1IT9H 4JZNB 1U8HA 4OV6F 2ZKHH 2MQ3A 4JKWA 1F42A 4OKVB 4S1SH 2GKIA 2C9AA 2D9QB 5J56B 4OM1L 3WKNA 3OHXB 3ULVF 2J12B 2A73B 3GBNL 3CX2A 3TBYB 2ZPKL 1Y0LA 5DR5H 1YMHA 3B9VA 4WW2F 1RZFH 2Y36L 3SDCA 3UTSA 5H37H 4ZOEA 1KPRA 4X6CF 4FZEH 2FB4H 3TCXA 4B0MM 3UTTD 1U6AL 4ZUTB 1CK0L 1JP5A 4CMHC 1TJGL 1U0QA 1L4IA 3AS1A 5FA3B 2F53A 4ZFZB 2EDKA 5MP6L 3S7GA 1VHPA 4JHZA 4YGVA 4KK6C 4AM0A 5GS0L 3RPIA 4M6NL 5JOPE 4HPOH 2UZIH 4Y19B 4TUJB 3V4UL 1HSBA 3WL9B 4WGWB 5CILH 4ZUWA 3VXRE 2I24N 4QRPA 2HJKB 4DW2H 5C0ND 1Q72L 3R0MA 4IJ3B 5E2VH 4ZFOA 4U6HA 4EXKA 2HT2D 3BSZH 4G8EB 4JO4H 2B2XH 3BGMA 3VD5A 3SQBA 3C5ZA 4QCIA 4B41A 2CGRL 1OTUC 2CR3A 3BMVA 1AGEA 1EMTL 1AR1C 4NQDE 4UT7H 3U4BH 1C5DB 5LCVL 2K3TA 3SGKC 1UKQA 3K4AA 1FSKB 5HYIA 3MBED 3HAEA 1NGPL 2LVCA 1YNKL 4HGKC 3KPTA 1PSKL 4PJDB 4XBPA 3ZE1E 2BRRL 3P3YA 1F2XK 1KENL 3N9GH 4GW1A 3LKSA 1K8IB 5IK3A 5F1OB 2BNUB 4MXWL 5E8PA 4XNXH 1U8HB 2PETA 1CFQB 5L2JB 4OKVA 1H3PL 3D39A 1ND0A 4FQCL 4Y4KD 4JDZA 1TTUA 4DOHB 4CN6A 3QCTH 5TQ2L 5KW9H 2BNQD 2RFXA 3QPXL 3FOMA 3G5XA 3FRUB 3GMMB 4Q2ZB 3Q0HA 4KJYB 4DFHA 4G7VH 2ED9A 4LVHC 3O45A 1R3HB 1JK8A 2F53B 4ZFZA 2CLRA 4N0UB 1ZLVK 4HKXA 1WCQA 1Y6NR 1I4FB 3KHOA 4HJJL 1HXMB 1X7QB 3OXSB 3H7BA 5EUOE 4F58H 2APXA 2WINA 4TUJA 5BVJA 2MCPH 3AM8A 1HILB 5AUMB 1HH9B 1QSFD 1AGBA 3PHOB 5FGRA 3W0WB 2ITDA 1JNNL 1D5IL 3LV3B 3MZTA 2F74A 32C2B 4DZ8A 2R0WL 2YPLD 2Z31A 1BGXH 1RK0B 3WSQL 5IMMA 1T22A 1WQVT 5DJZA 5C3TA 3FQXA 3GIZH 4KROC 2YPVL 2V7HA 3FRPA 1EEYA 2Y07L 2OR7A 1ZHLB 3VW3L 3FO1B 1NAMA 2CK2A 4R9HA 4HS3B 4LRNH 4NO5B 5EOTB 3V5DA 3PXJA 1RZIA 4RZCB 3D0VA 2DTSA 4JQVC 1NCBH 1YECH 3EOBA 4JY6A 1NLDH 3BPOB 2GAZB 1AGDB 1OAQL 4J3XA 5F93C 3K4ZA 5GRUH 3TV3L 4BZ2L 5DJ6A 4DKEH 1T6WA 2ILLA 2CIIA 4KVNL 2VIRB 1FIGH 4XCYB 1D9KA 4QXGH 1Z5LA 4YNYB 5T1KD 1KLUB 4L9DA 3RKPA 4Z8FH 3MFGB 1AO7E 4XP9L 1P6FA 3ZO0A 3U7WH 1UQSA 3O9WD 1EV2E 1DVFD 4IMKC 3EJYC 4JDVA 3WFCH 2BJML 1HNGA 4ZS7H 4K55A 4WI2A 1OOAA 3QFJD 4RA3A 1EGJL 2OL3L 1B0RB 1MFBH 3RWEB 3O45B 1WK0A 4UBDC 2YD1A 4UOW0 1VGEH 4WFFD 4WI3A 1J0YA 3EYSL 5BW7C 2N56A 4ODSL 4MJ5A 2G60L 1A2YB 2P5EE 4FTVB 1IC5L 3OB0K 5FGBA 1TTGA 3ARBB 4JKMA 1I3VA 5AUMA 1BECA 4JR9H 1T0NB 1ULVA 4OZ4A 3M17A 3E2HC 4P5TD 4YXHH 1YEDB 1UVQA 3RTQD 4MNGE 1BVLB 1JGEB 5E4EC 1UJ3A 3O9WB 4OCXL 1ZWIA 4Y19E 1ED3A 4WTXA 1PKQA 3RWGA 3ZLQC 3RZCA 1NKOA 1T22B 1ORQB 1S7VB 1NBYA 3MRMA 4X6CA 3DPBA 3E2HB 3V4UH 1UB5A 4XX1E 4OFYA 5IFHL 3EO0B 4NWTL 3FO1A 5GS0H 1G7MA 1XR9A 1RZIB 4RZCA 5EU5A 3VXPB 3LKRB 2BNQE 3THMH 1YMMD 3PWLA 3O3EA 1ACYH 4ZOCA 3UTSE 1T7ZA 1NC4D 2B8OT 1FNGB 5D8JH 4PG2A 1EAPA 3GJEA 2VLJB 1KTKE 4PLKC 5D5MB 5CP7B 1S7RA 4YDLB 2DBLH 2G60H 4C56A 1U8KB 2ESVB 3VXQB 5EU6A 4RISL 2NLJA 5E6IC 1AFVH 5I1HH 3I3BA 2Q20A 2FEDD 3CPLB 1XZ0A 3GFUA 4P46D 4QOKE 1BPVA 1VFBA 5EO1B 4RNRB 4OLWH 4LEOA 4APQD 3ECBA 4WFFE 1CFBA 4NZDA 2L0DA 4TSCL 2VL5A 4BUHA 5I16A 2P48B 3KR3L 5BJTA 1CD9B 1WZ1H 1FP5A 5DSCA 2BVOB 1S78D 3BD3A 4MB3A 1LK2A 5C8JA 4LEXH 3MLVL 4Y88A 2VH5L 4F15B 5F70A 2I27N 1CS6A 1PFCA 3PNWA 2SEBA 4DKEL 3UBXA 1Q0YH 3LS5H 5EZIL 5HJ3B 2HT3C 1O7VA 1B88A 4OF5A 1R24B 3QIUC 3ARBA 5FO9A 1JNNH 2ESVD 2VXUH 5J12C 4MNHA 4TUOA 3S37X 5AD0A 2XA3A 3B2UC 4ONHB 2JB5H 