4BUHA

Human ige against the major allergen bet v 1 - crystal structure of clone m0418 scfv
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
252
structure length
237
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSEYSFPNYWIAWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGQVNISADKSSRTAFLEWSSLKASDSATYFCARLGGQLWNSYYYYYYMDVWGKGTTVTVSSGYELTQPPSASGTPGQRVTISCSGSSSNIGGNTVNWYQQVPGTAPRLLIYKNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCEAWDGGLRGGVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CLONE M0418 SCFV
publication title Human Ige Against the Major Allergen Bet V 1 - Defining an Epitope with Limited Cross-Reactivity between Different Pr-10 Family Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 237
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA01
1JPSL 1XZ0B 2MQCA 4MXQD 4JFZL 2AEQL 5F7MC 3REVA 4YFEA 2K9UA 2PYFA 3BGMB 1XH3A 1PLGH 3T08A 5B39A 4WEBL 4UNVA 3QPQC 1BFOA 4X83A 5F93C 5ESAA 3PUCA 1HI6A 3IKKA 5KJRL 5EOCL 2APVA 4KDTC 1W8NA 3D85D 4F9LC 2VZUA 4OZHB 1TJIL 3G5VA 3C5ZC 5CEYA 2XZAH 1S7TA 4WWKA 3TESA 3BUYB 3TBTB 5IQ9A 1UWXK 3AS3A 2H2PD 1Q9LA 3VRLE 2NY6B 2Q8AL 1TETH 3T3ME 4OKVA 5CEZD 5DJ2B 1FG2A 2PW1A 2VDOL 5LKNA 5F9WB 2IALA 3MRGB 3OJDA 4MVBD 3P9WB 4YHZH 5HHPB 1FBIL 2DMKA 4XVSH 4CJ1A 1SYSA 3AY4A 2BVTA 5HTSA 1KCLA 1KC5L 3TBWB 3PQYD 2R0LH 2BMKB 2C9AA 1KJMB 3BRFA 1I7TA 3LVEA 4Z7NF 4PJGA 1A7PH 1Q72L 2F74A 2IMNA 4NHUB 2EE6A 1UYWL 4WHTB 3WXWH 4X8JA 3VXUD 1RUPH 3BKJL 4MD4B 4MAYD 1P5VA 4BK5A 3AS2A 1OPGH 3BIKA 3FAWA 1DQQA 1PX4A 4MJID 2CUIA 2EIZA 2A83B 1LVEA 3QJFA 5EFIA 5I1LA 4OJFL 5CD5C 4U1JA 3UC0H 3IDXL 4J3SA 5HGGS 2EDBA 4GRLD 3V5KB 1VFAB 4DGYL 2ICEB 1JI2A 1LP9E 4PJBA 3UTZB 5HSFA 3VFNB 2VDKH 4LSUH 2Y06L 3FMGH 3S9DB 5C09E 3V7AG 3FO1B 5KS9E 4YAQA 3GIVB 4FP8H 1YPZA 1MJJA 3EIFA 3PJSB 5ANMB 2AV1B 3VMPA 3FKUS 1MI5D 3FQXA 3ZE1E 4ZSOA 2P5WB 2NTFB 4JAMA 4LCCA 1V3JA 4XMPH 1LE9A 5JO5A 4NO3B 3TV3L 1S9WB 3TA3D 4F7TA 2BNQB 2QQKL 3N1PC 3INUH 1HILA 3GNMH 3BD5A 5C3LD 3MRQB 4O02L 1QLEL 2JIXD 4GRMB 3Q0HA 4XB8A 3ZL4L 3KPNB 4NM4H 4LQ1A 4XPFL 2JCCA 1O7VA 1YDPA 3P73B 3UZEA 1A22B 3BPNB 2RFXA 5J6HA 5BS0B 3VH8G 1EH9A 3P9LA 3LN4A 4LPTA 3B9VA 4YBQC 2BRRL 2HFFA 1FZKA 4K94C 5E8NB 3IU3B 4EOWL 4KZEH 1Q9WB 3S88L 4KI5C 5FYKD 1NC2D 3LEXA 3CX2A 2RCSL 3BPOC 3C08H 1FNSL 3QDGA 4C56A 1OAUL 5F8RC 5A2FA 2BY2A 5KVEL 1HSAA 3D0LB 3SDAB 1TPXB 4JO4L 4F58H 4X4YB 4TRPH 3TFKD 3JV0A 3P4NA 4UMGA 2IH1A 3ZO0A 3C5JB 3BQUC 4XRCB 3CFBB 4X7SH 5DJ0A 2V2WB 1FVEA 1DEEA 1QHOA 4N90E 4TPRL 3EYOB 3OXSA 4PRPA 1FFRA 4D8PB 2Z31D 3GMNB 2ZJSL 1FIGH 3EFDL 3B5GA 2EXWC 3SQOH 1DVFC 3PDGA 5GRUH 1P69B 3GJFB 3FN0H 1UB6B 3RDTA 3X11A 5ADOH 6FABH 3MBED 3NCCB 4LCUA 5JMOC 5I8OH 2X9WA 3NZHL 3P9MA 1C5BL 3L5HA 3UJJL 3BRGC 3MLZL 4MGXA 5C0AB 1W8OA 1F3JA 5JHDA 2BCKA 4CKVX 1J87A 1P6FA 4RFEB 4OCYH 3HMXA 4Q9QH 1X5YA 3C6LA 5I9QC 1BBDH 1BFTA 2EYTB 2YC1A 3REWA 4CDHA 5IB2A 1E4XH 3G6JA 4WTZG 1WVZA 4KMQA 5HHVH 1HINH 5FIEA 4K23H 3VDBA 4PRNA 1A6ZA 3ULSB 2FSEB 4YHML 1XZ0A 2CXKA 5C8JB 1NCTA 1FGNH 3BGMA 1WQVT 5FCSH 4XXDB 1YEKH 5A1AA 4JZJC 1DQLH 2P4AB 2R1XB 1V5JA 1HWHB 1HZHL 5BMFH 3NCFB 4XNMB 5JA8B 4OZHA 1N6QL 2E7MA 5GS2D 1D6EB 3JWDH 1U8KB 4QNPE 4MXVE 1D5XB 5EOQH 3S37X 3BUYA 4UOW1 3TBTA 4NWUL 3RX8A 3MSPA 4GSDL 1RULH 4WGWB 2DS4A 3MUHL 4RMSA 5F7WC 3MRFB 1B88A 5DJ2A 3VWJD 5IB4B 4P4KD 1PDKA 3MRGA 5SX5H 1MJ8L 3GSVB 3ARGB 4L8BB 4X6BB 4OLXH 5K93A 4PR5B 1KCVL 5HHPA 5D1QC 1ZLUK 1DN0B 3QIBB 2YD2A 3OB0K 4WVRA 4R7NB 5TJWK 4PJXB 3TNMB 4P48A 3TBWA 2W1NA 2BMKA 2A77H 1KJMA 4FTVB 2NY0D 3EJZD 1U95B 4NHUA 1K4CB 3RVXC 1G0DA 4UI2A 4WHTA 2VZTA 2CLZB 2X9YA 4HWEH 4MD4A 5D7JC 4X5LA 1U41A 5BZWB 4H0IA 2XTJB 2A83A 4H0HB 5HDBE 1RAMA 4ZUSB 4OCNC 4DGIH 1FVDB 2H8PB 4YFLI 3PP4H 3QDAA 1SBSH 3MXWL 3V5KA 4PV8B 1VFAA 4ODXB 4QYOB 3RIFK 2ICEA 4ZFZB 5E24E 3HC0B 3UTZA 4XVUD 2YPKB 3VFNA 1I75A 1RJZB 5GGQH 3BKCL 1NQBA 3MTRA 1J12A 1J5OL 1RZFH 5F7EL 3FO1A 3SGDH 3GIVA 1JPTL 3LKSB 1MCPH 4YBLB 5C70A 5I8KL 4Z9KB 3IRPX 1EUTA 3QULB 4NQXB 4TVPE 3PJSA 2AV1A 4IIQC 1M7XA 4JO2H 5ELIA 5C6TL 2D0HA 2P5WA 1CQKA 3JV6B 2NTFA 3CFCH 3PWNB 4I2XE 4NO3A 3DTXB 4J12A 5MEOB 1S9WA 2HWZL 4FQXD 1RUAL 2XRAH 4IEFB 2BNQA 3U6RB 2I5YH 5I74B 2F53D 1DSFL 3MRQA 3T0EE 4LSPH 5ITBH 4GRMA 2AJUH 4OM0L 4ZODA 1XT5A 1QRNE 3T2QA 4JFHD 3KPNA 3SDCC 3P73A 5D1ZB 1CXIA 5BS0A 4YHKL 1HHGB 1T03H 3ESVF 4P2OB 3TYGH 2V5TA 4P3WA 1NBVH 4JY5H 4XB7A 1AJ7H 5E8NA 1JGVH 3IU3A 2D4DA 5AYUH 1Q9WA 3F65A 4WHYG 5I30L 1JIBA 1Y0LB 2XKNB 4HIIB 3VFUB 1J10A 1UXWB 3BZFB 3D85B 3IAGC 4NRYB 3D0LA 3T09A 4NZUL 3SDAA 4X4YA 1RVFL 1KLUB 3Q1SL 2AJZB 3C5JA 4XRCA 5BRZD 3CFBA 4JPVH 2V2WA 2X1XR 4U1GB 4I0PD 3EYOA 5KVDL 4D8PA 4NCC2 3GMNA 1IFHL 3EYFB 5I1GL 3ZKND 1FSKB 1QFUL 3BRDA 3OGOE 2FB4H 4BK4A 2B4CH 3GJFA 5GJSL 4GFTB 4QXTB 1NANI 1S7RB 1CICA 2ESVA 1ONQB 1I8LC 1UB6A 4FG6D 4C83B 1WUNT 3T04D 2IGFL 4JO1H 5H2BB 3D6GA 4O9HL 3GO1L 3K4AA 3QCUH 5C0AA 2W9DH 3PQYB 1MRDL 4TQEL 1F5WA 4RFEA 1CDCA 3HR5B 4OIBA 1AC6A 5HI3D 1SBBA 2GJJA 2EYTA 4OD2B 4OD1H 4PJCE 5EO1B 1NL0H 5D7KD 2BOCB 4AYFA 4MAYB 1CD9B 1A5FL 3EZJB 4BQBA 4MJIB 1IGFL 1A1NB 5MI0C 4PG9B 4PJEE 1UACH 3BGFB 1ZLWK 1H0DB 