1R24B

Fab from murine igg3 kappa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
217
structure length
217
Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSNFGMHWVRQAPEKGLEWVAYISSGGSSINYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAIYYCTRGGTGTRSLYYFDYWGQGATLIVSSATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPGPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTDLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (IGG3-KAPPA ANTIBODY (LIGHT CHAIN))
publication title The role of homophilic binding in anti-tumor antibody R24 recognition of molecular surfaces. Demonstration of an intermolecular beta-sheet interaction between vh domains.
pubmed doi rcsb
total genus 31
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24B01
3GIZL 4EN3B 4XPGH 1A2YB 5D2LE 3O2DA 1IAMA 4OB5L 3TCLA 1J1PL 4K55A 2HWZL 1MFNA 3V4UH 5E6ZA 2FHFA 4GXVL 2OZ4H 1UM5L 4HWEH 4H1LB 4JFZL 1CN4A 5E9DE 5JPMB 1MELA 3V4PH 4BZ2L 4YHPB 2XNAB 2AERT 2LV4A 3ESVF 1WFOA 3H6JA 4HUUA 1UFUA 4R97C 2FX8H 4XNYL 4MSWA 4DJMA 3DO7B 2QSTA 2PXYD 3CVIH 4RQQA 2NY2D 4J6RH 3TN0C 1WT5C 5BXFA 4BQ8A 3HPLB 1MHHB 5EH1A 5IMOA 2VAAA 1DSFH 3LKPA 3RGVB 2ZOLA 4ORGB 5HGAA 2YD2A 2B5IC 1A9BA 4JPKL 2ZSVA 3FZUD 4GBXD 3VFRA 5B3JF 1I1YA 4F3FA 4XMLL 3TH3T 1XR8A 4NSKB 1G0DA 2YPLA 3OR6B 3QIUD 4OCRL 3DTXA 5C0IB 5DVKA 1GZPB 1SM3L 3M17B 4NN6C 4WW1B 3IGAA 5DHYB 1J8HA 4XHQA 3GSNA 4I2XA 1U8OB 4I0PD 3KYKH 4XVUD 5JOEA 1F4YH 4WEBL 5TF0A 3X17A 5LQBL 4IRSD 3HAEH 5HGHA 2CDEB 1NGXB 1T21A 3D5OF 4YBLB 4KPHH 3RVXD 4UV7L 5T1DH 3CSBA 4WHCA 5FO7A 4W6XB 4DAGL 3TJHC 5CEXA 4PB0H 2CDFB 4LCIH 4CN4A 3WJLA 1FVDA 4ISVB 3MRFA 3D0VB 2Q8BL 1KPVA 2EDNA 1QSEE 4MJIB 4S1SL 4WI7A 5DEZA 2XQYK 3AUVA 5D1ZA 2CUHA 5CHNB 2DYPD 4OZHB 5C0ND 1U3YA 5GGVY 3ZKND 1B6DA 2VNCA 2V9QA 3MV01 4YNYA 4RMWA 4EI5B 2X9WA 3RDTC 6CGTA 3B8SA 4PG2A 5ADOH 4YBQD 3B9EA 3I75A 2C7UB 1S3KH 1MAKA 4LLVB 4O2FB 3ARFC 3WDIA 3IFNL 5DJXB 4L4VD 1DUYB 1OL0A 1R3LA 3HC0A 5I1DB 2E7BA 2IFFH 1CLYL 2HVJA 4R4BB 4FQXD 5DJ0B 3O3UN 2DQHH 1JPFB 3U4BL 3OXRB 1T20B 4PLJD 2DQEH 1SEBA 4PJXA 4C4KO 5EBGA 4JVUA 3WSQL 4FS0A 2VLLA 2CIKA 4GQPH 5E0QA 4MGXA 1X4XA 4KDWA 