3A67L 4KHTH 2DQEH 1VEOA 1BQLH 5CHNB 4MZ2A 3PGDB 5DYOA 4NKQB 1UB5B 2V9TA 3WDHA 1Y6MR 1CTNA 2P5EA 1LO4H 2DWEA 2R0ZH 4PJ5E 5DJYB 1WFTA 3MJ7A 4F7TB 1RZKH 4D3CL 1XF1A 2R29H 4IRSC 1BF8A 5ICZA 4AENA 2E27H 5D9SB 2X4SA 3QPQD 2HWZH 3F7QA 2VXQH 3IETA 3KHQA 1FNAA 1XCQA 2OTWB 2BX5A 3DVGB 3REWA 2R8SH 1IZKA 4I13B 4RNRA 1CBVL 3VXTB 2DLEA 4JFQA 5FIEA 9CGTA 4PJ9C 4JN1L 4PTUB 4X6FA 4ZQKA 3BUTA 4GKSA 2C3HA 5I16B 5DUBB 3RTQA 2DQTH 3VFNB 5J3HD 1CU4H 2X9YA 3AY4C 5EC2B 5AYUH 3K2MC 25C8H 1LO5B 4U1NA 4Z76B 2BOCB 4AEFA 1U2CA 4HV8B 1U42A 3MREA 4XVJL 3KPLA 1P5VA 3TT3H 1L0XA 4R96B 3HHRB 2JLLA 5I8EA 5MEND 3DX8B 2VDML 3KPOA 3UJJL 3NMEA 1AO7B 1TETH 2FBOJ 2XZQH 2WM0A 1SBSL 5KS9E 5HJ3A 4G42B 1V5JA 3UC0H 4M62L 1R24A 3LEVH 4Z77A 1RJLA 2YK1L 1H5BC 1NBZB 4XBGB 3NABH 3WLWD 3MRNB 4PRAB 2HKFL 2IAMB 5JW5A 4GG8A 4MNHB 3AREA 1IGJA 2VISB 1M4KA 4M03A 4YHIA 4G9DA 4RFOL 3QEHB 3RVUD 1PZUB 3G04B 5ILTL 5D7LB 2DB8A 4ELMB 1LP9F 3KYMB 4H1LG 1HYSD 3LPFA 4O02L 1A3RL 1P6AB 2G9HB 3RRQA 1EGJA 1XR8A 3D1MC 2NY6C 4M43L 4ONFH 4AMKH 4A6YL 2P5EB 2ZJSL 1OAKH 5IR1A 4HUXA 1EBPA 2CPCA 3O4LE 3MR9B 1JF5A 2OP4H 4WFHE 2X89D 3OR7A 2ZUSA 4FZ8H 4GSDH 5ADOH 1LQSR 1RJCA 1S5IH 3HZYB 1Q9LB 3IU4L 3MRIB 4K3EH 4TSBL 5CZVH 2GQHA 5I1JH 1F4HA 4XT1C 1RVFL 5I17B 2XRAL 4FQ2L 2YD6A 4N8VB 1GGBL 1MJ8L 5DQ9B 2VDKL 4ETQA 1G6RL 1MJ7H 3GHEH 5GRWA 1C5BH 2Y06L 2APTA 3U79A 4WEMB 2MCPL 4Y4HD 3QUXC 3GMQA 2ICEA 4WI9A 4LSSL 4R4FH 3O6LH 1T2QL 3PF2A 4M02A 4J4PC 1RUAH 1SQ2N 4XZUA 5C71A 4XNQB 4OD3H 2PO6D 4XWOC 1KB5L 3Q3GB 1AQDB 3FONA 1I1YA 3MRGB 1XCTB 3TZVD 1ZANH 1RUQL 4NC1E 3OZ9L 4FZ8L 5HHOA 4M93B 2FJGB 3MO1B 3GI8H 3IAGC 1G7QA 3BO8A 5EDXA 3S5LB 5E6IA 3VGAC 1KXQE 3PQYA 2VXVL 4U1LB 1BIHA 2M1KA 4DGIH 3ARFC 4G6KL 1SEQL 2ICWA 1FZJA 3S35H 1SBSH 5M95B 3WKML 3WEXA 1IGIL 1P9MC 1R3KB 3QXTA 4LSRL 1I8KA 2YEZA 4PJIE 5T3XL 4U0RC 4C4KO 2F5AH 2R69L 3P11L 4P9HC 1JZ4A 4ONGL 3QUZD 3RWJA 3FT4A 4G3YH 4YFDB 1EHNA 4UDTB 2HMIC 4J3SA 3PGFH 3L3IB 2BSTB 3MUGB 4JZJA 1U8PA 4LHQB 5I30L 5CP3A 5E8OB 3T65B 5DVMA 2ADGB 1NH6A 5FYKL 4LL9A 1GC1C 3QZWA 4ZYKB 1YPZF 4I48B 3BVNB 1J8HD 2O26U 4QRSA 4MJ6B 4ZAKD 4PRBB 4NQVA 5L88L 1FL5A 5DMKA 5EU7E 3SCMB 4MA7H 3T2PA 4BH7B 2VDQH 2HN7B 3VH8A 4OZIE 2OJEA 3Q5OA 3DHJA 3OKNB 4PRPD 1A6VL 2OXHA 1DQTA 3S3PA 5E9DD 5A2LH 1FJ1A 1MI5B 4Y5XA 2RB8A 3K81A 2GT9B 4U3CA 1N8ZA 3QYCA 1DVFC 2AQ2A 3LB6D 3CSYB 2BSSB 1NBQA 3GB7A 2R2BA 3VD3A 1XCTA 4CU7A 5IVZA 1SBBA 5L0QC 1DN2A 4NNPH 4KK9C 1UM5H 2VITA 2PYEB 4L4TD 2A77H 3MA7B 4L4TA 5LWYL 5ESAA 5C6PB 3ZTJG 2X1PA 1S7XA 2A83B 3ZDXF 3T0DA 5JNYA 5EU3B 5J57B 2DQDL 3ZYJA 5IMOA 1CT8A 2NY4D 5EU4A 3T1WA 2V17L 4CW1A 1XIWC 1NGWB 2LV4A 4JKPH 4UTAH 5I1CL 1GGTA 3U6RB 3BWUC 1C5CL 2CK0L 3GMOA 2PR4H 4N90D 4LCWD 4EVNA 2QSCH 4XCFL 1UH3A 2EE6A 1J8HA 5A16A 3EGSA 3B5TA 2DQFA 3ARUA 3EOAA 5T5FH 2WBJD 2XTJB 4X5WA 3G5ZB 3IDGA 5CJXC 5EB9A 4P3WA 1CDBA 2GCYB 3RGVB 1FYTB 4AL8H 4NQVB 1MPAH 4PJ5A 1JPGA 4Z95H 4QWWD 5EZLA 3KR3H 3WFHA 1KCSL 3CFCH 3S36H 4LNRB 5DJ2B 4OB5L 4PJGE 1NAMH 4WU5A 3U83A 1GGIH 5DD6A 3NACL 3Q5YA 3X17A 1YJDH 3QUYB 2JCCB 4PJEA 5FYLE 1HYSC 4WO4A 3QDMD 2OJZL 3C9NB 4ZFFA 5D93C 3FB7A 1U58A 1SYSB 5FO8A 4XPAL 3IF1A 4CVXA 1DBML 3L1OH 1ZT1A 4PY8I 