4BUHA

Human ige against the major allergen bet v 1 - crystal structure of clone m0418 scfv
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
252
structure length
237
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSEYSFPNYWIAWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGQVNISADKSSRTAFLEWSSLKASDSATYFCARLGGQLWNSYYYYYYMDVWGKGTTVTVSSGYELTQPPSASGTPGQRVTISCSGSSSNIGGNTVNWYQQVPGTAPRLLIYKNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCEAWDGGLRGGVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Ige Against the Major Allergen Bet V 1 - Defining an Epitope with Limited Cross-Reactivity between Different Pr-10 Family Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CLONE M0418 SCFV
total genus 55
structure length 237
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA01
1I3RB 1F3JA 3QIWC 1IAKB 2IMMA 3NFSH 3VG9B 1N64L 1T1YB 5DQ9B 3INUH 3BKYH 5KOMC 4GW1B 4JN1H 4UUJB 4F57H 4XBPB 3P73A 4HUWB 3WHE0 1KFAH 2A6DA 4PBVC 1WBZB 3KR3H 4UQ2B 3S7GA 2Q6WA 1NDGB 3RIAK 4LEXL 5CSZA 4X0KB 1V7MH 1CFSB 3F7YB 2VLJD 4ZNCD 5IW3A 4CN6A 5C08E 5J3HC 5T3ZD 4NKDB 4PIRF 4WFHD 3GJFB 4R4ND 4OZIA 1ZE3C 2ZUWA 2NX5A 3PWJA 4MB5A 1NCCH 2C4FU 1Q0YH 4XP5L 4NKIL 3U1SL 1WISA 1HILB 4BQ9A 1A1NA 2F15A 2G2RB 3W0WE 4RX4A 1G7IB 4KRPD 4X6BB 2FX7L 1QFWL 5JHDE 3G5XA 2OXGA 2FGWH 1U8JB 3GSWA 4PJ9B 1AIFB 3W0WA 4LARH 5C08D 4DZ8A 2HN7A 5GZOD 5IMLB 3L3JB 3MLZL 4M62L 2VE6B 4H20L 4WW2C 2DDQH 4PJ8A 4E41E 2XPGA 2LAAA 1RZJC 5KW9H 4ENED 3V8OA 1EEYA 3X11A 1JL8A 4R3SB 5C08A 1A4KB 4P3DA 1OTUC 2QADD 1N4XL 1CBVH 2AP2A 1OSZA 3I75A 3VFPA 3NZHH 2F53D 1HK6A 5E5MA 5ELIA 2DLEA 3W0WD 2VQ1A 3DUUB 3O9WA 3MGOB 4NN6C 4XVJL 3V6ZB 3IF1B 1IM3A 1CICB 3MQIA 4XC3L 2FO4B 4YO0A 3FO1B 4A6YB 3GUTB 1JNJA 2EYTA 4PB0H 3TO4B 3KLAA 3TV3H 4WUUE 5HPOA 2D4DA 2JJVA 3BUYB 3Q48A 5JQHC 3N9GH 4JG1L 2DBLH 1OP5K 1IGYA 2NLJB 4IRSC 1I85C 3QP3A 2Q8AL 4JM2D 5FA4A 2OR9H 3GK8L 4M7KH 5HHQA 4TSAL 3QCUH 4WI9A 4XPAL 5FYKH 1XCQA 5FXCH 3WO4B 1P4IL 1NCBH 2W1NA 3OX8B 3T65B 5I8OL 5DA4A 1QUNA 4F57L 1JPGA 5K9JL 3I9GH 4GRLC 2XI9A 1UB5B 4M7KL 3IGAB 3QO1B 4X6CA 3BKJL 4DUVA 2HJFA 1I9EA 2MQ3A 4AT6A 1MLBA 1JVKA 1P84J 3UYRH 4X7FC 1INDH 2XY1A 5FHBH 3WD5H 3MRGB 4Q9CA 4ELKB 5C9JA 4Y4FD 4LPXA 1RD6A 3T0DA 2OSLB 4YDLB 4PJBA 1A6PA 4LVHB 4L3CB 4FQCH 4P4KC 2DWDB 4ZFFB 1B2WH 4OZIE 4PTUB 4JKWA 4XNZC 1FJ1A 4NRZB 5F7DA 3FO2B 4OUUA 4DZBB 4Z7UB 3LQAH 3TBVB 3MC0A 3BWUC 5EWIH 1V05A 4RNRB 2GY5A 4FQXA 2Z0BA 5D7JB 1R5IA 4YZFE 3IDIB 5CMAB 5TE7H 1CGXA 1HHKA 3PHOA 2EDXA 1L9MA 5F1OB 1VADB 3IFLH 3U36A 4O2CB 2PUQT 2E9WA 4DKEH 2UZYB 1J0JA 2FZ3A 4AK1A 4F3FB 1L6XA 3ARRA 3QPXH 3SN6N 2QR0B 3AY4A 2Z9TA 2VWEE 5C0AD 1CGSH 1B0RA 4R2GB 3SKJH 4KZDL 3TT1H 1A1OA 1H9VA 5L8JB 1YMMD 3MOBL 5HI4C 2BXYA 4ZXBD 4KK8D 2CDGA 4X4YB 4NQCE 1JZ8A 3ARZA 2F58H 4RFOH 3PDOA 1U8NA 4O51B 4C4KO 1AQDA 4JEGB 4U1GC 5IMOA 3SJVD 1HI6B 4BH8B 2CK2A 3MLSH 2WMPA 4XPHH 5C0BA 3EO9L 3QQ3A 4PJGE 2V6HA 3TT3L 3P11H 1UEMA 1JPFB 2AAVA 3O4OB 2DJUA 3ILPB 4APQC 1LHZA 4Y5VC 4NT6B 1TJGH 1QSFA 2I60H 3HI5L 4I0KA 1NCDL 1Q9KA 4MA8L 4UAOC 4MNGE 4E0RA 3S36H 5I74C 3EYOB 4NHUB 2QQKH 1JFQL 3KDMB 2B1AH 2OJEB 4Z7UF 2OQJA 1HEZB 4Y2DB 3AS1A 5ACMA 4PTTB 3WJLA 1TVBB 5ADOH 1HKLH 4IMLA 1QRND 4Y4KA 5TPWL 3MRQB 4MA1B 4CU7A 5M7QA 2WUCH 1VB9A 1Q38A 3O6FD 2B7DT 3TVMB 1KELH 4RGNC 3QRGH 4S0SD 3UP1A 1DZBA 3QWRA 5F88B 3T77B 5I1LB 2O61B 5F7UA 1U58A 5GS0H 5DJDB 1XGQB 2ZJSL 4K3EL 3V7AG 3VDCA 4PJBF 3OXRA 4OZHB 3VFWB 5IFJA 1WCBA 1IGJA 1QBBA 3Q5OA 2WINB 32C2B 1T22B 4LGRB 1QZ1A 4PJIB 1MNUH 3R06B 2HLFC 3QFJD 3QPQC 3DYMA 3PJSA 2WBJA 4R26H 2WP3O 3DTXA 3QDJE 4ZOBA 1IM9A 5F9JA 1VFBB 3W2DH 1ADQL 1S7VA 1WAAE 4CVXA 2H8PA 5FGCB 3QHFH 2GJJA 1MCPL 3F58L 3IXTB 2CLVA 3OSKA 5J1AB 4MQ7B 2EZ0D 3FMGH 1CZ8H 2BZDA 1EFQA 2IAMA 1U3HD 5DMIL 2HG5A 4RWYH 4NCDA 4NKOA 2W9EL 4NP4H 4IM8A 1TXKA 1MRFH 4PRIE 2MCG1 1LK2A 1MFBH 2G60L 4UV7L 1J8HE 5HGDB 4N0YL 2P42B 2Z8VC 1NEUA 1Z0NA 3WYRA 4HJ0D 5D70H 3PQYB 4U1GB 1I3GH 1I9IL 2PR4H 4MJ6A 2OI9C 2JCCB 1YY9C 1BJMA 5FOBB 3KS0J 5KW9L 5A2JH 2NY0D 5AZEL 3TNNB 1T66D 3QEQE 4Y5VB 3QUYA 1PKQB 4Y88A 2V2WB 5GGVY 3EAKA 1IKFH 1AQKL 1T83C 3N85L 4PY8J 4GG6A 1PJ9A 3S34L 3VFNA 4N68A 4RBPH 3V8CA 2KH2B 3FZUC 7CGTA 5CS7A 1TNNA 2YR3A 3VA2C 4JZNB 2BMKB 1EGJL 5FYJE 2AJXH 5C0RH 3IDYB 1CE6B 2DKSA 1NFDE 4KJWC 4UDUB 4NUJB 4QRPB 1E4XL 3C60D 2AK4D 1KCRH 1HSBB 1KEML 2NNAB 5CHNB 1XZ0A 4WJ5B 4P2OC 1DL7L 3FRPG 4M6ML 4M6OL 4ZQKB 1IAOA 3U7WH 2ADGB 4MCYA 4TRPH 4NPYB 4LHUD 1S5HA 3MLYL 5J4MA 1ZVSB 5E8PA 4KK9C 4DKAA 2C26A 3IYLW 5IVZA 4NO3B 1MHHB 4WIQA 3T2PA 4XPGH 5CUSL 4ZS7H 2GITB 4PD4J 5D6CA 5C0JA 3I3BA 4CGTA 3WXVH 3T8XA 5E9DA 3WD5L 5IR1B 1JF5A 5D2LA 4FQHA 2JCCF 4CUCA 1FG2A 1FFPA 3KYOA 5AWNH 4PJXA 1UH3A 2EYRA 3BPOC 2IBBA 3HLAB 5HHMD 3H9SD 3WSQH 3G5ZB 5HDLA 2AXGB 3EFFB 2BK8A 2F8XC 4HV8A 2GAZB 4BM7A 4DUXA 5FDYA 3HI1A 2JELH 4X98A 3MLZH 1A6AA 1PQZB 4YXLL 4KXZI 5F7LB 1ZHNB 4KI1A 1T7VA 2F8OA 5EIIB 3OJVC 4N0UE 3QAZC 4MMXC 2QTEA 4DQOH 4DEPC 3BEWB 4CNIB 4NQEA 4NZUL 1JNLH 4O2FB 4F7TB 3P4NB 5E1HB 1NCTA 5EO9A 3QIUC 4GG8B 5LGKA 4I3SL 3SE9L 3LKQB 3NZHL 1RJLA 1YPZB 3U9PH 1S7TA 1AHWA 5B22A 2YXFA 2H26A 3B9VA 3MUY1 