5KSVB

Crystal structure of hla-dq2.5-clip2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
180
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Unraveling the structural basis for the unusually rich association of human leukocyte antigen DQ2.5 with class-II-associated invariant chain peptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 180
sequence length 188
ec nomenclature
pdb deposition date 2016-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ksvB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ksvB01
2YA1A 3H0TA 4KGLA 4YHOL 3SPVB 3QEGH 4G43B 4NC2B 1T83C 3JUYA 3ZDYE 4XB7A 1IAII 4WEUD 4N8PA 4NKQB 1QSFB 3K1DA 3ROOA 4PJDB 1N26A 2YWYA 4BSJA 1AIFB 1IKNA 1ORSA 2VAJA 3V0WH 4ZFGL 2DJUA 5E8PB 5FO7A 5HGAA 3TO4C 2GT9A 1W8OA 4XP4L 4G42B 1TZGL 4P5TB 3MYJA 2D4DA 3CFIC 1FGVL 3FB8A 2JJTA 2YKLH 3T8XA 4YHPB 1KIQA 5IFAH 4HKXB 3RWCB 3QUYC 1H3VA 3CZFB 4FABH 4I48A 4PR5B 2VLLA 5JW3H 2R2BB 4BQ6A 3P0YH 4F3FA 2E7MA 4DOHE 3S3SA 3D3VB 2QQLL 1X5IA 4LU5L 1KB9J 4F7MA 5FAAA 2BC4B 4R2GB 5KSUA 3MUZ1 4MB4A 4ZS6C 2XZAH 4DK6A 2IPTL 5CJXA 2D31A 1RZKL 1FSKC 4KHTL 3BH9B 3SO3B 5I1JH 3AS1A 4YHLH 1P6AB 2EEAA 2R1WA 1V3JA 1PD6A 2CR6A 4NQCA 2ZSWB 3HMWL 1HINL 5KAQG 1CLYH 1INEH 5HI3C 3DXAA 3REWB 2B0SL 4P9HC 4YHZH 4OLUH 5GRJL 4XCEB 5JW5B 2KDGA 2NY1B 4DCQB 3OAUH 3S35L 3RI5K 4GBXD 5JIKA 3S37X 5HHXL 3KAAA 4IIQC 4J4PD 2CPCA 4UV7H 1D9KB 3O3UN 5E9DA 4LGPB 3MRIA 4GJTB 3MC0A 4PJGF 4Y1AA 1WZMA 2LAGB 2Y6SC 4UDTB 3JTTB 1ITCA 4TSBL 4UOJA 3S36X 1J0HA 3CDYA 1VESA 4QRPA 4UINL 1YC8A 3LKOA 2F74B 2SEBA 2GTWA 2CR3A 4ZXBD 4EXPX 3OG6B 3AS0A 3RUGB 4NNYB 3KNBA 3SBWC 3BIBX 1F6AB 2VNCA 1AJ7H 5I73B 5I74C 1ZMYA 1MREH 5TQ2H 4R8WH 1I7ZA 3VA6A 5C08B 4WEMB 4Y8DC 5F7MC 4K9EL 4JFQA 4ZUVA 4YH6A 1R5IA 3AB0B 3IYLW 3PP3H 3WO4C 4TTDD 3D2UD 4WV1B 3OB8A 4J3XA 4LKCA 1T5WA 4ZAKA 3ARBB 2C3GA 4POZD 1RJCA 5EOTA 3HZKA 3ZE0F 2YSSB 4LVNB 4XWOD 3VXPB 3MRMA 1MQKH 3MV9A 5CP7A 3C5ZB 4O51A 1WT5A 4UIKH 2IQ9H 1QFWM 2GAZA 2FB4H 2P5ED 4AY0A 4MJIB 3TVMA 2WLZA 15C8H 4LPCA 4A6YL 1FGNH 4V2CB 1OM3H 3ILQD 4JEGB 5D5MA 1DE4A 2CDEA 3E6FA 2CJUH 1QLFA 2ID5A 3BGFB 2F5AL 1KB5H 1QP1A 2JJVA 1LD9B 1YMMA 4KJWD 4K3HA 1YMHB 2P5WB 4HMEA 4KK9D 3VXTA 2X42A 1QR1A 3AU1B 4L8SC 4JN2A 1ONQB 4X99A 1RK0A 4OCRL 3ZHLA 4J23A 3CLEL 1C7TA 5F70A 2AK1H 1MEXL 2F5BH 4W81A 3GSQA 4QRRE 3D9AH 2I60H 1J87A 5K33A 2HLAA 1OD7A 1CFQB 2IAMC 5DVLA 4N90D 1BVLB 3QYCA 4YHOH 5DEGB 1T0NB 1K8IA 1AGCB 3QI9A 4KWUA 4WWID 4JQVC 5IR1B 2YZ8A 1CTOA 2APXA 1XT5A 3Q3GB 2FECI 3LY6A 2YRLA 1NGZA 4APQB 2NW3B 4ZFGH 3MV7A 3I6LE 1KTRL 1WBXB 3FO0H 4XPAL 4Q9RL 4XP4H 2EIBA 3IDNB 1TZGH 4QXGL 3QEQA 1VA9A 1RIUL 1FGVH 1MCRA 3MJGX 3M17A 1QHPA 4IMKA 3CFDA 4ISVA 1I9JL 1CWVA 1XGRA 5IMOB 4XVUC 1OSZB 2A73A 4ZMAT 4XRCA 3OR6B 3G5ZA 1JZ3A 1SYSA 3OSKA 2VISA 1XZ0B 3HCVA 3L3GA 2APFA 3QFJD 4WGWB 5ESQA 3U9UB 1WEJL 2QQLH 3OBAA 4LU5H 5HYSG 5ID0B 3DECA 4ZNEE 1AE6L 3SKOB 4JFOA 4MNQA 2VLRA 3KPQB 4E9LA 4HKJA 2IPTH 1RZKH 4NQEA 5CZXD 4KHTH 4ZTPL 1RIHL 3LRSB 1F6LL 4HUWA 1CGVA 5D7IF 4F8QA 2Z8RA 2FH8A 2ICES 1MCWM 2CSPA 4ZOCA 5HYJD 2IH3A 4PJGB 5ISZA 4FQLL 5I1GH 3HMWH 4G8EB 1HINH 2YPLE 3D0LA 2AKRA 3UMTA 3ARDC 3ET9F 1WJ3A 1MAJA 2R0ZL 2B0SH 1BWMA 2P45B 3U4EA 2PO6C 1F3DJ 4CJ0A 1BFOA 5B39A 2HT2C 4YBLB 3S35H 1HQ4A 4MAYB 4E41B 3V5KA 3MJ9A 5BV7B 3IT8D 5CEXB 5HHXH 3I3DA 1IGTB 6CGTA 2FR4A 1ZT1B 3GSUA 1A7NL 5D1XC 2P8MB 3ARPA 2YEZA 3CXDL 4YDLC 1Q8MA 5ICZA 4GW5A 4JM2D 4FQXB 1FVDA 4JHBA 4WGVB 4FRWA 1YY8B 4TSBH 4HCRA 1QRNA 2FLBT 4PG2A 2V5YA 5JHDB 3CGTA 4UINH 2NY2B 2Q7NA 2V2WA 5FYLL 4X9HA 3R06A 1Z6JT 1I3VA 3HLAA 3QHTC 3WHE1 1Q72L 4QHKJ 4FQIL 2IALA 3EOAB 3NZ8A 4ONHA 4EXKA 5DFVC 1TJGL 1N5AB 5A2JH 5J13B 1NEZB 4YPJA 4OZIA 3QUZC 4P46C 3T3ME 1CBVL 4K9EH 3BPNB 4JFXA 1YJDL 2C3XA 3CD4A 5FUCC 5JOFA 2AXGA 5KVFL 2Q3AA 4NC0B 4WFFD 2OJZL 2NW2A 3WEXA 4RA0C 5DUBA 4M6ML 1Z2KA 2IF7A 5J6GA 1SMOA 1W72L 2ILLA 4I2XE 2OQJB 4I9WD 2CGRL 4I5BB 1FJ1B 2MQ3A 3QEHA 4Q9CA 1NCTA 2B20A 2YN3A 2ITDA 1S7WB 3TIDB 4OI7A 3GSXB 3QWRD 3LN4A 3HC3L 1VKXA 1MCCA 3L3KB 5T3XD 5CGMA 4A6YH 4HLZH 5FA4B 4PRHB 2HTLD 1VADB 3CJJA 4YGVB 1JWSA 4H5SB 2XXMB 3CUPB 4POUB 3V6BR 4ELME 4OT1L 3RL1A 3DV6B 4WW2A 5E00A 4JPVL 1T1YA 2F5AH 1R3LA 3EJZD 5D96C 1DVFA 1GOGA 2XN9E 4KK8D 3RGVC 3KPSD 5ITFB 1HI6A 2FIKA 1DSFL 2DWEA 2GUOA 2MHAA 4GKNB 3O3BA 2EYSA 2GSIA 2FL5B 2VDMH 3MUJA 1JL8A 3ROLB 1MHPL 5EDXA 3ULSB 1YEHL 3L5HA 3QO0A 3GDBA 4OCRH 4KUZL 3WMSA 3CLEH 4JFFD 3OTTA 3SDYL 2VWEC 4HBCL 1MEXH 4NRYA 1E6OL 3LEYL 3VFRB 4X6DA 2EDHA 4F57L 5CJBA 2O5XL 2IH1B 4Y4FA 3VFVB 3B9KA 2OTWA 2JJSA 2X10A 4U1LA 2R23B 3RVTD 1EV2E 3DIFB 2VDOL 1JWUB 4QRTB 3VWJB 1LO5A 4KTYA 2KBGA 1C12A 2Q6WB 3ULUF 3ABZA 3RGHA 4EEEA 4IJ3C 1TMCB 3SDDA 4JM4L 4L4TB 3UDWC 1BD2A 1LE5A 2FATL 5H35A 4XPAH 4Q9RH 4H1LG 4QXGH 1RIUH 3U6RA 5I16A 3F7VA 1GZQA 2WINB 5D7IB 1I9JH 4FP8L 5JDSB 4Z7NF 1S7SB 1RPQA 3OAZH 5J56B 3DRTA 3QG6B 1UWEH 3AC0A 5BVPH 2X4UA 2UWEE 3ARUA 3DX8B 3IDYB 4P2OD 2ZKHH 3W2DL 5D1QD 1WEJH 3MXWL 1AP2A 1YPZE 1AE6H 1ZA6A 3FHQA 4Y19D 1I1AB 4XXDB 4BELD 2J5LC 5GSVB 2IG2L 4WI4A 2XKNA 2XY2A 1E4XI 4M7ZC 4ZTPH 1MPAL 1RIHH 2QTEA 5SWQB 