4BUHA

Human ige against the major allergen bet v 1 - crystal structure of clone m0418 scfv
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
252
structure length
237
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSEYSFPNYWIAWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGQVNISADKSSRTAFLEWSSLKASDSATYFCARLGGQLWNSYYYYYYMDVWGKGTTVTVSSGYELTQPPSASGTPGQRVTISCSGSSSNIGGNTVNWYQQVPGTAPRLLIYKNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCEAWDGGLRGGVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Ige Against the Major Allergen Bet V 1 - Defining an Epitope with Limited Cross-Reactivity between Different Pr-10 Family Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CLONE M0418 SCFV
total genus 55
structure length 237
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA01
3BIKB 3BO8B 3ULSB 5JW5B 4AENA 1AH1A 5H2BA 4YO0A 1S7XB 3AREC 1ONQA 1JGDA 4G3YH 3SCMB 4EJ1C 2H26A 2VITA 4KDVA 2DICA 2VAJA 5CLWA 2Z91A 4Y89A 4X5XA 5IBUG 5BZDA 1LE5A 1JGVH 1U93A 4ZNEA 3QIUB 2YUWA 2DF3A 1YN7B 1I1FA 1I1YB 1TVBB 4WNQB 3LY6A 5DO2C 4XP5L 3B9KD 1H3TA 1OGAB 5D6CB 2CLVB 4X6CE 2DQGL 2H2SD 5I1KH 2YPLE 5T1KD 1XF1A 3WFDL 1B0GA 4X4MA 3SKOA 4KVCH 3HMXH 1CLCA 5D8JH 3OG4B 4J4PC 2IBGA 1DQDH 3BP7B 4YFDB 1U36A 3QUXA 5EU4A 3N1QC 3VXPB 4W81A 1CFQB 3R06A 1XCTB 4Q2ZA 3FT3B 4YX2H 4HKBA 3WJJC 3KPRA 1AGCA 2NX5D 1T5XA 4FFVC 2DTMH 2OL3H 5HHVL 4LLDA 4KK6D 5HYQA 1LEKB 1KBGL 4KGJA 2OLDA 4F58L 3C8HA 5H8DA 1K3IA 5IR1A 1I9JH 4GKSA 2DLEA 2MHAA 5BV7L 1TCRA 3MGAA 3SDDB 1CQYA 3NIFE 5T33L 3IAGC 2DWDB 4GRLA 4X4ME 1IAII 3PGCB 5BVPH 4LSPL 2BFVH 5I75C 1U92B 4PJAB 4OM1L 5F3HB 4MQ7A 4JANA 1KACB 5B3JF 3BDYH 4XWGH 3D39B 5JZ7C 5EOCH 2JIXB 4ZFFA 4IMKC 5IVXB 1HEZB 4QO1A 3HPJA 1YJDC 4Q0XH 3K4AA 2K9UA 1JIBA 4LIQH 2O61A 3MCG1 3VFPB 1BOGA 1JPFA 1FFRA 2LFGA 4YGVA 5C7XH 3TYGL 3P9WB 3FOLA 4U0QB 5DEFB 3OTTA 3ARZA 5BQ7A 5IFHL 3D0LA 2AK4D 1U3HC 43C9B 3BHBA 2GTZB 5CINL 3EGSA 5DEZA 2FJFA 3FQUA 4HZLB 5D2NB 2XWJA 1SMOA 1IGTA 5IBUB 4R0LA 1CFNA 1Q9KA 1KB9J 3QRGH 1UEYA 1VFUA 2P42B 3ARXA 1YEJH 1NAMB 4LLUB 1S7VA 3MBEA 5CCKL 4GMTL 3I3BA 2DBLH 4LLMB 1MEXH 5IEHB 3FO1A 4XMKL 4Y88A 1HYRC 3HZVA 4TUJB 5D72L 1U8IB 1CE1L 4Q7DA 1MJ7H 3B2UD 3F58H 5HGAA 5L88L 4M5YH 3GMPA 5DHXB 4QRQB 5K59E 5I1AB 2C5DC 4Y16D 3T2NH 3QXAB 4C54A 3E2HC 3SJVE 5D5MF 3U7YH 5GSVB 3CVIL 15C8H 4YNYB 1JTTA 1MRCL 1KIUA 2AK4E 4OGAC 4OI8A 2H2PC 5K9KA 1FRGH 5FGBC 3ES6B 4TVPL 2N4IA 3W11D 1H0DB 2CDFA 2XZAL 3K1KC 4E0RA 4M93C 5SWQA 1GC1H 1H3VA 4YR6A 3P0YL 3L5XH 3T1FB 2XACC 3ESUF 4DW2L 2BHZA 4S10A 1A14L 2A9MH 3H7BA 2DQIH 2P7TB 2P7TA 4R97B 1IGIL 4NSKA 4NC0B 4KY1L 4R8WL 1CZ8H 4QRPA 2HFEB 1KTLB 3L5JA 2BNRD 1P69B 2BOCA 4N5UA 5TQ2L 2VZUA 4KKAD 4Z77B 3FAXA 1I1AD 2IFFH 5L0QC 5IB2B 5F7NC 4NQVA 5TDOB 4W6XB 2VMFA 4POUB 4AH2B 1VSCA 3BZ4B 5FA3B 4YNYA 3GMOA 3WFCH 2APWA 4I77L 4ZO7A 3O11B 4YK4B 3G04A 4MSWB 5E94A 1DQDL 1LWRA 1RHFA 3H0TA 5TDNA 4LDLB 2FB4H 1W72B 1KIPB 2EYRB 2X5PA 1LP9E 1NDMA 5F72S 4B5EA 5JDSB 4P2RA 3ARQA 3QQ3B 4UAOB 2Z92B 4YHZH 3OHXA 5IVXF 3E6FB 1BHGA 1JPTL 1UEMA 4L8SB 3ZL4L 1QSEB 3OBAA 5C0BE 4Y4KA 3VGEA 1JI2A 1QNZH 3DURA 2BVOA 3TH3T 1INEH 4K9EL 2PNDA 3DPBA 2I9LB 4OIBA 3IJHB 4U1GB 4I18B 4I18A 3ZMRA 4TSAL 4D0DA 1A9EB 1W72L 2UY7A 5IUSA 3L1OH 4XHJD 5I1EL 2AXGB 1T21A 4RQQB 4LMQI 3HI6H 2MJWA 3X3GH 3ROLA 4EEEA 5EZIH 1CDJA 5L9DL 1K4CA 2JELH 5CSBA 3STLB 1MCFA 3P4OB 3V6OE 1IQWL 1CGSH 4QWWC 4XTRD 2A74A 2GT9B 1HINH 3KYMB 4FA8A 4KKLC 4WEUD 4JM2B 4TOYH 4MDJA 4OI9A 3LEYH 5ICXB 1X4ZA 4OKDA 3WIHA 4JFDD 1F97A 2COQA 3DARA 4N0FB 4S1RL 4HIXH 1UQSB 2F54A 2WBJC 1CT8A 2VDML 2YUZA 1RU9L 4XP1L 4XWOC 5I1JH 3KPMA 5HGBA 3QNYB 4E41D 2ZZUT 3FRUA 2C1PB 2PXYA 3GNML 1EHAA 3QB7C 4I3GA 4YDVB 5I9QB 1RHHA 3RIAF 3O81A 4OCSL 2GJ6E 2P8LA 4V1DB 1N0XL 5C0BA 2R69L 3H7BB 4LEXL 3T0EC 5SWSD 3DRTB 2GYSA 3TZVA 1N4XH 4P59L 4JY4B 1H3PH 1WFUA 5TF1H 1MJ7L 1MAKA 2BOBB 4OFYD 3I85A 3V5DB 3SGEH 1SEQH 5GS2D 3MCLH 2D2OA 4PV8B 1A1OA 4D9QD 3VGFA 4G8FA 3VD5A 5ETUA 4R0LB 2JF1A 3IKCB 5F9JA 3SKOB 1I9EA 2Q86A 3QNXB 1UJTA 4G8GB 3TN0C 3RX7A 4LOUC 3U4BL 1B0RB 4OKVA 5ITBH 1TVBA 3I3EA 4Y8DC 1A14H 4F8QA 2NXYC 4P3CH 1M4KA 2XICA 5JOPD 2HJKB 3EYFA 2Y6SD 1U3HA 4P57B 1JGDB 4L3EE 3SCMA 1OAQH 2X4QA 1IGTB 3L3JB 3PWUB 1X4YA 4QRRD 3MXVL 3DX9B 5FYJE 4X7TB 5E9DA 2AJXH 3O8XC 3NCMA 4YHYB 2I9TA 4M8QB 2R56H 1F58H 3U7AA 5HHOD 5F3HA 5AZEH 4LSDA 3MFFB 3C08L 1CL7I 1Z9OA 1KC5L 3E3QC 5CWSB 1MLBB 3VFRA 1HYSC 5A3IC 3WHXA 1WBZB 2XZZA 2VABB 4BZ2H 2YN3A 2XQBH 4YHZL 1RIVH 3EYVB 2MHAB 1CD0A 1MHCA 3CUPA 1UJ3B 3DXAE 3GI8L 3GI9H 4GW1A 5CEXB 2Z35B 3GUTA 4X7DC 5J57B 1P6AB 2VXQL 3G6JF 4JG0H 4LCYB 1QLFA 1RZKH 3F65A 1YNTA 5GZOC 4Y5VB 1MI5E 4S1DC 3NVQA 3MPCA 4NZUL 5D1QB 3GHEH 4EOWH 2IH1A 4ELMB 1XIWD 3ZSSA 4WO4D 1C5DA 35C8L 2FYYB 1FV1A 3HE7A 1BQHB 3O6FA 3V5KB 1FL6B 4HUWB 4ZYKB 1EFXD 2EDLA 4P2OB 4HCRA 5JHDE 5EC2A 3U7WL 5IVOA 4R2GC 1KTKE 3ARBC 1HIML 2XFXA 1B4JH 2NY2D 3I6KB 1OP3K 4UTAL 1XF3A 1KELL 4Y5XA 1XGTB 4M7KH 4PJFE 4KTDH 5HJ3B 5DJDB 2K7QA 4QKXB 1OCWH 3DXAA 5DWUL 4I9WD 3GSOB 4XMLH 3HPLB 3X3FL 3I84A 1P7KB 1WF5A 3LEYL 4U6TA 1QFOA 4PJ9B 2JB6B 4HS6B 1WQVT 4OZFA 3PDOB 2VLME 12E8H 2H2SC 