3G6JE 3SGJC 1RUMH 1CU4L 1A47A 2CLRB 2VKWA 5TDNB 5J9PA 1M05A 1EGJA 1R3KB 4UT7H 3KPMB 4IRJD 3PP3K 4FG6C 1RZ7L 4KKLC 2AGJH 2ICWI 3G6JA 4XNMA 1S5IH 5D7LB 4D0DB 5F6HI 3RIFK 3NCFB 5I1AA 1AKJA 4WTXA 1YMHA 1SJXA 5D6DC 4HUWA 1FQ9C 4QHMB 2NY0B 2R0WH 4JO1H 3UDWA 2EE6A 4BSWB 1BVKA 1H3UA 5B38A 3U0TA 1MRDH 5IB2B 4JM2B 3MUZ1 5IW1B 2H3NB 4ODTH 4PR5B 4GKNA 1NBZB 4MDIA 3TN0C 2BSTA 1JP5A 3P0YH 4OGAD 3ZE0F 1HKLL 4P0DA 1YC8A 5H2BB 3VCLB 1HQ4A 2C4XA 2GSIA 4Y5YB 5CZKA 4WFFE 3L5WA 4JGJA 2YPVL 4PP1C 4OT1H 2CLZB 2P5WE 2G2RA 1H3WM 3UJIL 2NTSP 4EN3B 4P2QA 2NY5L 4ZUUB 3NGBC 1F6AA 4KJPD 3HCVA 1AIFA 1IKNC 3DV4A 5F7NC 3QUZA 2EKSA 2BHYA 4UT9H 2JKXA 4KQ4H 4QOKB 4FQPA 3X3GL 2J3SA 3MNVA 4NCC2 2AJSH 4LCUA 3PWPA 4JG0L 5IFHL 3G6AB 1JI1A 1JWUA 2BVOB 2Z35A 1JHLL 5F1IA 5E2UH 5HVHC 3VRLF 3V52H 4XVTH 3MACH 1OB1A 1ZWIB 5GGRB 4Y1AD 1PLGH 3GMLA 5JW4M 5EOTB 3OKLA 5I73C 3GNMH 3BN9D 4BH7A 3T4YB 1B90A 4MNHB 5D1XA 4W81A 2FX9H 2FO4A 4YO0B 3GUTA 5FO9A 2MQ0A 1RURH 1VKXB 3RWEB 1KC5H 3KLAB 5GS1B 1N4XH 4HZLB 4P9HC 1U91B 4JFFE 2ZP0T 1MQ8A 5C0GB 4I77L 4GRMB 1D5BA 3TBSB 4Z7NE 3PP3H 1OT1A 3CFBB 4NKIH 4FXGB 3DNKA 4NRYA 3ULVL 1ZHLA 2GUOB 4RISL 1LO4L 2DLIA 1P1ZB 5GIRB 2DQJH 1IEAA 1S9VA 4UBDC 5J1TC 4LKCA 4K2UH 4LKXA 3D87B 1H3XA 3MUJA 4Y1AE 1RFDH 5EUKB 5CINL 3LD8C 2ICEB 5DTFA 5DMYA 1A5FL 3KPLB 1RJZB 4BUHA 3HZMA 1MWAH 1NAKH 4R7DB 1K85A 2NZ9C 2FBJL 2PTTB 2OSLA 4XT1C 3S35H 1T0NB 4HT1L 3WDJA 4QRTB 3B9KA 5I8KH 1KTLB 5AEAA 4HUNB 1U36A 3ULVC 3TVMC 5EO1A 3EOYG 4O58H 4P46D 4J3UA 4OUUB 3WNLA 3FT2A 4M8VA 3WNKA 1L7TL 2B1HL 1DEEA 4WFGD 4PJEA 2XT1B 1FNAA 5E8EA 2PO6B 1H3VA 3QCTH 3OXSA 4NOFA 4H0HB 3KAAA 2DQHH 3LIZH 3CLEL 1BFOB 2GY7B 4LSTL 2DJ4A 4QF1B 3F7VB 5ALCH 2YN5A 1KB9K 3SQBA 1JZ2A 3ZL4H 3AS2A 4U1NB 1M71A 2VDNH 1Z5LA 1CTNA 1F4AA 2DTMH 3ZTNL 5IGXH 3HG1D 4XHJC 4L3EE 3LCYA 1A1OB 3R1GH 3RWDA 5GS2H 1CK0H 3K8LA 1FZMA 4NP4L 1KNOB 1A7PL 3ZKQD 1LO3L 3C2SA 3SDAA 3DVNA 5LCVL 2ZUQB 4LPUA 3RI5K 2HVJA 5J06A 3VGDA 1DBML 1HI6A 3O0RH 3ROOB 1V8HA 2YC1A 4OJFH 1YMMA 3QUXD 1U8QA 1Q0XL 5DJCA 1J0YA 5MEPA 1K2DB 3HFMH 4AG4L 5ILTL 1QTYT 1S3KL 4J3WA 3GKWL 2HKFL 3MLUL 5C0AA 3FO1A 4KMTH 2OI9B 1PG7H 2FIKA 3B2UC 1WAAF 1WQVT 1NGPH 1YEFL 5A2FA 3CUPA 4RZCB 1UFUA 4GKZB 5J1SC 4YBQD 1QLRA 5CFHA 2ATKA 4MNGA 4S1DC 1QEWB 3NAAH 5FA4B 5EWIL 3OF6D 4L4VE 5J3HD 4WU7A 4M61A 5FGBA 1V3KA 1ZGLP 4POZD 1MCWW 3LRGA 3AU1A 4LMQE 4LIQH 5HPMA 2RR3A 4GT7A 1VGEH 2BNQE 3IGAA 4X6CB 5F7EL 4L5FH 4BZ2L 2VZ1A 3OHXB 5F88A 2IAMC 3C9NB 1EO7A 2ARJB 4EDXB 3MUGB 4H1LA 2X4NB 3LKNB 3UMTA 3BT2L 3BXNB 3FHAA 3OXRB 1ES0B 1AP2A 1JJUA 1XGPB 3AREB 1MF2L 1SJEA 5HHNA 4FFYL 4GXVL 4KDTC 3VFUB 4J3XA 3GK8H 2GFBA 3UCRA 2R0KH 1DSFH 4RAUB 4O2EA 5JORA 2DN7A 4OAWA 3WNMA 25C8L 1KJ2H 4J4PC 4HUUA 2GIYA 5FGBC 3ULUH 4D94A 3QXAA 4HQQH 4XNXH 1YEIH 1DDHB 1IGFL 4LQ1A 3UBXI 3BJLA 5IMMA 3BPOB 1GGCL 4UTAH 5MEQA 1UWGH 4JQVC 3WMSA 3D5OF 3D1MC 2PYEA 3PQYA 4QRRE 4KPHH 4NZJA 1MH5B 5DD5H 1U8NB 1XGYL 1LE5A 2ZCKH 4WO4C 1EJ6A 1DUYB 2VISA 2XY2A 1FCCA 3U9UB 2X41A 5DJZA 1T1ZA 3TZVD 5GS0L 4G8GD 4DTGH 3RU8H 3VD4A 5F7WC 4OSUL 3GDBA 1FDLH 3V7MA 4GRLD 1FV1A 3U9PL 2AK4A 3NA9L 3T09A 4BKLA 3SKNB 2YXMA 4XBEH 3MRCB 3DI2B 4R2GD 2HT3C 1A9BA 3DROB 1INEL 3DMMB 5DC4B 3KLHD 5IB5A 1A7OL 1F4YL 1H8OA 2ARWA 5DD1H 4HPOH 4ZOAA 3L3DA 4Z9KB 1MCPH 3F58H 4UDUA 4X9GA 4HX1B 4OLVH 2ADJA 3ARWA 3TV3L 5JMRA 4X80H 3MSPA 1G0DA 2W65A 4PP2A 2EDFA 1MSPA 1PVHA 2SEBA 4LSUL 4R6UA 2DQJL 1NGXB 5KS9E 1MI5E 2BY3A 1N2RA 1QPPA 5B39B 5DSCB 4CJ1A 2UYLA 3QJHB 1EHXA 1CFTB 3SDYL 3DECA 4MA8H 1NH6A 4PG9A 1RUPL 1WCBB 3U46A 1A3LL 2XIDA 4F58L 5IR1A 1VGKA 3TN0B 3ECBA 5DHVB 2A9NH 2OTPA 1U95B 4F2MA 2RIKA 1VFBA 1FNEA 2H41A 1IE5A 4QHKI 3GMRB 4QEGA 5SV4A 4KJYA 4L8SA 3SE3C 4GBXA 1M6OB 4M5ZH 3CSYA 3UO1L 3LDBB 3BE1L 1A6WL 3ARQA 1FL6B 1ZT7A 3DARA 3QEHA 5JMOC 3MRPB 3OJMB 2XQBL 3J8F7 4L4TB 4APQD 3WIFB 2YPLE 5DT1H 4LSDA 1IAIM 2XA8L 2D7QA 5JPNA 4OZFB 4ZAKB 2V17H 4AMKH 4RRPG 1QFOA 2YA1A 4GG8A 2Q20A 1MCNA 1KEMH 3LKQA 5LKNA 3W2DL 3RRQA 2XN9A 2BY0A 5CWSA 3ZTJG 1OPGH 3GIVB 2AQ1A 2QHRL 5E70A 1AHWB 3MA9L 2V17L 2NY6B 3FB8A 3E3QC 5J9PB 2P49B 1FZOB 1DBMH 4F33A 5FAAA 1INEH 4I77H 1FGVH 3I3DA 1MJ8L 5BVJA 3GM0A 4OV5B 1JGDB 4WI3A 3UJJL 4HDIA 3RTQC 4UILL 1UM4H 1OGAB 1N3NA 4L4TE 4M1DL 3UJTH 3QDHA 1AGDA 1P2CA 4OCXL 4QHMA 3S8WA 4K2UL 4WTZA 3OJ2C 3QAZB 4FQ1H 3FT3A 4NSKB 4MCZA 3GEWB 3WIIH 2A9ML 3MCLL 2A6JB 3T0WA 3RQ3A 5IB2A 5A43C 1X5IA 1R3IL 2IALA 3MV9D 4ZS6D 1JFQH 1MWAL 2UWEB 5I71B 1ZT1B 4U2YA 1IL1B 3E8UH 5HYSB 1UVQB 1WBXA 3LMJH 2I9TB 3CFIC 2VKXA 4IJ3B 5F6HJ 1WAAA 2AQ3A 3BPLC 4LLDB 5D6CB 1VCAA 4O5LH 4JANB 1CDHA 3BOVA 3L3KA 4I18B 1JGVH 1UKQA 2EDHA 4KHXL 1NJ9B 1EGJH 1MQKL 4X8JA 4BSVB 1B0GB 3EFDH 1OARL 1QR4A 1WIUA 4HS6A 4OGAC 4WCYL 5DJXB 4MB4A 5HHOB 3K1KC 4G9FE 2J2ZA 4OD1H 3CZFB 3DRTB 3FB5A 4O4YL 3LKSB 2PO6C 2RQ8A 5GISH 2R4SH 2NY0C 3PWPB 3C60B 3BH9B 5AYUH 4HC1L 4EI5A 5KSBF 3BAEH 1KIUA 5DEFA 4HLZH 1PQZA 1RIUL 2DTML 4FFWC 3ZTNH 4JFPB 4JJHA 1QLEH 2FD6L 4JQIL 3CMOL 1NC2A 1I7TA 1IGTA 2VXTL 4KRPC 4UINL 1KPUB 2Q8BL 2CRZA 3MV9E 3DBXB 4XPBH 1KLGA 1LO3H 5EULV 4LSVL 3T4YA 1YY8B 4P5KB 4QXGL 5GZOC 2QHRH 1QHOA 3I3EA 1A0QH 4HWNA 5DJ6A 1DN2A 1QG3A 