1QTYT 3IDJA 4AT6A 3WHXA 4H88L 4KGJA 3HAEG 5HI5C 4UOJA 3V6OC 2QQLH 5DGQA 3VWJD 1FNGB 3D39A 2DQGH 2EDOA 2JCCB 4UBDC 4JFQB 4PJ9A 4Y4HA 2OP4H 1PEZA 3WNKA 3EFDH 3KJ4B 3MV7D 2CK0L 3ZYJA 2ZCHL 2BRQA 1X4ZA 3GRWH 3AY4A 4HS3A 2A0LD 2APXA 3QNXB 4QYOB 2PTTB 5D7KD 4OGYH 4TULH 3MRBB 2XIDA 3GO1L 4M3KB 3PWPE 5FO9A 2YUZA 3GMPB 3LKOA 5DFWH 3SKOB 1WBXA 1SVZA 4LAQL 1IGJB 4BQBA 4X7TA 1QA9B 3PP4H 3UDWA 3FKUS 5IVXE 3P11L 1H0DB 4HIIA 5T3ZD 1A14H 4XPGL 4YFLI 2GITB 5D7LA 1HI6A 3LDBC 1HEZA 5BRZE 2EO9A 5FYJE 2DWDB 4DQOH 3HUJB 4LLMA 3STZB 2BNQA 2NR6D 1AD9A 3IXTA 4AYFA 1B0GB 4CADB 4LDOB 5C0AE 4JM4H 1JF6A 3E3QE 1QBLH 4ELMF 1UB5A 1EEYB 1T66C 4LHUA 5ESVB 4QY8A 4ESKA 3TESA 3VJ6A 3QNZA 1GPOH 2RIKA 4PJAB 3O41B 3HZVB 2VKXA 2FX8L 4XT1C 2FWOA 3SGJA 3WKML 4U1KB 3CVIL 4JZJA 4YAQB 5MEPA 3KGRA 3UTSD 1U92A 3FB7A 1JK8A 2M2DA 5HDOA 4J6RL 2H32A 4NNYB 1KTDA 1U91B 4GRWF 5EOCJ 4APQD 1BIIA 1JV5A 2IPTH 4TTGA 1KB9K 4ZFOL 3CFDB 4KTDH 4KFZC 1U95A 1X5FA 3QUYA 1AHWC 1JF5A 3MRQA 1G6RB 2YPKB 3U0WH 1MCEA 5GGVL 4LOUD 2DI7A 4FTVA 2I27N 3BD4A 2PO6D 3QIBB 1XF4B 3OAZK 1RJYB 3FB6B 3BP4A 2P8PB 1QO3B 3ARVA 4G7YH 2CLZA 2R1YB 3WNMA 4R7DA 3KYKL 5I17A 3MBEB 5D1QB 4QHKI 5C0CE 1F4WH 3LKSB 3O9WC 2YD4A 2FO4B 1MJ8L 2LVCA 3DMMD 1RUKH 4IMKA 3F8UB 3MFFB 4X6CE 2NTFA 3DXAD 4X4YA 5DFTA 4LLQA 3DGCR 5D1XB 5INCA 5T1DL 3P4LA 5IMKA 2R29L 4MCYA 3ISWA 2VABA 1XR9A 1NAMA 1Y6KR 3UPCA 5E1HB 2HJLA 3S34H 2H26B 3WD5L 4PJIE 1ITBB 1UQSA 5C0EB 2Z0BA 4E0RA 3M45A 1YJDH 3B3IA 5B38B 2R2BB 1M4KA 5DVOA 5KANG 4JKLA 1T03H 3SBWA 2EYSB 1YMMD 4JZOA 4OKVA 2BY3A 4YC2B 4E42B 5F88B 4D9LH 3GJFA 3S88H 3EZJB 4PD4K 1UVQB 2VOTA 2PETA 2V7NA 2FX9L 1C12B 2Z31B 3KPNB 4R2GB 4J1UA 1XIWC 1SMOA 4XP5L 1YECH 2MCPH 2IFFL 3S6CA 3VXNA 2I26N 4PJGE 2QJDA 1VEOA 2IH1A 2DQEL 2W07A 4ZD3H 4K7PY 1MH5A 4IRZH 3IU4L 3H3PH 4HFWB 1I85C 3FQRA 4M7JL 1PX3A 3R06B 1E27B 8CGTA 1BVKA 3P0VH 5I9QC 4JFFE 4PJ8A 5DTFA 4W4OA 3C2AH 4M5YH 3FO1A 2OR9L 2DQGL 3TBYB 2CLRA 3SEPA 5BO1H 1AGEA 5F9JB 4OCXH 3EO1B 3VG9C 4U0QB 2W0PA 1R5WA 1R5VB 2YKLL 3TIDB 4OLXL 3OKOA 5IQ9A 4Y4KA 1QZ1A 2IANB 4JFEE 1NBQA 2F54A 3C5SA 1YYLL 1JCKA 4JJ5B 2PTUA 1WVZA 1PX4A 4TULL 3GMRA 4JQVC 4ZS7L 2WZPD 