4JO2H 1YEJL 4PJBA 3BIKA 3K0WA 3R0NA 4JJHA 5C0IA 2IMNA 4PJAE 4G42A 3BRDA 2VSCA 5F7MC 4M6NL 5DMKA 5C0CD 3GSWB 3EJYC 5E95B 1UCTA 3HC3L 5JIHA 1I7ZA 3RY4A 3MCKA 4MQXC 1J86A 3MJ9H 1J05A 2VQ1A 4HC1H 2G5BA 5H37H 2NY0C 2X42A 4I3RH 4P2QE 1QQDB 4U1SA 3WUWA 5F96H 1D5BA 2VDRL 3WL9A 4XPAL 5EUKB 1RZJH 5J3HC 4UT7L 4LSTL 3AUVA 4U1JA 1AR1D 1OLLA 1OTUC 2PTTA 4MMXC 4OLYL 4PJ8C 1J8HA 4AENB 4JKLA 3BO8A 3ULSA 5T3ZE 2IPKB 4X6DF 1CGYA 2OJEA 1UENA 1NBYA 3UMTA 3IRPX 2PCPB 3MRLB 3FFCA 4EDXB 5DD6B 3D9AL 5E2TH 1KENL 4XT1C 2WSKA 1Q9WA 1QRNB 3MRHB 1HKLH 5MP6L 5F6HI 1WV7T 3S96B 3SGDI 5C0DA 3W11C 4KHXH 5DD1H 5DS8B 3SE4A 3AS2A 3FMGH 1OM3L 3J7HA 1NMAL 1FHGA 3S88H 2FLBT 1AO7E 4LLWB 4PR5A 2AJXL 5DA4A 4RBPK 4Y19B 4YH6A 4IRJB 1FVCB 3RA7H 2X09A 4JRXA 4CVUA 3R4DA 3OGCB 5MEPA 4KK5C 1V7NH 4NJ9L 3B5GA 1K8IA 4NM4H 5I1DB 2Y4SA 2BNUA 3IDNB 3INUH 3ZYIA 4S11A 3N1FC 2C3XA 4I0KA 1LK3H 1NFDE 4MD5A 1A22B 2IAMC 1NJ9B 5INDA 4YBQD 1MNUL 1CF8H 2B4CL 2OS7A 5D2NE 4XXCC 4LCWE 5KTEL 1CE6A 4OD1H 3EDFA 1OTTD 3K2UL 3QH3A 3AU1A 1HHGA 3EO1A 3F7VA 4L4JA 2RBLA 1AXTH 2FR4B 1QD0A 2BNUB 3GKZA 3RZCA 4MZ3A 4PJEA 3V5KA 2ICWA 3QIBB 4HAFA 1NUNB 3ZHKA 1JZ2A 5EU3B 2X41A 1G6RH 4K3DH 3LVEA 3KYKH 5DK2B 2XPGB 1FZMA 4JQIH 2CK0L 3MRBB 4XNYL 4YPGA 5DF0A 4NN5C 3VFMB 4QRTB 3QDGD 1VESA 1LDSA 1YEGH 3H8NA 1GGIH 3ECBA 1FFOA 5E5MB 4RIRB 4KHTH 3PL6D 4G6KL 5AAMA 3GRWL 4TTGA 2IQAB 1Z2KA 2ZSWB 5KZCD 2DMCA 4MXQD 3RWIB 3KYNB 4PB0H 2O5ZL 4WW2C 1IM3A 5MENA 5EUOF 4NQUA 4BH8A 3QUZB 2IG2L 3C09B 4N1CA 1KXTB 4I13B 4X9IA 3ULUC 2F53B 1IZKA 2LE9A 4LHUD 1CXFA 3IAPA 3WNNA 4NQEB 3LS5H 4MA1B 3ZE1F 4IOIB 3GSWA 4QXGH 3H9HB 2YKLL 3BRGC 4JPKL 4LKCA 4QHMA 2G75B 4OF3A 2RFXA 3Q6GL 3UZEA 5CEYB 1FZOA 1HWGB 2MQ0A 3QI9B 3DMMA 4R4BA 1D5BB 4Y4FC 4ZUUA 1RIHH 4OB5H 5D71L 4JZJA 5DJ2B 2HT4D 4RAUB 1BJ8A 1MEXL 2Y36L 3VFUB 4PTUB 4XMKH 1B0RA 3VRJB 3WFBH 2NW3B 1KPRA 4XCEB 4HXBH 3ILQC 4A2MA 3ZKSD 1KEGL 4M5YL 1SEBB 4X99B 5I17B 2Q7NA 5T3ZL 3B9EA 1A0QL 1RZ8A 1G7MB 1FLTX 1FG2B 3O2WH 1QLRA 3DX6B 5DR5L 2VR4A 3ETBF 4UTBH 3MRGA 4PBVC 1G9NC 5DD1L 3DUUA 5F7DA 3TYFA 1HI6B 3FQWB 2WP3O 3THMH 4HKXB 2WIMA 4K94C 4YHNA 1WTLA 1A3QA 2FGWL 2HN7A 1FAKT 3ARGB 2F58H 1VADA 4ZAKB 5LVEA 2EC8A 4X6EA 3NPSC 1ZGLM 5FF6A 1U3HD 1RUQH 2NY4B 4N8VB 4JPVL 3VI4F 1I85C 3VFRB 3HE7B 5HDBE 5K9QI 1ULVA 4FXLA 4AEIL 5IP4A 5GRXG 4JO1H 4UNTA 4O58L 4PJ7A 1J9CT 1NKOA 5JNYB 2R0LH 4PG9A 5HPMB 4JVUA 5LGHH 3C60B 2UVEA 3QIBC 3KPQA 4O2CA 1FZJB 1M7IA 2BRQA 4KWUA 5E9DB 4K71B 3KYMA 2ITCB 2AKRB 3LIZL 1SJXA 5C08B 5I8OH 2XWBA 4JKMA 1P4IH 4XB8A 1FVEA 3O6ML 3G6AB 1MAJA 4LAQH 4NQCA 1XF2B 5ALBH 3M1BB 5C2BH 4FTVA 1XCQB 1JGEA 2GAZA 1JFQL 3CFCH 1VACB 5CGMA 4NOFA 4WENB 3PWLB 3FZUC 3O45B 3L95A 4XHQA 3NOIA 1N6QL 3JWOC 4ZAKD 2JJSC 5CP3A 3SDDC 3CCHA 1W72H 4N5ED 5B38A 4JHZA 1BX2B 3QO0B 2AV1A 3R1GH 3FQNA 1PQZB 2IQ9L 2M26A 3ARFA 1ZLWH 5I8CA 4WU5B 4JJ5B 3GSUB 3MBXH 3MGTB 1KJVA 3NABH 4P48A 1UCBL 4HT1L 4L4TD 4TNWK 4I4WB 3W9EB 2Z92A 4IJ3C 1ACYL 1H3XA 5CEZE 5I73B 3QG6A 3NIFF 4UBDC 2YD9A 5FGCB 1S7WB 1J8HD 3QNXA 4GLRH 1E4WH 5F8RC 5CSZB 5E1AB 3QNZB 2NY6B 4PFEA 5IMKA 1G9MH 3KYOA 4HIJA 4MQTB 2VC2L 4AIOA 4EBQH 1YYLL 1CDYA 4TYUA 2F54B 3NCJH 3T0ED 4Z77A 1QKZL 4KQ4L 4U1NA 1SYSA 1I4FB 3EYOA 3ARDD 5ESAB 3MJ8A 4DKDC 4RWYL 3EO9H 3HMWL 3Q6FB 2R15A 3IB4A 1G1CA 3VRLF 4FTVE 5T1KA 2P8LB 4FQCL 3BEVA 1Z0MA 4XMPL 2UUDH 4Y2DB 2PXYB 3NH7H 1UH2A 3DRQA 1E4KC 1OTUD 4N5EC 2Q87A 1C5BL 3NTCL 2R1WB 1F8TH 4BUGA 3T3PF 5LGJA 4JFPA 2AK1H 4P2RD 3KPPA 1V5JA 2NY5H 2R4SL 2AI0L 3BT2H 4CBPA 3KJ4C 1A6WH 1MI5A 1WBXB 1CLZL 3RL1B 2ICWI 3AB0C 4P2QB 4Z7UF 3RTQA 1FORL 2X1WL 4TUJA 2OJZL 3MLWL 3BDBA 4JHWH 3T4AA 3SKNA 4M03A 5ITBL 5IBLC 1AIFA 3FTGA 3SDCD 5IFAH 2UY6A 4KKBC 4GG6E 3OJ2C 2GJJA 1T1WA 3F7PC 5I66A 1EPFA 1EO5A 2GI7A 1EGJH 1OB1B 1IMHC 2BHYA 2EE6A 4ZDHA 3E6FA 1T2QH 3MACL 2R23B 4OJFL 1A3RH 1D9KC 5KJRH 3EAKA 5FEBA 3GIZL 3BE1L 1QLEH 2APBA 1CICD 3TA3C 5EU6A 1N6UA 4JDTH 2B1HH 1GHFL 4U05A 4DVRH 3QP3A 4M7JH 3EDDA 3D6GA 3ULUL 2BVOB 4KRLB 3MLRH 2I27N 4WI9A 3A6BH 5I1GL 3TNNB 1FVEB 4PJBE 4RZCB 2EDYA 1T0NA 5I8EA 4JAMA 1X44A 1WZ1H 4P2RB 2HFEA 1P4BL 4DJMA 4CNIA 5J13C 1E27B 2E7BA 4OZGF 3C60A 1FNHA 1OTSC 4NO2B 4YDKH 5DZNA 5C0JB 1X5IA 2C3WA 1CICC 5ID0B 5FA3A 3QJFA 4XNMB 1MELA 1T1XA 3CH1A 4OTXL 1ZANL 2BMKB 1Y6NR 3EW3B 4MJ6A 4G6KH 35C8H 4ORGA 5EWIL 3WLBA 3SDXA 2Q3AA 3DX8A 4ODVL 1SVCP 1FLRL 3GMLB 3BVNA 3WFEL 3FO0L 5TE7H 1NCAH 5DC4B 3WXWH 5T3XE 5ID1A 1LK2B 1SY6H 4OCLC 1RUPH 2V5YA 2VDOH 3IDJA 5E0QA 1ADQL 1JF6A 2HT3C 4QXGL 3BGFC 5JXAL 3BP5B 1P4LA 1XGPB 4ONGH 1YEKH 5JUEH 3P0VL 3KPNB 3C5ZA 1NUDA 4X80L 5F9OH 3MNWB 2XWJB 3RKDD 3KPPB 1ZHLA 2BJMH 1OW0A 4UT6L 2ENSA 3DETC 4JKPH 4OLWH 3U6RA 4JZOA 4N0YH 43C9A 1JHKL 2WBJA 3MODL 4X5WA 1CGWA 4NO5A 3GSVA 5DRNA 3IXTA 4G7VH 4OF7A 1D5ZA 1QZ1A 1RMFL 5F8QC 5FYKD 2F53D 5DJ2A 4ZUVB 3IU4L 3MV9E 5E8EA 2B1AL 3DOSA 4QRRB 4JFHD 4JM4H 1N5YL 4FXGA 3TT3L 4HLZH 3STZB 2FH6A 2VZOA 4KU1A 4Y1AA 4P46A 3HG1E 3V9FA 4RMSA 1R3KB 2BVTA 4JCLA 1R5IB 4Z0XB 5SWSA 3EO0B 2OMBA 3B9VA 5CJOL 1F8TL 5C0AB 4M61B 5BXFA 3RU8L 4UDUB 4U1HA 3THML 4ZMAT 3OX8B 2CD0A 1EJOH 2LU7A 2AQ1A 5IQ9B 3HUJE 2AV7A 4X6BB 4ZPTB 4LNRA 5TPWL 4N90E 2HT2C 