4BUHA

Human ige against the major allergen bet v 1 - crystal structure of clone m0418 scfv
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
252
structure length
237
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSEYSFPNYWIAWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGQVNISADKSSRTAFLEWSSLKASDSATYFCARLGGQLWNSYYYYYYMDVWGKGTTVTVSSGYELTQPPSASGTPGQRVTISCSGSSSNIGGNTVNWYQQVPGTAPRLLIYKNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCEAWDGGLRGGVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Ige Against the Major Allergen Bet V 1 - Defining an Epitope with Limited Cross-Reactivity between Different Pr-10 Family Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CLONE M0418 SCFV
total genus 55
structure length 237
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA01
1IFHH 4FXKB 3WFCL 2VZTA 1OPGL 4NUGL 2R23A 4NO5A 1J7VR 1LO4H 2R1YB 5E94B 3PWLB 2A2QT 4P99A 2CLVA 2XQBH 4L4VB 3VGGA 3QEQB 1JWMA 3V52L 4K3DH 4IIQB 4LEXL 3U7WL 2YXMA 1MFEH 3BKYL 4KXZH 4JFFE 5JMOC 1N2RA 1A7BA 5LQBL 1V5JA 5TQ0L 3L5XL 4JZNA 4GXUM 4P9HL 3QQNA 3WIHA 4ETQB 4I8DA 4EUPH 3RGVC 4GXUN 3VFRA 5MEPB 1MCDA 4HF5L 2JTDA 1DQJB 4PB0H 4K8RH 4PGEA 4P2RE 5GJTH 3LZFL 4PV8B 4UB0H 3W9EA 1XGPB 4OIAA 4QY8B 2QHRL 3AAZB 2C5DC 4X4MA 5FOJA 1D6VH 5J3HC 4HGWA 5CSBA 2JK5A 3HC3L 5JA9A 4X7SL 1QR1A 2HTLD 3GMLB 1V7NH 2ENYA 1FFNA 4R7NA 5C08B 1Y6NR 3HMXH 1EZVY 2FB4L 4JKPL 5H8DA 5DD6B 3ZL4H 4BJLA 1WZMA 2YD9A 3RWCB 4M6AA 4KZDL 1ZHNA 4J4PD 3D85B 4J3TA 4Y4HB 3NMEA 3P9MB 4HGWB 4YHYC 3QHFH 3F6IA 4WU7A 3DTXB 3MGOA 2JCCB 3BN9C 4I2XB 1JRHH 2ICWI 4K7PH 1OTTC 5D7IE 1I3RB 2XWBA 2LFGA 3HC4H 4UQ3B 1ZHLA 1XF2B 3TO2A 3CLFH 4J4PA 3TT1L 4HWEL 4U6HA 2C4FT 3L3JB 5ALCH 5EG6C 6FABH 5CCKH 1T6VN 4CNIB 3MA7A 1HHKA 3TNMA 3W0WE 3TEUA 4K3HA 1JZ6A 1MHEA 1I9IL 3JWNC 3FONB 4L9LA 1LP9B 2CQVA 5T1LD 1TJHH 4LFHG 2QR0B 3AREC 1DBAL 5SV3A 3UJJL 4LNRA 1CDJA 4MD4A 3OTTA 4IEFB 1ZHBB 5D7KD 4XB7A 5IMLA 5EUOB 1YC8A 2YD5A 2BVQB 3I6GA 3IFPB 4M1GH 1F6FB 1QRNB 2BSRB 2I07A 4JFZL 1ZTXH 4PJ8B 4G6FD 4XWOD 4HJ0D 3RWGA 3MGOB 3WXVL 1S7RA 3PG2A 3OKKA 4DN3H 1C5BL 3P9MA 4Y2DB 3CVHL 4DWHA 1Z3GH 2R2HA 1KBGH 5ID0B 1T83C 3UEZA 4J3OC 5TPWL 3OJ2C 3NOIA 3RRQA 5SWZE 5H94B 1ED3A 4CUCA 4LPWA 4JPIA 1J86A 2B8OT 1MHCA 4YHKL 1SJEB 1JHTA 1D5IH 1KJVA 4I3SL 1INQA 2WBJD 1EMTH 1MAML 2R0LH 3NGBC 1VEPA 4X4XB 3MRQA 2Z4QB 1HILA 1KTRL 4U0QB 4OJFH 1OGAD 4N8VA 4P4RB 5IM7A 1QFWM 4HMCA 1JHLH 5FFLA 1LEIA 1WIPA 3GSXB 2DI9A 3D39D 4WDIA 4N8CH 4IRJC 4KAQH 2F53D 4PRHE 4OCXH 4NN5C 3INUL 5DRXA 5E8DL 1QFHA 3QFJA 1UZ8B 5IT2L 2XY2A 1Q0YL 5GGTL 1ACYH 1ORQA 1MJ7H 3RY6A 3HR5A 1DVFC 4HCRL 4XC1H 2VQ1A 1EVTC 1UACL 3UJIL 3FO0L 3MFFB 1RZKH 2IPTL 2R23B 1XCQA 3LRHA 1A0QH 3H7BA 3TBTA 1HEZB 4OT1H 4APQD 1QFWH 1T5XB 2BY0A 3QAZC 5ERWB 4PJFB 5TH2B 4CMHB 5I9QB 5FV1L 1I9IH 3L9RA 5D7JA 3MRJB 5F1NA 4C55A 4JFEA 5E6YA 2D31A 5TE6L 1G7LB 4P3CL 2QV2A 4P46B 2YPKB 1L0XA 5HYEA 2HFGL 4JHWH 5IP4A 4LRNL 3BGMB 3EDFA 3EJZC 3FRUB 1IT9H 3MLTA 1CD1A 3L3HB 3W0WB 4R0LA 5GHWL 4HAGA 3NCBB 4M6OL 3RDTB 3O41B 3U83A 3C60C 4GRLB 3BP6A 1JPSH 2EDNA 3HPLA 4HWBA 4U33A 3VFMB 2VN7A 1YEIH 3O45B 3RVVD 3BZ4B 4HWZA 3STZB 4OLEA 2ZWLT 2A1WH 4XPHL 4YFEA 1JRHI 4IOSD 2VSDA 3DETC 1PDKA 5CGMA 3B9AA 4TTGA 4Y1AB 3UZVB 5GJTL 4CU8A 1W0WA 2NW2B 4AIXA 2MTPA 4POZD 1U8MA 1MCIA 5I1KH 3U79A 1DQDH 1IGML 5I1KL 4HH9B 2OM5A 4OLWL 2XRAH 5ESVB 1JGLH 1AR1C 4B7LA 1FG2A 2J4WL 4R7DA 4AIOA 5TF1H 4LNVA 3I6LE 4LSQH 5E4EC 2F5BL 4GXVL 5HYJD 4MJ4A 2F19H 1AO7B 4KZEL 2J6EA 2EIZA 2MFNA 1RZ7H 2O5ZH 3IDNA 2BRQA 1A6WH 5CIPA 3V7AG 3EFFB 3DARA 1E6OH 3EYFB 4TUOB 1SHMA 2AKRA 4D3CH 4O9HH 4UDTB 4PJCF 5INCB 3IJHB 5TE7H 4ERSH 4KPHH 4J1UB 3L5XH 4KRLB 1FORH 1JZ5A 4NKOA 3TVMA 3VXSD 5J1TC 5SWQB 1NUGA 5LBSH 3A6CL 4UTAL 2NW3A 4E0RA 3DLQR 4S1QL 4Y2OA 3T2OA 4ELKB 1DUYB 1K4DB 3EZJB 3DOSA 3QI9B 2BNQB 2GTZA 1UYWL 2QL1A 3EO9H 1K8DB 5E08L 2D2OA 3SO3B 3GSWA 3MJ7B 4NZUL 1GH7A 1KTLB 2F54B 2IBGA 2UZYB 1T3FB 12E8L 2HVKB 4KKAD 3VWJD 4Y5YB 3MRCA 3P9LA 4P2QE 4GS7C 4OGYH 4PJHA 1YEJH 4JGMA 3M17B 4GAJH 5T3ZE 3T0DA 5GPRA 1KLFA 3I75B 2GK2A 3PDGA 5GS1A 5ANMA 1KPRB 1CLOH 3AROA 3QXVA 2ATPA 4I18B 5JZ7D 5J13B 4KTEH 1A6UH 2UYLA 3DO7A 1U91B 2DLGA 3GB7B 4JFFB 1JGDA 2VH5L 1QFUH 2EKSB 4NHCL 5DQJA 1L7IH 1WFOA 4LSRH 4FQ1L 1T03L 5I1DA 2CRYA 4YHOH 2HT3D 4PLKD 3QUXD 5DDHA 1C1EL 1AIFA 2VKWA 3TVMD 1A6VL 1OSZB 5IF0B 3CSYA 1A14H 1HI6B 2PW1A 4HFUL 1AI1H 3VXTA 4LHJB 3JUZA 4YDVA 2P4AB 2K7PA 2VDKL 1NLDH 2UWEF 2EICA 4XVJL 1VFAB 4F7PA 4KGJA 3UO1H 4DZBA 3OBAA 4XNQB 3VE0B 1YZZA 3T0EE 1D9KA 4OZGB 5FF6A 1NCWH 1A7RL 4U1HA 3S36X 5D7JC 1PG7H 2NCMA 1O7SA 1DANT 3FRPA 3FO2A 3BN3B 3MRHB 4HUWA 3SE3A 1EPFA 2HLFD 3BHBB 1ZS8A 4OSUL 2FWOA 5IB2B 3DV4A 1W8NA 3S5LA 2Y5EA 1XF4A 3TA3D 2K3TA 4LBEB 1T1YB 2GQHA 3QUYA 4JFYA 5IMKA 1INEH 3VWJB 4KZEH 4MD5A 2I9LA 3NZ8A 3DPBA 4Q6IA 2F74B 1GGIL 1KXQE 4OCSH 3QZWA 3NCCB 4GAYB 3WS6C 1KB9K 3HMXL 1EFXD 1XF5B 3B5GA 2B4CC 2LU4A 1SVZA 2WBWB 4R90L 4UOJA 3LN5A 4L8BB 4ZFGH 2P7TB 2UY7A 1G7JB 5EU7E 3D2UB 1WISA 3MFGB 1MCJA 2QHLA 2VQTA 1EEZA 3D3VB 4ISVB 3CZJA 4H1LG 4U1SB 3CMGA 2BNUA 1G7IA 1YEHH 3NTCH 5HHQB 3C5ZA 4O51A 1JGUH 4GOSA 4XCFL 