4BUHA

Human ige against the major allergen bet v 1 - crystal structure of clone m0418 scfv
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
252
structure length
237
Chain Sequence
b'EVQLVQSGAEVKKPGESLKISCKGSEYSFPNYWIAWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGQVNISADKSSRTAFLEWSSLKASDSATYFCARLGGQLWNSYYYYYYMDVWGKGTTVTVSSGYELTQPPSASGTPGQRVTISCSGSSSNIGGNTVNWYQQVPGTAPRLLIYKNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCEAWDGGLRGGVFGGGTKLTVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLONE M0418 SCFV
publication title Human Ige Against the Major Allergen Bet V 1 - Defining an Epitope with Limited Cross-Reactivity between Different Pr-10 Family Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 237
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4buhA01
4YEEA 4LHUD 3U48A 3SJVB 3U4EA 2VLMD 3O2VL 1IARB 4BKLA 4HKBB 1LP9B 2N56A 4HF5H 3KYOB 1YEFH 1F90H 1WIOA 5EU6D 3U4BL 5HI3D 4PY7B 4DGVL 2BSSA 4JFHD 1AE6L 3GJFA 1U8JA 4KUZL 3QHZL 4FQ1L 4EZMA 5L8LB 1CD1A 4FFWC 2VSCA 5IG7B 4Z95H 4QRTA 4XMPL 3H9ZA 1I1AB 1MCIA 1NAKH 5IB5A 1A14L 3N1GC 4M9OA 5C07D 4BK5A 5C0CB 2A0LD 1EGJH 1JVKA 1TCRB 3BDBA 1P9MC 3GSXA 1GIGH 1RIHL 2J12B 4HXBL 2MPAH 4D9QE 1Q72H 5KSVA 1QQDB 3HE6D 3QISA 1NMCC 1MFEH 3RX8A 1BD2D 1KTDA 3CSGA 3ZYOA 3KS0H 5D8JH 3TO4D 3PDOB 4G6JH 2GSGB 3ARDB 1MFAH 1AD9A 2OTUA 2IH3B 4X5XB 1MCPL 2Q8BH 1DEEB 2BHZA 2CH8A 1VFUA 5L8JB 2Q86A 4YGAB 4YGVB 1SEQL 4F7PB 4BM7A 3IDGA 1YNTA 5JOEA 4FP8L 1VFAB 4I18A 3U7YH 3ULUE 4NN7B 4OBRA 1M7DA 2DQHL 5I1GL 3LD8C 5CP7A 2JLLA 4HUUA 1FCGA 1UJ3B 3D18B 1I8LA 2FLBT 1YNLL 4TQEL 3GMOA 3ARSA 2A9NH 4YHPA 5C0AE 4LLYB 3U1SL 3WNOA 2QKIB 4R0LA 3IDNA 2R1WA 3KPRD 5F1IA 3ESUF 4S2SB 4WTXA 3B2UD 5DR5L 3RJQB 4X6CB 2V2TA 3DPBA 4UT7H 4O51B 1UWXK 2PTUA 2W59A 1BREA 1XR9B 5EC2B 4X4XB 2UUDK 1LEKA 1B0GA 3C5SA 4DKFL 3ARGA 4OLXL 4FFYL 1TVDA 5E56A 3D2UB 2AEQL 3BXNA 4NOBA 4OZGF 5D93B 3ROLA 1ITCA 2YSSA 3R0NA 3DUUA 4GAFB 3RBGA 1F4XL 2YD9A 5KSAA 2ZUTA 3O9WA 5EU7C 4XVUC 1FO0H 1BQSA 1NL0L 3LSOB 4H88L 2AQ3A 4WHTA 1EEZA 2FH8A 4JO3H 1HZHL 1VACA 1U8QB 3JZ7A 5D6DC 3RA7L 1P4LB 4OV5A 1D9KA 3RX5A 4TVSa 5D5ME 1CFSB 4HUVB 3MCKB 5E4IA 3RJDA 1UB5A 5KTEL 1S7UA 1KNOB 1XF1A 3O4LA 5CGMA 4QXWA 3I02B 2DQCH 3ZTJG 3O6FD 1CYGA 1YEHH 5IVZB 4UT9L 2JJSA 3ROOA 3ZT5A 4O58L 3WIHL 5TQ0H 4WI9A 1JTPA 3VH8A 1OW0C 2E8YA 4I0PC 4NPYA 4PJBF 3NTCL 4QNPE 5GZOC 4R3SB 3NCCB 1ZTXH 4F15B 5I71B 4IS6A 1L0XA 5SWSB 3IVKB 1YMMA 1W0VB 3UEZA 4PBVC 4PPTA 2VZSA 5L88H 4RISH 3DETD 1CQKA 2VXVH 4N0FA 1XGTA 1CE6B 3VXNA 3PABB 1IM9B 2VDNL 3WNLA 3WSQL 5C0RL 1S3KL 1HHHA 1ZGLP 4UV4H 4YQXL 1VEPA 4F9LC 4L8CB 3HMWL 3LS5H 4ZO7A 2EDFA 3RIFK 5GS0D 5GJSL 4M00A 3GKZA 3FOLA 1L4IA 1BLNA 1IQWH 1T66D 3ECBA 1RK0B 3EYFA 4NM4L 3IAGC 1JNLH 4H26B 5F3HB 4WW1A 4XPFL 5MEOA 5BMFL 1WWCA 4L4TA 2LU3A 3WNKA 2CK2A 3OX8B 3WJLC 1QSFB 1DUYA 1UG9A 4D0CA 2RGSA 2EXYC 3P4NA 4M6MH 4PRIE 3H9YA 4KVCH 4PGBB 1A7QH 5I15H 3K2MC 1RIVH 4C54A 4F7MB 5I18H 1JNHB 5IR1B 1NAMH 2CKBB 4PG2C 1I9IH 4PGJA 1TPXC 5I16A 3ZL4H 2IAND 2LQRA 3S35H 1FNFA 1F97A 1YQ2A 1X5FA 5TE6L 2VABA 1FSKC 1WZMA 5EBWB 5ICYA 1JPGB 4P9HL 3VG0H 2ADGB 3HLAA 3HPJA 5I1AB 4IMLA 3UBXB 1AGEB 3MRIA 2H3NA 4KC3B 2VLJE 4JHBA 2V17H 1OD9A 1KUMA 5L8KB 3F7YB 4MD4B 1LK2A 3OKLA 3QXDA 5DJDB 4AG4H 5D1ZD 3MUGA 2NYYD 5LG1A 3D0LB 3WFDH 2P8PB 3ARRA 5TE7H 4OM0H 2YS4A 5C0DA 3FRPG 4GLRH 2HFEB 3V5HB 5I8CB 1KYOK 2APFA 4KKAC 3SDAC 1J1XL 1WGOA 5DGQA 5FF6A 3CLEL 1DN0A 4IRSC 2BOCB 1DE4A 2FJFA 1T7WA 4CMHB 2WIIB 1T4KA 3RPKA 1IGIL 5J11C 1K8IA 5DJ8A 4NQVA 3VXUA 3PL6A 4JPKH 2ZCHH 1U3JA 3QEHB 4D2NA 4Z7WF 2L7JA 5FYKU 3CFDA 1CFQB 4A2LA 3HUJA 2AP2A 4KROD 4RGMC 4MZ2A 3TN0D 1YPZB 3VXRA 2CKNA 4ZODA 2FLRT 4HK3J 9CGTA 5KVEH 5TFSL 4UDUA 1EXUA 4ZFZA 1H0DB 2ENSA 3UJTL 1TLKA 3QEQB 4IRZH 4NQSB 1KIRA 4EI5D 1ZGLB 3BW9A 3WHXA 4N8CH 5J1AB 2YR3A 5AG9A 2H32B 1F58L 1OY3B 1T22A 3QIUC 4RWYL 3VFVB 1KSRA 2IH1B 4HG4J 2Y36H 3L1OH 3HE7D 4TRPL 4ZDHA 1NEZG 3Q48A 4O9HH 2D7MA 4C83A 2BHYA 1NCNA 5IVXF 3S5LB 5E1AB 4X6DF 4GKSA 1C12A 1Q38A 1VENA 5H37H 1DBBH 2WQ8A 4ONGH 2NY2D 2PO6B 3VJ6B 2FYYA 3U82B 5F93C 1A6UH 1FZMB 1A1OB 1YYML 3CXDL 2YMXL 1U3ZA 4V2BA 4DK6A 1T83C 4XAWH 4KK8C 2ZWLT 3BAEL 4PJGF 2FNBA 5LQBH 5FA4B 2EYTB 3TPUB 2EDRA 2OYPA 3TJHC 2AK1H 2QADB 2XZQL 4WI3A 4TNVF 5AYUL 1DBJH 3AFLA 1L6ZA 1RZJH 2FSEA 2VYRE 2B1AL 5F6HJ 3BX7C 3HC4L 3VXTA 5EIIB 1MVUB 2YKLH 3O3AB 2P5WA 4GAGL 4CN4A 1EFXB 1GGTA 4PJCF 4G8GA 2ERJC 1OTSC 4LGPB 2HLAA 3UO1H 3FJTA 4L29B 1LQSR 3MRMA 2Z4QB 3JV6B 5TQ2L 5HPMA 1BJMA 4HMEA 1CZ8L 1JFQH 4M1CD 4BQBA 4PV9B 5D7JB 2RJMA 5DURD 1FYTA 1EHAA 5I1IH 4I2XA 3E6HA 1B6UA 5JPNB 1CQYA 4LRNH 3X14A 1I85C 3GUTB 1NFIB 4UNUA 3EDDA 1XCQB 2YN3A 5TH2A 1MWAL 1NEUA 4P23B 4PLJC 1D5MB 4PJ5D 3ARBA 4QXGH 4U0QB 5DI8B 5CEZH 3EOBB 5K59E 1W8OA 3MGTB 5C8JA 3RUGA 2BNRA 1HH6B 2AXFA 1BAFH 2VXUL 3VI4E 3IFLH 4LRIA 4C55A 5GISH 2DYPD 3CK0H 4PJ7A 3N0PB 3DX6A 4MHHI 2VDQL 5DRNA 1FZJB 3U79A 5L0QC 4XI5C 1MREL 1T03H 4M5YL 2ZUXA 5ENWB 2NY7L 5L2JA 4YHIB 2CO6B 5GRVL 5ANME 5T3XL 1YJDC 1KPVB 3JXAA 4LASH 4FQ2L 2QSQA 5GGTL 3KPSB 4OZFG 5HSFA 5MHSE 1Y0LA 3VI3E 3BYYA 1DL7L 5DRXB 2XWJA 4JFPB 2JCCF 