4IMKA 1X6LA 2CGRH 1AKJA 3OKLA 4WCYL 4M5ZL 3VXMA 1ED3A 1HHJB 3QIWA 3OAZK 4HIEA 3FMGL 3V79C 1J7VR 3KXFB 1C1EH 2P5WD 5JNYA 1SJEA 4O58H 1FFPB 4K3EH 1ETZB 1T89C 4RDQF 3QHZH 4V1DD 1BBDH 2V9QA 1X3DA 4P23A 5IB5B 1L7IH 2D7OA 1SJHA 1X5XA 2QQQA 1BZ9A 3O4LD 4O2FA 5DMIL 5EN2A 2H45A 1WFNA 1EEUA 2X7LB 4RA3A 1E28A 4IRZH 4TUOB 1HHGB 4C58B 3ARGA 3ZE0E 1JWSB 1QO3B 4J4PA 5AUMA 3EJJX 1G7PA 3RGVC 3VXME 5I76A 1MIML 4PTTA 1AY1L 1FNGB 1NJ9A 4J3TA 1VPOL 3P11L 3RZCC 5FYKU 3E2HB 5KTEH 4NQTA 1IE5A 1LP9A 4WEMB 2BVEA 1HKFA 1DBAH 3VXUB 1NCDL 2PXYD 2BNQD 2LAGB 4TVSa 2R0WL 3GMRA 1YMMD 3K81A 2V2XA 2BNRB 4P23C 5C6PB 1H8SA 3UYRH 4LIQL 5FM5M 3CLFL 2VLKA 3C6LC 1XGQA 1NCAL 2NNAA 5GRUH 1I3RA 4ZTPL 3V4VL 3ARGC 2OTPA 2ZKHL 3VD3A 2J8UA 1QR1B 2PW1A 1RJYB 5DFWH 1XMWA 5T3XL 4YDLB 3FOMB 2VXSH 5CZVL 3TNMA 1J0ZA 4IOIA 3G6JE 4KQ4H 5CZXD 5JLZA 5IROA 1FH5H 3UBXI 1ZV5A 1D5MB 4XBPA 2NY0B 1F4AA 2CRMA 4FRWA 3BP6B 2O5XL 4EXPX 4NRZA 2Y7QA 4L4TB 2E9IA 3IGAA 3LEVL 4UOW0 4OLWL 5GRVL 3UP1A 1BEYH 5B3NA 4J2XA 4FP8H 1IM3B 5EU6D 2DBLL 3KYNA 1DR9A 1Z0NA 4LSVL 3ZYJA 4MA7L 1Z9LA 4ELKA 3FB6B 3OKMB 3WD5H 1VKXB 5E5MA 5J56B 4JM4L 4JFXA 4KMLB 1IC5L 1UA6L 1A6TA 5AYUH 1C08A 1EA9C 4OD2A 5KW9H 4CU7A 5DVNA 3RDTA 1FZOB 1HCVA 1JF1B 1LO5A 4MD4A 3MLSL 1R3HA 4Z0BL 3L7FA 4OQTL 4K7PH 1WCBB 5AZ2L 3MLWH 3DIFA 2A38A 3D85B 3S36H 2P1YA 4KV5E 5GIRA 3MROB 3T2QA 3LEXA 4YIQB 5DHVA 3AXLB 1DQLL 2D3VA 3HE6B 4FQJH 2QQNH 4KPHL 3WEXA 3M45A 1FGNL 5HI5C 4XPBL 5SWZA 1K2DB 4OZHA 3HI5H 3BD5A 4PRPD 5I73C 3TEUA 5C86A 2JJVA 1DEEB 3G6JA 4O4YL 4CL7A 4Z7QF 1GIGH 4ZTOH 2GSGA 3MV8B 4NYLB 5E8NB 4D3CL 2V5MA 3LPFA 3A6BL 2CUMA 4OCRH 4HAGA 3L7EB 1BQHA 3V7AG 5ISZD 4H20L 3QIUC 1IM9D 4OZHF 3OAUH 1T4KA 1U95A 1HXYA 1RY7B 3M07A 3VDAA 5D9SB 3EO1B 3F7VB 4JO1L 4NN7B 2J2ZA 1DEEA 4HJ0C 2ZG3A 5TE6H 3DGGA 3VRIB 3AC0A 4WUUE 2CRIA 1I8KB 5I1JL 3MRMA 1LEGA 4K8RL 3DUUB 1MCDA 1MHCB 4H0GA 5F7DB 1QUNA 5DVOA 3G5VB 1H5BA 2GEEA 3MRQB 5EU7C 4XXDB 5C2UB 4O51A 2X70A 2Y25A 3VDCA 3WS3A 3MSPA 2O93L 5E6IC 4EUPB 3RWFA 4EVNA 4TNVF 3PWNB 3MXWH 1I1AB 1ZT4A 4CGTA 1DVFB 4F7TA 4EI6B 3CFKA 1MCWW 4MQSB 1JF5A 1P7QD 3RWCA 1KYOJ 3TN0B 1N6QH 2XN9D 2X89A 1SJVA 2JB5L 3U1SL 2OMNA 4P4RA 1QEWA 3P9LB 1QQDA 3KYAA 4P5KB 1QEWB 4P5KA 1GOGA 4TSBL 4Z7WE 3NACL 3SGJA 2IADA 3KNBA 1K4DB 2VQ1B 1A47A 1RQ5A 3B83A 1Z3GH 3NZHL 5SV3A 5T3XH 3WS6C 4XZUB 2NPLX 2HWZH 1RU9H 1QFWI 4LEOA 3DVGB 4HWBA 2YOCA 1DVFA 1MCRA 5C0IB 4CKVX 4F9PA 4PJBB 3PWNA 1M71B 4KTYA 5F9JB 5CILL 3MLXL 3PDOA 5EORL 3S37L 5MEQA 1M1SA 3GHBL 2ATKA 3B9DA 4QHLA 3WN5B 3AAZB 4X8JA 4PRAA 5FKAA 2D03H 2AXJA 2DWEA 4GAYA 3DO3A 2YPVH 4RISL 1QR1A 1U2HA 2NY6D 1ZMYA 1L4IA 2PTTB 3CFDB 1VFBB 4WO4B 3EJZC 1SEQL 2D0HA 3DRTA 1E4XH 3QEUA 4ETYA 2RB8A 3WL9B 3GMNA 5F7FA 4LGRB 1IGFL 4LF3B 4ODTL 5LAXB 5BS0A 4P23D 4GMSL 4K23L 5E2UH 1GOHA 3U36B 3MGOA 2XNAA 4UUJB 1LILA 4L8CA 4K7PL 5K9JH 1X9QA 5J06A 3JVGA 3S36L 2N7AA 2ADGB 4HUXB 4LVHC 3CDYA 3QXVA 3GJFA 2LVCA 1H3WM 2E9JA 2ZJSL 1DQLH 4FQJL 1KJ3L 3TBTB 1V3KA 4ISVA 5IV2A 1NCWL 4JFFB 1IGMH 5DRWA 4Z95H 1ODAA 4OZHB 3W0WB 3LKNB 2FIKB 4IRSC 2VXTH 5D7KD 2OJZH 4APQC 4MNGB 3ZT6A 3VI4E 5IIEB 4R96B 1BAFH 3DV6B 1F6FB 5DHVB 4L3ED 1LO2H 4FZ8H 5BRZE 2NZIA 3OJDA 3R0MA 5A2JH 3GSNH 2XQBL 5HHXH 1YZZA 2CJUL 1QLEL 4YXKH 5F1KC 2A6DB 4ELMA 1PX4A 3IDXL 3OF6D 3ULVD 3LSOB 1CXHA 1DBJL 3LMJL 1KF9B 4ZFOA 4QNPF 4KV5F 3MNZB 2FEEL 4XVUD 3BEWA 3KXFA 5IWLA 1QLFB 1S7UA 4P4KD 3PHQB 3MLRL 1KN4H 4Q9CA 2EEDA 4KMQA 2R1YB 3FB7A 5GHWL 1IKNA 2EIBA 2C4FT 4Y4FA 2EDNA 3EYQC 3UTPD 5E4IA 3TWCH 1MHPH 1JWUA 5CAYB 2ESVB 4N8CH 1F90H 1KIPA 4NO0D 4WFFE 4I3RL 5CGYD 4WU7A 4HUMB 5CWSA 5GJTL 4PLOB 4DFIA 2VDKL 1HIMH 1G6RB 4XBPB 5HYJD 3KR3L 4JHBA 1ZA3A 4OLYH 3D5OF 4XP9H 4ZUSB 3OB0K 2A6IA 5LBSL 4JM2D 43CAB 1DANU 1RZIA 5CUSH 1JYXA 2PN5A 3BQUD 4X7TA 1I1RA 2BP3A 1NFKA 9CGTA 2EE3A 5C0BB 4M48H 3S3SA 3BZEB 1PJ9A 4UOW1 5C0ND 4HGWB 1AR1C 2DQJH 2OCFD 3RX5A 1TQBC 1XGQB 3WXWL 1MPAH 2IBBA 5JIIA 2K3TA 2RCSH 4DKFH 5E6ZA 1UWEL 3GSVB 2PETA 2WBJB 1G7QB 4X5WB 5LQBL 4X4XA 5C0CA 1I7RA 1IARB 2LU4A 4NQDE 4N0UA 3JWOH 2IANE 4C55A 1AE6L 3KPSA 4RSVA 1CD1A 4O2EB 1A4KB 4PRIB 4FQ2H 2DN7A 2ZPKL 3TV3L 2J3SA 3TESA 1D6EB 1M7DA 4PJ9A 1QSEE 1P4LB 4GOSA 4KK8C 2DIAA 5EPMB 5DVLA 3HPLA 1V7NL 3CSYB 4YEEA 2Y5TB 4PRDB 3O0RH 3EIFA 4FFZH 1KBGH 4F58H 3MRIB 3BP4B 3SE8H 3I2CH 4LLUA 1WAAA 2EKJA 3S3JA 1KJMA 3BJ91 5CP7B 4JREB 4PJIA 3QDHA 3RRQA 5I0DA 3MV11 5E2TL 4TQEL 2DM3A 5I9QC 1L0YA 4C57C 4LSPH 2P48B 1Q1JH 4NQCD 5DQDH 1N59B 5KVFL 3RUGA 1R5VA 2A1WL 4YXLH 5BQ7B 5F89B 3EOTH 4RAHA 4S0TD 2NLJB 5D7JB 4HLJA 2F5BL 3O4OC 2GTWA 4OLXH 5E8DH 1R0AH 2GJ6D 4F7PA 4KTEH 4NO2A 2FH8A 2X1QA 4BSVA 3HNTL 3TO2A 4Z78B 1QSEA 4HIEB 4KUCF 3BIBX 5J1AA 3VG9C 2V2TA 2VXTL 5C6WH 1DDHB 1YJDH 4H8WL 4QXUL 1AKJD 1F4XL 4HJGB 2NXYD 1SBSL 3UEZA 3FQXA 2OXHA 2PYFB 1YC8A 2VKWA 5D7LA 5IQ7L 4H5SB 1LO4H 1MLBA 4OZIE 1UM4L 1ZSDA 2KL6A 5INCA 3B5TA 4O5LL 1KG0B 1TQCC 1FG9C 4FQIL 5SX5H 2OL3B 5TE6L 2DAVA 3K7UA 5TDOA 3T0BA 1JHLL 3LQMA 3AVEA 2YEZB 2VQUA 3VA6A 4ZO6A 5A3ID 5BRZD 1JHTA 5GSRA 4ODWA 5IJVA 3BPLC 4NQDD 4O9HH 3RI5F 1AQKH 5HYQB 2EH8H 1OW0C 4QF1A 2D7MA 3KPRB 4YZFE 3E8UH 1RUAL 4HKBB 1AGDB 4JPKH 2HKHL 5FO8B 1TFHA 