1LK3H 1OAYL 3RZCA 3ARFA 3O4LD 5DZLA 1A6AB 2NLJB 3OR6A 5I17A 4JREB 2FJHB 5CBEB 2P43B 2CLZA 4FTVA 4PB9H 4PJ8C 2XI9A 3U0TB 4MDIB 4KQ4H 1LD9A 1NGPL 1MCFA 4NOBA 2BK8A 4LLMA 3ZKMD 4YX2H 3HMWH 4RFOH 2DKSA 5I17B 3SDDC 1CICD 3RI5F 4QTHB 1LEGA 4CW1A 4JRYB 3F7PC 4QHKJ 1CT8B 3GHBH 3OWEA 4ODXA 4JDTL 3QJHB 4HUUB 3P11H 4TSAL 3X12B 1RK1B 1MY5A 4X98B 4P3DB 3D6GA 4MD0A 1OB1A 1U8IA 3HKFA 5AAMA 3ZHLA 1GJIA 4EN3B 1B2WL 4DFIA 1CBVH 2ED8A 1F58H 5DHXB 2D0GA 4O02H 2XQBL 1JP5A 1TZGL 5I1CL 3BKML 3ARBC 1B4JH 4NPYA 2H2SC 2FO4B 3TA3B 4BFIA 3DX9B 2GUOA 4IOIB 1FGNH 2DICA 4NCC1 4I77H 2XWJA 4OZFB 3DVIA 4QHLB 3LQMA 4V1DD 4XAKD 5C0RL 1V05A 5IFJB 3I9GL 1UYWH 3EO9L 3S4SA 3PQYB 2GK0B 3AFLA 1F97A 3SCMD 5IQ7L 5BQ7A 5HYIA 4ONFL 3QDJA 4U1JB 4WTZG 4KROC 1IAKB 4HEME 5I1EH 1FNSL 1QA9B 3WN5A 1SEQL 4ZSOE 4PJ7A 5TDNB 5DUMH 3I9GH 3L5HA 4XVTH 4GG6B 2C26A 4JFOA 4LVOC 4IDJL 4P2OD 3KAAA 4N8PA 1I1AB 4GAGH 5F7EL 1IEAA 3ARRA 3P0VH 4OI8A 3UYRH 5A2LH 4JVPA 3DRTB 4NNXA 4YDVB 4FFWD 4RRPA 2J1KA 4FXGB 5CD3B 3MA9L 1BECA 5EO1B 3WIIH 1WT5C 3KPNA 4JO1H 5E95B 3CSYB 2OR7A 1MWAH 2X9WA 3MV7B 4OQ1A 4PJ5D 2D7MA 4NGHL 1BWWA 4UUJA 4QOKD 5EU5A 5C9KA 4RISL 2W9LA 5HYJE 4NYLA 2HTKD 5DMIL 3AU1B 2AS5M 1JGDB 3ZDXF 4HKBB 5KN5B 5DJCB 2FIKA 1UWXK 4PRIE 1Y6KR 3UTOA 4G7YL 5ILTL 1KB5H 1AXTL 2XXMB 4G8IA 4Y5VC 3WLWC 5CBAB 4OI9A 3T1FB 4HMEA 4N0YH 1WFUA 4HSQA 4NO0D 5DWUL 5I8OH 2HWZH 3QEHB 1JYVA 3I75A 4MA1C 3QNZA 2N7AA 3O2WL 5EO9A 3MRKB 4G6AC 3G5YB 1IBGL 4FRWA 4P4KC 1FN4B 2BY3A 2BJML 5GS0D 3VW3L 4PJDF 3V4VH 4G7VH 1MCKA 3D69A 3MUJA 5KSBB 1R3JA 4IS6A 4KMLB 2NY1D 5AZEL 1RUKH 2EZ0C 2HTLC 4ZS7L 2J88H 4HJJL 5AZ2H 1ZXQA 3VCLA 4WWKD 5ITFB 2Q87A 1U8KB 4C83B 2ICES 4OGXL 4H88H 4BK4A 3WN5C 1T5WA 3GJFB 1OGTB 2ZNXA 2F5AL 1MCPL 2FR4A 4Y4KA 3KPPB 4J8RB 2XWTB 1UWXH 1ZT4B 5I71C 5DEFB 2R0ZH 3L1OH 1U6AH 5T3ZD 3ZTJH 3HI5H 1M7DA 3W81A 2GJJA 3O4OC 2AEPH 3ULVC 1JPST 5F9JA 5ITFA 2JELL 4KK6C 3HC3H 4O5LL 4YIQB 2BVTA 2M8XA 2FX8L 3X14A 4TSBH 1FN4A 3WFEH 4PB0L 3LKQA 4EIZC 2OTWA 1Q0YH 5GGTH 3G5YA 2DQJL 3CMOH 4MQXD 1QD0A 3ZE2F 2RBLA 3NCJH 1JF1B 4HK0A 4BZ1H 4E42B 2QTEA 4JQXA 4P4KD 5ESVA 4BSJA 4I1NB 1LO5A 3LKOA 1KEML 1IKNA 4TQEL 1TNMA 2I5YL 2WUBH 3SY0A 3H9SB 5ALBL 2XICA 1NBZB 1UXSA 4IRJA 5E70A 4OCLC 4CGTA 4MA7H 3WE6A 4Z76A 4OCWH 4UUJB 2BSTA 1DBML 4Z5RA 5FA4A 1UQSA 4UNTA 2V6HA 1IKFH 1MREH 3QIBA 3RZCC 4XVTL 1YNKH 3C5JB 4CVWA 1AD9B 3DX7B 1MSPA 1HIML 1PKQB 1CLOL 1U8OA 2UUDH 4R0LB 4ODVH 4OI7A 1IEAB 1U3JA 5DD5L 4D0DB 5J6GB 4EVNA 5T1KA 1WICA 1IAMA 4R8WH 1TQBB 4OCRH 3O6LH 3LQAL 4ENEC 1YEDA 4PLOB 4OKVB 2JJUA 4OLXL 4X5XB 4KU1A 4YHYB 4KHTH 1ITBB 4MX7B 2Z8VC 2V5MA 3VJ6B 1UM4H 4X99A 4XXDA 1S9XB 3CFIC 5F6HI 3VFOB 3GHEL 4PJFA 5BMFH 4LSUL 4F15C 3H7BB 2GITB 3TBTB 2O5YL 1UVQB 1U42A 5MI0B 1MNUL 4NP4L 4JZJB 1AHWA 5I1LA 2GSGA 2AVGA 3O4LE 1PVHA 4HV8A 4I13B 5AZEH 1IAIH 2AK4A 4W81A 4YK4B 4L29B 3RPIB 5DMJB 1CXHA 5MP6L 2JJTC 2XT1B 2GW5A 2LV4A 4WDIB 1J0JA 4MNQE 1UXWB 4PJEA 5BRZB 4KJWC 3FOLA 3RKDD 4DGIH 3L3DA 4ZPVA 1MRDH 4K7PY 2E9BA 5EU6B 5C07A 5I1AB 3GI8H 1KJ2H 2HG5B 3MODL 5TF1L 3T4YA 4TVPD 4GRWE 4OM1H 4Y2DC 1WF5A 2IH1A 2V2XB 2ZUUA 5F7HA 1ED3B 3BOVA 1JI2A 4XP4L 4S11A 1HOCB 4M1DH 1ZVSB 4UAOC 2X7LA 4GRWF 4YHZL 1S9YB 3T09A 1J18A 3TC9A 4PV9B 2FJHA 2NZ9D 2G5RA 5D2NE 2QSQA 2B5IB 5C0JB 1JZ7A 5TQ0H 4Y16B 2R1XB 1A6PA 4LQFL 4O51B 4QGTA 4ODTL 2NXYC 3K7UA 1AXTH 4G42B 4F3FA 4UIMA 1SY6A 2YS4A 3QDMA 5JLZA 4Z78B 1OSPH 5IROA 1DBJH 2FRGP 4MA3A 1SYSB 3D0VB 4L3ED 43C9A 5L9DH 2QBWA 3PGFL 4WJ5A 5I15L 5T1LB 3V9FA 2DM2A 5CGYD 3BP4A 3U1SH 2DQEH 5FYKH 4X6CA 1XF5A 3E6FA 1GC1H 1SYVB 1HHIA 1F6AB 1NKRA 2F5AH 2KH2B 1U0QA 1LP9A 1EGJH 2YRLA 4P5MA 4R4FL 4Q0XH 2AP2A 5CJ8A 3SBWA 5BXFA 5CSGA 2WANA 3WJJA 1BGXH 5DQ9A 3LPWA 2OQJB 5GIRB 3TIDB 1QBAA 2MJWA 5HGHB 2L7UA 3RX7A 4ONGL 1MY7A 3WXWL 1L9NA 1UZ6F 3BISA 3OAYH 1IAII 2ESVD 2IAND 2GT9A 4PIRF 5L88H 3PV6A 1FNEB 3RNKA 4XMLH 4TYUA 3G04B 1FNHA 2JE8A 4X5WB 2EDOA 1CFQB 4Q2ZA 4I0CC 4P2RB 3BVNA 4NJAH 4K9EH 1JTPA 3HAEB 3MBED 3BDYL 1UGNA 3DTXA 4OD3L 5HVGB 3KHQA 4NQEA 4K94L 3V0VB 1WIOA 2BVOB 1F3DH 4O02L 5D2LF 5JXEC 1OY3B 2HKHH 4M93C 1YEEH 3MROA 3QDGE 5DD6A 1KYOK 4GW4A 1QTYT 3WJLC 4J6RH 5C08A 3F7VA 4HUXA 2OTUA 5T3XH 3ULUH 1NC2A 4H5SB 5DJ0A 3PP3K 3STLA 3WNPA 1YMHB 1IZKA 2VE6B 3W9EB 1YEKL 4HPYL 4LVNC 4PFEA 1WBZB 1A14L 3ZE1F 2EXYD 1TJGH 1A1MB 3HG1D 1RJYB 4L9DA 4HW6A 4A6YL 2ILLA 3L5WA 3K74B 2XKUA 2X4SA 2DD8H 3L3GB 4ODUA 2MCPL 3FT3B 4FN0A 1UM4L 1U3ZA 4GRWH 3OJVC 3BPOB 1PSKL 1GRWA 1N2RB 3HNTH 3HZKA 1CTOA 5KAQF 1W0VB 5CFHA 2CKBL 3MLYL 1IMHC 4U49A 1S5HA 4ETYA 2DBJA 4BKLA 5IJVA 1NDGB 2E6PA 2G2RB 4G8EB 3FCTB 3WHE0 1FFPB 3LEVL 3UTZB 1UH4A 1AGEA 3ARDA 4HS3B 3OGCB 2O93L 3S3PA 1WIUA 3TCLA 3P9LB 3R1GH 3NN8B 4WFGD 3A6CH 4GS7B 1T2JA 5MENA 5B3JF 3DO3A 3MLVH 4Z7NE 3IXTB 4JG1H 4LP5A 5CJXA 4WO4D 3MV9D 3DVNA 4N9OB 1K8DA 1D5MA 3R0MA 5HHXL 1K4DA 4Y0GA 1TQCC 2VMFA 5ETUA 3C8DA 3N1GC 4S1QH 2X2YA 2YPLE 2P44B 2YD1A 1OARH 2CIKB 3GMRB 5J1SC 4R4FH 5JQHC 3FL7A 4PG2C 3U0PA 3JSSA 5IMOB 4OZIE 4EDWL 5C0BA 2JB6B 1FCCA 2FX9H 3DX6B 4QRTB 4Y89A 1FIGL 1YDPA 3GMMB 4U1KA 2X4PA 3VXSA 1QBBA 5KVFH 5MEOB 1P2CB 1JNJA 5F7MC 2FHCA 5F7DA 1G7PB 5JPNA 4JGUA 