1R24B

Fab from murine igg3 kappa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
217
structure length
217
Chain Sequence
b'DVQLVESGGGLVQPGGSRKLSCAASGFTFSNFGMHWVRQAPEKGLEWVAYISSGGSSINYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAIYYCTRGGTGTRSLYYFDYWGQGATLIVSSATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPGPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTDLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG3-KAPPA ANTIBODY (LIGHT CHAIN))
publication title The role of homophilic binding in anti-tumor antibody R24 recognition of molecular surfaces. Demonstration of an intermolecular beta-sheet interaction between vh domains.
pubmed doi rcsb
molecule tags Immune system
total genus 31
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24B01
2Q86A 1NGYB 3H9SE 1F4YL 1OGAD 1A7BA 4NP4L 5E8DL 4JAMA 5TGBA 2X4SA 4OLUH 4HWNA 3HNSL 5E8EA 3N50A 4C59B 3GHBH 5FXCH 4XH2A 3RTQC 4PRDB 4XT1C 3WXWH 1EA9C 1FJ1B 5D96C 4XMLL 5JORA 4N8CL 1EFQA 3STBA 1HH9A 4P4KA 1HHJB 1NMBL 3C60D 4HS3B 2XN9A 5CWSA 4JN1H 1D9KD 1AQDB 4S0TD 1EV2E 4JFFB 4YXHH 1AD9A 2R0ZL 4LIQH 1MAJA 4L1HA 3LN5A 4FG6D 5I1CL 4K2UH 3U4EB 4OBSA 4ETQB 2XY2A 3QQ3A 1MFNA 4X5LA 5KSUB 2AJSL 5AUMB 5D9SA 4K8RH 4L4VA 4N9GB 3EKCA 3QUMB 3SBWA 4Y7MA 4LSTL 3G5ZA 2E7LA 2DI7A 4XCYB 1DN2A 4PG2C 1UXWB 1F3DJ 5KSBB 1P7HL 1OSZB 3VXSA 5E8OA 2XNAB 2LV4A 3ARVA 4KKCD 4TTGA 4MAYD 1CU4H 1OM3L 1GZPA 4BYHA 1LO5A 5FUCE 1NUDA 4M8QA 1I1AA 1X5GA 4OD1L 2D9QB 4ODSL 3SKMB 1RIUH 2QSVA 4Z6AT 2DYPA 4E42A 1Q9WA 5EPMB 3U46B 5MEQB 3BUYB 5C3TA 3TT3L 1CVRA 2R0WL 1A3RL 4AIZB 2AXGA 3T4AA 3VXRD 2HT4C 3RWHA 3TFKC 3D39A 3MPCA 4P5KB 4NHUA 3WLWC 1LO0H 4QRTB 1QLEH 4EN3C 5C6PB 3PDGA 4NFCA 5JA9A 3W0WE 1BX2A 5I1KL 3UTOA 4PLJC 2IBZY 3BN3B 4MCYA 4PRHD 1RPQA 3QWRD 3V8OA 5E7BA 4QTIH 4W6YB 3JWOL 1XIWB 3QIBC 5DVNA 2VDQH 3AC0A 2WM0A 2DQEL 5D72L 1JGVL 1MFAH 5DRZB 5HHMB 4F37F 3SE8L 3OQ3B 4RAVB 3O9WC 5DMKA 2VJXA 1QD0A 4DVBA 1DE4A 3ESVF 4Y2DB 1IAIM 4JANA 1F5WA 3V4UL 3WFEH 5KANI 3LMJH 5HVGB 2VLLA 1FO0A 1OT1A 3ESUF 4DTGL 2XTJD 2HT3C 4WO4D 3H9HA 4OAWB 4E41D 2Q1EA 2W0KA 1DANU 1EX0A 3PWVA 3ILQC 1TQCC 3O11A 4PJCA 4XVUC 4N0UA 5CBAA 2HFEB 1G7PA 1RZ7H 1JPGB 3P4OB 2R2BA 5EOCJ 5CMAB 2CD0A 3PWPE 2XWJB 3DX6B 4L3EA 5EWIL 3GNML 5IEHA 3EYUH 4M43H 1U8KA 3FAXA 4NQXA 2EH7H 3IF1A 4WI3A 4PJXF 4HHAA 5T1MB 4APQD 3MLUH 1FNEA 3E3QE 3JV4A 2MSPA 1JPSL 2H2PD 4D9RE 5IBLD 5KVFL 1B0GA 1SM3H 5EIIB 3SGKA 2FR4B 3MV7A 3ARDB 3WFDL 3ULSB 1CWVA 1DVFB 2V17H 4F3FA 3LB6D 5E6IB 3LQAL 2F58H 1UH2A 2OTUB 1J0YA 3ZTJH 1FC2D 3FL7A 3RIAK 1QSZA 3S6CA 3MTRA 3KXFB 1QVOB 1OGAA 3UJJH 3OG6B 5B8CB 4ZXBD 1MHEA 4TRPL 3B9AA 3E8UH 1VFMA 4WU5A 1A6PA 1KUMA 4OSUH 1MWAH 4WV1B 3VMPA 3IDXL 5IB5A 5KVEH 2Y06H 1V7MH 1M1SA 3CCHA 43CAB 2BOCB 4U7KA 2ERJC 3NIFE 3B2VH 2PXYC 1CDJA 3C60A 3GK8L 3HE7D 4KGJA 4NOFA 4U4BA 3V5KB 3VFOB 2GY5A 4K9EH 1D9KA 1Q72L 4PV9A 1F4WL 1YMHB 4HKJB 4UTBL 1B4RA 3LKRB 4ODHL 5IQ9A 2VUYA 4HIXH 4JQIH 1X5YA 5DHYB 3LDBC 1I1FB 4PJBE 1U8LB 1NCCH 4S1SL 4JFDB 2WUCL 5EIQA 2F19H 3QEHA 4ZOBA 4JZNA 4NRYA 4L29A 1EERB 3MOQA 2VLKB 3GIZL 2YS4A 3QEQA 4EUPH 4UB0L 4XP1L 5BZDA 5AYUL 3KS0J 3NIDF 4R96B 4PUBL 1YEJH 4CNIB 4MAYA 3W9DB 1HHHA 1FNLA 1P84K 1KLUB 4PJIE 4P2OC 3RKDD 4TUOB 2JCCB 2CJUL 5CLWA 4WEUD 3BOVA 4WWID 2YC1B 3O0RL 3TESA 3TJEL 1KOAA 3SDCC 2DQIL 2ITCA 3EHBC 5GGUB 2VLJE 2R69L 5MEPB 1A9BB 2D4DA 4FOMA 3DO3A 1GIGH 3BP5B 1BJ8A 2B2XL 4YBLB 4GW4A 2A74B 2BXZA 3HZYB 4LKXB 3VXRA 4KHXL 3QPQD 1CT8B 3D0VB 2EXWC 2KUTA 3I84A 1NBYA 4QXGL 5DJ6A 3GZKA 2BNQB 2ARJQ 1RUMH 5B3JF 3AUVA 1ORSA 1SMOA 2Z92A 4GKSB 3R0NA 5HI4D 4PRIB 3A6CH 1E4XL 2X4TA 3JWOC 1I9JL 2IAMC 5I8CB 4KHTH 3OB0K 2NXZD 3E1F1 3QJHA 3QWRA 4RGMB 4HWBH 4WUUD 4KJQC 1AP2B 1ZGLP 3PHQB 3FB8B 2NY7L 5GS2D 4MNQA 3T0EC 3RPIA 3O3AB 1UWXH 4ZTOH 1PG7W 2ED7A 1A1NB 4TUKL 4HLZH 3ALPA 3EJZC 3IDIA 4XMKL 3ARGB 2E7MA 3MV9E 3MREA 5IV2A 3I3BA 2XZQH 2YSSB 2X41A 3FHAA 4NZUL 5CIPB 4QHKJ 4BELD 2DLTA 4HQQH 2Q6WA 3VXSE 2ZPKH 2EC9T 1AJ7H 1XCQA 4NOBA 3DVGB 1ZWIA 2P5EE 2AJUH 2X70B 2FD6H 3NOIA 1F42A 3ZO0A 4JQVC 3KPQB 4PJ8B 3I50H 5JDSA 5AD0B 2ZSVB 5DJ0B 3MRRA 3UZVB 2VN4A 3F6LA 4G3YL 2XA8L 4Y88A 2V2TA 1JZ5A 4WO4A 4E41A 3SQBA 1ZHKB 5ESQB 4DQOH 5JR1L 1I3RA 2R56L 3SKUD 4N1CA 1AD0B 1S9VA 5D70H 1KBGL 4I0KA 3I6GB 3MXVL 4X4XA 1FP5A 4IMLA 4HXAL 4XBEH 4ODTL 1A02N 2YMXL 4PJEA 4XI5D 4M00A 3TVMA 2FWOB 1JGLH 3H0TB 3HMXL 4MXVE 1A1OA 1I8IA 1CFQB 3LIZH 1U0QA 2EYSB 1X5FA 1LP9A 3NA4A 1BMGA 1NDGA 3MRPB 5I74B 4E9LA 1LE5A 1ZTXH 1GC1C 1V7NL 4GXUM 1EXUB 3KLSA 4I48B 3T3PE 2G9HB 3MRKB 4LEOB 4NJAH 5T3XD 2ZJSL 2WIIA 1KCVL 2HJKA 2BHZA 4XB7A 1G9NH 1X5IA 1KV3A 4F7MA 1FVCB 4RISL 2Y36L 2X9YA 1MCSA 1T04B 4Z0BL 1BOGB 4JRYB 3PWLA 1HILA 4HT1H 3WKMH 2VQ1A 1DP0A 5I1DA 3FFCD 5I66B 5IMKB 4ZXBA 3MJ9H 3KDMA 3CFBB 1AY1L 2C3XA 4QXTB 1FFQA 4P23B 5H8DA 3TBYA 2H26A 1W0VB 3DPBA 4NQCB 3HE7A 2OZ4A 4U1LB 2FX9L 1S3KL 2APVA 3BYYA 1IC5H 4JG0L 4WEBL 3L3GB 2FRGP 3FOLB 3VFTA 2Y25A 1DBJH 2G2RA 4HPOL 1WEJL 1T7XA 1A5FL 4TSBH 3R1GH 2IQAA 1HK6A 4NT6A 4PJCE 5BQ7A 1KPUB 2CH8A 1FHGA 4LCWD 2P24B 1WZLA 1TJGH 4M9OA 5MENB 2E9JA 3SE4A 4L3EE 4OFVA 1MJ7L 4Y19E 2AJXL 4Z7NF 