2ZUQB 2EDQA 3QQ3A 4N68A 4YBLB 3T09A 2P46B 5KSBB 3MRRB 3QCVL 3L6FA 3BP7A 4ZG1A 1G9NL 2EYTA 4J3XA 2H32A 4HG4K 1PG7X 5CGTA 3FT4A 4RGOL 1I9RL 1JTPA 1DBAL 3KR3H 3CK0H 4XP9L 3KPSB 4XPFH 4RAVA 5L0QB 3QDGB 1GC1L 1DLFL 3T0XA 3GM8A 4L1DA 4Z7UB 4Z7WF 5L6YL 1F6LL 2OQJA 4NNPL 4QTHB 3P0YH 2HJFB 4CU8A 1ZVSB 2C7UA 5A2IH 4M48L 5KN5A 1YQVL 4UV7L 4Q6IB 4KY1H 5ID1B 3F6IA 4WW1B 1L6ZA 2DQFA 4HPYL 5MI0C 5EO9B 5FO7A 1NC2A 3BGMA 4HIIA 2FBJL 1REIA 1MCJA 3V4PL 2A6IB 1HOCA 2VXSL 1ND0B 4J3VA 3QJFB 3DV4A 5GISH 3OKNB 5EZLB 4OV6F 2XZCL 3RWJB 1GJIA 1EH9A 1NH6A 2GK0A 5DVKA 4WHTA 1BBJB 1RIHL 5FAAA 4ODTH 2ZOLA 4JPVH 1T5WA 3DX7A 3L3GA 1IGJB 3HPJB 1JK8A 5IVXA 2A74B 3LZFL 2WBJD 4HJJL 1JNNL 1S7SA 1ZVHA 1U42A 5C0AE 3VI3F 5BMFH 3TO4D 2QV2A 2EO1A 4QGTA 3WUZA 2F54E 5J4MA 1FJ1B 1RURH 3U9UB 4HLZG 1MCQA 1KNOA 5HGHA 2A6DA 3QYCA 5KVFH 2YPLB 5MEND 3L1OL 2WBWB 4AG4L 2X40A 4X6FA 3U0PA 4QYOA 4L5FH 5L2KB 3FFDB 2WWMC 5MHSD 4PJIB 1KB5A 4W70A 3HNTH 5IOPA 4ZOAA 4X83A 2Q6WA 3RTQC 4NGHL 3HFML 1UYWH 3T04D 3L9RB 4U1MA 5ENWA 3QEHB 1T66C 2CKBH 2LU3A 1AIFB 2QQNL 3MYJB 1O0VA 4P9MH 4XNXL 1YJDL 3JV6B 4H8WH 4ZUWA 2V7HA 4QCIA 3U0TA 1CDIA 2Z8WC 4Q2ZB 2FHFA 1ZGLA 2ITCA 1ERNA 1HHKB 1MAMH 3RWDA 3ZKXB 3TPKA 3NA9H 5FGRA 4PRPA 1MCEA 1W8NA 3WCYA 2C4XA 3S8WA 1KSRA 3GMOB 3VD9A 1P7QA 4JG1H 2WUBL 3ZKND 1HNFA 4XBGA 3IFNL 3AY4A 3WXVH 2D7TL 2Y07H 5EBLA 2UWEE 4JFEE 5KG9B 4ZODA 2P5ED 3EJZD 1RSFA 2I07A 3KS0J 3VMPA 4EBQL 5E9DE 1EJ6A 3GBMH 4XP6H 1MVUB 1EO8H 3QUYA 4QHKJ 3AMKA 3N85H 1RZIB 1FN4B 3TPUB 3OQ3B 3IDGB 4U1KA 3V0AC 2WUCH 2I26N 1FL5B 4PRHA 5EU7E 4JVPA 2XWTB 5JPMB 2Q76B 1NFDB 2CXKA 1UWGH 3C2SA 3WSQH 1M05A 4NKOB 4HWZA 2NY7L 1I7TB 3QUKA 4Y5YC 4I4WA 4MJ5A 1KJVB 5BO1L 3KLHD 2R4SH 5BOPA 2JCCA 1J1PL 2PUQT 1MCLA 4NBZB 5M95B 4WGVB 4ETQB 3MLTA 2GJZA 4NBXB 1EEZA 1NAMA 1BVLA 2BVPB 5JZ7D 2OM5A 5EIQA 5CMAB 2J5LC 1F58L 5C09D 4F37F 3BSZL 4LKXA 2EDFA 3ARFC 3RL2B 4QHMB 2J4WL 1JVKA 1Q0XL 1B6UA 2FJFB 4ENEC 2WAHA 1MCSA 1WGOA 3PNWB 1FC1A 1CGXA 1DP0A 1I1AA 2GJ6A 3C08H 3A6OA 3O0RL 3QWRA 1IGIH 3LDBC 3ZKQD 1EGJL 4OLUL 2F53A 3MV7B 1EUUA 4WV1B 4BQCA 4P5TD 5EORH 5TGBB 3QULA 2BY3A 4GW4A 4HEME 4G6AD 4MLSA 3DYMA 5EIIA 5TQ0L 2HRPL 1CG9A 3GI8H 5IHLB 3EOAA 1H8OA 5IB3A 3GFUA 2ZUSA 4HHAA 1RJLA 4GQ9H 5ANMA 3ARBB 1U8KB 3VFOB 3LN9A 1KCRH 4NQDB 1MJ8L 3DHJA 4PS4H 3SKMA 4BFGA 2XY2A 3OG6B 1NEZA 3RVXD 1MCHA 1IGFH 4LPVA 3TA3D 4NUJA 2WQ8A 4Q9RH 5FDWA 2B7DT 5A2FA 1JRHI 3RVXC 3FFCE 5FUOH 1L0XA 5FDWB 4X8XA 3ZDZE 4LLYB 4QXUH 3TVMB 3JBG7 3HG1A 1PYWA 4JCMA 4OD3H 4OSUH 1LO0H 1KB9K 3DVNB 3I50H 1DZBA 1IAMA 1TVDA 1DBBH 1LO4L 4KXZI 3O3BA 1J8HE 4S2SB 3G6DH 2V5RA 3MACH 3BPNB 4HDIB 4LK4A 5ESVB 4ZUTB 1IVLA 1EK3A 2AEWA 4R26H 4YC2B 2R29H 3L3OA 1DQJA 3VD7A 3WIIL 4JDTL 4JZNB 5SV4A 1QSFE 4CJ0A 3WO4B 4R90L 5EC1A 4GG6F 4HCRL 1UM6L 4JY5H 1ZHBA 5F7EL 4R7NB 2EXYC 2L7JA 4RNRA 5L2KD 1RULL 3EFFA 4Y2DD 3W0WD 3GJEA 3REWA 4PJ5E 1X5ZA 4JG1L 2PTVA 3VGAC 5BS0E 5I8KH 3HC3H 2G60H 2J6EH 4G6ML 1ZLVH 4PP1C 1GZQA 2C9AA 4R7DA 3PGFL 4UV4L 1OGAA 2JJUA 5FHBL 2BSSA 5B39G 2XOTA 1W8OA 4UT9H 4X80H 5H37G 4Y19E 1X7QA 4H1LB 4XPAH 2ZSVA 4NT6A 4Y5YA 4RA0C 4CAGA 2OYPA 3QDMD 1T2JA 1A7BA 4L4VD 3VGGA 5DS8A 1ORQA 3QUKB 2R1XA 2XKUA 1U8LA 1G1YA 5J12C 1D7FA 2CKBA 1MHHA 3MRKA 4YE4L 2VUOA 2Q76A 4OLZH 3SDAB 3UTSD 3SO5A 1YEFL 3REWB 4NKDB 2DLHA 1W0WB 5CZXC 1OT2A 3N9GL 1QBLL 4WHCA 4XPGH 4M62H 2EDOA 1U58B 4X0KA 1B0WA 4DTGH 5DD5L 1UWGL 15C8L 1NDGA 3DMMD 3MLVH 3CFEB 1MRCH 4J12A 5MENB 3D87B 3RPIB 2ARJA 4X7SH 3TBYB 4P5MB 4JFZL 3VG9B 2IFGA 1NAMH 4LQ1A 3V7AE 2AXFB 1Q72L 2X2YA 3O2VH 3EBAA 4LAJH 4HK0B 3UAJC 1MLCB 3VFMA 4RWHA 4WI5A 4YPGB 4JM2C 1Y6MR 4FFYL 1U0QA 3PWPA 3OB8A 1I7UA 2GIYA 2BNRA 3RUGF 4OZGE 2LABA 3O3AB 1QHOA 2Z31A 3UTSE 5I6XB 4XNZC 5IW3A 5BV7H 4MJ2A 4I2XB 1A5FH 5FGBA 5FYKL 4MJIA 5T1LA 1VENA 5BMFL 1CF8L 2B4CH 4KQ3L 2EDJA 3HZMB 1YECL 4UDTB 2W9LA 2C26A 3QFJE 5HHOB 2XXCB 3BYYA 3NFPB 1YNKL 3CMOH 4OCXH 3S35H 1G7LA 3LS4H 3JV6A 3K2UH 1UGNA 2IMMA 4KJQD 3QBTB 3WJJA 2FCBA 3QULB 2VIRB 2X9XA 2IAMD 3SDYH 4F8TA 1QNZL 4I2XA 2R0ZH 3MROA 5A40E 3PWPE 2VQTA 4Q9QH 4ZS6D 2H32H 5FUOL 4PGCB 1SJHB 3NFNA 5JMOC 3VJ6A 4I1NB 5HVHB 3CLEH 4MXVF 2CUHA 1AGFB 1RZKL 4LKXB 3MRFB 2BDNH 4ENED 1EHXA 1MAML 1NEZB 3T8XB 2FATH 3GO1H 3VGAB 3LKSA 1G0DA 1FNEA 2X9YA 3X3GL 2EYSB 4QOKA 1XF5B 4GW1B 1F6AB 1ZAGA 3KAAA 5IW1A 3BAEL 3UJTL 4WTXA 2WUBH 1NCNA 1BP3B 5DUPL 1SY6A 3X12A 5H35A 2FX9L 3PE9A 4C56A 4KJYB 2J6EA 2A83B 4NFBA 1B3JA 3B3IA 3AM8C 4HG4J 3VXNB 2ZKHH 1FC2D 3QHTC 4XNQA 5GGRA 5E8PA 1VEOA 4IRJD 4GXUN 2W0FA 4HIXL 4RMUA 4XRCB 4PJEF 4F9PC 4MWFA 4MJ4A 3TM6A 3K8MA 5CZVH 4JDVB 5C0BD 1F42A 4R3SB 3CFJA 1WT5A 5D1ZC 5KS9B 1W0YT 2NMSA 1ORQB 5HYSG 1B6DA 5B38G 4M9OA 3GSQB 5ICYA 3BGAA 1KIRA 5FCUH 3O3DB 4O9HL 5DTFB 1ZVSA 1A6ZB 1KEGH 4YXHH 2AVGA 4FMKA 4S1QL 3I3DA 4QTHA 4HWZB 1IILE 2BHUA 1HSBA 3GMRB 1FDLH 4DN3L 3QDME 5D1QC 3UYRL 3O2WL 2VDNL 4YDIH 2P5WB 2A0LC 1NMCC 2IJ0C 4BKLA 3EJYD 3VXOA 2NX5A 1XR9A 2EYTB 3NIDF 4JM2F 2Z4QA 3BP5A 5TE4H 3S34H 5CKGA 3H2WA 3NFSH 4HC1A 3DROA 2YRLA 3LRHA 3IDJB 2P8MA 1P9MC 1CN4A 3BZFB 1NKRA 3OKDB 4QF1B 4K7PY 5HJ3A 2L0DA 1CXEA 3TZVB 1S7TB 3BOVA 4HF5L 2JJWA 3QO1B 4DUXA 4JRXD 4QRUA 