2BDNH 1GIGH 4FNLH 4HFUH 5DURD 4F7EB 1ZLUH 4XZUB 3KG5A 4YDKL 4P9MH 4H0HB 4U7MA 1A6VH 4DGIL 2EDXA 1H8NA 5DTFB 5FCSH 4YHZH 3F58H 2L7JA 1KG0A 4F7EA 4POUB 3K8MA 4QO1A 4G6KH 3HI1B 2OP4H 1OP9A 2P5EE 3Q1SH 2IQAB 2DS4A 1RUAL 3WUWB 4IRZH 1IE5A 3BE1L 4RCAA 3T65B 2VTFA 3WFHA 2FO1A 4KUZH 4Q58C 5GGUA 7FABH 3MZTA 3PNWA 4O2CA 4KK6D 1F90L 4L4TA 5DJDA 1CLZH 5EOQH 2YD4A 1JGVL 5I0ZA 3UBXI 3CC5B 5ESAA 4CADB 1HXYA 4HT1H 2E7LA 2FZ3B 2IFFH 3CDGA 2FEEL 3BQUC 3O3UN 3PNWB 4O2CB 4R26L 3OSKA 3ZE0F 1S7XA 3OKOA 3D3VE 2AJ3A 5F9AC 4MJ5B 3RWIA 2UV3A 2EIDA 5IB1A 4KRMB 2X1WL 3INUH 5E8DH 3FRPG 5DYOB 3MRBB 5ERWA 3NPZB 5JXAH 4N90E 1E4WH 3O9WD 2AJVH 5DTFA 3GMPA 4YO0A 1MWAL 4XCYA 2AJSL 4UNVA 4LLDA 3SKNB 3LS4L 4D3CL 4S1DD 2CGRH 4M62L 5E9DE 1NDGA 2ICWB 4PP2B 3DSFH 1DR9A 3QP3A 4PGCA 1IAOB 4JFDB 5MHSE 4MVBC 3EOBB 4U1KB 1A5FH 1AQDB 3SN6N 5J11C 5EIIB 1MCOL 4P4RA 5IM7B 5L2KD 2X4SB 5IW6A 5CIPH 5ACZA 2A9NL 3SGKC 1SEQH 2FLRT 4K7PX 5FB8B 2E6QA 3OAZK 3TA3C 3EFDH 1XGQA 1GAFL 4XPFL 2X6MA 4POZC 1JHTB 1AH1A 3L3KA 3MC0A 4UDUA 2BCKB 2R4SH 3MBXL 1UJTA 4DGVH 4ODSL 5DHVA 3PHQA 2ADJA 4TTDD 5LCVL 1ERNA 1FGNL 2CUMA 3TYGL 2EDQA 5EA0H 5CJQH 2BVOA 2M1KA 4NQEB 3QFDB 2YA2A 3NCJL 4HS8L 4KDWA 4LLWA 2VDQH 5DMGD 1SJVA 1VFBA 4JO3L 1SMAA 3FKUS 1JGVH 5EC2A 2P5WE 2X4QB 2R2EB 4ZUWA 2CDEA 3HN3A 5K9KB 1KIPB 4HJGA 1HH6A 3FHAA 2IANE 1R5VB 4JHZA 1A1OB 3SDCB 2VDLH 1T7ZA 3WFZA 5EUKB 3MBEB 1HHHB 1DJSA 3FONA 4L9LB 1JWSA 3QG7L 4JPVH 1OD9A 4OCYL 4U7KA 1K2DB 4RMVA 3EZ8A 4I5BB 1YYLH 1S7UA 1HHIB 3MLSH 3BWAB 1NFIA 3CNKA 3FT3A 2VQUA 2Y7QB 2FB4H 4LSSH 5BS0D 5JXED 3KS0J 1B9ZA 5AUMA 1F02I 1SYSA 3D0VA 4X6EA 3UAJD 1MFNA 5JLZB 3LKPA 3H9ZA 4X7CC 4Q74A 4IOFC 3HG1B 5GGVY 1RJLB 4Z9KB 5J06A 1JYNA 3AVEA 3HG1E 5KVFL 3ULVD 3FFDA 1ZVYA 3QXUA 4QEGA 4F8QA 5FYLH 1EO5A 1HHGA 5D1XA 1FG9C 1G6RH 4N8CL 4WEBL 2YUZA 4W4NA 5SV4A 1S7QB 4FTVE 1V7MH 2D7NA 4Y5VA 5EO0A 3H3BC 1I7UB 4OLUL 1CLCA 3ZKSD 3SOBL 2W0LA 5A1AA 1RZKL 1M71A 1Q8MA 4RWYL 1F2QA 5FHAL 4H26B 3I2CL 4PJCB 2L0DA 3PV6B 4Y19D 3MRLB 4M62H 4OZFH 4LCCA 5FKPB 5BVJB 5JR1L 4PJEB 5BRZA 5DJ8B 1MCBA 4N0UE 5E2WL 3UPRB 4DW2L 3JVGC 3MJGX 3CUPB 1GL4B 5LQBH 1EGJA 4JGJA 1U8PB 4L29A 2FL5B 1A6ZA 2AV1B 2ZCKL 3QDHA 4DEPB 4I0KA 4C4KO 1CXKA 5F7LB 1IM9D 4HJ0C 1F4XL 1ADQH 2VXUH 3N0PB 4L8SC 3VFUA 1A6TA 2LU7A 1CN4A 2XTJB 3JBG7 4PUBL 1YPZF 5L6YH 4N0FB 4Z7UF 3UC0H 3UTSA 2BMKB 4HBCH 3MV8D 4MA3B 2CR3A 3MR9A 3SO5A 2XZCL 4HBCL 1DE4A 4UIMB 1OQXA 4PGDA 3AGVA 4XMKH 1IC4H 2OZ4L 4OFPA 5DLMH 1ZE3C 3MRDA 4Z7WA 3ULVL 3ARBA 1X7QB 1X6NA 5JOPD 2H8PB 4U6XB 5FHBL 5IJKA 2EIEA 3L3IA 5IQ7H 1QPPA 4M6NH 4FQCH 4LSVH 3ARSA 4KGLA 4TRPL 3DMMB 5FGCE 4JM2C 3ZHDA 3LEVH 1WC7B 4NQCA 4F8TA 4JLRB 3RTQB 3AUVA 3PABB 1AGDA 3MV8A 4YBHA 1B6UA 4C54A 2IGFL 2FEDD 4FFVD 5B22A 4YUEH 3DX7A 4P2OC 3SJVB 5DC9B 3C5JA 3Q5YA 4LVHB 1JF6A 2AGJL 2OR9L 4U4BA 4WW2A 5EBWB 1NC4A 4MNHB 5IEKA 2OSLA 3S3JA 2APVA 4JN2B 1C5CL 1LK2A 1GGCL 1N0XH 3TVMC 4OFVA 1UXWA 1EDQA 4Z76B 2CIIA 3BD4A 4WWKC 4E5XB 5KG9A 1DLHB 2VKXA 1ADQA 4XBGB 1RIUL 5IEHB 3UDWA 3QULA 1CDGA 2EDTA 3OPZH 4XMLL 3ARFC 8FABB 1PYWB 4EJ1C 5D71L 3LB6C 3MCKA 4OIIH 2A0LC 3GSOA 5IBUG 3H2WA 2GITA 1KELH 1J10A 5DD1L 4I4WA 4JO4H 4DN3L 4HKZA 1RMFH 1VGKA 1C8PA 2IG2L 4WFHD 1BMGA 4X99B 5F72S 3A0OA 2DQGH 2OTWB 3HNVL 4XCEB 5DFVC 3WLWD 5IB4A 4MX7A 4Z7UE 3V8CA 3X14B 4Y1AE 4RGMC 5TE7L 5D1XD 3V6ZA 4M7JL 3RWFB 1FSKC 4UINH 1WJ3A 5T3ZH 1TCRB 3D3VD 1HQ4A 1WC7A 3IDIA 1NQBA 4NZJA 4KK9D 4M43L 4MLSA 4F9PA 1AR2A 1HDMB 1KPVA 4Y4FD 3LMJH 1WZKA 3MSPA 4PJGB 1KLUA 1JVKA 4W70A 4N90D 4J8RA 3MRDB 1V3MA 5DXWA 1JUFB 2VABA 1F4HA 4P5TC 3LDBC 2DQGL 3QUXC 1T5WB 3ARDD 1UWGL 3MRNA 3ULSA 1F4AA 2N56A 4UT7L 2R2BA 3QJFA 1MUJB 1HSBB 1UM5L 2Z31B 3S5LG 3MR9B 3DIFB 1I8LC 4Z5RB 5BVPL 4JJHA 3U7AA 4RGOH 4YHLH 2R2CA 4OZFG 4PJ9D 5BZWA 5HYSA 5KS9E 5CJOL 2AJZB 4XCNB 5MHSD 1C08B 3ZE2E 1BBJB 3K2MC 5IK3B 5F71A 5DT1L 1NEUA 1B4RA 2W0PA 4GRWB 3SPVB 4HGKC 3NFNB 5C3TA 3TIEA 4LSSL 2Q3AA 2RQ8A 4WWID 4LPVA 4RAHA 5HPMA 5IQ9B 2NMSA 1FVDB 1JF1A 4HK0B 1JK8B 5D5ME 2HT4D 5BVJA 4YEEA 4WHYH 3ECBA 5MI0C 1UJ3C 2CUHA 2Y06H 3DXAE 4JRXA 1DEEA 1KOAA 3SDXB 5FYLD 1AGBB 4ODWA 3OPZL 3MREA 1C08A 2W60A 3BIKA 4ENED 1FAKT 1RIUH 2VLRE 4WFFE 1H5BB 2A6KA 2IBBA 1FJ1B 5EO0B 2GAZB 4RZCA 5E6ID 3DIFA 2VDNH 2ZPKL 3VI3F 5AWNH 3BKJH 3D0LB 4GAJL 1FFOA 3DROB 3MRNB 2ZSWB 5I76B 4FQHB 1YEGH 1ZLUK 1JPTH 4HG4K 5IR1B 3ULVF 2FJFB 1DFBL 5E03A 3S3SA 3VXUE 5ID1A 4YHPB 5I8CA 1H15B 3MYJA 4ORZC 5JTWA 3C2AH 4OF0A 1DLFL 4JFQB 3HHRB 4F58L 3WKNA 3IYLW 3Q5OA 4J3UA 4Y8AA 4EI5A 4HIEB 4BFEA 1QSEA 4IRSB 4ONGH 5TDOB 4XI5C 4Y16C 1IGFL 1NCBL 2OLDA 2VR9A 5DRNA 3B2UC 3MLRL 1QSFA 5IB4B 2NY5H 2A9NH 5JNYA 1YY9D 1IC4L 5E6IA 1WCQA 1H0DB 3BDYH 3MRKA 1DTUA 1A7OH 1U3HD 2FBOJ 5HJ3B 3BYYA 1T20A 1BQLH 5HDQH 3GMQB 5DD0L 5HD8D 2HAZA 1G9NC 3S96A 1S7VA 1VENA 5K9KA 7FABL 3QULB 3R06A 1P1ZB 5FDWA 1A7QH 2FD6L 1DLHA 2QQLH 4JRYE 3LKSA 1KCSL 2A74B 4E5XA 4NYLB 4Q9RH 5E2UL 3K0WA 4ZNCD 2L4OA 5HHOE 4P3DA 1TZHA 2PXYD 3MV7A 1LK2B 1MFAL 1CQYA 3QO0A 4HS6A 5H2BB 3IS0X 3LRGA 4L4TD 4PJXA 5FK9A 3PWPE 3TESA 1TZIA 2YC1A 1OAUL 1BFSA 4RDQG 5DHVB 4Y19E 4RRPG 5ACMA 4FXGA 2FEEI 1AP2B 2H26A 3CDFA 4YX2L 4RGNE 2W0FA 3MNWB 