4P2RE 5D2NC 3KNBA 2VUYA 2OL3B 4HKXB 3SQOL 4OZIF 1A22B 2BCKA 3QDJD 4L9LC 1QSEA 2AW2A 4GSDH 3BZFB 1FAIH 3G6JE 2X10A 3JV0A 4G9FE 4J3TA 1A14L 3BWAB 4I4WA 3UZEA 1S5HB 4PLKC 4X6DB 3V7AG 1S7RA 3Q6FA 4DQOL 3F7YB 1JGDB 2X4UA 5IB2A 4BM7A 5F9DC 3ARWA 1N2RA 3QJHB 3HMWH 1KLGB 4OTXH 4LLYB 1QFWH 4K3EL 4JM4L 3F7QA 3H9SB 3LEXB 2VDLL 4ZUUB 2D7TH 3HE6D 4YHKL 3E6FA 1CYGA 2XN9E 3WO3B 3K2UL 2L7UA 3JWDC 4RGNE 4DKFH 1K6QL 1Q9WB 4KRNA 2V2WA 4YE4L 5TH2B 1EXUA 1JUFB 3HA0A 4U6TA 5ISZE 3ZL4L 2ADIA 3SDCD 3G5ZB 3T2NH 4NYLB 1EDQA 1LO4H 3D1MC 4M43H 3QI9A 1TJHH 3MRRA 4NC1C 4OIIH 3FN0L 4KTDL 1YNLH 4I3SH 1EAPB 4KU1A 4L29B 2OCFD 4KZDH 2C1OA 5DRZB 5E8DH 3U0WL 5E8PB 1IC5H 2X4NB 4N9GA 1HWGB 1Z6JT 3RZCD 3QXVA 3T0EB 5C8JA 4C4KT 2BVTA 4Y5XA 1JTTA 2FD6L 1YZZA 2BY2A 3NCFB 4YXHL 1P7QA 2CRZA 1HXYB 3SY0A 1H15A 1U93B 3OKNA 4L3EB 1FNEB 3CFCH 1T89A 1F4WL 3C08H 1UZ6E 1RUKL 3ARUA 4LPUA 4K7PL 3RL2A 3QH3B 3X11B 4XPAH 4F2MB 4OLVH 3S98A 4FZEH 3D85A 1ORQA 4R0LB 2L0DA 1EBAA 4FQPA 1JZ3A 3HE7B 3OKKA 4NHCL 1RVFH 4FQHA 4PGEB 4D0DB 4PPTA 3QDGD 2R0ZL 4OLZL 3S34L 3JV5A 2EE6A 5DK2A 5C0AA 5ILTH 3MJ7A 1OQXA 2UWEF 4GRLB 2NLJB 3RVUC 1A7RH 1UJ3A 3G08A 1R0AH 5HHNB 4JFXB 3BH8B 4P4RB 3FN9A 2GT9A 43CAA 3HI1A 2A83B 4Y2DC 4PRBA 1YQVH 2ICWJ 3S88L 3FT3B 4PV8B 4ZXBB 2UVFA 2AXJA 1DQQB 5F7KC 5GRZA 1C08B 3L3DB 2OYPA 1QVOB 4Y1AE 1RUAH 1E4XH 4LPXA 2W60B 4JVWA 2LTQC 2JB5L 3S3PA 5ETUA 4GG8B 2WP3O 1MRCL 2PTVA 5EUOE 3QFJB 4X9FA 1I8LA 4Q9RL 3RIAF 2F5BL 1OM3H 1AH1A 1EGJH 3H3PL 3B9VA 4CU8A 5I8KH 4YEFA 3S3SA 4X7SH 5F3HA 3QG7H 3NCYP 4LNRB 1I9EA 5A3IC 1DUZB 3P0VL 1NSNH 4AEIH 1HZHL 2NY3D 4FQQA 4C54A 1WBZA 5KVGH 1E4JA 3VFOB 3RVWC 4LPTA 1ETZA 4JAMB 3UJTL 5DO2C 4XP9L 1I75A 3GNMH 4AZ8A 3U46A 3L6FA 2XRAH 1RJLA 4M1DH 3DUSB 4R4NC 4MZ2A 4X6CA 3QDHA 3QO1A 4HUWB 3TFKD 3V5DA 1YN7B 1CDYA 1B2WH 2R23B 5EO9B 1Q8MA 3EJZC 3KLHC 2JTDA 3FFDA 3SHSA 5EU3B 3WFBH 1BBDH 3NCCB 1HKLH 3ZTJG 4JFOB 3VGFA 3UPRA 3BZEB 2UV3A 1VFUA 1TPXC 4YWGL 3W2DL 4PJIA 3DSFL 3CCHB 3A67H 5CMAA 3C9NA 4G80B 5CSGA 1MFCL 2N4IA 1DQDH 1KTLB 1A0QL 1S7UB 4JQIL 1IEBB 1VGEL 3NN8B 1ZHLA 2UVEA 4G6ML 2H2PD 1QYGL 4JPVH 4YGVB 3O3EB 2B4CH 1J0KA 4FABL 4P4KC 2VUOA 1VPOL 2Q76A 