5C0RL 5CEZL 5DJYB 4IIQC 4MD0B 4TUOA 3SDCA 1L9NA 4ZXBA 4IS6A 1RZ7H 3GMLA 4YHMH 5LCVL 3QNYA 2HH0H 1K8DA 3MXVH 4UAOC 5TQ0H 1NGXB 4KDTA 2EXYD 4G9DA 4ZPVB 3T65A 4WFGD 2R56L 2EDDA 3UTZB 3Q48A 3X14B 4M6AA 4LHUB 4PJCF 5GISL 3U9UA 5A1AA 3ZKMC 4M43L 3H42H 4YK4C 4CADB 3D2UD 1INQB 1YMMB 4GLRI 3ZDYE 4J6RL 4OGXH 4RBPH 3BKCH 3BN9D 4YUEL 1ED3B 1D5XB 4Z0BH 3GMMA 3MA9L 4C83A 3CXHJ 3HE7D 5C3TA 4DQOH 4ZPTA 4DGVH 1LK3L 5TGBA 3QFJD 1I9JL 1R24A 2R0ZL 4MX7A 2HFTA 1KN2H 3T0VA 3DV4B 3J8F7 1NEZG 5T33H 1T2XA 3ILPA 4XPBH 5FM5O 2HG5B 4WFGE 3BUYB 5SWSB 1JV5B 1WSST 5ITFA 5F7UA 5GS0H 4QRRE 3HZYA 4P57A 5C0GA 1EFXA 4I0PA 1K9TA 3MJ7A 3KVQA 5C8JB 4ZNCD 1UYWL 5CIPA 1TJGH 2AAVA 3UJTH 4L9DA 4PJ7F 3T4AB 1JK8B 3T3PE 2MTPA 2IEPA 4LVNC 1IGYA 2FX9H 2V7NA 4XMLL 1EIBA 2EYRA 4HKZA 1TETH 1E6JL 1TPXC 1E4KA 3F7YB 1OAYL 1RK1A 2BVQA 1KXQE 5C07A 2DD8H 3PDDA 3LKQB 5FYLD 4WWKA 4AEFA 1OF2B 3E3QE 5IBTL 3GMQA 1BREA 2YBRB 4IRSA 3VG0L 3LN4A 3L5HA 4YGAB 5F9WB 1PD6A 4G9FE 1UKQA 4BFEA 1JWMA 1U8PA 1HQ4B 2J88L 3V8OA 2Y07L 3PWJB 1MWAA 5B39A 2CMRH 1NGYB 5AWNL 4PJXB 5JQ6L 1FSKB 1NGYA 4FQXB 3VFNA 3SO3C 2JKXA 4XMPH 4BYHA 5KN5B 3NZ8B 1CU4L 2C7UB 4K2UL 3BVNB 2HLAA 5D72H 4I5BB 3SDXB 1E6OL 3KJ4B 4G8IA 4XP6L 1KFAL 2RJMA 2FD6H 4ZUSA 3LN4B 1OAQL 3ARTA 3T2NL 4AM0A 1P7QB 1RZGB 1G6RA 5D2LF 4Q6IC 2OK0H 1NGZB 1S9YB 1A6WL 4KKCD 4UINL 1Z3GL 3NZHH 4LDEB 1RK0A 2VL5A 2VLJA 2Z93B 4MXWH 1N8ZB 1BIIB 5D7KE 5D5MB 3RX8A 1ZVYA 3MGTA 1R3JB 2CSPA 2O5YH 1TNMA 3TNNA 5C0RH 4JJ5A 2CLRB 2DBJA 4G80B 4MQXD 3PL6C 1CFNB 1Q9KB 3FO2B 3REVB 4DVRL 4KJWC 4IOFD 4UILH 5IHZA 2L4OA 4P2QD 4W68A 2ADJA 2J4WH 3L95B 2ADJB 3MUHL 2P24A 3WFCL 5MI0B 3CMOL 4OCXL 3WNKA 2D0FA 2GFBA 5C0EA 4F33B 1IC1A 3RPKA 4WFHE 4WI2A 5JQHC 4GT7A 5FO9A 3RGVD 2AEPH 3MRIA 4K3GA 2XV6B 5IVNA 2IAND 3I75A 4C83B 4MA8L 3EYUL 3VWJC 3MJGX 1DDHA 3IDXH 2JIXA 2NY2C 4YHPB 4PGDB 3H9YA 1TENA 3RL1A 3C6SA 4TRPH 4CADA 3UXFA 3MLYH 3QEGL 3X17A 2OTWA 5FOBB 3G9AB 3IF1A 4KROB 5LGJB 5EZLA 3CNKA 5J11B 4U4BA 5I19L 1UJ3C 2DB8A 4TULL 3V0WH 3EYSL 1WLHA 1WIUA 4UUJA 1X6NA 5HYSA 5F70A 2E5EA 2I24N 3IDMA 2O26U 4OQTA 5CP7A 2X05A 2FNBA 2HA1A 4YHNB 3PQYE 5B39B 3D39E 5BJTB 3TYFB 3JTSB 1T7XA 5ESQA 3OMZA 5F9OL 2DWEB 3T2OA 3WIHH 5KSVB 4YEFA 4JFQB 3BWUC 4XVSH 2QLVB 1FG2A 1DQTA 1ZEAH 1KOAA 1PZ5A 1EEQA 3DTXB 1ZT7A 4FQXC 3ULUE 4OFYA 4NC2B 2YK1L 3V52H 3FT4B 1BLNA 4BKLB 5F1OB 1WITA 5DO2D 3FONB 3K1DA 1IGYB 4DGIH 1RPQA 2OBGA 5CGYC 2DQDH 5D1QD 4KC3B 5KVEL 5ERWA 4Z8FH 1AGDA 3TIEA 1Q0YH 1U93B 4LU5L 2AJ3B 1G9ML 5JORA 2W65B 3CXDL 4R6UA 1PQZA 3FQNB 4MJIE 4CMHC 4AT6A 5JW3H 1XR9B 4KZEH 5HYEA 1OM3H 3RWCB 1AO7B 5E08H 5EOTA 3BMWA 5EU5A 5LBSH 4G8EB 3RU8H 4F7TB 1WBYA 5DJ0B 5B21A 4RWYH 4PJ8B 1IKNC 3BYTA 1C12B 1N3NB 1NFIB 4KFZC 5EO1B 3L5XL 4NQEA 4NZTH 2GQHA 2DQEH 2B0SH 3FOLB 1VGEL 5DEFA 3JWDC 5IW6B 3KJ6L 2AEQL 3N06B 4LIQE 3GSQA 2CGRL 4OBSA 5MEOA 1MCOL 2AJVH 3PQYA 3ORJA 4NKIL 1CK0H 4JFFE 3FN3A 4U49A 1JWUB 1MH5A 1HEZA 3B9AA 4AIZB 1A4JA 3PABA 1K85A 3UC0H 2EDHA 3V7MA 1LMKA 1S9XA 3U4EA 4D9RE 4F57H 2ZPKH 1WIPA 3BPLB 1HQRA 1OD9A 1L7TH 1L7IL 4OD1L 2VXUL 4JQVC 2PO6D 4QOKE 2BVUA 1UVQA 4LSRH 5EIVA 3RUGB 3CVHA 2AGJL 4ZQKB 1N59A 2RIKA 1AXTL 3QR2A 4JPWL 5CKAA 4PP2A 5I1LA 1TZIB 4NNXB 2DQUL 5DLML 4O5LH 3D3VE 3EKCA 3SHSA 3PV6B 1A6VL 1KJMB 2YWZA 1G9EA 2WM0A 4U33A 1LNUB 2V9TA 1UC6A 5IIEA 4G5ZH 2C4FU 1AGFA 3WO3B 5HHOA 5SX4I 2R8SL 4X8JB 1DL7H 1OPGL 2VLRD 3AXLA 4NZJA 4PGZA 4PJHE 3SOBL 3EOTL 1G7MA 1AQKL 3SGKC 4J1UA 3IDNA 3U83A 1IAKA 2APXA 4C4KO 4NHUA 1ZLWK 5I17A 3H6JA 2O5ZH 1KGCD 3Q5YA 2E27L 5T5NF 2I5YH 3L3HA 3CC5B 1S8DB 5DVMA 1ZGLP 3A0OA 1W0VB 4PR5B 1HINL 3MGOB 2X4OB 3MV8D 2RHEA 1DLHA 1I1FB 1F2QA 1KIRB 4NP4H 3PJSA 1D6VL 2YD3A 4DK3A 1C08B 3L3KB 2Z91B 5BZDB 4YFEA 4BK4A 2DD8L 4HWUA 4YHOL 4POYA 3FQRA 1XIWA 3C5JA 1WJ3A 5L6YH 2WV3A 2G75A 3CFJB 4KK9C 2Q1EA 1T03H 4XP1H 3LEVH 1UM5L 1T1YA 1YQVH 3MRHA 2YC1A 2FX7L 4J8RB 2NXZC 1OQXA 1WTGT 3QI9C 4J3OC 3LB6D 1U8NB 5BRZB 2F74A 1EBPA 2A83A 1JBJA 4P3WA 4RMQA 5H35B 1N4XL 5DFVC 1CXLA 5IK3A 5D70L 3FOMA 3D69B 1A0QH 3IAQA 4Y4FB 1IKFH 3OZ9L 1QKZH 3FRPG 3S5LA 4GO6B 4RIRA 5A43C 5J13B 5HD8C 1R3LB 4KZDL 3RPIA 3HN3A 5EUOA 2H3NA 3T08A 2BZDA 1MJUL 1X7QB 2F54D 3QIWD 5IESH 1I9RH 3K3QA 1FPTL 1H9VA 4ZFOB 2ZUTA 3TN0A 4TUKL 3MOAL 5IFJB 2XPGA 3QSKB 4J8RA 3QHFH 3MV7E 1GZQB 3M17A 4M6OH 5EZOL 3L7EA 5MENE 3GZKA 3MR9B 4RDQG 3TT3H 5GGTA 4EUPA 3ZZ1A 1KENH 3CDCA 3C5ZC 4X9HA 2ZUWA 3HR5B 4UU9A 2FL5A 4XAWL 3UBXG 4LPCA 5KVDL 5IM7B 1BD2A 4AG4H 2R0LL 2Q7YA 5I76B 1FO0A 5INDB 1Y0LA 4QGYA 3C6LD 4YLQT 1LNUA 3CIQA 4OCRL 4YBQC 1GGBL 1TPXB 1PX3A 2BC4B 4N9GA 3O6MH 1IAKB 4BQ9A 2LVEA 1EBAA 1CFSA 1O7SA 2D9CA 4WWKC 5F7HA 1AQDB 3PIQA 1JZ8A 4POZC 5DJXB 5JOFB 2VZ1A 3Q2CA 2XNAB 1LEIA 2B5IC 3UTTD 3RVUD 4E41A 4OF6A 5I6XC 3SPVB 6CGTA 3QHZL 2C3HA 3P4MB 4Z7WB 3MOBH 1OHQA 4M43H 1A6TB 2R0KH 1IC7L 5E9DD 1JNLH 3FB6A 3DNKA 1I1CA 3MUJA 3U9PH 2F53E 4HHAB 3HE7C 5SWZB 1U8MA 2YS4A 5FK9A 4X5LA 4HMEA 3WHXB 3WEXB 1JE6A 3BKYH 2X9WA 2WBKA 3CX2A 4N0RA 1UCBH 2QBWA 3K8KA 5E6IB 3HG1D 4ZFGH 3BP6A 3MOQA 4LGSB 4UIMA 3GSNA 1ORSA 3GBML 4UDUA 3D85A 4LFHD 3SKUD 4QRPE 3WE6B 4Z7OE 2I9TB 1OCWL 3C5SA 3GGWB 3BRFA 2A73A 5DWUH 3DX9A 1K6QL 