5F7DB 3EFDL 3NGBB 4NQDE 2DWDA 4U1KA 4UILH 2VXSH 3GMPA 1Q1JL 3MRGA 2OJZH 1N59B 3ABZA 3NCYS 4R4BA 1ORQA 5CZXD 3T0VA 1WWCA 5K9QG 4QXWA 2UYLA 3L5WB 4RZCA 3IETB 3PGDA 3VG0H 3T04D 3OKMA 1NKRA 2HJFB 5F6HI 5C0GA 5ACZB 3MV7E 1EIBA 1BM3L 4JDTH 4F57L 3JV5A 2N1KA 3Q6GL 1AGBB 4S11A 2BJMH 2YWZA 2ZCLH 4IIQB 5JUEH 2FBOJ 5IG7A 4UV4L 3IKKA 5TDOA 3PWUB 4PLKC 2W92A 1BVZA 1OGAE 2NY2B 3OWEA 3X12B 4DGVH 1NDMA 3NVQA 5F9WC 3U36B 3RWGB 2XWTA 1DR9A 2BFVH 2OR8A 3QDGB 4LCYA 3UTQA 1YEFH 2SEBB 5ALCL 3HMWH 2IMMA 5EOQH 5M7QA 3VXUD 4GSDH 4YHZH 1N2RB 3MROB 1H3XA 2A9MH 1FL3B 4P46C 2JJSA 5DJ2A 1UCBH 4WUUA 3T1FA 4I8DA 2CXKA 4U1MB 3OJMB 4DVRL 2CGRL 4RGOH 5LGKA 2XKNA 3HI1A 3DBXA 3KLHC 1NC4B 4S0SD 1PKQA 3HZMA 4ELMF 1K9TA 5DWUL 3OAZH 3M8OH 5FYJH 1D5IL 4F8TA 4G9FD 4ONFL 4TYUA 4ZO9A 3QFJA 2EYTB 4Z95H 4G6JH 4JFEA 1QSEB 4YUEH 4RAUB 4PD4K 3IU4H 1ZHNB 3UJTH 4HG4J 3WJJC 5L88L 2H9GB 4R90H 1C5BL 2YWYA 4J2XA 4O2CB 1FO0L 1BD2D 4X8JA 3MCG1 4L4JA 2FDBP 2DWEA 5LBSL 4Q6YA 3ULUD 3KPLA 5FB8B 3VDCA 2O61B 3CFCH 1KGCD 3B6SA 2ITDB 5JPMB 3MV8A 3WEXB 4AL8L 3C9NB 1S7TA 3VH8G 3RNQA 1RUAL 5I73C 2OLDA 1T0MA 1A4KA 1B88A 2B1HL 2I60L 3I9GL 1ADQL 4HUMB 3GSUB 4YWGL 1GHFH 3WHXA 5EZJB 5KW9H 3JZ7A 1TVDA 1IJ9A 1UB5A 4DGIL 3U0PA 1J0ZA 4PRHE 3UEZA 2BY1A 1S7SB 5IW6B 5J06A 5KOMC 4JKPL 2E6QA 4JKMA 4MQ7A 1NC2B 2D4FA 1BWWA 5FUOH 4ZTPL 1BJ1H 1GCFA 3MOBL 2A1WL 4PBWD 5AAMA 3GSVA 3LKNA 5CP3A 3P73A 2MKLC 4HUVB 2FZ3A 3FFCA 2D31B 1MRDH 4OFDA 4YEFA 2HMID 2YPLB 3HZKA 1EHLH 3NCEB 3QI9A 1FPTL 1R5VA 4P4KC 1MIMH 1QEWA 1CGSL 4PJ7A 1K6QL 2H45A 4FFZL 4U0RC 4LLWB 1TCRB 3VJ6B 2DD8L 3WUWB 5HJ3A 5I15H 5GZND 3GMMB 4LSPL 2DQGH 5CJQH 1X5XA 1FZJA 5HHOE 1KN4H 1PLGH 4E41E 4MNGE 5I1EL 2H2SC 3BVNB 2A6JA 4YDJA 3O6FB 1IGMH 4OFYD 4M6OH 3SBWC 2OP4H 4X4ZA 2QKIB 4M7LH 3D87B 2E7LC 3OV6A 4HUWB 1NANI 2J8UE 3CH8A 4JO3H 2R1YA 1MREL 3WS6A 3QXAA 3CFDA 4MWFA 1BBDL 4RBPH 3P9MA 2DL2A 2ADGB 3MRCA 5F9OH 1KXVC 3ZDZE 4NRZB 4WDIB 4U1JA 2P8MA 4XAWL 4XVSL 4J4PD 4P9HH 1I1AC 1H5BC 4HV8B 4XPBL 1JHTA 5EN2B 1QBML 5H35A 4Q58C 5JW4Q 1T0PB 5IMMA 4PJDA 1ZLWK 3GJFA 3QA3B 3BGFB 3ROOA 5A2LH 5IOPB 3CXDH 3P77A 4GRLD 3VXPA 2B1AL 3ULVE 2QL1A 4QRUB 4OBRA 5ENWB 4YHLL 1A1MA 1BGXH 5I1GH 4YE4L 3DMMB 1WBZB 2NZIA 2FJHA 4N0CC 4NUGH 5LWYL 4KQ3L 5EC2B 2XIDA 2DMBA 5FK9B 2X4QA 3QHFH 5LG1A 2Z93A 1IAKA 2J3SA 2V6HA 1OCWH 2AK4D 1E4KA 1OF2A 2VXQH 3DTXB 4G5ZL 2R0KL 1CR9H 3VXUA 1QBAA 3S3PA 5DLMH 2BOBA 4J1UA 1QQDA 1DBAH 2GTZB 5B4MC 4N1HB 3BHBB 1MVUA 4LVNB 3QEUB 1M71B 1WV7T 3BWAA 3BO8B 4S1RL 4QHNA 4KGLA 2AQ3A 5CIPH 5EO1B 1Q0XH 2XPGB 4ZUVA 1QLFB 5BV7B 2FJGB 2VXVL 4XP9H 2E27H 5LCVL 2NY5L 5FO7B 3U2SB 3U83A 3TC9A 3KPSB 4MNHA 4R2GB 3EO0B 4BUHA 4PJXB 4G9FA 4JZJA 1A14H 3MA7B 1IC4H 4ISVB 3C5JA 4O2EB 4KRPD 2QR0B 5LQBL 1JNNL 3UC0H 4GG6F 4FA8A 4ZG1A 1CL7H 4YBQD 4M62L 5IHZA 1CCZA 3G5VA 5DRXB 3BQUB 4NM4L 1BD2A 3VRLE 2GY7B 4YIQB 4F7TA 1HYSD 5CLTA 3TV3L 1I1YA 2M2DA 5E5MA 5MHSD 3W5NA 1IM3B 5K59E 2NNAB 1YNKL 1OB1B 5L0QC 2FEDC 3D3VD 3HC4L 3MBXH 1T66D 3FQXA 1EHNA 3R4DA 3SPVB 2IG2H 2Z9TA 4JRXB 4X4YB 1BLNB 4IOIB 1YEKL 3VXMB 2GUOA 1JNLL 3FAWA 4P3CH 3BKYL 3W82A 4AENB 4D0DB 1GYAA 3IKCB 5IT2H 4D9QD 5C0IB 4OI9A 2FL5B 4LPYA 3WIIL 5C71A 3ZT7A 5FO8A 3SGKC 3CPLA 2OJEA 2QEJA 5I1IH 1KTDA 3NCYP 4P57B 4R9HA 5C2BL 1HCFX 3ZYZA 3ZTJG 1S9XA 1AR1D 4WUUE 4EIGB 4JGJA 1J0HA 3C5ZD 1YN7A 4JKLA 5FAAA 2Z4QA 3QUZB 5HSFA 2OI9B 5E0QA 3SKNA 1CD9B 4AK1A 4R7DB 3VFRB 2X4OB 1DQMH 1ZA6B 2HN7B 3RY6C 1DQQB 4YGVB 2AJYL 3QUYD 3RWJB 5TQ2L 3UDWA 3AGVA 4AQ1B 3BMWA 1UM5L 25C8L 2HKFL 3S9DB 3BPCA 2OX5A 3C60C 2BSED 1J0IA 3MLXL 3DRTA 4MJ6B 5J89A 4OCWL 2X89D 1XH3A 1W0WB 5C0FA 1EFXD 4JRWA 3JSSA 1H15A 2OZ4L 1HDMA 2QSQA 1BFTA 2F54B 1KACB 3WHE1 3VFNB 4XTRD 5T1DL 3OJDA 1EEYA 3SQOL 3K8KA 2G60H 3AM8A 3ZE1F 3MRIB 4OFYA 4O4YL 4EUPG 5F97E 4RMTA 3BIAX 3GRWA 3KPPB 3K7UA 1EGJH 3BEWB 5D7JB 1TETL 3L9RB 4J6RL 1E4XI 1P7QB 5IVOA 2O93L 2ICCA 5IMOA 3S34H 4KKCC 1GXEA 4JJ5B 4MAYC 4I3RH 2ESVA 3T0DA 3FCTB 3NACH 4GBXB 2LAAA 2YD3A 2Z8VC 4J4PA 4ZSOA 3U7WH 1XFPA 4HS8L 3DHMA 5F7FA 4DKFH 5EO0B 4M4PA 5CZKA 4OIIL 2EKSA 1U8QA 2LQRA 2K1MA 1FNHA 4XVJH 3MX0A 4GRLA 1JZ4A 4GAJL 3SDAB 1C7SA 2ZZUT 5CINL 4EI5D 2YXMA 2VITA 1UH3A 3V4PH 1NBVH 2HA1A 1P4BL 3U79A 5FYKH 4M1GH 3HUJA 3MRJB 1BJ1J 5A16A 4A2MA 5DFVC 1UENA 4ONHA 4QXUH 3FFCE 4N9OB 1NUGA 4F9PA 2AK4A 1AHWB 4O51B 3H3PH 4G9DA 4OD3H 1YMMB 1JN6B 2ZP0T 3BPLB 4QHUA 5DS8A 5C0CB 4HPYL 4PJ7E 3VD9A 3E2HC 3B5HA 1EO8H 4M1DH 1FFNA 1YQVL 5IHUL 5LXGH 4OZHA 1I7RA 3DUUA 4F33A 4HLZG 4WI2A 4O00A 5D7LB 1RSFA 3ARZA 5I16B 2BVQA 2DBLH 5GGSB 1H8OA 3LEVH 3RTQB 2RHEA 1OWRM 1N4XH 2XFXA 1BIHA 3LN9A 4KKLD 3K2MC 4Z77B 4XXDB 2CKBB 5DHVB 3OKNA 4LCWE 5IJVB 4FQ1L 2NY4C 4D0CB 1U95B 5AWNL 5I19L 4HSQA 1P5UA 3F62A 3F5WA 5IW3A 5EC1B 1X9QA 3EDJA 3LKSA 1DFBL 1T5WA 5BXFA 2EDRA 1YEGH 5GGTA 1HH6A 1HOCB 5KSAB 2XTJC 4JPVL 5K9KB 3T77B 1NEUA 1MIEL 3BP4B 2DQHL 4WO4C 4P5TB 1KEMH 1MEXL 3P11L 1QR1A 3MBED 2ZNWA 5EU4B 3T4YA 1LD9A 3SDYH 4RGNB 1JK8A 3ZDXE 1U8MA 1CFVH 3GSXB 5IF0A 5TF1L 4G8GB 1Z9SA 4RFOH 4D2NA 4F7CA 3WO4B 1SYSA 1FYTD 3TVMC 4IOFD 5ABDE 2G5RA 1QYGL 3D3VA 2QADD 1N64H 5TFSL 2DF3A 1T21B 2ADFL 2FGWL 2NXYD 4RWYH 3RKPA 4DN3H 1NGQL 