4RAVB 5I66B 1NCTA 3QCVH 5CIPH 3DHJA 2BOBA 2VE6A 4GXVL 3GSVA 3VA6A 5CCKL 1IAMA 1D3CA 3I6KB 1GC1H 4NOFA 2DBLH 3U30C 2FX7L 2GTWB 25C8L 2H2SC 3F7VB 1S7RA 3DBXB 1QSEB 2KKQA 5GS0H 2MSPA 1H3PH 4XPHH 5C0GB 3F7PC 3FO2A 2NXZB 3MV7D 4OM1L 3EYUL 4BQ9A 1IGFH 4ONHA 4PRNA 1CF8H 1CFTB 4Y19B 1BJ8A 5I1HH 2AEIT 4LBEB 4Y1AD 1FAIL 3MACH 1OSZA 2Z91B 5D96C 5L9DH 4XCCL 2UVFA 4K23H 1Q9LA 1LEGB 1A7PL 3RIAF 4EN3D 3BPLC 1C16B 3VXOB 1MCLA 2Y4SA 2ZJSH 3TVMD 4AT6A 5JHDD 3GB7B 1AQDB 1M7IA 4AIOA 4FTVD 3QUXD 1IGTA 4NQTA 5KSBF 2Y5TA 4PJHF 1MJJB 4H25A 2PTVA 1MCWW 3GJEB 4BZ2L 2X4TA 3STLA 2HTLC 4J8RB 2WBJD 3VDCA 3SE8H 5E8DH 2LAAA 4RNRA 4JFDA 4O00A 1G7QB 1SBSH 4GFTB 2WINB 4L1HA 1ES0A 5D70H 3SY0A 5BS0D 1YQVL 3EOYG 3EOTL 4ZOEA 4N90E 2AV7B 4KWUA 4OCYL 3KWWB 2NY6C 2Z93A 4F57H 3BHBA 4H1LA 3T4AA 2WNGA 4MXWH 3IDYB 1TNNA 2MQ3A 2A6KA 2CJUH 3TBVB 5D72H 4NKOB 5F3BB 1Z5LB 4JO4L 1MJUH 3L95B 3VFUA 2DM2A 4Q7DA 1J0HA 2FX8L 4CVWA 3CUPB 4K7FB 2HMID 4K94H 1AIFA 1ZHBA 3DUSB 1TETL 4PFEA 4AH2B 3O81A 3EYVB 4J3XA 3T0AA 2R4SL 1P4BH 2J4WH 1CFNB 2NZ9D 3CDGB 4R4BA 4ZO8A 4FN0A 1X5IA 2XQBL 3HZVB 3K8MA 2CMRL 4Y4HD 2HG5A 3DO7B 1X6LA 4KJYB 4U2ZA 2EKJA 1SJEB 5GJTH 3V4PH 1NCAH 1OARH 3MTRA 4M1DH 2P5ED 3FAXA 1XF3B 5FM5O 1BHGA 2D9CA 1BM3H 3QG7L 4KRPD 1JGLL 4JFQB 2RCSH 4JPIB 1KLUB 1B0RA 4EDWH 2UWEA 3GO1L 4I18C 2DWEA 5I17B 1J5OL 5JPMA 3H9SE 1IM3B 2CDGB 1A3LH 1QRND 4YE4L 3RI5K 1I8LC 3RWDA 1FGVL 1HIML 2MTPA 3VXSB 5J3HD 4ODHH 1AD0B 1KELL 4R0LC 3RDTA 4NFBA 1CXLA 1TZGL 3RVUD 3ZKMC 5ADPH 2EDDA 4XBPA 4OUOA 4XRCB 5HGHB 3QDJD 2KZWA 5DJ0B 1AC6A 1G9ML 3JV4A 1RJCA 3QJHA 1UQSA 3N1FC 5EU3B 1OWRM 1XT5A 3BO8B 1BZ9A 5CLWA 3D48R 2XZAL 1FIGL 3ARGC 3LN5A 3JBG7 1OAQH 1NGXA 3CVHA 3M45A 1NC4B 3X13A 3C8KB 5C0JA 2HYMA 3MRBA 2XPGB 1OWWA 1OQXA 4G7VH 2DLGA 4JDTH 2A6DB 1KB5A 3QRGL 3D3VB 5KSAC 2HT2D 2XT1B 1L9NA 3O9WC 2EDEA 2AK4A 2DD8H 3GKWL 1KJ3H 1ZA6B 2D7TL 3C2SA 4YX2L 1OM3H 1IC4H 2PYFA 4KMTH 3BUYA 4JN2A 4U2YA 4QRPE 4EIZC 3QH3A 1NMCB 3BMVA 2CDFA 3C9NA 3L6FB 1T0NB 5FCUL 3DGGB 4LL9A 4ELMF 4JB9H 1D9KC 3DNKA 1OP3H 1KENH 3EYQD 5MEND 2ESVE 2OZ4A 1JPTH 2OJEB 3S37X 3B9KA 2GT9A 4LKCA 1S78C 3WXWL 5K9KB 2G60L 5CILH 5J06A 4XHJD 3FZUD 5E7BA 3GBLA 2Y9RT 1I3RB 2JELH 4UAOC 3EOAB 2CLZB 3LKRB 2BRRH 1AGDA 2ZKHL 5F7HA 1T0MA 2NY3C 5B3JF 1JHTA 3NFPB 1J0KA 2V7HA 3LD8B 2Y6SD 3VA2C 1MFBH 1URLA 3RWIA 1K2DB 1II4E 1MCEA 5DHVA 3Q3GA 1BQUA 3QUMB 3Q6FA 1QYGL 5ETUA 5IK3A 3QUYD 1H15A 2BNUB 5GSRA 4YWGL 4LVOB 3CX5K 4X6BB 5T1DH 5C2UB 4G80A 4I0KA 1KXTB 3TF7C 2MCPL 2Y07H 4UB0L 2YXMA 3VFMA 3ARVA 4PJXE 3O8XC 2X4RA 1DBAH 1RIUL 4QLRA 4YFEA 2R2HA 2BHUA 3NN8A 3QNZA 3VXMD 4QCIA 3TNMA 4NNYA 4MNQB 4EI6A 4GUPA 1JMXA 3CFBB 4M7ZC 3G6JF 4GG8A 3OTTA 2ARJQ 4P46A 2EZ0C 4KRLB 4UINH 4X9IA 1S5HB 4PJIE 3IRPX 4WO4A 5BZWA 3V6FB 2XV6B 4H5SA 4FOMA 1J8HE 3CMOH 2GITA 3KPTA 1YEJH 3WXVH 3ZE2F 5L7XH 3JTTB 4ZYKB 4M62L 1I9RH 3BMWA 3KJ4C 1KPRA 1KPUB 4NCC1 1I4FB 4PP1D 5KZCB 3PV6B 3RNKA 2R1YA 4QT5A 5BRZD 1NANH 1U8KB 4PTTA 1SYSB 1NDMB 4HGWA 2GUOB 5D7LB 4F7EB 3F58L 3QFJE 4S0SD 4NKMB 2B2XH 3HCVA 4LCUB 4OLVH 4BQ8A 4YHKH 3TA3D 3PQYA 1ZLVH 3QO1B 4PGEB 4I77H 2C1PA 4I0PB 3KPMB 3L3GA 1U3HA 4HKJB 3E8UH 1JWSA 3MOBH 5DF0A 1HHJA 4OD3L 1WTGT 2Q3AA 4Z7OF 1NUDA 4FFVC 1H3TA 5INDA 3AMLA 3HR5A 2NLJB 5KS9F 3FHQA 1A6ZB 2CLVA 1R3IH 3I84A 3MRDA 1U8OB 1HHGA 4Q9RH 1K8DA 4KXZH 3T0EC 1MCBA 4XPTL 3RVTC 3I6LE 1H3GA 1CL7L 1NSNL 2N4IA 3IT8D 3MXVH 3NCJL 1WAAA 1SEBB 5C3TA 2FGZA 1K5NB 1PG7L 4KZDL 1A64A 1HXMA 3LEVH 4HPYL 3MCLH 1OF2A 2VQ1B 5HVWA 3MRGB 2OL3B 4ORZC 4UQ2A 1FLTX 1JL8A 2OMNA 3OKEA 5ERWA 2OQJA 2VLRE 3MLUH 3BSZL 3KPOB 5D6CA 1OLZA 2A1WH 1IRAY 2H2PC 3AXLB 4B53A 3S9DB 3PL6C 3FO9A 4LIQH 4O4YH 1FDLL 3RBSA 3MO1B 4PJEA 1QBLL 1NGYA 4F3FA 3ZYZA 3VG9C 3GSRB 4KKBC 5FFLA 2F5AH 1U8NB 4MJIB 3OAYK 3DMMC 3VE0B 4PLNC 1GGCL 3OPZH 2H1PH 5B39G 1RJYB 3MLZH 1ONQA 1G6RL 1WT5A 1NLBL 3R06B 5HI5C 1BVLA 4KKCD 1JPFB 1YUHA 1T89C 4IRJD 1TPXB 1I8MB 4KI5C 3OSKA 3B9AA 4Z18A 1VADA 4RGOH 1ZA3B 2D4FA 4KY1L 1BF2A 1NBZA 4UUJB 1FSKB 1AFVL 3SDXA 1KB9J 1ZS8B 3MLYL 3T8XA 3MV8A 5TDNA 2VR4A 2VDRH 2H32H 4NP4L 1NPUA 4X7EC 3G9VA 1LK3H 3G5XA 5JIPA 5DT1H 1HQRB 1RMFH 2CLRB 1T6WA 4MD0B 3X3GL 3MRLB 4O2CA 2OLDA 4IOFC 3FMGH 2G2RB 4PJFF 4QOKA 1P7KB 2WUCL 3WS3B 2APVA 4XNZB 4DQOL 1QVOA 1PD6A 2X7LB 5HHXL 3SDAB 4OZFH 4K9EH 3TBSA 1MI5B 5SX5K 4PJDA 3VGDA 1SVCP 3SCMA 1G7IB 4HX1A 4IRSB 5FA3A 1CR9H 4AY0A 5K9OB 1P4IH 2DLFH 4G7YL 1Y18A 4IIQB 3RAJL 5F88B 1FL6A 4JANA 4JFFE 3HRZB 2HJFB 4CNIB 5C9JB 2A83B 4IOIB 4DN3H 4RGMB 1N59B 1RI8A 1ZLWH 5IW3A 1I3GH 4KK5C 5F1NA 3FQXB 3D39E 3U36A 3STZB 2E6PA 1DQML 3LRSB 3O0RH 5MEPB 1EBAA 2D7PA 4FS0A 3L5XL 4E0RA 2Q7YA 4P2RE 1CIUA 3LAFA 1CICA 3HR6A 4UI2A 4HFUH 3QIUB 1MFCH 5ISZA 1L0QA 3MOQA 4EUPG 4I9WD 2VLME 3QNYA 1UXWA 4WI4A 3P0YH 2W9DL 3SE4A 2IQ9H 1A6AA 3ARBC 5EU6E 3L3IB 3HN3A 5HHOA 4JFHE 4FQIL 1T2QL 4LSUH 4XAKD 2WWKT 1BZ7A 1H3XA 1W72A 4HULB 2X44D 4X8XA 2EXWD 4LRIC 4XP4L 4K3DL 3LKQB 2JE8A 4OCNC 1IVLA 3RU8H 2ARWA 5L6YH 3HPLB 2IAMD 1NBQA 4DGIL 2FEDC 2FO4B 4HIEA 5E6ID 3WKMH 3QQ3B 4KMLB 4NRXB 4JHZA 3K0WA 5GGSA 1BD2E 1RUQL 1X3DA 1L9MA 5IB3B 4RAUA 4RQQB 3QAZC 35C8L 2ERJB 4D9LH 2ITDB 4Z8FH 3V6OE 