1WCBB 4D9RD 2E3VA 1G7PB 4DKDC 5E2UH 3UAJC 2A6KB 4BH8A 3KLSA 4M00A 1KEML 1NMBH 4HK3N 4OQTH 3WUWA 1Q0XH 5KVEL 4P59L 4JKLA 3WD5L 5IBUG 1INQA 3QIWC 3O8XC 5DWUH 3ZL4H 1ZHNB 1QFWI 1F97A 3EFDH 3QIUD 3VMOA 1NGWA 1AXSB 1D6VL 2W0PA 1NMCC 3SOBH 5DD3H 4DGYH 1QSED 4FQXD 4JLRA 3SKNB 2AW2A 5GSRA 4WWID 1JPST 5DHYB 4S1DC 3O8XA 3U1SL 5KZCD 5EPMB 3VMNA 4HFWB 2MPAL 2AJYH 3NTCL 3L5IA 4WNQB 1G7LA 1XGRB 2OTPA 2P49B 5D72H 5IVXB 5JPMB 2AXFA 1K5NA 4IOFC 5EN2A 5I1EL 2N7AA 2R2EA 1FN4B 1B0WA 1NKRA 4JREC 4L4VA 5I9QC 1KJ2A 3ULVC 2R0KH 2APBA 1MWAL 1QLEH 2XKNB 3VFVB 3HAEH 2YWZA 2VAJA 4J3VA 4N0FB 4OZHF 3WD5H 2AK4E 4KKCC 5L2KD 1IEHA 2ESVE 1H5BB 1DBAL 2ZP0T 4LLWB 3T2NH 4RMWA 3BKJL 3R06A 4HUWB 1RJYB 1N0XL 3ARFD 4JRYD 2MKWA 4NJ9H 3LH2H 1S7UA 4WO4B 2PTTA 4ZG1A 3T2QA 3DUSA 2HFFA 3REVA 3C5ZD 5HY9B 3I50H 5GRUL 2A6JB 4CVXB 1ACZA 5FYLL 5K9OA 3DHMA 3VG0H 5ADPL 3T0EC 5AG8A 3U0WL 1PG7H 5EC1B 2J6EH 1RZGA 4LPXA 3Q1SL 4PJCA 5CAYB 1VKXB 1KG0A 3ZDYF 4LVOB 2YD4A 4I18B 2NY7H 3S4SA 2FATL 5DQDL 3FAXA 4HG4K 4IIQB 4F33B 5DJ0B 4D2NA 2X42A 3C87A 4ERSH 2FJFA 3VWJB 4PLJD 2FO4A 5FUZL 4L8BB 5F9OL 1NDGA 2VKXA 4PJ8C 3SGJC 4M7ZB 5IWLC 3NFPB 3NAAH 3HNVL 5J06A 5ESQB 3VFWB 4UIMB 3GSXB 2EXYD 4K3HA 1F3RB 2ATPB 4FA8A 3QAZB 5F7MC 4WNQA 2AEPH 4AQ1B 4AEHH 1U91B 4KRNA 5I1CH 3BPOC 5JPMA 2B1AL 3VXNA 4BQ8A 5I1KL 4XMKH 5EN2B 1FNSL 3BQUB 3GSQA 4PLOB 4UT6L 4QRRA 3KPNB 4M93C 1KJ2B 1T1XB 2HT4C 1I3GL 2YMXL 2ZOLA 4MXWH 3G6JA 1S9WA 3CFJB 4UNVA 43CAA 3DXAE 2IANA 4HFUH 4QNPE 3KWWB 2QADD 1IAOB 2VLLA 4EJ1C 3OR6A 2XNAA 1JWMA 4OJFH 1K4DB 1K8DB 4H26B 3NTCH 3LRHA 3QXAB 4OCYH 1SY6H 2I9TB 5HYJE 4Y2DB 3RY6C 5GS2D 3QDGA 4KUZH 1PZ5A 4MA8L 2VKWA 1FRGH 2A6JA 3NZHL 4U4BA 4Y2DC 4ZDHB 3K2UL 2HVJA 2ZCKL 1LDSA 1BQHG 2VLKE 3L3HA 2VDOH 2BDNH 2X4TA 4ODWA 3BRFA 4PJCB 5GS0D 4ZUUB 1VKXA 2AJXL 2AXHA 4PG9B 5C0JA 3H3KA 1PVHA 4UT9L 1NC2B 3HG1E 4D9RE 3D85D 1BMGA 1OD9A 2W65B 4IMKA 2FJFB 4QRUA 3VWJA 4DZBA 3STLB 4KDTA 1BIIA 4MNQE 5DTFA 1ES0B 2VN7A 3QJHA 2DRUA 4HX1B 2M26A 4UT9H 5E1AB 2OX5A 1FV1A 4YHML 4JEGB 1J1OH 4HUUA 5I1IH 1I3RA 3I6KA 5HHVH 5IF0A 1JWSB 2NQCA 1OY3B 1QUNA 1OAZL 1E4XH 3P0VL 2XWBA 4OI7A 3MRFA 5L88H 4OLZL 1GOHA 4KK8D 5HHQB 2AEIT 2OR9L 1U92B 2RJMA 1EHLH 2GHWB 1D5BA 4HMCA 3HRPA 3BQUA 3GSQB 4P2OC 4Q9BA 3C6LA 4QRPB 5C09D 4OCLC 5F1IB 3SBWA 4Z95L 4JPWH 1N64H 4KDVA 5JDSA 4JO3H 3DYPA 4XVSL 3CFKB 5D1ZC 5B21A 1JNHA 4P2OB 3EJYD 4WRLA 2VABB 4UINH 4ZD3H 1JE6A 2YMXH 4IMLB 3ZT7A 5DJXB 3GIVA 2VXTH 4G6MH 1CFNB 2I25N 4LMQE 3OHXA 1BAFH 5H35B 2XZAH 2NY2D 3WIHA 1DBBH 5FUCC 4YDJA 4UINL 4ZD3L 3FQUB 1JZ2A 5L6YL 1Q9WB 1TMCB 3VWKA 1NCDL 2HVJB 1KBGL 4APQA 5IIEB 4PGCA 5F3HA 3QDJA 2V17H 5C6WH 4P23A 1BAFL 1MWAA 4PJDE 3MOQA 1A7BA 3RI5F 5E95B 3V0WH 3D39B 5C70A 5J3HC 3BPCA 1WWCA 4S0TD 2ZUTA 4HJ0D 5CLTA 5E0QA 5D7JB 2GTWB 2BRQA 1HSBB 2AK1H 4UQ3A 2AABL 3RP1A 1REIA 5TF0A 1BVKB 5D2NA 2P24B 2NW2B 4D0DA 5I15H 5GHWH 3RL1A 3DRTA 2YXMA 1IAKA 4P5MB 4MS8D 2BERA 2ENSA 3VFOB 2ZUYA 3DLQR 2A1WH 5I74C 1L0YA 4PLKD 5HHMB 1YPZE 3MOBL 5IQ7H 1FG2B 3NGBC 1HXMA 1MSPA 3GJFB 4LCWB 3QA3A 5ADOL 2FD6H 4X6BA 4RFEB 2B4CH 4J23A 4IRZL 2UV3A 5I8CA 2K1MA 4LP4A 1T1YA 3KG5A 3ZTNL 32C2A 4M43H 4HWUA 4L8CB 4H5SA 2Y5EA 1FLRL 