3PIQB 2ARJQ 5KANI 3LIZH 4M3JA 1ZGLM 1I1AA 1AD0B 3M45A 3DUHA 1CXEA 1T22B 5I18L 4OUOA 4KI5F 1S78C 4R6UA 3T4AB 5KSBF 4EEEA 1P84J 2V17H 5IVXB 1J1OL 2MSPA 4Z7WB 1AQDA 5GXBB 5IOPA 2XG4A 3BUTA 4FQIH 5C0AB 5F6IC 5J9PB 1EEZB 3D3VA 4PP2A 3MV8E 5I1GL 5KSVA 1ZGLP 2VLKB 3FO9A 4KKLC 3SE4A 1ONQB 5GGQL 1XEDA 4Y8DC 2OJEB 1F8TL 3DX9A 4UBDC 4WHDA 3SKOA 1BFOB 4GUPB 4PRAA 5F70A 1VGEH 2EDFA 2ITCA 1TPXC 2AV1A 1V3KA 2DN7A 4DQOL 4QRPD 4M5ZL 3FMGL 3CUPA 4DEPC 1T1YA 3UPRA 4DKEL 5K9OB 4BSVB 2AABH 5FKPA 2YPVH 1MCQA 3VA2C 1OTUC 1ZS8B 3QG6A 1NEZB 2IJ0C 1XF3A 4ODXB 3EOAB 3QEGH 1JMZA 5CHNB 1MQ8A 4QTHA 1ACYL 2EYSA 3W5MA 4Y5XC 1DVFA 1K3IA 4JCLA 4NQDA 4DZBB 4LCUB 1HNFA 1B6DA 1S7QA 1XF1A 4G9FB 4YEFA 4JEGB 3JWDL 1K6QH 1TQCB 2VL5A 3U9PL 2OTPA 1FDLL 1P9MA 4FMKA 2VXVH 4KDVA 3BKCH 3TNNA 4WHCA 2F8OA 2CKBA 1OSZA 2BOCB 3LAFA 4X9IA 4H20L 1CL7H 3AREA 4XPAH 3ZSTA 2V5YA 5D7LE 35C8H 4F57H 3J7HA 2APWA 5DQJB 1NFIB 5LG1A 3TGXA 2BNQD 3JZ7A 5JXAL 2WLZA 3DO7B 4UIKL 4R2GB 3P4OB 2K7QA 1CL7L 1HH9B 4K3JH 4L4VE 2W65A 3BXNB 1ZANH 4G8GB 2F54D 3AMLA 1HQRB 4WWKB 2CK0H 1KIQA 4YWGH 4Z7OF 1QLRA 1YN7B 3F7YB 3MRMA 1Q0XL 3ZDYE 1IM9A 2K1MA 4O5LH 1NC2D 5I2IA 4XRCB 5IB2A 5E2TL 4P2QA 2CH8A 1RJZB 3S88L 4JHBA 1AKJD 4HT1L 3G6JF 1PZ5A 4U1HB 3RVWD 3HR6A 1KCVL 5ACLA 1VFBB 4LLUB 4AL8H 1U3HA 3DURA 4FQQA 1SEBA 4TUJA 4WHTB 1KTLA 5E08H 4DN4H 3DYMA 2CR6A 2APTA 1CL7I 5IIEA 1AO7D 4RGMB 1QSFD 5ETUB 1P7HL 3ARYA 3D39E 1FSKB 3L3OB 2B1HL 2AQ1A 1FZOB 1KTKE 2YPVL 3AMKA 4XP9H 2ZKHL 2A83A 1DDHB 2VC2L 4PTUA 4M00A 1TJHL 1CF8H 5EZIL 1SEBB 3TYFA 4K3GA 5SWQA 1XGQB 1EZVX 3O8XD 1AIFB 4LQ1A 3UTQA 1YEEL 4MXVF 4MNQB 2YWZA 3FT2B 4HDIA 2DIBA 4ZFOL 1NAKH 3IAQA 1Y18B 5EOTB 3BPLC 1TFHA 4N0UB 3DVFA 1DANU 5I8OL 2HFFB 2C1PB 1V7NL 3F7YA 5JDSB 3EJZD 1DQQA 3THML 3EYOA 1WBYA 2D03L 4Q6YA 3BGFB 1KJ3L 4OZ4B 1JPFA 1S5HB 1Q9LB 3FQTB 1JPFB 1W0VA 3E8UL 5D6DA 3OHXA 2HFFA 1MFAH 1LO2L 3T77A 5E99H 4BELD 2ZJSH 1BVZA 2HJFB 4OCMC 3PL6B 4EDWH 3V4UL 4DJMA 4RSVA 2NW2A 5E2UH 1W2KT 1YMME 4KMTL 3VWKC 2CKBB 3VD3A 3MV01 1QKZH 3TYFB 5IMMA 4OD2B 3TZVD 3OKNA 1EAPA 4V1DE 4XAKE 4H5SA 3STLB 4DFHA 5JMRA 2W91A 3HMXA 3QIWA 3E1F1 4HUXB 3WNNA 3VXQB 1CGSH 1EH9A 2EC9T 4Z8FL 4NUGH 3CFJA 1YNTB 3B83A 2WNGA 4GW4B 4GRLA 4PYGA 4E0RB 1EHXA 2EH7H 3QHZH 5FKAA 3NH7H 4LCUA 1EJOH 1QG3A 3CC5A 2WV3A 4F37F 4MJ2A 5CILH 1EO8L 3FO1B 4D8PA 4XP1L 4H1LB 1Q9WB 4C4KT 5E00A 5ITBH 1UADC 3MACL 1ZLVH 1LEKB 4P46A 5GZNC 3KDMB 1UCBH 5IVZA 3RNQB 1S9VA 4JPWL 4IRSC 1IGJB 5F1SA 3RWDB 4P5MB 1VPOH 1OGAB 5L2KA 3FZUC 3P4OA 3NGBB 3HZYB 4RAUB 2E7BA 5HHME 4XVJH 5ICXB 4L4TE 2NY2D 1L7TH 5FM5O 3RUGF 1INDH 4MQTB 1YJDH 5DJ6A 2EDJA 4ODBD 4PRID 4XVUC 3PDOB 3IDYC 5JPNB 3MLZH 1FL3A 3RBSA 4RGND 3C2AL 1BF2A 5C0AA 4F3FB 4UI2A 4OLZL 4GRLC 1DFBH 5I73B 1LEIB 1YY9C 1G9ML 3TV3L 2F58H 4RFOL 1MHPL 5F3BB 4O2FA 4OGYL 2DTSA 5D70H 2YSSA 2Z4QA 2HJLB 3C6LD 5IHBA 3MRQB 1L7IL 2KZ1B 2R56L 5IMOA 2GJ6B 4FP8L 2VZOA 2WBKA 3U0PB 3VDAA 5CKAA 1INQB 3RIFF 5D1ZB 12E8H 3E6HA 2QQNL 1E27B 2DLTA 4OLXH 4NQDE 3V4PL 5ISZB 2DQCH 2NR6D 2VSCA 3T4YB 3KYNB 4ZAKB 5C0CB 1G1YA 1JGUL 5DSCA 5EIQA 4ELMA 3OF6A 2ZNWA 1E4WL 2APFA 4PYHA 1P6FA 1QNZH 1YEJL 4C56B 4ZXBA 5IKCB 3IFNH 5FHBH 1U58A 4Y2DA 1E0OB 1J0YA 4NRZA 3RWGB 5CILL 4QRPE 5JUEH 2EH8L 1CGVA 3EOTH 3TBSA 3REWB 4RWHA 3H6JA 4OIBA 4F7TA 1GC1C 3DUSA 3TN0A 4RMWA 4HPOL 5TH2A 4QNPE 4MAUL 2X40A 2GSGB 5F1OB 2IAMA 1S7VB 3S96B 5L6YL 1A4KB 1CXIA 2VIRA 1JNNH 2RCSL 1QKZL 5A16A 1ORQB 1S9XA 4OV5B 2CO7B 1N5AA 5DRXB 1F90H 4MB5A 3HZKB 4I2XE 3VRLE 4CNIA 2AJYH 2ZUQB 4S2SB 5LGHL 4BZ1L 4K9EC 3L3JA 5MENE 5F8QC 2KKQA 1J1OH 5JORA 1LWRA 3OL2A 4LIQL 3KR3H 4OLYL 4Z7VF 1MJ8L 4UQ3A 3IJSB 1T80A 5T1KB 2HLAB 3CU7A 1ZLWK 4N9GA 4WI3A 2DDQH 3PIQA 3IS1X 4ELME 2OI9C 4PJIB 1CGYA 4YR6A 5DUBB 1JHKL 4J2XA 5D7LD 1TVHA 2G60H 4ELMF 3LY6A 2ZSWA 4JG1L 3ROOA 2MCG1 1P53A 3DGCR 3I02A 4GKOA 4ORGB 5ID0A 3V0VA 5JPMA 2F54E 3VFGH 1S7RB 3RDTD 2VLJE 1XIWD 1ETZB 5CZKA 1I9RH 4JE4B 3SKMA 4BH8A 4MB3A 3H9SA 4X5WA 3I6GB 1FIGH 3VFRB 3T04D 4W4OC 1ES0A 5F9OL 1CLYH 1Q38A 5JHLL 4JRXB 2CKBH 3MLYH 1QPXA 1XT5A 5GGVL 5HGHA 3TIDA 1ZV5A 2YZ8A 2QR0A 3B43A 1BQSA 1T20B 5DD0H 5HDBE 2NY3D 4OTXL 1T03H 1ZHKA 3R4DA 2GKIA 4KJQC 5LXGH 5BW7A 4WW1B 4D9LH 2IPKB 3QEQA 2XYCA 2CLVB 2QKIA 2UZIL 4Y5YC 1R3IH 5BOZG 2AJZA 4XCNA 3SDAD 4RMQA 2YD6A 5IW1B 3C5SB 3FN0L 4FXKA 5GS2D 5JW4Q 1QLFB 1QR4A 3ZMRA 4CRPA 1CFBA 1Y6MR 4B5EA 4DGVL 4Y5XA 3AC0A 3GHEH 5EPMA 1CYGA 1U41A 1M7IB 3EFDL 4OCXL 1IGYA 4UMGA 4P2OA 4D9RD 4Y4HA 5A2KH 3GUTA 4HS8H 5GS0H 1SJHA 1J0HA 1XGYL 4G6MH 4F2MB 1FFNB 4FQXD 1RZJC 1BAFL 1U8KA 2PYFB 3MA9H 25C8L 1EFQA 2PYEE 1TCRA 5HGDA 2A6KB 1BPVA 5GRVK 4OFDA 2OMBA 1S7SB 5KOVC 4PGEB 5D8JL 3MRIA 1BVKA 2IQ9H 3IT8D 1AGBA 3UAJC 2Q7NA 3NZHH 3U9PH 3RL1A 4MJ6A 4QRRD 3NCYS 1KN4H 2PW2A 4X6DF 2QQQA 3MRRB 2W92A 3GJFK 3QNZB 4K55A 5JIPA 1DQLL 3P9WB 4F9LC 3WDHA 3VG0L 3CMOL 2NY6C 3EHBD 2DRUA 4X83A 4HLZH 5HYSG 3MCKB 1ZEAH 5CBAA 1NGYB 3L5JA 5B8CC 2E5EA 4X7EC 1AFVH 3BRGC 3X3FL 1RZJL 2DM4A 5FHAH 4CAGA 2VDOH 4M5YL 4E41B 1OSPL 1NCAH 2NY2C 3X17A 3C8HA 2DJ4A 3MOBH 1L4IA 5A2JH 4PBVC 1GPOL 2F5BH 1VADA 3BGFC 4GXVH 5EN2B 1PFCA 3MRGB 3OJDB 5KG9B 4Y88A 2AJVL 4OD3H 1A4JB 