2YD4A 3V7AG 4X4XA 2EDQA 5ENWB 3TA3D 4U6VL 3GGWA 1JN6B 3P73B 3SQOL 2ZOKB 2DJSA 4FQLH 5IMLB 3MSPA 3S3JA 4NJAL 3PQYD 4Y5XA 1XH3B 2ENYA 3UPCA 4R7NB 1E6JL 1FFOA 2BVEA 4PGBB 4Z7WE 3VMOA 1EHXA 1F00I 2R0ZH 4OD2A 1BIIA 4CNIA 3MRQA 25C8L 4QT5B 3ISWA 3DETC 2Y23A 3MRPB 5HHPB 5JZ7D 3BO8B 4NIKB 3EDEA 4NO0A 2X44D 4WDIA 4Q7DA 4WFHE 1A7NH 4D0BB 3PWPE 2GJZB 3T0WA 1CLCA 3CXDH 5J11B 3VXQB 1U93B 2ZCKL 5DJ8B 3EYQC 3VD3A 2V9TA 3QNYB 4LLDA 4LF3A 1MJ7L 3IU3A 3RDTD 5F89B 5IW1A 3HB3C 2H9GB 3ZDXE 4GRWF 1A9EB 3IXAA 3PV6B 3RIAF 1IKFL 5FB8B 3QCVH 4P23D 1LILA 1TIUA 3DBXA 3LKRB 1Q72H 1S7XA 2IJ0C 4FQIH 4LPTA 1K5NB 3QDME 4PV9B 1SEBA 1IM3B 1TJGH 1ZLVK 1I7TB 3RAJH 5H8DA 1N6QL 3QCTL 3K4DA 1U3HA 4U6YA 1WFOA 2YZ1A 5F7LB 2CK0L 5CMAB 1MHEA 5I8EB 1LWRA 2DWDA 2K1MA 2A74A 3W9DB 2N56A 1YJDH 1JPST 2HJLA 1HOCA 5KVFH 2G75A 5C71A 5GIRA 3S4SG 1ZWIB 1HDMA 3TO4D 3DROA 2QR0B 3ZTJG 3ES6B 1P7KA 4M6MH 4M6NL 3FT4B 2ZUUA 5EUKB 1W72H 1GC1C 3IDXL 1J05B 2CGRH 2UUDK 1GSMA 4YPGB 3OKNA 1LEKA 1XF5A 1T1WB 1JF6A 3HC3H 1FNLA 3GBNL 5HVHC 3EO1A 3UEZA 2AQ3A 2Z9TA 4K3GA 5I1AA 1PYWB 2VKXA 3T0EA 4NBXB 3BP6B 4OB5H 4GS7C 3RWIA 1KPVA 4J4PA 4OT1H 5I1DB 2ERJC 4ERSL 3BQUB 2YUXA 4JPVH 4DK3A 3EGSA 1I3UA 2ITCA 1I8IA 2XTJE 1WAAE 1KT2B 1DSFH 2A38A 1MHPH 1YEHH 1ES0B 3V5HA 3GRWA 2BNUA 1KTDA 1OGTB 2OMBA 4L9LB 4KUZH 4ZXBA 5HI5C 1AGFA 4YZFE 5B22A 3SDYH 4U1KB 4HBCH 2CKBB 1HEZA 5HI3D 3V7AE 2DKSA 5DJ6B 3JWDC 1CXLA 1E6OH 3LEYH 5FA3B 4ENEC 1JYWA 4F57H 2Z93B 4WTZG 5BVJA 3BRGC 2O5XH 3C8DA 3N1GC 3RIAK 1YN6A 4LHUB 4GRMB 3VXSD 3PHOB 3A6OA 1W0WA 4ONGL 4L8DA 5HYQA 3H0TB 2VDOH 4O4YL 4CU7A 5DR5L 2DQCL 3LKNB 1P1ZA 4L4VE 4AJ0A 1KIUA 1GXEA 2Z91A 4YHIA 1Z0NA 4JM4H 3RWHA 3PL6A 2MQCA 2FATH 4TOYL 5C2BL 2DIJA 1P7QD 4D0CA 2Y6SD 3QWOA 1NUFA 1ORSB 1UZ6F 5FO7B 3MRRB 5HGAB 2GT9B 5EU5A 5CFHA 4R3SA 5E4IA 3MYJB 4FP8H 4MA3A 3FB8B 4OBSA 1A7PL 4YDVB 3MNWA 4PJ7E 2J2ZA 2AXJA 3Q48A 1P84J 2NYYC 4FMFA 4HJGA 4JO2L 4XPBL 4I48B 1PEWA 3ARTA 3W2DH 4XNUL 3K8KA 3MXWH 1NGPL 2BDNL 1J9CT 2IG2H 2X2YA 3NH7L 1MPAH 3I50L 5KSUB 1KJ2A 4MXVF 3O3EA 3H9ZA 2DM3A 4U6VH 1BFTA 4LRIC 3SQOH 4BA8A 1G7QA 3VD7A 4NJAH 3OKYA 3RRQA 5F7YC 1G7LA 2YRZA 4LDOB 4GRWB 3DHMA 25C8H 2XZQL 3DXAB 4IMLA 1V05A 5EC2B 1IM9D 2PYFB 3ARVA 3O45B 4NUGL 5E8NA 5F71A 3SGJA 1KNOB 5ACMA 4PJXA 3HG1D 1QLRA 2IFGA 2Z0BA 5TE7L 3BUTA 4L3EB 1IGIL 4NCC2 5CLWA 2ZCKH 5C0AE 2AEIT 1NEUA 1MJ7H 5E9DB 1D5MA 1BPVA 2YUZA 3ZE1F 2XQBL 5KOVC 5BZDA 1IKFH 5DRZA 3J7HA 4QRPB 1QSEE 4RFEA 2SEBB 4QRQA 3FZUC 4PREA 3U82B 3TYFA 1N6QH 3QCTH 3KNBB 2CK0H 4ORZC 5HHMD 3SCMC 2IAMD 1A4JB 4X6FA 1I7RA 1ULVA 4ZDHA 1IGML 2L7JA 3O11A 3SKNB 4L3AA 4ZSOE 4U2ZA 5AYQA 3DUSA 3OJMB 4PJAE 4PJHE 1I7ZB 4C58B 1GGYA 1AC6A 4NBYB 4JFQB 4ZUVB 1G84A 1CICB 4CVWA 4XZUB 1R5IB 4JG0H 4LGSB 3UROR 3DGCR 4M6NH 3IDXH 4LKCB 2QJDA 3GIVA 2XWBA 1T5WB 1H3XA 4ZAKB 1JGEA 3BZFA 4WENB 1A02N 4ZQKA 4XI5C 2JIXB 5MEQB 4YBQC 4M1DL 3MRMB 3ARFC 4JHZA 4M93C 4XVUD 4YFLF 1XGUA 3GBNH 5CP7B 2X1WL 1I7UA 5CILL 4MA1C 5GRWA 5ESVA 1VHPA 5IBTL 2AEWA 4Y5YA 3TVMB 2FNBA 4D0DA 1ZVYA 2WV3A 2IADA 2YD3A 1Z3GH 4ERSH 5KANG 2P24A 4HWBL 1A6VH 4JM2A 1JPTL 5L2JA 2CDGA 4BKLB 1QLFB 1Q94B 2VTFA 1J18A 1YZZA 3B2UC 1YMMB 4QXTB 4YXHL 1ACYL 3SE4A 5E2VL 3VXTB 2MPAL 2MCG1 5IT2L 1QR1B 5IJKA 1FPTL 5AYUL 1NFIB 5AAWA 4X99B 4K8RC 1DP0A 2D7PA 3ARDD 2Z92A 3VCLA 2PO6D 5J9PA 2I5YL 3GSQB 2XPGB 2HT2D 5TDNA 2BK8A 3GJEA 4ONGH 1I1FA 5LGHL 1SVCP 4OLYL 4WW2F 4O4YH 1MCOL 2HH0L 3QIWC 5DR5H 2DQCH 1F2QA 1K8IB 3BT2L 3QI9B 1OWWA 5D1XD 1AD0A 2ZUVA 4N5ED 3RX7A 1GC1H 3HI5L 4TOYH 5C2BH 3B9VA 2I24N 2W0LA 5JHLL 4ODXA 3GMMB 4OZGA 3RY6C 1X5YA 3GSNL 3QEQB 1U8KA 2WUCL 3ELAT 1CFTA 2DTSA 4X6DF 4ETQA 2D7TL 3QWRA 3M17B 2H32H 3CFDB 4ISVB 2X40A 5KSAD 3L7FB 1XGRB 5DFVD 43C9A 4JO2H 1OAUL 4XPBH 5MI0B 1A6TA 4Y2DC 4XNUH 4XRCB 3G6DL 4M9OA 1NGPH 2BDNH 3G5ZB 3QUZD 1SYSB 2PYEA 3EW3B 2VISB 3HCVB 3L3GB 2W92A 4P46D 5E99L 3U4AA 4HULB 2UY6A 3K74B 1KLGB 1TPXB 4K94C 4TVPD 2BOBA 4MNQB 2VLRB 3KPSA 3NH7H 3I50H 4DTGL 2HYMA 2P42B 4KROB 5J7CC 3CDFA 4NQEB 2YD6A 3KYOA 3PXJA 4OGAC 1NC4D 4AL8L 4BQ8A 3WN5A 3UPAA 3MRGA 2BNQA 2B5IB 5HY9A 4PLKC 3NA4A 3BPOC 1BVZA 3D0LB 2AKRB 5DS8A 5LJYH 2XZQH 4P59L 4ONOA 4U4BA 5E4EC 4NUGH 2ZUWA 2CQVA 2NY4C 3V6OA 5E8DL 1BFOB 5B39B 2BY3A 3HC0A 1CGUA 3GHEH 3PDOB 2VSDA 1HQ4B 5TE7H 3V5KB 1ACZA 1JPFA 3HPLA 5ICYA 2A9NH 5C0IA 1IGIH 3UJTH 3H9SE 4MD0A 2FR4B 5CKGA 1LDPL 2GY5A 1EXUB 3RGVD 2G9HB 5ICZB 2A77L 1F6FB 3V7MA 4HPYL 1KB5A 1BQHB 2XQBH 4JY5L 3C6LC 3HE6A 1TTUA 5E08L 4ODSL 1A1OB 3QULA 2CDFA 4RNRA 2V2WB 3R06B 5HDOA 4KUCD 4PJ5D 5I6XC 3HLAB 3KPPB 3WIFA 1JHLL 3HRZA 5E03A 1NFDF 3D39D 2IALB 3NZ8B 4ONHB 5D1QA 4A2MA 4MWFA 2RHEA 1AQDA 2H1PL 3CZJA 3V4VL 3FOLB 3BRDA 4FFZL 4G8GB 2RIKA 2ICCA 1OL0A 1T7XA 4JDZB 4N8VB 5I2IB 4UBDC 4JFXB 4M03A 3S97C 2R1XA 4JFPA 5JOFB 2NY0C 2XYCA 3JVGA 1IGFL 1QHOA 3PQYA 4ZOAA 1L7IL 3D85A 2NW2B 3WEXB 3UJIH 3EYUH 4P4KA 5DUBB 5J6GB 3K1KC 1IJ9A 5DD6A 4PRNA 3MACH 3QEHB 1FAKT 2ZUSA 5K9OA 4DEPB 1UB5A 2ITDB 2R2CA 3MRNB 3LN4B 2EDKA 2F19L 5IBTH 1VKXB 3QXUA 2OL3L 5EU6A 3LRGA 4X83A 1SYVA 5B4MC 5D71L 4HWBH 1JPTH 3TO2B 3CFKB 5DRNA 3IFPA 3I9GL 3WIHA 4GFTB 4WW2B 