1SMAA 2QHRL 4EDWH 4HT1L 4XBEH 4RMUA 1BWMA 2AI0H 4N5EC 2ITCA 2B2XL 4Y4FD 3ILQD 5LWYH 4X6FA 3I50L 3C8KA 1FPTH 4DKFL 1IQDB 1KIPA 1MWAB 3CX5J 5IW1A 3BEWB 4LVOC 2NXYB 2PW2B 5DWUH 5D5ME 5EU6B 2Q8AH 1P6FA 1W2KT 1X5LA 3NCEB 4YEEA 5ENWA 2QADC 3G6AB 5EU5B 3N06B 4JFFA 3WFCH 4G8EA 1Y18B 3T2NL 1BMGA 1RZ7H 4AQOA 3VW3L 4WTWA 5DD6A 1IM3A 4OIIL 1PBYA 4I3SL 5H35B 3FFCE 2ZNWA 3MJ9A 4WW2A 4LBEA 2IADA 3L7FA 5E8DL 2N7AA 4XI5D 1K4CB 4EUPH 2X70B 3RWFB 1NCCH 2ZG1A 5E5RB 5GISL 5FUCE 4LSVH 4PRPE 5SX4I 4L1DA 2X6MA 4I5BA 4DGIH 5K9KA 1T0PB 4NO0B 3WXWH 1IEAB 1KB5H 4JO3H 4LQFH 1MVFA 1IM9B 4I18C 4PJFB 4TN9A 4JGJA 4NO3B 4P2RA 1CL7I 2X1OA 4ELKB 5J6HA 1EHNA 3JTTA 4KKLD 1GC1C 3CFCL 1MCBA 4MZ3A 1H5BC 5DMGC 3UC0H 5IKCB 3MRIA 1A4KB 4ODHL 2ZUYA 1D5XB 3C08L 1RAMA 1AO7B 2OQJB 1HILA 1I3GH 3G6JA 3MLTB 4YFEA 2XZQH 1N0XH 2D7PA 4ZFFB 4OLVL 3IDYC 5JOFA 4FZEL 3VXSE 5JW4Q 1CT8A 4QXUH 1EAJA 2X7LB 2QSQA 3AVEA 3GK8L 5EPMA 3VXRB 2ADGB 5I16B 3HZKB 1NMAL 4S10A 1YMHA 1RVFL 4P5TA 3MGOB 2DL2A 5C0GA 1CICA 4DW2L 1Q9LB 1T7YA 43C9B 2OTWB 3KPRD 3KVQA 2X89D 5ILTL 3KPLA 1ZTXL 2X4QA 4B7IA 1MIMH 3PWJA 1HHGA 2NTSP 1ZANL 5JQ6L 1A7RL 1MRDH 3TA3B 2XN9A 3BQUB 1Z0NA 4QT5B 3RX7A 2JELH 2P5EE 1IL1B 5I6XC 4UZGA 4P23D 4XZUA 3MODH 2VLJE 1S7WB 3CC5B 4HUVB 3LD8B 4PJXF 5ISZA 4LSQH 1HSBA 1Z5LB 3ARDA 5D7IF 1QSFD 4NQCD 3RNQB 1E4XL 1UZ8A 4F7PB 2YSSA 3IDMB 3UTQB 2ADFL 4P2QB 2PYFA 1Q9KA 3NFSH 3B4NA 4HWNA 5BV7L 5BZDA 3NAAL 4G6AC 3C2SA 3HMXH 2ZJSH 4Z7QF 3L7EB 1AGBB 4YXLL 4MA1B 1V7ML 2E7LC 5SV3A 3RPIB 4YR6A 5C0FA 1J05A 1ZHKB 1A6ZB 4QXWA 4X0KB 3QG7L 4RDQF 4GW4A 1FFPA 1CFTA 2YUXA 4AEIL 3MNWA 5FV2A 1T1XB 3ZE0E 1LVEA 2ERJC 2D03L 1JGEA 4PRNB 4JFDD 5CZKA 5HHOE 1KNOA 3CDGA 3AU1A 2FJFB 1YJDC 1GZQA 3EYVA 1FL3A 3GNML 3MUHL 4M1DL 1DDHB 1JYWA 1T3FA 2QQKH 4LCUB 1XH3A 4P2OB 2YBRB 4O58H 4UTBH 2EIZB 2ZOKA 4F9PC 5E9DD 4ZSOE 5DHVH 3CFIC 3UPAA 1PLGL 1FZOA 4WI9A 5LXGH 5TQ2H 3FHAA 3U36A 4XNZB 5JHDB 4OM1H 3BZ4B 3T4YB 1IE5A 2NXZB 2YWZA 4HEPG 4BSJA 1FO0L 3A67L 1ZVYA 2BOCA 3CVHB 1JNHB 1QR1A 3V6FB 3LKQA 5KSUA 5BMFH 2X4TB 3RI5F 5C0BD 4FFWD 1JYXA 1ND0A 4R8WH 1ORSB 3EYFA 2H3NB 4WIQA 4E41A 3OJDB 3TNMB 3V0VB 4JPVL 1BQHA 2Q86A 4U1SB 3ARGB 