2CRMA 5ICXA 2YPLB 4OZHB 1XEDA 2D03L 3C08H 2FDBP 4WU5B 5ALCL 2C3VA 2DQEH 3ES6A 4JQVC 5HGAB 2WSKA 3GSNA 4I5BB 1XF2B 4KDTA 4X9BA 3LN4A 5SWZD 1U2HA 3LV3A 2FBOJ 1S8DA 1T04B 2C5DC 4HT1L 5C08B 4MVBC 4ZFOA 4RCAA 4WCYH 4MS8C 3LKNA 1S7QA 3CFCH 3RKDC 5F9WB 1ZLSH 3LRGA 2AI0L 4NC1C 3GRWL 2E3VA 4Z76A 1NBYB 3KPRE 1OAZH 2DI8A 3AVEA 1EVUA 4PJAB 4LCYA 5TGBA 4U7KA 4XNYL 5J89A 2HKFH 2PYED 3H9HA 4ZFGH 1QA9B 4J3UA 3PV7A 5JXAH 2ADJB 3VFRA 5EIQA 4DTGL 5KVGH 2IPKA 4GQ9H 1YZZA 5L0QB 1D5ZB 1A9BB 3R1GH 4P9HC 1Q0YL 5ITFA 1RFDL 2FL5A 3MRPB 2C3HA 1RUML 3UROR 1FVDB 3AGVA 2COQA 5CEZE 5C0EA 4K8RL 5EBGA 1IKFL 1DFBL 4MAYD 4M6NH 5BJTB 3C5ZA 3JUYA 4HBCH 4LCWD 4PREA 1YN7B 4HJ0C 1QKZH 4FQLL 2FBJH 2XRAH 4P5TC 4QHMA 5C0BD 4GMSL 3O11A 4WW2A 3L7FB 5GGVY 2BMKA 3FQUB 4OZIF 3UTSB 4LLDB 4HS3A 1BIIA 3RVVC 4S0TD 4TPRH 1HOCB 3MNVA 3U30B 4Y4KB 4H8WL 5I1KL 2PNDA 4UTBL 4I13B 2IEPA 3FL7A 4RFNC 4YFLI 3VWKD 1CL7I 5CP3H 5MERB 4H20L 1A02N 5I1LA 4OF3A 1FP5A 1JRHH 4POYA 5BVPL 3LCYA 2I25N 2QQQA 3MBXH 5L2KA 1TVBB 3AB0B 1C08B 3IDJB 1XR8B 5IB4B 5IQ9B 5EOCH 3S88L 3O2WL 2V9RA 1MCJA 1EPFA 4LKXB 3NIDF 1IZKA 4F8QA 3BVNA 2VUYA 1F3DH 3DUHA 1R0AH 1UT9A 2NY1B 4PRHA 1OGAD 4YO0B 2VH5H 1R6VA 1AKJB 4L4VA 3O6MH 3ZKXC 5D96B 2XY1A 1C8PA 3MR9B 3PWUB 2ARJA 3VFGL 5ID0B 2GCYA 3DXAA 4M48L 4XBGA 5F7YC 1JZ8A 4Y2DA 2BERA 1V7ML 3OB0H 3TZVD 5D4QA 3FT3B 4LARL 5FV1L 5C0ND 3NA9L 4GBXD 1QEWA 4P3CH 3SDDD 4MA8L 5JMRA 4J7RA 1CTNA 4N0UB 2K1MA 1I3UA 3GM8A 4N5EC 5T5FL 3PJSB 4KTEH 4JKPH 3FFCD 4MNGB 4U1KB 3U4EB 1DQDH 1J18A 2DQGH 4HLZG 4BKLB 1E4JA 3PGFH 3RDTC 3SKNB 4MXVF 3KXFA 1PYWA 3EO1B 4K3EH 3VFOA 2XYCA 2NY6B 1ZT4A 4P2OC 5MEQA 3GJFB 1IT9L 1U8JB 5C09A 5EH1A 2IANE 1Y6KR 4JPWL 4HCRH 2F54D 5FECA 1FLRL 2IJ0C 1CD1B 2XN9E 4HH8A 1I7UA 2GAZB 1Z9MA 2JJWA 4QRTB 2B8OT 1UB6A 2H8PA 2VDML 4XCYB 5FYKH 4LSVL 3RVWD 3W9EA 4NKDB 3WN5A 4KQ4H 3MUHL 1WCBA 4Z7UA 3M17A 3IFOB 5D7IF 5JXED 1HHIA 2F5BH 4XH2A 1RZKL 4HXAL 5AWNL 3EDEA 4NN6B 4LK4A 3ZSTA 3QHFH 1UZ6E 1P5UA 1AP2A 3HG1D 3DVIA 1LP9E 1PLGL 3DSNA 3IJYB 3INUH 4PJBE 3F62A 5DMGC 3MLTB 5IKCA 2M1KA 2NXYD 3B9KC 3I50L 3GGWA 3IFPB 2XTJC 3K2UH 4YHOH 4WUUD 4BSVB 3UPRB 2VXQH 3A6CH 5ITBH 4NNPL 1IAOB 3IDGB 1YY9D 4I18B 3E1F1 5DJZA 4F7TB 2VLKB 4ODVH 5C0CE 4PYGA 4HUUB 2X4PA 1JF1A 4JFXB 2R0WL 4UBDD 5IHLB 3NCBB 3GMOB 3PGDA 3TJHD 5DJAB 5SWQA 4FQCL 4R0LB 1XH3B 2R1WB 1EO8H 5E2TH 3DV4A 3QUMH 1ADQH 1JPST 2DQIL 4C4KT 3UYOD 4C56D 1S9VA 4P5KA 3ARGB 3C8DA 4PGZA 4WUKL 4EVNA 4KVNH 4ODUA 1ORSB 3HNTH 3UYRL 3DI3B 1GPOL 3C60A 4Q9QH 3MMEA 1QOKA 3QDMD 3QO0B 5TF0A 4JRXD 5KSAB 2BVPB 1UEMA 4ENED 2EECA 5IOPA 1NFDF 4WHTB 4UOW0 5IFAH 1L7TH 1BOYA 2DJUA 1INQA 1VACB 3Q1SH 2FGWL 4WENB 2JB6B 3L3DB 3MZTA 4AMKL 2ZSWA 4TVPD 4PRBA 4NQDA 1D9KB 3CC5A 4PLJD 5JA8B 1OAXL 3RWFA 4P49A 1UH3A 1RURL 4ZUVA 1S7UB 4D0DB 1JP5A 3O4LB 3KPNA 4NO3B 2NY0C 2VL5B 4NKIH 1NC2A 2EIBA 1JHKL 1R5VA 2W0LA 3TFKC 3ROOB 3FO0L 4LSSH 4WFHE 2J8HA 1WUNT 3VH8B 4YXHH 3TIDA 1ITBB 4YZFE 3O2DA 1U3HC 5E0QA 1YDPA 1DLFL 3SGDH 1QBML 2PR4L 5DDHA 3WHE0 1ZHLA 2HT4C 2XQYG 3RWHB 5T33H 5A1AA 1LEIA 3CFKB 3WNPA 5D71L 4HUWB 3RPIA 4B41A 4LCCB 4RRPA 1NGPL 1T2JA 3D25A 3QQ9D 1JWUB 4UT6L 4L3CB 5IMOA 2ENYA 1RUAH 3H3KA 1GZPA 4GAJL 1BBJA 5GRJL 1HHHB 1AQKL 3S4SA 3U6RB 3ULUL 5EULV 2PXYD 4Z77B 5DD6A 3C09B 4PJ5E 3ZO0A 3PWJA 2AABL 3O8XB 2E7LA 5F7KC 3NZ8A 3QCUH 1HKLH 4P9ML 3ECBB 2MJWA 3EYFB 1LO5A 4CJ0A 4WIQA 5LWYH 4PG9B 5EC1A 4G8FB 2R39A 1VGKB 4M7ZB 1AJ7H 5FGBA 4K2UL 3TV3L 2O5ZL 1BFTA 1LDSA 3MLVL 1ED3A 5IB1A 3DX9B 2WZPD 4ZPVA 1DUYB 1IEBA 5SWSE 4D0CB 1D6EA 3P4NB 2V5MA 1LDPL 3V6ZA 4Y4FD 4J3SA 5J4MA 3OJMB 1NCDH 1WT5C 1GGIL 4ONFH 4QHUB 2HRPH 5IVXE 5JW5B 4EUPH 4NQEA 4I3RH 4FQXD 3FHAA 3EFFB 4X6DE 3NCEB 3S3SA 5ACMA 2ZUQC 1IBGL 2ZOKA 4FMFA 3U7WH 4LSQL 4ZG1A 5C6PB 3ULVL 1IGCL 4LOUC 4AIZA 2IC2A 1AO7D 3BD3A 4YHYC 3HPJB 3M8OL 1EO7A 2O5YH 1FC2D 3HB3D 4IMLB 5DO2C 3MRIB 2H3NB 3PXHA 3HKFA 2IBZY 1D7FA 5BZDB 3MNWB 4P2YA 5C86A 3PWPA 2OBGA 4A6YB 3HTLX 3KDMA 3BN9C 2HTLD 1XGQA 4NNXA 5C0DB 2QHRH 1XCTB 1G1YA 1JGDA 3T0EB 3K46A 4XCFH 4ORGB 3IXAA 4CADB 2KL6A 3MPCA 3MV7E 3SKJH 1BFOB 3LEYL 4JAMA 1UCBH 3GMLA 4EXKA 4PJCE 4G6KH 1DN0B 5DUBA 3SCMC 2K9UA 2WLYA 1HYRC 1DE4B 3RTQA 4Y1AE 2AJVL 2IADA 3WFCH 5LBSL 1OAUL 1YYLH 4EDXA 4FQJH 1K4CB 1VHPA 2WIMA 3A6BL 3VXUB 3LN9A 1LILA 1G9MC 4CUCA 4L5FH 2QSTA 5LAXA 1TJGH 3ALPA 1JUFA 1H8NA 5JHDE 4ZTPL 3VG9B 4FTVE 1PKQA 1UVQA 4PUBL 3DMMB 4HHAA 2O5XL 1T5WB 5HJ3B 4U6HA 1MCQA 4NDMB 1I8KA 1I75A 3LMJH 1D6VL 3WIIL 1OVZA 4ZAKC 1CICC 1RK1A 4FG6C 1U36A 1T22B 3QPQC 3IDXH 1MRDH 1NCUA 4ODTH 2ATKA 4LIQE 3SE4C 1LE5A 5F89A 3JTSA 3QXAB 4DVRL 3Q6GL 2NNAA 3CLFL 5D2LA 2DDQL 3FB6B 1FVEB 4GKSB 1C12B 2C1OB 4BFBD 5DEFA 3MV9B 2J8UA 5E00A 4P2QA 4XNXL 3DX7A 2N7AA 3CJJA 3DECA 4CW1A 15C8H 3T2PA 1E4XL 1QLRA 2XKNA 4PRPB 2JCCE 3O6LL 4YBQD 1MFDL 3CFEA 3GIVB 5HVGB 3QEQE 4WI2A 5GQBA 3T2QA 5GRXG 5F6IC 4HD9A 4XWGL 5IEHA 1DSFL 1A6VL 3VWJA 2UZYB 2Y7QA 4X83A 1HH9A 2C4FU 3GMRA 3ZKNC 1GOFA 5I2IA 3SGJC 2P5WB 4HIHA 3ARFA 3OKMA 5FM4A 4M61B 2X4OB 2JJTA 1JYWA 3W9DB 3MLXL 2LU7A 5DTFA 5IVOA 2P5EE 5TE4L 1Z9LA 1XGRB 3O9WD 3HMXH 4NZRH 3MJ9L 3GBMH 4KDTC 2XXMB 5GRUL 4R4FH 1FYTB 2V2WA 4GJTB 1NQBA 