5E00B 1DVFB 4YXHH 1ACYH 5E2VH 2MPAH 1HI6B 2FIKB 2Q76B 1P6FA 5IT2H 5EUOA 1CR9H 3O3BB 2GSIB 4P23A 1FPTH 5AYUH 5JW4N 2FGZA 1SJXA 4QHKI 3G04A 3ZE2F 3S5LB 3HNSL 4GLRI 1VGKA 4KKNA 2I5YH 4NRYB 3DETD 4M62H 3MRDA 4X6DB 1SJEB 4MJ5B 3JXAA 5D7JB 5LGHH 3QWQB 4OLYH 4G6AC 5D2LA 1MCOH 1XGTA 2HH0H 3B9KB 5T1MA 2OTWB 3C6SA 4UUJB 3B83A 2NTSP 3BT2H 5IW6B 2DAVA 2VE6A 3FB6A 4YXLL 4KV5F 2C4FU 3QXTA 4HUVA 4EDWL 4PY7A 1C12B 3HI5H 3EYQD 3PABB 5L2KD 4MX7A 3TO4A 3VWKC 1NMCB 1MIML 3SKMA 5JHLH 1BD2B 2AK4A 4HK3J 4RGNB 3CXHK 3HB3D 1LE5B 4S0TD 1C5DA 3GSNH 4LVOB 4BZ2L 3QUYA 2WUCH 4UDUB 3Q6GL 3F7VB 4J7RA 2WBJD 3MGTA 4LHQB 1CIDA 5DC0A 3BD4A 1OAUH 3DRTB 3WFHA 2X9XA 1MCLA 3G6DH 2X4UB 2GJ6D 5J57B 5TDPA 5DJAA 5E99H 5C3LD 2OBGA 3KYNA 3TCLB 4OI8A 1ZA6B 4WI9A 3T4AA 4C4KT 4DTGH 4IRZL 4U6TA 5D1ZB 4Z7OF 3VRIA 2XKNB 4RRPG 3HC4L 2JF1A 3NCBB 3LQMA 3V6FB 2BSSA 1FYHB 3BW9B 4R0LC 3GGWB 5KZCD 2FJHA 5AUMB 3IS1X 5IVNA 4LLAA 5DK3A 4XB8A 2QSQA 3S9DB 3P4MA 4FNLL 4P59H 5F3HA 1A1MA 4OD2B 1BIIB 1L6XA 4CNIB 5SWZD 1X6NA 5E8DH 2BNRD 3OWEA 4KKBC 3MV8E 4XP5L 1N8ZB 1NFDB 4IIQA 1JIBA 2Q7YA 5C09D 4K71C 4NO0B 5FHAL 4NZDA 3QZWG 3EFFA 5BRZA 4WDIB 1YN7B 3TEUA 4HMCA 1CXIA 1P7QA 1R5WA 4K3DL 2A77H 2VZSA 2X4SA 1N7ML 4HPYH 4LLDB 2WP3O 4DVRL 4LF3B 2NX5B 3IU3B 4JY5H 2EDBA 2B4CL 1LNUA 4OCNC 4ODSH 5E08H 3QUMB 3DYOA 5HI5D 1BOGA 3VXME 3IXAB 5DVKA 1FVCA 3STBA 1IZKA 1JHLH 1NGQL 2DIAA 3DBXB 3WHXA 2QADC 1S7XB 4ENED 4E42A 4PJXF 2QQKL 2H1PH 4IOIA 3PJSB 3FMGL 3MA7B 1RIVL 1ZLUK 1U3HB 4FFZH 1J10A 4OSUL 2EIEA 1RUML 1MHEB 1YQ2A 2DWDB 5TQ0H 3AM8C 3FO9A 3C8KA 3ESVF 2A74B 1QKZL 4LSVL 3VXOB 5CEZL 2DLTA 1QRNE 3AUVA 3VFOA 2VLKE 3H6JA 5TGBB 2HJLB 4P4RA 2QEJA 2H45A 1HOCB 4ODVL 1IGFH 2W0FA 2X41A 1L7IH 3WUWG 1HDMB 1X5GA 1IAOA 3IFOB 3GIZL 1KPUB 4NKOB 2VABA 4DZ8A 2VL4A 1YEDB 4HH8A 5IVXA 4OZIE 2XFXB 5AZEL 2ENSA 4XHQA 1JNHB 1XF5B 2NYYD 3ZTNH 2VZUA 3MLPA 2F19H 4JRXE 2OL3H 5I1AB 1DUZA 3NIDE 4RFNC 3DGGA 4MZ3A 3T0EB 4LLYA 3HUJE 5D71H 2VR9A 4FTVD 3RWIB 1KPVB 4B7LA 3I9GH 1WF5A 4MA8L 1KC5L 1F3RB 4FFVC 4I0KA 3EGSB 4XWGL 2D0HA 2ITCB 1I8IB 5C0GB 1H3UA 4L8SA 2ZOLA 3EKCA 3DOSA 4NUJB 3DLQR 2XA8L 1Q9LA 5L8JB 1RUPL 3V5HB 5C70A 4CMHB 2BNUB 3HNSH 1E4WH 9CGTA 2ZUXA 3G5XB 3QQ4A 4PYGA 4O5LL 4X7EC 2YXMA 3U4BL 1HEZB 3BZDA 5C8JA 3UTPD 2IAMA 4NRXA 4KAQL 3VH8G 4F80A 4X6CE 3LCYA 2BP3A 4OQTL 1W0WB 4L8DB 5HYQB 4XCYA 4YXLH 4M02A 4GRLC 5FF6A 4EDWH 4PJBA 3MLTA 1P1ZB 1N64L 4PGJA 2NY6C 4YHIB 4MQ7A 1E28B 3PL6B 2JCCB 2F54D 2DKUA 1PZ5A 5E2JA 4AMKL 4S1SL 4D0CB 5F93C 3QWOB 3SDAD 4Z6AT 1J5OL 1JI1A 4XP1L 3Q6GH 2X05A 3QRGL 2OSLA 2R69L 4NN6C 5DJZA 3K3QA 1BF2A 4MA3B 1FL3B 3MX0A 3FZUD 3MNWB 3KPRE 4HIJA 1TXKA 3GKWL 3GBLA 5CJQL 4HJGB 3EO0A 1Z9LA 3W0WE 5CHNB 5D6CA 1FZMA 4TNWK 1V7ML 3SCMD 3WL9B 1ETZB 2VJXA 4Z0BL 5GJSL 3O4OB 6FABL 3NCJL 4IRZH 4TQEL 5KTEL 4M6OL 1M71A 5GSRB 4XPFL 3SDAB 2FWOA 3D0VB 1WCQA 2V9RA 3HC4H 1KJ2B 3T2OA 2YS4A 5SWSD 5JXAH 4NGHL 3BWAB 3SY0A 2H3NA 4F9PC 5F9DC 4FNLH 4XI5D 1PBYA 4NSKB 4YBQD 2PO6A 5E6IB 4BFGA 3RKPA 1REIA 3IKCA 2PW1A 4IMLB 1XF3A 2OTUB 4XP5H 5GRXG 4EI5C 5E8NB 4FXKA 4MNHA 4LSUL 4PJXB 3BVNA 4MB3A 5FHAH 1KYOJ 3K8MA 3X13A 1KCRH 4LFHG 1J8KA 1N7MH 3B2UD 4DVRH 5C0RH 5IHLB 1D5MB 4E5XA 3NACL 1KB9K 4WW1A 2P1YA 2ARJQ 5BZDB 1IVLA 5DRZB 4OLWH 2EH8L 4K8RD 1NGQH 2HN7A 1OVZA 3K4AA 1BZ7A 4OF7A 3F58L 1T2JA 1CN4A 1P5VA 4HUXA 1YNKL 2QQKH 4PREB 4Z8FH 4O02L 4HZLB 3TYFB 1KEGL 3FMGH 1RIVH 3KPTA 1MI5A 4OSUH 3O6FC 5DXWA 3TV3L 3ZT5A 3AGVA 4KRPB 1RUMH 3QIWD 1H5BC 3INUL 1I7RB 3ARED 4ZDHB 4NZRL 3BZEA 4PRPD 3G9VA 3O11B 4LSVH 2R56L 1QKZH 1OT2A 3I6GA 5CSZB 2ZJSL 4RMVA 4ZUTA 5T3ZL 3FAWA 3E2HC 3BPCB 4ODVH 2MCPL 1ZS8A 5JORA 5F3BB 2ADIA 3GIZH 3KYAA 3LN9A 1NCDL 3WNLA 4HIEA 2XWBB 1FZJA 1JGEB 3BZFB 3MBED 5AZEH 1BBJB 4PTTB 2LU3A 2NY7H 3FONA 1XGUB 1K3IA 5ALBL 1X3DA 4NM8L 4YE4H 3TBSA 3QJHA 1B6DA 2VXSL 5DUPL 4DAGL 4ODUA 4RMWA 5ESVB 4TN9A 3CVHL 1OPGL 5INDB 3BD5A 3QDGD 1X7QA 4QRUB 2IADB 2YA0A 1BIHA 4MA8H 2EE6A 5A2KH 1KC5H 3RGVA 2P24B 3QXVA 1RZ8B 4U1HB 4XWGH 3N06B 4NT6A 3VG0L 2CDGB 4BFBD 4NNPL 4OGAD 5KJRL 1KTLA 4M5ZL 4HQQL 2XA8H 4NKMA 1UQSA 1RUPH 3RIFF 4PJ5A 5D2NE 4PLKD 4V1DA 3ULVC 2XOTA 3D39A 3P77B 3U4BH 3KLAA 5EZOH 1FNAA 1J1OL 2RCSL 1YQVL 2CXKA 4KAQH 2NY4D 1PKOA 3F8UB 2HFEA 3KDMA 1J0IA 4OQTH 4F7CB 1SQ2N 5TDNB 4D9QD 3GJEB 1I1FB 3CNKA 3FRPA 3HHRB 1SVZA 2XTJC 4AH2A 3UDWA 1IC4H 1N64H 3BKML 2ZUTA 2V17L 5EUOF 1AD0B 5A3IC 4NC1E 2QBWA 4EZMA 2VDRH 3T4YA 5EIQA 2VZ3A 1MIEL 1ROWA 3C6LD 1J5OH 4KGJA 4XP1H 3GB7A 3QRGH 3FQTA 2ESVD 2XG5A 4O2CA 4NQXA 2R69H 1I3RB 3VI4F 3DMMC 1U8KB 4MHHG 5H94A 4PV8A 1CL7I 5HDLA 2VDKL 4Q9QH 1BVKA 3GKWH 4QCIA 4CGTA 4K55A 5D2LF 1K8DA 43C9B 1A6TB 1GOHA 1P2CA 4Z0BH 5GJSH 2PYEB 6FABH 3MGAA 3NCJH 4K7PL 4YNYA 4XVSL 1C5CL 4TQEH 5KTEH 3H2WA 4M6OH 5E7BA 4XPFH 3HE7C 4RAUA 4TYUA 5H2BA 2BOBB 4UBDD 4OV5B 3C2AL 1WCBA 2P5WE 5CP3H 2NY0D 1CXHA 1ZV5A 3KYOB 4NGHH 3B5GA 3X12A 1NEZG 4PJFE 2ZCHL 4OIIH 3WN5B 2K9UA 1IGCL 2P5EE 4QOKD 5IBUB 3MRGB 4HS3B 2BNQB 5D4QA 4NM4L 4X4YB 4NO2A 4X9BA 5HY9B 3JTSA 4EDXA 2CLRB 2DYPD 4HXAL 5DS8B 1YNLL 1MFNA 2DLFL 1P9MA 1KLUA 2NY5C 1RZGB 1GRWA 3I6KA 1UJ3B 2WWKO 3QHFL 