1OARH 3MV8B 4RNRB 4X7EC 4WWID 3TO4C 5CJXC 3LN5B 1ZT7B 4Y1AA 5B21A 3FB8A 1LNUA 1FIGL 2HH0H 1NUFA 3U0TB 1G1YA 3JWNC 5EUOA 5FHBH 3STLA 3U7YL 4YFLF 2YK1L 1CDUA 1CGWA 5EA0L 3QUKA 5DWUL 5IB1B 4P0DA 3VH8A 4UT6H 3U4EB 3EO0A 1NBVL 4K2UH 3LKNB 5I8EB 4X6EB 2UZIH 2JK5B 5DLML 3NIDF 1ZXQA 1CL7L 5CAYB 1V3JA 2A6KA 4QOKD 4LSDA 4PGCB 4NKOA 1VACB 2EDBA 3EDDA 3KPSA 3MTRA 5IBTH 1RK0A 1F11A 1TETH 2AQ2A 2R69L 3F5WA 1P2CA 3FQNA 4DGIL 4X8JB 5AG9A 3HR6A 3T4AB 1P5UA 4JO3L 4OFYA 4P3WA 3TBWA 5F8RC 2HT2C 4OF7A 4JRXE 3BJLA 3FB5A 4UDTB 4LEXL 4NUGH 5D2LF 4IRJA 5KN5A 5DK0A 1AKJD 3SCMC 2YN5A 3IDGB 4MS8C 3JV6A 4JFPA 5IMMA 3L3GB 1EMTH 1U3HA 3LOWA 4H8WH 1AQKH 2XZQL 3ZKQD 2VDRH 1V7NH 3C87A 4XCEA 4QXUL 1BGXL 1FFNB 3UTPD 4WNQB 3O4LA 2Q3AA 3BDBA 4L8SC 1MHPL 3ULSB 1P4LB 4IEFB 1BVZA 2XFXA 1EHXA 4BFGA 4Z18A 4ODXA 2NW3B 1NMCB 3FONA 4Y16D 3OPZH 1BFOA 1MRDL 4U1LA 4AM0A 1C5DB 2JELL 3QXUA 3UBXB 3BKJL 3R4DA 1NCAH 2C5DC 5LGJA 2H8PB 1YUHA 4TPRH 5D5MA 3REWA 4F37K 4WO4B 1R3IH 2X09A 1D5BB 2NY5L 2V5TA 2RGSA 2VLME 1CGVA 4P46D 3QEUA 2P47B 5D9SA 3NFSL 1HKFA 1I7UB 4M9PA 1YN6A 4OCMC 4QTHB 3RVVC 3LPGA 4KKAC 4MDJB 4DFIA 4JO2L 1U8HB 4U05A 1FVCB 2ITDB 4PRPA 3SGEH 4YHIA 1KJ2H 3MRHA 1VFBA 4QGYA 1DANT 3MGTA 5FA4B 5C0JA 5FYLH 5I1HH 4BK4A 2MKWA 4UNTA 1O0VA 4XCNB 3GEWB 4PRDB 1S7TB 4HG4K 2QQKL 5T1KD 4ZNEA 4YO0A 2FX7H 2FB4L 1A3RL 2XOTA 3Q5TA 3O2DH 3N9GL 4M7KL 1JRHI 4UTBL 3VXSA 1I7TA 4S11A 3X3GL 1BJ1H 1SBSL 2BP3A 2DKUA 4PD4J 1UM4H 1AC6A 2NW2A 2BHZA 1EEZB 5TQ2L 4ZO8A 4NKMB 2DM7A 1RZKC 1OHQA 2Z4QB 2J8OA 4OM1L 1ACZA 4BQCA 5T1LA 4HZLB 1XEDA 2MKLC 4M7ZC 4JPIA 1UACH 4WTXA 4MJ6A 4NQVB 4J4PD 2CRYA 3P4MB 1MCFA 1RIUH 2HA1A 3OG6B 1AGCB 2P5EA 4NQTA 5B8CB 4JN1H 5LVEA 4U6VL 1JF1B 2Y07L 5KSAB 3ROOB 3VFGL 4S1QL 2VDNL 5D4QA 1OARL 3O6FD 5GSRB 4YQXL 4NUJA 5EN2B 3DIFA 2A9MH 1QHPA 4KRPD 3ZHDA 2FR4A 3LRSB 1I9IL 2HH0L 1CIUA 1S7VA 1NFDE 2VRAA 1BJ8A 1E4WH 1I9JH 3O45B 3IKCA 1F00I 3O6MH 2IQAB 4KI1A 1QFWM 2J6EA 3BH9B 4G43A 4AMKL 1MVUB 3EYUH 3CU1A 5C0CD 4IRSC 2A6DA 5GQBA 2VXSH 5F1NA 3FT2A 4UT6L 3TVMD 1RZFL 3ZE1E 1G9NC 1FC2D 3GSNH 3DX6A 2ESVD 3O3AB 3FO9A 1DANU 4YHMH 5HHOA 3U83A 3GSUA 3U2SA 1JHKH 5DFVC 3VRJB 1XCQA 3AREC 