1Z3GL 1RVFL 4HMCA 3B9KC 4F80A 5DVKA 2ATPA 4GRMA 4LBEB 3V4VL 2FCBA 1K4DB 5TDNA 5CJ8A 5FYKD 3T0EC 5IJKA 1LO0H 1BOGA 3E6HA 3BN9C 5KVEH 2XZAL 1BX2B 1S8DA 2ESVA 5SWZB 3UTZA 5MHSE 3P4OA 2VXVH 3LPFA 1EAPB 5IFAH 2C3XA 4KU1A 4CMHC 3VXMD 4I0PA 5FGSA 4XCEB 3KXFE 3F5WB 1T2QL 5IQ7H 6FABH 4U6XB 5FCSH 1TQBC 4XBGB 4C56A 1AO7E 4S1RH 3QR2A 4GUPA 3FL7A 1TETH 4GKNB 1HCVA 1NBZA 3S34H 3O9WD 5F21B 1MCSA 3UBXB 5ABDE 3QQ9C 1IILE 4KXZH 4N8CL 5FECA 4NJ9H 5E8DH 2J12B 4ZD3L 3VXSD 5GGQH 1QLFA 3WN5B 1MHPH 2CUHA 2DQFB 3MBED 5HDBE 4XWOC 3OJDB 4ZPVA 1WV7T 2X4QB 5CJXA 4ZUUA 1BREA 1QVOB 1BFOA 4ELME 1CXKA 3ROLB 3S3JA 1F4HA 5ID0B 5D2NA 3A6BH 1KSRA 1S9YB 4PJFF 4WFHE 1PEZA 4M9PA 2B1HH 1WTGT 2XZZA 3QH3B 1IT9L 1I1FA 5HY9B 3RWDB 5BRZE 4I1NB 4C54A 3CX5J 4X6CE 2YZ8A 3EHBC 4PJCA 1KG0B 3TJEL 5FUOH 4YDVA 5FYKL 2IPUG 3C5SA 1W8OA 3JWNC 5BZWB 1YEGL 3HMWL 3W39B 3IVKB 1ONQB 4OLUH 1RULL 4NNPL 2YWYA 2APWA 4U1SA 4XAWH 5LGHL 1NAKL 3TO2B 4BH7B 5J13C 3STLB 1FZJA 4HXBH 5L9DH 1INDL 1FLTX 5JNYB 1NCWL 5EU6A 2C5DC 4NWUL 3VFMB 1IVLA 1FL5B 5I6XB 3EJYC 1U91A 1WT5A 2R9HC 2IGFL 3LVEA 3UROR 2RFXB 3LAFA 2XN9E 1J8KA 3D69A 5FYLH 3U7YL 1DANT 3MGAA 1A14L 2AK1H 5D1QC 2V2XA 1WICA 3AM8A 3A67L 1P1ZA 3I2CL 5GIRA 5C9KA 1S9VB 4HK3J 1RUQL 2HN7B 4MZ2A 5T33H 2OZ4L 2VE6A 3PWLB 4XB8A 4TPRL 2X05A 5EUKA 1BBJB 2X4SA 2ICEA 4OCWH 3ORJA 3QNYB 2NY1B 3IDMB 1NDMB 4NC1E 3WS6A 4CADA 4Z95L 1MNUL 1NLDL 2ZUQC 2K1MA 2F53A 1TQBB 4JAMB 3VWJD 1QR1A 15C8L 1FO0L 1MJ7H 1H3TA 4K3JL 3LKNA 3H3BC 3HR5B 4Y8AA 1OLLA 1E0OB 4KV5E 5K9KB 1AP2B 1XGPA 3VW3H 1NGQL 3QO0B 5FEBA 1MWAB 1MFNA 3P30H 2D9CA 1G7JB 3GMNB 3VFUA 3KYNA 3BDXA 3TO4A 1CL7I 4KH2A 3VMOA 4PRAB 5T3ZE 5DK0A 4LF3A 1OP3K 2VZTA 2L7UA 4LSRH 5D1QA 4HUUB 1QSVA 4H1LG 1CLZL 2Z91A 4NN7C 3HRPA 3TBYA 1XCTA 4M7LH 3F7VA 2EXWC 3QDMA 2EE3A 2X4RB 3HC3H 3MJ9H 4CU6A 4Y4KD 1AGEA 4MX7B 2BOCB 4S0TD 1AC0A 5AZEH 3V4UL 4J3SA 3ILQD 3HC0A 4JFEE 4YX2L 3REVA 2EXWD 4HKBB 4XPFH 4KI5C 1IKFL 1DUYA 5IBUG 1WUNT 1F3DJ 1Y18A 4HFWA 5DYOB 5TDPB 3B6SB 2YEZA 4QHNB 3WFZA 2DBLL 3OAYH 4WWKD 4RFNC 1RZJL 3PHQA 5GGVL 1QRKA 3OKDB 1JWMB 4M93B 1DE4B 4AIXA 5KVFH 4HPYL 2BDNH 5ITBH 3PGCB 3QIBB 4HHAB 2NW2B 3AFLA 4WI8A 2OR7A 4G8EB 5JW4N 4F7PA 3PHOB 2W92A 4XNUH 1Z9LA 2ZKHL 3JV4A 3QPXL 4NRXA 1QEWA 4OQTL 3JBG7 4NQVA 3T08A 4FABH 2VRAA 2VDOH 1JGLL 4B7LA 3TZVC 4LVNC 4S11A 4PJ7E 4XNUL 1SEBA 3B3IB 1ZXQA 1AR2A 5SWZE 4UNUA 5EZJB 5MHSD 1MCDA 5IEKB 4XPGL 1JYVA 2FJGA 5D8JH 2YSSB 4FQQA 2P8LB 4WU5B 3FMGL 1DUZB 5ISZB 4R2GC 1ZSDA 5FCUH 3CFEB 3HZYB 4KKAD 4WO4B 3GI8H 1WFUA 1W2KT 3BXNA 5IMOB 4QHKJ 1AFVL 2YK1H 5I1GL 5IROC 1Y0LB 5GRVK 4XXCA 1MVFA 2ICWA 1UJ3A 1IARB 1C5DB 3FOLA 4L3ED 1DBAL 4KJWD 1XFPA 2HJLB 2L4OA 1B0WA 1ODAA 2HTKC 1BFSA 6CGTA 4OI9A 2Q1EA 1JPTL 2XRAL 1HDMB 4PGDA 4ZUVA 4HGKC 5CD5D 2EDBA 2X1WL 1CXLA 3OZ9L 4GBXB 1M6OA 4E5XB 3VWKA 4MQSB 2J8UB 1RZIB 3KPQA 4I18C 4ZNEE 4RWHA 1AD9B 4AH2B 3O2WL 2PYFA 3IETA 2QKIA 5B3JF 2H1PH 1BQLH 4X6EA 1BVZA 5IBTH 4TUJB 2BNQA 5HHOE 5K59E 5I16B 3RL1A 3WNNA 3E1F1 4B5EA 4LPCA 4KRLB 4LSQL 1TZIA 4GLRI 2GJ6A 1MH5A 1XGQA 3H9SA 5E95B 2DKMA 1HKFA 1TJGL 1T20B 3FFCD 3FQNA 4M93C 1RY7B 4UTBH 3RNKA 4YPJA 4FZEH 4XC1L 5GGSA 4OZIF 2ADIA 5F7FA 3BGAA 3IU4L 1BM3L 5JXAH 3VFOB 4CVZB 5KVGL 1T0MA 1T1WB 2DOCA 4GO6B 4XP4H 2C1OB 2XTJE 4RDQF 1LEIB 4PGBA 5IQ9A 4OF8A 1JF1A 3FN0L 5IWLA 1BIIA 3EDDA 5KVMC 4ODVL 3D39B 1JGDA 3F62A 4XPAH 5JDJA 2VDOL 3CJJA 1DR9A 1KELL 4U6HA 3QIUD 2Z8SA 3VFGH 1MVUB 3I9GL 5LGJB 1WITA 4NKOB 4IOIA 3TIDA 1GSMA 1D9KA 1MHCA 2JTDA 2Z31A 4D9RD 4DGVL 5HHPA 1S7SA 5HGDA 4KROB 1D5ZB 4J1UB 2NXYD 5D5ME 1C12B 4RA0C 2E5EA 3NCBB 4GRWH 3NIDF 3X3FL 1NAMA 1T5XB 4WUUB 5IBUB 1IL1A 1BD2A 1JNHA 1TCRA 4EXPX 1N2RB 3S3SA 3TM6A 5F9AC 4S1RL 3CC5A 4JZOB 3MRDB 3C09B 4OFPA 3GSRB 3WIHL 1YNKL 1WBZA 2O5ZH 2K7QA 3HNSH 4PJ9D 2VJXA 3UEZA 3PWPD 1CD1A 3C2AL 4G5ZH 2FECL 3QUMH 1UZ8B 1UACL 2DI8A 2VXQH 3NFPA 2DQIH 3WFEH 3D18A 1EFXD 3RTQB 3F12B 4KV5F 2CD0A 1R5WA 1S7WA 1WZMA 1XH3A 3VJ6A 3MRMA 3C60A 5BOZG 4P2QD 2PN5A 4NQXA 2APBA 5IV2B 1RIHH 1RZ7H 1IGIH 1HH6B 1NFDB 4WCYH 2WSKA 2YD1A 1FLRH 2GTZA 1HSBA 2YD9A 3AS3A 4MWFB 5I71C 2QEJA 4NNXB 1XR9A 4OFDA 3W0WB 4O4YH 5TF1H 3HS0A 4IOSD 4F58H 3SBWA 4NZRH 2VDMH 3L3JA 4YEFA 4X6DE 3N9GL 1QACA 1U8KB 1FVEB 4XI5C 2PCPB 3ZT5A 4WTWA 4P2OB 5E2WH 3HE7D 3V6OA 3RP1A 3MLRH 2XN9B 1QLEL 1KACB 1A3RL 3OKKA 2VDML 4KDVA 4JFFA 4IS6B 3MLXH 1FFRA 2ED9A 1MI5B 4FQHB 4LBEA 2Z4QB 2HYMA 4IDJH 2APTA 4PJ7B 4GOSA 1P5UA 4U6YB 4ERSL 2CSPA 1UXSB 4MD0A 2C1PB 3RY6A 3LZFL 3EUUA 2EYRB 5DWUH 5E8OB 1G0YR 5IT2H 1LO2H 2O5XL 2EIBA 3MGOA 5L8KB 5DGRA 1QNZH 5JUEL 1TZHA 2AK1L 3ULSB 5ENWB 2C3VB 1U6AH 4EJ1C 5HXMA 1ZLSL 2IANA 4JO3H 4U6XA 4ZFGL 2Y7QB 3PP4L 2Y5TA 2FGZA 4HFUL 5GRZA 5IESL 1C5CL 3RIAF 2IALB 3BEWA 3T1WA 4CNIA 8FABA 2N7BA 2I9TA 1JWSA 2H2PC 3D3VB 3C09C 3PABB 2BHZA 2VXTH 2XTJD 1AC6A 3T2NL 1AD0A 4UUJA 1EPFA 1FNHA 1R0AH 3HAEG 2AJ3A 1H8SA 2HWZL 3QUZD 4UQ2A 5D71L 4ODWA 2R8SH 1L0XA 4PJBB 4RX4D 5J57B 5ID0A 4RQQB 1CLOL 1X3DA 2FATL 4K7PY 5FGRA 4FNLL 4KMLB 5GJTL 5ADPL 2EEAA 4JDZA 1OY3B 1ZT4B 3O6FB 3PIQA 3QUZC 3TVMD 3MLVL 2HH0L 4Z7UA 1AKJB 1IEBB 1QSEE 3PXJA 3ZE1F 1XGUB 3QDME 2BSED 4H5SA 1GZQB 4EUPB 5E94B 5DEFB 