4ZFOL 4DW2L 4CN1A 4LSUH 1JZ7A 4P5KA 1LHZA 3HC0B 5B4MD 5E7FA 5F7FA 1AXIB 5LGKA 1KELL 4QHMB 1JPFB 3WLWC 3HPLB 4ZUUA 1W0YT 4HFWB 4EI6B 5ICYB 5I75B 4YHYB 4GQ9L 3PGCB 5C9JB 1DUYB 3IDJA 1UB6A 1OTTC 2GK0B 3PE9A 3NACH 1KB5B 3HE6B 5LAXA 1I1CA 2EH8H 2ZP0T 3QULB 2CDFB 4N90E 3F58H 2DQFA 1YNKH 2GJ6A 4O02H 3BP4A 1KEGH 3CFEA 2BOCA 5CAYB 1RI8A 3TV3H 4GW1A 4G6AD 1AQDB 3PV7A 3INUH 5F6IB 1Z5LA 1MFBL 1CFVL 4L3CA 4NZRH 3S6CA 1J0KA 2R56H 2ZJSH 3NCEB 1N5YL 3H9HA 4GKOA 2C3WA 2MCPH 4B41A 2IGFH 1WFNA 3VWKD 1BLNA 2D3VA 4WUKH 4UIMA 4X80L 3V52H 3HTLX 1AQKL 5DD3H 1NCDH 3D85B 3G6JE 2JJUA 4P4KB 4DQOL 4ZPVB 5FEBA 1EX0A 1A22B 3QFJE 5DT1L 1N59A 4K07A 5DD6B 4PRNB 4D9RE 2V6HA 1JZ2A 4NM8H 3VXNB 2H32A 5K9OB 2W91A 1UB5B 1YECL 2VXSH 5DUPH 5C09A 3VGBA 1PY4A 4RAHA 3TT3L 3W39A 3CVHH 5HGBA 5EU6B 1OPGH 1CLZH 2AXFA 2W9DL 2P7TB 1FNGB 5GGTL 1IMHC 5EU3A 5HYJE 5C0CA 3VG0H 3IFPB 1D5XB 4NNPH 5KSVA 5KJRH 1QYGL 4M5ZH 3FB7A 1JHTA 5IW3A 5IVXF 5JHDE 3UTSD 1BGXH 3EIFA 5EUOB 3GSRA 5F6HJ 1D5BA 2AJZA 2X1OA 3G04B 1EGJA 2HRPL 4UTAL 1J1OH 1VGKB 5JA9A 2MJWA 2RCSH 3ZE0E 5GS1B 1SJHB 1YQVH 2P8PA 3K4ZA 1EEUA 3RX5A 3JV0A 2Q8AH 4KKBD 4QF1A 3CSBA 1T7ZA 3VXUA 5D2LB 1XGTB 4PP1C 5T1MB 4NKDA 1N6UA 4L1DA 2D4FA 2VXTL 5LXGL 1MJJA 2V17H 5FHBL 4HUVB 3FQUB 3G5VA 2EDYA 3CLFL 4LLUB 4BJLA 7FABL 4MX7B 1MIEH 1T4KA 3EUUA 4HAFA 3RZWA 2AK4B 3QNZA 3ILPA 3SKMB 2E7LC 1C5DB 4KI1A 3BKYL 3PP4L 3QUYB 4KJPD 1UKTA 3MLVL 1NL0L 2VDKH 3W82A 2QADD 4ZD3L 3ZSSA 1PQZA 4ELKA 3FAXA 4CMMA 5FYJU 1W8NA 3WFHB 1F4XL 4PFEA 5F1IA 4XBEL 3O3AB 4FN0A 4MMXC 4R4NC 2VUYA 1RUAL 1YEEH 4PJBF 4K7PH 5TDPB 5DJAB 4M48L 2XT1B 4XVSH 1C5CH 4NWUL 4WFFE 3KYNB 1BFSA 3U30B 3SDCC 3T4AB 2BX5A 3C2AH 4I9WE 4OZGE 1BBDL 4RGMC 3WS6C 4LRIA 4MJ6B 3VRIB 3MRHA 1TQCC 1OQXA 4M8QA 3GO1L 2BSSB 4AEFA 4XMLL 3S96A 4H1LH 1AD9B 1IGCH 1NCAL 5FYKD 4GKSA 3QXAA 2FJHB 5T3XE 4NM4H 3W5MA 1FAIL 1PAMA 1S5IL 4O58L 1FFRA 4HXAH 1YNLH 3B5HA 3C5JA 3MOAL 2DLFH 5FO8A 3F5WA 5HGDA 1S7RA 2AERT 3X17A 4F7PA 1SJVA 3PGFL 4DW2H 2LV4A 4LSRH 1GAFL 1OAZL 3T2NL 2Q7YB 3VRLE 4YEEA 4A6YB 3NIGF 4FFVD 5BRZB 4GQ9H 2EYRA 4HWBA 5B3JE 3GBMH 2O5ZL 4JFFE 1R5WB 2F54A 1NMAL 4XGZA 4WWKC 4WUUA 2QQQA 3DRQA 3HI1B 5K93A 1LNUB 4MA7H 1BOGB 3FQWB 3IFNL 1AGDB 1G7PA 4XNZB 1GGCL 4E42B 4HGKC 1KSRA 1S9VA 2FHCA 4IOIB 3O4LD 5TE4L 3GEWB 5B8CB 1CFVH 4WU5B 3QB7C 5DK0A 5KVEL 4JDTL 4JQXA 5MERA 3W81A 4BSVA 1HSAA 2VAAB 4FS0A 3FO9B 3C8KB 2NY6D 2DS4A 4YFDB 1BQSA 4X80H 4KQ4H 3D69A 4LHUG 3FCTA 3L5JA 1IAOB 4DQOH 2VABB 3ARFA 2XQYK 5HSFA 2Q87A 5DT1H 2IEPA 2ADFL 5IVXB 3THMH 4Y16A 1K9TA 3EYVA 5IP4A 4Y19E 5MENA 1J8HA 1U8HA 5BS0D 3NAAL 1I4FB 1I9IL 1YECH 4NWTL 3TT3H 3UTOA 1DUZB 3WV0A 2GJJA 2W9DH 2FZ3A 1NGXA 4K3EL 5GGTH 1YDPA 1HWGB 4I3SL 5DHYA 4XAWL 1F11A 3OKOA 2FEDC 1PFCA 1FL5A 1QYGH 3GSOB 1U6AH 4G6FB 4LEOA 5CEYB 4H0IA 1M05A 3KVQA 4GKZB 3ZTJH 3JV6A 1Q9LB 2R0WH 4YO0A 5F1NA 1II4E 4PBXA 1ZANL 1BFVL 3UZQA 2HRPH 3BZ4A 1ERNA 4IHOA 4PRDB 3UJJL 3QQ4B 1B90A 5GXBB 5ECJE 3WIIL 4JPKL 1UVQB 5C8JB 3H3PH 4QGTA 4NRXB 4XHJC 4EI5D 4PRPA 1MJ8L 4PJ9A 2AP2A 1QRKA 1NPUA 1IAIL 1LE9B 2C4XA 2VXTH 1T0MA 4GAGL 1A7OL 2GHWB 2NNAA 4XCYB 4QWWC 4C54A 5FHBH 1JF5A 5ALCH 1FNEA 5FF6B 3S37L 4PJBB 3MLTB 3CLFH 3DPBA 4UU9A 7FABH 4WHDA 4HS6A 2GIYA 4ZOEA 4QTIL 1ADQA 5IHBA 4GG6A 2V5TA 3UXFA 2C3VA 4Y4HC 2PTTA 1PZ5B 3BKYH 3CX5J 3PP4H 3O8XB 1IAKA 2PW2A 4TUOA 1S3KH 3S36L 2EYTB 1NL0H 1OY3B 5C0BD 4ZD3H 2OSLB 3F6LA 2OR7A 1WZKA 3V0VB 4Y2DA 3RVUC 1G7JB 5GS3A 1TENA 1F4XH 3QH3B 4HIJB 5MEOB 4XBEH 2AJ3B 3EO0B 4G8IA 1RUAH 5DURD 3O6FD 4S0SD 1OAYL 3IDUA 1FZMB 2A6DB 4M48H 1JNNL 1AH1A 3HI6L 4NWUH 3QDJD 4X9FA 1XCTA 1R3KA 4XP9L 1BBDH 1M71B 1LEGB 2FWOB 2X09A 3AAZA 3GO1H 2K7QA 1D5IL 5IB1A 4XMLH 4AENA 2YK1L 3K2MC 3B9DA 1NCAH 4EIZC 2EE2A 2H8PA 5IBLC 3SY0B 4AEHL 2H3NB 1B9ZA 5A2FA 1FAIH 1S5IH 3TP4A 4O58H 3OKDA 1HIML 5ACLA 1W72B 3MOAH 1WICA 2RQ8A 2A6JA 4LSSL 2YBRB 2BSED 3IKCB 4OKVA 4GT7A 2X7LB 1GAFH 4FXKB 4XNXL 2OL3A 1OAZH 2J1KA 4MNHB 3T2NH 4YK4C 3BVNB 2GTZB 2VRAA 1DDHA 1P84K 4LASL 5FM5M 3QPQD 2O5ZH 1DL7L 1NMAH 5CD5C 3ESUF 2I07B 5I0ZA 3C6LA 1CDCA 4FQ2L 1LEIA 4LVEA 5DFTA 1NAML 4HWZA 1A47A 4JKMA 4WW1B 1EBPA 4WU7B 4YDJB 1YY9C 3VXSE 3BDYL 3TH4T 3VFNB 3ULVD 3IFNH 2ZG3A 3OR7B 5D70L 2HN7B 4DKEL 1AKJD 2B1HL 1BZ7B 1GGCH 2ZPKL 2LTQB 1G7HB 2R4RL 2XQYG 3CMGA 1XMWA 5TE4H 5ACZB 5KVEH 4JDTH 1MI5B 3IAGC 1BJ1H 1RZJL 4KVCH 4XBGA 2AXHA 4WO4C 3BZEB 3ZDZF 2XTJD 4W4OC 3I6GB 2Z31A 5GPRA 1JGUL 1QO3A 2HFFA 2VR5A 2CUHA 5GQBA 4NHCL 3W9EA 5A3ID 5GZOC 3G6AB 3DO7A 5I19H 1ZS8B 2MSPA 1HQRB 3NA9L 4N9GA 1QNZL 3DMMD 1H8SA 2ADFH 3PWLA 1FZJB 1F90L 1OP3K 4I0CC 5TDOA 5DDHA 3NAAH 2KKQA 3VGAC 4KZEL 1KCSL 1I9IH 1NBVL 2IC2A 4NWTH 3FONB 1GPOL 2JK5B 3TBSB 3QJHB 3SDXE 1D5ZA 4K3EH 5C1MB 1C08A 4LCWB 2CKNA 4I3SH 4L3EE 1CCZA 2X1QA 1X7QB 4XAWH 4LDLB 1QBLL 2VN4A 4X5XA 1FLTX 4X0KA 4J6RL 4NT6B 2V5RA 4NCDA 1KTLB 4NKMB 1A2YA 4QNPF 5D7LB 3GSWA 5EU4A 1ZANH 1BFVH 3TBVB 1BEYL 1CXFA 4P2RD 4N0UA 3HG1E 4HS8L 4LBEA 2ED7A 4V1DB 3UJJH 1EIBA 3C60C 1LDSA 2D9CA 3WIIH 3KLAB 1NMBL 5J12B 4R6UA 2E6PA 2PXYA 1YEKH 3FQNA 4KVNL 3JUZA 1MJ8H 2HFEB 3KDMB 3JZ7A 5F9OH 1IAIH 4KHXL 4CU6A 1I85C 