1OAXL 1TETL 3FJTA 1RU9H 2DQGL 3T0EB 4R7NA 5DJAA 5F72S 4HH9A 4UTBL 1T3FB 3WUWG 1MHPH 3CCHA 3LMJL 4HS3A 2EDRA 3OGCA 4PJGA 1FVDB 5C1MB 3EYSH 3CLFH 1M6OA 4GQ9L 4UI2A 1HZHL 4HC1H 1MCOH 2EDXA 4L1HA 5GGQH 2NY1D 5BQ7A 5JW3H 5DD1L 1WVZA 3U46A 1TNMA 2APFA 4TSAH 4EBQL 1WZMA 3K8KA 4V1DA 4ZTPH 2VYRE 5FKAA 4Y5YC 1QQDB 3BE1L 1KLUA 3RJQB 3WNNA 4XVJH 3DO7B 3AMLA 4WJ5B 1FFQA 4J8RA 4MCZB 1KUMA 3BSZL 2ICES 4NZTL 1H8SA 3QDHA 3BESR 1A0QH 1SY6A 4D9QE 1ZA6B 2PTUA 4WUKL 2NCMA 3CUPB 1VERA 4UBDD 1HEZA 1BZ9A 4Q6IB 4FMKA 5D1QA 4F8QA 3HNSH 1JHLH 1QO3A 1AGFA 1RJZA 2UWEE 3HNVH 3H9SA 1UA6L 2HJLA 1T4KA 5CSZB 8FABB 4N0RA 1WZLA 3VFOA 1MCSA 4POZC 1QLFB 1FORL 4ZO6A 1M05A 3LKOB 1FNEB 4FG6D 7CGTA 1FG2A 4GKOA 4MJ5B 3RUGE 5E5MB 4XXCC 1GGCH 3ARED 3TT1L 1S7QB 4J3UA 1MVUB 3NOIA 4K3JL 1TJIL 1G7HB 2PYFB 1PG7W 3AAZB 4W4OA 5DEGA 1JUFB 1B2WH 1GH7A 2BCKB 2PW1B 3A6CH 4XXDB 5MHSE 1UVQB 3OKKB 4P9HL 5HHMD 2QR0A 3TBVB 5TFSH 3WV0A 5I1DA 3SEPA 4NRXA 1NEZB 1FL3B 4RMUA 4OIIL 4JFFD 2GJ6D 3HG1A 5BV7C 4ZMAT 5GRYA 4NKOA 5MERA 5FB8B 3IJYA 1QRNB 1MHHB 4ENED 3LQAH 2UY6A 2BC4B 1DVFA 1KB9K 4YJZL 1BP3B 4M7ZC 3I6GB 4HZLB 2CKBL 4KJQD 3CFDB 4Y89A 2QHRL 4MJIA 1OPGH 2VLJA 5D5MA 3BD5A 5GGRY 2UWEF 5KOMC 4IBLT 3N85H 4XVUD 3V5KA 4PB9L 5EU6B 4OM0H 3TBTA 4L29A 2J8UB 3KXFE 1OGTB 5GZNC 5IB2A 2NTFA 5HYQB 4JHAH 4ZXBD 3RAJL 4Z7UF 4H25A 5F21B 2DQJH 5IHLB 3ARZA 4EI6A 4G80B 4C55A 3U30C 4NQDD 3PIQB 1CZ8H 4UAOB 2WWMC 1I9RL 2VMFA 4NQEB 2MPAH 4PP1C 5F6HI 1WWBX 3QI9B 1BD2E 2BY2A 4XNZC 4F9PC 4Q6IA 1KB9J 3RI5K 4LIQL 5T1DH 4JZOB 4HEPG 4PRNA 2Q86B 3T0BA 3WIHL 1OLZA 1NEZG 1P84J 4PJ7B 3L3GB 1HHHB 4JQIL 1IEAA 3F7RA 4N8PA 5IBLC 1AKJB 4U1IB 1JPSH 2R4SL 2P5ED 4X5XB 1BBDH 1PW3A 2YC1A 3VWKD 2DQIL 5KS9F 2VB5A 3GSVA 5FV1L 5EORH 1F8TL 1YEEH 3FZUD 3MRHB 1G7HA 5BMFH 1U8MA 1Q9OB 1T89A 1F4WL 3D5OF 1BFOA 3CDYA 4GKZA 2IALA 1JUFA 1EHAA 2D0HA 2DLFH 3LSOA 4NC0B 4P2RE 5LKNA 2ENYA 1S7RB 5I8KL 5AD0B 3QXWA 3SDDB 2IH1B 2P5WB 1TCMA 5HVFB 2FNBA 1KCVH 4NYLB 4H88L 4QRRE 1ZLSL 3CPLA 2CO6B 3QWOB 2ZG3A 2R9HC 2BP3A 4IDLA 1LMKA 5SWZA 3GRWL 4NKOB 5MERB 4FQHB 5HVHC 4KHXH 3L9RB 5I8KH 2GW5A 3QEUA 1CD1A 4F9LA 5JIIA 4IDJL 3MACL 3PWVB 3DURB 2VL5B 3VRJB 3AFLA 4D9QD 2D31B 3NBNA 4KRPD 3KNBB 4WU7B 1RZJL 5C08B 4YDIL 2ADFL 3MLTB 5BJTB 3QO1B 3OAUH 2VZ3A 1KCSH 3B5GA 4GUPA 2DQEL 4GXUM 1UFUA 5FYKD 3U7WL 3QUXB 4CVUA 1X5GA 3L95B 4QY8A 1P2CA 4Z0XA 1I8MB 1OP3K 4V1DD 3HMWH 4JFDE 3EYQD 5TFSL 3RVVC 5DR5L 3DVGA 2E6QA 1LO3L 4QXWA 1A6TB 4OGZA 2HTKC 4YE4H 4RAVA 2JJSC 1GGIL 5DRXA 5DK0B 3DXAB 2JJVA 3C60A 4U1KB 4HKJB 4L3EE 1JIBA 3QI9A 3NGBB 3B83A 1RUKH 1HSAB 5HHME 2Q6WA 4MJIE 1HN1A 2CXGA 4YFLI 3OL2A 1HHJB 4HCRL 4MX7B 4E42B 4BK5A 4CDGC 3BPNB 1NGZB 5BZDB 2NPLX 1EIBA 4BK4A 3IXTA 2KDGA 3ZHLA 4TVPD 4AH2A 3GKZA 4G8GE 4RSVA 1KXTB 1KJMB 4I9WD 5CEYB 2X9WA 3SDDA 3DSNA 1BQSA 3IS0X 1ZEAL 1B4JL 3CZFB 4S1DD 5D7JC 5FXCH 4FQIH 1A64A 2V9RA 3BZEB 3IDXL 4Y5VB 1OTTD 1G6RH 1MJ7L 3FTGA 3CFBA 5C0CE 3PDOB 1JZ3A 4M7LH 3QEUB 5BV7B 1TXKA 4P4KB 1KIPB 3TBWB 5DUBA 4UIKH 1YEIL 1A4KB 2LE9A 2Q8BH 3VWJD 3W0WD 3SO5A 1KSRA 1WEJH 4GOSA 3TC9A 5TF1L 4Y4FD 4JY4A 5I17A 4KY1H 4MD5A 4P4KC 4YHMH 3GHBH 2HLAB 5HHPA 1FCCA 1T04B 1C08A 4OD2B 3C5SA 2EH8H 