2PTUA 1R5IB 3G9VA 1SYSB 4UV4H 4XPHL 5DA0B 4D3CL 2VLJA 5LAXB 2WIIB 3I50L 5TF1L 3IRZA 1NC2B 2X40A 3WLWC 3IVKA 2YBRA 3MBEA 3KPPB 1A22B 4M5ZL 4UNTA 3VXNB 3TO2A 4IHOB 4KWUA 3DX7A 4L9LB 4KTDL 3EOAB 1I4FA 1QFPA 2F5AL 4K7PX 4M7ZB 3TWCH 4LOUC 5JO5B 4I5BA 3RWGA 4U0RB 5GGVH 1OGTA 5DURD 2Y9RT 5C2UB 3EJZC 5IB3B 3GJFK 3SGDH 3MV7E 4BH8A 2V2XB 4HXAH 1X44A 1GGBL 3OGCB 3SDCA 2X42A 4YC2C 1KENL 5C0BB 3V6BR 1NBQA 4NQCB 3G5YB 3OKEA 1WIOA 1JF6A 4L8BA 1FG9C 3LHPL 1LP9E 1QSFB 1U9KA 2DQHL 5D9SB 1PEWA 4L4VB 3V52L 5DEGB 4JHAH 1CLCA 4HIXL 4K94L 4F7CA 1DL7H 3EYOA 4DGYH 3KDMA 4I0CC 3BI9X 4R8WL 4PV8A 1A0QL 2P8MA 3RVXC 4P57B 1YC7A 5C0FA 4JKMA 1XF3B 3QUXA 5K9KA 5JPMA 1CDCA 4OZGE 1TVBA 2X9XA 3GI8L 3ZTJH 2BNUA 4YDLC 4G6JH 4ZO7A 3DI3B 3TA3D 4PRID 4O00A 3MRQA 1RHHB 1UB5A 2JF1A 5I73B 1SMOA 4DW2H 3TVMA 3WN5A 1QO3B 5GS1A 2EDRA 4HZLA 2DIBA 5DK0B 4HIHB 4DGIL 1EEZA 3DSFH 5EA0H 1WZLA 2B8OT 4ELKA 1CQYA 3EYSL 4WGVB 4KVNL 3TGXA 3IKCB 5DJYB 2EIDA 1WGOA 4NNYA 1D6EA 1DQDL 3F6IA 4GXUN 4ZXBA 1RZGA 3P9MA 2OMNA 1T5WA 1CD8A 2Q76B 3ME0A 4AM0A 4HC1A 2X89D 1HE7A 1YECH 1U3YA 5F9WC 4YBHA 2FGWL 3EO0B 4RNRA 4CVXB 4YFEA 1UC6A 3U0WL 3T3ME 2A38A 2OZ4H 2X89A 5LBSH 3MV01 2XFXA 1ZANH 4U6TA 4W6XB 5HHXL 1R3HA 1AO7B 4S1QL 2NW3A 4HIIA 3B6SA 4MXVE 4L9LC 4QHNA 2MJWA 4WUKL 3STLA 1BLNA 2NY4C 4TOYL 4R90H 2VQTA 2V2TA 2ERJC 3O3AA 3QG7L 1U3HA 5C86A 1ZA3A 1C1EL 2BC4A 1CICD 3VXSE 1XF1A 5IVOA 5MERA 1QD0A 1TDQA 3BT2H 5FFLA 1I8IB 4WHCA 2JJSA 2E8ZA 2OP4H 4APQB 2VR4A 5L6YH 4Z0BH 4TYUA 1MFCH 1OAUH 2Y23A 2JJSC 3W5MA 2GW5A 2DM7A 1U93B 3KHQA 2GK0B 2YRLA 4G7VL 5FO7B 2YOCA 4HMEA 4Y5VA 3U7WL 3HZKB 4N8VB 4ALAL 3VWJA 3CFCH 2YSSA 1VPOH 1N0XH 5CP3A 1K4CA 3Q0HA 3MODH 4PRPA 2ZOLB 4M1CD 4WHYG 4E41B 1ZSDB 3I02A 4IRZH 4XWOD 1JRHL 4M6NH 5IT2L 1F97A 1T83A 1YEIL 3CVIL 4R0LA 4YBLB 3K1DA 3SGEH 2OJEA 4XNYL 3HR5A 1CGYA 3FN9A 5HGHB 2QSCL 4O9HH 4G8FB 3U4BH 3LEVH 1BZ7A 4XVSH 2Y07H 4NKMB 3QO0A 3MUHL 4JVUA 1CFQA 2NR6D 4PJCF 4QRQA 1C5DA 3FOLB 4WNQA 4JJ5A 4JO4L 4LLWA 3QDJA 2J88H 4K7PH 5C09B 3IDXH 3RUGE 1MRCH 1AGCA 1QFWI 4PGDB 2A6KB 3BP6A 5E0QA 5KVDL 1YEKH 2AJUH 43C9A 1P7HL 2JB5H 5DQJA 4NPYA 2ATKB 3DVFA 2NR6C 4JKKA 2BDNL 4RRPA 4WU7B 3VI4E 4AEIH 1FORL 3HAEH 3U2SB 1GPOH 1TENA 4LGPB 4AEFA 4WHTB 1T22A 1YEEH 2HAZA 5D2LB 5HPMB 4LLUB 4G9FA 4PG2C 4P3CL 2PNDA 3DTXB 3J7HA 4KMQA 2F19L 1ZLWK 1S7VB 2XYCA 1A4JB 3RVWD 3MROB 4JDTH 5HI5D 3WFDH 1X4XA 4FMFA 4LRIC 1G7LB 4PY8I 2X4NA 3WKNA 1PKOA 4ZFOB 3OR7A 4D8PB 1T20A 3FQNB 1J10A 1RJCA 4TOYH 1IQWL 1E6JL 3RNKB 3HC4L 2AEPL 2GJZB 1ZEAL 1AFVH 2YK1L 4YHNB 1BOYA 2NY3D 3B2VL 1F02I 3PV7A 5KG9A 3T0XA 4QRRA 4HWBH 4PGBB 5CZVL 5IQ9B 4HHAA 3FTGB 3V9FA 4HH8A 1LO4H 4XNXL 2ZSWA 2QQNL 1R3IH 2O5YL 3PWNB 2FWOB 3BIBX 2PW1A 2W9DL 2VLME 2AXFA 1JZ6A 5D7IB 2J8HA 2IQ9L 2R2BA 3QFJE 4XMKL 1D5ZA 2M1KA 4N90E 1BPVA 3VGBA 4MJ5A 1SQ2N 4EDWH 2APVA 5HGGS 4M4RA 5B21A 4Y19B 1BD2B 1JNHB 4ZO9A 4HWEL 3SDXF 3LPGA 1M7DB 5ACLA 1DQTA 4XCNB 5D93C 1OQXA 5E9DD 3RGVA 5DGQA 3CC5B 1GAFH 4RGOL 2RCSL 4EUPG 2H45A 5IG7A 3MLYH 1XIWC 3JSSA 4Z6AT 3IS0X 5D6DA 3HNVH 5TH2A 3BWAA 2HJLA 5B38B 3V2AR 1WTLA 1C7TA 1X5HA 2VR5A 3RDTD 1B3JA 4ZQKA 9CGTA 1IAOB 1A9BB 3HE7A 3DROA 3FHQA 5M94B 4KGJA 3QXDA 4MNQA 1D5XA 1WWCA 3BMVA 4AEEA 3ZDXE 4XP4L 1AY1H 3UTPE 1W8NA 5SV3A 3VH8G 2EH8L 4JHZA 3JZ7A 4YHPB 2PYFB 4HX1A 5BS0B 2DQIL 5EOQH 4OCRH 2YRPA 4PJIF 4V1DE 1FNLA 3TYFA 1J11A 5DI8A 1DBBH 3QUZB 2Y6SD 2ARJQ 1T2XA 5ANMB 5FDWA 3JTSB 1X6LA 1WC7A 1HHIB 4KJQC 1JHKL 3QDGE 4NQED 4XX1G 1EFXA 5I1KH 2VMFA 2OX5A 1JPTH 4OQ1A 2AXJA 3GMPB 4KRNA 1HHGA 2FECI 5DFVD 3QSKB 5D5MA 5LJYH 1RZKL 3GIZH 3S4SB 2PO6D 4QTIH 3V6OE 2VDRL 1ITBB 1QYGH 2ADIB 2VUOA 1VGKB 3QBTB 2Z4QA 3ECBB 4WFFD 3H42H 2BP3A 4FFWD 5C6PB 3DPBA 4HWBL 4LCYB 1T1WA 1UKSA 5D7LD 4XVUC 1SJHA 1QFWM 1ZGLB 3GMLB 3TC9A 3MNZB 1JK8A 1F45A 3CFJB 3MRJB 5D1XB 4UT7L 1BIHA 3F7RA 1JZ5A 3PGDB 3S35L 2A74A 4XC3H 3HPJA 4I9WD 1EMTH 4NJ9L 3ZDXF 4NYLA 2H26B 4PRDA 1D9KB 1MHCB 4OM1H 5HHPB 4GMSH 1IFHH 4FXGA 4J1UA 3RX5A 2FJFB 5DJ8A 4X7EC 2Y06H 8FABB 3H9SE 3W82A 4WGWB 4G7VH 3NFNB 5C2BH 2F54E 1KPVB 3C8KB 2A83A 2FD6H 1URLA 1YMHB 3GIVA 1FO0B 4NKQB 1GZPA 1X5FA 4L3AA 1HH9B 3AROA 4OFKA 1M4KA 2X9YA 3KGRA 2WWKO 1EZVX 4Y5XB 3ZYJA 4RQQA 3U7AA 3BZ4B 1OF2B 2WUBL 1J0KA 4MDIB 5FUOL 2X1XR 1C08A 4DKFH 4UIMB 4DCQB 5EB9A 3UTTE 4H0GA 3PIQB 2E6PA 3P4MB 4JFDA 4TSBH 1XGUA 3DVIA 1YN6B 3SOBH 4PJEB 4NQXB 4HULB 5KVDH 2R2CA 4FZ8H 5D7IF 1OLZA 5ESAB 4Y1AB 5FYJD 4TSBL 4LCIL 5F6IC 3GMOB 1LE9B 2C3GA 4RSVA 3LV3A 4LLYA 4YZFF 4WW2B 3WEXB 5KOVC 3HNSL 3BUTA 4IHOA 3BDYL 2OJZH 2NPLX 4JVPA 1PLGL 2WZPD 3EOAA 3NIDE 3OB8A 1CN4A 4JFHE 1BVLB 4BZ1L 5E6IB 1FAKT 1G6VK 4NQDA 4KKLD 5KSUA 1NFIB 1Q9OA 1OGTB 5CBAB 4IJ3C 2VDLH 4PRNB 2XKNB 4PLOB 3UTSB 3EHBD 2B2XH 3QDGD 4PJ7A 4WI2A 3BPLB 4KUCF 4UNVA 3ROOA 5HYSG 5J7CC 1F90H 4Q58C 1A21A 3OKLB 5CJBA 5E8OA 3VA6A 1QFUH 3MJ9A 5J12C 1A6TA 4QLRA 4HC1H 2VAAB 4RISH 1KJ2A 2FL5B 3BN3B 1QRNB 5FM4A 3HUJB 1CFNB 1DVFD 1NAMH 4P46C 4P4KD 4DWHA 3CUPB 4L4VA 4OM1L 4FFZH 3H9HA 1UH2A 3LMJL 3IJSA 4LHQB 4C83A 4U1LA 3ZT7A 4MNGB 1G9MC 2E6JA 3QYCA 4AYFA 3LKOA 1CTOA 1PYWA 5JPMB 1G7PB 4LCWE 2LTQB 5C09E 3RZWA 4U1JB 5I1JH 3ARGA 5KS9F 4OF0A 