5I75C 4Y2OA 3VXPA 1NJ9B 3FQRA 1X4YA 2P1YA 5FM8A 3X14B 4X98B 1DBKH 1QRNE 3GMPB 5E5RB 3SQOL 4MLIA 3SDYL 3K81A 2D9QB 1E6OH 3TYGL 3D9AL 4WEBL 1EUTA 3S96B 1T1YB 2X05A 3P4OA 1ZVHA 1WV7T 5EWIL 3MBED 1MCNA 4MCZB 4OFIA 4UNVA 1WTLA 2QLVB 2UV3A 5KSBE 4JG1L 3GI8L 4PJHE 4TVPH 1UH4A 3V0WH 3LS4H 4X99A 4GKZA 5CJ5A 3UTPD 2NY3D 4JR9H 8CGTA 5GIRA 1OSPH 1EMTH 3P2TA 2ZCKH 3DX6B 4CU7A 4ZTOH 3H3PH 5EUKA 3UZEA 2SEBB 1YMMD 1X4XA 1MIMH 5IW6A 5DJYB 5JLZA 2FX9L 4X4MA 1GSMA 3AY4A 4NZUL 4XWOD 4GOSA 4IBLT 4Z7QE 1SMAA 3LEXA 1GL4B 3QG6A 3HUJF 1MSPA 2P43B 4KZEH 1KGCE 4HLZH 4WI8A 4AEIH 1CDYA 4MWFB 2XWJB 1KLFA 1XZ0A 1YJDH 5T1MB 1FNHA 3LKSA 3MRRA 3QAZB 1YEEL 2VE6B 2JB5H 4I1NB 5MENE 1J05A 3DJ9A 3LQAH 5CKGA 1KCVL 3QXUA 1AY1H 4KI5F 5HDLA 1OB1A 5IESL 4FABL 4CU6A 2YXFA 3LKPB 2DQJH 1WIUA 1P84J 1Q8MA 2EZ0D 2I9TA 4L4TD 4JHWH 4TNVK 3NACH 3X11A 4PJ9A 3DROB 2DJ4A 3P11L 4M7JH 4ONHB 2QTEA 3SJVA 2ITCB 3SKOA 3UTTA 1ACYH 1B3JA 4M93C 4HKBA 3KPSE 4LVHC 5GHWH 1QNZL 3PHSA 1MHCB 2E6QA 3EO9H 4PY7A 1BBDH 4DOHB 4OLZH 2R8SH 1A7OH 4XVTH 3V7AG 1RVFL 2XY2A 5I8OL 2QEJA 5SX4I 4PS4L 5IG7A 1PSKL 4Y5XB 4FFVD 4G3YL 2C3GA 3STBA 4MHHG 1QSEE 3VXME 2EIZB 2VERN 2Y5TB 1N4XH 4H25B 3QBTB 1TCRA 4XZUB 3WJJA 4QRUB 1VPOL 3RVTD 1CTOA 5BV7L 4HC1A 4RNRB 4JFDB 1LO4L 3G6JB 5JUEL 4P5TB 3QXVA 3X12A 1EVTC 4JKKA 3QPXH 3WLWC 5BRZE 3PDOA 2VN4A 2V5SA 5E9DA 1UM4L 3ARDA 2Z93B 2WUBL 5I19L 2P42B 4H1LB 3IU3B 3PL6D 5IFJA 3OL2A 1DEEA 3IAPA 4RFNB 4GW5A 5F1OB 4YGVA 4F7PA 1WITA 4Q0XH 5I1JL 1SM3H 3VXRD 4KKBD 4V1DA 3VFUB 1NUFA 4R96A 3RUGF 1RZ7H 3WN5C 1G7JB 5F70A 1UJ3A 3D18A 4ELME 1AIFB 5ELIA 4N0CC 4JFZH 1MPAL 5EZOH 2QKIA 3IRZA 4RZCB 3QWQB 4LPWA 4RGNB 4S2SA 4KI5D 4X6CA 3ZKXB 4R4BB 3W0WB 4S1QL 2NX5A 5HPOA 2WV3A 1XR9A 3KS0J 5EC2A 4X4XA 5CINH 4YDKL 1K6QH 5DK0A 5F96H 3U0PB 2HG5B 5DD0L 5IMMB 2YA0A 3QQNA 1HDMA 3QB7C 2J6EA 4P4RA 5AZEL 4JFYB 4P4KC 3MLWH 2FHFA 1U6AH 4GS7B 3D2UA 2ZZUT 1JPSL 2GFBB 1X4ZA 4X9FA 1RZ8B 4U3HA 5JW3L 1B0RB 2DWEB 5I1CH 2FD6H 5JPMB 2R0LL 1NCWH 1KFAL 2E27L 2YEZA 2R15A 2I60L 3N85H 4LNVA 3SDCC 1U8QA 4OGAD 4RSVA 3UTQA 3L5IA 1CLYL 4TSBL 3Q5TA 3CD4A 4NYLA 4OB5L 5FHAH 1XIWA 3MCKA 4XBPB 1MFNA 2L0DA 4P2OB 1KNOA 1EEQA 3QJHB 2DI9A 1BZ9B 2HH0H 2IBZX 3ARTA 4G8GD 1E4XI 1TJHH 1NGXB 4OT1L 4R8WL 4RX4A 2A6JA 5F9AC 2BNQB 2YK1H 3ZE2E 5C0JB 2G5BA 1B4RA 4R3SA 3B5TA 4N0YL 1O7SA 4MXQC 4XNQB 2Q20A 3IVKA 1W0VA 4WHCA 5INCB 1QSVA 4MA7L 5IM7B 3BRDA 1VSCA 3BUYB 4AIXA 2IPTL 5IT2H 4QHNA 3QH3B 3PABA 3QUZC 5T1KA 4KH2A 2CDFB 2EEAA 1KEML 3C9NB 4KUCD 5C0IA 2WLZA 4MGXA 3ARBD 4JO1H 1BWMA 5FO9B 3B9KB 1MWAB 1CD9B 3RRQA 2BNRD 5FYKE 2XTJB 5KS9E 4OD2A 5F3HA 2W9EH 2ZG2A 3HI5L 1IGMH 5T5NG 5IUSA 5ILTH 2IPUK 2ZUSA 4XGZB 1JHTB 1MCDA 3T2NH 2V7HB 5J6HB 1CK0H 4OI8A 3RWIB 4PGBA 2ZPKH 2F53B 4XXDA 4OJFH 3Q6FB 4Q2ZA 1JNHA 5IR1A 4YUEH 4UIKL 2J8OA 1X5XA 3S34H 1TENA 1A3QA 4I9WE 1N64L 3L3OB 3BJ91 4FNLH 1VGEL 1Q9OB 1XGPB 3NOIA 3VFMB 5BXFB 2ADGA 3RVXD 5I1AA 2X4RB 5MP6H 3UBXA 1LO0L 4G43B 5B3NA 2E7LC 3VW3H 2FO1A 4FHBD 2R2HB 1JYNA 4XAKE 1P2CA 3NN8B 1CDJA 3TNMB 3VDBA 3F7YA 1JGVH 2FHBA 4EI6B 4MD4A 1OP5H 5DJDA 2GJ6B 3D0LA 4MVBD 5IEKA 2GI7A 1CT8B 2FR4A 4DKEL 3DTXB 2HFEA 3OKNA 4CJ1A 3F7QA 3UBXI 3V5HA 3OF6D 2B1HL 3WYRA 2IWGA 1FE8L 1IFHL 1WEJH 4LMQE 2OTWA 5KANI 4HS8H 1KPRB 3PP4L 4M3KB 4DFIA 4U6XA 4R90H 3PHQA 2Z31B 1I1FB 2CXKA 4F58L 2R1YB 1BFSA 2YRPA 3O3DA 4QT5B 2UWEF 3UC0L 2BOCA 3EFDL 4OF7A 4M6OH 4HGWB 2WIIA 3FQTB 1WZLA 3VFSA 1AR1D 2NY0B 1EZVY 3HCVB 3LQZB 3VD3A 3W82A 4JN1H 4QRRB 2AJSH 1JF5A 4HF5L 2I24N 5JDJA 1A4KB 5HHQB 5HYJB 3ALWA 3QEHA 3UX9B 4Q58C 5DD5H 1U3HB 1CFQA 4XMLH 1JWSB 1HHJB 1YPZA 1E0OB 5IQ7H 3QI9D 2CLVB 5EU7E 4Z95L 1H0DA 1KIUA 3MRDB 2GYSA 4OI9A 5SWZE 1CG9A 2XKSA 4NQSA 1ZGLA 2IGFH 3VRIA 1FQ9C 1EGJL 4HJ0D 4QTIH 4PGDA 1GIGL 1E4KC 2MPAL 2NY5C 4OV6F 1OF2B 4M4RA 1KV3A 4ZS6C 5D7LE 5FB8B 1MFEL 3BP7B 5ERWB 2OQJB 1UM5L 3DHMA 5E1AA 5D8JL 2PYEE 2DF3A 4LNRB 4G6JL 1V3KA 3FO9B 4PGCA 1F4YH 1MFAL 1JZ2A 2PO6A 3VJ6A 4HFWA 4NSKB 1NGYB 2PCPB 2VB5A 4F3FB 2Q8BL 4L9LB 4C58B 1FZMA 1A1OA 1BFVH 1PG7W 3SGKA 1WC7A 2NR6D 5FA4A 5B38A 2PW2A 4KKLC 4ZNCD 2FIRT 3HI6H 2EDXA 3ARQA 3BZ4B 1RZKC 5E2WH 2A9NL 2ZUQB 1VADB 2HTKD 2JKXA 4LCWE 1ZV5A 5EIIA 1NBZB 3O3AA 1JIBA 5F9JA 5C0BE 3HC0A 5ACZB 1RZFH 1EFXA 4H0HB 4G6FD 4UT7L 2PW1A 4Q97A 3GSOB 4L29A 3AU1B 3AS1A 3JV6A 3WL9A 1WWBX 2GY5A 5D7JA 3CDFA 2A74A 5D1XB 4QOKB 5J6GB 1FNSH 4JM2A 3T09A 1EFQA 3WDHA 1QVOB 4KRMB 4MJIE 1YC8A 3GUTA 1FO0L 3TBSB 2ICWJ 4BFEA 3EIFA 1XCQA 2L4OA 3RDTD 3TWCH 3SCMB 4HX1B 5FA3B 1ZE3C 4JO3L 5DI8A 4KQ3H 3EOBA 1OGAE 2CD0A 3VWJC 2EDKA 5J13C 3MGTA 4N8VG 2VTFA 4WUUB 4CN1A 1FL6B 1M71A 3ARFC 5CJBA 1A1NA 3KLSA 5DSCB 1HQ4A 2DQCL 1YEHL 2YD5A 5F1NB 5ENWA 1FZKB 5TQ0L 1TTGA 1YECH 2AK4D 1V3JA 4KJWD 1YNKH 5E7FA 5JMOC 1QBBA 1KPVA 4DKFH 5CSBA 1ZTXL 3TNNA 5EU4B 2Q7YB 4BH8B 4ZAKB 2GEEA 1CICB 4ETYA 3FFCE 4RDQG 1QLFB 1LE9B 1MI5E 5ISZB 2ZNXA 4R2GC 5DRXA 1K85A 4RISL 4JFPA 2OSLA 4RAVA 4G9FB 1Q94A 3QNYB 5I66A 2VXVL 3FT2A 5AUMB 3EJYC 5AAMA 1A6AB 3PGCB 3GHEH 1GXEA 2X2YA 4UV4L 3AM8A 5KW9H 1WAAF 3LS5L 2GTWA 3HC3H 1BZ7B 3F7VA 3IB4A 2XG5A 1DANT 3EBAA 1IQWL 3RA7H 1MY5A 2RFXB 2HFTA 1MLBA 1R24B 1T2XA 5HGDA 5HI4C 