2NY4C 5HD8C 1HHIB 1K6QH 2CIKB 5INDA 3QH3B 4RAVB 2AV7A 4QT5B 4WUUB 4M1DH 5DK0A 1AC0A 4K7PL 1BBJA 2X4PA 1ZV5A 4IM8A 3K0WA 4W6YB 4XNQA 4NC1C 2EDWA 1YY9C 1EFXA 1KIRB 5E08L 3UTSD 4XMLL 4YHIB 5C08D 3V6ZA 4JQIH 4OD1H 1LEIB 3QDGE 4AY0A 1EGJH 1UACH 1MHPL 3ZSSA 4ELMA 2DM2A 1BX2A 1T0PB 5L2KB 3OB8A 3NCEB 1J0ZA 1EFQA 4KXZI 1NJ9B 4NO0D 4JFEE 1S9KC 1NAKL 2KH2B 4HUVA 5E5RB 3I2CH 1MCOL 1ODAA 3RX8A 5E08H 3SDDD 4RGNB 4DKAA 2EEAA 4EQ3A 1FIGL 5GGSA 4KRMB 1ZANL 4ODTH 4S11A 3TYGH 5HSFA 3H3PL 4M1GH 1VFAA 3S88H 1T6VN 4FTVD 3WIFA 3Q6GH 4NN6B 3HC3L 4OAWA 5I2IA 2F9BT 3RWCA 1OSPH 1YEHH 2Z31C 3MLUL 3ZKNC 4Z78B 2YUWA 3EJZC 2AEPL 3F6IA 3MUGA 5T1MA 1NGQH 1LO2L 1KIPA 4GRLA 5CZXC 3R8QA 1UC6A 1XEDA 2BK8A 4QOKA 2R29L 3QIUB 1NDMA 3QJFB 5E8NB 2X4RB 5HHOE 5C09A 4ZYKA 3E6HA 3OJMB 3QI9D 1I1YB 3VXUB 3NAAL 5IB1A 2AJVL 5HHPB 3MRGA 1MFEH 4Y19D 5TDOA 1ZLVH 3FB8B 3SCMA 4LVOC 4ELKA 2P43B 5DMIL 2Q8AL 5D1ZB 1ZA3A 3QH3A 5IP4A 3VH8B 4CMHB 2DDQH 2CD0A 4LPWA 3VFPB 2AV7B 3BO8B 3SJVB 3G6AA 5E6IB 4XPBL 4NUGH 1CWVA 1MIEH 3GSWB 3WXWH 5CGYD 1FO0B 2Y06H 3TIEA 1A7PH 3U2SA 4KI5D 4CL7A 2H32A 1UKTA 5F6IB 1BFSA 2RR3A 1JHTB 4G6JH 3GB7B 4OLYL 1MF2L 2HH0L 1RHHA 3VFSA 3IRZA 4G6ML 2GJ6E 5CD3A 2W0KA 1F4XH 1RURH 2AQ1A 5E1HB 5ESAB 2G2RB 5GGVY 4JCLA 3WFBH 1ZK9A 4G5ZH 2YK1H 4YXKH 4PJ9B 3RWHA 1K4CA 4U1HA 5F7FA 5L8LB 4LGPB 1QVOA 3DX7A 3KYAA 4JJHA 4XBEL 4K2UL 3QNZA 1FVCA 4Q6YA 4I48A 2OMNA 5HDQL 1N4XL 4LRIC 4PRBA 1AIFA 1WAAF 4UAOC 2YD2A 3RY4A 4OZHB 3QWQB 3DVNA 1DL7L 3HI1B 5DS8A 2AXJA 1DR9A 1MLBA 1OAZH 1H0DB 4FQXA 2OJEB 4L9LC 3PV7A 3FFDA 1ITBB 1FSKC 3NZHH 2CMRH 5GGTA 3LMJH 3VFRA 3GZKA 4M6AA 4NO0A 3RBSA 4JY5H 4X5WB 4DTGL 1Z2KA 5F71A 2X4RA 1TVDA 2GT9A 5IKCA 4HGMA 3N50A 1SM3H 3CLEL 2WIIB 1N8ZB 2GJZB 2JE8A 1M1SA 4H1LA 1FCGA 2GCYA 1E6OL 4WFGE 5GZOD 5CD5C 3I9GH 5DD3L 4Z7VE 1S5HB 3O3BA 1FC1A 5IROA 1ZLUH 4FXGA 5D1ZA 4HIXL 4K7PH 3EUUA 3BH9B 4K07A 3IJHA 3HLAB 1YNLL 3LKQA 2ZUQC 4NPYB 2P8MB 1YEIH 4RDQF 4MAYB 5HYJD 4Z7WE 2HVKB 1KCUH 3RWDA 4J6RH 2B1HL 4O58L 4LARH 4X7TA 2IPKB 5HVHB 2ZUVA 4NKDA 1A1OA 1SHMA 4HBCL 4L3CB 1ZT1B 5IGXH 2APVA 5CD3B 1UB6B 5I66A 1FNFA 2NXYB 5DK2B 2BY1A 3B3IB 4Z7UB 4WY7H 1OLLA 1ZSDB 1KYOJ 1MRCH 5LJYH 4X7CC 2JCCF 1Q9KB 3PDDA 5JIHA 1DQQB 1KN2L 1ZHNA 1Y18A 3HR5B 3TNMA 3AC0A 2UWEB 4XC1H 1FVCB 2DN7A 2FL5A 3BKCH 1B4JH 3JV6B 1AIFB 4EIGB 1ZT4B 5FGCE 5LGHL 2HRPH 3V8OA 3BH8B 4DUWA 2D7PA 4FQXC 2QSVA 4JDTH 1MLBB 5TGBA 1NFDF 3MODH 2ARJQ 4U31A 4LSTH 4PBXA 1JI2A 3O4LD 1VESA 4MXQC 2DLGA 2BMKB 4MQ7A 4F7EB 3VGAB 2F19L 2OZ4H 3CVIH 5H94B 4LLVB 3SDXB 1N0XH 4OFPA 3P0YH 4HHAB 3C9NA 4NRZB 4ZFFB 3W81A 3WFEH 4OZFA 4MAYD 5FO8B 4NHCL 5CJOL 1F3DH 1RUPH 3CC5A 4IOIB 4N0FA 5GZOC 4YQXL 2KL6A 5JMRA 1FPTL 3RVWC 3ZE2E 3SE4C 3V8CA 5HYSB 1YEGL 2ED8A 2P8MA 3K74B 3PWPE 4OLUL 5E8DL 4D94A 4X9FA 5C6TL 4HUWA 1FGVH 4M5ZL 5J13B 1AXTL 2HVKA 3IDMA 4HC1L 4M48H 3WLWC 3IDYC 1JV5A 4PREB 5IFHH 4JFEB 2PTTB 4XH2A 2DJ4A 1UM5L 1HH6B 3FN9A 2JJTC 2NR6C 5F7LB 4APQC 2EIBA 2FIRT 3TA3B 1N3NB 5GSRB 4PJXE 4A6YH 1NLBL 3D6GA 4RCAA 1CIUA 4MCYB 5IV2B 1A9BB 3TA3C 4HFWA 5IESL 1ZMYA 5SV4A 2YUVA 1G7LB 1RHFA 5ICYA 1FG9C 2EZ0C 3SE3A 3TNMB 43C9A 3ULUF 2VDLL 5F96H 4TQEL 1I7TB 4PJAF 1AD9A 5L0QB 