4I13B 4KTEH 1C08B 4G7YL 3VI3F 4FS0A 1FH5L 2YD4A 3OF6D 2APBA 1UYWH 5IBLC 4WFGD 2MCG1 2ZUSA 3QFDA 3DECA 2WANA 1BFSA 2V7NB 3BT2H 1ED3B 1XZ0B 4J8RA 4LBEA 3C8DA 2Z8WC 4PRPE 3BIBX 3RWIB 3C5ZA 3QJFB 4G8EA 3S35H 2ICEB 4ZS6D 1QFHA 3ROLB 4BSVA 3UTPD 1ZANL 1K8IA 4KK5D 4U1SB 4ZXBC 4EN3B 2ADIA 1KFAL 5DZLA 3SHSA 5ILTH 3LQZA 4HH9A 3MXWL 3THML 5ICYA 3QUYA 4GKZB 1OW0A 5IW1A 4IRJD 3AMLA 4G9FE 3VFMB 2GSGA 4FQHA 3QIBB 3VA2C 3HE7C 3QQ4B 2I9TB 4HUKB 2X89A 4X6CA 5SX4I 4X5WA 1EFXA 2DQCL 1FC1A 2P8LB 5GS0C 1A3LL 1UB6B 4LCUA 4NM8H 1BD2E 1H9VA 4UU9A 4PR5B 1DSFL 5IGXL 5CD5C 3K4ZA 3O9WB 3OMZA 3VGHA 3ULUE 3GUTB 1HHGB 1KGCE 1U93B 4PGDB 4UUJB 2HTKD 3JWDL 2GK0A 5D1QB 3KPMA 4HIIA 5F88A 3U1SH 1FNGA 5TH2B 3VG9C 1J1XH 3FMGH 3U30B 4D3CL 5BO1H 4ZUUB 5D2LE 5I6XC 3PP4L 3PDOB 2WLZA 5JLZA 5DJAB 3RWCB 2VZTA 2YPKA 2C3HA 5D71H 1VACA 4LPXA 2MPAH 3RWFA 1PKOA 3GHEL 4UV7L 5BRZE 1GZQB 4EI5A 5JXAL 1EEZA 2BVPA 2W59A 4JFFD 4ELMB 1RJLB 3OXRB 1MWAA 3QPQC 4NHCH 4LSRL 3HI5H 3DVNA 5I30L 2QHRL 4TULH 3H7BA 4JKWA 1LEKA 3MCKB 3QNXB 1QNZL 2MJWA 1ZGLB 2YEZB 3IXTB 3AS3A 4XPHL 3AB0C 5HI4C 1OVZA 3OAYK 4PB9L 1IBGH 3L95B 1PQZB 4Y8AA 4PG9A 2JJSC 4OCXL 3UTSB 4UT9L 5ETUB 1X7QB 1A0QL 1DUZB 5T1LB 3OKKA 5BV7H 5I17B 4KV5F 3OX8B 1D5BA 2PR4L 3MUGA 1OOAA 2R2CA 3VRIA 3CJJA 4EUPA 1OAUL 1EZVX 4K7FB 3FTGB 4PJHB 5JHLL 1TLKA 2V2XA 5IB3B 5FKAA 1C5DB 4LARL 3F12B 5E56A 5I1HL 1BQHB 1FV1A 2PXYB 4C55A 4DKEL 4YHNB 4MD5B 1NCAH 3IDNA 1NCNA 1EBPA 5A2IH 3N1FC 3WIFB 4KTYA 1WBYA 1NFKA 1TZGL 4JFHD 3MMEB 1X6LA 1CGYA 2J2ZA 2FO4A 1MHPH 1XT5A 3MRLB 2DTMH 1J9CT 1NFIA 3BKML 3M07A 1CE6B 3MBEA 5E2TH 4HKXB 3WFCH 3K81A 4YLQT 2LTQC 2QQLH 4PJ5B 5EBLB 4DFIA 4ZNCD 1VDGA 4NKDB 5TDPB 1AKJB 1G7JB 3ULUL 4FFWD 2O5XH 5ITFB 3LPWA 2JB5L 1Q0YH 3MRMA 4OT1H 4XI5C 1FYTA 2ICWJ 3LPGA 4M3KB 4Z18A 5CZVL 3DO7A 2MKWA 5HHMD 4HWBA 4LIQE 4NBXB 4QT5A 2BVEA 1U92B 4L8BB 2VC2H 3HC0B 4LP4A 1UM4L 1IEBB 3QSKB 3SGJA 3OF6A 3SDCB 2CLRA 4XVTH 5CSGA 4JO2L 5F7HA 1G0DA 4Y2DD 3QQ9D 1DBKL 4DZ8B 1ZA3A 1ZT4B 5IVXF 5FYJD 4P9MH 5FGSA 3EZ8A 5TE7L 2VH5H 1JRHH 5EBWA 3HRZB 4FZ8H 5HYJB 4H5SA 3O2VH 3QZWB 1DBBH 1FIGL 4M5YL 4X7EC 4JFXB 4JFPB 4KMTH 4Y16C 3QI9C 3WFZA 5BJTA 2IAMB 5JPNB 3E6FA 3RBGA 3S37X 1Y6MR 4XC1H 1HZHL 5FA4A 3FQUB 5DK2A 3STZA 4HWEL 3MFGB 2W9EL 5TPWH 4HZLB 1IC1A 1IC7H 3T08A 1MRCH 2BX5A 3I75B 3QCUL 3BZFA 1BJMA 3VXTA 2CDFB 2IC2A 1BQLH 4NZTL 1DDHA 2IPUG 3WS6C 3DV6A 5MHSE 4JDVB 4XNXL 3ARDD 5F44A 1KYOJ 5DJDA 4LEXH 1G9ML 1DVFD 1I7ZA 5J3HC 5E6ID 3C2AL 3WFBH 3TEUA 4MXQD 1WCQA 3KXFD 4XNQB 5E2VL 3JV6A 1KCLA 4HC1A 5EORH 1J87A 2CRMA 5HI3D 2YR3A 4BQ8A 3JTTA 4PRDA 4LSUH 1NL0L 5LGJA 1FJ1A 3Q6FB 5BZWB 2BRRH 5CHNA 4FN0A 3T0WA 4Q0XH 4OLUL 1WISA 3GHBL 3AREA 4OZFB 3WXWL 3WE6B 3U4EA 5D93C 4ETQA 1DEDA 1N0XH 5DC4B 1E4KC 1G6RB 4KUZH 1F13A 1T20B 3F7PC 5KSUA 1MJ8H 4JN1L 4N9GA 4GG6B 4JFDD 4JJHA 4Y5YC 4YXHL 3IJHB 3QUMA 4LIQL 4YNYA 2P5WD 2HG5B 1MFBH 3DYOA 4K2UL 4XCYA 1JWUB 1D6VH 2VLKD 5LAXA 5KSBA 3QHTC 1OSZA 2ED9A 2LU7A 3RA7H 4BZYA 1VCAA 2CSPA 1Z6JT 4Z7WA 1TFHA 4LPVA 1FGVH 2CKBH 2CDGB 1IL1B 3KPNB 5DHVH 3ZE2F 4XP6H 1L7IH 2AXHA 3SKMA 1I75A 3EJYD 3F65A 2NCMA 4PJEF 5F72S 1CU4L 4PYHA 3U46A 3BUYA 4JZJC 1LP9F 1QSFB 4XNZB 1IM9B 4AIZA 5F7KC 1U91A 3RGVD 2PTUA 1HN1A 1RIUL 2E7HA 1UG9A 2M1KA 2Y07H 2BNUB 1R6VA 4QRTA 5FCUH 4GRMB 4RIRA 4PRID 3ULUC 2WBJB 1EJOH 3S3JA 4YR6B 1LO0L 3OKOB 4KQ4H 1LK3H 1QLEL 1WJ3A 1T1YB 1BQUA 3MR9B 1HIMH 4N5ED 5IM7B 5ANMB 4AJ0A 1ODAA 5I8KH 1TITA 4CRPA 4B7LA 4LLDB 5DRZA 3G6DH 3OAUH 4QTIL 1SEQH 1PBYA 2VMFA 2VDQL 2XG4A 3K8MA 2BDNH 3IAPA 1B0RA 4MD4B 1KG0B 4X7DC 3RL1B 5FYJU 1MFAL 4Y2DA 5GGRB 3X11B 3EW3B 3GM0A 4PJ8D 1TTGA 4PYGA 3EDEA 2QBWA 4QCIB 4PPTA 3P9LB 1Q9OB 4RAHA 5CGYC 5B39A 4YDIL 4K23H 4LNRB 3UDWC 5SWQB 3WFEL 1KLGB 4O5LH 3LMJL 4P46B 4S1DD 2CLVA 3O2DH 3VRJB 1JPGA 2R2HA 3P4OA 4G6AC 2FCBA 2NW2B 2X1QA 2XWJA 1HEZA 3SE9H 3DX6A 2KPNA 2C4FT 3HNVH 3V5HA 2BVYA 2JB6B 4JCMA 4Z7VF 3P0YL 5GZNC 3NCJH 2CK2A 4QNPF 2FBJH 1UADC 1IEHA 1RZ7L 4HIJB 3AM8C 3QXUA 4NO5A 2ORBH 4PBXA 2YD5A 1MCWM 4GKOA 5EIIA 3EYUL 1EMTH 4M43L 2Y5EA 5E2UH 2FR4A 1AI1H 3ARDA 2EH7L 3DOSA 3ULSA 3FT2B 1PZ5A 4IEFB 2ZG3A 5E6IA 2YKLH 4U1HB 2X42A 4OLWH 3DJ9A 4HJGA 3MLUL 4IS6B 4J4PC 3FO2A 2OTUA 4JRYD 3GBMH 4QRQB 3FQRB 1SM3L 1X6NA 3KXFA 1QVOA 4RQQB 3WL9A 2EEDA 5B8CA 1G0XA 5GS3A 2V17L 4OCMC 1H3VA 1IILE 4GRLC 4WFED 3AS1A 2F58L 1E6JH 1P6FA 3VA6A 4P23D 3V0VB 43CAA 2AEPH 2BOCA 3UJJL 4AMKH 4NQCD 4O02H 3V5KA 5INCB 4ORGB 3VFOA 3E8UL 3O3BB 2JJUA 4OSUL 1MWAL 3UTPE 1YMHA 4HKJA 3LKRA 2EDYA 1D5MA 2Y06L 2XZZA 5D5MF 4F9PC 5C07D 5KVEL 5DHYA 3BI9X 2ZG2A 1I1FA 1U8LA 2ATKB 3B2VL 4NSKB 4K9EL 2P5WA 1BAFH 4LL9A 5MEND 5FECA 1ND0B 2VLKA 1UZ6E 4HIXL 4JQIL 5KS9A 4OF8A 4TNWF 4WU7A 1SY6H 4F58H 1NCCL 4R96A 3BZ4B 5JZ7D 2QSCH 2HYMA 4WI6A 3W9DA 5HVHC 5H37H 4PJFA 2F19L 2EE9A 2HH0H 5EU7C 4TUOA 5JNYB 2JCCA 4WW2C 2EDKA 1DLFH 2YC1A 1MNUH 1YEJL 1R5IB 5DJ8B 2XN9B 5MEPA 4F7EA 3JV0A 3BP5A 1HQ4A 4GQPH 3GKZA 2A74A 3HZYA 1QRNB 3S35X 4KRPC 3EO9H 1WK0A 5SX5H 2NY2D 3D0VA 3RGVA 4GAYB 1FDLL 4YBQC 4LLAA 1OD9A 3QDGD 2BC4A 5FYKD 4L4VB 4OKVB 1GIGL 4LSSH 3FQTA 3IDMB 1HYSC 3G5ZB 3HR5B 5I8CA 1MJJB 4ODSH 2CUHA 3IXAA 4OM0H 1N6QL 