5C0GA 1JNLL 2WWMC 4TSAL 4Z7VF 5CD5C 3OG6B 1X6NA 2I9LB 4A2MA 3CSPA 4PJEF 4Y19A 4EQ3A 1REIA 5F6IB 4OZIE 4LBEA 4RDQF 2X4QB 4M6ML 2R2EB 4K71C 4KVCL 1A7QL 1RIVL 2Z91A 1I1CA 4G8EA 1G7HB 5I18L 4Q9BA 3WV0A 1NAML 2BFVH 1DCLA 3BQUA 3CCHA 1I9IL 4L3EB 1C16A 4TTGA 2J2ZA 1FG2A 3VXOA 4GKNB 4LGRB 3ZL4L 2J88H 1J88A 5AYQA 1AQDA 4YHLH 3S35L 3QDAA 1CWVA 4O2EA 1SYVB 4FXGA 3C2AH 3WSQH 5C0RH 1S3KH 3VG0L 4P46D 4MJ5B 43C9B 3VI4F 4EIGB 1H9VA 4WO4D 1ZSDB 3GJEA 4Z7NE 2V17L 5I75B 3DVFA 2KQNA 4PJ9C 4ZFOB 3IS1X 4J8RA 1EA9C 1T3FA 3LKNB 5DEGB 1S7QB 5DD1H 4AG4L 1MVFA 3RGVD 4NQCB 3TP4A 3WFDL 1G7QA 3M1BA 1FNEA 4OM0L 1N5YH 4L8DB 1A9EA 1ODAA 2WINA 5C6TH 4UNTA 4Z76B 4YXLH 4W68A 5GRVK 3C6LA 1CGYA 2ATPB 3KWWA 3QIWD 5TGBB 4NHCH 3H9HB 2R2CA 4BSWA 1OTUC 3PQYD 4PJDF 4C56E 4YBLC 5EUOB 1MF2H 3FQNA 3IF1B 3DIFB 3NIFE 3TBVA 2YPLE 4OZHE 4NKOA 3GI9H 5F3BA 1MAMH 2HT4D 1Z5LA 3K80A 1F2XK 1KLGB 3ULVC 4NQUA 4UQ3B 3REVA 1YEKH 3QDME 1PX3A 4JPKL 3Q2CA 2ZCHL 2X1PA 3CUPA 4K7FA 4JRXE 2OR9H 3DYPA 3DUSA 4RBPK 1QFUH 1U92B 4MXVE 1B88A 2D0FA 2ESVA 5DWUH 4I4WB 5KVEL 1A4JA 1CFNA 4RFOH 3MXWH 3CDGA 4X7FC 4PREB 1N5AA 1XMWA 4TVPE 3MQIA 4IRZL 4LSRH 3HZVA 1GAFH 4QHMB 4N8CL 2EIEA 1SJEA 3ARDC 1BIIB 2AEWA 1AGFB 5E6ZA 4AEFA 3L1OL 4NT6A 4O9HL 5D7IE 4OAWA 4GRWB 4N1HB 1A1MB 4NWUH 5DRZA 4JFQA 4JPIA 5DC4B 4OF6A 3QUKA 4H1LH 3MLPA 2CDGA 5JORB 1DBBL 2H9GB 3DVGA 4ONGL 1IGIH 5T1LA 1UJ3C 2ORBL 4LCIH 4PV8A 3QIBA 3VXSA 3GDBA 4LVHB 4LDOB 12E8H 1A6UL 3OGCB 2MMXA 3BVNB 2MKWA 2E7MA 4PRHB 2APTA 1ZXQA 4JHAH 4XAWL 4XRCA 1G6RB 4L4VB 3BEWA 5DJ0A 1J86A 5EU3A 2Q1EA 4U1SB 5GZNC 4KJQD 2ARJB 4LOUD 2XG4A 3WS6A 1A7BA 4GG6A 3MV8D 2O61B 1RAMA 1GGBH 4XBGB 1DBJL 1NC4A 1RZJL 3BT2H 1R3JB 3C8KA 3CIQA 1WF5A 1RZGB 2FIKA 2YKLL 2FJGB 2EDTA 2A6DA 3IJSA 2R2BB 3DYOA 1TCMA 1QEWB 3D3VA 1IAKB 3UO1L 4UTAH 2VO5A 3VFTA 4LPUA 3NIGF 1N26A 1DQQA 1ZA6A 4MSWB 5MHSD 1B0WA 1NLDH 3WFBL 1ZVYA 1JFQL 4MDJB 5CZKA 4XNMB 2O93L 3L6FA 1T0NA 1OQOA 3HI1A 5GS1A 1EZVX 1V05A 1FO0A 4LRNL 3ILQC 3KXFB 1XIWC 2OJEA 3V4UH 2YPVH 4ODWB 1HEZA 5C09B 2YMXH 5K9KA 4CVXA 1T7VA 4HUXB 4QXGL 5CEZL 1I3RA 5KOVC 1IC1A 2CLZA 5HDQH 5CZVH 4R4NC 5CJ8A 1NFDE 3MLSH 1LNUB 3W9EB 1BAFL 3B8SA 3IFLL 1BOGB 5GISL 3DWTA 3CVHH 3CK0L 3RZCB 4OFPA 3U46A 1M05B 2F58H 1KJMB 1T03L 2DQTH 2BNUA 1KB5H 1N0XH 4J6RH 1QP1A 2QSCH 1CZ8H 4LASL 5M94B 3NCFB 4Z9KB 1C5BL 4XMKH 5EZJB 5HHOD 3T77B 2VIRA 1HSBB 3WD5H 3FOMB 4P4KB 4TUKH 4H0GA 5EBLB 3GGWB 3QCVL 2X09A 2EC8A 3WNNA 2Z35A 1ZK9A 3WFEH 2OZ4H 3ARPA 4FQPA 4MNQA 4WW2F 3BISA 1GC1L 2DBLL 2IBBA 5DJZB 3KYAA 4Y16D 4OFDA 3V6FA 5HTSA 2A77H 1CXHA 2NTFB 3BKMH 3GMNB 1JF1B 2DRUA 2VRAA 5GS0L 3SDCB 5CEXB 4LF3B 5D6DA 5HD8D 3D85A 1KPUA 1BMGA 1I4FA 4XPHL 4K7PL 4JPVH 5FUCC 1FH5H 3L5WB 3WIFA 4NM8H 5DQDH 1SYSA 3ZKND 4X7SH 1NDMA 1IGFL 2GUOA 5DHVH 4C59B 4YDLC 1CF8L 1GZQA 4DZ8A 3MRHB 5I74C 4LCUA 3BWAA 1BPVA 1N2RA 5I1HL 1G9EA 1S9VB 1Z3GL 4IMKA 2RB8A 2KPNA 3QO1A 4YDJA 3MACL 4PGEA 4ODUB 3G5ZB 5L9DL 4HKJA 1DVFA 2GJZA 4K23L 5E08H 3WKNA 3MMEB 3ZDZF 2NLJA 1A6ZA 4MQTB 4OQTL 4Z5RB 4W4OA 1UGNA 4JRYA 2ZJSL 5IOPB 1U8OA 3LOWA 2PKDA 2YZ8A 3QDHA 5DA0B 1A6PA 1ZKAA 2AEPH 3QUZB 4JJHA 5CBAB 1SEBA 4PRBB 3FTGA 1K5NA 3CC5B 3QDGA 3KYKH 3GSWB 2VQ1A 3SE8L 4LSDA 3E3QE 5E8DL 4DGYH 2OL3A 4ZUVB 3ZKSD 3PWNB 2NW3B 1QSZA 1SBSL 3DX8B 1R5VB 5D70L 4XVJH 2LTQC 3AXLA 3KLHC 5EFIA 2C3WA 3CX2A 4F57L 3MO1A 4ZUSB 1JZ5A 3H9SD 4GLRI 5DDHB 1FAIH 4MXWL 3GIZH 2HT3D 4LHUA 4PRAA 4OGXH 2CJUL 5D72L 2DIAA 3RPIB 1MJUL 5ADOH 1JGUH 1YEDB 2YRZA 1QR1A 4PJIF 1JPFA 4PG2A 3C5ZD 4K94L 1U8PB 5IMOB 4OIIH 1GZPB 1BBJB 4ZNEA 5BV7C 1ND0B 4Z7UF 3S4SB 1ZA3A 1KTLA 4XP6H 5DD6B 4UUJA 3VD4A 1P4BL 1MRCH 2J4WL 1P53A 3O4LE 1LVEA 3IU4H 1QFWM 4MAUH 4HH9B 2CIIB 3IS0X 5C07A 4KV5F 1NGQH 4QKXB 2CLRA 5EC1B 4MD0A 3MRLA 5GJTL 4ZXBC 1NCAL 3V4PL 1OARL 2PO6C 2G2RA 4M1DL 5L2KD 4HW6A 1P7KA 3HE6A 3WS3A 1EH9A 1IEBB 1BM3L 3P9WB 2K3TA 4QRPD 1WFTA 1YMME 4HZLA 3EYOA 1N8ZB 3SDAA 3V6ZB 3SGKC 1KJ2H 2RCSL 4EDWL 4TNWK 4G6AD 2P46B 4IRSA 2QADC 1MQ8A 4P59H 4D0BB 4NQEB 4JVWA 5K9OA 3J7HA 4E41B 5IW1B 5GS3A 2ED8A 4ODHL 4IIQA 5F88A 1F8TH 1NCBH 3DXAD 3LHPH 2OR7A 1CLZH 1T7YA 1BQHA 2JJUA 3KAAA 5ADPL 3HRZA 2HJFA 4Y2DD 4CNIA 5C9JA 3CDCA 4MJ6A 2A83A 4IOIA 1N59A 1JNJA 1OLLA 5CEYB 5CD3B 5GRYA 1OAQL 3PWPB 5CHNA 2X9YA 4AQ1B 3STZA 5CGYC 4JFEB 2P8MB 1TZHB 5KVDH 3LRSA 4L4TE 5D7JC 5MEPA 4G7VL 1E6JL 4JM2C 4U49A 4JDTL 4PTUA 3IXAB 4XPGH 2EH7H 4MMXC 4JVUA 3DURA 2GKIA 5FK9B 4V2CB 2BVUA 2DD8L 1KJ3L 2OMBA 1OM3L 4IEFB 3WLWD 1IC4L 5IB2A 2B0SH 4KMTL 3MA9H 4MX7A 1E4WH 4OCXH 3HZMB 3L3IA 4NBXB 4RRPG 4HK3N 5A3IC 5KBNC 4UU9A 1KENL 5FYJD 3G6AA 3EHBC 3G6DH 1JPTL 3B2VH 5KAQG 1MCKA 2WANA 5CSZB 5CILL 2NY4C 1TZGH 3RWCB 4GH7B 4KI1A 1UVQB 2JELL 4HHAB 3HPLA 2DIJA 2BRRL 4JDZA 1EEUA 2Y5EA 3WLBB 1J9CT 2FO4A 1CGSH 5IBLC 2WW8A 1MFBL 1U2CA 4PB0H 3QQ3A 3IGAB 3MRNB 4HKZB 3I3DA 5F9OH 4MB3A 4HWUA 5IB3A 2ATKB 2ZUYA 1Z0NA 1LE5B 3RNQB 2ITDA 2NNAB 2ZG3A 1JV5B 5D2LB 3CH8A 5SV3A 5T1DL 2V6HA 4NJAH 3MA7A 1F5WA 3AM8C 2Y07L 5JOPE 5H94B 4LPXA 4J3VA 3VXUE 5KAQF 2JK5B 1S9XA 5HGAA 4GQPH 5DEFB 5FCUH 1DBAL 2J8UB 3HUJE 3VXRE 3DX7B 1T04A 2BVOB 1TDQA 5DFVC 4CW1B 5C08A 3G08A 3NFSH 1W72H 4M1GH 3TT1H 