2FBOJ 3QUKB 5KTEH 4LMQI 4X7TA 4P99A 5EBGA 3LKPB 5D1XD 3TCLA 3QWOB 5KZCD 4JPIA 2F74B 1IC7L 3KPLA 3U6RA 2P5WB 2WW8A 1PZ5A 2R2HA 3ARGD 5D7JD 3WJLC 4EVNA 5FF6A 1K5NB 5HYJE 1ULVA 3IFPA 4H1LB 4FTVA 3TPKA 3MRIB 4F9PC 3HN3A 4FS0A 3B9KB 1GOHA 1H5BB 3GM8A 4IIQB 3PNWA 3O6LH 3TPUA 5HHVL 4ORGA 4JM4H 4EEEA 3HI6H 2R2EB 2Q76A 2FX8L 4P2CG 1IC1A 4F7EA 4XB7A 3CDFA 3KLDA 2IFFH 2IADA 5D7JC 1R24A 1H0DA 1OTUD 2QADC 1FYTD 4OI7A 5EZLB 2DQGH 1XF4B 3F5WA 4ONGH 3TBWB 5EC1B 1S9WB 3UPCA 1I9JL 1TITA 1MJJA 4KVCH 3GJEB 1P4BH 3WFCL 3TT1L 5BCAA 1Q9LA 4JGMA 3BQUD 3RWHA 1JN6B 3S37H 5I30H 1SM3L 2BHUA 5IIEB 1J8HD 4NO2B 4LASL 1QSZA 5MEQB 1QLFB 2BC4B 3MACL 4ETQB 2EXYD 2OR8A 4OM0H 1K3ZA 1S3KH 4I5BB 1WFNA 3B9AA 5DC0A 4OCYH 4N0UA 4NO0D 2N4IA 4PJDE 4Y4FB 1J18A 4DN4L 4BQ6A 5BOPA 2Q7NA 5J12B 5FM8A 1CDUA 3OGCA 4W4NA 3QWQB 5IROA 1ZLVK 1NCAH 3T04D 1A5FH 4XNQB 5GRYA 1NAML 1I1FB 1F2XK 2AK4B 4LSRL 5E1AB 3VH8B 2W0FA 4OB5L 5I74B 4M1GL 4PJEF 4LGSB 4PJXE 2WAHA 2P43B 1G9EA 5HVGB 4PJFB 3VFSA 2YUVA 2XRAH 3QDMD 2BFVL 4UQ3B 4P57A 3W39A 2EYSB 1KXTB 2H9GA 4MA1C 3PL6A 3G08B 2Q7YB 2IEPA 3KYMA 4XPTL 2EZ0C 3NMEA 3VFMA 1AGCB 1E4XH 1FL5A 4JO3L 4ZFGH 2GCYA 1RUKH 2OZ4A 3GI9H 4B50A 3CH8A 3G6DH 1B2WL 5I6XC 3MLTA 3ARED 4WDIB 2IBGA 3QJHA 3UX9B 3L9RB 1KJ2L 1UKTA 1RZGB 4UOW1 3U46B 3M17A 4LHJB 3K4DA 3MRNA 2GFBB 1N8ZB 3LSOB 1DBJH 1FNEB 3QNYA 3IDMA 4OQTH 1MUJA 2FHFA 5JORB 1NCBL 4PV9B 5EPMA 5BVPH 2BY2A 5CD5C 4G8GB 2NY1C 4DW2L 1I1AA 2Z8RA 1PY9A 2NXZB 3QXAB 5BRZD 1Q0YL 4XP5H 4YJZL 3GKWH 3MLUH 1R3HB 3K4AA 1FPTL 4I3RH 4ZDHB 1JRHH 5B8CB 2HTLC 5EH1A 3FOMB 2V2TB 5FM5O 1Z3GH 3IU3A 4XRCB 3MOBH 4TTDD 2GJZA 3UTTD 4DVRH 3THML 4KUZH 4HJ0C 2BNQD 2A6IA 5JHLH 5MERB 4PRAA 1CLZH 3WXWL 4BK5A 4KDTA 4F9LA 4OZFA 4ZAKA 4APQA 3VGAC 1RZ8A 2R23A 3N1MC 1B4RA 2CGRL 3HG1E 2FLBT 3O2DL 1K3IA 4M3KB 2VISB 4JRWA 5DO2D 1JI2A 4M00A 1IAIH 3VWKC 2X4RA 1NBVL 3DMMC 5BRZA 2IH3B 4LSPL 3CDGB 3H3PL 3N85H 1E4JA 4U05A 1U8OA 5F89B 4H26B 2XN9D 2DMKA 4QHLB 1A7NH 1EBAA 1E6OH 3CFKB 5KSAD 4U1MB 1L0QA 4P59H 5L88L 5BVJB 1KCKA 1P53A 1ZAGA 1OTSC 1UM5H 4BYHA 1F4WL 1J05B 4HT1H 1ORSA 1V3LA 4LCCB 1B4JH 2KUTA 3RGVC 3RWCB 1BZ7B 1RZKC 4G9DB 1JUFA 3L3DB 2OP4L 5FGCE 3C60C 2XWTA 3EYQC 3MRLA 5DRNA 2Q86B 3IFNL 3RWFB 3QDJB 3QRGL 4CJ0A 3PF2A 5C0EB 5TFSH 1F3DH 1NMCB 1VFOA 2I5YL 3MJ6A 5IVXA 1EZVY 5HYSA 5I1JL 2X9WA 3G9AB 1UVQA 1WBXB 5IHZB 4JLRB 5B39A 3X14B 4RCAA 3UDWC 3HPLB 5JZ7D 5IF0B 1IMHC 4LL9A 4FFVC 3RL2A 2DMBA 1NCNA 4GAGH 1AJ7L 3L3KB 2X6MA 4HUVA 3RVTD 5BS0A 1DQML 3Q6FB 4KJQD 1A6WH 4WO4D 1B6UA 3BRGC 5F8RC 4FQQB 1B0GA 3WKML 2YMXH 3SKOB 2IPUK 3FB6A 4GW4B 1JTOA 3O6LL 1ERNA 3CZFA 2OYPA 4ODHL 3TYGH 1ZHBB 4KZEH 1G9NH 4PPTA 5KVFL 4ZAKC 3C5JB 1KYOK 3A6CH 1NCWH 3WNPA 3BH9A 1BECA 1CXFA 4J6RL 4QRPE 4LHUA 4OFYD 3QEHB 1Q9WB 3X3FH 4JFPA 5KSVB 1CT8B 3SDDB 3V5KA 4DEPB 1A7BA 4L4TA 5IKCB 1WVZA 5KANI 2P47B 1FZKA 1SJHB 4HS3A 1G7HA 1OAYH 5GGTL 2UY6A 1T6VN 1T2QH 1LEGB 1MEXL 5D72H 2OBGA 1SMAA 4S1QH 4MD4A 2CIIB 3MYJB 3ES6B 4JHBA 5F1NA 5HI3D 5DJ6B 4GBXC 4ZSOA 2NY6D 5IK3A 1J0ZA 2ITDA 2NZIA 4P2OD 3TF7C 3BISA 3QEQB 4Z95H 1CWVA 1KTKE 4TUJA 2H6PA 4K8RC 4MNQD 2VLLA 4PB0L 4NM8H 4K9EL 2NQCA 1T0PB 4RDQG 1G7MA 4OF5A 3HAEB 1T21A 1UM5L 3DXAB 1BZ9A 5MENA 4FQ2H 4Y19A 3BO8A 3NCYP 1P4LB 1GIGH 1RU9L 1S8DB 2ESVB 4OLWH 1RSFA 4JPWH 3B2VH 3UBXG 1QA9A 1EVUA 4HDIB 1XIWA 4QHUA 4MD5A 4RMVA 3MXVL 4XBPA 1WWBX 3P73B 4P5MA 1Z2KA 1T80A 5I76A 3MRRA 3FT3B 4B7IA 4L8CB 2LTQC 3FN0H 3F7YA 3VFOA 4CVZA 1J1PH 3BKJH 4Y5XA 4QTHA 4JHWL 1CCZA 1KCSL 1JV5B 1B9ZA 1BIIB 1KIRA 3VDAA 4YDIH 2DD8H 1WSST 3NACH 1D5XB 3CZJA 3OAUL 4I48B 3LEVL 5BW7C 3HRZA 1JE6A 5EZOL 5DQDL 3QCVH 5TGBA 4PJAB 1DQMH 4PJ5A 3NGBB 4EI5D 1KTDB 3SE4A 2NY2D 1OSPL 1WK0A 3CDCA 1C7SA 1QNZL 3FQRB 3LIZL 1UQSB 4XC1H 1I9JH 3JTSA 5KS9A 2X44D 1ZOXA 3DRTA 5DJ2B 3CLFH 1N59B 3LKSA 1NEZB 4HWZA 4QXGH 5HVHB 1FIEA 3QEQD 1KG0A 4Y5XC 4M43H 3RA7L 4P5TB 2EDLA 4DQOL 4ZFZB 1UG9A 3ABZA 1VEOA 1OSZB 4EXKA 1WEJH 3EOBB 1DFBH 3UC0L 3IDUA 4RFOL 4OCYL 4M43L 1I8KA 3D18B 1FZJB 3GZKA 3RTQA 3F12A 4Z7WB 5BV7H 3IF1A 4ODUA 1DBBL 3SKMB 3HUJA 1U8LA 3UPRB 2OL3B 1RUML 1XIWD 1J1XH 5DVMA 4LOUD 3WS3A 4C83B 4RFEB 3D69B 4KDWA 1KB5B 5IMKA 4HGWB 4V1DA 5D96C 3U1SH 3LKOB 4GSDL 4NNXA 2AV1A 2ZCLH 3RDTC 2X70A 3EJJX 2P5WD 3HS0B 1T04A 4BFIA 4X4ME 4LSPH 4PP1D 4PJGA 1U8KA 1FVEA 4FFZL 1T6WA 4RAVA 4E42B 3MXVH 3IDJB 2MCPL 4GKOA 4XZUB 1KCUL 1Q72L 1RPQA 4I0PB 5E7BA 5CKGA 4YHML 1NDMA 2F8VA 3BKCL 1A1MA 3AUVA 3MRGA 2R39A 5T5NG 4C55A 1K5NA 3VXRD 4F8TA 2WM0A 2AKRB 4P23B 3FB7A 1I8LC 1MIMH 2M2DA 3V79C 5LBSL 5GGUA 1UWXK 1KJVB 4EN3D 2J6EL 3IB4A 3L3IA 3DO7A 2VDLL 1F00I 3EYUL 4OLXL 1DTUA 4HH9A 3NN8A 4P46B 4PB9H 2H2SD 2IQAB 2E9IA 2CDFB 5FV1L 2CMRL 2ZWLT 3T2QA 2NY7H 3MZGB 3TBWA 1HSAA 3Q6GH 2AGJL 2VDNL 2OK0H 1MJJB 4BZYA 1YDPB 2ICCA 1FGNL 2QSQA 4P9HL 4F3FA 3ARDC 5L6YL 4KAQL 2C3HA 2VH5H 1UGNA 1NLBL 2P5ED 4CW1A 2IH1B 4LVNB 1A2YB 2XG4A 4MX7A 4ONGL 2NY5C 4KY1L 2HKHH 2GTWB 4LDEB 3MRBA 3BIAX 4I2XB 3K8KA 1KN2L 5KSUB 4M02A 2BSSA 3P0YL 2WBKA 3UTSA 4HUKB 4O51A 4UBDD 5FKPA 1SVZA 4LCWB 5D8JL 2HRPL 4P2RB 5AUMA 4JCLA 4YHZH 1Z0MA 4AJ0A 5BV7L 1QBMH 3UTSD 5EBLB 4G80A 3PHQB 3STZA 3B2UD 4DGIH 4JRXB 1XR8A 