2QSCL 3PWUA 3T0EE 5D1XC 4WDIB 1YEGL 4Y1AD 3RBGA 3L3KA 4PJ9D 1DBKL 2CH8A 2YK1H 2G5BB 4YFLF 4AYFA 2DQHL 2HWZL 3CDGA 5ADPL 2JCCF 3L3HB 4WJ5A 3IFNH 1TTGA 3MJ9L 3TBVB 3P0VH 4PRHB 3BWAA 1WISA 3FB8B 3KPRD 3SE3A 3VXSD 4OCWL 4M1CC 4AT6B 2IPUK 5SWZD 1NC4D 2BK8A 1NANI 5JORB 3V6OC 2NTSP 1HCFX 3TJHC 1ES0B 3L3OB 5HDQL 3QUYB 3NIGE 3MRNB 1QO3A 5ESVA 1UWXH 5E1HB 1IFHL 2FRGP 4EI5C 3RNKA 3DGGB 3VRIA 2R9HC 4OB5L 4Y5XB 1CBVL 1BWMA 5E2UL 1KV3A 1VGEH 2PO6A 2VB5A 5HHQA 1FL5A 1UKSA 3RWHA 1BMGA 4M7LH 1NLDH 4N9OB 4ELME 4MJ6B 1BZ9B 4O2FB 4EUPH 1YY8B 1QSVA 5D7LD 5KSVA 4HS3A 5F3BB 3BN9C 2IH1B 3K8LA 4XPTH 4JO4H 4N0FA 2EH7L 5IF0B 3MLUH 1ZS8A 1OARH 5C0FA 3RGHA 4XCFH 1CS6A 4LCYA 1FFNB 2WWKT 4OQTH 4M1GH 5FA4B 4JRYD 5HGGS 2DIBA 4XH2A 5ANMB 3AB0B 1LO3L 3HI1A 4G9FA 3E6HA 2F8XC 3HUJB 2KDGA 2OZ4H 2ICCA 2MPAL 1MHEA 1WT5C 5D1ZA 5FKPB 5FECA 2AXGA 1GGCL 3NN8B 1OP5H 3QUYD 3LQAL 2C3VA 1JN6B 1IT9L 5AD0A 3BH9A 5GZND 3GDBA 4G8EA 1SM3H 3DJ9A 4WI7A 5IHZB 3L7FB 4NN6B 4AEIH 4OCNC 2NY3B 4GQ9L 1UM6H 1BGXL 3WKMH 1HE7A 1BQSA 3WDJA 1MFDL 3C8DA 2OTUB 3GM0A 1MHPL 4PY7B 3ROOB 4OIIH 3W9DA 4NCC1 5ILTL 4CMHB 5I8OL 4M7ZC 3O41A 3FN9A 4UV4H 3IJSB 3ULVF 1A1NB 5HHPA 3VXMB 2HLFC 4XAKE 4QYOB 4NO5B 3ZKMD 4NKOA 1JRHL 3DX7B 1MIEH 4Y4HB 4YQXL 1RZKC 5J9PA 2VDPL 4X6BA 2VDKH 4ZSOE 4NDMA 3KPOB 1SQ2N 3I6GA 1ZA6A 3REVA 4CN1A 5KS9E 3CVHH 2CO7B 3SDAC 5TH2A 1NCDH 4EQ3A 1HHHB 4L3EA 4XCCH 5DJ8A 3JTTB 3ARFD 5T1MB 2OP4H 5D7SL 4RCAA 3S5LG 4HXAH 4R26L 4LHQB 1AI1H 4HBCL 3PGDA 4HWEL 1RVFL 3DUHA 1R3KA 5BV7C 5D7IF 1KTLA 3RVWD 1K5NB 2DQJL 1A6UH 4R90H 4NSKB 1T5WB 2IG2H 2IFFL 1NFDF 1J10A 3MA7B 1NBQA 5A16A 4HPOH 1JWMB 4OZIB 5D5ME 1UB5A 3D25B 1OAUL 4R2GB 1KPUA 3QFDA 5HBBA 1OLZA 4XNZB 3RY5A 5EU6E 2X44D 4EUPG 4K3HA 1T0MB 1KLGA 4JRYE 2Y72A 4UNUA 5TH2B 5KVGL 2VLJD 1ZHKA 3TV3H 5FOBA 5C07B 3OV6A 1GH7A 1NSNH 4PREB 1MJUH 4NBYB 3ZTJH 1EHLH 2DQGH 4CNIB 4ZOBA 1U8PB 3SDXE 1YN6B 2XN9A 2EDBA 2KZWA 1TNNA 3BKMH 4ZS6C 1IGCL 2A6JA 5D8JL 4OLZL 3S37H 1P1ZB 2VAAA 2PYED 2GKIA 3FRPA 5IJVB 3DBXB 4U2ZA 5GSRB 1OF2A 1JHTB 4RAVB 4U6VL 1F3RB 5LXGH 1FAIH 1RFDL 5I1EH 3QWOA 1PY4A 3S35L 1L0QA 1RK1B 2BVQB 4D0DB 1MOEA 4Z7UE 4X7CC 1HH6A 1DFBH 1A7RH 4HGKC 3MLZL 2OL3A 4M4PA 1U3JA 2VUYA 4NZDA 4BQBA 4XCFL 2DQEL 3PP4L 5JOEA 3H9SB 3OF6A 5D96B 4M3JA 2DRUA 2YUXA 5FUZH 1JGLL 3E6HB 3BQUB 3K4ZA 3LPGA 4JR9L 2IALB 2EDRA 5D5MA 3WDHA 4JFDA 1B2WL 3TJEL 1SHMA 2VLJB 2Z93A 4JFDB 4KKBD 4N0UE 3UBXA 3H3PH 3OXRB 4JAMB 1A3LL 2BFVL 2CKNA 4JFHE 3H7LA 1X5FA 3K74B 4HUVB 4UZGA 3GSRA 5I71B 5HGDB 3OKKB 1FZKB 4XC1L 3LQAH 2VXVL 1GIGL 3KPRE 1MFBL 2J8HA 3SQOH 1RZGA 3T77A 5I30H 3PDGA 1IC7H 1JNLL 1YEHL 2AGJH 5ICZA 3WKML 2J5LB 1RUKH 2WMPA 1R5IA 2W38A 4Z0XA 3IFOA 2NZ9D 1CGVA 4LAQL 4P46B 4GRLC 4KK6C 4QRPB 5EBMB 2NQCA 4XC3L 1D9KA 3I02A 2PR4L 4IRSD 3VXRB 1D5IL 3OL2A 4ZFGL 2DL2A 4BSVB 1KCUL 5ESAA 1F13A 4NHCL 5DZOA 3W2DH 3EYOB 4ZUVA 5D7JA 2Y5TA 4PRDA 4GW5B 1ACZA 4CN6A 5DRNB 1QG3A 4N0CD 4WV1C 4RGOH 4ZPVA 3LMJH 3TCXA 1YMME 4X4YA 3ES6A 5ISZA 2QSCH 5T1MA 3QXWA 2R8SH 1MI5B 2BSRA 4P2RE 3IFLH 1ZA6B 5JIPA 1DBKH 3RVWC 3ULUF 2CRZA 1BJMA 3QEQD 5HGAB 1H8NA 1URLA 4Y4HA 2Z31D 2CLVA 5KSBA 5I1IL 5AG9A 5ADPH 4HEPG 1A1NA 5TE7L 4OZIA 4NN5B 4CW1B 4ZO8A 5EO0B 1TTFA 3MA7A 3RWEB 3QUZC 1I9IL 4CMMA 3S34L 4YHOH 4PUBH 1F4YH 3MNVB 3C5SB 2HG5A 3GGWA 1YEEH 3VDBA 5EG6C 3QI9D 4RGMB 5D1ZD 4DKAA 4XRCA 1G6VK 3BPNC 4BZ2L 1VACA 1J8KA 3AS1A 1NSNL 1AFVL 2CPCA 2X1OA 1JGEB 2GAZB 5D2NC 1BJ1H 4LASH 4NKMA 4GRWF 3X12B 5DJAA 3LRSB 3HUJF 5KAQF 2XWBB 5GGVL 3BKML 4DUWA 1FNAA 5HHMB 4XH2B 4I77H 1UADC 1XEDA 2AKRA 1I8IB 1JJUA 3VXSB 4JDVA 3PHQA 4WU5A 2AEIT 1P2CA 4ERSH 4JANB 4G9FD 5C0FB 3QO0A 1CD9B 4WW2F 4YZFF 1FYTA 3BD4A 2MFNA 3BFOA 3TGXA 3KHQA 1LQSR 2UV3A 3O45A 4O00A 4N9GB 4BH7A 2OZ4A 2CKBL 2VLMD 2R1YA 5HHNA 4Z7NF 4CVXA 5CEZH 3AU1B 3RZWA 4FTVB 3QO1A 3GBLA 5GZOD 4HKJB 5FM8A 1OSZB 5KVDH 2FLRT 2M2DA 3H3PL 3DSFH 4HUKB 4UQ3A 4IEFB 1G7JB 5GRJL 5JOFA 3CSYA 1CDUA 5IB1A 5TF0A 1IAOB 4R4FH 1FFNA 3HZMA 4UDTA 2NTFB 5E6YA 3ULVL 1T66D 2IGFL 4A6YL 1ZS8B 4B53A 5TJWK 4QHUB 5C08D 3FCTB 4PGBB 1EZVY 2E8YA 4HQQL 4K8RD 2ADGA 3RVUC 4HC1L 4M6MH 1GOFA 3EDKA 3VGBA 3IKKA 2EZ0C 5HHXL 1NEUA 3AGVA 3PWPB 5BZWA 1G7LB 1GZPA 1EXUA 3BXNB 3S4SB 1Q94B 2ICWJ 4ONOA 4GJTB 5LAXA 5BS0B 2PR4H 4LF3A 3OKOB 5K93A 3C60C 5HDOA 3Q6FA 4NOBA 1H15B 1ONQB 1N64H 4GKNB 1JMZA 1S7XA 3KLSA 3FQWA 4LCIL 4U3HA 3VH8G 5IMMB 2R0KL 5JW5A 1OD7A 2VTFA 2E7LC 1M7XA 2ZUYA 4OCMC 3FFCB 3RBSA 1NCCL 2Y06L 1JZ6A 3DMMC 4JLRA 5I1KL 2DQTH 4FQLL 3WFDH 3BX7C 3TBWB 4QHNB 1JGUL 3TFKC 3TBSA 3LB6C 3GMNB 4FS0A 3DVGA 3MRDA 3P0GB 4Y16B 3HMXL 1J8HB 2HJLB 3PXHA 4Q9BA 4MS8C 1G9NH 4OZHE 4LLQB 2AP2A 2R2HA 3MRDB 1HDMB 3X13A 5GJSL 4JFYA 1JPGA 4OFPA 3SPVA 1A6AA 3N1PC 3SE9L 1A7PL 4YX2L 2P5WE 3PJSB 1CLOL 2Q8AH 4K9EC 1CLYL 2NY1B 3SGJC 1MPAL 3VWKB 2BSSB 5JHDD 1A1MA 1BM3H 2VLLA 3PG2A 1UWEH 5IROC 1KJ2A 3RGVB 4MLIA 5KANI 5EU3A 1I3GL 1VFOA 2BRRH 1NMBH 2HTKC 1MHHB 1AD0B 3RZCB 3JWOL 5K9JL 4UIMB 3CX5J 1G9MC 5EBWB 2NR6D 2QHLA 3EYQD 1VCAA 2HRPH 2VLRB 1A6AB 3N0PB 3MUZ1 1IC5H 1UA6H 2DJUA 1ZLUK 1MQKH 2WANA 2XZCH 3VXTB 1N6VA 4PD4K 3RAJH 1PVHA 5C71A 4ERSL 5DJCB 1KC5H 1U8QA 1NCWH 3SE8L 3HR5A 1IGML 