3ULSA 2FSEA 4EQ2A 4FFZL 4AK1A 5C8JA 1PKOA 4P3DB 2IJ0C 1BIHA 4XXDA 4GRLB 2NY3C 5BXFB 4WUUD 5ILTL 2R1XA 1KGCE 5IVXE 5FYLE 5GQBA 3ALPA 4U33A 4Z5RB 5CJ5A 1FLRL 3AGVA 3V2AR 2FL5B 5TQ0H 3LKPB 4XNMA 2DF3A 1Q9KB 2A0LC 2XA8H 1D6EA 4KMLB 3G9AB 4Z7VF 1U8KA 3QI9B 3QCVL 4HK0B 1A1OB 4NN5B 3RVTD 1UKQA 1D5XA 1T6WA 1U36A 3QNZB 4RWYH 3CMOL 4P2YA 2VDPL 1JHLH 3GKWH 3B6SB 3TA3B 3MRFA 2RQ8A 1ZS8B 2F5BL 1V3LA 1HCFX 1T6VN 3MCLH 1PG7X 5L9DH 3GSVA 4KRMB 1TTGA 3ARGA 4L8BA 4W6YB 2QQNL 4X6BA 3VXSE 4HUWB 4PR5A 1DN0A 3KPSD 3QIBA 1OAQL 2FGWH 1DL7L 2ZUWA 3I6LD 5B38G 1F4YH 3TNMA 5F7DB 5GS1B 4KKBD 2HMID 4RX4D 2WUCL 3GMRB 4IOIB 4PJAF 1CD8A 1QPXA 4L4TB 4FTVA 5DD1H 3A6BH 1K4CA 4LSSH 3OF6A 1I1AC 1NC2B 2VXQH 3WIIL 2CLZA 5HHMD 4YXLH 4TUOB 5J12C 1U8MB 1TJGL 1ZE3C 5BZWA 4ONGL 5L88L 1BAFL 3G9VA 4D94A 1FDLL 1DZBA 4GRWE 4ZUSA 1RFDH 4M6ML 3UTTE 3QHZH 1FPTH 1L7IL 1FVDA 2H8PA 1DQJB 4PJ9D 3MACH 4K94L 4G6JL 4JQXA 4ODXA 3CPLB 4IRSD 4PV8A 1INQB 4QYOA 1UH3A 1I85C 3HC0A 4J4PA 4ZFZA 2NY7H 5TE4H 4BZ1L 2YPKA 4LLMA 2VDLL 1RJZA 5BV7C 1NUDA 2Z31B 1UT9A 2AJYH 2BVUA 2HFTA 3LKSA 4G42B 4FQ2H 4PRDB 5GRWA 3QULA 4NQXA 5F6IC 4WFHD 3VFGH 1VFOA 3DETD 4LVHB 2H2SD 2AQ3A 3JV6A 2NTSP 4KY1H 4MLIA 3MBEB 2RBLA 3T0XA 4HS3B 3PWNA 1RU9L 3DTXA 5KTEL 5MEOA 2BERA 3SJVE 3MV9E 1MHPL 3U6RA 2YUZA 3PWPE 3U30C 1N3NB 4KMTL 4KFZC 1HN1A 2GAZB 2E7BA 1CDGA 2CR6A 3U4AA 3N9GH 5D1ZA 3Q48A 1HHGA 4KKNA 3WUWG 4KK8C 4R26H 4UB0L 5T5FH 2NY1C 2XQBH 1GAFL 3B5TA 4HWBA 4NN7C 3LDBB 3MA9H 2VO5A 1BBJB 4DN3L 4G6KL 3MLUL 4LSVL 4APQC 5KW9L 3HI5H 1ADQH 3BN3B 1KYOJ 1Y0LA 4JN1H 4LIQE 2HFGH 2XKNA 2I27N 4HIIA 1MFEL 5MEQB 4IRZH 3VFUA 1AO7E 5HYEA 3SQBA 1UXWA 3BZFA 2IANE 3D85A 5SWZB 1ETZB 3DWTA 4ZS7H 4NRYA 3WO4C 3UBXG 5JUEH 7FABH 1D5BB 1KLUA 5D2LF 2AJZA 4UTBH 2PYED 3NFSH 3UTQB 4Z7WB 4NNPH 3QDJE 1OGTB 5DEZA 4NUJB 2RR3A 4P99A 1P7HL 4I3SH 3EYFA 5SWSE 1T0NB 2EKJA 3WYRA 4HXBH 2ERJC 4FFVD 1EMTL 2PKDA 3SO3C 4QXTA 1S7RA 4FQJL 1ONQA 2FNBA 3S3JA 4LEXH 4C83A 5T1MB 1Z3GL 5DQJB 2YPVL 5H2BA 2R1WB 3V8OA 3T0EC 3VXRE 3ZDZE 3PQYA 3HE7D 3OKMB 5IVZB 3EZ8A 4GMSL 3VGAC 2NY0B 3HR5A 5KANI 3B83A 4OD2A 2PR4H 5EO1A 1A2YB 1K8DB 5GRXG 2BOCA 3H9ZA 4MAYA 2B5IC 2QSCL 3K2MC 4GKOA 4MJIA 1A1NA 4PG9A 1H0DA 1XGYH 3LOWA 3RY6A 1G6VK 4KI5F 4P3DA 4PS4L 2WBJC 1ZHKB 4OGXL 2QADC 4GRLA 1AC0A 5BXFA 3HCVB 5J6GB 4ODWB 4RFOL 4Z5RA 2FL5A 3WS3A 3LKPA 1YNKH 4CVWA 1Q9KA 4KUZH 4Z7UE 3HC3L 1GH7A 2BX5A 2N56A 1I1YB 3NIGF 3QI9A 2JJTC 3R0NA 4ZOCA 4HK0A 1A1OA 3MLYL 1BQSA 1BFVL 3QNZA 5TF1L 3L5IA 1TITA 2P8PB 1ZT7B 3P4MB 2CIKB 3B6SA 4FQXB 4HC1A 3TA3A 1ZS8A 3MV8E 2BSTA 1A6UH 1IE5A 4XPTH 2EEBA 1PG7W 4MB4A 4QY8B 4XX1E 4HUWA 3QQ9C 2BNRD 5GGRY 1INDL 1NJ9A 2VLME 3RL2B 1T7VA 4UAOB 5F7DA 2XG5A 3N1FC 3O9WC 2ARJQ 3GMRA 4IOIA 4Z6AT 2IQ9L 4L4TA 5J11B 4N0RA 3SDXE 2OYPA 4P23C 1NC2A 2I9LB 4GQ9L 2R29H 4G3YL 4TUOA 3Q6GH 3NCEB 3HHRB 4DKDC 4AL8L 1OAZL 4K9EL 1FFNB 4F33B 4NPYB 3BVNB 4OZIB 4RBPH 1DQJA 3O8XC 4TSCH 3CPLA 1INQA 3NGBB 3DXAD 5JW4N 4I0PB 2AERT 3S37L 1WIOA 3WV0A 2Z31A 1F02I 5C0CB 4G42A 4YNYB 2IAMD 5ID1B 4PRDA 4KK6C 1ZLSH 5F7LB 3MRIB 3CDGB 3WNPA 1K6QH 2EYRB 3OAYK 4C55A 5CD3B 3MBEA 5C0RH 4UTAH 1I1FB 4HIJB 4HS3A 4PJ7F 3E1F1 1L9MA 5HD8C 4DN4L 4ZFGH 2G60H 4DZ8B 5AAMA 1NFDB 5H8DA 1N3NA 3QHFL 5FOBB 4M5ZL 1U93B 2YKLL 2XNAA 1U8JB 2JJWA 4OZFG 2VL5B 4ZXBD 5DJDB 3W11D 2IC2A 4YDKH 2ADFH 2EDEA 4Y16C 1EO8L 5CKGA 2CK0H 1FL3B 5E2VH 4N5UA 4P46C 2CO6B 3WD5L 4MZ2A 2Y4SA 3QEGL 3MX0A 4MDJB 1BBJA 4JKMA 3MGOB 1RUMH 3V4VL 2F58H 1YN6B 4WUUB 2R2HB 1MF2H 2FWOB 2ZZUT 1RURL 3CVIH 5D2NC 1GVIA 5JW3H 1ACYH 3MFFB 4NDMB 5BOZG 4JRWA 3CFJB 4PY8I 2DQDL 5SWZA 4L8CB 1ETZA 1ZV5A 2KUTA 2GCYA 3GSUB 4FZ8H 2B2XH 3C60D 4HCRL 1SY6A 4TTGA 3GUTB 5I1AB 1D5BA 1MFDH 1P9MC 4Z7WA 3UTQA 3WFCL 1OGTA 4WFGE 3DSNA 4NUJA 1SMOA 1AQKH 4YR6B 2YXMA 3FN3A 5EOCJ 4DAGL 1AGDB 4AY0A 1T0NA 4JRXB 2VZOA 1CFVL 4KROC 3T3PE 3KPSB 4PGCB 2ORBH 4P57A 4A6YB 1QBMH 4RISH 5T1MA 2E7HA 5DQJA 4XC1H 3D87B 2R1WA 1T83A 4X4ZA 5E9DE 1I3GL 4OSUH 4Y5VB 2VR5A 1Q0XH 1T4KB 4ORGB 1AE6L 3OKMA 5I1HH 5HHOE 3R8BB 5IVZA 1WT5C 5I73C 1EO5A 5D8JH 3E2HB 4YQXL 4LRIC 1XIWC 4R4ND 1OCWL 2ZCKL 1A2YA 1K8DA 5HHMB 3ZYZA 4K3EH 5CSZB 2PXYC 4Y5XB 3BYYA 2GHWB 3IETB 2D03H 2DQCL 3D3VE 3ARFC 2ZUTA 5C86A 2UWEE 2DMBA 4JJ5B 4PRHB 4UQ2B 3G6DH 4GUPB 2DTSA 15C8L 1RI8A 3RVVD 1ZHKA 4R97B 4PJ9B 3N06B 3HCVA 3KPOB 5J6GA 4OCSH 5E08L 4NFCA 3UJIH 4LSQL 3UYRH 4ODWA 2YRPA 4UOW0 1F6FB 1HIMH 1MWAL 3UDWA 4NGHL 5BV7H 1I1YA 4N5ED 4JPWL 1X6NA 5KS9F 2OK0H 4HKJB 4MQSB 2EZ0C 2P8PA 1ZT7A 3P4MA 2CIKA 1KBGL 4HWUA 4FQXA 4L9DA 4R4FH 5DO2C 3ZE1F 2NR6C 2IEPA 1WZ1H 4D3CH 4QY8A 5JIKA 4M3JA 5LCVH 5L2KD 2C7UB 4R2GD 4HFWB 2HH0L 4XX1G 1JBJA 5H35B 2NY4B 3MLTB 3RL2A 2C3HA 3TO4D 2PO6C 2DLFL 4J3WA 4L5FL 5DFTA 4N8CH 4OF0A 4XCEB 4EDWL 3O45B 2I9LA 2NX5E 4FFWD 3BE1L 3GSOB 2D7TH 3MLRH 5I8CB 1EA9C 1LO4L 4JM4H 4OCLC 1FFNA 4F33A 3OG4B 4NPYA 2NNAB 3BVNA 4OZIA 1P5UA 1A9EB 4QRPD 3RWIB 4LHUB 1A0QL 4I0PA 3VXMD 1JCKA 2W0FB 3HPLB 4U2YA 2ZP0T 4Y4KC 1F3RB 2O5YH 2P24B 3W0WB 4TYUA 4YNYA 5ID1A 1V3KA 5FHAH 4PJDB 3MRIA 1VPOL 1G7QB 3OX8B 4XCNB 2EYRA 3O6LL 5CD3A 1EBPA 1I1FA 4HIJA 1Y6MR 3RKDD 5GHWL 5EUOB 3EDDA 4DZ8A 5HDOA 2MWCA 