1LVEA 3ILPA 1BQHA 1C5CH 3MGTB 4TULH 4UILH 1WT5C 3WO3B 4PJXF 3HUJE 4EBQL 3I50H 3C5ZB 5E24E 1S9XB 4Z7QE 2QJDA 5C0AE 2OJZL 4G8EA 5GGRY 3P77A 4S10A 1CFVL 2CJUL 4NQVB 5IFAL 1FVDB 5E8DL 3OR6B 3AAZB 4JFED 4CDGC 5AG9A 4D9LL 1SEBB 3ARGB 3B3IA 1NEZG 3PL6B 1NUGA 2AV7A 5BXFA 5J0BA 5IEKA 4HPOL 3KYMB 1UH4A 2YPLB 3CCHB 2HT4D 1CLOH 3TCLB 4DAGH 3AY4C 4Y4KC 4YQXL 2P8LA 4WU5A 2EE9A 1ZVYA 2LU4A 1U8MA 4Q2ZB 4CVUA 1H3GA 1RI8A 3BKML 1O0VA 3U6RB 4EQ3A 4FQJH 3GNML 2LU7A 5E2VH 2OS7A 4KQ3H 5I15H 1CG9B 4ZUSB 1DVFB 5TFSL 4DAGL 4Z18A 4EI6A 4OLYH 5L2JA 3DJ9A 5T5FH 4YFDB 5GS2D 2D31A 2R0WL 4LSQH 3M17B 4DUWA 1CDYA 4F15B 3B4NA 4JFOA 3MRFB 3UPAA 1R24B 2YZ1A 1UWEH 2WBJC 1FLRL 3EGSA 1MUJB 3V0WL 3OAZH 1CLYL 2FEDD 5DS8A 4J4PD 5EC1A 4GRLA 5EFIA 1T7YA 1N6QH 3WE6A 4YNYA 2AXHA 1MIEH 2HFFA 5DD0L 4PYGA 3WKMH 3ZYOA 3TBYB 2VDKH 1RFDL 4J8RB 1BMGA 3DETD 4PG2A 1AI1L 3GSQB 3DVGA 3BP7A 1HZHL 1CDBA 3UJIH 1I1CA 1IM9D 4WHDA 3VGHA 5MEOB 2DJSA 2GI7A 1I9RH 4O02L 1UM6L 3ULUC 4XAWL 1CDIA 5FIEA 2XA8H 4LFHD 5HI5C 1EJOH 5CGTA 2WUCL 1P84K 4NNYB 8CGTA 1T89A 4JFXB 3LOWA 1V3MA 4TPRH 3SDDC 5BRZB 1XGTA 1FYTB 4ZOCA 2DYPB 5EUOB 2GJ6D 3MLWH 4D0BB 5H94B 3T2OA 1EA9C 3CIQA 1YJDL 1GGIL 4UB0L 5DJAA 3U7YH 1A7OH 3K2MC 4X4ZA 2W0FB 5FYKU 1JF1B 1FYTE 3H9YA 1DLFH 4G6JL 1GH7A 3WIHH 5HBBA 3VFSB 5EU5A 5CLTA 1F90L 2R4RL 1LNUA 3QUYD 1ORSB 4U6HB 1U2HA 2DL9A 4OIIL 5D1ZD 1Q1JH 5LQBL 4X5WA 3ARBD 4P2RD 4MHHG 3GJFH 3TIDB 1BLNB 2R1YA 1R0AL 1FVCA 3EOTH 4QRPA 1U3HB 3O2VH 4YGVA 5FK9B 5LWYL 3GMQB 1FNSH 4HBCL 2H32H 3CFEA 2D7TH 4OGYL 3ULVE 2WWMD 4OLYL 1JNNL 3MTRA 5JHLL 4ODTL 4JZOA 3RGVD 5IF0A 3PWUB 3N50A 4WWKB 3NBNA 1L0YA 3CU1A 5I8OH 3VRJA 2J5LC 4YXKH 1W0WA 3TT3H 1MFDL 4U7MA 4LP5A 2DD8L 4OGYH 2XWJB 4OCLC 5BS0E 3Q6FA 3F8UB 5JOEA 1RZKH 5F9OH 2WWMC 1UZ8A 4YAQA 1P7QD 3G5VB 3TBTA 4OZHF 3S36L 1J0HA 3HLAA 4QRPD 1WF5A 1L4IA 1OAQH 1I1AB 2J8UA 3KPQB 3M07A 1OAZH 5TE6L 4XMKH 3HI6L 4AH2A 3MR9A 2G75A 3QFDA 3V5DA 4LLVA 3VD9A 5IV2A 4XH2B 1ZHNA 4JG1H 3KPNB 2ORBL 1CT8A 4G6AD 2Y25A 4MXWL 4LHUG 3MJGX 2A6IB 1YPZF 2IMNA 1LDSA 1G7HB 1VA9A 1JHLH 5D7KD 5BS0D 4F7TA 4MXQC 2R23B 2PCPA 4PJ7F 4ZO6A 4GAYA 1M7IB 2ZUYA 5IESH 1FNGB 1U41A 4XP6H 2NY3B 1CGSL 3SKJL 1FGVL 5IVXF 1L9NA 4H25A 3LN4A 4YE4H 4ODXB 1UA6L 1QBLH 4CMMA 4HG4J 1OAKH 5CD3B 4WUUD 1G7MB 1I7ZB 3QEUB 4H8WH 4JPKH 3AB0B 5TDOB 1AJ7H 3L3GB 3KNBB 2DQCL 1IGFH 3DV6A 5D2LF 4NQEE 4Z7UE 5FKAB 3IDXL 3GO1L 2ZUSA 4PD4K 4FXLA 2C3VA 3A6OA 2X1OA 2BVPB 2COQA 1ZS8B 2VSCA 2Z31B 1AE6H 2Q86A 2VR9A 4F37F 4OBSA 4ZFOL 2RAMA 2CKBH 4QNPE 2RBLA 2VLMD 2LVEA 3MOQA 3FTGA 1RV6X 1SYVB 4K8RH 5A40E 3P2TA 3GBML 5H2BA 1TCRB 3VCLA 3NPSC 2XG5A 2DQUL 5I0ZA 3SDYH 3X14A 3HRZB 4J7RA 2CIKA 5DDHB 4H88H 3PWNA 1P6FA 3MRDA 4LLQA 5B4MC 4UI2A 1ZVHA 1UB6B 1NQBA 4M7ZC 4JRYE 5AYQA 5B39G 1CD1B 1HXMB 1DEDA 4U1HB 5BV7C 1ZANL 2EO9A 5GRXG 3MOAL 4YHKH 3FO0L 1KJMA 3UAJC 4PJGF 5IM7B 3HR6A 3QIWA 1ZV5A 3FQXB 2VAJA 4G8IB 4IRJB 3WCYA 2N1KA 2NTFA 4UINH 5GRVL 2AJZB 2F53E 5D93B 4JR9L 3U0PA 3G6JF 2P4AB 1NFDA 2V9TA 4PGCA 2GTZB 4HPYH 5T3ZH 1HINH 2D7NA 5EOTA 3BRFA 4G7YH 3GJFA 1CFBA 1RUPH 4QNPF 3DX7B 4MNQB 2EH8H 3X12B 1N7MH 2KZWA 5FO9B 1I4FB 3MYJA 1HQRA 4UDTA 3SDXE 1KT2B 2NZ9D 4R4FL 1G6RB 5GSVA 5HYQB 1MRFL 4HWEH 4MYWB 4JFFB 1BGXH 4ZUTA 1BWWA 2DTSA 3UZQA 3T0ED 3DGGA 3VGEA 1RMFH 4U7SA 2ED7A 3ZKXB 1UEYA 4WWID 4HF5L 4Y4HA 4ZTPH 1T21B 4QT5B 1T3FB 3MNWB 2ITCA 1P4LA 3MXWL 4PJ9C 3A67H 3I2CH 4E42A 5E9DE 2AERT 2BVUA 2JELL 2D3VA 4IRSA 4X7DC 4RMRA 5K33A 4Z7VB 3TLRA 4JO4H 3C2AH 4G5ZL 5D9SA 2BSRA 4KKBD 5EO0B 5IOPB 1A1MB 3WIIL 3HZMB 4R3SA 5C08B 4YR6B 4NOBA 4KKCD 3ET9F 5F7EH 1DQLL 4JRYB 4QRTA 3T3PE 4YFLI 4XAKE 5D71H 3JV6A 3MNZA 4HJJH 4ZUWB 4I8DA 4NDMB 3O3DA 4QXTA 2K9UA 1JWSB 3WS6C 1Z9SA 2I26N 3VRIB 3MRKB 3L3HB 1RHHA 1HXYB 4YHIA 3O2VL 4YWGL 4OGZA 2ERJB 5I1CH 1S7XA 1PSKH 4OQTA 1L7IL 4HIHA 5D1XC 3BUYA 1OVZA 2X4OA 1JHKH 1KB9J 2LVCA 1F4XL 1EO5A 3EBAA 2Y06L 3GB7B 3QNXA 2R0KL 5EU3A 3UJJH 4R7NA 1SEQL 4EIGB 4F15C 3EJZD 2X4UB 3D2UB 1IJ9A 3CFDA 3AM8C 5DJ2A 5T3XL 1IQWH 3TO4D 1B88A 1A6VL 3DIFB 5HI3C 2CDEA 3BW9B 3ZKND 3QG6A 3CSPA 1UXWB 4FZEL 1HH9A 3LQAC 1PY4A 1VESA 3BSZH 1DANU 3DVNB 5LAXA 4K8RD 2I60L 3HI5H 4OB5H 5C3LD 4LCWA 1Q72H 4OZGB 5EZOH 2DQTL 4U0RC 2ESVE 3VXQB 43CAB 5KTEL 3EOBA 5GPRA 3DLQR 5CBEA 1GL4B 4NKDA 1YMMB 1U8QB 4DVBB 4KPHL 5EBLA 4UIMA 3S88L 1KN2H 3MCKA 3BRDA 4R4FH 3QXTA 2DQEH 1YNLH 3QUMB 3BQUB 5E08L 1HILA 2FJHA 5D7JA 5GJSH 2AJVH 3RWGB 2EXYC 2X09A 3JV5A 3LN5A 3O8XD 1YPZE 3VXRE 2XTJC 4NUGL 3GMOA 1LE9A 3QEGL 3S35X 3MV7B 3OR6A 2FX8H 1T4KB 3DX9A 5C92A 3S36X 2X5PA 2QR0A 4DK3A 5K9OB 2KBGA 2E7MA 2AV7B 5BXFB 4CDHA 4NQCA 1MFEL 3ARDA 7FABL 4LSTH 1QSED 4JQIH 3B9EA 2DM3A 3VWJC 4KVCL 1CU4H 3OKOB 4GAJH 1XF5A 2J7LA 3I84A 2ENYA 1NMAL 3PDOB 3HB3D 2NY2C 4KUCD 5DRZB 4XX1E 3RAJL 2WV3A 4ONHA 1U3HC 4MDJB 5ESQB 5L2JB 2Z92B 2D7TL 3IAQA 5T3XD 4YXLH 2HWZH 2HFGH 1J7VR 4YEEA 1XF2B 1MHPL 5I1CL 5T1KA 4KI5D 4GSDH 1QO3A 2E7LC 4WENB 4XAKD 3S4SG 4DFHA 3RZCB 4OAWB 4M62H 4NN7B 5F9WB 3OQ3B 4YNYB 1FP5A 3ZHLA 2FLRT 2W9LA 3QFJB 2HFEB 4BZ1H 2K7PA 3P40A 4J8RA 3O6ML 3P11L 1NBYB 3WUZA 3U2SA 1G7PA 4U1JA 1FIGL 5JXEC 3WHXA 3VI3F 1MCQA 2IH1A 5IQ7L 4Y4KB 5A1AA 5EBMA 