4UIMB 1RUML 2X4UB 5DUPH 1TENA 4LSVH 4JFFE 5F9AC 5I76A 1AP2A 3BPOB 4IHOB 1GZPB 3PHQA 1T66C 3FB8A 1M6OB 3A6CL 4LSQH 3ZE0E 3O3AA 1I9EA 4FQXB 1H5BB 4KHTL 1NC4D 1NSNH 1WT5A 5FGRA 4HWBL 4E42B 4CN6A 3ZYIA 2I07A 5CIPA 3S4SB 5KSBE 4NN5B 4NO3B 1I8LC 1AR1C 2AXGB 4ZTOL 4HJ0D 2R8SH 3DVGA 1QSED 2X70A 3OG4B 3QXWA 4HJJH 4NZRL 3KPQA 4PJ8A 2XZQL 4MX7B 3JWOH 5DD1H 5DJ0A 5DD3H 4HQQL 3PABA 3LRHA 2ZPKL 1OP9A 1BX2B 1FG2B 2VABB 1QG3A 3TBWA 3WUWG 2AJUL 2FD6L 1ZHKA 3DYMA 1MCWW 5ESQA 1XR8B 1OW0C 3QH3A 5F1NB 3WLBB 1WF5A 4AYFA 1AD0A 1TZIB 2RBLA 1J11A 4OCNC 3I6GA 5CEZE 1R24A 2CO7B 4MJ5A 4YHYB 5DI8A 2VR5A 4PJDF 2Q7NA 1JWMA 3QNYA 4JFHE 4DQOL 3H0TA 1GRWA 2FHFA 4DJMA 3B5TA 5D70L 4QYOA 2N7AA 1CFQA 3QYCA 1NQBA 1RHHA 1F11B 3MRPA 4XBEL 1P1ZB 1EXUA 1UKQA 3CDGA 4DTGH 1T4KB 4I48A 1JGLL 4DVBB 3WKNA 1A6UH 1CDUA 3MRKA 3VW3H 3TYFB 3LIZL 1G7HB 1NC2D 1LK2A 5CFHA 2W0PA 1FVCA 1ZTXL 1T04A 1BF8A 1BOGA 5HHME 4JRYA 3H9HB 4FZEL 4NUJA 2EDDA 4LKCB 4D8PB 4NJAL 1VADA 2FECL 2EDNA 2RGSA 4HAFA 5FDWA 3V4VH 1WIPA 5I66A 5EWIH 4HG4K 1F45A 4HC1L 3GNMH 5DEZA 5FOBB 2NW3B 3GSNB 5J7CC 3CFBA 1L9NA 2YA1A 4N0UB 1G9NL 1OLLA 4OZFH 1F3JB 4QXTA 1NCDL 3VD4A 2DKSA 3D9AL 4DN4H 5I9QC 1R3IH 3T3MF 4HT1L 3RVVD 3WKML 1NCTA 5L0QB 5CCKH 1G6RH 1NBZB 5GGSY 3P3YA 1P9MA 5FYJE 5TDNB 3MJ9L 1NCWH 4U1LA 3MLSL 1U8KB 1GC1H 2EDTA 3L3GA 2DM4A 3FOLA 1GGCH 3GI9L 4HHAB 5C07A 3O6FD 1FNEB 5K9QI 3MLTB 4KZDH 3QEGH 1IC5L 3QUML 3RVUD 2P24A 3LD8B 1DBJL 4XMPH 1E0OB 1MCCA 4TSBL 1VKXA 3UZQA 1MCHA 1EGJA 4LAQH 2YA0A 5CJ5A 1N59A 1TJGL 3DGGB 3L5WA 3IETA 1F4WH 4KKLC 2BY3A 1J0JA 1CD8A 2LU3A 2HJFA 1N5YH 3QXVA 1UM6H 5ACZA 4UILL 2VXSL 3C60B 1YYMH 1HQRA 4WIQA 1KT2B 3K0WA 3IU3A 3VG0L 3FQNA 4MHHG 4TVPH 5IQ9B 5FYKU 3ELAT 5D8JH 4UB0H 2FH8A 5IVXB 4JDTL 3U36A 2ICWA 4YK4C 4PUBH 3QDGA 3IDYC 3MBEC 2SEBA 2I9LA 2BJML 3TBSA 2ZCLL 5JUEL 4PGBB 4JZNB 4NRYB 5CBEA 3ZKND 1XGTA 1N2RA 1UJ3B 1TPXC 2D7TH 3QEQB 4J23A 4DGVL 1NGZB 1Q9KB 4XNMB 3WXVH 2BFVL 2HVJB 5HDQH 5C0NC 2DMCA 2BRQA 1YEFL 1CLZH 3HMWL 2QADC 4YO0B 4MA7H 5EOQL 4QO1A 4U1MA 2NXYC 4GSDL 4YHZL 3FZUC 1KEGL 2A9ML 5GGVH 3BISA 1UCBL 4JFDE 3SGJC 2A6KB 4TNVK 2YUWA 3KPSD 1KJ2B 1U8NB 4RGOL 2VLKE 4GW4B 1WFOA 2EYTA 4R26H 1QSEA 5GRUH 1NBYB 4RAUA 3OKYA 4JY6B 4ZS6C 1ZHNA 5E8PB 2Z92B 3QXTA 3M8OL 3NCFB 5FYJL 2JCCE 5HDLA 8FABA 2H9GA 3T0AA 1A21A 4O2CA 3BQUD 3VE0B 5DDHB 5CSZB 4Z95L 4G6JL 3WNNA 1KIQB 4YUEL 3CMOH 5FB8A 1FBIH 1IGCH 3IU4L 1XMWA 2ITDA 3UJTL 5JPMA 3E2HB 4RA3A 3LS5H 3WEXA 4JE4B 4R90L 1WLHA 1J8KA 4MNQB 3C9NA 4X99A 1JPTH 5GJTH 3SO5A 4M9PA 2BNQE 4JRXD 3CFCL 3VXMD 3O3UN 5FDYA 4PRIE 3TO4B 4JO1H 2R0LH 1UXSB 1BQSA 1EO7A 3H9YA 4G3YH 3G5YB 4LQFH 3HUJF 2Q6WB 1GGBH 1Q9LA 2J88H 2HTKC 5DD5H 5CS7A 3CD4A 3ARRA 3DLQR 2NY4B 4CDGC 1NC2A 4NQEA 1KCUH 1KBGH 3QUZD 1GHFL 3VFVB 4EDXB 2AJ3B 5KW9L 3KYMA 5F7UA 2V2TB 4U2ZA 1G9NC 3H42H 3QDJB 4OZHF 4QRPD 2D31A 3ZKXC 4GQ9H 1S9VB 4Q2ZA 5FUOL 1XF5A 2EXYC 1AGFB 1CIUA 4LVHC 3AREC 4TTDC 5F7EH 4Y4KB 4YJZL 3TVMB 4UBDD 3H3KA 2ZSWA 4WW2F 1A1OB 3CIQA 4LLWA 1MRDL 1TCRA 3EYQD 2RAMA 5F3BB 1EHLL 1LP9B 3GMMA 1MIML 4X6EB 1LO4H 1WZKA 2F54D 4W6XB 2ENYA 3TN0B 3N1PC 3DXAE 1OT2A 3O6FA 2ZCKH 4ZAKB 4Y5VB 1CLYH 3DX8B 2BSTB 2QKIA 4OLYH 3ZKMD 2G75B 4HUWA 4JDZB 5D7JD 5I15L 1P7QD 5D2NA 3AU1A 2DQGL 5CJQL 1KN4L 1PLGL 4NRZA 4WDIA 2FLBT 2B0SH 4M6OL 2OP4L 4NZJA 4GBXD 3QIUB 2JIXB 2P8PA 4JO3L 5GQBA 2ID5A 4H0GA 4HV8A 3IRZA 1S3KH 3ILPB 5SWZE 5EN2A 5F9OL 2LU4A 4M3JA 2V2WB 1NGWB 3E6HB 3QA3A 5IOPA 1H3GA 1ETZB 4WTWA 3SDAD 4P9HL 3TBYB 4QRUA 5EULV 4NC1C 3NABH 3OAZK 1WBZA 3V9FA 2XV6B 1L0XA 4ZFOB 1WGOA 5EC2A 4JRYE 5FK9A 3CXDL 3VGEA 2YA2A 2YUZA 2IQAB 4KKNA 4LSDA 1J05B 4X0KA 2YUXA 1BGXL 4NT6B 5BQ7B 1YMMD 3DTXA 4U0QB 4WFEE 4NUGL 5C0CD 3WDHA 1VEPA 3INUH 3D69B 1FRGH 3GMLB 4XPTH 3MJ6A 4NQCE 1IAIH 1OCWL 2GTZA 1VHPA 3CXHJ 3VG9B 4U1KB 2VL4A 5D7LD 4YXKL 2VXQL 3BHBA 3D18B 3HKFA 3QEUA 4R8WH 3ORJA 1M71A 3GMQB 3KAAA 3IFOB 1CR9L 3BO8A 1WICA 5SX4H 4RZCB 3PGDB 1X4YA 4Y8DC 5EO1A 1F6AA 5DLML 1QLFA 3OKMB 1PG7H 3AAZA 2CXGA 1DBAL 2FJGA 4XCCH 3WBDA 4Z7VB 3HR6A 5FO7A 4MZ3A 4X6CF 3EIFA 3U2SA 3HPJB 1Q94A 3KPSA 1ZKAA 5MENE 5IG7B 5TDOB 4XHJC 1Q0XL 4ISVA 3BWUC 1V3LA 2FYYB 5CEYB 4GS7B 4XP9L 2QR0A 4HIHB 1F2XK 5KSAD 4LCYB 2C4FU 4AEHH 1X4ZA 4P5TD 2WINB 3BQUA 1A14L 4P2QE 5KTEH 1IC4L 5IESH 1PEZA 5C09B 4RGND 4I5BA 3UC0L 2VSDA 2B20A 3CFKA 4G8GD 2FATH 3MLWH 3SO3C 2FLRT 3T1FB 1CL7L 1IM3A 3QULA 1OB1A 4QHLB 1IARB 1EVTC 3VXNA 3CSGA 1ZLWH 3M17A 4ONFH 3DBXB 4OTXL 1OL0A 3SPVA 4X4YA 4JRXA 5IR1B 1BLNA 1V3MA 4IOIA 3QDGE 5FYKE 3CH1B 3VXMA 3ZSSA 4D0DA 1PKQB 3MODH 3IKCA 2EEBA 3MBXL 5EU3B 4C83B 4A6YB 5D5MB 4AY0A 3QFJB 3VWJA 2IG2L 1XGYH 4P57A 4JFEB 1UACH 4FXLA 4P3CL 5C0BB 3TFKD 1YC8A 1JMXA 1X5HA 1UQSB 3GSNH 2F5BH 4RBPK 5T3ZH 1WAAF 4BH8B 1I8KB 4P0DA 5GRVL 4EN3D 1RK0B 4OIBA 5F7NC 1LEIB 4R7DA 3VFRA 5I1IL 4GAGH 2X4OA 5HI3C 5JXED 1G7IB 1ZA6A 3N1QC 2HN7A 3KPLB 1DQQA 4QRPA 4YGVA 1ZVYA 1CIDA 3RWJA 4WI8A 3MV8B 4DAGH 4OCRL 5KSVB 3OJ2C 4KK9C 5E5UB 3QIBD 2EDHA 1QSEE 1CFSB 5CKAA 1T2JA 3TH3T 3RNQB 1W0WA 4OZGB 2WP3O 2EDQA 2CO6B 2F54A 3VFNA 3O9WD 5JHDA 3U0PB 5C6TH 2W65A 3QBTB 1KC5H 2AEQH 5D1QD 3KPPA 3HLAA 5D7JA 5H37G 1P7QA 2LE9A 1DUYA 