1ZWIB 1NFDA 4ESKA 3CUPB 2WK2A 3HE7B 5FOBA 3VG0H 2P5ED 1U8JA 3GMMB 5FUCE 1OT1A 1E6OH 2VL5A 1KENH 3FO0H 5BW7A 1JRHI 2CGRL 5DJDA 1NAMB 4Y8AA 1JV5B 4JFYB 3VD3A 5JQHC 2VRAA 1J1XH 1FL3A 3MNVB 3V95A 4X6CE 1I7UB 1JL8A 4HGKC 3U1SL 4MDJA 4XC3H 3IU4L 5DRNB 3H42H 3W2DH 3MGOA 2VC2L 3FHAA 4NP4H 1YN6A 4WUUA 2R2HA 43C9B 3IDIB 5DVLA 2FWOA 4H26B 3MFFA 4PLKC 3WJJC 2X4QB 4NDMA 3CFJA 3GHEL 1F6AB 4EXPX 4L8CA 3GSUA 3DV6B 2P1YA 5DS8B 2VDRL 4K2UH 3UPAA 3GUTA 4WHDA 5I1AA 4BQ9A 3ARBC 5H94B 4HT1H 2YA1A 1M6OB 4YR6A 1KACB 4QNPF 1WAAE 2EH7L 4HIXH 4MXVF 1RJYB 3H3PH 3DGCR 2NY2D 3D39E 4JRXA 4UINL 5I66B 3RVWD 4OF7A 1QSFE 3KPSA 4FQHB 3NCJH 2A38A 4PGCA 4ZTPL 3RJQB 4A6YA 3QFDB 3RZCC 4W6XB 4QXWA 2BNRB 2WIMA 4MYWB 3V52L 2VSCA 3H3BC 2B8OT 1ZLUH 4Y5VA 1T4KA 4DKEH 4ORGA 4RX4A 3OB0H 1HYRC 1OQXA 2XZAL 3LS5H 4M43L 1LK3H 3F58L 1NCNA 5HVHB 1G9MH 1VDGA 1TETL 3KPQB 4EN3D 4PJHB 5EB9A 4KUCD 2VDQL 5CSZA 4Y5XA 3GSNL 5B3JF 5C7XH 3IETA 4I3RL 4X80H 4LARH 1KEML 5IJKA 2V2TB 1L7TH 5D7IE 4WW1A 4N68A 4D9RD 4JJ5A 4PRHA 4UQ2A 3O2DL 3BT2H 3T2OA 4GUPA 4XVSL 3NABL 4UT7L 5ISZB 4PG2A 4PJ9A 4NM8H 3KPOA 5A2JH 3DI2B 3DXAB 5HDBF 2AQ1A 4PB0L 1DBKH 1MCIA 2R8SH 1LK2B 5CGYD 5D5MF 5DTFB 4WTWA 4JKPH 1BECA 4WI7A 4FXKB 2DIJA 1IC7H 5DFVD 1C08B 4HKJA 3VXNB 3MMEB 3HMXH 4K3HA 4LAQL 2J6EH 2BNUB 3EJJX 4NZRH 3HE6D 2HKHH 4AMKL 3TJHC 3FAXA 4F9PC 4LSUL 4N0UE 2C7UA 3BXNB 4KRNA 4HFWA 3LEYH 1EEYB 4NQVB 5H35A 1IC5H 3MLTA 4ORZC 3L5WB 2R2BB 5FK9B 4X7TB 2P8MB 3FB7B 3SOBL 1WTGT 1I9RH 2H9GB 4XCEA 3O45A 2N1KA 2FIRT 2VLJB 4KH2A 5F3BB 5FO7B 3INUL 4G7VH 3GSOA 5I8CA 3B5HA 1B0GB 3MA7B 4C57C 4X6EB 2HT3D 3UP1A 1CR9H 2NNAA 4ZS6C 3S4SA 5BO1H 4OKDA 1A9EA 2APXA 4XBPB 5A2LH 3RWIA 4LHUA 1WFTA 3MBXL 1LDSA 1JZ7A 1JWSB 5IT2H 2W0FA 3HPLA 2OZ4H 2C3GA 2RHEA 3QWQB 4XPHL 3SKNB 3EDJA 4XNZC 1F42A 2P24A 4JPKL 3W0WA 2AK4E 1YEEH 2A6JB 3V6BR 1CD0A 3K8LA 2YRLA 4PJDA 3DHJA 3OX8A 1NC4D 2BSED 1UKTA 1NMCB 4XCNA 5E4EC 1ZHLB 3C09C 4TSAL 2GKIA 4OM1L 3QXUA 4OZFH 1M1SA 1SVZA 5EUOA 3CC5B 5JOFB 1C7SA 2WQ8A 1ZWIA 4F58L 1NAKH 3CUPA 3HE7A 5L7XH 2COQA 5EU6D 3GMMA 5JW4Q 3HMWH 2EC9T 5IESH 1F4WL 3MLXL 5A2KH 4P9HH 1INEH 1GGIH 1NAMA 1JV5A 4JFYA 3BFOA 5LXGH 1QSEE 3MNVA 4UDTB 3MLWL 5E2WH 1I7UA 2BHZA 3H9SD 5GRUL 2FX7L 1FV1B 4X4MA 2GTWB 4PJCF 5DRNA 3PWUB 1A7BA 2JJVA 1FAIL 2OBGA 4OGYL 5DLMH 4M61B 1AKJD 2DQTH 1D9KD 43C9A 2OJEB 5I8OL 4OV5B 4PJEF 3IDIA 2X7LB 3ULVH 4H26A 1T20B 2X4QA 3SKMB 3S34H 4PBWD 1F6AA 1W72B 4JFFB 4OCYL 4QHLB 2R0ZL 2F54D 3DV6A 5DS8A 3HAEB 3LN9A 4NT6B 2X6MA 5DRXB 4XI5D 4EZMA 2ZPKL 5DR5L 5H94A 2EC9U 4S1RH 2J8UB 3RIFF 2BHYA 3IJYB 4Z77B 3FRPA 4KKCC 5HHVL 3ZHLA 4CRPA 1HINL 1M6OA 2EDYA 4K23L 1UC6A 3HI1B 4YK4B 1CXHA 4JFOB 5IJVB 1RJYA 3GIZL 3MRCB 5SX4H 2VISB 1G6RH 2Z0BA 4FABL 5DRWB 4CMHB 2VERN 5I66A 2KDGA 1JGUH 3QFDA 3KNBB 4PP1D 2BNRA 2CMRH 2KZ1B 1G1CA 1J7VR 4KJQD 1MIEL 3TO4B 1ZOXA 5FUCC 3RTQD 1YEIL 5AUMB 1NDMB 1U3JA 2F9BT 2H26B 3KPQA 4NRZB 3FFDB 4PJHA 3PXHA 5ICXA 3KXFB 5F21B 1N2RB 4LP4A 1EFQA 4O5LH 2V2TA 3V6OA 4BUGA 1KTRL 1YMME 2ZOKB 3QYCA 4UV4H 5ISZA 5IVOA 4HKXB 4QRPB 1WWBX 2R56H 5I15H 3DXAA 4GRWF 3T0DA 3E8UH 4CJ0A 3S36X 1VEMA 4WUKH 1LK2A 5IHUH 1UENA 1DFBL 2QL1A 4D0BB 4NRXB 5HYSG 1A4KB 5CHNB 4LGRB 5DK3A 1OY3B 3RJDA 1C08A 1TQCB 3VXNA 3MMEA 4TSBH 1NEZB 3FOLB 3SPVB 2EDRA 1AD9B 4C4KT 5GS0C 2BNUA 1RUQH 1QBLH 2XI9A 3AMKA 2DL9A 3E3QE 5D7SH 1ZLVH 5GZOD 5IIEB 4EI6B 3BGAA 3PP4L 5DXWA 2AP2A 3VGHA 3RAJH 1UM5L 3EW3B 4KQ3L 5D7LD 1H15B 25C8L 3ARED 4B7LA 4PJGE 4HFUH 5LWYL 3BXNA 4LFHG 1J8HE 1HKLH 5E1HB 1CK0L 5FUOH 1EEYA 4BFIB 2Q3ZA 4NQVA 2A6IB 2IF7A 2MJWA 4UDUB 5C0BB 1PX3A 4KJWC 3L5WA 3DMMD 2R2BA 3NFPB 4KHTL 5FK9A 4X7TA 1UB5B 3C2AH 2J5LB 2P8MA 3VW3L 3FB7A 3CLFL 3SCMC 4N9OB 3QG7H 4Q0XH 1J0IA 3CFCL 2H9GA 1X4ZA 3S7GA 1BP3B 3UX9B 3MYJB 1T2XA 2VLJA 5F3BA 2ITDB 4PJBE 5FO7A 4Y4HB 1CFNB 5IG7B 5ITBL 1T5XB 5KN5B 1B0GA 3MA7A 3CDFA 4X6EA 3C60A 4YE4H 3KLHC 1T7YA 5BCAA 1YPZE 1GYAA 1VERA 4M7LT 1YEGL 1T03L 4YXKL 3QUMB 4OBSA 2Q87A 2A9ML 3CXHJ 5T3ZH 1JWSA 4DTGL 4HPYL 1DEDA 5F6HI 3V5DB 2CJUH 1MCCA 3WSQL 3ULUH 3SKNA 1MCQA 2K1MA 3PABB 1AJ7L 1JGVL 3BO8B 1N7MH 2A6JA 3T2PA 4JFQB 1B9ZA 2P49B 3LHPL 4H1LG 4KHXL 1YY9D 1MPAH 4Y1AD 5EUKB 1ZHLA 3MOAL 4AEHH 5DMGC 5D4QA 4XMKH 1LGVA 3CC5A 4LVNC 4WRLA 5JOFA 4JFDD 3FT4A 2IPUK 3B9KC 2HT2C 4NJ9L 3DYMA 1SJXA 3QR2A 4Z7OE 3ORJA 4XPGH 4MJ2A 5J3HD 4XVJL 4JVWA 1PD6A 4U7KA 3IFNH 4UDTA 3O3DB 2XT1B 3QDGE 1TZIB 1FV1A 4C56E 4JHWH 5EG6C 1MRFH 2GTWA 3R06B 4RRPG 3PWUA 2B1AH 3QO1B 4M61A 4Y19D 3F7PC 1LDPH 4WDIB 1IEHA 2ZUXA 2OJEA 4OV5A 1G7HB 1LO3L 5CEXB 2X7LA 1CQYA 5HPOA 1KCUH 5E03A 1T20A 5HY9B 3SKMA 1W72A 4JFFA 2ZUYA 4QHLA 3HAEA 4NT6A 3U0PB 3N1MC 5DRXA 5E6IB 1NL0L 1OTUD 3ES6B 2J8UA 3OZ9L 5EORL 1LO0H 4YO0B 1X5ZA 3WHE1 4Z7UF 3IJYA 4M3KB 4Z77A 1BQHG 4GW4B 2NXZC 2E9WA 3HI1A 4PTUB 4JFOA 5IJVA 2R4SH 4UIKH 3MRCA 3ARXA 5FYJU 2ED7A 1UEMA 4MNQD 3HE6B 2VISA 5DRWA 3QPQD 4MA3B 5ADPL 5JHDE 4S1SL 3KNBA 4LAJH 3ALWA 2B1HL 4ENEC 1AFVH 5JORB 3O4OC 4JM2B 3C5ZD 3TO4A 4MA8L 1A3RL 3CLEL 3EYSH 5I76B 5AUMA 1RD6A 4RWYL 3TH4T 5FGCB 5GZND 5CZVH 2H26A 3TO2B 2WLYA 4TOYL 4NRZA 3FFDA 1ZHNB 4DGVL 1QEWB 1FLTX 1UJTA 1N2RA 1EBAA 4HGMA 4DUWA 4ZOBA 1P4BL 