3WDJA 2ENSA 4XXDB 1UB6A 3P30H 5CP3A 1YEFL 3F12B 5HGBB 5C0IA 4OTXH 4PRPA 1EUTA 2W9EH 3KWWB 3O9WA 4D94A 5EC1B 1A02N 1H5BC 4L1HA 4PJ5E 1J8HE 2ESVE 3U4AA 3FN0H 3RTQA 1T7VA 4PRPD 5C0ND 1NPUA 4I0PB 5EH1A 4Q0XL 2AABL 5I66B 2GFBB 1RUKL 4YAQB 1R24B 3V6FA 3EYQC 3VD9A 4WI9A 3FQXA 2X4UA 3JWOL 2XV6B 5E8EA 5T3ZL 3QXDB 1Y0LB 2VZSA 1LE5A 2PTUA 5ABDE 5B38G 3T8XB 32C2A 3S7GA 4S1SH 1FHGA 2GK0A 4ZTOH 3S4SB 5J8OA 2GI7A 2VDML 3PV7A 3UTSB 4MHHI 4AK1A 3VFTA 1OVZA 3VH8A 1RZIB 3MRGA 1FZMA 2W9DL 1OAKL 2GUOB 2PTVA 4IOIA 3DJ9A 2FO4A 3TA3A 3P4MA 4PJAA 4BFIB 2IFGA 2R4SL 5M7QA 5D5MF 3PGDA 1PLGL 1LO5B 4LVOB 5KSAC 4MZ2A 3ILQD 3JV4A 1OW0A 1BOGB 4PGBB 4PJ7F 5CP7A 2VXSH 1IQDA 5CEYA 2EDHA 1D9KD 2Q7YA 4PG9A 5LGJB 4L3EB 1MJUH 1GGIH 4MJ6B 1FV1A 3ES6A 3M07A 1MAKA 1C5CH 1OTSD 3BMWA 4Q7DA 4CU7A 1C12A 1F4WH 4X9HA 1MFBL 4K8RL 2G75A 2NY0B 4NT6A 4YWGL 3SJVA 2RHEA 5I6XC 1N0LA 3S37L 2QSVA 3HA0A 4R4BB 4G8FA 5EORH 1CS6A 2BHZA 3H9HB 1AXSA 4KAQL 2Y5TB 1DQLH 1S8DA 1G7HA 3IF1A 2VLME 2HA1A 1BZ7A 4JDVB 4G6ML 3RA7H 1RZFH 1ZA6A 5DQDL 5DEFA 3RGHA 3V52H 2APBA 2BFVL 1NMBH 1NGQL 3KPPA 4WUUE 1RFDL 4KROB 4OZHB 1UJ3A 5JW5B 5C0BD 4BH7A 3LEXA 4PGDB 1T7YA 5D7IB 4NWTH 4U1SA 5C7XL 3ZKQD 3MTRA 1PBYA 4B41A 4C56E 3QXTA 5IHLB 2AJSH 1R3JB 4IS6B 1T04B 3UJJH 1A9BA 3MXVH 3CSGA 3K2UH 2NY3C 2F8VA 2NY5L 1I85C 3GSRA 3BPNC 3T0EA 1U8PA 4WEUD 1UB5B 3KPLA 1NUNB 5ELIA 2Z91B 1T66C 1KPUA 3SDCA 1CR9L 4QTIL 4QCIB 2DLHA 5DGRA 4ZUWB 3BW9B 3I2CH 3SKMB 4BH8B 4RA0C 1RUQH 3IVKA 1N7MH 5DF0A 2ICCA 5I8EA 3HZVA 4R9HA 3FT4A 4LKXB 1MHPH 2SEBA 4IM8A 1RVFL 4HIHB 5HI4D 2E9WA 1HYSC 5ALCL 4IJ3C 4JFHE 4OLZH 4OGXH 4MA1B 5D96B 1NJ9A 4G3YL 3VXTB 5D2LE 3S36L 3U6RB 3FHQA 2J88L 1RUAH 5DHVH 4JY6B 3VXRA 1RHFA 4L1DA 3HG1A 5DFTA 2OI9B 4KI5E 4L5FH 4PJXE 4N9GB 2FECI 4OBSA 3RVXC 5DFVD 2DQJH 4LDEB 5E6ZA 5KANG 2Z93B 2H9GA 3IDXL 3WN5B 2EO1A 2EKSA 3BWAA 5JO5B 3P73A 1OTUD 1S7UB 1TXKA 4LCWD 2BVUA 2D7TH 3TO4D 2DDQL 1I7TB 5A16B 1KPUB 2IMNA 4JM4H 1A6WL 4QWWD 3QXWA 3O4OB 2VIRB 5MERA 3CXHJ 4NN7C 5E9DB 4M7ZB 3GIVA 3B5HA 2ESVA 2Q3ZA 5C0FB 1FNGA 4HPOH 3EBAA 3EYUL 4Z7VA 4KVCH 1DSFL 2HVJA 3HE7A 4JO1L 4X6DA 4X0KB 3HCVA 1H8OA 1L0YA 2ZSVB 1KEGL 1YEFH 3LKRA 3GSWB 1PG7W 3LV3A 4ZXBB 3AB0B 3OKOB 1DUYA 3T2QA 3PHQB 5F3HA 1XCTA 4B53A 4K71B 2VDRH 5ESAB 4CADA 4GQ9L 4TULH 2YHGA 2VZUA 4S1RL 4UDUB 5IHUL 4V2BA 5E1HB 3TBVA 3CFDA 5ICZB 2HLFC 4W6YB 1NAML 4LLMB 2YD8A 1NAKL 3PL6C 4JDVA 4YBQD 1NLBH 3AY4C 4U6TA 4NOFA 1LE9A 5C0AD 4ZDHA 1AXSB 1FVEB 3ARVA 5D7SH 1MRCL 5CBEA 1DZBA 1X5GA 2DBLL 1G84A 1XGRA 3TP4A 1QRNE 4MXVE 2FNBA 3P4NA 5EZLB 4LGRB 1C12B 3FN9A 4HQQL 1MNUH 4NP4H 4YPGB 3GO1H 4OD1H 5KSBE 3KLHC 3ULUL 3RHWK 4XX1G 1FG2B 4R7DB 4PG9B 1KTDA 3SCMB 2ORBH 1G7JA 4WW2F 1FZJB 4DZ8B 4HZAA 1S9KC 3CFEA 1IGCH 2X4OB 3LN5B 1DQTA 4F7MB 4XCYB 1WTLA 5LKNA 3FQRB 2YK1H 3R8BB 1IQWH 4YGAB 1A6UL 2ADFL 1OGAA 2JJSA 1FBIH 4CVXB 1C5BH 4NJAL 4HPYH 1YEKH 1RZIA 1P2CA 2M2DA 3VH8B 1S9VB 4KJPD 5FO7B 4YLQT 2WBJA 3RNQA 2VUOA 3KDMA 4PUBH 2QSCH 5IVXF 3QDAA 4XH2A 5KVGL 1YDPB 5C09E 4KHXL 3VRIA 4CMMA 5I1EL 3B2UD 1D5BA 5EU6E 4NCDA 3E3QC 4M8QA 4NZRH 4WV1C 4D8PB 3BT2L 5E2JA 1LNUA 3DSNA 1G1CA 4LASH 4Y4HD 5CINH 3QHZL 4MXQD 3VXPB 2PNDA 2DQFA 3L3HA 1JBJA 1O0VA 4JJ5B 3HUJB 4OQTH 1VFUA 3QQ9D 4CN1A 4JM2D 1EMTL 1LVEA 1YNTA 3RWEA 1XH3A 3WFHB 5L9DL 3KHOA 3REVB 3KWWA 3LVEA 4TQEH 1EAPB 1UC6A 5J0BA 3BDBA 5KTEH 5IMMB 4YFDB 2X1PA 5TDPA 1UWEH 1FH5L 3IDJA 3QRFM 1RZFL 1E4JA 1HKFA 2VLJA 5IGXL 5DC4B 3WS3A 3VA6A 4KUCD 4G80B 3PQYD 1AGCB 3MPCA 4NNPH 4N8VG 2A0LD 4WFGE 3RZCD 3O81A 4NSKB 3OGCA 5DK2A 5FYLL 3RL2B 1FLRH 5E2VL 3UTZA 1TTFA 4KRPC 4JQIL 3SEPA 4E41A 4AEIL 3FCTA 4XBPA 3WEXA 4BKLB 3HR5B 5IJVB 3TLRA 5E8PA 5EZJA 4PLJC 1LO3L 5F7DB 3SGEH 4OZ4A 1UZ8A 5CKGA 3EYOB 4XPHH 1XMWA 5MEOA 2NXYB 2VLMD 1U8QB 4MZ3A 1RUPH 1XIWA 2F15A 1G7MA 2X4TA 2DM7A 5DS8B 2VZ1A 3M17A 4PJHB 4R2GD 2IG2H 1AC0A 1LDPH 1KJ2A 3IDYB 3QBTB 2WQRA 3I85A 5I74C 4LHUB 2J2ZA 2G5BA 3QEGL 3IGAB 1WBZA 1MLBA 1WVZA 4D0BA 1IAIL 3WDIA 1YMHA 3GSNL 4JPIB 4P57A 1L9MA 3VD4A 3QWRD 5FGCB 4WI5A 1T4KB 1MIEL 1HYRC 5LVEA 3L1OL 2JIXD 5D7IF 1OPGH 2R1WB 1PD6A 4MGXA 4WHTA 3KPTA 1TJIL 4S10A 4YDIL 4X80H 1QFUL 4TNVK 4F7CA 1ZAGA 2VLRB 1CFQA 2E7HA 3IJHA 5INCA 4RAVB 2JIXA 2BP3A 4EZMA 1KGCD 4MJIA 2B4CH 4YHNA 4M1CD 5DQ9B 5A40E 5LJYH 4GKSB 3B3IB 1FFPA 3W11C 1KNOB 1NFDF 2VISA 3ALXA 4EOWH 3HRPA 1XR8A 5FYKD 1MHEB 2ICWJ 2PXYB 3HRZB 2H6PA 3MRFB 2GY7B 3FOMB 3BPNB 3U9UA 4NC1C 4JFHD 4YHMH 3TYGH 1AQKH 1EIBA 3ME0A 2RAMA 3L3GA 2H41A 4ODUB 5F89B 5C7XH 4EI6A 3X11A 1UACH 4Z78A 1R3LA 3OF6D 4QHNA 1I1FA 4KI5D 2EIBA 1J1XL 5DUPL 1ND0A 3H3KA 4RISH 1NC2B 1J0KA 1DVFD 1J8HB 4AENA 2YRZA 3BZ4A 5FGRA 5C0JA 3RX5A 3IKCA 2EDWA 1JZ4A 3BP6B 3C6LA 3O41A 3F5WB 4GSDL 2WK2A 1NCBH 4CVZA 4YR6B 3UZQA 3G6DL 5EUOF 4ODHL 5EU3A 4KFZC 5KSAA 3VGBA 3MV11 1BAFH 1FL6A 3G04A 5EU6A 1CQKA 1FNEA 3RNKB 4MQ7A 1NEZA 4JG0H 1OM3L 1N6QL 1FO0L 4XC3L 5GGSA 4JHAL 2IALB 3CFKA 4BSVA 2VXSL 5AG9A 1CG9B 4D9LL 5I30L 5BXFB 4LPXA 4PGJA 2MOVA 2R9HC 3B6SA 3QEUB 1OGAE 4LHUG 1UWGH 3KJ6L 4ZNEA 2UWEB 4RGNB 2DLIA 4M1GL 1MCEA 4UILH 3QUKA 5I1LB 4JZJA 1VHPA 5CEXB 1VEMA 2F53E 4I77L 4P46D 2IAMB 5T5NG 1HKLL 4DKEH 3UX9B 1MVFA 3RGVA 