3WLWD 1WC7A 2ZUQC 3S37H 1UACL 1XR9A 4IJ3B 3ALXA 4JANA 3VWKA 4H0GA 3TZVB 3DYPA 4G9FD 4BQ9A 4OZFH 4QTIH 5K9JL 5ICXA 4X4ME 4CL7A 1OTTD 3K80A 3JSSA 3T4YB 2WP3T 3MJ9L 3IF1A 4JPIA 3LPFA 4I3RL 3S36H 3GB7B 4O2CB 3KHQA 4NQXB 4X6EA 5HHME 1SY6L 3UP1A 5DK2B 4QCIB 3BXNA 2O61A 4HJ0C 5HJ3A 1JCKA 2BXZA 1OAYH 1JNNH 4QHUA 5DWUL 1BQHG 3HI6H 4ZTOL 1P2CB 2AJSL 4XP9H 1FFNA 3QG7L 4M7ZB 4O2EA 5C0AD 2EXYC 3F65A 3AXLB 5H2BB 1S8DA 1MRCL 3RWDA 3GSVB 1S9WA 4PG9A 3DSFL 1D5IH 4R0LA 3VE0A 3RBGA 2YK1H 5HBBA 3WFEL 3MJ8A 3X12B 4AEHH 3IDGA 3SEPA 3GI8L 4XXCC 1HIMH 1WBYA 2JTDA 1PG7W 4NO2B 1PSKL 1QPPA 5FGBA 3JTSB 4EDXB 4LSSH 4N8VG 4LLQB 5DJYA 4Y4KB 3EHBC 4P48A 3T09A 2I9LA 5F7DB 3M1BA 4NN7B 3I6KB 4XNXH 3P9MA 5GHWH 2VLJD 1CU4L 3U48A 4LRNL 4UT6L 5EOQL 4AIOA 3MXVL 4LASH 2OK0L 2YD2A 4X5WA 1DL7H 2IFFL 1N2RA 1FYTD 3F7QA 4S1DC 4FQ2H 4Z7UE 1NAMH 1L4IA 4RQQB 5C07B 2YPLA 3RNKA 4N9OB 1LP9E 1E4JA 1CE6B 3BDYH 3VFMA 4OM1L 3BJ91 5LAXB 2YMXH 2XZZA 5EOCL 5D70H 4DKEH 1QBML 4LCYA 3KPLA 2DQFB 5ID1B 2ZPKH 1BM3H 2R4RH 4OF8A 3BP4B 4KDWA 1IQDA 2BOCB 3OQ3B 1FE8L 1AO7B 4KY1L 4I0PA 2A83B 4GAFB 4PP1D 1RZJH 1Z5LB 3J8F7 3HN3A 4OQTA 4L3CB 5E2TL 1A3LL 3S5LG 1M1SA 1JGUH 5MEPA 3P0VH 1JZ8A 3KPMA 4NHCH 3H9HB 1DLFL 1AXSA 1FV1A 1QLEL 5C2UB 4P5TC 1TJHL 2FJGA 3NA9H 1PLGL 2AV7A 1QNZH 5CBAA 1MY7A 4Y0GA 1F90H 2W38A 3KLHC 5HGHA 1N59B 4U7MA 2EICA 5KN5A 2Z8WC 4KZEH 1KCSH 4TVPE 1NBVH 3NGBB 2IBBA 1GPOH 2H32B 3B9EA 1HNGA 4R4ND 3DVIA 5DJDA 1GZPA 1FC1A 1R3JA 1FZKA 4R2GC 5HGBB 1UM5L 4F15B 3WFDL 2AXFB 1PW3A 4HC1H 1S7QA 5JO5B 1QBLH 4RX4D 3IETA 5EU3B 3NIFE 2R2EA 4J6RH 4QLRA 5C0CB 3SO3C 1M7XA 5FDWB 3ZYIA 3IJHB 1O5DT 4I2XA 2ED9A 4GW4A 3CK0L 4NO3A 4RAVB 4MSWA 4ZO9A 3WXVL 1BEYH 4LQ1A 1T6VN 4WI5A 1D5BB 2AJZB 3O81A 1ED3A 3IGAB 3U7WL 3AMKA 3FFCD 3L6FA 4LSQL 5DLML 3RPKA 3O6LL 3B6SA 4U1JB 4KVNH 4PLNC 4GRLA 4QF1B 5I0DA 1OF2A 4G8GE 1CD1B 4LLMA 3VXUB 2MOVA 2XN9A 3NFNA 4NKDB 1D9KC 2QV2A 1UACH 4XMKL 2AEQH 5HYSA 1OT1A 1MJJB 1B4JL 5DJ0A 1T21A 5K9JH 4WWKD 5KS9F 4PJ5E 3G5VB 2VWEE 2FIRT 3NTCL 4WTXA 2F15A 2RBLA 3MJ7A 4P5MA 3D39E 3QNZB 1OP9A 4I3RH 4AIXA 1SY6H 3KYMA 3LRHA 35C8L 3LPWA 1OQOA 1OLZA 4ZUSB 3MREA 1T3FA 3UAJC 4F37K 2E9BA 1PQZB 1I8KA 4ELKB 1KGCD 1XCQA 3OJ2C 5I73C 4CMMB 5KSBE 3CFCL 1NH6A 4U6XB 2IPKA 3TH3T 5F1IB 5DWUH 4ZTOH 3C08H 2AJSH 4WHYH 3H9SD 3QG7H 1E4XL 1MCJA 4EN3A 1MRCH 3AB0C 2N7AA 4GG6F 2DLIA 4KXZH 1EEQA 3DSFH 4WV1C 1WFUA 1U8LB 3MODL 4U1IA 3MRHB 1A6AA 3ARBC 5F6HI 3WFEH 2XACC 2J8UE 4M8QB 4C56D 4LVNC 5L0QB 3S96B 1Q9KA 3GI8H 1HHIA 4GKSB 3QXAB 3C5ZC 2UWEA 1IEHA 1JVKA 1J1PL 1UXWB 2WAHA 1PSKH 4OFDA 1JP5A 3QT2A 2DQDH 2R0KL 3EDFA 3C5JB 1YPZA 3QUXA 4HGWA 4J1UA 3F5WB 3IAPA 5HGDB 3L7EA 1VCAA 1BWWA 5CS7A 5T1KD 1CU4H 3HAEH 5K9QG 4LRNH 4UT6H 5EOQH 5T1LA 3BGFC 2OZ4L 1A14L 3CVHA 3W5NA 2WLYA 4RZCA 3HS0A 2D7NA 1KG0A 2FEDD 1TZHA 2EYRB 3X11B 3WLBA 2J8OA 3T65B 4YFEA 1AFVL 1YEGL 3LV3A 4WUUB 3BP7A 3DRQB 4LL9A 4GQPH 4Z7WA 1CG9B 1TTGA 4OM1H 4PJCA 3MRFA 5EOCH 1LK2B 1DFBL 3ILQC 1QBMH 4BM7A 4Y2OA 2UZXB 5F88A 5TH2A 3MMEB 2WZPD 3O6FA 1EHAA 5EZIL 5D8JH 1H5BA 3MZTA 4XHJD 1FE8H 4UZGA 4KY1H 5L2KE 3PWPA 1T1XA 3WJLC 4J3WA 3GRWL 2JJWA 5DK0B 1U8IA 1A3LH 3L3HA 3RWEA 5MERB 4QWWD 4APQC 1OHQA 4BSVB 2YC1A 4P2QD 5CIPH 3TPUB 1DLFH 2G2RB 3PIQA 4MDIA 1QEWA 1QLEH 3DNKA 4JFYA 1AGEA 1FFPB 1KPRA 1MUJA 1TJHH 1DQDL 2A2QT 4Y4HD 4LCCC 1PLGH 3D69B 3GMNB 2VH5H 3FCTB 2GJ6E 1CQKA 3QDMA 1RJZA 5I76A 1MY5A 3O2DL 2X4NB 3OGCA 1PX4A 3ARFB 1U3JA 4M93B 5BQ7A 1QA9A 1OGAD 3GSNB 1OAQL 3JWOC 3ARWA 3RVUD 4Y16B 1ZA3B 3EYVB 5MENB 1J8HB 3VGGA 1JMZA 4Y89A 1M6OA 1XGYH 3SJVD 1NFDE 4DZBB 3TESA 3NPSB 1UM5H 3KJ6L 3WFDH 1A7QL 1RVFL 5DHYB 5ESAB 2EEDA 3MCLH 2F53D 2BY0A 3U46B 1F11B 2BSRB 2I26N 1I8LA 2C1PA 4P3DB 2NX5E 1FL5B 4B7IA 4JFEB 1M05B 3CK0H 4OCXL 3MNZB 1VPOL 5SV3A 3RTQD 3WXVH 4OD3H 5SWZE 5IBLD 2BNRE 5HPMA 5KS9B 1AKJA 4H1LA 2YD8A 3U7WH 2LVEA 4LSQH 1ZXQA 3N1MC 5EFIA 4FG6C 5DLMH 1G6VK 4IHOB 4KPHH 3O6LH 1BMGA 2DMKA 4YBLC 1EEYA 1AHWA 4MAYC 4Z7VE 1RJLA 5BV7C 2CO6B 1IEBA 2WWKT 4ZFOA 1WAAA 5EORL 3JWNC 4PJ9B 4JVWA 2A9ML 4XMKH 1QFUL 1T0MB 4FQXC 3MZGB 1B4JH 1T89C 3PNWA 1FNEB 5CD5D 4P3WA 4PP2A 1AGBA 3TCXA 5GRZA 1DQLL 3NTCH 3GK8L 4UU9B 2XY1A 4X7DC 2NY2C 4O2FA 1WWBX 4HS6B 4GG6B 1FN4A 2C3VB 5HYIA 2F9BT 1J7VR 2PTTB 5IVZB 1YY9D 1U8QA 1IAKB 2PW2B 35C8H 1F42A 4MNGB 1KJ3L 1EO8L 4HWNA 4Y2DB 2ICWJ 3WE6A 5J13C 3CSYA 1DEEB 4Q97A 3H7BA 3QFDA 3CFCH 3MV8D 4P99A 1ZK9A 5L8KB 4L4VA 4G8IB 4RCAA 1KEML 3HE7A 3BPNC 2WIIA 4K2UL 1ZVHA 4WO4D 1XCTB 1R3KB 5GZOD 2B2XL 5DVOA 5I66A 3MODH 2V2TA 4KV5E 1K85A 3AAZB 3OL2A 4XBPA 1WWCA 1RZIB 1U91A 3ECBB 4P2RA 4AENB 5K9KA 2Y36L 5I1CL 1L0YA 1B0GA 4PJ7A 2PTUA 2H8PB 1O0VA 3BPOB 1J1PH 4FTVE 2R0KH 4HUUA 2BMKA 1TLKA 1MAKA 2A6JB 4DOHB 1RZFL 5HHOD 4HW6A 3WFBL 4OKVB 1NDMA 2R39A 2MKWA 4WCYL 1R3HA 3GJFB 3E6HB 2OZ4H 1A14H 2DBLL 2OL3B 1V3MA 5GGTA 1N0XH 2FLRT 1AFVH 1YEGH 2JCCE 3VXRD 5DMIH 1JGLL 3RQ3A 4HWZB 3UTPE 4OCSL 2FO4B 4PJ8B 3S4SA 2VIRA 1DFBH 2G5RA 5I1HL 3VGDA 5MHSE 1CDYA 3C60D 3MRJB 4JG1L 4GAYA 4L8BA 3KWWA 2RFXA 3GMOA 1NDGA 5IOPB 4IRJA 5FGRA 3RKDC 4MD4A 4W6WB 4PRIB 2OS7A 4XNQA 3VWJC 3FQRB 3V0AC 2I9TA 4FXGB 