1JWMB 4AQOA 3W81A 3CFEB 4UINL 4AEHH 2AJ3B 1FCCA 1M4KA 3CMOL 3AROA 1YEJL 3WXVL 3WDIA 5L7XL 3B6SB 3VWJB 2ZKHH 3TPKA 3BKJH 4KI5E 5J13B 1HH9B 3HFMH 4PJAA 2XIDA 5C7XH 4Z78A 1F6FB 4PR5B 2WQRA 4HIHB 2EO1A 3ARFB 1J0ZA 4WI6A 2AJUH 3BQUC 2ADJA 3FB8B 1HXYB 3C60D 5DS8B 2B2XL 4F7CB 4OLVL 1K4DB 1A9BA 4ODXB 4YHKL 4WTZG 4ZFFB 2EC9U 3S36L 1DP0A 5B4MD 3NCYP 2W38A 3E6FB 3MRPA 3E8UL 3MOBL 3BPNC 3NVQA 5BW7A 4OQTA 2BY1A 1Z9OA 4TULH 1UKTA 4OZGA 1R3IL 5E5MB 3LB6D 5BJTA 1CFVH 3GSNH 4OTXH 3UJIH 4R2GB 4NQDD 3QXTA 1PW3A 5A43C 4Q9RL 1YN7A 1G7PB 1LO3H 4MB4A 3L7FA 3C6LC 1DJSA 2EDHA 1KBGH 3UTSA 3MXVL 5EO0A 1ZHNB 1HOCA 3PIQB 1NC2D 3LEVL 4Y4KA 3MCLL 2P5WE 3W39B 2C7UA 1P7QD 4G8GE 4X99B 1F6AB 3MYJB 5D1ZA 4JG0L 5CBEA 4XPAH 3MLUL 5DUPH 5DZLA 3PE9A 1T5XA 2A1WL 1F02I 1TVBA 4QXUH 1D5IH 1C08A 4LIQL 4O4YL 2YD7A 4YJZL 1XR8A 3GM0A 5IW6B 5JLZB 4U1MB 3VGHA 5DFTA 1GRWA 2VDOH 3CPLA 1FYTE 4P48A 5CJXC 1JZ6A 4I2XE 4JKWA 3LEXB 4PJBA 2DM4A 5F1KC 3QEGH 3I3BA 2F5AL 4K71B 1XZ0B 2H1PL 4J23A 3MLZL 3MR9A 3ZE0F 4J3WA 3I75A 3LKSB 3MRRB 4HUNB 4E9LA 2BY3A 4OLWH 3OJDB 4DN4L 4QHLB 5CJQH 4RGOL 3O41B 3RUGE 2BNRE 4FQQB 1CDBA 1F4WH 3DRTA 3I9GH 5C0AB 1BGXH 4KZDH 4M6AA 2VDRL 3F8UB 2Z8RA 4LEXL 4PJ7E 2I9TB 1LK3L 3X11B 4MNHA 4N0UA 5DT1L 4PJ9B 4NUJB 4QO1A 1RMFL 3PJSA 4WWKC 3UAJD 3FMGL 4GRWH 4MNGA 4U1KA 5EOCJ 3ZHKA 4EQ2A 2UZXB 2YC1B 3QIBC 3SKOB 3UTTB 3CFIC 2MOVA 4U6YB 1ZLUK 4JZJB 3SKNA 1F3DJ 3JWDH 4ZSOA 3EO1A 4YHMH 4J3OC 1A3RH 4RFEA 2D31B 1J1PH 1CR9L 2YUWA 4YBLB 2VDKH 3WS6C 1JYVA 1CDCA 1P4IL 3WUZA 3NZHH 2GAZA 1TVHB 2DLFL 4DUXA 2W91A 4LQ1A 4APQC 4XCYA 4HWZA 4NKDA 5E99H 4NO5B 4DN3L 5D5MB 2I5YH 1H8OA 1SQ2N 3IFOA 3PDGA 1I3GL 4P57A 5GXBB 2IFFH 1FNAA 4GW4A 2RBLA 3O0RL 5IF0B 1PG7X 4ZS6D 1AHWA 5GS1C 3RTQD 3X12B 3IJYA 3BUTA 4MQXC 5E9DB 3MLTA 4HFUL 3V2AR 3TO2A 1MFCL 2JIXB 3SKUD 4QRSA 4IDJH 4DQOH 3IFPA 3P0YL 1SY6L 3EZ8A 5IFJB 3HAEB 2VISA 2IQ9L 4B7LA 4BSVA 3UPRA 4GW5B 1IAOA 4LSUL 5BOZG 1PY9A 4GRLC 1MAKA 4V1DB 1WQVT 4NRZA 4W81A 4R96B 1JTTA 4F7TA 2VLKA 2P45B 4NHUA 1OGTB 5FYLD 5FYJH 1WBZB 1M7XA 4JFXA 1MRFH 4Z7WA 5DJAA 3QWOA 2DS4A 1U8HB 1XH3A 3H42H 5I1EH 1IC7H 5L6YL 4JFDE 4LVOC 4U1HA 3QQ4A 3G5YA 2NX5B 5DK0B 4QHKI 1DQMH 3WKML 1HDMB 1A6TB 2DQDH 2UZIH 4BUGA 4P4RB 2CK0H 1ORSA 1XF4A 1PQZB 3N9GH 1OTTC 4PRIB 3IFNH 2LE9A 4D9LL 3QO0A 4Z8FL 3I2CH 3OZ9H 3EO0B 4P2QD 4M8QB 2BVPA 5FUOH 3C08L 2W9DH 5CEZD 2DQEL 1G0YR 3R8QA 2YEZB 4FQIH 2Y25A 32C2B 4Y5YC 4OCSH 2JB6A 3L3DA 3UTQB 3MJ6A 2FECL 2VDLH 2XZCH 4JLRA 1HINH 4KTYA 4NYLB 4WCYL 2AERT 1XIWB 3F7RA 5JZ7C 3CFCL 4XP4H 2VLJB 4NUGH 4NO0D 4D0DA 4HLJA 1ZLSL 4NO3A 1UZ6F 1CXEA 1IAII 2VL5A 3QHTC 4PJGA 3AMKA 1OAZL 4IMKC 5IV2B 1LP9F 3QA3B 2HRLA 4H0IA 2A6JB 2HKFL 4ZFGL 2G5BB 4EBQH 1DVFC 1DQLH 1FGNH 4TUJB 4GAYB 3N1PC 3RWHA 3EZJB 3MV7A 3CFKA 4HUWA 3TM6A 5KVGL 1U95B 2GHWB 3IDUA 1PX4A 4GQ9L 4W4OC 2UWEE 5JW4M 4LCCA 4YK4C 3R1GL 1NANI 5F71A 1JWUA 5CZXC 4L3CA 3HS0B 4QHNB 4XP5H 5T1KB 1OPGH 3OAZK 4HDIA 5HHMD 5C0IB 3VFNB 3U6RA 4Z77A 4X5LA 1ZANH 4M6NL 5I6XC 3O8XA 3FONB 4HBCL 2X1WL 3NAAH 3QUXA 1QKZL 2FBJL 2XRAL 2A2QT 4OD2B 2R29H 5BQ7B 4LSTH 1MCOH 4PG9A 5D2NA 1EV2E 2ID5A 4G8FA 4RA0C 1AXTH 1VGKA 2BSRB 5BCAA 4TPRL 3N1MC 5HI4D 5IHUH 5D1QB 2WWMD 3DX9A 1RPQA 3RL2B 5I8KH 3GNMH 4PJ8D 1YEGH 2R9HD 2XA8H 1DDHB 5C2BH 1JRHL 2AK4E 4XXDB 3EAKA 3O2DH 1EAJA 4F33B 3MBXL 4I8DA 4Q2ZB 5BS0A 5TDOB 5H8DA 2R4RH 4QHUA 5JW5A 1X44A 5HI3C 4GO6B 3EFFA 5EOCL 4YDLB 5I74B 1V7NH 4BZ1H 1MNUH 4D3CH 1XGUB 3T1WA 2MFNA 1R0AL 4XP1H 1DLHB 2VH5L 2XN9D 1MHHB 4HWEH 1EEYA 1UA6L 3O6ML 3OXRB 1H3UA 3NGBB 3JWNC 6CGTA 5BZDA 1JHLL 1P2CB 2Z8SA 3MYZA 1G7MB 3MNWA 2NMSA 4A6YA 1ORQA 1F00I 4S10A 4DUVA 1W0YT 5IEKB 2FR4B 4KDWA 1XCTA 3OKNB 4YZFF 2Z8WC 3HE6C 3T0EA 4XNZC 1AGCB 4ORGA 5HVHC 4CADA 4IM8A 5HHNB 1AXIB 4P3CL 1RV6X 2OTWB 3SJVD 1BFOA 4L8SA 2W65B 5GGRA 4GXUM 2NPLX 4U6XB 3PHQB 3BKCH 3TO4C 3O3DB 4KTEL 3LQMA 3OAUH 4JKPL 3X3FH 1WBYB 3HNVH 4S1SH 4TUOA 4G8IB 3MV01 3VFSB 1DQDL 1OTUD 2AJYH 2P48B 2DQGL 4JKLA 3RWGA 4AK1A 1K4CA 4IIQC 5E2UH 2LTQB 4FQHA 4K3EL 3O2WH 3IETA 3UMTA 3O3UN 1I1AD 4X4YB 4XBEH 4HCRL 1SJXA 5C0CD 1WFNA 1RZJC 4GMTH 5E8EB 5IMKA 3DMMA 2DMBA 5CJOH 1T5WA 1JNNH 5HJ3A 2FZ3A 1FHGA 3JWOC 1CG9B 5FYKL 4NDMA 4U31A 3QNXA 1MCHA 3VRIB 4LLWA 1T89A 4K3JH 4KQ4L 4OLUH 3QDJA 2HJLA 2LVEA 4YPGB 2W92A 4PGDB 5DZNA 3UTOA 5BV7B 2F5BL 3GMQB 5CFHA 3VRJA 3ALXA 1NUNB 1PGRB 4HAFA 2BCKB 3QHFL 3ARDD 4OQ1A 3WFHB 3QXAA 3FB6A 1FVEA 3T3ME 2E9BA 3ZDYE 2UUDH 2NY5H 5IVNA 3PQYE 2C1OA 3INUL 5ANMB 1QR4A 4ZXBB 3ZYJA 4PGCB 4U6TA 5EA0H 4IHOA 1SY6A 3MV9A 4HFWB 4YHOL 1IGYB 3EJZD 3I85A 5HYSB 4P99A 1R5IA 4PLKD 3UBXG 2VXQL 3A6CL 3PP3K 4PRPA 2BXYA 1WC7B 4GW1B 3GIVA 3V0AC 5B38B 3L9RA 4U1LA 1Z6JT 4ODVL 3ZSSA 2PW2B 5I76B 2XOTA 1WAAE 3D6GA 4GRMB 5FYLH 2MHAA 1EO8L 5DQJB 5F9JB 1FNGB 3HC0B 4NBZB 4M61A 1RULH 2B4CC 1CDUA 3ARYA 4WFHD 2X4OA 5E2TL 2PW1B 4R9HA 3QUML 3W9DA 1ADQL 5KG9B 3TBWB 3QZWB 5M7QA 3WL9B 2V5TA 4Z7VE 4O02H 1O7VA 1XGRA 4HS6A 4KVNL 4PJEE 1HYSD 2FJHA 3HNTL 5E70A 2A74B 2XWBA 1A22B 5E1HB 3SGEH 4JM2B 4Q9QL 4XB7A 3OV6A 4XVSH 4S1DD 1NJ9A 3MRQB 4K3GA 3P77A 2ILLA 4S1RH 4X98A 4F80A 3GMPA 4KK6D 5GGUB 5F9WC 3KLDA 2RAMA 5J1TC 2EH8H 2I07B 5IFAL 