2PYEB 4P2CG 5J9PA 3IFLH 4YDIH 3TWCL 4OUUA 4QXGH 5I1IH 3MLWH 4PJBF 4ODTH 3BD3A 3MRPB 4NRYA 1E6OL 2HKFH 1YEDB 3DXAA 4JRXE 5C6PB 3VFVB 4QRUB 4AEHL 1MI5E 3S35X 4H88L 4M1CC 5JW3L 3TBWA 1UM6H 2G9HB 5KVMC 1I1RA 5DSCB 1X5KA 2QHRH 3GGWA 2H32A 1BZQK 4WFFD 3LHPH 1OCWL 2PTTA 4GH7B 5GRXG 4HF5H 1AD9A 4G6KL 1PQZB 4KK5C 4DGYL 1CICC 4PJXB 5IHZB 4ZOAA 5BW7C 1IEBA 3VXNA 3FB6A 3FQNA 2HKFL 3N1PC 4RFNC 2HT3C 5BCAA 3WLBB 4ZYKA 4OUUB 3OGOE 4QHNB 4BZ2H 2EZ0D 4XNZC 2AK4B 4TNWK 3RGVB 3UPAA 2GSIA 3HE6B 5F1KC 3O4LA 2OYPA 3ABZA 4NWUL 1WGOA 1G0YR 3VMNA 3MOAL 4MD4B 5EU6D 2FLBT 2FGZA 3O9WC 1D5XB 1KACB 4K8RD 5DO2D 5B8CB 1S5IH 4TUKH 3T0VA 2Z92B 4GW1B 1J9CT 1MELA 3QZWG 3B9KB 2FDBP 2VXQH 2DQIH 3R1GL 5IVZB 1RUQL 4PJCE 1YMMA 2HP4A 4XCCL 3KYMA 1D7FA 3GEWB 5GGSB 3U36B 4Q9CA 4JHAH 4H0IA 1CZ8H 4MQ7B 3WD5L 3BPCB 4EI5B 3WFCH 1MRFL 1N8ZB 2XWBB 4R8WL 4H1LA 1CR9H 4QTIH 5KSAB 1H3WM 1Q94B 3HS0A 3MQIA 4ZFOB 4WY7H 2JCCA 4ZFZA 5K33A 3HNVH 2V2WA 3TO4A 4AT6A 4LCWA 5HHOD 1G6RA 4NIKB 3C6LB 5E5RB 5DD1H 3GJFA 1B2WH 4PY7A 1CFNB 4R7NB 1KCRL 1RZGB 4NKMA 1MCWM 4C83A 2YRPA 3EO1A 2E7CA 2BSTB 5L8KB 4G3YH 3WE6B 4B0MM 2PR4L 3CXDL 4M7KH 5KJRH 2WMPA 4IRJB 1JZ2A 4AYFA 1I1FB 5E7BA 3W11D 3RVUC 1FLTX 2DLFH 2W60B 3BIKB 4HC1H 1G6VK 3C6SA 4EQ2A 3BIBX 4ODWB 2HMIC 1CWVA 1I9EA 3FB8B 5DEZA 5JQ6L 2H2PC 5C2UB 2I5YH 2WUBL 2BFVH 1IRAY 5DO2C 4Q9BA 2EYRB 1D3CA 2R0LL 2X4TB 5KZCD 4M02A 4MDJB 4OM0L 1MEXH 1VPOL 1UH3A 1C16B 4OGAC 4N5ED 5EZJB 3BSZH 1WBYB 2IGFH 3BE1H 1KNOA 2VISB 1F6LL 2H3NB 3DX8B 1I8LA 5EORL 5JDSA 4HKBA 4FABL 3T0XA 1YJDL 5AD0B 5DK2B 3N9GH 1MWAB 4YHNB 5BZWB 3GBNL 1QYGH 2NY3B 4QLRA 3V6OA 4M48L 3V6OE 3ESVF 5F9JB 3KPSA 3M1BA 1NLBL 3ARGD 3WS3B 5HYJB 2MHAA 1JJUA 4F7CB 3NIDF 4KVCL 4WTZA 3V0WH 5J6HA 2IF7A 4HGMA 1AJ7H 1D6VL 1KLUB 3SHSA 4MA8H 4W6XB 5D2LA 2FR4B 1XH3B 3L3OA 5GS3A 1ZT7A 4XNXH 1EEYA 3NA9H 4XCCH 2XZAL 2J5LB 5DD3H 5F9WB 5IIEB 2CK2A 3GJFH 1H3TA 1HQ4B 1W72H 1E28A 3ESUF 4TUJB 5FYKE 4Z77A 3RKDC 3P0YL 3SDXE 5IROC 4U1GC 1PX4A 1OP3K 2C3VB 3CVHA 3IGAA 3SJVE 1LHZA 4WEBH 1JNHB 4G7VL 4L8SB 1IM3A 4U3CA 4D0CA 5C6WH 4HMDA 5LAXB 3KVQA 4KK8C 5T1DH 4FFZL 4DVBB 1E4KC 2VDPH 4P46C 5FO7A 3B2VL 5D4QA 4RWYH 4YFLI 5LWYH 4N0YL 5FM5M 8FABA 4YNYB 5K59F 4NPYB 3BXNA 2W65B 4XBPB 3WEXB 2X41A 2Q6WA 1NGWA 3HPJA 5IEHA 1CE6A 3SGDI 5KZCB 3WV0A 2W9EL 5JUEL 2YMXL 3GK8H 3V5HB 3ZT6A 4BZYA 1K5NB 1MJJB 1AR1D 3OB8A 3RDTC 1DBBL 5CGYC 3ETBF 4KDTA 1AY1L 4OCYH 1ZGLA 3BH8A 2DYPD 1F4YL 3GI8L 4U3XA 3JWDC 3ARXA 5I75C 1S7WB 1MLCB 1A7QL 2WBJC 4NN7B 5IJKC 4C59B 3OKDB 4JFPA 3RWEB 4JLRA 4ZDHB 2KL6A 1BD2A 2JJSC 3Q6FB 3QI9C 4U05A 4G9FA 2XTJC 4YGVB 4XT1C 4MDIA 2MCPH 4MYWB 5D1QD 1N26A 1WCBB 4ZUTA 2H8PA 2NTFB 3HAEG 3C60D 3RJQB 3VWKA 1BFVH 1QSFE 1SBSH 1BBDL 3EOAA 2C7UA 1JTTA 2VDLL 3O6LL 3QDJB 4U1JA 4JB9H 1T0MA 5GGRA 2EDDA 3DMMD 2XACC 2CXKA 2P46B 2AXGA 3MX0A 4LLYA 1A3RL 2R8SH 5K9OA 3RKPA 1NMCB 4DN4L 5DJ2A 2WINA 1HYSD 2XTLA 1JPGA 3B9KD 3EDDA 3VFUB 2GY5A 4DUWA 4XP6H 4GAFB 5BV7L 4JM2B 5CMAB 2X1OA 4RMTA 2BERA 3PHOA 1ZT1A 1OP5K 5C0DB 2A6JA 3F62A 2NX5E 2ATKB 5DRWB 3PHOB 2JJTA 1MI5D 2R39A 2JJVA 3IB4A 1F2XK 4ERSL 1MI5A 4YBQC 4RMSA 1X5AA 4LLYB 4XVUD 3B5TA 1R3HA 3QXAA 4XC1L 3W9DB 3H7LA 5GGVH 4HUUA 4HUWB 4PJCA 1IEHA 4KTDH 1QSVA 3EJJX 4FFYL 2ERJB 3FQWB 4V1DB 1OOAA 4XNQA 2Y9RT 1I7UA 4P23B 4K2UL 2VLKE 5E2WH 4YGVA 1GZPA 1NBYA 3GKWL 1HXMA 1A5FL 3WO3B 3KPMB 3Q6FA 2W0FB 5DUPH 3S35H 1PLGH 5CEZL 2J6EL 2OMNA 3EDEA 1CK0H 1EJ6A 3NABH 1Q72H 2YPLB 2NX5A 4NFDA 5JHLH 1JMXA 4GFTB 4OF5A 1KCKA 1G7IB 1SY6L 3QO0B 2DKMA 2Y36L 4I9WE 3BRDA 4Y7MA 2AXFA 1GGYA 1JGLL 1QBLL 1CICB 1CGWA 4OLWH 1MJ8H 1T2QH 4RIRA 4JRYD 3CH1A 3X13B 4DUVA 3HZMA 2UVEA 3R06B 3QZWB 4GAYA 1PKQE 3H3PH 4QXTB 3G08B 3O6FB 3NZ8B 2I9LB 3PF2A 5MERB 1HHHA 1MFDH 3QIWC 3A6BL 1ZK9A 5B4MD 3QHTC 2FJGA 2Z91A 2FJGB 3KPLB 1A1OA 1JNNL 5EFIA 3S5LB 1HH6B 3ISWA 4QXTA 3BHBA 2D7TL 5EIVA 4AZ8A 4D0CB 1KCUL 3WIFB 3BX7C 4EBQH 3MLWL 4AQOA 3FO2B 3QI9D 1CI5A 4UT9H 3GIZH 1T3FA 3IDXH 4WI6A 2M26A 3CX5J 3PGCB 5JA8B 1L6ZA 4HIEA 1JZ8A 3BT2H 1CLYL 4XWGL 1RHHB 1A0QL 1N59B 4KV5E 4F7PB 3JVGA 4XXCC 4ELKA 3FO0H 2DWDA 3OKLB 1UJ3B 4JN1L 4LCCC 4OZHA 5CJ5A 1RZJH 4JY6A 3V4VL 2XFXA 3U6RA 1YYMH 2NX5B 1HI6A 1CDYA 1BM3L 3L3KB 1OTTD 2B2XL 5I76A 4KKAC 3VWJC 4TNVF 1S3KH 3SDCD 3O8XC 4NNPL 3VG0H 4M03A 4Z95L 4NO3A 3GJEA 2EE2A 1X44A 1OAQH 4LSTH 5E2TH 2EDLA 4H25B 4AG4L 4KKBD 3C6LC 2EYTB 5SWSA 4G8FB 3PJSB 3FQWA 1LO3H 3V2AR 4ZFFB 3ALPA 3GM0A 3W82A 5AD0A 2G75B 4NT6B 4PRHB 4ZO6A 3MREB 5DD5H 5AYQA 1U91A 1AO7A 2VH5H 4I18A 4U1LA 2ATPB 4LARL 3G5VB 2CJUL 4UOW1 3U4EB 4OFYD 1M6OA 1WT5A 2XG5A 4O2EB 5E1AA 4KRPB 4YJZL 3ARZA 1JI1A 4WUKL 5DYOA 3UYPA 4UT6L 5FUOL 3OAZH 4DK3A 1WZ1L 3RWIB 3VFTB 3SGKA 4N1EA 4K9EL 2AXGB 4WEMB 5GISL 4TOYH 5A3ID 4R4ND 3WCYA 2FH8A 3BP5B 2BNQA 2GTZB 1CFNA 3SJVD 2V7HB 2PF6A 3MNVA 1BD2D 4P0DA 1TZGH 2IAMD 3EGSA 1OTSC 3IXAB 4KV5F 1P5VA 5IFHL 2Q8BL 1WITA 1MF2L 3TJEH 1FQ9C 4EOWL 2CMRL 1KENL 1HDMA 1KPVB 4KHXH 1J88A 3I3EA 4HXBL 1K8IA 5A2IH 5I66A 3RA7L 2J7LA 3RPKA 1BD2B 4UDTA 2BNQE 1JE6A 3H9HA 2BXYA 3VDCA 1BBDH 5JIHA 1MLCA 3V6ZB 4CBPA 3MUY1 4JY4B 5EBMA 2YPKA 3W39A 4Q6IC 3HB3D 1YEGL 3KLAA 3U30C 3PWUA 1EXUA 4ZUUA 3GBMH 