3VCLA 4X7FC 1KN2H 4XBGB 5GS0D 1VADA 3PL6D 5IBTL 1OY3B 4PJHA 4PGBB 3PNWB 2DTML 3QPQC 1CGTA 2B4CC 2UZYB 1R3JA 1LE9B 1X5XA 5C0DB 3K7UA 3WBDA 5F7WC 5IVXF 4BFIA 1IBGH 3TT3H 1ZT4B 3MNZB 5C09D 2NX5E 2W9DH 2PYEE 2IALA 2K9UA 2OS7A 4UDUB 4ZPVB 5HHPB 1J1OL 4NUGL 3DVIA 4ZAKD 3WHE1 4M1CC 4MX7B 4OD2B 3ULVE 4V2BA 4HUMB 1EMTL 4KJYB 2D2OA 1FG2A 1JNLH 4H8WL 1JZ7A 1AQKL 3QEHA 2VDRL 3QIUB 5E6ID 3BP7A 2DJ4A 1H9VA 2OTUB 3L5WA 1XGUB 1MCHA 3EYSH 1KOAA 1UCTA 4M93B 5ERWB 1XT5A 1N26A 3OSKA 3CSGA 5SWQA 3BGMB 3U9PH 1J5OL 5DJ2B 1D5MB 5LGKA 3ABZA 3I6KB 4BSWB 1DQTA 3CX2A 1N6QH 5D72H 3WHE0 4QNPF 2YRZA 5J3HD 1IGTA 5TDNB 2VXTL 3VXMB 4ZMAT 2COQA 1NCAL 2ARWA 1OW0C 3MCLL 5GS2H 1CFSB 5T3XH 4JFED 3RL1B 4WHTB 4TUJB 2VLKE 3PWUA 1NGZB 1XF2A 4F7MA 5K33A 1LK2B 4R97B 3MFGB 2EC9U 1UC6A 1KTKE 4NPYA 4OZGF 5I75B 4WGVB 4C56E 5KS9B 3TN0B 1BFTA 25C8H 1MJJA 1NCWH 5FKAB 5ITBH 2E7CA 4TQEH 2Z93A 1YEDB 1ZGLM 2DL9A 2B5IB 3TZVA 1KJ2L 2HFTA 2D7QA 4PY8I 3NFPA 2R4RL 1KBGH 4Z7OE 1QKZH 4JRXA 4OV5B 5I1HL 2EDDA 1IGMH 2VDKL 1EVTC 4OUOA 4JR9H 1TZGL 3DVNB 5GGSA 4DCQB 1F4HA 2GTZA 4Z76A 4KZEH 1IILE 5D6CA 1FFOA 4QHKJ 1C5BH 1JJUA 5IHZB 5KSVA 3CZFA 3KDMB 3UJIL 4YHLH 2MHAA 1NGYB 1AY1H 3BKYH 3SKMB 1JNJA 1SYVB 3DX9A 4XPBL 3BYTA 1BZ7B 1LO2H 1S7XA 5A16A 3PV6B 3KWWA 4D0BA 5EBLA 5JOPE 4RDQG 2EDHA 4MQTB 4JY6A 4PJDB 5DHYA 3BIAX 1BD2B 3GMQB 3RUGE 3VXOB 3U9UA 4JN1L 4BUGA 2D9QB 1JPTH 1PD6A 4LRIC 4PJGF 5D7JA 5F96H 4QO1A 3A6CH 5DD1H 3C60A 2H32H 2IANE 2YRPA 4ETQB 1I3VA 4RBPK 2MFNA 4KDTC 3IAGC 1CXLA 4PJ7E 4NM4H 2A9ML 2XG4A 4QHLA 1S9VA 4B50A 2CKBL 4WFGE 3EHBD 1QSVA 5E1AA 3PWNB 5KVFH 2KQMA 3QP3A 4OAWA 5HGBB 2C26A 1NC4A 3EYUL 3O3DB 2GJ6B 1C16B 3D0VA 3RWDA 5E8OA 4RWYL 4G8FA 1LHZA 3GSXA 3TM6A 2VWEE 2YEZA 1MCDA 2DQDL 3NCJH 3KS0H 3GSNL 35C8H 1NFIB 4YHML 3CAFA 3GMNB 2LAAA 3E8UL 1CU4L 5E08H 3UJJH 3OKDB 2FIKA 2V17H 2BY0A 4GO6B 1WIPA 5GRXG 3BP6B 3RNKA 4RA0C 3GSRA 5L2KB 1HDMA 1I8IB 3UTSB 2P8MB 3I2CH 3BW9B 1T0MB 3RBSA 3G6JF 3QUXD 3TT3L 5SV4A 3WV0A 2AJZA 1NAMH 2FZ3B 5AG8A 3OX8A 2W9DL 3B9KA 4JRYE 1B0RB 3T0WA 3QJFB 4Q97A 5JO5A 4XPHH 3QUZA 4FRWA 3WYRA 4D0CA 3SGDI 3PXJA 1JNLL 5ID0A 1A7QL 3Q1SH 4LLWA 3VWKD 4P59L 1MI5D 