1L7TL 3S96A 1T1YA 2OM5A 4MJ4A 3ZHDA 3TEUA 3Q1SL 3UPAA 1T66C 1TJIL 1FG9C 4MCZA 3PWVB 2CDEB 2NQCA 4RIRA 3G9AB 1M71B 1WLHA 3O3BB 3SDXE 4RX4D 4R4ND 5JO5A 1A1NB 3MV8E 2YWYA 1HQ4B 1QBAA 4OF5A 2NY4B 4NKIL 3WIHA 2SEBA 5SWSD 4B7IA 3S5LG 1FC1A 1ROWA 5DJYA 4YXHL 5LXGL 2YD1A 1QD0A 4QOKE 2DQUH 3TNNB 5BW7C 3FQWA 5FM5M 1YPZF 2NCMA 1IM9D 2X89A 4RMVA 3CU7A 4MWFA 3BN3B 4PJDE 2OSLB 5T1MA 4U05A 1Q94B 1EJ6A 3T0XA 3V5KB 3U0WH 3FT2B 1H5BC 4JM4H 4GSDH 1GHFH 1UWGH 7FABH 1S7TB 3TCLA 1HKFA 1IQDB 5I8EB 1RUAL 2PF6A 5E8NB 3HNSH 4Y4KC 3W5NA 4JQVA 5IBUB 2EDYA 3LKPA 1AXSA 5D1ZC 3QCUL 2NYYC 1HKLL 2R69H 5E94A 4HKXA 1MLBB 4L1DA 5HGDB 1QSFD 1G7LB 5LWYL 2YZ1A 5T3ZD 5JQ6H 4FMKA 3DROA 1XFPA 1AJ7L 3AB0C 4OD1H 2ITCA 3UDWA 3FN3A 3U0TA 5GS2H 4DVBB 1FORH 1U91B 3RP1A 1MHCA 2NY1C 1QBMH 2PR4H 4JDVA 1J1OH 3F6IA 4G8EB 1NCDL 4L9DA 2HRPL 3BQUB 3CCHB 5LKNA 4I3RL 5HHOE 5A16A 1FG2B 5DQ9A 3H9SB 1JRHI 4Y5XA 1IEAB 5JNYA 5F7FA 4WGVB 3U7WL 5M95B 5IHBA 8FABB 4O2EB 4FXGB 4F9PA 4GAJH 1KOAA 2EIZA 4YHNB 1ZT1B 2V2XA 4QF1A 1EJOH 3H0TA 1AQKH 2O5YL 2WM0A 3BPNB 4CDGC 4XZUA 3V0VB 1A7NH 4QRUA 4LFHG 3S6CA 4EI5C 1I9EA 3SQBA 5FDWA 1T3FB 2J3SA 1EHLH 4B5EA 1CU4H 3M1BB 1FNEB 3G6JA 1A9EB 2QHRL 4P5TA 4XCFL 4XXCC 2O5ZH 1UWEH 3C6LB 4Z7QF 3SKJL 5FGSA 1UCBL 3AC0A 4BSWB 2Q8AL 1IJ9A 4G6KL 3KLHD 3IU3A 4R26H 1KTKE 2NY2C 3FQNB 3NIGE 4YDVB 4YHZH 5AEAA 3WFCL 1YYLL 4FQJL 3L7EB 3O45B 3REVB 2AV1B 1G7JA 1X5ZA 4L5FL 1TJGL 3QEQD 3ULVH 2ESVB 4I3SL 4G6MH 2DAVA 4Z0BH 1BZQK 4RZCA 2PTTB 1A4JB 4NN6C 4ESKA 2VQTA 5F8QC 3W0WA 1N5AB 4D94A 1DBMH 4U6VL 1AHWC 1N6UA 2DLHA 3LMJL 1OCWH 3U0PA 5IMMA 4HC1H 3IDXL 4JFYA 4D8PB 1MRDL 4CN6A 4M5ZL 2VZVA 4ODTL 4NT6B 1F3JB 1V5JA 5DJXA 4LEOB 2GFBA 2LU4A 1FV1B 4OAWB 4YFDB 2PO6D 2ZUVA 5DVOA 1RZ8A 3RY5A 3MUZ1 5HBBA 5DRZB 1ZOXA 1T0PB 3QUKB 5ESAA 3S37H 4WWKB 2XKUA 5EOTA 3DVGB 5T1LB 4LLVA 3PNWA 3BD4A 1S5IH 4PV8B 3QIBB 4HUMB 2QADD 3CVIH 15C8L 4PJXB 1IKNC 3QRFM 2EE6A 2KQMA 2R23B 3BEWB 4P2OA 1JMZA 1S9WB 2AQ1A 4DFHA 3LH2H 5JHLL 1EFXD 2O5XH 4GG6B 1SBBA 4PJIB 3BWUC 1I7TA 3DV6B 3TH4T 1J8HB 2BNQA 1KCUH 3EDFA 4APQB 2FIKB 1KIQA 4OGZA 4KTDH 3IJSB 1JJUA 4GRWE 2IAMA 3EW3B 4XNQA 3BP4B 5D7JD 5INCA 2J6EH 3VFTB 3FCTB 2VQUA 1DQQB 5IM7A 5L2KE 2QQKL 1KGCD 4WEUD 3HMXL 3QFJB 4NZRL 5GGQH 1F11A 3K4DA 4ALAH 5FHBH 3IDIA 5IFHH 2X41A 4JEGB 5KJRL 1G1CA 3HI1B 4X9HA 5GS1B 1I8IB 4LP4A 4P23D 1AC0A 4PJFA 1FO0B 4PRHE 4X7TB 1DBKL 5FO9A 4L4VE 1MWAA 3ZDZE 1HEZB 1E6OL 2KUTA 4CVXB 3AS0A 4LFHD 4MJ2A 3DXAE 3BDXA 3SOBH 2EICA 4ELKB 2MNUA 4GRLB 1FL3A 3P9LB 4XWGH 4XT1C 4TVPL 1DSFH 4PP2B 4XGZA 5DJ2B 5J6HA 3V0WL 4OCMC 3G5VB 3LS4L 5J1SC 3VGEA 3VD9A 4JR9L 4NQXA 3U46B 3DGCR 1OSPL 1EMTL 2F53A 2ZCKL 4ZTOL 3KPSD 3AUVA 3H3PL 1LD9B 4LCCC 2HVKB 2X70B 1F4AA 1MIML 2VLRB 5D7SH 5GGTA 4OF8A 3SE9H 3MLXH 2XZZA 4BYHA 5KN5B 2QSVA 5A2JH 5LJYH 3L3OA 2Q6WB 2BSTA 4KZEL 2QQNH 3LPWA 4R7NA 1XGPA 1Q9OA 4AEIL 1KC5H 2VIRB 5HDBE 3C09C 3KPLB 3MRCB 5BXFA 4G43A 1HK6A 3KJ6H 3QUXC 3IYLW 1QSED 3Q5YA 2JB5L 2Z35B 4WDIA 4U33A 4WRLA 5D2NC 5FYJE 2M2DA 3LQAL 3TYGH 2GJ6A 5DFVD 1AY1L 1ZWIA 3OR6B 4OCRH 1CT8A 4MA3B 1WZ1H 3DTXA 5EWIH 2WBJC 2NXZD 2DQJL 2R0ZH 1XGYH 4Y5YB 2P47B 4Z7UE 3V79C 4J2XA 3D85B 4JHWL 3T4YA 1CVRA 3NACL 4Y19D 4KK9D 2Z31A 1I1FA 4M43L 3WIFB 4M7JL 5T3ZH 3TJEH 1V3MA 1S7VA 3FQTA 2YN5A 2HJKB 4KV5E 1GZQB 4DZ8B 1ACYL 3LQZA 2G75A 3BWAB 5GHWL 1N2RB 2ADFH 3Q0HA 2VWEC 4QRRA 5JW4R 1K3ZA 2FX9H 1A4KA 1MQKH 5BVJB 3V4VL 2CKBH 5HHQA 3EO9L 2DKUA 4YDJB 5HYJA 1BBDL 4NZUH 4OLZL 2R8SL 1A7OL 2ZUWA 5EZIH 1NAMB 3T3PF 1X5LA 4EUPA 1DVFB 5ESVB 2GJZB 4XVTL 3AREB 1OAYH 1ZHKB 3BP6B 5E8PA 4URTB 5E95B 5DVLA 3IXTA 4JRYB 5HVFB 4YK4B 3RQ3A 3KPQB 1BJ1H 2W07A 1WFOA 5TF1H 4OIAA 1N4XL 2NZ9C 2LABA 4L8SC 4JFFB 3FTGB 3F12B 1PAMA 4CMMA 5IWLA 3QDGB 5JDSB 1P84K 5I6XB 2N1KA 3C5JB 3TZVA 5FB8A 2YHGA 3BP7A 2MQ0A 1SJHB 3D39B 2D0GA 3QPXL 4GBXA 4LNRA 5EFIB 1OL0A 2A9MH 4PIRF 5I9QB 4NSKA 2PCPA 4P2RB 3SE3A 4L9LA 4D9RE 3FFCA 5K9QG 4WU7A 4PRAB 4LHUB 5DLMH 4Q0XL 1SM3L 5J3HC 2APXA 3TT3H 5HDOA 3ZE1F 3DSFH 5I8OH 1QR1B 2V5RA 3K4ZA 5EU6B 3KR3H 5B8CA 4KHTH 1RZ7L 1CS6A 3BZ4A 2DB8A 2DN7A 4PY8J 4JFZL 1B2WH 2DOCA 4NQDE 2UYLA 4XC1H 4Y5VA 1KTLB 1T1WA 2F54A 1W8NA 3VU2A 5EB9A 1FN4B 5ACZA 3AAZB 4O2FB 4QWWD 3TBYB 2OTPA 3GSOA 1HILA 1J7VR 3AU1A 2HFFB 1C1EH 5CINL 5F96L 1K6QL 5C07B 2BDNH 3KYNA 4U1NA 4NWTH 2HT2C 3UJJH 5JXEA 3MLWL 1U6AL 5D1XA 5J6GA 2FEEL 3HE6B 1KCRH 1KN2L 4YC2C 1A5FH 1UM4H 5HVHB 3HG1A 1QFWH 4HZLB 3EYOB 2A73B 3F65A 1BD2B 3LZFL 3VXSD 1MLCB 3GHBL 5F6HI 3OJ2C 5I1CL 2FD6L 3TO4B 3WFZA 1NCWL 1HNGA 4BJLA 3N85L 4PB9H 1J8KA 1DANU 5FYKD 4WUUA 3VD5A 1OAKH 5I30H 4XHJC 2NW2B 4FFWD 4QGTA 2ICWB 5FHAL 3V52H 1BQHB 1NC4D 4MJ6B 2R1XA 5DSCA 3LDBC 1X5KA 3HZYB 2FH6A 2HH0L 4ZUWB 2Y6SC 3D3VD 5CHNB 1FZKA 5JIHA 3EJJX 1YY8B 4LGSB 4O5LL 4YDKH 3KPRB 4NZTH 5EU4A 4PTUB 4BH8A 1ERNA 4ZAKA 2F8XC 3V95A 3DURB 1QLFA 5AZ2H 1LE9A 2KBGA 1FJ1B 2P8LB 4LHUG 4NO2B 4G9FA 1UKQA 5IB2B 4MQXD 2CQVA 5AUMA 4MX7B 1JZ3A 4KKNA 5IT2L 1A47A 1U93B 4LLQB 5KVFH 3P4LA 3PGCA 4WV1B 3JSSA 4AL8H 3QDMA 3D69B 4UU9B 4POUB 4JO1L 3G6AB 5IROA 3F5WB 3TC9A 4BSJA 2LV4A 1B4JH 2RFXA 1MHPL 4JZNB 1INDH 1U0QA 4OB5H 1R24A 1KJVA 2ED7A 4RMTA 2W9EL 