1F58L 4IMLA 1YN6A 5B8CA 4P2YA 1A4JA 2MKLC 4MCZB 1MJUL 5CCKL 5FM4A 1NGXA 3NAAL 3QUMA 1F8TH 1U95B 5TFSL 2J8UE 2IPUG 1CGXA 5INDB 3ZTNH 4DAGL 3PGDB 4FZEL 3O4LB 1T89A 2R0KL 1N5YH 4N1HB 2VAAB 4Y19A 4PJAE 1UENA 1FZMB 2FX7L 3VFGL 5D7SL 3O6KL 1XAUA 2ITDB 3DHMA 7CGTA 2X4PB 3BZFA 1X4ZA 3STZA 5C09A 3HE6D 3O6ML 32C2B 3O45A 2A77H 2AXHA 3RL1B 3MLPA 2HWZL 4YDKH 3KS0H 4L4JA 1LE5B 5DI8A 4Y4KC 1MFCL 1RURH 3VI3E 1JPSL 3WNMA 1RVFH 2DIAA 1VKXA 1BLNA 4FZ8L 5HGDB 3PABA 1R24A 4NQCB 1GGBH 1I1CA 3DECA 5J57B 1VERA 5DMIH 1EEYB 3MLTB 1ZLSL 5CJXC 2IH3A 3QA3B 4OSUH 4FQPA 4JANA 3VFVA 4D9RE 2R2HB 5EC1A 3ARUA 3L7FA 4NQVB 3NFSH 5I8KL 3QQ4A 3GRWA 4FA8A 2VAJA 2P5EB 4UILL 3P77A 3LS5H 1X5ZA 5HY9B 1I4FB 3IU4L 3GM8A 5I1IL 1QRNA 2BSRA 2I07B 4Y5XB 5J12B 1T2QL 4HKXA 2NXZD 1I7ZB 2GIYA 4N0FA 1QLFA 2YD3A 3TCLB 4PJBB 3C5SA 3D9AL 3GI9L 5FUZL 1A6TB 5IMLB 4GRLD 5EN2A 1MWAA 2W38A 3MLXL 1Q0XH 2QKIB 1YECL 3QUKB 1NMCC 4J12A 3UJIH 1IC5L 4QRRE 4KJQD 3BZDA 3VXMB 3OXRB 2CK0L 3X3FH 4NJ9L 5HVFB 1CFSA 1YNLL 2VLKD 4XP5H 2X1XR 1FNSH 1NGZB 3MJ9A 1ZSDA 3DGGA 5HTSA 3TPUB 4RFNB 3BRFA 1WAAA 1F13A 2FGWL 3LEYL 4UTBH 3GBNH 1KFAL 5HBBA 3SE4C 1N7ML 4LU5L 1QQDB 2EKJA 3RZWA 1ES0B 2NYYD 1QP1A 3L5WB 3U7YH 1BVKB 1I3RA 4X4XA 4DAGH 3FFCB 2AK1H 2YXFA 4NM4H 1CTNA 4X8JB 1KJVB 3QCTL 3MO1B 4XBEH 2VE6A 3S37H 4Z7VE 3PP4H 2BVPA 3S9DB 3SE3C 5HXMA 1MHCB 2PYFA 2R56H 3F5WA 2N4IA 4FQCL 5HI4C 4RX4D 5BV7B 3QWQB 3SDAA 5I1HL 1MVUB 1IC7L 4KWUA 2FSEA 2P8PB 4JPKH 5TQ2L 4R96B 3MROB 4MS8C 2BSSA 1J8HA 4AENB 1JV5A 4Z95H 3KXFD 4R3SB 3HS0B 4X8JA 3O3DA 1I3UA 5HHMD 4EI5C 5KS9A 1TETH 4FQ2L 2D4DA 1F3JA 3KXFA 2BVQA 3F8UB 4PD4J 5MEPA 2DBLH 2GT9B 1A3RH 4J6RL 2Y7QA 1X5JA 4NCC2 3KYMB 3ROLB 4ZPTB 1RULH 4RX4A 3C8KA 3QT2A 5IHUH 1CFSB 4QHKI 3O11A 4NKIH 3E2HC 4YK4C 3VI4E 4F33A 4IDLA 2R0ZL 5LXGL 1MRFH 3B3IA 2A9ML 5CZVH 1CZ8L 5GGTA 3T0AA 3TZVB 4XMPL 1T0PB 5DC0A 2QQKH 1FNAA 4RA3A 4WNQA 1J0IA 3O2VH 1HIMH 1OF2A 2NY5C 1ZHLB 3QUYC 4G5ZL 5A2FA 2X4QA 4FFWC 4K3JL 4XP1H 3TN0B 3RVVC 4QHMB 4HIXH 4WV1A 4PTTB 2MQ3A 2XQYK 5BJTB 2PO6A 5F9DC 4FG6D 4GBXA 4IRSD 2XY1A 1TMCB 2UZXB 4NQVA 3IAGC 2A6DB 1RU9L 1BX2B 2ZCHL 4JKMA 4R96A 5I0DA 3ZDZE 1CGSL 4Z8FH 5TJWK 1S9YA 2AQ3A 5D93B 2WQ8A 3SDAB 1TTUA 2D7QA 3MUHL 1PQZA 1RAMA 2YN5A 2RFXA 2XTJD 2NR6C 4EIGB 5CEZE 1SM3L 4JVUA 4F15B 5T5NF 3AAZA 3WUWG 3A6BH 4J7RA 3Q0HA 4AH2A 2HLAA 5JW3H 1DQJA 5IESH 2DYPB 4ZS6D 1I9JH 1CK0L 2DLEA 2KUTA 3RGVD 3L3DB 1N64H 3KPOB 2KDGA 1CDIA 3OXSB 4MQSB 2DQHL 1GHFH 1PEZA 3Q6GL 1U8QA 4PGCB 1I8IB 3V6OC 5FO8B 2AJYL 1XZ0B 3KJ4B 3PP3H 2DI8A 15C8L 3FB7A 1JWMB 2IQ9L 4L4VA 5DJ6B 5EBGA 1NUFA 4L8DA 4LLDB 3SKNA 3U0WL 4C57C 1A3LH 1X9QA 2J8UA 5CEXA 1A4KA 1M1SA 4NUJB 5D1ZC 1J05B 4P48A 4GMSL 4G6JL 3ZDYF 1IBGH 4LSRL 3SKJH 3MGTA 3H9SE 5T1KD 1T6WA 5IGXH 3LN9A 2ZG1A 1R5IB 1NSNL 2X9YA 3DETD 5I19L 3VGEA 4OKVA 4C56A 5IKCA 3GBLA 3IRZA 1IT9L 4ZS7H 5AZ2L 4JY5H 2VLJD 1Q9WA 1CU4L 5J6GA 2PN5A 1CDHA 2XA8H 4QXUH 1VACB 5EU3B 1TETL 2ZOLB 2Y6SC 2Q8AL 3LRSA 4K23L 1U92A 5ISZA 5D6CB 3CCHA 1VKXB 5DK0B 3DWTA 2CDGB 4PJHF 1CIDA 5DI8B 3MNVB 2IADA 3QWOA 1EUUA 1NKOA 2NTSP 4QRSB 4AIZA 3KPRB 2LAAA 4OAWB 5DK3A 5C09B 3FZUD 4YXKH 3UJTH 4HCRA 1WZ1H 1B0GB 2WBJB 1EK3A 2ITDA 4P3WA 3ZYJA 3OKEA 1Z9LA 2Y72A 25C8H 3TM6A 1S7TA 4NM4L 1MCRA 2DQTL 3T2NH 2VAAA 3HI1A 3PDOA 3HAEH 2RGSA 5DA0B 2BZDA 2R15A 1XGYH 2FYYB 3FQRA 4LU5H 3K1KC 4ZTPH 4F7MA 3AXLB 4UQ2A 1M6OB 3BEWA 1NCDH 2EC9U 1IC7H 4KVNH 4XZUA 1NGXB 2PXYA 4PRBB 4OCWL 4MJID 3WXVH 1YN6B 4LCWE 2VDNL 3V7MA 3UTSD 3U46B 4MCYB 4PJ7E 4M3KB 1KN2L 3PP4L 1X4XA 1DQQB 2XKNA 2ZZUT 3PWUB 3QPQD 1RZ7L 1ZA3B 4NNYA 4WY7L 3L5IA 1Q1JL 3VXSB 2C1PA 4LPCA 1LEKA 4JY4A 1QBML 3W2DL 3N1QC 2RB8A 3G6JB 4MJIB 4TNWF 5EOTA 2PYED 2JIXB 3MACH 3OZ9H 5E00B 4YHLL 4RAVA 1FYHB 4KK8D 4NO3B 3QWRA 1DQDL 4XP6L 5EZOL 4GMSH 2P8MB 1N3NA 1QACA 3GMRA 2CIKA 3H9YA 3EKCA 1EGJL 4S1RH 3QRGH 4AM0A 3S97C 4Y4KB 1QFOA 1FZOA 2V7HA 2CRIA 5H37G 3ILPB 2IANA 4WI2A 1UFUA 3U2SB 4OZIF 1U8HB 1RY7B 2IPUK 1T7WA 2ERJC 5IVNA 3DURB 5GRWA 3SKJL 2EEAA 1IGTA 4NQTA 1I85A 1SMOA 3D69B 4LF3B 4P23C 2FIRT 1GHFL 2X4NB 4LHUA 3ZHKA 1PGRB 1JFQL 4BQ9A 1WWWX 1KJ2B 5CUSH 3GIVB 4Z7QE 5E9DA 4MWFA 1IM9B 1OLLA 4CL7A 1RUPL 1U8JA 3FQUB 4JDTH 3QPQC 4GLRH 1T1WB 1TVBB 2P5WD 5B39B 3IFNL 2UUDK 3NTCL 1KELL 2XZAH 4QOKB 5E8PB 4PJ5A 3V5KA 1J8HD 4Z6AT 2NY7L 5DVOA 1PKOA 3FN3A 3MGAA 4PRPE 5DJCA 3X13A 1EERB 2Y4SA 1PG7X 1B3JA 4HAFA 1DL7L 3PJSA 4P9ML 3VFSA 1CFTB 3QPXL 1BIIB 1R5WA 2KQMA 4RBPK 5T33H 4MNGE 1EHLL 5CJOH 2H2PD 2DJSA 4OKDA 5CP3H 4JDZB 4Y4FC 2VXTH 4HBQA 2X89D 2ARJB 3REVA 4A2MA 3NPSC 2OTUB 3UTPE 2DTML 1TQBC 4LIQH 4X4YA 2XPGA 3GMOA 5GJSH 5FV2A 1RUML 4PJ9A 3S98A 3ULVE 1GZPB 2B0SH 1RHHA 1INDL 4U0RB 5D1XC 5BV7C 3EYVA 3PGCA 3HZVB 5TDNA 2WLYA 1SQ2N 1W72A 3FTGA 5HPOA 1XF3B 3MMEA 5FOBA 4XNXL 1MHHB 2V5TA 1NAMA 1CIUA 2Q76B 1BJ1H 2P42B 4XH2B 4JPWH 1VDGA 4U1MA 2OQJA 5IFJA 1AI1L 1C5DB 1YN7A 1RIHH 2XWJB 4OZFA 3RY6C 3LQAC 1UB5A 1D6EA 4LKCB 1KLGA 3U82B 4G8GA 5A43C 2FBJH 3AS3A 2ITCB 3L95A 5IB5A 1NGQH 4NO2A 1NUDA 1ZT1B 3KYOB 3F7RA 5K59E 2NY0D 2ZPKH 4WJ5B 3T0BA 1S5IL 3E2HB 3FO9B 4LEOB 2XTJE 2UY6A 2JCCF 4GO6B 1EHNA 3AREB 4JB9L 1DUZA 1XIWC 4WUUD 2DQCL 1M05B 