1QTYT 3OGCB 3GSVB 2G60L 1BQHG 1K3ZA 3HN3A 3K4AA 3FCTA 1CGSH 3DX7B 1ERNA 4GBXA 2HT3D 1QFWM 1EGJL 1NCBH 4Y16B 3QI9B 1R5VB 3S34L 1RV6X 1WVZA 4I3RL 1U41A 3NACL 3SDAA 4ZFZB 3U7WL 4YBLC 4NN6C 4DGYH 2BXYA 2W0FB 2C9AA 3RGVC 4FMKA 2GFBB 2ZUQC 3MRJA 4U6VH 1WTLA 4XVJL 2D7NA 1D6EB 4M6MH 5T5NG 4YDJB 2A6JB 4CVUA 1WC7B 4XVSH 1HXMA 1NBVL 2YPLE 1AHWA 5GGRY 2VWEC 4O51A 2R1YB 5FYKL 3J8F7 3OBAA 1YMMA 3QXAB 4M1GL 4MWFB 1T1WA 1E4WH 3P9MB 5C0CA 2ZCHH 4RGMC 3UTSD 4OGAC 1YZZA 2P8MB 5DJCB 4QXUL 4CJ0A 5T1LD 4P59H 5HPMA 1NKOA 5DURB 5D7LA 1UZ8B 4OD3L 1H3UA 1JHTB 5I16A 3V95A 1J0KA 5GGSA 1KJ2H 2VXTH 1WT5C 4URTB 5H35B 1REIA 4Y89A 2R15A 4M1DL 4MQSB 5LXGL 3O45B 4C4KT 4IJ3C 5L2KA 1AO7E 4Z77A 5ERWB 4J3OC 4XXDA 2CKBA 3OR7B 3QZWG 3VXPB 5JIIA 5DHVA 3L3JA 4U49A 2DBLL 2R9HC 2PXYD 2FJHB 1QACA 3LEVL 3EFFB 1RZGB 1U95A 2R0KH 4D0CA 5GRVK 5KVMC 4PJ8C 3FOMB 1N4XL 2X4QB 1I1RA 3S88H 4XRCB 2EC8A 5EC1A 5D93B 4TNVF 1IAKB 1OAYH 5KSAA 5K9KA 3T77A 4ODWA 3BP4A 3UTTB 4P5TA 3F58H 4AIOA 4Y5YB 4F9LA 2FECI 3VXUB 3TCXA 4L4TB 1JL8A 3KPOB 4Z7QF 4PJ5D 3GSXA 4JB9H 4TSAH 1AKJD 4S1DC 1YEGL 4G8GA 2X4PB 1Y0LB 2E6PA 4POZC 1KEML 2C4XA 3TCLA 3UPCA 3BWAB 1J1PH 4C56B 2H3NB 1T21A 3SDYL 2OTWB 4YH6A 4YHKH 4DUWA 2VDNH 1OSPH 5ISZA 1C08A 4GFTB 1VFAB 5I74C 4RFOL 4RDQF 2IALB 1TQBC 3SDCD 1QHPA 3EHBD 2H32B 3MRFA 1N64L 1MY7A 5HDOA 4DN3L 4RWYL 2D7MA 2V7NA 1C8PA 4JZJB 4L5FH 1XZ0A 4LGSB 4LHQB 3U7AA 2FEEL 4KTEL 5MEOB 5GHWH 3HG1B 4Y5XC 1DJSA 1U58B 3QJFA 1UYWL 2ICEA 5J13B 1RI8A 4OZFG 5HYJD 2QHLA 3BT2L 4I1NB 1T22B 2VLRB 4HWUA 1HCVA 5JXEA 4XCFH 4L3CB 1I1YB 4U3HA 2IAMD 5CEXB 4Z7WF 2C7UA 4GKZA 3S35L 1ITCA 4PJXE 3VFMA 1T5XB 3QDMB 3BDXA 3V7MA 2BSRB 3QIBA 4BUGA 1JHLH 3QQ4A 5ILTL 5J6HA 2I9TA 3BIKB 3PUCA 4RMSA 4KVNL 3O2DA 2GUOB 4P99A 3NFPA 1UB6A 2NPLX 3RZWA 4PR5A 3LKOA 3O9WA 5DTFB 3HZVA 1KTDB 1HHGA 1U93A 1S9XB 2J1KA 5D1QA 2BVOB 2H6PB 3GMRB 4L1DA 2AJYH 2Z4QB 3D0LB 4NM8L 5TH2A 3SDDC 5GXBB 5JZ7C 3NGBC 4FXKB 1FL5A 2MQ3A 3NFNB 2MCPH 4ZUUA 3H9SB 3PDOA 4N0RA 2F74A 5DJAA 1CXFA 3RWCA 2ZUTA 2OZ4H 3U1SL 4HUXA 4UNVA 5BMFH 4PFEA 1RIHH 2CKNA 1J1XL 2EE2A 3FMGL 5BO1L 2X40A 2EECA 5T1DH 3DRTB 5AZEH 3SQOH 4XCNB 1GZQA 3IJSB 5GS0H 3UP1A 1RJLA 4OCYH 3OXRA 1TETH 4IRSB 5D71L 2CRZA 2NY2C 3RIFK 1J5OH 3MCKA 2MPAL 4YDKH 1NMCC 5IWLC 4P2RA 4A2LA 3NIDE 3QNXA 2NY6C 1ZGLA 3IXTA 4HLJA 1I3UA 5E1HB 5TJWK 4NHCL 3L95A 3G6JA 5E6ZA 3HI5L 4TULL 2I27N 3MRNB 3U9UA 1WFTA 5IMOB 1H0DB 1XGPB 3UTSA 4M1CC 3QNZB 2ESVB 5ETUA 1MFDH 1X7QA 4Y1AB 1DUZA 1JZ2A 1KYOK 1L6ZA 4ZSOB 5I17A 5J1TC 2PCPB 1IBGL 4N90D 1WQVT 2BERA 2X2YA 1SY6A 4K7FA 4PJHA 5B3JE 3ZDYF 5IB3A 5BV7L 5FGBA 2JK5A 1AXTH 1C5DA 2CR3A 1QSFD 1BZ9B 1MQ8A 2IF7A 4HJ0C 3UO1H 1X5ZA 1BQHA 4HFUH 4YHNA 4MD5A 3IVKA 1FLRH 3HUJB 3H2WA 4S10A 3RUGE 4EZMA 4JEGB 2FIRT 3MMEA 1JVKA 3KG5A 2AK4B 5C08B 4AEEA 5IB2A 3DX9B 3GI8H 2HLFD 4Z0XB 4TVPD 4IDLA 1CE6A 2WBJD 1NCAL 4QHUB 3W0WB 5GS2H 2FJFB 3TF7C 1RURL 4HKXA 1YECH 4PJ5A 5CUSH 5EBLA 5KN5B 3EJJX 1VEMA 4NKDA 5TDPA 1ZGLM 1G7JA 1IQWH 1K2DB 5ITFA 4U1GB 5DZNA 1MCPH 1KIRB 3X3FH 2DTML 3AMKA 2ED8A 4Q9CA 5DUBB 5E2TL 3WFCL 3MYJB 5AWNH 3SY0B 4MSWB 4A6YH 2QQLL 4WW2B 2DM7A 2O5XL 3ECBA 3V6BR 5LGHH 1Q0YL 3HC0A 1YMME 1IEBA 4OT1L 3SCMD 2W9DH 4Q9RL 5C0CE 2FB4H 3RWDA 3SDCA 5C70A 1Y6NR 1A2YB 2MHAB 4K94H 4V2CB 1ZT4A 2XZCH 4PLKD 4RFEB 5EZIH 3OHXB 5E00B 5D7LE 2VC2L 3ARBB 2GT9B 5C7XH 3B9DA 2GAZA 2IGFH 4L3AA 4XVTL 3HRZA 2WW8A 5HYJA 2P49B 2XZAH 1EH9A 3QZWA 1C16B 5KS9F 4UDTA 4JFXA 5A2FA 2HP4A 3RU8H 4LGRB 4P9ML 3LRGA 4F37K 1VESA 5JPNA 4PJFF 4I2XE 4P46D 2VH5L 4HMEA 3RVVC 1JRHL 4AEFA 5JIKA 3FQUA 3MLRL 4FZ8L 3D3VB 1B9ZA 3O2VL 5DF0A 1DBBL 3TH2T 3S7GA 1LO2H 3PIQB 4KMTL 3SEPA 1MCDA 5HD8C 2A0LD 5FM5O 5T3XH 3MQIA 4XC1L 2IH1B 4KI5C 3O6FC 4FQIH 2CDFA 4O58H 3DSNA 5ALBH 5KG9B 4RGNE 2N56A 5J56B 5D2NC 5TPWL 4G8GE 2WBKA 3RVUC 5C9KA 4HXBH 3HPLB 1MRCL 3MXWH 1ES0A 3THMH 5JA8B 1BF2A 2V5TA 1BQLL 1TNNA 1FYHB 1JYVA 3FONB 2P45B 1FORH 4HH9B 3LSOB 2OR9H 1PG7X 4LEXL 3S36H 5ICYB 4R4ND 2DQCH 4V1DD 5IW1B 2IQ9H 2RR3A 3WFBL 3FB5A 3Q6FA 5BZWA 3K1DA 4PS4H 3OGOE 4Z7UA 2N7BA 4X6CB 3TBTB 2EDXA 1JF6A 4LSUL 4D9LH 4HBCH 5J12B 1ZVHA 3WE6A 1HWHB 2C5DC 3V7AG 1CXIA 1YY9D 4UU9B 2BRRL 3BJLA 1T20A 4Z7NE 2XTLA 4Q0XL 4X9BA 1BWMA 3FN0H 4GG6A 3ZKNC 1S7VB 3MGOA 4X7CC 2NX5B 3KPMB 4HIIB 1U3HB 4OCSL 3P4NB 4WI5A 5F88B 5LVEA 3FT3B 1N0XL 5I71B 1FNGB 2VDLH 4HX1B 4KUZL 3P4LA 4LPTA 4Z8FH 1A6TB 3S4SG 1CL7I 5J0BA 3BN9D 3RVXD 2XG5A 4H26A 5JXAH 1KPVB 5JLZB 1MFBL 2CDGA 1IL1A 3KPNA 1D6VL 5EOTB 1VACB 4NWUH 3RA7L 4HGMA 2QHRH 3D2UB 1J8HE 3RWFB 1KCKA 1JV5A 2Z0BA 1QNZH 1N3NB 2DB8A 3ARFA 1A7PH 4HUUB 3X17A 2XN9D 2EICA 1C5CH 5I9QB 1FGVL 2CKBL 3DNKA 1A6ZA 3V52H 4XP6L 3KR3H 1L7IL 1QRND 3TM6A 3NZ8B 3H7BB 1HKLH 1RMFH 2APTA 3D6GA 3T09A 3R0MA 1MAKA 2BNUA 3F7VB 1A7NH 4L4VD 3OZ9H 1ITBB 3BQUC 3BX7C 4IOSD 4CVZB 4XPGH 2WBJA 3MRHB 1ONQA 1VENA 4YR6A 2Y07L 3O81A 5F3HB 5FCUL 4ELME 3OKKB 1T1YA 3MR9A 43C9B 4TUJB 1PD6A 4JR9H 2WWKO 3HFML 5ANMA 4OFIA 5IVZB 3MUGB 4FQXD 4QOKD 1I1CA 2H32H 1EJOL 1JPFB 3VD3A 4LLDA 2QSTA 5DJXB 3EDKA 4KQ4L 1LK3L 5F89B 1HIML 2LFGA 3SCMA 3VWJC 5EOCH 2CIKB 1KG0A 3RL1A 3MRDA 3BKMH 2R1WA 5I8KL 3UTSE 3IDNB 5GGRA 3G6DL 3X11A 