1W0VB 2HJFB 2IAMD 4KJWC 5CGTA 3OKMB 4JKMA 4N8VB 3EYSL 3GJFH 3HS0B 2HG5B 1FV1B 2RJMA 2E7MA 2HYMA 4F37F 4MXQD 3VFMB 5MEND 3U0PA 3U9PL 3IXAA 3RY6C 5BW7C 2HT4C 4MNQB 3T0EE 4KKCD 3SDAC 3LDBB 1I1AA 3QZWA 5C3TA 5EOQL 1A7OH 1NFDA 2AGJH 3RKPA 3BX7C 1ZA6A 3HR5B 3GMPA 1Z0MA 5F21B 2KPNA 1N5AB 5E2UH 4M4RA 4P9HL 2FGZA 1FH5L 1JWMB 1IKFH 3QUMA 3SDXB 3CK0L 2YD6A 3RDTA 2X1QA 4I3GA 1QD0A 1DQMH 3UCRA 3ARFA 2J7LA 3HLAB 4FP8L 4UUJA 5EIIB 2FECL 1DE4B 4OGXH 3DO3A 4PIRF 2DBLL 4NQXB 1KJMB 5B4MD 3PQYE 2B0SL 1VA9A 5HGDB 4LCCA 3RIFF 25C8L 4HWBL 4TNVF 5JQHC 3ZKMD 1UZ6F 5E00A 2ENSA 3LB6C 3TO2B 2O5YL 2VIRB 3P0YH 3PIQA 5IVZA 3PV7A 4LHQB 1MNUL 4M6MH 2NX5A 4JHWL 2PYEA 4L8BB 5K59E 3REVB 3KLAB 3LEVH 3SDDA 1IGML 3LV3A 5I1IH 3H3BC 3MOBL 4JR9L 2ED7A 4MA7H 4NKDA 5GHWH 4K07A 3FCTB 3RWGA 2H2SD 4LPWA 3DUUB 4JG0L 5FGBC 1IKNA 1SJHA 2CLVB 5CJBA 5HVHC 4KZEL 3QFJE 3T3ME 2VDQH 1YC7A 3O9WB 1NUGA 3OGCB 4OV6F 3T65B 4JFYB 3BP5B 3IAPA 1OTSD 4ZQKA 1ZA3A 3UTTB 3RWJA 1HNGA 4U6HA 2MCG1 1INQA 1AY1L 3BKYL 4RCAA 3SDCC 5IB4B 1YEIL 2CK2A 1FDLH 5E2WL 3MROA 2YXFA 4J8RB 1FFRA 4ZTPH 2EDKA 3ES6B 3GJEA 4ZS6D 3BPNC 1F3JB 3T2PA 1S5IL 4DKDC 4PJBA 1CK0H 2I9LB 2J5LB 3OXSA 1R3KA 3AMKA 4D94A 2A6JA 1HHHB 2YZ8A 2XKUA 5F96L 5I1CL 3A6CL 3L1OL 3MR9A 1IC4L 1S8DA 2BNUA 2VLKA 5I8CA 3DHJA 3ARPA 2Y72A 4CVXB 4H26A 4U6YB 5KVFL 1N3NB 3BGFC 3MA7B 4C56A 1IAII 4LLDB 2HTKD 2Q3ZA 2ID5A 4WV1A 1XIWB 1AD0B 4JDVA 3T8XA 4LVHB 2VJXA 1CDIA 5BS0D 4XP1H 1QPPA 3AAZA 3ARBB 4NKIH 3BVNA 1LP9E 3HE6B 4MDIA 3NFNA 3D2UA 2X4PB 2BC4A 3UJJL 5I9QB 2V17L 5FO8A 1AHWA 3FO2A 3IETA 4HGWA 2MTPA 3T04D 3QQNA 1YY8A 1OGAB 4K7FB 3I2CL 3RWCA 3VG9B 1PKQB 3O8XD 2I07B 5FYJH 5CJ5A 4FQJL 2C3VA 2E9IA 4ALAH 1JZ6A 4X99B 4Y8DC 1NAML 3QCUH 2I9TB 1E4KA 4AJ0A 1XGYH 5CJQH 2VLJD 4OGZA 5EU6E 4FFYH 3ZYIA 1T04B 4PV9A 3Q1SL 3CUPB 1HOCB 3V5KA 12E8H 5IHLB 3UAJC 5GRVL 5IB5B 1AIFA 2YS4A 5D6DA 3RUGA 5DJ6B 5CBEB 4HPYH 1HHKB 2BNRE 5E99H 1T5XB 2YD8A 4U1IB 2ATKB 2FCBA 3RHWK 1UADC 3VGHA 3VFSA 4FFVD 4B5EA 3QQ9C 4K8RL 1IARB 1PW3A 2EDXA 5LKNA 3CSYA 4PJ7A 4ONFL 1DVFD 2DQTH 4GKZA 5DYOB 1D9KD 5GGUB 3WS3A 4NT6A 2AGJL 4PJFE 2O61A 1SEQH 5EU4A 5F9OH 3MYJA 3GUTA 1BZ9A 3BEVB 3HI6L 