5C0AA 2F54E 1IILE 3IJSA 4LARH 2DD8L 3P4LA 2Z31B 3BGMB 3EYFA 1ZLUH 2HFFB 5AWNL 2HT4C 3W9EB 1QSEA 2WUBL 1DQDH 3L95A 4JGMA 3DI2B 4YHNA 1KYOK 5DQ9B 1HXYA 1FL6A 3O2DH 3I75B 4QTHA 5B38G 3B8SA 3G5YB 3R0NA 3ETBF 4M4PA 5TDOB 4HLJA 5DDHB 1UXSA 4BK4A 1A7RL 4HJ0D 4ZSOA 4PJAA 4PJHA 3VFPA 4ORGB 5IIEA 1I1AC 3OB0K 5FO9B 3KJ6H 1A7QH 1D5ZB 4FFWD 1MCFA 5SWSE 2EKSA 4NFCA 2DM7A 1RVFH 3KPNA 5T3XL 4X0KB 4ZFFB 4NHUA 1IRAY 4GXUN 1VPOH 1EMTL 4AQ1B 3PGDA 3GSWB 5EU4B 4Q9BA 5GGVY 1J1XH 3T3MF 4LBEB 3OHXA 1PKQE 2CXGA 1ZT7B 3EHBD 2I27N 1EJOL 2PXYB 1EFXA 1KXTB 3FQNB 3QQ9C 1HH9A 3WS3A 3LQAC 5E94B 1RD6A 2A9MH 3CC5B 5J11C 2BVUA 4YUEH 5DHVB 1QFUH 3O9WB 4N0FB 5IBUG 4U0QB 4A2LA 1WC7B 2EDOA 5KBNC 3RWFB 1XR9B 2GCYA 4JANB 5J1AA 4S1DD 1DQLH 1ZGLA 3GK8H 4H8WC 3BN9C 2CIIA 1KCUL 1OW0C 2ED8A 3JWOH 1MCKA 5IG7A 2FB4L 5BJTA 1PVHA 2XKSA 3IF1B 2DKMA 4NZTL 4JPIB 1KJ3H 1EO8H 4QRRB 4WFED 3KPOB 1ZVSA 4X6EB 3OJDA 4ELMF 1VACA 3BXNB 2O61B 1GYAA 1XIWB 1KEMH 5EWIH 3UYRL 4RX4A 3SDCA 1D6EA 1QSFD 1F45A 2P8LA 1FFNB 1L0QA 1R6VA 2B2XH 3RI5F 1S8DB 2EIZB 4YR6A 4P5TD 3VE0B 1I1RA 2ZSVA 4M61A 2Y36H 3BP5B 5I1CH 4XC3L 3IDGB 5I8CA 5BV7H 5E5MA 3KLHD 3QDGE 5AAMA 1WBYB 2NR6C 4FQ1H 1PG7X 3V8CA 5FK9A 5DMJB 1ZLSL 1RZFH 3WFBH 5DJYB 2WW8A 4AT6A 3D3VD 3M1BB 4WCYH 3BQUC 3FO0L 4R2GD 3P9MB 2DBLH 2HJFA 4HV8A 3DWTA 4H8WL 2B7DT 1ORQA 4WWKA 1KCVL 2NZ9C 4M3KB 3QIUA 1QACA 4KI5D 4OFYD 5I8KL 3ULUC 2APBA 3OXSA 1JGLH 1T5XA 4IDLA 2NXYB 3U0PB 4L9LC 1ZEAL 2UWEF 4OCSH 2YPLB 3MO1A 4LMQE 3RNKB 2A6IA 1GJIA 2BHYA 5I1HH 4WIQA 3X14A 4D9QE 1YPZF 4NO5A 2L7UA 4JG1H 3WIHL 2X1PA 4FZ8L 2NY1D 1HHKA 1NJ9A 1KACB 2YD7A 4HWEL 1J0YA 3OKEA 1IQDB 3H9SA 1IGYA 2YXFA 1KJMA 4I0PB 2GY7B 5SX4H 1D9KD 2DD8H 5I1GL 2ESVE 3HA0A 3MRBA 2HFTA 5FYKU 5AWNH 5I1LA 3KPMB 4OV6F 1CDJA 4Z7WF 5I17A 3U0TB 2WUBH 4PGCA 4F2MA 4JO4L 1AXSB 1FV1B 1UWXH 4OZFA 4JRYB 4MCZB 4YDIL 2FJGB 4FQPA 4MQTB 5CD3A 3WNNA 2AV7B 4O9HL 4CJ1A 4NQDB 1UWGH 3UAJD 2DI7A 3L3IA 4AYFA 4DGYL 1A7RH 4R4BA 5T1KA 5GGSY 1LVEA 3BH8A 4I8DA 5C08D 2Q86B 2EC8A 5IHUL 5DJDB 1GZPB 1R3JB 3ZDXF 5E70A 5E6ZA 3KG5A 4P9ML 1B88A 4QOKE 5CJXC 2YUWA 5T3XH 2R2EB 4TNVK 1EMTH 3ARBD 2ZNWA 3W11C 4I2XB 1CD0A 2AS5M 4N5UA 4KTDL 4NO3B 5L88L 4LFHD 1SHMA 4MSWB 1NBYA 2XWJB 5D7SL 4TPRL 3C5ZD 1HKLL 4MMZC 4C4KO 1KIPA 1CYGA 4MJID 2EEBA 1FP5A 4JE4B 2AV1A 1EJOH 3B6SB 1A3RL 4ELMB 2Y72A 4GRLB 1OF2B 3N9GH 2R1YB 4P2QA 4LLMB 3L3JA 1BOYA 1G7IA 4U33A 2XN9B 4HUKB 4P9HL 3NFNB 3UBXI 2X89D 2P5WD 1KCUH 1VFBB 4Y4HA 1T21B 2BZDA 3TIEA 4I4WB 4N0UE 4PB0H 5BMFH 2NY3B 5BOZG 1FLRL 1NAMA 4P5MB 4NZTH 1OGAA 3MLUL 3UZEA 1KBGL 2J8HA 1HYSC 4QEGA 5CBEA 3KYMB 5EBGA 1CFNA 1K4CB 1T3FB 2E6JA 4X7FC 1X4XA 1I8KB 2HLFC 5C0JA 1XCQB 4C57C 1NC2A 3FOMA 1K2DA 1GIGL 2Z35A 4JJHA 2IPKB 3UYRH 2VDML 3VW3L 3N1PC 3ZYOA 3KXFB 1H3TA 4APQD 1FRGL 3LQZA 1RUKL 1CICC 4DVBA 4QXUL 1FZOA 4YZFF 5DQJA 4EN3B 4RIRA 3VJ6B 1IE5A 4WI8A 2YOCA 1H3GA 2VXQL 5FUOH 3O3DA 4U1IB 4ZAKC 5FOJA 3CFJB 3WBDA 3P9LA 4XC3H 4NYLB 5JNYA 2X9YA 5IQ9A 1S78C 2Y7QB 3UBXA 1Q9KB 4J3SA 3VG9B 1HHIB 3EYOA 1S7TA 2UWEB 4FQQA 1CLOL 1WT5C 3VFTA 1ZLSH 3I3BA 3TVMC 1YPZB 3QUXB 4HGWB 4J1UB 5GS0C 1IBGL 1KN2L 1S7VA 2HFGL 3ARSA 3NZHL 2QHRH 4H8WH 5T1LB 2KPNA 4ZNCD 1EO5A 3UTSE 1KCLA 4KDVA 1P69B 4OCLC 1T20B 4ALAH 3FFDA 5IKCA 1KCVH 1KIRA 1A4KA 2QSCL 3HS0B 5I8KH 4HC1A 3WLBB 4PJ7F 5LG1A 4IM8A 1UWEL 1ZEAH 2DQEL 5BVPL 4Z7WB 2BVPA 2ZKHL 3P0GB 3VFGL 2ZZUT 3MRFB 3WIHH 3BWUC 4FZ8H 4D9RD 4FG6D 3MV8A 5K59F 3QUKB 5EPMA 2C3HA 1Q0YL 5F88B 4E41D 4MAYD 4HWEH 5TH2B 5HHQA 1JGDA 2W0PA 1H5BB 3DVGB 1BZQK 3PWPB 3QI9C 4KXZI 4B0MM 4W4OA 2BVOA 4HX1B 3CFBA 1U8IB 4FQXD 3WDIA 3L3HB 3PHSA 2DN7A 1UEMA 4Q2ZA 2C4FT 3PIQB 4JO4H 4MDIB 3VXMA 5E1AB 5JHDD 2NY2D 1QEWB 4Q0XL 1AGEB 1MUJB 4YDIH 3ZT6A 4O9HH 1F3DH 1N6VA 2YPKA 5JPNA 3BD3A 3LZFH 3QDMB 1JV5A 1GVIA 1RJZB 5GS0L 3OGCB 5BQ7B 1J12A 5MI0C 2GITB 3IJYA 2RB8A 5J6HA 1SY6A 4DGYH 2IPUG 4BK5A 3L5WA 4N5EC 1MFEL 1TTFA 2P46B 2G5BB 1M6OB 4OIBA 5IHUH 1TPXC 3CSGA 5EIIA 5FOBA 2VLKA 3GMQB 4JZNA 5T5NG 4P9MH 5FGCB 4KROC 4MXWL 5FYKE 4U1GB 3QCVL 3WNKA 3DVNA 3QQ3B 3FRUA 3N0PB 1KV3A 5DGRA 4HK0A 2C1PB 5KSAC 3EO9L 2X4TA 3K46A 4XX1G 1L9NA 1NCCL 1INQA 2B5IC 4KTDH 2VL5B 4KQ3L 3RAJL 3DTXA 3NVQA 5L88H 1FCCA 4GLRH 5D7SH 5IK3A 4TPRH 1X4YA 1HKLH 2ADJA 3QNXA 4Q6YA 1F3JA 4JRXA 4FQHA 4H1LB 5E8EA 4P49A 1RURL 3QIBB 4PJHF 5EFIB 4R97B 3HUJA 4PRHD 1WFTA 1A3RH 1EEYB 3PDDA 1AHWB 3SOBL 1RJLB 2EDWA 4G6KL 2ORBL 1IEBB 4PJIE 3X3GL 3PF2A 4Z78A 4P9HH 3HAEA 1YUHA 4H25B 1T04B 1PDKA 5IJVB 1VFMA 3PNWB 3M45A 4L1HA 2GSGB 3AROA 1AGBB 1MWAL 4L29A 1FLRH 4PG2C 2RJMA 4O2FB 4OUUA 4DGVH 4RRPA 5GGRB 3MLUH 1FN4B 1DLHA 1KBGH 2R0LL 4JFDB 3O4LE 2V2XA 4OB5L 3HRPA 4X6CA 1G1YA 5DZOA 1BAFL 1TVHA 2QKIA 4CVZA 1MVFA 4QY8A 3ARGA 5E1HB 4ODHL 3RKDD 2H26B 1GIGH 3VWJD 5INCB 3MPCA 3STZA 2F8XC 3VW3H 1U8PA 3FB5A 1S9XA 2V7HA 1FRGH 2WIIB 5I71B 1RUKH 4G6JL 4QXUH 4L4TD 3EBAA 1U8OB 3P11L 5CCKH 4WHTA 3D18A 2FO1A 2HT4D 5CIPA 2VXQH 5I66B 2V2TB 3OKMA 1OTSC 4TVPL 5BS0E 2W07A 4ZS7L 1U91B 1BREA 5K9KB 3KPRA 3QAZB 1B0GB 1UH3A 5IFJA 4PJ7B 5BXFA 1MH5A 1CLOH 2X4QA 5JIHA 3W0WA 4DEPC 4EUPG 4LPYA 1M7IB 3HZVA 1QQDB 3FKUS 