1NDGB 4XNZB 1MQKH 3QWRA 3WO4C 1BD2A 2J4WH 1YYMH 4YDLC 5HYSG 3HE7C 1WC7B 2P1YA 2H2SC 3MV8E 2DL2A 4JGJA 4XPAH 2UY7A 3HC0A 3IT8D 3L5JA 2WZPD 3OJ2C 1C16A 4YBLB 4OJFL 1XMWA 3DYMA 2HT4D 4YXLH 2H2PD 4D8PB 4YPGA 1N6QH 1JI1A 1A6PA 2AJYL 5FDYA 1PY4A 5C08E 4FFZH 1JGDA 4PRHA 5SWSA 4OZGE 3MRKA 4LDEB 3P30H 4PG2C 3TV3H 2A9NH 4JHWL 3T1FB 3L7FA 2V2XA 1U3JA 5J89A 5T3XE 4PRIB 3QQ4A 4N68A 3IXAA 1K8DA 4JG0H 5D2LF 3L1OL 3INUL 1WTLA 5GRZA 4NJAH 3TH4T 2O61B 5DJ0A 4DVBA 5A2IH 2OJZH 3CFIC 3ARPA 2Q8BL 1JWUA 4M6NH 1J0KA 1CGWA 3TF7C 5F88B 2R0ZL 3OPZH 1WTGT 4NNXB 1J18A 4F7MB 1N3NA 1DFBH 2Q7YA 4HIHB 4AEEA 3OX8B 4NNYA 1MCWM 1JMZA 3HPLA 2NR6D 1U8QB 5HI3D 5ITBH 4JFZH 2GJ6A 3HG1D 3LD8B 3EO9H 1P7KA 1LVEA 2BOBB 3QUYC 1CLZL 1XT5A 3BAEH 3MROA 4LVEA 2W9DL 1VFMA 1MY7A 4N90E 1U95B 3VU2A 1AGCA 1QLRB 1QR1B 5IBTH 1S3KH 4I3SL 1MUJA 3I50L 2IPUG 1CQKA 1JYNA 3CFCL 4HUUB 3PWPD 5IF0B 3CZJA 4NCDA 1IAOA 2VLLB 2I07A 4ZSOA 3IGAB 4YHZH 1KBGH 1RFDH 4HWZA 3DMMA 3L3OB 1RIUL 5TH2B 4C54A 3T0XA 5KJRL 1CXLA 1EEZB 4YPGB 1CVRA 1E6OH 3L3KB 5H2BB 1PZ5B 4QYOB 2CKNA 3BIKB 4AT6A 3BN9C 2XTJC 4LK4A 3HUJE 5SWSB 5JQ6H 2R0KL 4U33A 2FECI 3T3PE 3MNVB 3VJ6B 1QFWM 4Y2OA 3CD4A 4XB7A 3FT3B 1OAUH 1S78C 1CFVH 3I75B 4HK0B 4YK4B 5C0GA 3SDYH 5DRZB 3RWFB 3U30B 4GG6E 3LPGA 3WHE1 4QXUL 4JAMB 3PV6B 2X1WL 3PP4H 4UILH 3TFKD 3MA9H 4MDIB 2O61A 2JJUA 3MUZ1 4MVBD 5HVGB 4RAUB 2GUOA 4C56E 1IQWL 1ES0A 1N7MH 1F4YH 1XF3A 1JGVL 4FABL 4RGOH 2C7UB 5EO0A 1KT2A 1L0QA 1T21A 4PJAB 4RRPA 4U1MA 3P9LB 2V5RA 4APQB 2X70B 3FO2B 3KDMB 4G5ZL 2C3VB 1A9EA 3P2TA 1JWSA 3BWAA 5F9AC 4KMLB 2YA0A 3PWPB 4X83A 3U36A 2X10A 3V2AR 5IEKA 2NY6B 5EA0H 5K9QI 2EDQA 4PTTB 3QHZH 1WF5A 5GGRA 3QXDB 2EH8L 4HC1A 4MAYC 2AI0H 1HQRA 1TQCB 3WO4B 4YWGL 4KQ3H 4QHUB 4DUVA 3HZVB 4M1CC 3JXAA 2IPTL 1TITA 4K3GA 4C83A 5A3IC 5LBSL 1G9NH 4OFKA 1CFNA 2DWDB 4XVUC 4P3DB 4LCWA 3DMMD 4QHNA 4U7SA 5I8OL 2X5PA 3MUHL 4P2QB 3MGTA 1PKQE 1AR1D 1J9CT 3ARBD 3SQOL 5D7LE 4WDIB 1BQHB 4TTDD 2NXYC 4XP9H 1A3LH 2VZOA 5JIKA 2X7LA 2C1PB 3SDXF 3FB6B 4HFUL 2DQCL 2J6EL 3BDXA 2YN5A 3GHEL 4RMRA 1F6LL 1P84K 3J7HA 4ZSOE 3LEYH 3MLRL 2QL1A 1TPXB 4Q0XL 2F5AL 3O2VH 5DJAB 3TH2T 3BEWA 4Y5YB 3BPCB 2E8ZA 1IGCL 5IW1A 2A6IA 2AV1A 1K2DA 4LLUB 1DSFH 3DX6A 3IU4H 3VI4F 4BQBA 3LKNB 1Y0LB 4K3DL 3LEYL 3FFCB 5KSUB 3HN3A 1C5CH 1F2QA 1BVKA 3DRTB 4O02H 5T1LB 3LRSB 4XC1L 4MD4A 1HIMH 3E6FA 3BXNB 1CCZA 3STZA 4OGYL 4XCNB 1T03L 3LB6C 3SE8H 1IAIH 5BVPH 5I1EH 1JMXA 4ISVB 2EYSA 3QXDA 4LFHG 4L3ED 4KKBD 4ERSL 4OD3L 2E6PA 4K3JH 4Z5RB 2UYLA 4QTHA 5HHVL 1RD6A 3BP5A 5EZOH 4WV1C 3LY6A 1UJ3C 4ZFOB 5CUSL 1JZ7A 3TLRA 3WLBA 4LGSB 4QHUA 4X9HA 3RNKA 1W2KT 4CBPA 4WV1B 4OIAA 1U8NB 1FNEA 4M3KB 5FYJD 4ZFGL 3H8NA 2XFXB 3CCHB 1WSST 4G8GD 4MHHI 3O11B 5DT1L 2ARJB 5CMAB 1G0XA 3V95A 4YHOH 4JFED 2PYFA 3BIBX 4U2YA 5C2BL 5JLZB 1FNHA 3QPXH 5I1GL 3BT2H 1CXEA 1VADA 3NFNB 2CRZA 5JHDB 5BQ7B 3JV5A 3LDBC 2BCKA 2PW1A 3BKJH 4ONFL 1G7IB 4BSJA 5F1KC 4ZXBB 3V6BR 1NAKH 5FA3A 3O4LA 3UJJH 4NRXB 3HZMB 1QKZL 5HI4C 4MCZA 4JDZB 1RK1A 5H37G 3RPIB 2WBWB 3DX6B 2NY5H 4Y19A 4CDHA 4RMTA 3CUPA 2R0LH 1DL7H 3TP4A 1S9YB 5EFIB 3UTTE 4YO0A 4Q2ZA 2VNCA 4K9EH 5T1DL 4P46A 5LCVH 2Y5TA 3MRRA 5AZEH 4OCRH 5ENWA 3VA6A 