2VWEE 3SDXF 1UEYA 1MEXH 2ZOKA 4OZHE 3TC9A 5C08D 5CEZH 4HKXA 2AW2A 4QRPA 1MREH 2LQRA 5I1DB 2NZ9C 1OARH 1S3KH 2EE3A 3ESUF 1FC1A 1UWGL 1XFPA 2X4UB 4L3EB 3SKJH 3K8KA 1AHWB 1PJ9A 5GGUB 3GJFK 4D0BA 3A6BL 2CK2A 4LQFH 4NRXA 5D72L 1VKXB 3QH3B 1A4KA 5CHNA 5GRVK 4LSRL 3IAPA 2APBA 4J2XA 3HI6L 2IFGA 2XV6B 1IBGL 1JPST 1FL5B 1NEZA 4MAUH 3FOLA 1FE8H 3SPVA 1AD9A 4YC2C 1YEJL 3MXVH 5C9JA 1E4WL 4G8EB 2R69L 2OI9B 5IFHH 1KYOK 4U3CA 5CD5D 5IIEA 4EI6A 3MOBL 1MCKA 1H15A 5T1DH 3C5SB 1RK0B 5F7HA 4BFIA 3BKYH 5L8JB 4I9WD 2AJYL 1G7PB 2A6IA 2FJFB 5KSAC 4UDUA 3ETBF 3H9SB 5C0BA 1WGOA 5MP6H 3EO0B 4LVOB 2AK1L 3KVQA 1QLRB 1HQ4B 3NFPA 2VLRE 1B4JH 1UB5A 3FRUB 4KY1L 5CS7A 3D18A 1D9KB 5EZJB 2O5XL 2AGJH 3MYJA 2ITDA 5AEAA 1EFXD 4Y4HA 1CFNA 3OTTA 1JK8B 5IG7A 3P0YL 1JHTB 3CSPA 1BVKB 5HVWA 1T5XA 5KN5A 1M7DB 1YN7B 4RDQG 2F8OA 4HC1H 3T4AB 1HHJB 2VH5L 3R4DA 4U3XA 4L29B 3QUMA 5ANME 1AXSB 4WWKC 4R26L 1CLOH 1MLCB 2P5WE 2OM5A 1II4E 4YBQD 1X4YA 3V5DA 3O2WH 2FRGP 3ZKMD 1RQ5A 3PABA 3BO8A 3LD8B 2FIKB 4ELKB 1A7RH 1PSKL 4JFQA 4KI5D 1OQOA 3HI5L 4JZOB 2HJKB 4JN1L 4MQ7B 3ZLQC 5EUKA 4IRZL 4OLZL 3VI4E 1YEFL 1CZ8H 5BS0E 3E3QC 3AU1B 3T3PF 3L3OB 3U36B 2ZCLH 3F12B 1CGUA 5JUEL 2X4OB 3RTQB 1KLFA 3BJ91 2HTLC 5EWIH 3BQUD 5KVMC 4NNPL 3WS6A 4LPUA 3DRTB 3TBYB 4FZEL 3ROLB 1UCTA 1BQLH 3B3IB 1ITCA 3O3DA 2EXWD 1DVFD 5IGXL 3WXVL 1Z9SA 1TZIA 1YYLL 1S5HB 2BRQA 2APWA 2ADJB 1B4RA 1ZGLP 3R06A 5IOPB 3GMLB 2WZPD 3OB8A 1I7RB 1S78C 1GGCL 3QO1A 5F9JB 3QUXC 2CKBL 3NCYS 4WDIA 2UZIL 1A7QL 2ENSA 4U7MA 3UTSB 1G7HA 5CEXA 2UWEF 3G04B 1UWEL 4GS7B 4K7PH 4UZGA 5HY9A 1P1ZB 1U2HA 3LY6A 2EC8A 5HGAB 3AS1A 3WNLA 2H6PB 1GOGA 3HB3D 3U0PA 1EHLH 4H20L 5F1KC 5E6IA 1XGTB 4RMRA 2C26A 3ES6A 2XZQL 1OWWA 4KC3B 4YO0A 4LCCC 4GW4A 4F57H 4PTUA 4OFIA 4XWGH 3DROB 1JTOA 1C1EH 3HE6A 3IGAB 2J4WL 5D70H 5C0AE 1IT9L 3LQZB 3LN5B 3QUYC 5GS0H 5LAXB 5FFLA 4MA3A 5AZEH 3VRJB 2CO7B 1U42A 1UJ3C 3AREB 3L7EB 4XCYB 4DQOH 2DL2A 1CGTA 3HG1D 1N6UA 1YNKL 2NQCA 5JORA 3SGEI 4JM2A 1TENA 5CGMA 1T7XA 3HZYB 4QTIL 5I76A 1TQBB 3V4UL 1QZ1A 5GS2H 2QR0B 2UZYB 3HLAB 3TO2A 1SY6H 1WJ3A 1MCEA 1ZHNA 3GK8H 4XP9H 1QEWA 3QPXL 3QP3A 1GC1C 1FFOB 1T1WB 4YPGB 3ARRA 3TVMB 5D1QD 3TM6A 5CBEB 3WFBH 4J6RH 3V0VB 5I1DA 2ICWJ 4Q97A 1CCZA 2DJSA 5HVFB 5I18H 4KTDH 1CIDA 1T66C 2X4UA 4L3EA 2Z92A 2JELH 1AHWA 5GGUA 4LKXB 2FH8A 1VKXA 2WQRA 3QH3A 3RVXD 5LJYH 1HXMB 1IMHC 3ARUA 1UH2A 5D7JD 4Y1AB 3GRWH 1FL5A 4KV5E 3LPGA 2BXYA 3T77B 1QPPA 2K7PA 5B8CC 2ATKA 4G8EA 5A2IH 4J3TA 4I18B 4PJXE 3RGVC 4NWTL 4ODVH 3R1GH 3MLSH 4TSCL 5EU6A 2X4PB 3C6LC 3CFEB 1R3JB 3C5SA 4MJ6B 1RK0A 1QQDB 3O2VL 1MCWM 1I8MB 1NLDL 2FJFA 1G7PA 3QAZB 2UYLB 3H9SA 3T65A 3SE8H 2IPUG 3EO0A 3HFMH 5EIIB 5FGBC 2VAJA 2XTJE 1QLRA 1HQ4A 4BFBD 5J1AB 2EEAA 3FRUA 4YHOL 5HHXH 3F5WB 4Y19B 3FONB 4E41D 1D9KA 2FO4B 4QEGA 5EZJA 5C0RL 1HHHB 1HSBB 5F70A 3WCYA 3KYOB 3X12B 4ALAL 1YMHB 4G6MH 2G60L 4NJAL 4P2QB 2OQJB 2PNDA 1JK8A 1T1YB 2VWEC 2D0FA 5EN2A 3UJTH 1MJUH 1JHTA 4QTHB 1BVKA 3S36L 1RZJC 1IGIH 1M7DA 1YN7A 2P46B 4K3DL 1J0JA 4PJAB 4F7EB 1IKNA 4MS8C 5FYJE 3T4AA 1HHJA 4YDKL 4L29A 2ADFL 2CK0L 1AXSA 5E2VL 3FL7A 1MLCA 2WINB 3CDCA 1WBZB 4R0LB 1U8QB 1Y6KR 5F9WC 4OLEA 3SKOB 1G0YR 1FNAA 2EDFA 4H1LH 4MNQB 3VGEA 5I1KH 3RY4A 2FIKA 4ELKA 2F58L 3KJ6H 1DANT 4FXLA 5CILH 2ZUQC 5DI8B 2VR4A 1MF2L 2PW2B 1SEQL 1B2WH 4JZOA 2HJKA 4L8SC 5ESQB 2XPGB 5JW3L 5AG8A 4MQ7A 4X9BA 1ZANH 2C3WA 2B39A 1W0WB 3GBNL 3U4BL 2XZCL 4B7IA 4CGTA 1J05B 4FNLL 3AU1A 4FZ8L 3L3OA 4L9LB 3U36A 2ILLA 3F12A 3QA3B 3VCLB 2EDOA 3RTQA 2X4OA 3TN0C 1LNUB 1RY7B 2QV2A 3GBMH 5C09D 1N5YL 3ZKXC 3T1WA 4ZAKC 4P5MB 3DRTA 3TBYA 3U82B 3ROLA 4YDIL 4YIQA 3B3IA 2KBGA 1E27B 3UEZA 5EA0L 5EU3B 5TDPB 3JSSA 4LASL 3NACH 1JRHH 4N0CC 1L0XA 4YHIB 1S5HA 3KAAA 5FA4A 4U1IB 2ADJA 5IOPA 3GMLA 1I7RA 3P30H 1OW0A 5C08B 1GOFA 5F9JA 1QBML 1DUYB 4LCIL 1X5FA 2MTPA 3TYFB 3UTSA 5D7IF 4HF5H 4POZC 3H9YA 4GW1B 3G04A 4U6VL 1IC4L 1Q0XL 1P1ZA 5HGAA 1TJHH 3EYQC 2H6PA 1TZGL 4QF1B 1A3LH 4FXGB 4HAFA 1MFCH 3TZVB 4NQTA 1KIQB 2YD8A 4Z0BL 2NY5C 1XGTA 3VD7A 5IMLB 1FG9C 1NBZB 4LDLB 4PUBH 1YUHB 3MRLB 3DROA 4G80B 1T7ZA 4P2RD 1V7NL 3WKMH 1QFWH 1ZT1B 4MXWH 3IGAA 3VGGA 2NY3D 4D9QD 3LQZA 3LN5A 3MGAA 3PQYE 5LAXA 4YXHH 3VRJA 1CE6B 4M62L 1BLNB 3AREA 3L7EA 4XCYA 3S8WA 3BPNC 3OWEA 2GTZB 3RWCB 2A0LD 1H3WM 3BI9X 3E6FB 1E4XI 2DQUH 4YFDB 1M4KA 2GY5A 4MJIE 3HZYA 2EYSB 4N90D 1QR1B 4XCCL 4I8DA 2M8XA 4HBQA 5L2JB 2QR0A 3HLAA 2HYMA 3GSQB 1UZ6E 1JNNH 1CF8H 3QUKB 2DTMH 4D9LL 4AQOA 3BD3A 1WZ1L 2BHUA 2O26U 1FFOA 4DK3A 1T1WA 4GXUN 4YPGA 3TVMA 1V7MH 2WBWB 1BEYH 5DMIL 3SDAC 3RUGE 3WIHA 5CBEA 5DZOA 3V0VA 4EXKA 1EAJA 3EUUA 5DK0B 4YBHA 1S7SB 2UUDK 1MY7A 2GQHA 1KB9J 4A6YH 4AG4H 2B0SH 4LKXA 4GJTB 1FNLA 4KJYB 4U1MB 1I1AD 1IZKA 4HG4J 5J06A 1HXMA 3BPOB 1ITBB 1E6JL 4Y1AA 4TTDC 3OR7B 2WWMC 4IRJC 3O3BA 3OJ2C 1ZTXH 3T77A 3U7WH 3VWKB 4I18A 2UY7A 4XP5L 1AXIB 5AZ2H 4B41A 4WO4C 1D5IL 2VTFA 1SYVB 1F45A 2X4PA 3NCYP 1VFMA 2YHGA 1FYTE 4L4TE 3CFEA 4F7CB 1R3JA 1JHKH 1YJDC 5IEHA 2DKUA 4MJ6A 4B53A 5EBGA 1QQDA 1T0PB 3PDDA 1I8MA 5FYKE 2VXTL 5DGRA 3A0OA 2UYLA 3SGKC 1NMBL 4XGZB 5EIIA 1OP3H 3B2VH 1X6LA 4YWGL 4O4YH 4KDWA 3AXLB 1MFBH 5J1AA 4QHKI 3F5WA 4Y19A 