4N0CD 1SEQL 1VFBB 5E7FA 5GIRA 4L8CB 2WZPD 4ORZC 2BDNL 4QCIA 2GJ6D 4HH8A 3IDYB 4LNRA 5BW7C 5SWQA 1KLGA 1TPXB 1JTOA 4OJFH 3D48R 4F2MB 3OSKA 2O5YH 4P46A 2YBRA 3MRMB 3VRJA 4FFYH 2NW2A 3PNWA 4UBDC 4K23L 1IGTA 1IGYB 2HTLD 4XBGB 4JO2H 3EYQC 4QRRE 1KTRL 5KOVC 2JB6A 4O5LL 4QT5B 1K5NB 4CJ1A 1T6WA 5DA4A 3O2DL 4XWOC 2NY3B 2A77H 3SE9L 3ZKMC 5D7JC 3HNVL 4OV6F 3UPRA 1FIGH 4CW1B 3NCJL 1SYVA 2PW2A 2FBJL 5B38B 5IJKA 3FT2A 4L9DA 3T65A 5KJRH 1A6WH 3WS3A 4IS6A 2NYYD 5EBWB 5BVPH 4QRQA 3FQRA 5JOEA 2Y5TB 1EMTL 4HWEH 5IEKB 4H1LA 5E2UL 1AI1L 5T3ZD 4RA0C 4I0PB 2YKLL 4V1DA 4OLWL 5C6WH 4ERSL 5D7IF 4LVEA 3SDAC 3GBML 3FKUS 5DK2B 1MELA 1M4KA 3STZB 4FP8H 4KK8D 2Z91B 3P30H 5INCA 4ORGA 2BNRB 3O3BA 5HYQA 3GRWH 3IFPB 4H0IA 1FL6B 3LEXA 1OTTC 1RZKH 1ZLUK 5HYJE 1E6JL 3BZFB 4P4RB 1AHWC 2AEPL 1RHFA 4AMKL 1CVSC 2ATKA 4O02L 3BH9B 4J3WA 4KXZH 4PJ9A 2KBGA 2A2QT 5C0EB 4RSVA 1MVFA 3RIFF 4AH2B 4WHTB 3WMSA 1MCIA 3HAEA 2VZSA 2LVCA 4KAQH 4GLRH 3BZ4A 3JV6B 4Y19B 2EIZB 1UH4A 3CFEB 1SMAA 3D5OF 3MLZH 4JM4H 1BAFL 3JTTB 5JNYA 3DI3B 5LGJB 1WTGT 1I7UB 3ZKXB 4M7ZB 3MGAA 1SY6L 4ENED 5CHNB 1TNMA 4F58L 1R5IA 2QSCL 5DJ8A 3C09C 3HHRB 4W68A 2HH0L 4LVHB 3AREB 5F6HJ 1DLFL 2FEEI 1QRNA 5EZOH 1MNUL 4LLMA 1PW3A 4GAYA 5KSAC 3BJ91 5J9PB 4P5TC 1RK1B 4D94A 4J3VA 3KHQA 4OKVA 4F9LC 5EBMA 3IDMA 2HRLA 4YNYB 4RGNC 4M7KH 5CSBA 3HR5A 5LAXB 3EO9L 3QEQD 1MJJA 1OPGH 5E2JA 4UIMA 5I2IB 2X4UA 3WO4C 2UUDK 3FB6A 1INEH 4LSSL 4Z7WB 4IHOA 1LDSA 3DRQB 1R3KB 1K4CB 1M6OA 1OWWA 2IPTH 4FQXA 1YQ2A 4QOKA 1H5BA 4OM0L 3VGBA 5IBUB 5DUPL 2UY7A 4GG6E 4LSVL 5FGCE 4NFBA 3TJHC 2HLAB 3GEWB 5F9DC 1IT9H 4OF6A 1CTOA 1P5VA 4LSQL 1UWGH 3QR2A 2IEPA 5GGTH 3S4SA 3EDFA 3X3GH 4Z7OF 4NO3A 3CZJA 1JI1A 3T2NL 1FN4B 4N8VB 1U91B 1NSNL 4KI5F 1I3GL 4JM2A 5DJZB 1GAFL 1VPOH 4K3EH 1EBAA 4B5EA 1T0NA 4MX7A 4UIKL 4ELKB 5DFVD 4N90E 3DYPA 4RIRB 2GJ6A 4EVNA 4MCZA 2H8PB 3VI4F 5JXEC 2Q8BH 5EDXA 1FG2A 3V6OC 2VABA 3QB7C 2R8SL 1G0YR 5E9DA 3I3DA 2CIIA 2DLEA 4HJJL 1XR8A 3TWCH 5F1NA 3WLBA 3B3IA 1TZIA 1QSFE 5DD1L 3O2WH 5DD3L 3TIEA 2UZXB 4MNQD 1U6AH 2VYRE 3QWQB 2F5AH 5IROA 1CF8H 4KRMB 3LH2H 2YD1A 4OZIA 3TO4D 1BVKB 1ZXQA 4ZOCA 5IMLB 4TVPE 2HWZH 1F11A 1B0RB 3LPFA 1P1ZA 4YDIH 5D1QC 2Y7QA 1T4KA 4GMSL 3IRPX 3SDXE 2NY4D 5I1AB 3TYFA 1G7HA 5ANME 1U2HA 1RIVH 1MF2H 4LF3A 3VXQA 3U30C 1K4DB 5B39B 2YN5A 2ARWA 2N4IA 1HINH 1KCRH 1A6UL 4LKCA 1CDIA 4D8PA 3VW3L 3QDJD 1TJIH 5FOJA 3WD5L 5DK0B 3P0YH 5FOBA 2NW3A 3GSNA 3BDYH 4OD2B 1F3JA 2CLVB 2R2HB 4N8PA 1JHKH 2VR4A 3SO3B 3WV0A 3N9GH 3ZE1E 4Y4KD 1HEZB 3TVMD 1I85C 1NBZA 1UGNA 3V4VL 4AEIH 3V5HB 5TDNA 5CAYB 2KZ1B 4KRLB 4W6WB 3RNKB 2W0LA 1DLHB 4PREA 3TN0D 1RJCA 4DN4L 1R3IL 4NO5B 4FQPA 1UEYA 5SX5K 5HHOB 4MJIB 5CCKL 4ZAKD 1G6RL 4H25B 4JZOB 4MNGB 1IZJA 3C8KA 5DQ9B 4JN2A 3MLTA 1NCWL 5ICXB 1GC1L 5DVLA 1I3VA 3VD7A 1EAPA 2J8UB 1NUNB 1PZ5B 1WZ1H 1GGCL 1DQLH 3MFFB 4HJGB 4J3SA 1S78D 3FO2B 3QIUD 2JIXD 5AZ2H 3WL9B 4KZDL 3QEGL 4MHHI 4C58B 2AW2A 4BFIB 2PTTB 3QIWB 4HZAA 4MB3A 4S1QH 2W91A 4OV5B 5F70A 1AGCA 3O4OC 3DGGA 5DVOA 4JPWH 4JHZA 3RY6A 1ZHLB 4XMPL 5FGBC 2P48B 3IS0X 1OP3K 4LAQL 2DTSA 2X10A 1T1XB 4Q7DA 1KT2A 3LQMA 3GGWB 4PRNB 1EUTA 3TBVB 2WK2A 1D5MB 1N5YL 4LHJB 5GS0D 1UM6L 4MMXC 5IVXA 1AQKH 1X5JA 4MDIB 3MLVH 4ONGH 4EDWH 1FFOB 5CD5D 1YYML 2HT2C 3D85B 4PGBA 1OARH 3VFPB 3KLAB 2P5WB 1TXKA 4TVPL 1UJ3A 5FECB 5KS9B 2OXGA 2R1XA 5HYSA 1NGZA 5D8JL 2AP2A 4WU7B 3MO1B 1Q9KA 2RB8A 4XNMA 3I6KB 2AQ1A 3W9EB 2HVJA 2O5ZH 1JRHI 3IJYB 1GPOH 4PJFB 3HNTH 4YO0A 4ODBD 5F8RC 3CUPB 5GJSH 2D7TL 2IANA 5IK3B 3WNPA 3PHOB 2IBZX 3WXVL 3NPZB 4NPYA 5HDQL 1FDLH 1UKSA 1CLZL 2A6KA 3N85H 1CDCA 3K1KC 4MA7L 2K3TA 4F7EB 1KJ2A 1U8NA 1HQ4B 5C8JB 3BZDA 1KXQE 3GIVB 3ARXA 4NN6B 2NY1C 4GOSA 1T7VA 5GGVL 4KUCF 4K3DH 3IDUA 3RGVB 3SN6N 3FN9A 4X5XB 1N6QH 2ZUQB 4JY6A 5C0DB 5E8PA 2BC4B 3S8WA 4GMTH 3FQTB 2VO5A 3VE0A 2EDFA 2P43B 4I3SH 5DDHA 4R26L 5C09D 5CSZA 1AXSB 4JGMA 3IXAB 1KIQA 5GRUL 5I75C 2X5PA 3MRBB 2XN9E 4GUPB 3VI3E 3BW9B 5I76B 2AERT 1ZT1B 4JY4B 5A2JH 5F1IB 3CMOL 4Q6IB 3CXHK 1FBIL 1IGCL 2Q3AA 4L4VE 1EK3A 5DJYB 2HFGH 4NZRH 3LS5L 3EGSB 3TO4A 1UXSA 4IJ3B 3QWOB 4TPRH 1JPTL 2I07B 3OL2A 5GJTL 3G5YA 4NGHH 4NO0A 5SWSB 3QFJD 3VFGL 4F7PA 4JFED 5ICZA 2XT1B 4LU5H 1W2KT 5C0BD 2DQDH 3O3EB 3V7AE 4XC3H 1JNJA 4JO1L 2R0LL 2DI8A 3VFVA 4DK6A 2VAJA 4EDXA 1I7TA 2AJ3A 4LQFL 4UQ2A 1GGBL 1YNTB 2J88L 3PABB 3TBWB 5DD5L 3QHZH 1F58H 1MUJB 3TYGH 1AGDB 1Y18B 3QDJA 4PGEB 3QH3B 4M02A 4WW1A 1A6VH 3MV8D 5DEFB 1KCUL 1MQKH 1AGFA 1R24B 1NAKH 4MJ5B 5DI8B 3FRUB 4DEPC 3D39E 1VERA 4LHUB 4Y4KA 1JWMB 3H42L 4ZDHB 3QNYB 2DQFA 4GQ9L 4QYOB 5F3BA 3GMNB 1JE6A 5E94A 5L8JB 4X6EA 1RHHB 1MCJA 3LHPH 3TN0A 4CDHA 4W70A 3RWEB 5F7EL 3REVA 3CDGB 2X4NB 1TQBB 4ZAKA 2FH6A 4Y5VA 4FZEH 3DX8A 3MLYH 3NH7H 2BSTA 2MFNA 4F8QA 2J5LC 3K80A 2G75A 4JDZA 1INDL 3HTLX 3MNVA 2EYRB 1J12A 1LK2B 4HC1H 4YFLF 5CILH 4G6MH 1LO4L 3TT1H 4JREB 4Y5XB 1NCDH 3D9AH 2ZCKL 4NUJB 1CLYL 1YUHA 4OLYL 1VADB 2JIXA 3QIUA 5FDWB 1AH1A 4XPFH 1T2QH 3KYKH 2Z8RA 3BP7B 3MZTA 3MLSH 4Y16D 3ILPA 1BVLB 3QI9D 1MCRA 1S8DB 1WWWX 2V2WA 3ARFC 3GSWA 1NGWA 1JF1A 3E6HA 3GI9H 3Q48A 4HK0B 5IB4B 4BFGA 2B0SL 4X7TB 1ETZA 1L0YA 2ARJA 4XNZC 2FHCA 3QT2A 2BZDA 