4UQ2B 3BW9A 1E6JL 3KPRD 2OR8A 1QNZH 1I4FA 4ZS6D 4H25B 3DIFA 1C5DA 2EO1A 1VEMA 2A9MH 4XCNA 5HYEA 2GY5A 4ZAKB 4MNQD 1DBJH 4NQEA 3ZKQD 4AEIH 3IU3B 3U9UB 1I3GH 3UPAA 2FEEI 3BP4A 1T5XA 1E27A 1RZ7H 2ITDB 3MX0A 4PB9H 4PJHE 5TDPB 4I3SH 1QSFE 4C58B 1U3YA 5CGTA 1IKFH 2UVFA 2L7UA 4UU9B 2MMXA 4QTIH 5L2JA 3G5YA 4JO2H 3L5HA 3ARGC 1LE9A 3GMLB 4JPKH 3EFFB 4NFDA 4ODUA 3E1F1 4NO5A 2OSLB 2WUBL 3D0VB 1EVTC 3S35X 5IMKB 3G5XB 4JY6B 1UXSB 5DMIH 4ZOAA 2Q8AH 1BGXL 5C0BD 2JJTA 3O4OC 4FFYL 5FO7A 3RUGF 1JRHI 1T89C 2Y72A 2R0WH 5C0CB 2F8OA 5HYJB 1MJ8H 5DJ6B 1JK8B 1D9KB 5DJDB 1EZVX 4L29B 1TZIA 4MJID 5DQDH 3BI9X 4EI6B 4KUCF 3ARFA 5F9WB 5BRZB 2HYMA 4EZMA 4GKNB 3BRGC 1WGOA 1XGPB 3IRPX 1F6AB 2XACC 1OSPL 2B1HH 1DFBL 1I1AD 1AGBB 1EEUA 5D2LE 1J5OL 1LEKA 1VPOH 3TN0B 3GRWH 4OZIA 4PJ7A 1S7SA 2VUYA 4OIBA 4HBQA 1UZ8A 1HHHA 4A6YB 4UQ2A 3E0GA 3BEVA 4LLQA 4QY8B 3FQXB 1AKJA 3IKCA 4X5XA 4F37F 3MOAH 1OCWH 5GJSH 3EYQC 3RVVD 4P2RA 5JHDD 1A2YA 3LKPB 1N2RA 4NHUB 4X4ME 1J0HA 4TULL 3EYFA 2X2YA 4YK4C 3MLWL 1A1NB 3MYJB 4KTEL 1WIPA 4EOWL 4K71C 4HIJB 5I75B 5IHUH 3UX9B 3MNWB 1UJ3B 2GK0B 4HAFA 1JTTA 3W39A 1Z5LB 1YNKH 3G5YB 5IFAH 1AE6L 1NGZA 4XNYL 4XNUH 2IF7A 1U8IA 4FQJL 4ZO7A 1I3UA 1IJ9A 1WWWX 3UPCA 1G7MB 3E8UL 4HWBL 3ZL4L 1P7QB 4HWEH 3DURA 4M1DL 3VRJA 2WV3A 1UQSB 3O3EB 2KKQA 5D7JD 4QF1B 3QO0A 2YD5A 4YXKL 1B0GA 1B0RA 5ESVA 3ULSB 2AEQH 4EI5D 1OT1A 4OSUL 2BNRB 2Z8SA 3UYPA 2IQAB 3LIZH 3GSRB 5JUEH 1CL7H 5SX4I 1DQML 3FFCD 4LAQH 3C2AL 4XPHH 4JFHD 4M5ZH 4R4BA 4GG6A 5CINH 2PXYD 4X9GA 1NAML 4MVBC 4PJBA 3MRPA 4ODBD 3SO3C 3VGGA 4FQIL 4OZFH 2HJFB 1U2HA 3VWJC 3S36L 2HTLC 5FK9A 1OM3L 4F80A 5B3JE 3MNZB 4QKXB 4A6YA 4ALAL 1FZOB 3WHXA 1NBYB 2XZCH 4X6CB 1E4WL 4PRHE 1PEZA 2ZUXA 4HF5H 3SGEI 1QACA 5C6TH 4QRQB 4ONGH 6FABH 2PO6A 1S9XA 4HS6A 3TO2A 3MLXH 3U0TA 1HDMA 2ICWI 4WW2B 3H0TA 4HDIB 1IL1B 5F6IC 2Q3ZA 1LGVA 3HS0B 1XF4B 2QBWA 4PJ8B 4XNMB 3MODL 1IT9L 1UKSA 1EFXB 1KIRA 4BZ1H 4DGIL 5CEYA 3EKCA 4NDMA 1NGYB 2VH5H 3V6ZB 3QQ3B 4JPIA 4F57L 1WJ3A 1CLOL 3CIQA 3PL6C 3O2DL 2Z91B 1IC7L 5ITFA 5JHDE 2EXWC 5HPMA 1NCNA 1OGAB 4GRLD 1L7TL 4M3JA 1RZ7L 4LPTA 4TNVK 5ABDE 4I9WE 4MYWB 5FUZH 3LD8C 3FQRB 4LPVA 3OAZK 3QO0B 4ACPA 1N6QL 3ARDC 1EHXA 5JTWA 1KCLA 4CU8A 1EH9A 5GGSB 3SKJL 5ISZD 1TVBA 4MWFB 4L3EA 4WGVB 1DUYA 3D87B 4KK8C 4CMMA 1XCQB 3QB7C 4ZTOL 5HHNA 3Q1SH 3REWB 1EHLL 1HHIA 2LTQC 1P4LB 1OP5K 3EO1A 2NX5D 4JFQB 5JW3L 4R4BB 3U7YL 1G9NL 4ZQKB 2CDFA 2L7JA 3X13A 5IVXF 4NM4H 3N1GC 1U8LA 3VFNA 1D6VH 3T8XA 2GTZA 1UXWB 1I1RA 1LEIA 2R23A 5KAQG 4Z7VF 3UTZB 1A7RH 2FWOA 4OQTL 3T4AA 3DV4A 5DYOB 4E5XB 5EUOA 1OT2A 1RUMH 5I19L 1KIQB 2G75A 2H3NB 2Z93B 1Q72H 4MNGB 5E2VL 3SJVA 2RBLA 2E9JA 5CFHA 5I30H 5L8KB 2CMRL 4JFOA 4F7TA 5JA8B 5EO9B 3L7EB 4QGTA 3UZQA 4UIKL 4ENEC 3K2UH 1U93B 3HPJA 3QUMB 5KVMC 4NQEE 1JZ8A 2XI9A 2Q1EA 3HB3D 3O0RH 2EYTB 1NCAL 4I4WA 2FB4L 5C09E 4W6WB 2DLHA 3WNKA 3A67H 4LBEA 5I0DA 4I3RL 4PTUA 2E8YA 1KTDA 5FHBH 1NCDH 3D85A 3OR7B 4QOKB 5CBEA 2R39A 4U1HB 1VGKB 3RVXC 2OBGA 3T0WA 4OM0L 4PJ7E 5DJCA 3TO4B 1YQVH 5HGBB 4DQOL 4TOYH 4N8VA 5CCKH 3U4EB 3N1PC 3AXLA 3EDKA 2LU4A 4RBPK 5TE6H 3MV11 4Y8DC 2VWEE 1AO7A 1Z6JT 1ETZA 1CLOH 1RSFA 3C2SA 3IDNB 4QHLB 1GZQB 3PJSA 