5I1DA 3V0VA 1UT9A 3LN9A 2WBJD 3QO1A 1MQKH 3NCJL 1UENA 5EZIL 2F74A 1A4JA 2FBJH 3VI3E 3U79A 3NTCL 1EXUA 1HOCB 4G6FB 2BSSB 1DVFC 5DF0A 3U83A 1NMBL 2R2HB 4WEUD 3WFHA 1G7LA 4OLUL 1NGWB 4RGNB 1H15B 4BZ2H 3ZSTA 1P7KA 1UADC 4I2XE 4G6MH 4L3CA 5AUMB 3VFWA 5IFJB 2VUYA 5D7SL 4FQJL 4AMKL 3ARYA 4O02H 3FFDB 4N1EA 4F7EB 2AJXL 2WBJB 1A6UH 2IADB 4RGOH 4B53A 4BKLB 1S9XA 1T1XB 5E2UL 2VB5A 1N5AA 3TCXA 3TZVA 3Q1SL 4ONFH 1BEYH 5ALCL 5IW6A 3KLHC 1AO7D 2MHAA 2FWOA 1FVDA 2FZ3B 3VE0B 3JWOL 1U93A 1VSCA 4X5WB 3RWHB 3VWKD 3IXAB 2R69H 1A6ZA 1KCVH 4MJIA 2QSCH 5CUSH 3VWJB 4OKVB 3GMQA 4XHQA 4MMZC 4PRIB 1AY1L 2X4PB 1ZK9A 2DLFL 2AJYL 2ZOLA 1OW0A 1HZHH 3RKPA 1A7QL 4MJ6B 1MCCA 2YA0A 2P7TA 4YPGA 2K3TA 3SGEI 4JFYB 4X9BA 4CAGA 5I17B 4EI6B 5A3IC 4ZXBC 3PWUA 1NFKA 3B43A 4K23L 1HIMH 3D48R 4ODHH 5FV2A 2F54A 3CK0L 4C59B 4K55A 4JY5H 5AZ2H 5I8CB 5D70L 4WNQB 5T1DL 4F2MB 4DKEL 3MRFA 1F5WA 5JXEA 1QFWH 4YAQB 3VH8A 1JNNH 3QZWA 5FYJU 3NABH 5I30L 2ADFH 2DB8A 4QWWC 1MHEB 4NHCL 1RUQH 3VFNB 5ACZA 3BP5B 4LEOA 4CBPA 5E2JA 4UQ3A 3OPZL 1NC4B 4G6AC 4JZNA 1YECL 2VLKB 5HVFB 3JWOC 4LPTA 4XVJH 4X4XA 4IBLT 4CKVX 1NKOA 2FHBA 3T4AB 4HSQA 3KPNA 5L88H 4LLUA 2CMRH 2XWBA 3DURA 1D9KC 2NNAA 5DRWB 1XZ0B 2B2XL 1NMBH 1F11B 5JPNB 2ADGA 4MCYB 3GSNA 1WC7B 2AEWA 3ZKMD 4PRHE 1S5HB 1ZVSA 4GAYB 5CZVH 2A0LC 4ZFOA 1Z9MA 5D5MB 4LPYA 5FUCE 5I8EA 1D9KD 2ZG1A 4P2RE 4U33A 4LQFH 4LRNH 4WW1A 1MAML 4HJGB 4M6OH 4M6MH 5EUOA 1CK0L 2MSPA 3WV0A 4CMMB 3EW3B 1QPXA 3ULVF 1FZOA 1GHFL 2Q8AH 3ARVA 3EZJB 4Q74A 4N5UA 3QEUA 2GSGA 1JK8B 1YN7B 3SCMA 4P49A 2YS4A 5HTSA 2CLVB 1X5ZA 1Y6KR 3KJ6H 2IC2A 3R0MA 3H7BA 3VD3A 1WZKA 4L29B 4OJFL 4PJDB 4FG6D 5JUEH 3HPJB 1OTTD 4ELMF 1KCVL 3GI9L 2E6QA 4I4WB 1CI5A 2GYSA 4MCZB 3FOMA 4X99A 4HAFA 3MJ8A 3F65A 3GSUB 4HAGA 2YUZA 1YNTA 4MJIE 1TTGA 3L7EB 3PP4H 4MLSA 1F6LL 4O2FA 3MCG1 5DQ9A 2XOTA 2KKQA 4R96A 2WNGA 2VDPL 5DDHA 4DK6A 2VL4A 2WIMA 3KPOB 5FYLE 4PS4L 4TQEH 5JQ6H 3VRJB 1DLHA 3CX5K 1DBAH 4LLDA 4HW6A 2P8PB 5M95B 1NDGA 4DN3H 1NJ9A 3QUYB 4QHLA 5CP7A 4MSWB 5FOJA 3CFKA 3DRQA 4D0CB 3B83A 2MNUA 4G3YH 3G5VA 1DP0A 5EBWA 1KF9B 3B5HA 3SGKC 3ULUD 1KJMB 3AXLA 5J8OA 1ACZA 5ID1A 2D03H 1F58H 4MAUH 1E6JH 1GXEA 2HP4A 2PTVA 3P4MA 4JFDB 2UV3A 3GSXB 3OAYK 4LCCA 2R29L 3SDDD 1LO5B 2WP3T 3N1FC 5JLZA 2G75B 4W6YB 2ZUVA 2D03L 3QHTC 4TSCH 4JDTL 2BNRA 3MOAH 1YYLH 3N1QC 1OCWL 4NUJA 4UU9A 3S96A 3GSWB 3FFCB 3ULUF 5C0EA 4PLKD 2R1WB 3C6LD 2YN3A 4JPWL 1AXTL 4Y19D 3VFTA 2UUDH 5DRXB 1NMCC 1D5IL 4PRPE 4UDTB 3S9DB 3S4SA 4KTEH 5GRWA 4NGHL 3JUZA 3BZFA 5C0JB 3S88H 2Q3ZA 1P4IH 4P2QB 1LO2L 1NGYB 4PUBL 3KYKL 4NO5A 4WI6A 4ZYKB 2XQYK 3SY0B 1FFPB 1VPOL 1OAZL 4LCYA 4LDOB 3HUJF 2VN7A 3AGVA 4PBXA 1IBGH 5DD5L 2XQYG 3BD3A 1U8HA 4KKBC 1GCFA 3DUUA 5EG6C 12E8H 2VAAA 1H5BC 2UY7A 4AY0A 1N5YL 2EYTB 2VABB 1RK0A 4FA8A 3H9HB 3WDHA 2P48B 4TRPL 4AIZB 2QADB 4OZFH 5F1IB 3JUYA 5KSVA 2VTFA 3MZTA 3K3QA 3LQAL 4XXDB 2JJTA 4DGYL 1FZKB 3RNQA 5HDOA 3QXVA 2HJKB 5CGMA 1FFNA 2GT9B 1TCMA 4P9MH 5FECB 3N1PC 5DMIH 3VRIA 1BAFL 5DD3L 3RAJH 2HJFB 2NY2B 3V0AC 4Z0XA 2VZSA 1IRAY 2A6DB 3WSQL 2G9HB 4KKCC 3DOSA 3BESR 3TBSA 1BJ1J 3IFPB 1CFSA 3GB7A 2H6PB 2VXQL 4OBRA 4Q7DA 5CILL 2Y5EA 1CS6A 3HAEA 3VXMA 3IDGB 1H5BA 3EYFB 1BGXL 1IEAB 4IIQA 1ETZB 2X4UA 1PKQE 4JY5L 5AZ2L 1PSKL 3SDCC 4RWYL 4U1KB 5L8LB 3MREA 2ENSA 5DZLA 3UYOD 4NFCA 1UXWA 1YYLL 1GC1C 1BZQK 3MXWH 5ITFB 5I76B 1S9WA 2MPAL 2ADFL 4BSWA 4YDVB 1BVKB 1E27B 2XNAB 4PGCB 5HDBF 3GJEA 4OZGA 3NCJH 4ISVA 4JM2A 4MJ2A 3VXSA 3GSOB 4WW2A 2RGSA 5EO1B 3H3KA 3ARDD 1A9EB 1HQ4B 5JNYA 4Y5YA 3SKUD 3IFOB 1CGWA 1S7RA 4BFBD 1KULA 2XPGB 2V5YA 4NZTH 4BUGA 2Z93B 4X80L 4R4BB 5DR5L 4XWGH 2P5EB 1A7NL 1VFAB 3QZWG 1MCJA 2ZSVB 5F3BA 2X1QA 4G8GE 4OD2B 3RVVD 2LABA 3L3OA 3F7PC 3BDBA 1AQDB 1MJUL 4Y4FA 4I0PD 4BFEA 4QY8B 5GRJL 1HYSC 3MMEB 4QF1A 5C2BL 1F4WH 4Y4HB 4HKXB 1E4KA 2V7HB 5E5MB 2BRQA 5DEZA 1F4XH 4JR9H 5E6ZA 1Z5LB 4PJIE 1C8PA 1RUKL 2NY7L 1VFUA 4XP6L 5GSRB 4PY7B 4J3OC 1U6AL 3HB3C 1UYWL 1BBJA 2X4SB 2CKBB 3WLBB 5E1AA 3CLEH 4FFYH 5IOPA 1TLKA 4PLNC 3IJSB 4PJFA 1G9ML 3TP4A 1H8NA 1RUAH 1PZUB 2VSDA 3EKCA 2OQJB 5DQDH 4JKPL 3QDGB 3VXPA 2YC1B 4GKSA 3CVHL 3PDDA 4U49A 2NXZC 1MWAA 4NDMA 1K2DA 2IG2H 1XEDA 2Q7YA 3G08A 4Z7WA 4XVSL 5EUOF 5T1KD 2VLRA 5C0AB 4X7TB 3TA3B 2DQTH 5B8CC 1CZ8L 4IIQC 1BF8A 4P2QE 3BHBA 4B0MM 1U8PA 5C0GA 2P5WA 4HXBL 1HHJB 1HWGB 1QLRB 4RFEA 4CU8A 3PXHA 3QI9D 1LO0L 2Z91B 3CFBA 3ESVF 5DMGC 2HMID 2AV1B 4M61B 4KZEL 2PXYB 3RA7H 4LKCB 3CFDB 4ORGB 1F6FB 3PHSA 4RAVB 3IDJA 3DIFA 3N06B 4X9IA 1W72L 1MAJA 3QI9C 1OHQA 3U48A 4LCIH 5C0BD 3W81A 4D3CH 3CGTA 4PJHE 3WFEL 3C9NA 2EDOA 4N8PA 3MLPA 2VOTA 1NGWA 3O45B 1H15A 2I9LA 1R5VB 1KC5L 3O8XB 2IAMB 5ICZB 3VXQA 5E5RB 4TNVK 1VERA 1KJVA 1X5KA 2D0HA 5AG8A 4J12A 5IIEA 4NO2A 2UVFA 3N0PB 3MCKB 1ADQA 3FFDA 4EOWH 1NSNL 1ZLWH 3KXFB 5J6HB 1SEQH 5J6GB 3QUMA 5T1MB 5I15L 5J89A 3PGCA 2FJHB 5MI0C 4LRNL 2PW2A 5E8EB 2UZXB 3TESA 4NZRL 2VH5L 4ZTOH 1U8IB 2P24B 2HH0H 2VO5A 1C5BH 3TNNA 4BSJA 1QSEA 2Y36H 2IH3A 2KPNA 5KSBE 3CDGA 1P6AB 5AAMA 4OFIA 3RWIB 4UAOB 1KBGL 3NZ8A 4Z5RA 1YEJL 4NT6A 4QCIB 5I2IB 4JN2A 1MIEL 1F2QA 1DUZA 3KHOA 2NY5H 1XF5B 2PYEB 3EYUH 4N1CA 1Q9KB 4NHUA 1LEKB 1X5YA 4UT9L 