5DQ9B 5I1EH 3FONA 2FO4A 2F8VA 4NUGH 1HHHA 1HSBA 4Q7DA 1RZKC 4WI4A 3OKNB 4LF3B 3X12A 1YMHA 1JVKA 4P2QA 2OQJA 2C1OB 1T1YA 3VG0L 1T5WB 4QTHA 4FQPA 1OM3L 1E6OL 5I9QB 3FHQA 2DM2A 3KPPB 4PJAA 4K55A 1MHCB 2ZG3A 4F7EA 4HPOH 5C0IB 4KK8D 4L4VD 1WBZA 1JGEB 4R0LA 1FRGL 1U8QA 3MQIA 1XGRB 4XC3L 5GISH 3SKOA 4MNQA 1DBMH 3IDNB 1GPOH 2DQHH 4JZJB 4APQD 3KPLB 5DI8A 1J1OH 3F6IA 4N1HB 3KLAB 2PW2A 1FQ9C 3WIFB 5ESQA 3QQNA 1A14H 2XPGA 5DJ6B 3GI8L 3HG1B 4LLUB 1ZVHA 4KDTA 1QUNA 1A6WL 1G9NH 4GMTL 4F9LA 5A43C 1W0WA 1XF5B 1J05A 4L9LA 3D9AH 3QA3A 2EH8H 4K2UL 4PD4J 3CVHL 3VCLA 2R9HC 5EC1B 5C1MB 4PLNC 2WUBL 1LNUA 4HT1L 4Z0XB 5DRZB 1KJ3L 2BDNH 3ZDYE 4V1DB 1T04B 4P5MA 5I1JL 2R39A 1K8IB 1KB5H 1E27A 5TFSL 4TVPD 5EU3A 5TDPA 2XTJC 3THML 4YHIA 4IOSD 3CSYA 4U1IA 2ADGB 5D1QB 2ARWA 5SWZE 5C08A 2DDQH 1FORH 1KNOB 4QXGH 1DUYA 2WSKA 3TYFA 3L5XL 2QQLL 2XA3A 1NH6A 4JEGB 3T0ED 4GW1A 4Z7WE 5GSVB 4MCZB 3O4LE 3QRFM 2OXHA 3WHE0 1KJ2B 1QRND 4DKEL 4JQIH 3F6LA 5I0DA 1IGCL 1LK3L 4QF1A 1GC1L 4YBLC 4FXGA 4OZGB 1BQUA 3TZVA 2IG2H 1KIQA 4EIZC 4ZD3H 2J8HA 5D7JB 3QRGH 1Q0YH 3IS1X 5IMLA 4MWFB 4X80L 1NBZA 4H25B 2IWGA 1MQKL 3G6AB 1YUHA 3MRLA 2GUOB 4G80A 4QXUL 5FA3B 1ZT1A 5I74C 2WBJD 1BF2A 2HRPL 4CADB 2QADD 5ESVB 1MVUB 4GXVH 4NM8L 1CE6A 4Q6IB 2G9HB 5IMKB 3S3SA 1BLNA 3RIAK 4UBDC 1DBKL 2OMBA 2YMXL 4P2OC 4YEFA 2GTZA 3RWCA 2BVOB 3H0TB 3E6FA 3DYPA 4PYGA 4PJGF 2AI0H 4IIQB 2XXMB 3DVIA 4DFIA 4DUVA 3RP1A 2EYSA 1EGJH 4JFXB 1QR1A 3P3YA 4XP4H 2E6QA 4E41B 3HMXL 5L2JA 1U9KA 3GSQA 5HYQB 3QUKA 5E8DH 1RIVH 4DJMA 4NZRL 4OQTA 2HKHL 2G5RA 1LD9B 1JZ3A 1KN4H 3P11L 4ZTOL 5HGBB 4RDQF 1IAII 1D5ZB 1MIMH 4PJBF 3DGGB 3QQ9D 4KVCH 3LEYL 4XBEH 5DK0A 4G5ZH 1VGEH 1S7SA 3KPRB 5KBNC 4FQIH 1OTTC 3PP3K 4KTEH 1NGPH 2IPTL 4RMTA 4YUEL 5HGDB 1H3PL 4C59B 3O9WD 1A3QA 5FGRA 1M7IB 3C9NB 1FSKC 1RZJL 5IBUG 4U1MA 3BEVB 4P23D 5IBLC 4ISVB 1R24B 4G7VL 2DLTA 4S0SD 3OR7A 2JTDA 1F90L 1S9XB 4AIOA 3Q5TA 1CLZH 3VWKA 3ZZ1A 4Y89A 2VL4A 4GAJL 2VXUL 1KGCD 2BK8A 2LAGB 1OAXH 5FYLD 1O5DT 2DKSA 5K9QG 1SYVA 1AY1H 5C09B 4F7CA 2CD0A 1BM3H 1E28B 5KS9B 4HEPG 2A73B 1OSPH 1NSNH 1OSZB 4P59L 1ZAGA 2IADB 3PGDB 4E5XB 3SDDB 3ARPA 3W5MA 4Z7OF 4KK6D 3BGFC 4XGZA 2CSPA 3RY6C 3QCTL 4OB5H 4DWHA 5J13C 3AXLA 2BOBB 2MHAB 3GI9H 1D6VH 5F8QC 5I1CL 2VKWA 5DQ9A 3ARVA 4ZO7A 4OZIE 3FQWA 2BC4B 2VDML 3OKNA 5HD8D 4LF3A 2OTPA 3VXSD 1NAKL 4BSJA 2C1OA 1T5WA 4NSKB 4XPBL 5F9OL 3HMWL 5D9SB 3LH2H 3KPPA 5DHYB 1HYSC 1MHCA 5C0CE 5KOVC 3QI9C 4P9HL 3HTLX 4NN5C 4Y16D 5C0IA 1JYNA 4JHBA 1U8HB 4J3OC 5LXGL 3V4PL 4P46D 4KKLC 4HWZB 4P9ML 1MAMH 2DKMA 5MI0B 4ONFL 1JGEA 5CUSL 4NZTL 1XGRA 4P2RB 5DUPL 4PRID 1ADQA 3W82A 3IDNA 2NY3B 1EERB 4ZG1A 1NFDE 3GHBH 4JZJA 2GT9A 2DQFB 3KPLA 3KLAA 2YD5A 3K7UA 1IGML 4FRWA 3WIFA 3ULVL 1VENA 3U9UB 5DJ6A 1R3LB 3HG1A 1CG9B 2DWDB 4LLUA 3QUZB 3UTTD 1KTKE 4K7FB 4OFYD 1XF5A 3BAEH 1KFAH 5ENWA 5GS1C 5EC1A 3FFCD 1XF3B 1WIPA 4Z0XA 5DRZA 4G8GB 4X6DF 4V1DA 5JHLH 1T04A 2YD1A 2HKFL 1N4XH 1U6AH 4JHAL 4XP6L 4ONOA 1K8IA 4FMKA 5T3XE 3OJVC 1GGYA 2VLKB 5DJ8B 2ADGA 4KROD 5D1QA 3AFLA 1CFTB 3SJVD 3NA9H 3MV9D 2XXCB 3BP6B 4UILL 2CMRL 3NN8B 3PWPD 4M03A 4MCZA 5GSVA 1KJ2A 2X4SB 4RCAA 4OZHF 4WTZA 5IQ7L 2Z31C 4CU7A 5IM7B 4OZGA 1XIWD 5CKAA 1I1AB 4JRXE 3DJ9A 2FBOJ 5D7JA 2PXYD 5J12B 1OT2A 3TH2T 3KPSE 2BY0A 4MWFA 3FO9B 4H25A 1OAKH 1F4AA 3ARFD 3G6AA 4NKQB 2I60L 2DLIA 2GUOA 3KYMB 5FA3A 1E4JA 1O0VA 4WEMB 4CADA 5C0FB 3A6CL 1MVUA 1AGCB 2R56L 2DBLL 2G9HA 5IMKA 1C5CL 1AO7D 2FECI 3ZKSD 1AH1A 5BV7B 2IAND 1I9EA 4WGVB 4RGNB 1XR8B 4UUJB 4ZOEA 5HHME 1TZHB 1YYMH 2BVOA 3WL9B 3H0TA 2ICES 3CXHK 3U79A 1ZVSB 5F6IB 4XCFL 3LDBC 3D48R 4IIQA 3QDJD 3JWOH 4JFXA 4NKIH 1CBVL 1JNJA 4XMLH 4PRHE 2FATL 4E41A 4U6XB 2EZ0D 1VEOA 4TSBL 3ABZA 5I19H 2HRLA 4L3AA 3IDUA 5CLWA 5HYQA 1YJDL 3DSFL 1RUQL 1K3IA 5DO2D 2NR6D 1VCAA 1RZKH 2MCPL 5ALBH 5B38B 1LD9A 4QOKB 1MHHB 4U0RC 5HGBA 3NA4A 5DC9B 1D5ZA 2QHRL 2L7JA 1GHFH 2I24N 4HFUL 3GJEB 2BJMH 3MJ8B 5FUOL 3KJ4B 4WFHE 1SM3H 1J1PH 1PEWA 3KPRA 4JKLA 5GIRA 3SGJC 1MHEB 2HN7B 2CXGA 4L4VB 4Z7QE 2PO6D 2EDLA 4M8VA 3WFEL 3U7YL 1BGXL 2E9JA 4M02A 1M7IA 3C9NA 4HBCL 4JR9H 1WIUA 4Q0XL 2H41A 4APQB 3KLDA 4NC2B 2JLLA 2MPAL 3BEVA 1Y18B 2EXYD 3QB7C 4ISVA 4R8WH 1QTYT 1R24A 3LCYA 1EPFA 1CS6A 4HK3N 4OKVB 1S9XA 3FOMB 2H3NB 3I02B 1T83C 5D5MB 3WO4B 5MHSD 3WFHB 1UVQB 4YHYB 4U31A 1R3IL 4JVPA 5C09A 5T3ZL 4HUMB 1E28A 5KS9A 2A73A 1OSZA 4OIIH 1KJVB 4P3CH 3B43A 3ULUL 2IADA 2AJXH 4M7LL 3PGDA 3SE3C 4E5XA 4NBXB 3SDDA 2ERJB 4OAWB 5H37G 4XNQB 5JQ6L 3SO3B 4P5KB 3O0RH 1FHGA 2FX9H 2BOBA 1JNLL 2MHAA 1EK3A 1UA6L 1YNLL 1QACA 4LU5L 3L1OH 5GGVY 5JR1L 2BC4A 3MV8D 3T0EB 3UTOA 3WUWB 3BP4B 4F37K 1DJSA 2EIZB 4JDTH 3LKQB 4NSKA 3KDMB 3KHOA 3UDWC 4MMZC 5JW4M 5D9SA 3HNTH 5DHYA 4U1JB 2GJ6B 3W0WE 1GSMA 4OCMC 4XWOC 3LKNB 2OL3H 1U8HA 2B5IB 3MROB 2X42A 2K7QA 3BPLB 4D0DB 4HWZA 3NOIA 1QP1A 4KPHH 2DJ4A 4WY7H 4P2RA 3ELAT 5EUOE 4PLJC 3IB4A 2VB5A 2DQFA 5FYJL 1A6PA 4ELMB 2HJLB 1KCUL 4G43B 3U9UA 1R3LA 4OI7A 1CG9A 2DWDA 3OKEB 3NH7H 3QUZA 2VUOA 4K7FA 2V5RA 3CZFB 2C3XA 2VMFA 4ZNEA 1BF8A 2HTKC 4UAOC 4LSDA 1T3FB 2X4RB 1A6VL 3MRNB 3ARBD 5J11C 4X4ME 3CXDH 1XF3A 5IHZB 2OJZL 4G8GA 5F97E 3D2UD 1A7OH 2R4SL 1MVFA 