4NKIH 5I15L 1M7XA 3RY6A 4Z77B 3MBEC 3QFJB 4JM2F 1CLYL 3MJ9L 3UO1H 3PGCA 2ZUUA 5FCSH 3QCVL 5BZWB 5T3ZD 3QIBC 5IEHA 5JZ7D 1LO4L 2Z92A 5DF0A 2DAVA 3RX5A 4K9EC 5D7LA 5C2UB 3BYYA 3MRCB 3VFSB 1S5HA 3O3BB 3NCMA 2UUDH 4O2FB 1E4XL 3P0VH 4NN5C 1KIQA 2G75B 2Z93A 3H9ZA 5CZVL 3BFOA 3S5LA 2BXZA 3ARWA 3M1BB 1OM3H 2NY1C 2YR3A 2EE3A 1RAMA 5D8JL 1EO8H 4A2MA 2FJHB 2IC2A 1R3KA 2VZVA 1D9KC 3JZ7A 5F9DC 5DHVB 1INEH 3MRLA 4XWGL 4FQ1L 5KSBA 3UO1L 4P2RD 4UDTA 5DUMH 4KZDH 3AVEA 4Y16D 3L5WA 4DGVH 4FQXB 1FYTE 1CFTA 3B3IA 3TN0C 5KW9L 2E6JA 2D7MA 3QIWB 4MAUH 1KFAH 5F6HJ 4GRMB 2ED7A 1MAKA 2YPKB 3SDCC 4YX2H 3Q6GL 2MSPA 3G9VA 2V2WB 3QZWB 4ODXA 4KUCD 5BXFA 2WIIA 3MJ8B 5CWSA 2FL5B 1XGYH 3FOLB 3GUTA 3WXVL 2A0LC 1LE5B 3ULUC 3MO1A 5LWYH 1F4AA 4MD0A 3BH9A 2ITCA 3MRJA 4XAWL 3QRGL 3EAKA 5IB4A 4HKZB 1FJ1B 4ZS7L 2ICWJ 5A1AA 1JN6B 1AHWA 1X5YA 1D3CA 5E00B 4HJ0C 4MA1C 4LCYA 1KN4L 5ACZB 3KPMB 4JRXA 2D03L 2X4QA 4RGNE 2GSGA 3QG7L 4O2FA 2H1PH 5F1SA 3T3MF 2X4OB 3B8YA 2X4UA 3TESA 3WJJA 1JVKA 5JNYB 1EERB 3UROR 3QZWG 5I71C 1MF2H 4ELME 3NZ8B 1FYTD 1CT8B 1Q9KA 3AM8C 5D1XA 4F3FA 3HR5A 1A7RL 1CICC 1KJ2L 3EOTL 4FP8H 3MQIA 5IM7B 1ORSB 3WDJA 1QYGL 1T2XA 3MRDB 4J1UA 5GQBA 1M7DA 3GM8A 5DRNA 5E6YA 3O8XD 5DMGC 2FECL 4KHTL 1AY1H 2IPUK 3TA3A 1OQOA 4GAGH 2VXSH 2ADIB 4HCRA 5BS0D 2FIKB 3QPQC 1FL6A 4M48L 2PW2A 4I18C 4HT1L 1BZ7B 4L8DB 4E41B 3EGSB 1OWWA 2BMKA 1NQBA 1BFTA 1RIVL 1UJTA 3D3VA 1TJIH 2EZ0D 2BSSA 4PJCE 2R1YB 5IBLD 3VCLB 3BJ91 5IVZB 2IADA 3QBTB 5KSBF 2CUIA 4LFHD 1JGUH 4U0QB 1C7TA 1PG7L 3DNKA 3VFMB 3G6DH 4HW6A 1IKFL 4WU5B 5FFLA 5T5FL 5HYSA 1UWEH 12E8L 4HJGA 4RQQA 4JFFE 4M7LT 4G6FD 4D0CA 2VERN 3TJHD 4PR5A 3O2DH 3KPPB 1DCLA 5TE4H 1A47A 4QHMA 3NABL 3LN5B 3VGBA 2X1QA 4PRPB 4N1HB 1IGFL 5E8EA 2W9LA 5CEXB 1C1EL 3BKCL 5CSGA 1LP9B 4X4XA 3JV4B 1FDLL 3DRQA 4EN3A 3QQ9D 3SCMD 1QFOA 1A22B 5FOJA 1ZVSA 4H0GA 5GGQL 1M71A 2A2QT 1XGUA 3EYOB 4N8CH 3C2AH 1MQKL 4RX4A 3SOBL 1AXIB 5I1JL 3RGHA 1Z9LA 3DROA 1GOFA 4XVTL 1AXSA 2DMKA 4E41D 2P8PB 3CDGA 5GIRA 2W0LA 2Q76B 3I6LD 3N1QC 4V2BA 5HI3C 2AGJH 1P9MA 5LGJA 4V2CB 3KPSA 1UADC 2CUHA 3O8XB 1Q38A 3O41A 3GK8L 4OBRA 4XRCA 3RKDC 4S2SA 1N5AB 2HT3D 4P49A 1X5IA 2VSCA 5CEZE 1XGRA 2NW3A 3MGOB 1DP0A 5E2TL 2VSDA 4RWYH 1E28A 4DN3H 4HMDA 5IOPB 1MHCA 4LHUB 4L4VB 3MRKB 3LQZA 1U8JA 4PJAE 1CF8H 1QPXA 5JMOC 1RZJC 4P99A 2VR9A 3F7VA 2IANE 4J7RA 5EORL 1CGVA 2ATKA 4NQCE 1OF2B 4UV4L 2DQIH 1KENH 1NANH 2W91A 4U6XB 2D2OA 1DQJA 4G8IB 3UTPE 1VACB 2J5LC 1H3TA 4P2CG 3KJ4C 2NY5C 4JO1H 3REVB 5B3JF 1F02I 2MJWA 3LN5A 5BO1H 5DC0A 4NFBA 4JVUA 5HY9A 2FBJL 5HTSA 4Z7WA 1C12B 2D7TH 4ONOA 1UWXK 4L9LA 4HIHA 3DRQB 4LNVA 3FT3A 4YIQA 4MQTB 2CRYA 5EIQA 1IBGL 3GGWA 3B9KA 4BKLA 3EDJA 3BDBA 1JYXA 3VXME 4Y4FC 3RAJH 4IIQA 4F33A 3E3QC 4WI6A 2AXFB 4JZJC 1TZGH 1Q94A 1RUKL 12E8H 2WP3T 3RDTC 3BIAX 2HH0H 1FN4A 3BP6A 2Q76A 3RWIA 2C7UA 5EO0B 5LQBH 5AWNH 2XKNA 1TNNA 2P45B 2QSCL 4XCFH 4XPTL 3ULUH 2EE2A 2HT2C 2HG5B 1FIEA 5AYQA 1H5BA 4G43A 5D7LD 2I07B 1VSCA 1A14H 2YOCA 3ZKMC 3QT2A 4HWZB 1D5XB 2JB6B 2R9HD 3X14B 4IOFD 1RIHL 2Y4SA 1S7UB 4WI8A 5CBAA 5IMLA 1O5DT 3IDIB 1U3HD 2IAMD 3ES6B 2MKLC 3MGOA 3S6CA 3ULUL 4NT6A 1GZPA 3BIKA 2MCG1 4IIQC 3S37L 4X6DF 2DTMH