5I17A 5FKPB 1YNLL 3QB7C 4H0IA 5D4QA 4JY4A 5I1HL 4WI5A 2ED8A 4Y2DA 3KVQA 1MREL 1XT5A 3OKNA 4PTTA 2IFGA 5L9DL 3U9UA 2H9GB 2NY1D 1CIDA 3HMXL 1OD9A 1RIUH 1YEKL 2AJUL 4JRXD 4JCMA 3T0EE 5ICXA 1WBYA 4MVBD 4U2ZA 4W68A 4HFUH 1CF8L 5DLML 5SWSE 3PQYD 1JZ7A 3SEPA 2D0GA 1F3RB 3RZCA 2GCYB 1MHEA 1SY6L 2O61A 2P44B 3DMMA 1Z9OA 2JJUA 2F5BL 2DM4A 2DKUA 1YUHA 2F54D 3OMZA 5EU7C 4NBYB 5BVPL 1EEUA 1SY6H 1RVFH 4OM0L 1AGFB 2V5SA 2AI0H 4NQDE 5BZDA 2XICA 3WDIA 5IB4B 2W65B 4PFEA 4KQ3L 3LQMA 4Z76B 3HE6D 4QWWD 1F11A 5ALBL 4K3JH 4HZAA 4BQBA 3CAFA 3O8XC 5HYFA 2FSEA 4G8GA 4JQVA 2J4WH 3QQ4B 5I8EB 4NQSA 1A7QH 3S37X 2ZPKL 3MV8D 4PYHA 4U6VH 5D1ZA 4K3GA 5DHVA 4LVOB 3EYVA 5L0QB 3V5KB 4LK4A 2JLLA 5I19H 5I18L 4M7JH 5F7MC 3EYQD 2B5IB 3EGSB 2HT4C 3BEVB 1JGUL 1N5AB 1IEHA 1T2JA 2PF6A 3UXFA 4TUOA 4L3EA 4PBWD 5FOBA 1UCTA 1RJLB 1IC5H 1MVUA 3L5XL 3OB0H 3VE0A 5A2IH 2GK2A 4G6FD 2HT2D 1UZ6F 4QKXB 4IOIB 3U0WH 3LDBC 5J11B 2GHWB 5GXBB 2VLLB 2V2WA 4KKNA 4QYOA 4FRWA 1M05B 3PWVB 4RGND 3RVTC 2A1WH 3KXFD 5I9QC 4KHXH 3EDJA 3CSGA 1KENH 1INQA 4TNWF 1LE5B 1MREH 5JA8B 1QA9B 1UWEL 4YIQB 4ZS6C 1XIWB 5IHUH 3FT4A 2XQBH 1NANH 4PB9L 3RWCA 2F54B 4QGTA 1XGTB 2ZG2A 3TN0D 4PREB 1AKJD 5H35B 5CP7B 3RWFA 2VDKL 3WHE1 1U92B 4Y16C 3D9AL 2H3NA 2OK0L 2R4RH 5EORH 3NFPB 3QZWB 5JW5A 1FHGA 1X5JA 3MYZA 3AXLB 5IHZA 3QCUL 3O11A 2GSIB 3BP5A 2YHGA 4AEIL 3BPCB 1S7WB 2L7JA 2DYPD 5GGSY 5EU4A 1Q94B 4RMSA 4KY1H 3RL2B 3P30L 4Y16D 4X4XB 2Y72A 1MCBA 5BO1H 4PJ5B 1O7SA 1C16B 3DX8A 3R0NA 4N5EC 1CGUA 1FG2B 5HYJD 3DX6B 4X5XA 2YPKA 3D39D 2XWBB 3DURB 2MOVA 5CJQH 1AXIB 3KYOB 4F9LC 2I07A 2R1WA 4MA3B 4L4TD 1TPXC 4OCSL 1UQSA 1ND0B 3BMWA 4OD3L 5T3XE 5CCKH 1ED3B 1FL3B 2AXGA 3RBSA 1QRNE 3MO1B 4D9QD 5DSCA 3OTTA 3NA9H 5SX5K 4DVRL 4KROD 2HKFH 5C8JB 4XCFL 3QUYC 5JW3H 5C6TL 3G6AA 1JTPA 5IP4A 3AMKA 1J88A 2VDQH 4Y16A 4U4BA 1UCBL 4UIKL 2GJ6E 3WFBL 3VXUA 1U95A 4U6YA 1F4YH 3TWCL 4P3WA 2E8YA 4Y89A 1DN0A 5AAWA 4GS7C 3ZDZE 4N9GA 4WI4A 3I6LE 2QQNH 4P23C 5C0BE 5HHOA 4WUKH 4H1LH 2VYRE 4IMKC 4Q6YA 5GRJH 4KHTH 2CIIA 4P3CH 5FHAL 3KYKH 4ZNEA 3EO1A 4AL8L 1VFMA 3T0EA 4XH2A 4NCC1 4X99B 2NCMA 4YHKL 5ITBL 4K7FB 4OZGF 3WIFA 2R29H 3JV0A 1YNTB 2X70B 1BJ8A 4HEME 3KPMA 1EO8L 5DJ0B 3RIFF 1FFOA 2P45B 3C87A 3DXAA 4LQFL 5DUML 1YQVH 1FRGL 3Q6GL 5J56B 2DICA 3BAEL 4XNMB 1AGBA 1JGLH 4JKPH 1D5MB 5T5NF 3L1OL 1DCLA 4QHUB 1YEJH 5F3HB 3KJ4B 4FQIL 3QQ9D 1NGZB 5CIPA 2AJ3B 4I3GA 4TVPE 3LN4B 4WEBH 3ZYIA 4JFDD 1CLYH 4LPVA 3U0TB 4Z7QF 4XNYH 3P9LA 2AEQL 4Y5YC 1N7ML 1G6RH 5EBWB 5GGUB 3VXMB 1XGYH 2QV2A 2YD6A 5CEYB 1ZKAA 1BX2A 2J6EA 5SWZA 3UTZB 1JMXA 3P4OB 4JRYD 4PJBE 4YDKH 2CPCA 4V2BA 2W59A 1LO5A 1GGCH 5JLZB 4OSUH 1TVHB 5E94A 5EOQL 4P5TD 3LQZB 4EN3A 2PO6A 4CMHB 2DAVA 4NSKA 4PJ5D 5KVEL 1KTDA 4TVPD 4UU9B 4XBGA 5GZND 3KPTA 4I3SH 1IAKA 3VXNA 2I27N 5EUOE 4MB3A 3ZE2E 35C8L 5E6IC 3S5LA 3M8OL 2CK0H 5DRXA 2CIKB 3C5ZD 2Z93A 4LCUB 1QQDA 2OTUA 3WBDA 2QSVA 2UUDK 5GZNC 3NPSB 1FZMB 3AC0A 3QUXC 5B3NA 5FCUL 4QXUH 1TJIL 3SDAB 2LAGB 2X1PA 4OCWL 4ZFZA 4DOHB 4ODSH 1QVOA 3T2NH 1HXMA 1DQJB 1ZLVH 4KI5E 2CH8A 3DHJA 4X7SH 3SDCB 4FQ1L 4QXUL 4PGJA 4MNHA 4N9OB 3STZB 2NX5B 3O4LB 2ICES 5C0CE 1CL7L 2EDTA 3GBNL 2CKBA 1RK0B 5BJTA 1A1NB 3CNKA 5EC2B 1R3LB 1KCSH 3P77B 4LSUH 3NVQA 4I0PC 1EO8H 4PV8B 5IMKB 1NUNB 5BZWA 4HGWA 4V1DB 3KPSE 2O5YH 3QDGA 2FB4H 1IT9H 2B1AL 2D7OA 2X7LB 4XCCH 1T04B 3KJ6L 4A6YL 4M6NL 1IC7H 2NX5D 2C4FT 3L5JA 5ERWB 3X12A 4PJ8B 3UAJD 2XA3A 4XZUA 5TPWH 3E3QE 4XPTH 4NC0B 2UWEE 1CVRA 1HHJA 3CVHH 1BFVL 4NM4H 4V1DD 1K4DA 2WUBH 1G6RL 3IKCA 5DJYA 3FB7B 3SJVE 3VFPB 1GAFL 4MNQE 3ZDYF 1KTLA 5CEZE 5DMKB 1X5AA 3PG2A 1ETZA 1SJEB 1OGAE 1SY6A 4XCYB 5IFHH 3PWLA 1OPGL 2CRYA 2AS5M 1EAPA 3G04A 5T3ZL 3T3PF 2IQAA 4RMTA 4RAUA 2EECA 3LS5L 4LSVH 3D6GA 1ITCA 4MQTB 2OM5A 2EICA 3O45A 1R5VA 1X6NA 1M7XA 3U30B 3SDAD 4JPVH 3BKYL 3W9EB 5HHQB 3GSQA 3FQTA 4ONFL 3WFDL 3DVGB 4U1NA 5ICYB 2ZUUA 4M5YH 3P4LA 2HRPH 3IFOA 4GQPH 2QQLH 5MEOA 4M1CC 3L3HA 3KG5A 4KK6C 4R4BA 4AT6B 1MFBL 2G60H 3SDAC 4LF3B 2FYYB 1KNOA 3HE6B 4Y4FC 1KLFA 1EIBA 2ILLA 2XZCL 4Q9RH 3TH2T 4PJCE 4M7JL 2IBZY 5MP6H 3ROLA 2N7AA 3P9WB 5LWYH 3D39E 3O3BA 2DWDA 1XGRB 2MCPH 5GJTH 5ADPH 2GK0A 2B39A 4YH6A 2B0SL 2MPAH 2XTLA 5MEPB 2VDRH 4NQCD 1I7RA 4M1DH 4JRXA 4D0BA 4PY7A 3QQNA 1EERB 5H94A 4Z5RB 2J8UF 2E7CA 2BFVH 3QDJD 3ARGC 4OF3A 4ELMA 1S9KC 3RX7A 4MAYC 1VADA 1NL0L 2Y36L 4NFDA 4YQXH 1OAXL 4HK0A 4N8VG 3K74B 4JDVB 1ONQA 2DQUH 4G42A 4KK5C 3VXPB 4NKMA 5EZIH 4PRHD 3RVWC 2YPVH 5HI4D 3UO1H 1DE4A 1LP9A 2LV4A 1JYNA 3HHRB 2VL5A 2DWEB 3OHXA 5IVXE 4D2NA 5C0CB 2ZUXA 1BFVH 2A6KA 3BP6B 3ZZ1A 43C9B 1E28A 4F7PB 1BBDL 2HTLD 3LN5B 1S7QB 4XP9L 3BQUC 1J0IA 5EIQA 1WZ1H 1IC4H 3ZSSA 5EIVA 3F6LA 2F9BT 1NANI 3IT8D 4LFHG 1MFAH 2XWJA 1AR1C 4J3TA 3QQ3B 4GH7B 1ZTXH 1AI1H 1IC4L 4YK4C 1U42A 3EDEA 1KIQA 3KWWB 2CXGA 4QRSA 5DO2C 1NCUA 3GMRA 5CGYD 5DS8B 4XP1H 5F9DC 4Y0GA 2MKWA 3CVHA 2HFFB 3THMH 2HKHL 4HLZG 1HEZA 5E99L 1Y0LA 2AI0L 3E6FA 4M5YL 4NQSB 4TTDC 2BNRE 5FHBL 1N6UA 2DLFH 4PJHF 2AJYH 5IMMB 3RZCD 1XF2A 5IBLD 1T03L 3MFFA 5D1ZC 2ID5A 3UTPD 3X13B 5J6GA 3HE6C 5KG9B 3P0GB 4QRRB 1HDMA 1JBJA 5BQ7A 3RKDD 2VDQL 3M1BA 4OCXH 4KQ4L 1FC1A 2CUMA 2VQUA 1CXIA 3ESUF 1N6VA