4UTAH 1CDBA 1L6XA 4W4OA 4PV8B 1WWBX 3QUMH 5L7XH 4ZFOA 2Q3ZA 4HS6B 4ZNEA 1DCLA 1LNUB 4FXGB 5A3IC 3BGMA 5C07B 1B6UA 5DQDH 3EOAB 2XXCB 4YAQA 5GRZA 2HLFC 1J05A 4KV5E 4LDLB 4RMUA 3ZZ1A 5T3ZE 3NABL 4N0UE 2WBJC 5K93A 3F8UB 4F15C 1HKFA 3D69A 3DV4B 4M93C 5J3HD 3GMLA 3FO0H 1W72B 1VKXB 4FABH 4PTUB 3SDDB 1QOKA 1SEBB 3OR6B 5DURD 2XACC 3D18A 4U31A 3GMQA 3IFOA 3INUL 2AKRB 5TE6H 1FRGL 1KIPA 4XPTL 1S7XA 4NCC1 1IAIL 3SCMC 2AI0H 1D5ZA 4Z7VA 2YD9A 2HAZA 3HPJA 4R8WL 1MJUH 4WCYH 1PSKL 1HQRB 1VEOA 3PXHA 3IU3B 2F53D 3FQNB 3LOWA 1RZJL 2LVEA 2FYYA 5CEYA 1PG7L 3RZCA 4XHQA 3WNMA 5TE4H 4K7PH 4V2BA 4XCCL 1FG9C 5EU6D 4HIHA 4CMMB 1NMCB 2ICWB 2Q8AH 2ZKHL 2J7LA 2NY6B 1RUQH 1OTUC 4OFPA 2I9LB 3UTTD 4ZUWA 2WINA 3TBSB 5CBEB 1XGTB 2IWGA 2KKQA 5C09A 4L4TD 1KEGH 2EIBA 3CNKA 1QBBA 3BUTA 3TH4T 3BPNB 4AEHL 4EQ2A 4G6FB 3T0BA 5EIVA 4QHLA 4C56D 5D7IB 5KTEL 5IESL 3HS0A 4FTVA 5DT1H 5IVXE 5IR1A 4Z5RB 2A0LC 2M8XA 2YPVH 2OCFD 2FATL 3CH1A 3MLWL 5ID0A 3LRSB 4IDJH 5E5RB 1RJZA 5EU3A 3QEQE 4C83A 4A6YA 1CDHA 5D5MA 3T1WA 5IJKC 3HG1D 5IHLB 3AXLA 4KDWA 4E0RA 1VGEH 5LJYH 5C0BA 3MODL 4PRPB 5I18H 2XRAH 3G6JF 1UQSA 8FABB 5K9OB 4BH8A 1I8KA 3ME0A 4OB5H 3RVWD 1RK0A 2VLRD 3L3HB 1LEIA 1XGYL 3OKLB 4X98B 1HHKB 1UACL 1G7IA 4R4NC 1UKTA 2VDKH 4K3JH 5KSVA 3RJQB 2F5BL 3GSNL 3QDMD 5T3ZL 4NBZB 4POUB 1G1CA 1Z0MA 3VXRE 4O9HH 4X99B 4X6FB 4GAGL 1CFSA 4PJHF 4OZGA 2XKSA 4JY5H 1QP1A 4DAGL 4UZGA 4ZUSB 1T3FA 1YY9C 5DRWA 5E6YA 4PJ9C 1Q9LB 3GSQA 3HCVB 4JG1H 4X9GA 5DRNB 4EEEA 3HI6H 5DVMA 1FZMA 3QUKB 1ZVSA 1X4XA 4MNQE 4NQEB 3GSOB 1C1EH 3OGCA 1A8JH 2CMRH 3KYMB 3BN9C 5C6TL 3RVXC 5CGYD 1BREA 2DOCA 3DX7A 3H9SD 1KC5L 1CDGA 2AEQL 1KENH 2DBJA 3A67H 5J1AB 4KWUA 5D2LB 4Q2ZB 3NBNA 1XF5B 4Y16A 3U9PH 1NFDF 5T5NF 2FIKB 3UBXB 2V9QA 7FABH 2EIEA 4MMZC 4G6AD 2ZOKB 4ODUB 3CU1A 4RX4D 4ZFZA 2ZSWB 1DZBA 3WFHB 5BRZB 1NCBL 2W0FA 4XCEB 4IRSD 3CDYA 1E6OH 2GFBA 2XTJE 5B21A 1D6EA 3DROB 4XNYH 3QDJE 2DIBA 1WC7A 1FZKB 4QGTA 4DGYL 4EIZC 3ZE2E 4NQTA 4QF1B 2IBGA 3QG7H 5D2NB 2DRUA 3AU1B 4UOW0 5AG9A 2XKUA 4U6VL 4PJEE 4M6ML 2ESVD 3BPOC 4Y1AD 5DJCA 1OHQA 5GZOC 3DIFA 1CTNA 1N6VA 2JTDA 5HYFA 1LDPH 1LP9E 2P8PB 4FQXC 3U82B 1UZ8A 4MXWH 3ZHKA 1NAMB 1E4WL 1P7KB 5E2WH 2ZCHL 5JMRA 2E8YA 3O45A 2D0GA 4P59L 5ERWA 5GRXG 3OR7A 4NN5C 5C86A 1RZJC 3L7EA 4P2CG 3LY6A 2GCYB 2GKIA 4GW5B 4NCDA 3KNBA 1J86A 1KJ2L 2VXTL 3FFDB 2R4RH 3JTSA 4JM2C 3EFFA 1RZGA 1WSST 3B9KC 2F53A 3FOMA 2VISB 1QR4A 3B5GA 1LO3H 4XRCA 5MP6H 2DQUH 2G5BB 5EU6A 4X0KB 5C08D 4CAGA 4G43B 1HWGB 4YXKH 1YDPB 3U0WH 3UTTA 4Y5YA 4R6UA 3W0WD 2P7TB 4L4TA 3S88L 4PJGA 3KPOA 1NMAH 4DOHE 3UMTA 3MUHL 1OAYL 4G80B 4YHYC 2X4PA 2P47B 5IROC 1UVQB 1Y0LA 3BKCH 2HTLC 4ZQKB 3F58L 4ZNEE 1G6VK 3OB8A 4C56A 1IQDB 2H3NA 3FO1B 4NKMB 2OTWA 2YK1H 4JB9L 1F6AB 4TSAL 4X9IA 4UQ3A 4JGUA 3AAZB 4Z7UF 1VFAA 4YDVB 2IALA 1Q94B 1J1PL 2H32A 1Z9MA 1T7ZA 3GJEA 2VDMH 4LLVB 4XXCC 3PWJA 4YHKL 4PY7B 2VR9A 2VDNL 1OSPL 4YHOH 3CSBA 2P1YA 5MEOA 5DD0H 3HG1A 3SE3A 3ARBD 5KBNC 3MZGB 5J6GA 1KB5B 1U58A 2VDPH 2NYYC 4QRSB 4LPUA 4JFOB 1DL7H 2EDOA 1CD0A 4L5FL 5F96H 3PJSB 1T22A 2VLRA 1IRAY 4I5BB 2A83B 4OTXH 5GHWL 4L3CA 4YHIB 2D0HA 5CEXA 4QNPE 3CFKB 4TQEH 3A0OA 5F6IB 1UEMA 1T5XA 3QDMA 3QULB 2BSRA 3VXNB 4KK8C 1CFNB 4Q9QH 3V6FB 3M17B 1TIUA 3AROA 4XCFL 2IH3B 3MJ8B 3BIKA 4KU1A 1EEQA 2JE8A 5M94B 3PGCB 5FHAH 3WYRA 3I6LD 3RAJH 5C09E 3V0WH 4ZMAT 1TTFA 1JHLL 5DGQA 1OAZH 4LQ1A 5DTFA 3VWJB 2GJZB 1LVEA 4RMVA 1OAKH 1NUFA 2BVOA 2VERN 2AGJH 4WUKH 3LD8C 2H6PA 3GMRA 5HHXL 4OCRH 3D0LA 2DIJA 2VIRB 4LFHG 3L6FA 1MRFH 4FXKA 3NFNA 3H9SA 1TTUA 1PKQE 4QRPB 4MB4A 1QFUH 5ADOH 5C2UB 2FX7H 1JWSA 1JYXA 4FNLH 4ENEC 5D5ME 2D03H 3QFJE 1KJVB 5IHBA 4JFEE 1BHGA 1S7RB 2MCPL 4XCNA 1NGPH 2DLIA 3IJSA 4RX4A 5C0BE 4R3SA 5L8LB 4FQ2H 3MUJA 4IRSA 3PP3H 2FO1A 3P0VH 4MJ4A 5BMFL 1RIHL 2NMSA 1JBJA 4ZO6A 4ZFOL 1NPUA 2OBGA 1KN2H 4ZOAA 5JHDB 2D7PA 5AZEL 1PVHA 4NN7B 2W65B 1J1OH 1W72H 4OGYH 5GS0L 3MV8E 4OCYL 2Q7YB 2NX5D 1UJ3C 3HLAB 5JQHC 3BKJL 1U3HD 3B8YA 4MGXA 1J5OL 4XBPB 4F80A 1DUYB 3OKEB 3MRNA 12E8H 3I85A 4YDKL 3RPKA 1H0DA 1JIBA 1XGPA 3VGGA 4B0MM 2RFXA 3QNZA 4LDOB 3R8BB 4Y1AA 4Z9KB 1CLOH 4KI1A 1QA9B 3ES6B 4MLIA 4K7PY 1A4JA 2PCPA 1YEIH 1KJ3H 2DQJH 5DMGD 2BY2A 3ET9F 3WNOA 3KJ6H 4MJ2A 3D2UD 3NN8B 1X44A 1FQ9C 1MFDL 1MHCA 5T3XE 1Z9OA 2WUBH 3BRGC 3LZFH 4LFHD 1BZ9A 2EZ0C 1IGJB 3LN4B 4LCCB 4LRNH 1LHZA 2ZOLB 2UZIH 3WO3B 3VMOA 3T8XB 1SJEA 3C8HA 1AXTL 1HXMB 1WFUA 5C08A 3DX9A 4GKNA 1CK0L 3UO1L 4Z0XA 2F8OA 4HFUL 4PTTB 1T1WB 1FLRL 5FM8A 3AS0A 3W0WA 2FJFA 1MFEH 4KJYB 4CL7A 3U0TB 5KN5A 1K2DA 2MWCA 5HPMB 1P2CB 5CD3A 5GGQH 3GI8L 1KIRA 4M03A 2EC9U 4QY8B 1YEDA 5B38G 5DUBA 2JELH 3MYJA 3UYPA 1YECL 3SY0A 4MSWA 3TZVB 3UYOD 5CUSL 4WW2A 3TO4C 5L2KB 1PEWA 1IQWL 5HGBA 4JFYB 1MCPL 3X3FL 3L3JB 4FHBD 3C09B 2A9NH 1G7LB 1A2YA 2MHAA 3NIGF 2X1XR 4A6YL 5TQ0H 4RFEA 2P5ED 1IAOB 3OHXA 5E00A 1CS6A 2R4SH 3C08H 3ARBA 5LGHL 2GT9A 3HE6A 1Z3GH 4WHCA 5J57B 2W9DL 5E08H 4ODWB 2FB4L 3HC3H 4PJDE 4K94L 1OP5K 3D1MC 1C16A 3GSRA 2KQNA 4ALAH 2XZCL 3OXSA 5EZIL 1FAKT 1BBJA 1QO3A 5C7XL 4QGYA 2IGFL 1OD7A 4EQ3A 5C0ND 4Y4KC 3TCLB 3L3IB 3L5HA 4HK3N 2XZAL 3KYAA 3KPRB 3W2DH 1AE6H 4CVWA 1XGRB 3PIQA 4C54A 3PWPA 