4PJIF 4UV7L 1LE5B 5HDQL 2XKSA 3QUMH 3CH1B 5D96C 4NFDA 2VLKA 5DJ8A 1GGBH 2Y36L 4HWBL 4ZUWB 3HRZB 1CFTA 2VKXA 2Z91A 3I50H 3BP6A 3NGBC 4U6TA 3NN8A 1FGVH 2X4SA 3O9WB 4HLZG 1HSAB 2FD6H 3KLSA 3UAJC 5IM7A 5AG9A 2F15A 3LS4H 3MYZA 1F4XH 2WIIB 4POUB 5TE7H 1PQZB 1X5GA 1I1AA 5LVEA 2BY3A 3PWVB 4K3JH 3RBSA 1R0AH 4FG6C 3VD9A 2D31B 3IF1B 3FO9A 3IFLH 1JP5A 2XACC 3BIBX 3ZMRA 1J86A 5KSBF 2NXYC 2FLRT 2BNRE 2V17H 3KYMA 4RMUA 5LBSL 1TVHB 4DVRL 2IFFL 5C0FA 1T2QH 1AGCA 3ARYA 3QNYB 1FO0H 3X3FH 1S3KL 1DBBL 4JG0L 1BPVA 1NCDH 3T0AA 4PJXF 4M6NH 3TLRA 1OAYH 5DC0A 1XR8A 4UUJA 1UZ8B 1TZHA 2IPKB 4LRNH 1H3GA 4XH2B 3WL9A 5TQ2H 3T2NH 2VZVA 3BP5B 3HNVL 1ZVSA 5EZOL 3V6OE 4JFZH 2AEQH 4WFGD 1NUFA 5CZXC 4WEBH 5CIPH 1NCAL 4U6XA 3SGEH 5ISZE 4HS8L 2JB5H 2YD9A 5EOCH 4JANB 1K9TA 1MELA 4ZPTB 5DJZB 5B38A 4QOKA 1CL7L 1MHHA 3TJHD 1TJIH 2X1PA 4MA1C 3GJEA 3KR3L 3EOTL 3MJ8A 3DUUB 5GGTA 2ZNWA 1OB1B 4P46B 1MHEA 2HN7A 4YZFF 4L4VA 2Q8AH 5MP6L 5C07D 5JIIA 4PRIB 3MV7D 4APQA 3HC4L 1BVLB 1Y18A 1FBIH 1XCQB 5D2NB 4YGVB 4PJ8C 3M8OL 1VHPA 3OG6B 1OP5K 4ODHL 5JXAL 3FOMA 1IVLA 2H3NA 3JBG7 3TGXA 3MZGB 3I02A 5D5MA 1JF6A 4ZS6D 1KC5H 4Y5VC 2R0KL 4HC1L 3RU8L 3WFHA 1UVQA 4KKBC 1ACZA 5KG9B 3FFCB 1Q72H 3OR6B 1IL1B 1CLOL 4WW2C 4AEIL 4M7ZC 3BOVA 3S6CA 1UYWH 1IKFL 1KSRA 1KJVA 2Z8RA 3BKJH 3ZT5A 2JE8A 2PTUA 5IJKC 2VLJE 1KEGH 4OAWA 5I1IL 2Q8BH 2EIBA 4KRLB 4XNQA 4KROB 4P5KA 3B9EA 4OJFH 3GFUA 2UVFA 4RA0C 4OZFB 1DLFL 3SHSA 3IDXH 4R97C 4DGYH 3CMGA 1DUZB 3MV9B 5FHBL 2P48B 3PWPB 3T0EA 4TN9A 5FYKL 2E27L 1CU4H 3WUWA 2Y06H 3BP4A 1BWWA 5I73B 3LKQA 3KDMA 1WK0A 5EWIL 3TT1L 5C6PB 1XIWB 2GJ6A 4LHUG 4KZDL 3QSKB 3FQNB 2EDKA 3LKNA 5BZDB 3PL6C 1BQLL 1G9EA 2PXYB 3MROA 1YQVL 5DD5H 4TUJB 4D0DA 4MLSA 3Q3GB 4M1GL 4O02H 1JPFB 2LE9A 3H7LA 1QLEH 4JY6A 2NX5D 3DHMA 3Q2CA 3ZL4H 2LV4A 4XPFH 4ELMA 2HJLA 1U8LB 3LQAC 4G43A 2O5ZL 4K7PL 2IANB 1JGDB 3OKEA 4JHZA 3CZFA 2NY4C 1RZIB 3IS0X 2BRRH 1T3FA 2V9QA 2JJTA 2X4RA 3VXTB 3MRNA 1MSPA 1SEBB 1NUGA 2J3SA 1Y6NR 2HP4A 3OAZK 2XIDA 4EOWH 3QIWC 1A6TB 4KKCD 5IHZA 3S88H 1MUJB 1G6RB 5J0BA 2YA2A 2RCSH 4XWGL 1FNSH 2EO1A 4HWNA 4RIRB 2PCPB 4LCWD 3LEVL 1OAUH 1LE5A 3RHWK 3CH1A 2XWBB 5EIVA 5KVEH 2YR3A 2IQAB 4GOSA 4JFFE 2P7TB 4JO4H 1UZ6F 3IFPB 5IUSA 5CGTA 4ZUWA 3UBXI 3HRZA 3P77B 2A9NL 4AEEA 1MAJA 5DWUH 1DLHA 2J8UE 2YD7A 5J1TC 4M4PA 3RUGF 1H3XA 2PO6B 3O9WA 2ZJSH 3EFDH 5BJTB 5IROA 2WIIA 5E7BA 1I9IL 1PQZA 2V5YA 1W2KT 3N85L 1XEDA 3PWVA 1SY6L 3RL1B 4BSVB 3GK8L 1IQWH 4PJEA 1GIGL 2D31A 5DGQA 3IF1A 2ZUVA 5I75B 5ETUB 4O00A 3NZHH 1C5BH 3UJJH 3DX6B 2AABL 4LLDB 3MLZH 5E94B 3PGFH 1TVHA 1EIBA 5IBTL 3HE7C 1K2DB 3S35X 3QNYA 1FIEA 3RNKB 1FCCA 1CICB 2ESVB 3MRRB 1QYGH 5CBAB 1PKQE 4ZQKB 5D6DC 5DJAB 5JDJA 1U58B 1KIRB 4K71C 1F3DH 4NQUA 1N0XL 3EGSB 1NFKA 2JELL 3ZYIA 1UZ8A 2IPKA 4XH2A 4HMDA 3KXFE 2FEEI 4JG1H 5D71L 3BP5A 4DCQB 5L6YL 3U0TB 4NKOB 5DQDL 5BVJB 3SE4A 5K9JL 2J6EA 1IM9B 5F89B 4QRPE 3MV8B 3QIUC 4PB9L 1HZHH 5GS0D 4X9IA 5M7QA 4JANA 4ZPTA 3MJ6A 5DJZA 2W59A 3MLSL 9CGTA 4X7CC 1N6QH 4AH2B 1JFQL 3QDMB 4FMFA 5IW3A 4Y16A 3DUUA 1ORQB 1CFSB 1OB1A 4P46A 3WNNA 3SE9L 4NWUH 4GSDH 3SDYH 4G8FB 4KJWD 4XNUH 3RA7L 1DQMH 12E8L 4XHJC 1KN2L 4PRIA 3SDXB 3SCMD 5T1LD 1MJ8H 2FHCA 4NHCL 3T4YB 1BVLA 1XCQA 5D2NA 1QSZA 4YGVA 1SVCP 2DQGH 2I07B 1IGIL 4M48L 5EZIL 1XGUB 3DO3A 3KLHD 3SBWC 5C0BE 2DIAA 1CGWA 4LNRB 4AM0B 2W9LA 5KG9A 2ZSWB 3LQMA 2OZ4A 3FFCA 4TNVK 3OR6A 1IL1A 4NQEB 4YHLH 1MCNA 5H37H 3WIHH 1U8PB 2EDDA 1RUKL 3RBGA 2QBWA 3V6OC 1KXVC 4LPWA 1ZA3B 3VE0B 1V8HA 4RAUB 4OFKA 3HNSL 4OZFA 1JE6A 4OLWL 2L7UA 1EJOL 3MXWH 4NN6C 3MV9A 1DUZA 1NCBL 5T33L 4YLQT 1ZANL 4Z7NE 2PF6A 5DMGD 3PWPA 4LFHD 3BKCH 4OF6A 3B9KD 5F7EH 1A8JH 3AUVA 5KVGH 3GBML 1XIWA 4Z7WF 5IHBA 1ORSB 3FQNA 1WLHA 4C54A 5C6TH 3CDYA 5BZDA 4LLMB 5E4IA 2PXYA 4TUJA 4YGAB 3Q3GA 1JRHL 4QT5B 5T5NG 2HWZH 2Y6SD 5C2BH 1ERNA 1DSFH 3A67L 4LSTH 1JPFA 4S1DC 2X05A 3IDJB 4NBYB 4OCRH 1RZGB 2OP4L 3O81A 3DO7B 1A47A 3QXVA 2VABB 2E8ZA 3BZDA 1U8LA 1SHMA 4JO3L 5DJXB 2DQIL 2IANA 1UQSB 1JGDA 1KCSL 1E4KA 4HQQL 3VXOA 1F6LL 4C58B 1A3LL 2W91A 1RZIA 3B9DA 3VXTA 1B0RB 1SEBA 4XT1C 3MREB 1KB9K 1JZ8A 3PDOB 4QHMB 1ZT4B 1CLYH 1A6TA 2E5EA 4UIMA 5D1XC 2NXZD 4R3SB 3GSXB 1MUJA 4PUBL 1G6RA 3W9EB 4FQ1L 5I30H 3K3QA 4MA7L 4OLUL 3WKML 4HG4K 4K9EC 1ODAA 2DI7A 2PCPA 4RIRA 2SEBB 1IEAB 1KXTB 2FJGB 4KJPC 5HGHA 3S5LB 4P5TC 4YDVB 2XWBA 4RGOL 3L3JB 2IQAA 1WEJL 5TDNB 2P7TA 4JB9L 4NZUH 3IFPA 2D7QA 2DM3A 3P77A 3Q1SH 4OLYL 2Y7QB 4PIRF 4ENED 4HLZH 5CJ8A 4L1DA 5KVDH 4JFPA 3HAEG 1MJ7L 2PO6A 1UM4L 3U4EB 5T3XL 4MB3A 1F13A 5C07B 2XTLA 5BJTA 5I1GH 3W9DB 1CTNA 5CWSB 1QFUH 3MV7B 5F1IB 1QSED 5SX4I 3LRGA 3GMQB 3RL1A 4BSVA 2HLFC 3TIDB 2DTML 1KCRL 5ETUA 3GEWB 2IGFH 5JZ7C 5E6ZA 4O9HH 3DX6A 5DVOA 4LLDA 3GO1H 4IM8A 5E94A 4C4KO 5GS3A 2QJDA 1MRDH 1K2DA 2VZ3A 4DEPB 1RIHH 3RNKA 2NZ9D 3MRRA 4BH7B 1L0YA 5CBAA 4ZQKA 5DJAA 1U58A 4JZNB 4A6YL 3MR9B 1KIRA 5FGCE 3B2UC 3EGSA 3GGWB 4Y4FC 3RWJB 2B0SL 2EIEA 1IGFH 3JVGC 5C92A 4M5YL 3DX8A 4FFZH 4DCQA 4J1UB 3U0TA 4NKOA 3TJEH 5BVJA 1IM9A 5F89A 5ILTH 4PJ5D 3VXUB 1MRCL 2Y9RT 3MUGB 3O3EB 3MV8A 3U7WL 4UT9L 2I25N 4I77L 4U4BA 3MV01 5EU7E 4OZIF 5AWNL 4AH2A 4L3EE 3QDMA 2Q6WB 1JHKL 3EHBC 