3RZCB 3SE8L 1UM4L 1WISA 4HUUB 2BMKB 1IBGH 1KN2H 3CX5K 2HFGH 4RMQA 5J1TC 1I1YB 3DX9A 1I1AD 3NZHH 2W60A 1F2XK 4F33B 1NDMB 3BRFA 1JTOA 3ZYJA 3CPLA 4WW2C 2VMFA 3GFUA 1DVFC 2QSCH 5I8OL 1CFSB 1HYRC 3SKUD 5CJ8A 2DQEH 3DUHA 2Q3ZA 1JUFB 3BAEL 3VFGH 2WQRA 1W0VA 4LLVB 2VIRB 1MVUA 2ICWI 2ZWLT 4J3TA 5FYLE 4Q74A 2FRGP 1T1ZB 5C86A 1Q0YH 5D7JC 1NBZA 4L8BB 5AEAA 3SPVA 3KWWB 4G43A 5L8LB 1NDGB 4IRJB 3B9KC 2JJSC 1KN4L 1ZGLP 3QQ9D 3RPIA 4OAWA 4PGDA 1QSFA 1DANU 4GXVH 4JY6A 3IJSB 2YR3A 3VFWB 1NGWA 4JRWA 3ZKXB 4UT9L 2GEEA 1NMCC 4G7YL 4RGNC 5C0BE 4RWHA 2KL6A 3BN9D 4PJCE 3EYFB 1FORL 4HUNB 4Q0XH 4LVOC 1QSEB 4YHNB 2R9HC 4P57A 2D7QA 3TNNA 2WIMA 3BKCL 1FL6B 3SN6N 4PR5A 1TVBB 4LHJB 4HHAA 2DL2A 5GS0H 4UOW0 3FRPG 4BZ1L 2UZYB 3QDJE 1J0ZA 3SGEH 1MFEH 1UXSB 4QKXB 1EHLL 3UTTB 4ZSOB 1I8MB 2EH7L 4PJHB 3VFPB 5GZNC 2O93L 5IIEB 5CJOL 2ICWA 1IZJA 3VH8A 5D1ZC 4MXWH 1UENA 2EKSB 5JOPD 3FO1B 4HBQA 1CS6A 4HFUL 3DYMA 3TPKA 2M1KA 1JHKL 2WBJC 2VUOA 3C2SA 3EO9H 5JQHC 1NCCH 1CGSH 2ZSWA 1Q38A 4JJ5A 4KQ3H 3HNTL 1HHGA 3SGKC 3VRJA 2X5PA 3PGDB 2QQNH 4DCQA 1RURH 2NR6D 5IB5B 4Z18A 3FN3A 1MHCA 1WITA 2WANA 2H2PC 3SOBH 4MYWB 4G6KH 2ORBH 4JG0L 5I1KL 1D9KA 1EFXB 3BQUD 2YD9A 3X3GH 1MFCL 5A1AA 4UB0H 1VENA 3OV6A 3VGFA 1B0WA 2NZ9D 3C5SA 2OZ4A 1MRFL 3ULVE 4LKXA 2GCYB 5I1EL 5J1AB 3ULUD 1MWAH 2F74A 1ZGLB 1HHJB 5D2NA 2CIIB 1BF8A 4GBXA 3TN0B 2GQHA 3FL7A 5IG7B 2R0LH 2VN7A 1CL7L 4NNYA 5BJTB 1CDGA 3KJ4C 5FYJD 1Z3GL 1BAFH 1ZVSB 4D2NA 3IAQA 4LHUD 1A6VL 1ZOXA 2QLVB 4H26B 1VACB 4F7TA 4ODHH 1U3HC 3LKQA 3RL2A 4DFHA 3WCYA 2D0FA 4LCWE 3ZO0A 4JVPA 4KFZC 2IANB 5DTFA 3LAFA 5DZLA 3SDCB 3OKLA 1D6EB 4G6JH 3MQIA 4WV1A 3MYZA 3P11H 3CX2A 1ND0A 1BQUA 3MV11 1MLBB 1Z9MA 4ODTL 1WVZA 1KUMA 4G5ZH 4TVPH 3UYOD 4YR6B 2DTMH 5D7LE 2BHZA 4ZS7H 3C5ZA 1A6ZB 4M61B 3LS4L 4IRSB 5D5MF 1Q0XL 1A7BA 2AW2A 3L5XL 3O2DA 3SE8H 1UM4H 1GOFA 5FK9B 3D2UA 1GC1L 3T0EC 5JQ6L 3ROOB 3MNVA 4AT6B 1LD9A 4G8FA 2HJFB 1YMHA 2P5WA 2AJXL 5I8OH 2O5YL 3T8XB 1FC2D 1KIQB 3QIUB 4P2RE 3ZZ1A 4PJFA 2C9AA 1SEQL 4U1NA 4I18A 2P5EA 2OMNA 5JOEA 3W11D 1BX2A 3BAEH 2VLLB 5HI4C 3MO1B 4UILL 4PBWD 1WSST 4HEME 4U3XA 4F3FB 4WTWA 3DXAD 3X14B 1W2KT 4NO5B 3CSPA 1CFQA 4F7MB 1BVLA 3NBNA 1T0NA 5DRXA 3WDHA 4JO3L 1JZ4A 1HHKB 3WJLA 5IR1A 1DN0A 5E5RB 1KN4H 3LD8B 2D31B 4G9FE 1FG2A 2JE8A 3OKEB 4HXBL 5ERWA 2YPVL 4L3ED 1P4LA 2NW3A 3I85A 3IU4L 3JWDL 4M1CC 3I02A 1EGJL 5F7NC 5C9KA 2R1WB 5E9DD 4UT9H 1FNFA 3IDNA 2OLDA 2P47B 3T3PE 4G7YH 4NQCB 3MCG1 3MUY1 3A6CL 3MRBB 1X5FA 1FORH 4LCCA 5I17B 5DJ2A 5DEFA 4MHHI 4F2MB 4QRPD 3BKCH 3S88L 4QHNA 4OZFB 4HG4J 3GHEL 5CD3B 3OR6A 2N4IA 4BZ1H 1HYSD 4OGXL 2A9NL 3VU2A 4MLSA 1MCHA 3U9UA 3UJTL 5HDQL 5JXEC 1ODAA 3L3IB 2HLFD 5IMMA 4R4BB 3KPQA 1EHLH 3MRIB 2EH7H 4HK3N 3O4OC 1C7SA 1OP3H 4PBVC 5CJOH 4Y1AB 5E24E 4XAKD 3LRSA 2ADGA 3SDAC 4MJ2A 2NZIA 4PS4L 2VXVL 1JE6A 1CICD 4HFUH 3LKOB 1EFQA 1JHKH 4NQVA 2GTWB 3F62A 3G6JA 3ZDZE 5C07E 5J06A 1IFHH 4EKXA 3MCKA 1AR1C 4ZAKD 3RJQB 3HNTH 3V95A 3QFJA 2JIXD 2OI9C 1S78D 5HD8C 5E6IC 4K3JL 1NBYB 2HVKA 2X4PA 2VLJE 2FGWL 3T04D 4MAYA 3CU7A 1I75A 1LMKA 1RMFL 5CEXA 4LVHB 1KIPB 3SGJC 2VZVA 4OLEA 1F4YL 1IGTA 5SX4I 3TVMD 1J11A 5GS0D 1F4HA 5HYJA 1FYTE 2AV1B 5I1KH 2P8MA 2VO5A 3BESR 1MFCH 4FQXA 4EVNA 4OZ4A 3T77A 1FNSL 3UJIL 1YY8A 3EYUL 1G7IB 2BJML 5EOTB 1MRFH 3HZKB 1YMMD 1FHGA 5JHDA 4Y5VA 5I1EH 4URTB 3MACL 4NNXA 4FOMA 4OZIF 2DLHA 3MV9B 4JREB 3MLYL 2VR4A 1LO4L 3TIEB 4O51B 3MUHL 3H9YA 3Q5TA 2GAZB 1CL7H 1NAMB 3RWJA 1WWAX 3NIDF 1LO2L 3WDJA 2DM4A 1N5AA 4OBRA 1NEZA 5T1DL 1JFQL 5CBEB 5D5MB 1DE4B 2NXZB 1CFNB 2CDEB 2VDLL 4JKPL 3E6FB 4KRPC 2HWZL 1NC2B 1OAXL 3QI9D 1K2DB 2V9QA 32C2A 5SX5K 1CR9L 1FVEA 3OMZA 3U7YL 1OCWL 4JN2B 5AZ2L 1G1CA 4M00A 4G6ML 4JVUA 3LQZB 1RK0B 4NQTA 1FZOB 5JW4M 1K3ZA 4UAOB 4ODTH 4RIRB 5TFSL 1FJ1A 2LAAA 5LBSL 3X3FL 2J12B 3QEQD 5IM7A 4M62L 2APVA 1L6ZA 3LS4H 3O3DB 1Q0XH 3TIDA 4X6CF 3P9LB 2EDXA 2HLAB 5EO9A 1A3QA 5IQ9B 3L3KA 3UBXB 3L5XH 3AREC 4NZJA 3EYOB 5FA4A 1S7TB 4FQQB 1UADC 4YGVA 3CUPA 2XZCL 1Y6KR 5JQ6H 2RAMA 1NGZB 1T66C 2HP4A 3R8QA 1KJVA 2A0LC 1S7VB 3BUYA 3MV7B 4MNQD 2VLRD 2GI7A 2AJXH 3VMPA 4GKNA 1XGPA 3P4NA 4KROD 4U0RC 2O5YH 3FFDB 4NQED 1KIRB 4ZPTA 3ULSA 3MBEC 1A4KB 1SEQH 3SE4C 3FFCE 1X6LA 2A73B 4OGYL 4UILH 4YC2B 2WK2A 3L9RA 4CU8A 3VFRA 1JK8A 4Z7QF 1HCFX 4WHCA 2BVPB 3TGXA 3VFVA 5ESQB 4ETYA 4JFOB 1EAJA 4JO3H 1NKRA 3DIFA 4D94A 3VWJA 4HKJB 5EPMB 5IROC 1DN2A 1JGDB 4HXBH 1G0YR 2YPVH 4HUWB 4K8RL 3IU4H 3JWDH 4JFFA 1EGJH 2BVOB 2EZ0C 2IH3B 1FQ9C 3CFBB 4P2YA 5ISZB 4ONFL 3M07A 3ZMRA 3A6CH 4LPVA 4YHML 1IAMA 4TUKL 5DJXA 2WINA 3KR3L 3VXMB 4CDHA 2UY7A 3U4EB 4UQ2A 3S88H 1JZ6A 1HKFA 1KGCE 5DYOA 5ANME 4JZJA 1DBML 2YPKB 2P4AB 1JV5B 4OGXH 1QOKA 5HDQH 3Q1SL 5J6HB 2DB8A 3GSUB 3BPLB 1TNNA 1I1AA 1MCBA 1RZ7L 4NJ9L 1MHHA 4NOBA 2YEZB 1ADQL 4GW5B 4G8GD 1L0XA 1FVDB 3CMOL 4XH2A 1YC7A 3K81A 5FOBB 1QRNB 2E7BA 2VLKB 4PS4H 4JZNB 1DR9A 2VXVH 4C56E 2DOCA 1NANH 3SE3A 4M7LT 5TPWL 1JN6A 3P73A 2ZOKA 3ZLQC 2Z8SA 5DMGD 4P2OA 4K94L 1OTSD 2D2OA 1GCFA 2X4TB 4PGBA 4AEIL 1IC1A 1INQB 1MAML 4Y19A 3DTXB 4K3JH 5BW7C 4OZIB 3MRPA 5IK3B 2FGWH 4AEEA 5IB3A 5HHPA 2ADJB 3QNXB 4NKIL 1F3JB 