1ZT4B 1NBVL 3QXTA 4PJ7B 1TZGH 2YZ1A 1IRAY 3EYUH 2YSSB 2EDTA 3DI2B 3V4UH 5I15H 2X70B 5DK2A 4UINH 3CVHB 4P4KA 5E03A 5GGSB 3M17B 4GRMA 4KROC 4E5XA 3D18B 1XR8B 1I7UB 2P4AB 2YSSA 4WI8A 3UTQA 4YXLL 1XH3A 5CD5C 1OSZA 4HKJA 4PG2A 1UZ8B 2BCKB 4ONFL 2BVYA 4NZRL 4AIZA 2IC2A 2VL4A 5D96C 1FO0B 3RQ3A 1UJ3A 1BD2B 5F7WC 4KDWA 2XT1B 4R4FL 5DMIH 2ARJB 1OWRM 4ZQKA 1KCVL 3TO4A 2DKSA 5GHWH 4NGHH 5E5RB 3WN5A 3G9VA 4PGBA 4U1IA 4QHUA 1ZLVK 3O6KL 4QY8A 4OV5B 2VERN 5DUBB 3OXSA 4DCQB 5EOCJ 1UZ6E 1T7VA 1J0HA 3PNWA 4NQDA 1JUFB 4PJAF 5I16A 1Z5LB 3JWNC 5DC0A 1G7JA 3D0VB 4ZFOL 4WFHD 3UO1L 3RKDC 4ZUUB 4JRXE 3P9MA 3CAFA 4GW4B 4ZO9A 3RJQB 2LQRA 2NY3D 1DLHB 3E8UL 3BZDA 2XI9A 3S96A 4P46D 1Q0YL 5GGQL 1QRNA 3TBSB 3TBWA 1KJ2B 2BERA 2IBZY 5DR5H 4GG6A 2EE9A 5CJ8A 4LSTH 3VWKA 2DIJA 5BRZA 4J1UB 3DTXA 2EICA 5E08L 2WW8A 1PW3A 4OFKA 1HDMA 3X13B 2ICES 1S5IL 1VKXA 5ESQB 2F58L 5IMMA 3JTSA 5ERWB 4LLQA 1UKTA 3I6LE 4NZTL 4AZ8A 3V5HA 1YMHA 4C56D 2E7HA 4HDIA 5CEZD 3O9WA 4FQHB 4PGJA 3LN5B 1JTOA 4QHNA 4U6YA 3HR6A 4UIKL 1U95B 3WSQL 5HYSB 4PJ9C 1TJIH 5KSAB 4HUWA 2B2XL 4ZYKA 5ALCH 4OF0A 3KGRA 1PZ5B 3IDGA 2G2RB 2YZ8A 4XXCA 3QDAA 2BRRL 1QRNE 4MA7H 4U31A 4ZAKC 4Z8FL 4BSWB 1B90A 4L8BA 1JYNA 5D1QA 1GC1C 5D7IE 5AYUL 2GSGB 4CMMB 5BJTA 4P99A 4U2YA 2B4CC 4P2YA 4PPTA 3EDEA 5GGSY 1AHWC 4GXVL 1N5AB 1N0LA 3CUPB 3O6LL 1C5CL 3QCTH 2X4SA 3OJVC 2MCPL 1JWSA 1MRDL 1WBZA 3QUMB 2QR0B 1G0XA 2M1KA 4GMSH 4K23H 3T77B 3MUGB 3D85D 3I6KA 1FE8L 5HHNB 4LLVA 3KJ6H 4JFEB 3SBWC 4GAJH 1E28B 5F97E 4DGYH 2GFBB 3V4UL 3VXUA 1A9EA 4OZIF 3ARBD 3M8OL 5E2JA 1JNHB 5IQ7H 4HUVA 2XYCA 1QBML 4J3UA 3R1GL 2BNQA 5IMOA 5I1CH 2A6KA 2YA2A 3Q1SL 4E42A 3G5ZB 1AO7A 4PTTB 3DWTA 4GKZB 1EHNA 3QDGE 1AC6A 1T1ZA 1J12A 2F19L 2FEDD 5FO9B 1TQCB 3ULVH 3O4OB 1P53A 1RZJC 1BQLH 1G6RL 4D3CH 1A4JB 1CICA 2QQKH 3JSSA 3KYKL 4ELKB 2WWKO 3UTSA 4PRNB 5ICZB 5F21B 2P24B 4AY0A 3WIFB 2VC2H 1WAAE 1A3LH 1NFDA 3OAUL 4OFDA 4XB7A 3Q5OA 4F7EA 1BD2E 3VE0B 5DK3A 3IU3A 1A6VH 3RWJA 1FZKA 4G8FB 3TH4T 4KI5F 3OKKA 4Y1AE 5ECJE 2OJEB 4BFIB 2CLRA 3WS6A 1N64L 4U1LA 4KKNA 3V5DA 2Z0BA 1NC2B 1MUJB 2PW1B 3GJFK 1TZHB 1RUKL 2IALA 3U4BH 3SOBH 1KN4L 4NO0A 5F1IB 1PKOA 4YPJA 2GK0B 4X4ZA 5JW4N 1D5IH 4QT5B 1AP2A 4S1QH 1QPPA 3RHWK 4NC1C 4PJ7E 4OKVB 4Z5RA 4PJ5D 3KWWA 2ICEA 1Y18A 4OFVA 5C0AA 5BXFB 4IRSB 3VXRD 3VH8A 2R2EB 5E99L 1QSZA 4ZD3H 2W9EL 4PJCB 4Y4HC 1NGPH 3IKCA 3QXDB 1OAZL 3DETD 1F3JA 3C6LB 5A16B 5DD3L 4TSBH 3KPSD 2X10A 3MOAH 4FXGB 4KRMB 5ISZB 4PJXA 4X4YB 3SDDD 2H8PA 1U8IA 4BK5A 1ZGLB 2BOBA 4XNUH 4D9RD 3FO1B 2V7HB 3PGDB 5FYJL 4YHKL 4JY4A 4G6JL 2IAMA 1I3GH 3FN0L 4XBEL 4PJHF 1X5JA 2FBOJ 3GSXB 3VXRA 2UUDK 1RZ7L 1TJIL 2B2XH 1GGTA 3WO4C 1ZTXH 4TSCL 5LQBH 3KPOA 1MFNA 4XAKD 2ZCHH 3NPZB 2IWGA 1T0MA 5EN2B 1A6PA 4JGMA 4X98B 4XP4L 4DAGL 5GPRA 5FB8B 5FO8A 1IQDA 4IDLA 4GBXD 4HULB 5L8JB 1GAFH 1VGKA 2DMKA 4XCYA 3FB5A 3V6OA 1T3FA 2ARJQ 2GCYA 2PYFA 5I1HL 5EDXA 5IESL 1T7WA 5K9QG 4L8SA 8CGTA 3QIWB 5CEXA 1JPTH 5IJKC 3O6LH 4LCCB 4BUHA 4LCCA 1V3MA 1KELH 3MTRA 1A5FL 1U3ZA 4MAYC 5CLTA 5CJBA 3F7RA 5FXCH 1T1XB 4K9EH 1F4WH 5TDNB 5JTWA 1U92A 3UPRA 3LKRB 2VN7A 3MJ6A 4EIZC 3G04B 5E94B 2W60B 4W4NA 2NY5C 1OGAD 1YNKH 1ZSDB 1MY7A 2XZQL 5INCB 4TSAH 3FO0H 5HGDA 3WV0A 1HH6B 3GSRB 5B3JE 5F88A 3Q1SH 1ZHNA 5D6DC 4APQA 1SY6L 3BKJL 3QUMH 2R39A 3C2AH 4OT1H 1JFQH 1MFCL 3CFCL 1KCVH 5L9DH 1P5UA 2FHBA 5GXBB 3H9SA 3C09C 4LBEB 4TOYL 4DZ8A 3BZFA 3CLEL 1YEIL 5DT1L 4H0HB 1BIIA 4MCYB 4LHUA 1S9KC 3G5ZA 5IJKA 1UH3A 3TZVD 2H41A 2UZXB 5T3ZD 1R5VB 3CFBB 4LNVA 2PF6A 3MZGB 3HNVH 1MRFH 1S78C 3MZTA 3MRJB 2EDXA 5GSVA 1X5GA 3PP3H 4PJCA 1RULH 2PYEB 2B1AH 2GSIB 5C0CB 3QQ9C 1NCBH 1FO0L 2ATPB 3U9PL 1N0XH 1P5VA 2NYYD 1Q9OB 4P9HH 3HZVB 1LE9A 4OCSH 5DFVD 4WNQA 3QUXC 1AP2B 4J7RA 1TXKA 4WIQA 2XTJE 3QWQB 1SBBA 4NO0B 3LKPA 1EFXB 3A67L 2FD6L 1K5NA 3MCLL 5DYOA 1YYLH 4K55A 1I4FA 5H2BB 1X5AA 3N1GC 1SYSB 3FQUB 3KLHC 3ALXA 3S88L 3NA4A 4E0RB 4U1LB 2EIEA 3VH8B 3WMSA 1KLFA 4X4XB 5K9KB 2VYRE 3O9WC 4L3EB 5DJ8B 4L29A 3CK0L 2HVJB 3Q3GB 2AS5M 4Y2DA 3B3IB 3QG7H 1NCCH 4F15C 1J1XL 4M62L 4U6YB 1NGWA 4H5SA 1N26A 5F1IA 3LN5A 2DDQL 4HKZB 5IGXL 3IS1X 3FQXB 1CTOA 1E27A 3NTCH 4X7SL 3MRNA 1LGVA 4MNHA 1F6AA 5KS9A 2EDEA 4JO4L 3SCMC 5CIPB 1FNEB 2EEAA 3O2VL 4I0PB 4U7MA 1FRGL 4TVPH 3MNZA 5E8PB 3B8SA 3HTLX 4RGND 1KT2A 1S7RB 2DLGA 3IRZA 3NFSL 3FB8A 5DSCA 5IMLA 5F7KC 3RP1A 1JV5A 4Y8AA 1LO3H 3WN5C 3RDTD 2A6KB 2Y9RT 1EV2E 4NUGL 4ZXBD 1NC4A 3VJ6B 2D7NA 1EO7A 5IKCB 1JNHA 2ZUQC 5D1XD 4HF5H 1U8MB 1IJ9A 4L4VE 1NCTA 3ZO0A 2IPTL 4D0BB 1XF5A 4K3DL 1OB1A 5I1HH 5KJRL 4P3DB 5FYKH 4Y4KB 3M1BA 4Q6YA 1QBBA 1KPVA 1T04A 4DEPB 2NXZB 4TVPD 3HI1B 1QFWL 1ZWIA 4M7LL 4D2NA 5C08A 1P6FA 4JG0L 1Q1JL 2ZOKA 5DQDL 1XCTA 4NQED 2BNQB 5IMOB 3PP3K 4M3KB 1M7IB 1FZJA 3MLYL 1Z6JT 1G0YR 3QEGH 1AGBB 2VE6A 4MVBD 5DUBA 5E8DL 5F1SA 4PJAA 5IF0A 4GBXB 1MFEL 3LPWA 2F19H 3PXJA 4WFED 5I19H 3P3YA 3L5IA 2P5WA 5DGRA 4G9DB 2WWMD 1XCQA 4M1GL 1I7RB 3T3MF 1NGXA 4UTAH 5ELIA 1U8JB 4PGEB 1AGEB 5J6HB 3C2AL 4L4TE 2Q7YB 5E4EB 3RWHB 3NCBB 4RGNB 3BEVB 4G6MH 1MLCA 4OFIA 2PO6B 5FA4A 2W59A 3DGCR 3QEQA 3X3FH 4LRIA 1UZ8A 8FABB 1S7TA 2R4RH 3CFDA 1ZEAL 5EWIH 4U6XB 1XH3B 5DJ6B 5C08E 1U8HB 