5C0BE 4YPGA 3QJHA 1CT8A 1PAMA 2UZIH 3SGEI 3TN0C 4K3EL 1KFAH 1RFDH 4TN9A 4FZ8H 3WL9B 1DP0A 2VXQL 4C56D 1KT2B 3S34H 1YJDC 1WTGT 2EXWC 3ARGB 4LIQE 1CE1H 1PJ9A 4YXHH 2F53B 4BSWA 1U8LA 1NBYB 4DKAA 2FH6A 3IF1B 2Y5TA 2IH1B 2GHWB 1U36A 3MNWA 3QCTH 2RIKA 4X4ZA 3GO1L 2HH0L 1WBXB 3RU8L 4L8CB 4I3RH 2H26B 3BO8A 1AP2A 3GSUA 4X4ME 4KK9C 4LARH 4YDLB 1AC6A 5BZDB 3C5ZB 3VWKD 1EFXA 4M6NL 2BNUB 4PR5B 5DMKB 3LV3B 5F7FA 5LGJA 3LKRB 3MOQA 1NFDB 5IB3A 4K94H 3IDMA 2NQCA 4G9FD 5EU4B 1U93A 1A9EA 1FC2D 1YEIL 2APXA 3JV4B 5J89A 2X44D 1FORL 1CE6B 4U6YA 4HV8B 3LB6D 4KRNA 1AHWB 2F74A 2I60L 3BWUC 1T1ZB 4RGOL 4WHYG 3AY4A 5B39G 4DUXA 4XTRC 1OAKH 5KSVB 5HJ3A 2A73B 2HRPH 3QIUB 4GJTB 3QNYB 4KJYB 3GMNB 4HFWB 3NFPA 1FCGA 1W72B 3O6MH 4H8WC 3CVHB 3KLSA 4K3DL 4HIJB 2DQHH 3FQXB 4ZUTB 3UO1L 4Z77B 1QSEB 4GBXD 4IRSA 4JO4L 3VXMD 2WP3O 4YAQA 1IZJA 2PO6D 5DEGA 4BQ8A 2FX7H 3S88H 2I60H 3GFUA 1YY8B 3M8OL 5SWZB 4Y1AD 5H35A 1H15A 4MA8L 4JG0L 3QISA 5ID1B 1BQHB 3LKNB 4FZEH 3ARDC 2ARJA 2E9JA 3TPKA 2I24N 5IR1A 1NJ9B 3CDYA 4PRPB 1N4XL 4KKCD 2PKDA 3VG9C 6CGTA 3F12A 3FFCD 1MJ7L 3BH8B 3QQ3A 5KS9F 1CCZA 4M48H 2WUCL 4HIHA 1G0DA 1BIIA 3E8UH 3UTSE 1DCLA 1MCCA 4NQUA 3LKSB 3MODH 4KTEL 3BW9A 4UBDD 1P1ZA 3WIHL 1NGWB 3HPJB 5F1IB 1VESA 1E4XI 4Y16D 2YR3A 3D85D 5E24E 3DI3B 1LP9E 2OXGA 4J23A 3GMQA 4PJGF 4LSPL 2GTWA 4X9BA 4FOMA 4MDJA 1P4LA 3KPSD 4K8RC 3NFNA 1NBVL 5IG7B 2VJXA 5C70A 3SKUD 4X6CF 4LSDA 1WZLA 3T0EB 1FVCB 3MRIB 1AGFB 1IARB 4QKXB 5E4IA 1M7XA 4YIQA 5C0AE 3QH3A 2H1PL 5SWSE 3EO1B 2X09A 3KJ6H 5FYLE 4NKMB 1WSST 1ODAA 4IIQC 4AL8L 1K4CB 4M9OA 1JUFA 2VABB 5F96H 5D2LB 3Q3GB 4G43A 1G0XA 3Q3GA 4LCYB 4KHTL 1IQWL 2ARWA 4JRXD 2EE9A 4G8GE 4P2OB 1CD9B 3F6LA 2V2WB 1OGTA 2P8MA 2EXYC 4UV7H 3C08L 5LCVH 5FGBA 4S0TD 5HYJA 4BK5A 3UC0L 2YA1A 3JTSA 2GCYA 4HULB 3QUML 2AW2A 5J1AA 5ALBH 1CXFA 2H1PH 5KSBA 4M4PA 1F4XH 5C08D 2FECL 1NMBL 4D9QE 5KVEL 5K9JL 3IDNB 2FHFA 4ONHB 1EVUA 5HI5C 5DZOA 3HTLX 2H3NA 2CLRB 3TF7C 2NY1C 1DEEB 1WUNT 5FA3B 4LP4A 2AK4E 4PJEF 5GRZA 4X80L 3ECBB 1ZHKB 2HT2C 2XRAL 1BOYA 4ZS6C 3MOAH 2OX5A 3LSOA 1NGPH 1DN0A 1U8MB 2KZWA 3UP1A 4U31A 3D48R 3AM8C 5KN5A 1KEMH 4K7FB 3DVGA 4HLZG 1FRGL 4AG4H 3ARWA 3JV5A 4KKBC 5I1JH 3V4UH 5HI3D 2ZOKB 4Z7WF 5KW9L 1HN1A 3I6KA 3KPRA 2RR3A 1QLEH 2CO6B 3TJHC 5T1DL 4UU9A 4ORGA 1P7QD 3QIBC 1H3XA 1LMKA 2IADB 4TVPH 3WHXB 4X7TA 2CDGA 1U2CA 3I3DA 4XAWH 3RDTA 3BQUB 2VO5A 4PRIB 5L2JB 5D6CA 2B7DT 4ESKA 2QADD 2H32B 4HIXL 2GFBA 3CLFL 3IDGB 4JFED 1VACA 1I75A 1ZLSH 1SM3H 4I0PA 4LRNH 3FMGH 2CSPA 3OR7B 4KY1L 5JORB 3U36A 3NIGF 3RWFA 1RU9H 5I16B 2MPAL 5HYQB 2MKWA 1IAKA 1E4KA 3FAWA 1WK0A 3H42L 3J8F7 3TH4T 3B9KA 6FABL 5GHWH 4K71C 3K81A 3QG7H 5F7NC 3D2UD 4LPTA 5J7CC 3CU1A 2A73A 1CXLA 1Z0MA 2PYEA 4LDOB 5GRUL 3QSKB 1SY6H 2Y36H 1RZ8B 3ZT5A 5IW3A 1MIMH 4X6BB 1WAAE 3K4AA 1VADB 5ILTH 5C07D 1QNZL 1PYWA 4OIIL 3MBXH 3QO1A 3QUMH 2MNUA 2YD7A 2VDKH 4MSWA 2X4RA 4QRRA 3T3ME 4OQTL 3KYKH 1A6ZB 3F58L 2BXZA 3B6SB 3QEUA 3UBXA 3GKWH 1FBIL 5FO8A 1SBSL 1P4IH 1I8IA 3Q48A 3V0WL 3WLBA 9CGTA 5FGSA 5CSZB 4KXZI 1U8IB 1FO0H 2CRMA 3MRRA 2D9QB 3OAYK 1U58B 2IALA 4FFYH 1MCNA 1IEBB 4JN2A 2X10A 1HILB 5EOCH 1MAMH 2ORBL 5JQ6H 2D7OA 3RVXD 1O7VA 1OAUH 1TJGL 4JZOA 3VXRE 4NKQB 1QHPA 1UKQA 4GAGL 2OR8A 1L0QA 5F7EH 2AV7A 1KGCE 4LLQA 1S9WA 2W59A 3OB0H 4NGHH 1KF9B 4AY0A 2BSED 2G9HA 5D93C 3U0TA 2HJLA 4N0CD 1BHGA 2CLZB 4FTVB 4QRUA 1KT2A 5F3BA 2I25N 3ARGC 3DXAB 4NRXA 4WI7A 2GEEA 2F9BT 2CRZA 2UVFA 3OKKB 3WNLA 3L6FB 5EPMB 4OFYA 3UYRL 3GRWH 4WV1B 2I9TA 4N0RA 2VWEE 4TULL 4YZFE 3SDDB 2CUIA 2BMKA 2MQ0A 1A2YA 4BUGA 4ONOA 5AUMB 4PP1C 1WQVT 5EUOA 4NZUH 2MQCA 4LASL 5CINL 4KTYA 2HT4C 4A6YA 3A67L 1MRCH 4NO2B 2GJZA 5JHDB 5F96L 1G9NL 3PE9A 4WO4A 4QXWA 3VXME 1IGJA 4Q9QH 4KUCF 5HHNA 4XI5D 5T3XD 3VWJA 3ZZ1A 5IMKB 1HHKB 3TNMB 4TVSa 4MMZC 4PLJD 2V7NA 5DJ8A 3EOYG 1XF4B 3UPCA 1GC1L 1KUMA 4OLVL 1FGVL 4L4VD 1FAIH 3GSQA 3GHBL 3BUYB 1KIPA 5L88L 1MHHA 4HHAB 5DJZA 2CDEB 5I9QC 4H26A 1P9MC 3PGFH 3IDUA 3A6OA 2YK1L 1W8OA 4R97B 3FFCE 5GSRA 4CN4A 1BGXL 3EO0B 4MQXC 5KVDH 3DYPA 1CBVL 1OT1A 1HZHL 3EYVB 4WU7B 1XR9B 2IBZY 4LSQL 3LS5L 2WZPD 1UA6H 3HFML 1DL7H 1MVUA 1OT2A 1S3KL 1LK3L 4WCYH 1RPQA 3GMLA 1I1AC 1RIVL 3LZFH 4IBLT 3ARQA 4QY8A 5DUBA 3PXJA 1RJLA 1AO7E 1CVRA 5IF0A 8CGTA 2ZUVA 3CFBA 1DBBH 4URTB 2G5BB 3IJSA 3X11B 1UM5H 4EI6B 1P4BH 1X5IA 4PD4K 1CFTA 2VDMH 4HUNB 4WO4C 3AS2A 2G60L 2V2TB 5DS8A 5E7FA 3O3AB 4XGZA 3K80A 2H6PB 3HB3C 1ZVHA 4HG4J 1QVOA 1UG9A 4GKZB 4NQED 2PCPB 1Q9LA 3FQTA 3TN0D 4LAJH 5FYJE 3MBEA 1MQKH 4JPVL 4HC1L 3PWLA 3RVTD 5B3JE 3GMPB 4CU6A 4N0UA 4TTDC 3DUUB 5LGHH 5TFSH 4XHJC 2NX5D 1PY9A 2WAHA 4XAWL 4F7TB 2VLRA 4Z18A 2P5WA 2VLJB 4Q9QL 3GBML 2VUYA 3IU3B 3P77B 1HINH 2R1WA 3BAEL 3IETA 3ALWA 2C1OA 3DMMC 3L7FB 2IANB 5K9QG 3HC0B 4NBZB 2AI0L 1Q9KB 1E4XH 1Q9OB 1IL1A 1T1XA 1YMMD 2IH3B 4WRLA 1BQLL 4D9QD 4YE4L 4OLVH 2NW3B 3HUJA 2VB5A 4ODSH 3KYNA 3S6CA 1HHJB 5DUML 3K8KA 4ODHH 1BLNB 3QDMD 3WO4C 4B7IA 1MLBB 1C1EH 3U4BH 3TVMB 3MLRH 4P5TA 1G9MC 4YDJB 5IT2H 4J1UA 5D7JD 4M8QB 3LD8C 4OFIA 3V0AC 5DQDH 3E3QE 4XPBH 4RQQB 3EDKA 2Q86B 4W6WB 2QSCL 3G6JA 1HCFX 1CFVL 1N6QH 2LU3A 3P0GB 5GJSL 1QLRB 4CJ0A 2IQAA 2HH0H 1KIQB 2J8UF 1UKSA