4JRXB 4FQHB 4KTEL 1RMFH 3O2WL 5E8EB 5TQ0L 2XICA 5H37G 3U7AA 1UJ3C 1F4YH 3V6OC 1X5KA 3H42L 1E27A 3TA3A 4D0BA 2L0DA 4L5FL 2GJZA 1DCLA 1A9BA 2AXGB 3VXQA 5DMYA 1MNUL 1FNSH 1V7NH 5I75C 2BJMH 3K8LA 4Z78B 1DVFD 3HAEB 4U3HA 3U36A 1FH5L 3PV6A 2GKIA 1H9VA 1EVTC 3REVA 4U1SA 5FB8A 3FT3A 1A21A 3MLYH 1LO4H 3LKRA 4L29B 5HVGB 3ZTNL 1K5NA 4F9LC 4OUUB 3TFKC 1LO2H 3F12A 3D6GA 2CLVA 1DLHB 5T1DH 1BZ9A 1JFQH 1JWSB 5TJWK 5TF0A 4OZHE 2DICA 3RL1B 3VD9A 4X6CB 3EOTL 1Z9SA 2VDLH 4JKPH 5D7JD 5I9QC 1NUNB 2QKIB 4CVZB 1T1YB 4P2QE 5TF1L 3RDTA 1R3LB 3B9KD 4QY8B 5F6IC 3ARGB 2HWZH 3W9DA 4XPGL 4J3OC 1OAXH 2EECA 1K6QL 2DWEB 2GUOB 3SHSA 2MHAB 4U31A 2EYSB 3U7YH 1OCWH 3BSZH 5AZ2H 1U8PB 5LWYL 3FB5B 2V7HB 4G6MH 4RBPH 3QO0B 4RFOL 1E4WL 3FT4A 1BD2D 5CUSL 4RGND 1J05A 4LSDA 5TFSH 1OGAE 3JVGC 3D18B 4JFEE 5LBSH 3X3FH 4YPGA 4F8TA 1IL1A 5CIPB 2PUQT 2HVJA 2R9HD 1T1WA 4P4KC 4Y4FB 1UEYA 1YNTA 3FN0L 3SJVE 1T83A 3H8NA 1GHFL 3KPRB 5F9AC 4U1LB 5BXFB 1MH5B 4LAJH 3PWVA 1LO5B 3W0WB 1OAKL 3BP6A 3T0DA 1G9NC 1P53A 4NP4H 2XZCH 5F7UA 1SMAA 5I1DA 1D3CA 2F53E 3BQUA 2MTPA 5D6DC 5HDBE 2BVQA 3SDDB 1DBBL 5GZND 5H35B 3DX9B 1KT2A 3PXHA 2W60B 5D1ZD 3U6RB 3CPLB 1QFOA 5I16B 1GZQB 1OGTA 1DZBA 4DUWA 4OTXL 1RZKC 4U1KA 4OGYH 3WKML 5D7KD 2E5EA 1C8PA 3LEVL 1YEJL 3Q6FA 4MNGE 4LHUA 1AP2B 5GS1C 2GK2A 3GZKA 1MVUB 3PHOA 2RGSA 4TULL 1Y18A 5GJTL 4CVUA 1MCEA 2OXHA 4DN3L 3EJYC 1NBZB 2H2PD 3LKNA 5C0DA 4NO0D 4K8RH 4X4XB 3RPIB 4OAWB 4PGDB 5JXAL 1J0JA 4CW1A 4PJFF 4ONFH 3RVVC 5C0NC 4JY6B 4Y5XB 4YHMH 3MRRA 1NGWB 4JR9L 2NX5D 4TUKH 3H3BC 1FFOB 3KR3H 3VI3E 3VXSA 4YDVA 4M6AA 2DRUA 3MRQB 3RHWK 1HWHB 1LO0L 1G9NL 4P57B 1DBMH 3QPXH 5EC1A 3QJFA 3TNNB 1IGJA 3GKZA 3QBTB 4HHAB 5HHVL 1IARB 3Q1SH 2MKLC 4OF0A 1RZ7H 1KCRL 3MA9L 4NJ9H 1ADQH 1U3HD 1YEFL 5LCVL 3CMOH 1YYLL 2BCKA 5C0RL 3U30C 5IW1B 2ICWB 4UI2A 2DBJA 3VH8B 5TPWH 3VD4A 4KJPC 1QVOA 4OLWL 4K9EC 1NCNA 3SBWA 4K94H 5FKPA 4AEIH 1CGTA 4Z8FL 5EBMA 1SEBB 3A0OA 4JJ5B 1MAMH 1HHGB 5EC2A 4HGMA 4U6YB 5HHOE 4WJ5A 2PYFA 5F9JA 3O45A 3WSQL 3VRJB 4NKIH 3C09B 1KNOA 3ARRA 4KTEH 3EOYG 3O2WH 4S2SA 4BUHA 1ITBB 3SDXA 1U2CA 3H42H 1HNFA 3IRZA 1MHCB 4L5FH 4PRIE 4L3EA 3T0ED 5JW4R 3OJVC 3AFLA 3WNPA 5F1KC 2G75B 5GIRB 3VXRE 1MNUH 3DROB 4FHBD 4TVSa 1P7KB 4GUPA 3G6JF 2V5MA 1TNMA 1FH5H 5FCSH 5L9DL 4TNWF 3C5SB 3BEWA 1IM9A 3OKNB 2ATKA 5J89A 4TSAL 1LEKB 4LKXB 2DJ4A 2NY7L 5IEKA 3HG1A 4EQ2A 5D2NB 3S8WA 3FT2A 3EO1B 3MRLA 3BMVA 4YE4L 4KRMB 5HI4D 4ZFZA 4GBXB 3UX9B 1JYVA 1UM6L 3SGEI 4XNZC 1T03L 1A4JA 3EOTH 2AQ1A 5TF1H 3SKNA 1Z9OA 5AD0A 5B8CC 4F7TB 4XPGH 2A1WL 3RL2B 3LKQB 1K6QH 1U95A 4IS6A 4PJEE 1CICA 2J6EL 4CADA 4M1CD 4XZUA 5LWYH 2DL9A 1T2QL 5DTFB 5CGTA 4X4MA 1WQVT 3OKLB 4RFOH 1KTDB 3MLZL 4XNMA 5CJ5A 3OKKA 4ZXBB 4OM0L 3TBTA 1AGFB 2D03H 5CUSH 3PL6D 3V2AR 2VZ1A 4RMTA 1RFDL 3ZT7A 1ND0B 1XF2A 2JIXA 5MEQA 5EZOL 5BVJB 3FN0H 1YN6B 4JQVA 4JM2F 1HH6A 1GHFH 5F8RC 5MHSD 4HMDA 3QXDA 4NCC1 1OAKH 3V4PL 5JXED 1IC4L 4WFGD 2AAVA 4G9DA 5FYKL 2Z91B 1DBBH 1C5BL 5JTWA 3D2UB 3RWHB 2VDRL 4BKLA 3HPJA 3MNVB 1Q94A 1MFDL 2LQRA 3BDXA 3VDAA 1XFPA 3MRKA 4QXTA 2KZWA 4G8FB 5EU5B 4R3SB 5JIPA 1TQBC 4WI3A 4OTXH 1NFIA 4Q9QL 4PJFB 3QDHA 4U1NB 1AR1D 4I18B 3F6IA 2P5EB 3WKMH 3AVEA 1BX2B 5ELIA 1MCQA 3CH8A 3LEVH 3RWGA 1YEJH 3ZKSD 5HD8D 5E6ID 5I15L 2XPGA 2VC2L 4LP5A 4TULH 5GJTH 4DN3H 3QO1A 5EIVA 2EDDA 5DRXB 1HHHA 2JLLA 4OZGF 1DN0B 1UH2A 2YA2A 3GM0A 3O3EB 3WHE0 1FG2B 4AG4L 4OCMC 5ERWB 4DKFL 3UTQA 2K3TA 4Z7UA 1VGEL 1P4LB 1G7QB 4OIIL 3I02B 3ARDA 3IS0X 2Y07L 3GMMA 4JR9H 1G7LB 5CEZE 4WFEE 1LP9A 4LCCB 3O8XC 5DJ2B 5KOMC 5DEFB 1LO0H 1MWAA 5DHXB 1N0LA 1G9NH 3ZSTA 3L7FA 4QHNB 2EXWC 1QLRB 5D1XA 5HHVH 3BIKA 5GRUL 4YXKL 3VRLF 2VSCA 2W59A 3MA9H 1QSFE 2K7PA 1KLGA 4PJDE 5B3JF 1YEFH 2EDRA 5LCVH 2VDQL 2EIDA 4KRPD 1A1NA 1YYLH 5IMMB 2O26U 4GG8A 4B50A 4RDQF 2W0KA 3BYTA 2ADGB 4U1MA 5KSAA 4Z9KB 3S3PA 4NOFA 3F7RA 4W6XB 1YJDC 4RFEB 4QXWA 4LPXA 1ZHKA 3OB0H 5JLZA 4NQVB 4YFLI 3DVFA 4QRQB 3G6JB 3QUZA 1XGQA 4TTGA 3MCKB 3O6ML 4P46A 3QFJB 5F7HA 2Y1VA 3WSQH 5GRJH 3D3VE 1UYWL 2AQ2A 4X6FB 3QA3A 1GL4B 4M43L 2X4PB 2HVKB 3V6ZA 1UJTA 1JWMA 3PDOA 1UWXK 2IBZY 3DUSB 3Q0HA 4DGIL 5M7QA 4FZEL 3KLSA 1NC4A 2NMSA 5JDJA 1T66D 1UKQA 2BERA 2IGFL 2OTPA 4KI5E 5DD0L 4RMRA 2A0LD 1EXUA 5HYJB 2LE9A 4WUKL 3BEVA 2G9HA 3CVIL 3V52L 4DJMA 3QCUL 5KVGL 2R8SL 4JCLA 3H7LA 5DD3L 4EVNB 3GI9L 4OZ4B 3T77B 5L9DH 1BQHA 3GIVB 1CTNA 4TUJA 1FIGL 2OP4L 4ZQKB 4I1NB 3HR6A 3LDBB 3QHZL 4TSAH 1A1OA 3M8OL 4HKZA 4Y5VB 4N1HB 3OG4B 4CAGA 3RBSA 4NNXB 3KPPA 4JRYE 2EO1A 2XRAL 1UM6H 5F9WB 5LGJA 4PRBA 1I7UB 4QO1A 4NZUL 2D0GA 4Y5YB 2EC9U 2FEEI 4NQDE 3RWJB 3T0BA 1T03H 3MLRL 1FBIL 4D0DB 1CLZL 2LTQC 5C0EA 3TF7C 1ZGLM 3FOLA 4M4RA 4IOSD 4JM2B 4G8GA 3QPQC 2WMPA 5L2JB 2A1WH 4X9GA 3DUUA 4JDZA 1UGNA 4N8VA 5I2IA 2J6EH 5D93B 5L6YL 1T2QH 32C2B 1BGXL 2EZ0D 2EDTA 3MLZH 1FVEB 2NTFA 1CE1L 4LGRB 1OP5K 4OM0H 1H15A 2L4OA 5EU7C 1EUTA 1MELA 4Q6IC 1RFDH 4KJYA 3PUCA 3RUGE 4G80A 2Z92B 3VCLB 4AK1A 5J9PB 2CIKA 4OF3A 5IM7B 5CSGA 2Q8AL 3MRNA 1NFKA 4Z5RA 3TC9A 5EO9B 5C08E 5KSBA 4TSCL 3LKPA 3V4PH 1BJ8A 1OLLA 3SGDH 5FYKH 1CDIA 3TO2A 1C5BH 3CFKA 3QSKB 2PYED 5BCAA 1FO0L 1X4ZA 1MFDH