4W4OA 1BJ1H 4PD4K 4HJ0C 1ORQA 1CFSA 2XYCA 4IHOB 4KRPC 4AQ1B 3CMOH 3QXDB 2VDPH 3WS3B 2Q86B 3WDHA 4G8FA 1IAIH 4YK4C 3B2VL 1HWGB 4O4YL 1MCOL 5IR1B 3SDXA 1IGTB 4W6WB 2NX5B 4OT1H 3MGTB 2QQNH 1MI5B 2QKIB 4RSVA 3T4YA 2KL6A 1NLBL 4HS6B 1QFWM 4GBXC 4Z95L 1BIIB 3EYUL 3WJJA 3O6KL 2YD3A 1YMMD 2J88L 1OAQH 3RFZC 3CH8A 1DL7H 2I07A 3EDFA 3I3DA 1XGUA 2BSTB 4WU7B 2JIXB 5JNYB 3TO4C 4NO0D 3H9SE 2WUCH 4LNRA 4M1CC 4AM0A 2ZSWA 4OQTH 2V7HB 5IB1B 4WWKD 3BSZL 4GKNB 4NZJA 3BISA 3T0BA 2Y07H 4NQEA 3RIAF 3WIIH 2V9RA 3QFJD 1NJ9B 3LQAL 1U8PA 4I0CC 2H1PL 4G7YL 1TJGH 3EOYG 4LCWB 2CDGB 4ONGH 5L88H 1BAFH 4K8RC 1FDLH 1TTFA 1ZA3A 2NW2B 1BFSA 1X5IA 3BP7B 3VE0A 4M6MH 4RAUA 4XVTL 3HUJB 2QEJA 4K94H 4G6JH 2F19L 1WZLA 2X89A 1ZEAL 4JFEE 5HI5C 1AI1L 1G9NL 2Z8VC 2VDLH 4JJHA 4G9FD 3MCG1 3DPBA 4L8DA 2HTLD 3IYLW 3RY5A 3U48A 1J8HD 2BDNL 3ROOB 1ORSA 1T21B 2CLVB 2AAVA 4R7DB 3KPMB 4OF8A 3OMZA 5J4MA 3VMNA 5EC2B 2NPLX 4QT5A 3NFNB 3WHXB 2V7NB 1S78D 3BWUC 3QUXD 3IDJA 1RZGA 2AJVL 4QHUB 3DO7A 2VABA 5DJXA 4AENB 1UQSA 4KQ4L 3MLVL 3PHQB 3RVUC 4UB0H 1GRWA 4GAGL 4OFVA 1GAFH 1N26A 2OTWB 3F62A 4KWUA 1AXTL 1B0RA 2XNAB 3MREA 4WW2F 3PDOA 2C4XA 4QHMA 1ZT4A 4DN3H 1KUMA 4R3SA 3CU7A 3MLUH 4LSVH 5KW9H 3GSXA 4EUPG 3AB0C 3W9EA 4F15C 4V2BA 3UTSE 1NAML 4Y4HC 2DLHA 2SEBA 1IEAA 2FJGA 2YSSB 4CVXB 3S5LA 5E8EB 1MH5B 4YDVA 3QUYD 3L3JA 1C5DA 4F9PA 5TDNA 1CN4A 3QWOB 4PGDB 4RFNB 3CK0H 2Y7QA 1CXEA 1NMAH 3PWJB 4U05A 3OSKA 4EJ1C 4X98B 3I2CL 3CCHB 4GAFB 3U4EA 2GCYB 5C07A 3RWEB 3W9DA 1GJIA 4XP4L 3SCMB 3EDEA 1PBYA 2AEPH 5CWSA 5T1LB 1EMTH 3MV7A 5F1IA 4ODBD 3VRIB 3X17A 3GMQA 4FQJH 3O6MH 4OBRA 3TIDA 1U3HC 2AEIT 1SQ2N 4C56D 4B5EA 1Z3GH 1MCLA 2YZ1A 3VWJB 5CCKL 5DJCA 4P4KB 4JCLA 2A6DB 2WP3T 4GMSH 4KVCL 4P57B 3FQRB 1VGEL 4FQIL 4BH7A 2XWJA 4DOHB 3ARDC 3C8KB 1T66D 4JZNA 3MR9A 4NQDE 4M93C 3GGWA 3RWJA 1ZHBB 3EFFB 4IMKC 2G5BB 5JIPA 2J8OA 5BVPL 2DYPD 1B0WA 1KJ2H 3K4DA 2I26N 4J1UA 4PS4H 1QHPA 1FAKT 1TNMA 3WLWC 3VXUA 3MUGA 3O3EA 4BH8B 4RFOH 4A2LA 1T2JA 5CAYB 1U8NB 4OF3A 2R2EB 3B9KB 4Y8DC 3B8SA 3RGVD 2DD8L 3HC3H 3C6LD 4RMVA 3WLBB 3LSOB 3N1QC 2Q6WA 5FO8B 1YA5A 5DVMA 5E6IC 1FCGA 3MLYH 5HYJD 4N8VG 1EVTC 2JB6B 1BFVH 4GT7A 3JXAA 4IHOA 5TF1H 5IP4A 3WN5C 4BZ2L 3QXDA 2Q86A 2EDJA 2DQEH 1FZJB 4N1CA 5IR1A 1IGTA 2NX5A 3MGTA 1MI5A 4WCYL 2QKIA 1UKSA 5IB5B 2MQ3A 3NPSC 3S35L 2JJSC 4HS6A 4N0YL 1BIIA 3BKML 3TT3L 5IKCB 5CZKA 3QZWG 1INDH 2F53B 4WU7A 5F96L 3PIQB 4JM2C 2JIXA 5JNYA 5MEND 3L9RB 1VFBB 2V7HA 5IB1A 4GKNA 2MCG1 1NCUA 4H1LB 4G3YH 4ERSL 2GK0B 3NCBB 5LQBH 4LCWA 2CDGA 5I8EB 1QVOB 2YK1H 4P2QE 4AL8H 1CGXA 2NW2A 3BP7A 5F72S 3HUJA 5GGSB 4PJAE 5E2TH 5DHVH 1KELL 4CN6A 5F1OB 1KPUB 2WMPA 1A6AB 3S37H 3O4OB 3E6HB 5EU7C 1KFAL 4OLVL 5D93C 4KXZH 4GG6E 5HDLA 5CP7A 3TN0D 3U0WH 4FA8A 4MNQE 3ROOA 4ZAKD 1T21A 2CLVA 4Y88A 4R7DA 3KPMA 5BRZB 1C8PA 1NGWB 2KQNA 1N4XL 2JK5B 1S7VB 1RIUL 5EC2A 1AGEB 2VLRD 3NFNA 4KVNL 3WHXA 4DN4H 5F7NC 2V7NA 2XZZA 2OR9L 4HJGB 5ALCL 5LGKA 2EDWA 4M5ZH 4QHUA 4POZD 1WSST 1XGQB 5K9OB 2WM0A 1SMAA 4AENA 1EO8H 1MOEA 3JZ7A 3DUHA 3MJ9A 3EYQD 1BQHB 2PN5A 3PHQA 1FL6B 3CU1A 2X5PA 2K3TA 4NKMB 1M05B 5TPWL 1DP0A 3WFDL 4WI8A 4BKLB 3WD5H 1CGVA 4QRRE 1NGQL 1WICA 2OTWA 3QEGH 4Y2DC 5J1SC 3BD4A 3IJHB 1AR2A 5F3HB 4PJ5B 4GKSB 4YC2B 3VG9C 1GL4B 5CJOL 3K81A 2M2DA 3IDYC 4D0CB 2FBJL 1T7WA 2YSSA 4CVXA 3QWRD 5E8EA 1MH5A 5FUZL 2DQDH 5FCUL 2I9TB 4WHYH 3L7FB 1FFQA 4HCRH 4PGDA 3BH8B 3QWOA 1G7JB 4V2CB 5IFJB 3PWJA 3W39B 3WFCH 4RGMB 5F9AC 4X98A 3QQ3B 4RWHA 3CCHA 1QG3A 3RQ3A 4DAGH 4F37F 3IT8D 2X1OA 1MFAL 3RWEA 3LD8C 4NQCE 3SCMA 1OHQA 3K4ZA 5T1LA 1W72L 2YEZB 4YDLB 4QWWC 3EDKA 1CFVH 3VRIA 4TNWK 5IB3B 4OD3H 4JCMA 5IHLB 3GB7B 1XGPB 1YMMB 3VWJA 3LV3B 5JXEC 4DKFL 5B22A 4YX2H 4P4KA 3SDAD 2A6DA 35C8L 1GHFL 4NO0B 1AE6H 1UWXH 3VRLF 3T3MF 1I8KB 4YQXH 3FQRA 1J1PL 4G6AC 5IVNA 4PBXA 1OCWH 2OXGA 4DK6A 3C8KA 3QFJB 4CMMB 3KYKL 5J56B 1U92B 2DQCH 2V9TA 1ZHBA 3EFFA 2G5BA 4IJ3B 3GRWA 1FJ1B 5DT1L 2CPCA 15C8H 4HLJA 3RWHB 4MHHG 2WWMD 4IRJD 1OVZA 4BH8A 4GS7C 1U8NA 4NCC1 2R2EA 4G9FB 4WW1B 1YEHH 3B9KA 1VADB 4GLRH 4WO4D 1BREA 1MWAH 5FOJA 5F44A 3GSWB 4NGHH 4K8RL 1J8HB 3WLBA 3LSOA 1F8TL 1YC7A 1FNHA 4IRSB 5FO8A 4XP1H 2Z8SA 5E70A 2G75B 2OCFD 2JB6A 1TXKA 1J18A 8FABB 3WFZA 1FZJA 1KBGH 4IDJL 5T5NF 1LP9F 2EICA 1WISA 3QUXB 4TULL 1S7XA 7CGTA 4JQVC 5IB5A 5GRJL 5DZLA 3VDCA 5HHQB 4R90L 4NIKB 5B21A 4XNXL 3U9PL 2HH0H 5IKCA 3JWDC 4CN1A 4MB5A 2F53A 1BD2D 3ILPB 3PIQA 3L9RA 1VFBA 5FM5O 2DLFH 5C2UB 4MSWB 4Y0GA 3WKNA 2DM7A 3I9GL 4L5FH 4CU6A 1P4IH 4Z8FH 1TQBC 2AXGB 4EDWH 4H1LA 4KPHL 2JF1A 3PE9A 2X44D 1EJ6A 3FJTA 1BZQK 2GK0A 3BE1H 5GGTH 1FH5H 5I8EA 1QVOA 1OD9A 4L3CB 1LO4H 3QUYB 3TVMC 4H8WL 1UJ3B 1F58H 4PY8J 43CAB 5GGSA 5I0ZA 3UZVB 5EO0B 4PLOB 1A0QH 5GXBB 1KPUA 4TVSa 1A6AA 1KTLB 3E6HA 1WWAX 3L3DB 4Y5YB 2R9HD 3HR6A 3S4SB 1PG7H 4X9GA 1FP5A 1KB5B 2VXVH 3OF6D 1VPOH 2PYEB 2LU7A 4HKZB 4DW2H 5BRZA 1A7OL 1NGWA 5CMAB 3DUSB 5E99L 1JN6B 1YY9C 2JK5A 1S7VA 4OTXL 3O6LH 4GKZB 4RAHA 3QUML 3VFPB 1AGEA 1H9VA 2W60B 4KK9C 3QG6B 1A7NL 1RMFH 2BFVL 4I18C 2VDNL 4HJGA 1KULA 2Y1VA 1NCCL 4FQLH 4WI5A 4CBPA 1N8ZB 1PFCA 4TVPH 1S5IL 5GRZA 1XGQA 5K9OA 2CGRH 2EECA 5FKAB 4MNGE 2HFEB 1HDMA 