3RU8L 3FZUD 5EU5B 4R4FH 5ISZB 1ACYH 3TN0C 4ZFFB 3PE9A 3UTTE 2ICES 3V79C 2IH1A 1BFVL 1VSCA 2E9WA 4ZAKC 3VXUE 4IM8A 2NY3D 4Y5VC 3MRFB 5IVNA 3GO1H 5KG9A 2VDOH 2D0FA 3MNZB 1LO2L 4HDIA 1O0VA 4WY7H 1I8LA 4DCQB 1MCFA 3HPLA 5T3XL 1QHOA 4FQIL 1F4XH 4C56E 1S78C 3CC5B 4LAJH 4RDQG 2EH8H 4O58L 5ALBL 32C2B 3CLEH 3QIUC 3T3ME 2NY0C 5INDB 3FONA 1GGTA 5DA0B 5EUOF 4HXBL 3LSOA 1QLRA 4HD9A 4BFBD 2C7UB 4I0PD 4KVNH 4BQBA 1NH6A 1IAII 3KYOA 3X13A 3G6AB 1FORL 3HG1E 5J6HB 2PETA 4W4OC 2OR9L 2BNRD 5SV4A 3S36L 3GMOB 3TBTA 4I9WD 2IQ9L 3NFPB 4PGZA 5EB9A 2VLRE 3LKOB 4PS4L 5HYIA 3JVGA 1ZSDB 3HZVB 1CXLA 3BD4A 1X5LA 4JM2F 5T1KB 1NLDH 5IBUG 1S7VA 1P4IH 2NX5A 4D9LL 4HBCL 1U3HA 5HPOA 3P4NA 4MA8H 3FT3A 1NAMH 3WIHH 4HX1A 1A6TA 4UNUA 1FL5B 3FN0L 1KXTB 3TA3B 5EUKA 2D7OA 4Y19D 1AGEB 4N8VG 1KPVA 1N26A 1JFQH 1CBVL 2F74B 4BZ1H 2D7QA 4P49A 4OLZH 4PJIA 4HUXB 5EOTA 1QFPA 2VDLL 4Y4HB 3D2UA 1EEUA 2EXYD 1S7WA 5LKNA 4Z8FL 1N3NA 4OZIF 4HUUA 4JHWH 3G08B 3F6IA 1CICA 4TTDD 3ARED 3E0GA 3RZCC 4GS7C 4KFZC 4NWUL 5F7YC 3VWKD 3ARSA 1LGVA 3NZ8A 3NCBB 1K3IA 4DZBB 4P2RB 2D9CA 1A7PL 4TNWK 3VXOB 3F7VA 1C5CL 4PRBB 4MB5A 3MOAH 2KZWA 3V6ZB 3V52L 5GRYA 3KR3L 1MCBA 1NJ9A 4AIXA 3G6JB 8CGTA 2CDEB 4CVZA 1WAAA 3U7YH 3U9UB 4GRWF 5D1ZB 4U3CA 1HKLL 3MRHA 1RMFL 1IFHL 3QP3A 5F3HA 1TZHB 5HHPB 1A7NL 3OZ9L 1CZ8H 3JUYA 43C9A 2H1PL 3ARYA 4TUJA 1XCTB 3PV6B 3EOBB 1XAUA 5BOPA 5IVZA 3PF2A 4XPGL 4BKLA 3GKWH 5DO2D 4KZEH 1JPFA 5A43C 5B39G 3O4OB 1U42A 5DJXA 5F89A 4RRPG 2JK5B 4CKVX 4JR9L 4M8VA 1CQKA 3MV9A 1KB5H 5IBTH 2CIKA 4Z78A 4GH7B 3IVKB 2ESVE 4Y1AE 3I02B 2DM3A 1RURH 2MOVA 4ZSOE 2P5EA 1VFBA 4K94C 4L8CA 2WQ8A 5EOCL 5IB2B 4OQTH 3BZEB 3BSZL 1IE5A 5DQJB 2QTEA 5DUMH 3DVFA 4N0FB 3WCYA 1CD1A 4MDJB 3ZKSD 2YHGA 4J3UA 4NZDA 4F2MA 4ETYA 5E8NB 4GW1B 2J4WH 2PO6C 1NFDB 3HUJE 3O6KH 4Q9RH 4PRAA 5F1KC 1IGYA 3MV01 4G8FB 4OM1H 4XBGA 2AK4E 5C08E 1K5NA 1WCBB 4OJFL 1QFWH 3ECBB 2VSCA 2O5YL 4KROB 2PYEB 3MACH 2E7CA 4FFYL 2V5MA 3RWDB 1FNFA 5F8QC 5GISH 5TF0A 4OZHE 4CW1A 2B4CH 2NY1B 4XHJD 4HWZB 4H8WH 5B38A 3LKQB 3BMVA 4IRZH 4U7SA 2GAZB 3IDJB 4I0CC 5K9JH 2A77L 1MPAH 5EU7E 3MLRH 1AIFA 2AJVH 4JO4H 3NMEA 2Y5TA 4UDTB 5IEKA 2OMBA 4CADB 2B5IC 1U3YA 5E70A 3TPKA 4I0PA 4YX2H 4WI4A 5I75B 5KJRL 1A6WL 4RFNC 1EJ6A 3QRFM 3PXJA 4CMHC 1B6DA 5BVPL 2QQNH 4WGVB 3N1GC 1S7QB 2Z91A 1WWAX 1CE1H 1XF3A 2BNRA 4D0BB 3IFPA 1FL6A 1BEYH 5EZLB 6FABL 5H94A 4BQ6A 1MCQA 4P4RA 5HHOD 1WZMA 2VAAA 4MJID 3DI2B 4FP8L 4NJ9H 4FMFA 2AK1H 3BH9A 3P30L 5GSRA 3QO1B 1R0AH 5HGAA 5C0EA 1JF5A 1BZ7B 3GRWL 3H7LA 2CPCA 5GSVB 1ES0B 1RZKL 4AH2A 4WHTA 3D3VE 3IS1X 4ODXA 5IFAH 5HHNB 2HJLA 5A40E 2C1PA 4Y19A 1KIUA 1ADQA 2EIZA 3CFEA 5L2JA 4NQDA 3QIWD 3I6LE 4D9QE 5FEBA 3PGFH 3B8SA 1F4AA 2GK2A 1I7UA 2LAGB 4KPHH 3FB5B 3C87A 4KK9D 4KAQL 5J11B 4ZPVB 2CK0H 5HYEA 2Z31B 1NGXA 4Z7UB 1T80A 3CMGA 4DEPB 3ULVD 3MLZL 2DJ4A 4JM4L 4XP4L 2YD6A 1YPZF 3BEVA 1MAMH 2YD2A 2WWMD 4OCSH 3VWKA 1OTSC 5GS1A 3C6SB 4YDLB 1ULVA 4U6TA 5J9PA 1RK1A 2P42B 3MGOB 3D85D 4J3TA 4NKQB 4G42A 3ZHLA 5DVKA 2J5LB 5CJBA 4NDMA 3Q3GB 3C5SB 5EZOL 4PB0H 5I2IA 3O8XB 2X7LB 3F7YB 2IADA 4NQVB 4X6CE 3L5JA 3DRQA 5AYQA 1R3KA 1MLBB 4H26B 3L1OL 1K4CA 1CI5A 4M7KL 1T2XA 1EAJA 1OPGL 1I8MB 4UAOC 1P4LA 1JV5B 1INEL 2HLAA 2J8HA 3ARFB 2NX5E 2NTFA 3PQYB 1A7OL 1A6ZB 1TVHB 4N1EA 2IPTL 4UMGA 1ZLUH 4OZ4A 1MFCH 4AT6B 3SE3C 1FN4A 4N8VA 4EI6B 3K3QA 3S98A 5FKPB 5DJZA 5JTWA 5J13C 4ZFGH 1IT9L 4LHUG 4ELKA 4FQQB 1UWGL 2W1NA 3RVWC 5GGTL 3X3GL 3AS2A 2H8PA 3HFMH 5L6YH 2UWEF 4F15B 4LASH 1ONQB 1VPOL 4K3EL 4HMDA 1U9KA 1OAXH 4OGAD 1KPRB 3SGEH 4M93B 2DL9A 6CGTA 2Q8BL 2EIDA 4E5XA 3TWCL 5JW4N 3P9WB 5J8OA 2DIAA 4WWKC 1FIEA 3O2WL 5IMLA 1BVKA 3QPXH 1F2QA 1U6AL 1WAAE 1Z9LA 3SCMB 3CVIL 2VRAA 2F5AL 3BDBA 1CF8L 3L3OB 1WIUA 5SWSD 1EO5A 3LH2L 3O6LH 3MRDB 2R1WB 5FYLH 5F9JB 2R9HD 3GBNL 1XF4A 3RUGF 5I1AA 2A6IB 2IJ0C 4PRHA 5GIRB 2A6DB 2HWZL 2HFTA 5KAQF 3DUHA 3WN5B 1K4DA 3A6BH 4KJWD 4HFWB 3G5XA 4JVPA 4RRPA 3MRQA 3C6LB 5DEGA 2UUDH 5DK0A 4QHMB 2QQQA 4TOYH 1RIVL 5FCSH 1MF2L 4OD2A 5FO9B 2YBRB 3PNWB 2R39A 1HINL 3C2SA 3LS4H 1IGTB 4LHUD 4POZD 1KCRL 1SBSH 1TJIL 4IRSC 4Y4FB 2BHYA 3BDYL 3SKOA 3RNKA 5GRJH 3Q2CA 4YPJA 3EO1B 3VU2A 2YXFA 4ODVH 3DGCR 1DLHA 1JHKL 1LEGB 3N9GL 5HHOA 4MJIA 4H25A 4JZOA 2DQTH 4MNGA 4AEIL 1RZKC 5DQ9A 3DXAB 1N6UA 1FNSH 3UPRB 1D5XB 3CX5J 4CU8A 1SHMA 1HXYB 3ALWA 4ZUTB 5ICXA 1SYVB 1O7VA 2PW2B 2J8UA 1FYTE 5C9JB 3T65B 3MFFA 5T33H 5C0JB 4XZUA 4ERSH 3WS3B 1RJYA 1U8IA 1P53A 2JKXA 5GPRA 1AFVH 5J1SC 5ESAA 4H1LB 5FUCC 2W07A 4BFIA 4BQCA 1R5WB 2PTTA 3QIWA 5M95B 1WZ1L 4OV5A 5I0ZA 1DQLL 4WFGE 4G8IA 4N0YL 4V1DB 1ZE3C 1ZHLA 4LCIH 4P2YA 5SWZB 1PYWB 3M1BB 4APQA 3L3DA 5AZ2L 1A6AA 5DFTA 3LQAC 4CUCA 2Y6SC 5CKGA 4MD0A 1T1XA 4U1NA 1X3DA 4S1QL 3BD5A 5HYQB 2NR6D 3GGWA 3LEXB 4JPWL 1I9RH 4MS8C 4PRNA 1BIIB 4PJAF 4XPAH 3TBVA 4PP2A 3G04A 3M45A 3IDGB 5ITBL 1WBXB 3ZTNH 4MDIA 5E1AB 2ATPB 1FFOA 1U2CA 4BSWB 3EYVB 4PJ9B 1V5JA 3D85A 3VFPA 1G7MB 1QUNA 3KLAA 3X14B 1C7TA 5HHQB 1FFRA 1FVEA 5E03A 1CG9A 1EUUA 3HAEB 4LLQA 4U1GC 3MO1A 1AQKL 3SDDD 2XXMB 3I6KA 3MLVL 4ONGL 3W9EA 4EDWL 2BNRE 3FO9B 3RRQA 4TSCH 2VDRH 4I9WE 3IJYA 4JPIB 1ACZA 1OARL 3CUPA 5IK3A 3PHOA 3V2AR 4NWTH 2O5ZL