1JTOA 3PWPE 4MCYB 3DLQR 1RZIA 1IGML 1Q1JH 1G9NL 4HWBL 5ILTL 4JREB 4PP1C 2I9LA 4JDZB 3CSBA 4ZMAT 1Z2KA 3T2NL 4OFKA 1QRKA 2VMFA 1CK0L 2X4QA 4N0RA 3WUWB 2R2EA 4X80H 2ZPKL 1YMHA 1R3KB 3O6FB 2APBA 1G7HA 3SGJA 2BK8A 2WMPA 3TA3C 2R56H 1VFOA 4YUEL 4XP9H 4L3EA 1NUGA 4GKNA 3S34L 2VITB 3MA7B 4L4JA 5EIVA 1D5BB 4FRWA 1SYVA 5IP4A 1S9XB 4MNQD 4E5XB 4XVUD 1V8HA 1Y6NR 5MP6L 5CIPB 3VW3L 4MJ5A 43C9A 4X9GA 3NH7H 5F44A 3U2SB 5F8RC 1CBVH 1BQHG 1ZSDA 2D7QA 4OKVA 1KT2B 1PKQE 5FOJA 3G08B 5DEGA 2GSIB 2XI9A 5FYLE 3ZE0E 2W0PA 4NQCA 2X4SA 5KZCD 4L8DA 2PXYA 3UDWC 1RUPH 3MJGX 5D7LD 1WEJL 2ATPA 4HS8L 2C4FT 4Z78B 3OKDB 4R90L 3UTZA 3LY6A 5FUZH 3P9MB 2W1NA 3EKCA 5EUOA 4I0PD 1CXFA 3EGSB 5D2LE 3IF1A 3DIFA 5GZOD 4Y5XC 4NJ9H 1MCSA 1KLGA 4JN1L 1MJ8L 2AJSL 4UQ3A 1U8MA 1R3HA 2X9WA 4DEPC 4F9PC 1ZVSB 4Y4FA 4YXKH 5FEBA 4P2QE 2AJXH 4XMLL 1OHQA 5K33A 1U92A 4KKCC 3A0OA 3G04B 1T1ZB 5DGRA 2R0KH 4I4WA 2EDJA 4FQXA 1Q0XH 1MJ7H 2AKRB 2KH2B 4OZGB 3OAYH 3BP5B 2IANB 2XACC 1H5BB 1NKRA 2IGFL 3ZKQD 3MUY1 3X17A 4QGYA 1AO7A 1FFQA 5LGHH 1N6QH 4OUUA 1MHEB 4QTIL 5EO0B 1TQBC 4P5MA 1U41A 1AGFA 3U9UB 1BQLH 3O6KH 1VEMA 2C7UB 3E2HB 4YPJA 1MIEH 3BH8A 4QRQB 5D1ZB 5CBEB 2XWTB 1A1MA 3ZHLA 1RJLB 3P30H 1T5XB 3EFDH 2EXYD 4MJID 1UYWH 1F4YL 5JORA 2H9GA 5FIEA 5HXMA 3CPLB 3IKKA 4PJBB 3OGCA 1BFVL 4Z7NF 4RGNC 5IJKA 1G6RA 3CFJA 5SX5H 3ISWA 4U1SA 5HHME 5DRWB 3I75B 2O61A 3HI6L 5EO1B 4LAQH 4XNUH 1R3LA 5E2WL 4KROB 3TN0B 1KULA 1R3JA 3B9DA 3BFOA 3MFFB 1RZGA 4GS7C 4BQ6A 1RZFL 2FJGA 3DRTB 3ZTNH 2R2BA 4X5WB 2FCBA 1IAKA 4J4PA 1NGZB 1QPPA 1B90A 3BI9X 4EI5B 3HHRB 4P0DA 4MNHB 3NIFF 4MSWA 4OZHF 3HZKB 4ZS7H 4KKAD 4POZC 4Y0GA 1SVZA 5DUMH 3SDAD 1UM5H 4MDJA 4X4ME 4XNMA 1MI5D 2QQLL 1I7RA 3QWRD 3D0VB 1FNSL 5BO1H 2AXJA 2EE9A 3HE7B 4IRSD 2K7PA 3WNMA 2RIKA 4ZSOB 2Y06H 4U1IA 5HY9B 1TITA 4JCMA 3S8WA 3JV0A 1N7MH 4RFEB 1CLOH 2VLLA 4ODWA 4EXPX 3TWCL 2FEEI 3MCG1 2AGJH 1AGBB 3LIZH 4HUXA 4KQ3L 2NY2B 3DOSA 5FKAB 2EXWC 1NKOA 1DEDA 1JF6A 1VKXA 4PJAF 1LNUA 4HWZB 4U1GB 2XFXB 3QYCA 1IZJA 2IAMC 1BOGA 2I26N 3RZCA 4PRDB 4DKAA 1D5XB 1M05A 1FVCA 1KJMA 1IC5H 2BJMH 3PDDA 3VGAC 5DJCA 4P57B 1LO2H 1S7SA 4YNYA 5E6IC 4G5ZH 3QIUD 1YECL 1YNKL 3TGXA 4GW4B 3SJVE 1FFNA 4JY4A 3UTTE 3BDYH 1S7WA 1AHWB 1CXIA 4AZ8A 1MCFA 5EZJA 4Z0XB 3B43A 3T77A 1HSBA 3TO2B 3FOMA 4P4KA 4QRSB 5EBLA 4TOYH 2VISB 3FO1B 2ADIA 5FGCB 3FFDA 3RHWF 3GHEL 5DURB 5KSUA 3REWB 3ULVE 3O3EB 5KW9L 4NRZB 2IQAB 2BC4B 3HC3L 4KK8D 4G9DB 5A2IH 1I7ZB 4NHUB 1TIUA 2NTFA 3GEWB 3GMNA 2DQFA 3UXFA 3SDCA 5CEXA 5E4EC 4LF3A 4Z7WB 3QWOB 2ZCLH 4PJ5B 3MBEA 5JR1L 3L5WA 4HWBA 3F6LA 4U1HB 3QQ4B 3G5YB 2VJXA 1Q9WA 4JGJA 3QT2A 3BGMB 3MRHA 4BFGA 4K7PY 3MJ8B 1BEYH 3L5HA 1I9JH 2ZUUA 1OTSD 4L3AA 4BA8A 5E9DE 2DYPB 2DJSA 1ZAGA 2YPLD 1FFOB 3G5ZA 1XF4B 4L8BA 4JFOB 4ZD3H 4OFYA 2BFVL 5F7LB 4Q6IC 2ZP0T 3L5JA 5TPWH 4KAQH 3TIEB 1N0LA 3MJ7A 4Z5RA 2J88L 2BY0A 4V1DE 4YHLL 5IVXB 1INEH 5C08D 3GMMB 2OI9C 3OXSB 3T1FB 4MAYC 3C2AL 4X6DB 1F13A 3OB8A 3BZFA 4F37F 2HWZH 3QUZA 5CBAA 3MRFB 5EORH 1U58A 2DBJA 4JLRB 5EO9A 3ZDXE 2Z31C 2HN7A 1MEXH 3GSWA 4X6CE 5DD1L 1LHZA 4XC3L 3GRWA 3PWNA 2NW3A 2NX5E 1N5YL 3NCYS 3DX8A 4MYWB 1HWGB 5K93A 5C6TL 3KPPB 4PJGB 4TSAH 4YR6A 4YXLL 3OMZA 1KN4H 4N68A 3VWKC 4N9GB 3K4AA 3MSPA 4NHCL 3CH1B 5FCSH 3LKOB 4ZUSA 4XI5D 1F2QA 5J57B 3BIAX 5DMIH 1NEZB 1UADC 3MV7B 3WBDA 1MF2L 1GGYA 4M9PA 1TTUA 4PJCB 3GI9L 1MAML 1RHFA 1YEDA 4Y1AB 2OJZH 1YEKL 4WHYG 5CMAB 4HEPG 4OKDA 4ODSH 2OR9L 1O0VA 3V6BR 1U8PA 1QFUL 5FAAA 4HDIB 3NPZB 1ND0A 4U7MA 2EYSA 3MODH 4NZJA 5DWUL 5HHVH 3T2OA 3JUZA 4EN3B 5IWLC 3UTSD 3PHOA 5JHDB 4RFOL 3MXWL 3TVMB 2ED9A 3GFUA 4Y4KD 5LCVH 1UXSA 2H2SD 4FTVB 3TZVC 3QUXB 4LSRL 1GAFL 4HH9A 4HIIB 5C0NC 2CIIA 5D2NB 4GBXC 2OL3H 3SDDC 1XF5A 1RUKH 5C70A 5DD3H 3A67H 2WBJB 5J8OA 4Q74A 3SE3C 4L9LC 1JK8A 1VFBB 2AXGB 2P7TB 4X8JA 1N8ZA 4PY8I 1E27B 2X10A 3QEUA 4NWUL 1CVSC 1NH6A 3UZVB 5BS0B 4P2CG 1A0QL 4ETQA 1PKOA 2NY1D 5LGJA 5B8CC 1HSAA 4D0BA 1AKJD 2EDBA 2V9QA 5AD0A 3WDJA 4E41A 5IW1A 4LCIL 1EO5A 12E8L 2HLFC 4M7KH 3T08A 3ZT6A 4Y5VC 4UILL 1HE7A 1U8IA 4LLUA 4JHAL 2X1QA 1EEYB 4WFFD 4LSPH 4LHQB 4HUKB 5HYFA 3RVWC 2E7CA 5CEYA 5CD3A 3S35X 3MLRH 5GGVH 2JCCB 3MREA 1GGBL 1FNLA 1ORQB 1P6AB 3BT2L 4JFEA 2P8MA 5JXEC 1TZHA 2FATH 5D1XC 1QSFE 5T3ZE 3VH8G 3OJVC 2XXCB 2AJZA 4UTAL 2X6MA 5I1DB 5FK9A 1FBIH 4L8SB 2HFGH 5GGRB 1E4KA 5FUCE 4Y4HB 1NLDL 4U0RB 5F7EH 3DVNB 4TUOB 2NY6D 3HZMA 1X9QA 2NXYC 2H6PB 3DRQA 1J11A 2P5EB 3RWGB 4KRPB 4OZFB 4FQHB 2ORBH 3IETB 3MGOA 3V4UL 1FPTH 2YPVL 1YY9C 3MOAH 5IMLB 5CSZA 3RWCA 1QRNB 3BGAA 2L7UA 5IMKB 5HDQL 2A6IA 4UBDC 5CZVL 2MQCA 4NGHH 2QBWA 3MLSL 2FZ3B 3MROB 3QNXB 3BYTA 3NABL 4LLWB 2DL2A 3WLBA 3GBNH 3QDJB 2HJLB 2VC2H 3W11C 3CVHL 1CD0A 1HWHB 3IGAA 5KSBB 3MRNA 3ZLQC 4HKZA 2K7QA 4PJHB 2F58L 3JWOH 3VRJB 1Y6MR 2DQTL 2J1KA 1KB5L 1N0XL 3RNQA 2DM3A 1ZEAH 1JV5A 2QSCL 4J6RL 5ALBH 2CRYA 2ICCA 3KYMB 5CKAA 1M6OA 3WFBH 4W6WB 4JCLA 2X4NA 5H94A 4QXTA 4WFED 4XMKL 2JK5A 5IROC 3WD5L 4ENEC 4IHOB 3BPCA 1NMAH 4TUKL 5F7WC 4DW2H 1YPZE 5HHPA 2VLKD 4YC2B 2BVOA 5C6WH 2V7NA 1R5IB 3WFEL 2OZ4L 2DMCA 1JWMA 4J12A 3D1MC 1AI1H 1WVZA 1X7QB 1A7RH 4YDIH 2AJ3A 4DCQA 5MENB 1P5VA 3L9RB 2A77L 4XCEB 4U1LB 5E8OA