1FNFA 3LMJH 4V1DE 4X4XB 1BQHA 2PETA 1FL6A 4Q6YA 4NKMA 1M05A 1ES0B 5FYJD 4BKLA 3V0WH 2DYPB 1NGZB 4URTB 3DVGB 4EUPH 1R0AL 4M7JH 2VC2H 3IJHA 4WI2A 5F3HA 4JPIB 4PJ5A 4M1DH 2LVEA 4HJJL 4GKSA 3MODL 5B8CB 1FFPB 3K2UH 5HI4C 2CDFB 4D0CA 4U7SA 3RGVB 4ZNCD 1MCFA 2YUWA 3GBLA 3GHEH 2R0WL 2I9TA 4ZYKA 1M71B 4NNXB 3NTCL 4LL9A 3L7FA 2ED9A 2VDRH 3BH8A 3AVEA 1NGYB 4UBDD 1G7JA 4BYHA 5HYJB 4OZGE 1IGYB 1OAYL 3OPZH 5IFJA 4P2OD 3LKOB 3FT3A 4X6DB 3TP4A 3W39A 3MUJA 1MCHA 4LRNL 4M7KH 3QQ3A 1S8DB 4N0FB 2EH7H 1UM6H 4XNYL 3O3UN 3BZEB 2RAMA 2EDQA 2YEZA 3LIZL 4UINH 1QFWI 4J8RB 2JB5L 5DVNA 5IB3A 4ZTPH 2ZKHL 2OR8A 3GB7A 1XGPA 3Q5OA 1YMMA 3VJ6B 1NGXB 4PP2B 3V52H 3LV3A 2CUHA 4L9LC 2H32H 3L95B 1PLGL 3BHBB 5MENB 4NO0A 3ARWA 1QBBA 5EU5B 4M43H 1I8KA 3F58H 3N50A 4FQCH 3BPCB 1OTTD 5GZNC 4MQXC 4E41E 3QFJA 4CMMA 3VGDA 2VDQH 3BYTA 3GSNH 1U92A 2B4CC 4I3RH 1D3CA 1KEMH 3QXAB 1REIA 1PW3A 2ZUQB 4ETQB 5IBLD 1FJ1A 3P0GB 3O2DH 4L8SB 3NABH 4UT7H 4S0TD 1CFQB 3RWHA 2VUYA 4GXUM 5TH2B 1WFUA 2VXSH 5ICXB 4PB0H 3KPRE 4G9FA 1VADA 1PY9A 3RHWF 4YHZL 3TN0B 2DJUA 5J9PB 3GSWA 5IW1B 1J8HA 3ZKXB 3TZVC 4ZAKB 3CFIC 4IRSA 4DKAA 2G75A 1FC2D 2JKXA 5FXCH 3OAUH 5FYLH 1H5BC 8FABA 1KEGL 2R0LL 2Q8BL 4LAQH 2VLRB 5HHNB 2NZIA 4R4BB 5EBWA 2WV3A 2IAMB 1A7PL 4I4WB 4ZOAA 3QUXA 4AMKH 4EKXA 4XAWH 3WXWL 1RUPL 3VA2C 1JF1B 1Q8MA 1OPGL 1DBJH 5HHQA 1Q9OB 1CU4L 5J89A 4ZDHB 5K59E 2W0PA 4KI1A 1HYSD 3ILPA 5FDWB 3UC0L 5FECB 4FN0A 3QI9D 4UQ3B 1MFNA 4MSWA 2VDKL 4ZXBB 3J8F7 5DD5L 4KKLD 2AXGA 3FMGL 3I3BA 3SOBH 4KUCF 1VSCA 5EBMB 1BVZA 4FP8L 3CVHA 1L0QA 3FB5B 4LEOB 2GW5A 4L3CA 3QUYA 1UJ3A 3TH3T 4XMPL 4JDZB 43CAA 3MNZB 5EO0A 3MBXH 3LAFA 4HEME 4O2FB 3GNML 1KTLA 1OTSD 5JDSB 3L3DA 4Y5YA 1AP2B 5KZCD 1AGFB 4XPHH 3V7MA 1FYTD 4NM4L 3ZKMC 4L4TD 3C60B 4JPKH 5DYOB 4GRWH 1RZ7H 2LAAA 4P2RE 1KB5A 4HKZA 1S9KC 4MMXC 2PYEA 4ETYA 4D9QE 4EI5C 3PHOB 5CMAA 4E9LA 1IEBB 3DUSA 1JN6A 4JY4B 4GKZA 3VFPA 4OI8A 4TSAH 4OM1H 1MCJA 1NUNB 2W60A 3QG6A 5JMRA 3VWKC 4KZEL 4ZNEE 1N8ZA 1TLKA 3C08L 1F4WH 5DWUL 3MLXH 4CU8A 5FKAA 2DI8A 3ARZA 3BJLA 2HFEA 4G8GE 4X4XA 4JM2F 3MLWH 1ES0A 3FT4B 4TRPL 2FX7H 4XTRC 2VSDA 2DYPA 1NGZA 4IOFD 3DVGA 1FAIH 4X7SL 2VLKE 4OGYH 5L0QC 1IQWL 4TNVF 5AD0B 2N7BA 4JPIA 4IRJB 1FIGL 5B8CA 1FFPA 3F7QA 1X3DA 2HVJB 2J2ZA 3SQOL 3PGFL 2GYSA 2CDFA 3RGVA 4WO4B 1B6DA 2PTVA 1I9JH 3FN0L 3L6FB 1M71A 2R0ZH 4NNXA 1NCWH 3IRZA 1V05A 3HB3C 1QYGL 5ADOL 2EDTA 6FABL 1NGYA 5HYJA 2ZPKH 1SJHB 1IGYA 5DR5H 1JYXA 3OKYA 4WFEE 4OCXH 3LKOA 4X6DA 1ZLWH 1CT8B 1EGJA 2VQUA 4LIQH 4PJIB 4JG1L 1S8DA 4N0FA 5FGBA 2VZSA 4Q9QL 3GIZH 5IVXF 3BZEA 3G5ZB 1BBDL 1S9VB 4FABH 3IKCB 1E4XL 2GEEA 4J8RA 1KIUA 3ISWA 1AGBB 3VJ6A 1NGXA 4PP2A 5SWZD 1EO7A 1FGNL 1BD2B 4RGNE 3L95A 4WNQB 1MIEH 1YEKL 4U1KB 3BHBA 5MENA 5E56A 2D9QB 1YEIH 3WNOA 1DQLL 2VR9A 5EU5A 3O4LD 1ZMYA 5BMFL 2X4TB 3BPCA 3QEQE 4R2GB 3SDYL 5L2KB 3RRQA 4NFBA 4XNUL 4HHAB 2NYYC 4DUXA 1DQML 1D7FA 4PJFE 5KSBB 3JWDL 3QXAA 4M9PA 4LOUC 4KKAC 4ETQA 2VITB 1TCMA 5EOQL 1LWRA 2GSIB 4QOKE 4L8SA 1CFQA 1RULL 4KTYA 5DHXB 5TH2A 2DQGL 2HLAB 3D1MC 4YJZL 5ID0B 3S98A 3CFDB 4OLXL 4L4VE 2XICA 3UTPE 3TN0A 5B3JE 3V6FB 1DFBH 5J9PA 3G08B 1MY5A 5BQ7B 2YRZA 5IW1A 1G7MB 3TEUA 2BVQB 3STBA 4ZAKA 2ED8A 3O6FC 4HDIB 1PY4A 4YHLL 3WIHL 1P2CB 3VXMB 3PF2A 1RZ8B 2A77L 4YDJB 2VLRA 5HHNA 3FB8B 4R4BA 2IAMA 2CLRB 2YN3A 4PY7B 4I4WA 5D5ME 5J7CC 4PTTB 3STLB 1UM5H 2AQ2A 1JF1A 4HWEL 4KQ3H 3PV6B 4Q6IC 25C8H 1Q9OA 3TWCH 5LWYH 2OLDA 1WBYB 1CK0H 5C9JB 4ZDHA 3NPZB 3DI3B 5KVGL 4DGIL 2R23B 3WO3B 1E0OB 2OL3B 5FDWA 5FECA 2P5EB 1SBSL 3TIEB 1WF5A 2BY1A 4UQ3A 5ANMA 4KHTH 4XWOD 2MNUA 1JWMB 2RIKA 4ZXBA 1HKFA 3VW3H 3CLFH 5TE6H 5GGQL 5F1SA 4Z76B 1N0LA 1RZFL 3KYNB 5EBMA 1AD0B 5C2BL 1MCPL 1DQTA 4OFDA 3FB5A 3AAZB 4LEOA 4LSTL 3QWRA 4OCRL 4PLJD 4JO2L 5LGHH 1J0YA 3D18B 4O51B 4JDZA 4CN4A 3MNZA 2GJ6E 5CP3H 1YEGH 3ZYJA 4YXKH 2XRAL 4JRYD 2I5YL 2A9MH 4O2FA 2HTKD 4DTGH 3DRQB 4HPYH 4HH9B 4LSPL 5JDSA 5IWLA 2AJUL 1AP2A 3WSQH 1AGFA 5FM8A 5DYOA 1CLYL 5E5RB 4BFGA 3LHPH 1DR9A 2W38A 3TYGL 3PHOA 4KHXH 2X9XA 1IEBA 1R5VB 4TUKH 4ZSOE 4JY4A 1NBVL 2LVCA 4ELME 3MOAH 3TCXA 3RI5K 2X1QA 1OL0A 1MCWW 4JY5L 3IXAB 2NY2B 4OIAA 5FDYA 5AYUL 5E8PB 2LTQC 4NJ9H 4G6FD 4PREB 2JCCE 4XVJH 3EBAA 3AM8C 5C0GB 3UAJD 5C0CD 3SDDC 4ZFOB 1O7SA 2PTTB 1V3MA 3EJYD 4JPVL 1RSFA 5AD0A 3MRJB 3ZDZF 2AXFB 4IRJA 4EN3B 1CDJA 1LO3H 2WNGA 2NXYD 3F7RA 3RX7A 1G7IB 1FO0B 2HVJA 5C0DB 3LB6C 2WANA 5FM5M 4WO4A 2FB4L 1BJMA 2B4CL 1RIHL 1FNEB 3L6FA 3FO2B 5K9KB 3HZMB 4XHQA 5HYFA 4JO1L 1SJHA 4X5WB 1JWUB 3OZ9H 5EORH 1BMGA 1TVDA 3QCUL 3SGKA 2W9DL 1CT8A 4PJIA 5F88B 4PRPE 3QEHB 5CIPB 2APFA 5J13B 3CNKA 3G5ZA 5CZXD 3TJEL 1S9VA 4OD1L 3IKCA 3UZQA 1T89A 5ADPH 4S1SH 5AAWA 3VFRB 2ZCHH 1BJ8A 1I3UA 1HEZB 4JN2B 5T3XD 3KS0J 1AGBA 5E8OB 2B1HH 4EDXB 1UACL 3S3PA 3QUZC 3ZTNH 2CDEB 3RUGB 3TNNB 4U1SB 4WV1C 1BD2A 2MKLC 1F97A 3MUY1 4WNQA 4U1KA 1BOGB 4MA8H 1A3RH 1U8IB 3CLEH 2YPLD 2Z8WC 5IBUB 2X4TA 5L2KA 3WBDA 5TQ0L 3BUTA 1IAIL 4HHAA 4TOYH 4DGVH 5IB4A 3DIFB 2XA8L 3DNKA 3G6JE 3WJLA 1UCBH 3QT2A 5KSBA 3MNWB 1EHNA 4OT1L 4JRXD 1P4BH 3L3KB 2VITA 2GSIA 4PJ8D 2UZXB 3NIDE 1JHLL 1K4DB 4Y2OA 3GKWL 4R7NA 5E2UH 1Z0NA 1LILA 1GOHA 4PJXA 3MCLL 2HLAA