4XCNA 4YHLL 3PIQB 2HTLC 3CFEA 4S0SD 12E8L 2QKIB 4JO2L 4RFNB 5JA8B 3QUZD 2AJUL 2WNGA 3EOYG 3U36A 3L3DB 4FQ1L 4MCZB 3QJHB 5CSZA 1BZ7A 1M6OB 4M02A 2F5AL 5DGQA 1C7SA 1S7WA 1O5DT 1PKQA 3VGDA 3O9WB 2HKHH 4PV9B 4NRXB 4AMKL 1TETL 2Z31C 1QVOA 5FYKE 4YJZL 1JRHH 2LTQC 2AJYL 4KVNH 1A7QL 6FABH 2EYSA 4QOKB 1BF8A 3HZKA 5HYJB 3A67H 1X5HA 2BJML 3ZE2E 1S7VB 1NDGB 3QI9A 4UT6H 1KTDB 2IANB 4FNLL 2H26B 2VITB 3D0VA 3BDXA 1G84A 4DWHA 4XI5D 1T7ZA 3QDJE 4HUUB 1HILA 4JZJC 4N8VG 3UCRA 1R5WA 2AEQH 4PGCA 1IGCH 1R5WB 1KPRB 4Y0GA 2B0SL 1B88A 5JQ6H 4TVPE 4YHKH 3LV3A 1FGNH 3OJDB 1TVHA 5SX4H 3WLWC 3VXNA 1QFUL 1F2XK 4PB9L 4NKIH 2DJ4A 2C1OA 1VEPA 1NCUA 5ISZE 3DMMB 4R4BB 1TTUA 3V8CA 3E0GA 2ZCHL 1F5WA 2HTLD 3LKNA 4WY7H 1LVEA 3NAAL 1A02N 2BNQE 1C16B 3HRPA 3QZWG 1WWBX 3KPQB 4O2CB 4PJEE 4F57L 3G5YB 2VWEC 3MRFA 4NUGH 4M5ZH 1OAKH 4HUXA 1WICA 5LCVH 4Z7VB 4N90D 2YC1B 4Z7VA 3SBWA 4JZNA 4L4VB 3VW3H 2DQUH 5DLMH 1I8MB 5GZNC 4GKSB 4HJJH 1LEGB 1DN0A 4I48A 5E00B 1I8KA 4G5ZL 5FOJA 1IL1B 3SDAD 3X11A 3X11B 5CD5D 5JOPE 4MVBC 4QRTA 4DN4L 1T5XB 4BFBD 1WVZA 4EDWH 1FSKC 4JVWA 2IQ9H 1KCRL 4TN9A 5IM7A 3B6SA 3MXWL 2ITDA 4HUNB 2IF7A 4DQOL 4M1DH 5HI5D 4JREC 1CVSC 4G6AC 1RIVL 3U82B 3PHOA 5HVHC 4PBXA 4P2CG 4OCYH 5C92A 3QDMA 1XFPA 3P77B 4LPUA 1YEDB 2OI9C 2VXQH 4NP4L 3IFLL 4ZOCA 5FM4A 1JPST 3QRFM 3TIDA 1JZ5A 4FZEH 4PJXF 3GJFH 2H3NB 2FL5B 4EN3C 4UU9B 3HZKB 3PF2A 4MJ5B 3MV7A 4AK1A 1T83C 1T6WA 4WW2A 1TZIA 4ZOEA 1HYSD 3VFVB 2XTJB 4JEGB 5ACZA 3TBYA 1SYVB 4PJGB 4HCRH 1WBYB 5DJ0A 1YEHH 4LHUG 3W39A 3D3VA 5I2IA 3NH7L 1PLGH 4FQ1H 1E6JH 3ILQD 4ODSL 4KK8D 3RL2A 5IFJA 2XQYK 1HQRB 5L8KB 1CE1H 1G7IB 5CMAA 2LV4A 3DLQR 3RDTB 4P5TC 4PJIE 5IBTH 4O51B 1VFAA 2VDNH 3PGFH 5EZJB 4NHCH 5A2LH 5HYJA 3CSBA 3PABB 1FQ9C 2AI0H 1P84K 2EEBA 2BSED 3BT2L 4KI5C 1S5HA 4PJHA 4F7MB 2MQCA 2NY2B 4DZBA 3ARED 1YDPA 4K7FA 4Y2DC 3HRZA 3DVNA 3L3IA 4LVHB 4HXBL 2D9QB 2QHRL 3QJHA 1BOYA 4MCZA 1J0KA 4JO3L 4LLYA 4L29B 3MCKB 3TVMA 4R4NC 3WD5L 4R7DB 2HFGL 1YEFH 4YC2C 1CIDA 1UB6A 2VDRH 3BE1H 2YXFA 2PW2A 5EA0L 5DD5H 5LKNA 5T1DL 5DYOB 4MDIB 4U1JB 1OAZH 4FXKA 5EC1B 1A9BA 3G6JB 4LHJB 1NL0H 2OSLB 3ZT7A 5J0BA 1EFQA 1XGYL 4CW1A 4P9HC 5DDHA 3TIEB 5C09A 2X4OA 5EBLB 1BFVH 4XBGB 3MV9B 3HE6A 4U7KA 3MMEA 3IF1B 4WTZG 1AFVH 2ERJB 4NHUB 2JJTA 2BSTA 3SDCC 3H9SE 3DSFL 2N7BA 4PRPB 5IHBA 4LLAA 4B7LA 1LP9B 2ZP0T 3VW3L 3FT2B 4UILL 5H94A 4OZ4B 3KHOA 4OAWA 4XVTH 5IB5A 2A77H 3MOBL 1ETZA 4QCIB 3U0TB 4FG6C 1ZWIB 5T5NG 4B7IA 3LIZH 1U91A 4WI6A 4Z18A 2YHGA 5ENWB 4G43A 1U8OB 3QISA 1U6AH 1WCQA 1DUYB 3OSKA 4OUUB 1I8IA 4JN2A 4WI4A 1CFBA 3QXUA 4D0BA 1MH5B 4QOKD 3AMLA 3HC4H 3O6FB 1NUGA 1BWWA 4Y4KD 4HV8B 2W92A 1UXSB 2X6MA 1FFQA 5C0NC 4F2MB 1XF4B 5IW6A 1AC0A 2VOTA 2VLKD 1K6QH 3OKNA 3LKRA 2UZIH 1S9XB 1NLBL 3S97C 5JLZB 1P2CB 2NY1C 1YNTB 1HOCB 4PLKD 2BY1A 4HW6A 2DOCA 3I9GH 2OI9B 1RUMH 1AXIB 5GRVK 5JHDB 3UBXB 3EOBB 2H1PL 1RK0B 2VL5B 4JKPL 3VG0H 3I75B 4Z7QE 5EUKA 4JY5L 3SEPA 3PQYB 2YD2A 3MBXL 5FGCE 3F62A 3QT2A 2NNAB 2I5YL 4H8WC 2QADD 4W4OA 5E8EB 4ESKA 1ACYH 5KS9F 1J05B 1CYGA 3IXTB 4JN1H 1PY9A 4R4ND 4M9PA 1ND0A 4FQ2L 2PYEA 1GXEA 1S3KH 5FHBH 3FO9A 3BGMB 3B9KA 1HXMB 3ARGD 4OCWH 6FABL 4YHIB 1MRFL 3NZ8A 4Y1AB 3ZTNL 3K80A 2JB6A 4WRLA 3VRLE 1GL4B 1J0IA 3ULVC 4ORZC 1UWXK 1KCLA 1NQBA 3QZWA 5DK0B 1X5YA 4GW5A 2H9GA 3VFTB 3UPAA 4P9HL 4ZUWB 1Q9OA 3S7GA 3FZUD 1CTNA 5HTSA 2ENYA 3LS5L 4ODUA 1RIUL 1BVKA 5E2VL 5ACLA 2GK2A 1C5BH 4FQXD 4FABL 4YHIA 4IDJH 3MLVL 3F7YA 5EBGA 4ZSOA 4N0CC 1ZT7B 4OLXL 4APQD 3T0EA 2R2EA 1A1OB 4PV8A 1Y18B 5T5FL 3KWWB 1OAXH 3MLUL 1DVFC 4MGXA 3D25A 3OKEB 1UB5B 3B2UC 3P40A 2NW2B 1CLZH 4PRPE 1RV6X 4R2GD 5TE4L 1AXSB 3SE9H 4BA8A 1JZ7A 5CP3H 1HHKA 1MWAB 2AJVL 1HHJA 4PY8J 4GSDL 2MWCA 5IFAL 4DW2H 3RVVD 4NM8H 4AEHH 3KLDA 1SVZA 3HC0A 1A7NH 1T0NB 3EYVA 3P30L 5KAQG 4OM0H 2AEPL 2VABA 2AQ2A 3TO2B 1PEZA 2OXGA 1S9WB 4UQ2A 1MIMH 4RFNC 3HAEA 4HK3N 2B1HL 5DHYB 3FFDA 5DHYA 5FUCE 3HAEB 1UXSA 1YECH 3C60D 5FV2A 4JGUA 4M8VA 4L8SC 1A2YA 4M8QA 4I0PD 2V7NB 4NQSA 3LS4L 3ARYA 4WUUD 3HS0B 1BAFL 3IDIB 4PRID 5CJQH 2QSTA 3O8XA 3V6ZB 4OUUA 5I8EB 2ORBH 4RZCA 1U8OA 1P4BH 4Q6IA 5FV1L 3FB5B 5D93C 1T22B 2IAMB 3O2DL 4G7YL 2CJUH 3JWDL 4BM7A 2CO6B 4X9FA 5FHAH 3VD4A 1CD8A 3AREB 1YNLL 4X98A 3HAEH 5EU6B 3NMEA 2J12B 5D7SH 3JVGC 4NQXA 2MMXA 4XCCL 4IS6B 3C5ZB 1P4IL 2X4RB 4IHOB 2ADFH 4G80A 4XVJH 3CD4A 5ALBL 1R3JA 2X4SB 5KSAD 2GHWB 5GS0L 1A6UL 4JRWA 2Z4QB 1ADQH 1MWAL 5C6TH 4LCUB 5JPNA 5KSAC 1CL7L 4U0RB 2VDOL 3RUGE 5FDYA 1TZHA 4JN1L 2MKWA 3IJYB 4YDVA 1CD1B 4O2EA 1HXMA 1T7YA 2R4RL 4EQ2A 3X14A 3WLBB 1UB6B 3CXDH 4QRPD 2R1WA 1S3KL 2OQJB 1CDBA 1P9MA 3P2TA 1CT8B 3T0EB 3N1MC 4Z5RB 2ZUXA 5DUML 1CXKA 3WNLA 2DQHH 2H2PD 3HRZB 1GPOH 3U48A 1CIUA 5T1KB 2V5SA 5J9PB 5JPNB 4LCUA 1YDPB 7FABH 1UZ6F 2A2QT 4JO3H 3UTSB 4HH8A 3V5HB 1X5LA 4K7PX 2Y23A 2GT9A 4LLMA 1FDLL 4FHBD 3ZLQC 5MP6H 3VWJA 4U6VH 1CR9L 1HSAB 4PJFA 3VA2C 4F7PB 5EA0H 4PRIE 5ITFB 2NLJA 1A7RL 5D2NA 3CX5K 1FPTH 3KG5A 4NDMB 3ABZA 2MCPH 5AD0B 4WFFD 5TPWH 1H3GA 3ULUD 3QG6B 3BQUC 5CBEA 2Z8SA 1IEHA 4H0IA 1INDH 3T0AA 4FQCH 1U41A 4U3XA 1CWVA 3O41B 1XIWC 1OT1A 1DUYA 3BPOC 3U30B 1T1WB 4NJ9H 5C0CE 4PY7A 4NQCB 4GSDH 4D9QE 2ZCKL 3T8XA 4WHYG