1IKFL 3TIEA 3IVKB 1AO7E 4F8TA 3DV4A 3R8QA 5F7HA 5IB3B 1G6RL 1PGRB 2OJEB 3LQAH 4PJEB 1WJ3A 5IMLA 3RVTC 1IGCH 4F7TB 2Z8SA 5TF1H 1NJ9B 4C83A 1F4XL 5EIVA 4UV4H 1GH7A 1ZS8B 1NC2D 2A9NH 1CE1H 1U8PA 4OGXL 4TUKL 3GI8H 5DEGB 4XNQB 4FG6D 4X8XA 5HYJE 1WAAA 3WL9B 1HH9A 3L5XH 3GSOA 3C6LD 5FV1L 3HC4H 4Y5YA 1KF9B 3OKYA 5I15L 5DI8A 4PGDA 4XC1L 4ZUUA 1CFBA 3P0YL 3GM8A 1AJ7H 3WLBB 5GRVK 4Z7UE 4JRYA 4Z7NE 3GJFK 4LU5L 3LEVL 4X9HA 3STBA 1VERA 4KKNA 2PW1B 5I1IL 3V8OA 4P3DA 4MA7L 4KV5E 5GHWL 1IGIH 1J8HD 2R1XA 4D9QE 4WJ5B 3DBXB 3MRCA 1XGRA 3BXNB 1NLDH 3K80A 4G8GA 4CMMB 1TTGA 4P2QE 4UNVA 1YYMH 1UKTA 1AE6H 4J3XA 1URLA 5CINH 3UX9B 4QGTA 4CDHA 3HN3A 4U1NB 5D2NA 5HVWA 1CI5A 1C5CH 1ZHNA 2BOBB 3LN9A 2EKJA 3GMLB 3P4OB 1F42A 4L9LA 2GK0A 2QL1A 2BDNL 1FDLL 2F53D 3QFDB 3V6ZA 4AEHL 4EXKA 1J10A 4ZTPL 1GIGH 4IMLB 1G9EA 2N7BA 1KENH 3OQ3B 4R3SB 1A6TB 5J1SC 1LO0H 4PRHD 1MUJB 3MRLB 3MRNB 4Z0XB 4ZUTA 2HRPL 1IAIL 5F1OB 3TBVB 3WIIH 4BH7A 2EC8A 3S96A 3UDWC 4IDJH 4Y2DB 3QBTB 4HW6A 1X5ZA 5EOTB 3LQZB 1HYSC 3MJ9H 1Q38A 1FCCA 5AUMB 2X9YA 4HIXL 4UU9B 4GMTL 4K3JL 2W0FB 5ACMA 2X4RB 3FT4B 2HLAB 4FXGB 5JHDE 4HG4J 2KKQA 4ZO6A 3PQYA 4PY7A 5ACZB 1FYTB 1DN0A 3D3VB 4Z77B 2ZUSA 4L3CB 1RZGB 2LTQB 3HAEB 3Q3GA 4IIQA 4NQEA 4XP1L 1YEFH 4O5LH 4U31A 3WNOA 4YH6A 4JN2A 2R2HA 5IG7A 3C5ZA 1YC8A 1U8KA 3RGVD 1QLFB 4ZYKA 5ID1A 1C1EL 1M71A 2FDBP 2KDGA 2XPGA 5CEZE 2DJSA 3SGJC 1QRNE 1EK3A 1CD0A 3MV8E 4JZJC 5J8OA 3EDEA 2JJUA 4PJ9D 4OCSH 2XA8H 5DRXA 1ERNA 3OMZA 3V79C 1TTFA 2ZG2A 2IPKA 2YC1A 5F1IB 3AXLA 5EO1B 4ALAL 4QRRA 3U79A 1X5HA 4NCDA 4M61B 3QUYC 5FGRA 1A4JB 2FSEA 3OJMB 2LQRA 4HUKB 5HY9A 1GOGA 3FQUB 1D5IH 4RFOL 2YN3A 2XI9A 1TVHB 4L4TB 2EIBA 2AJYL 4LPVA 2Q20A 4N0YH 1T7VA 12E8L 1AQDB 1R5IB 4UILH 3VFOA 4MVBC 5HHMB 2EXWD 4HPYL 3PWVB 2ED8A 4NHUA 5E99L 1FG9C 1QLRB 1TPXB 1WC7B 1JL8A 2FLRT 5C6WH 2VXVH 4UNUA 3S7GA 3T2QA 1H3PL 3JUZA 3SJVA 5MHSE 4JZNB 4IMKC 2XWBA 5IFHH 4MJID 4HUWA 4P5MB 1JYVA 2DQTL 2R2EA 3DNKA 3VRLF 5IBUB 1NGQH 5A2JH 3UZQA 3QXDA 2WINB 1YY9D 4EI5D 3VRIA 1O7VA 3W82A 2EO1A 2VC2H 2UYLB 2R1WB 1EZVX 2XWTB 4LCYA 4LIQH 2QHLA 1N64L 5KW9H 4NWUH 2ENYA 5E8EA 4G80A 4MQXD 5LCVH 4HMEA 1X5GA 2OMBA 5TF1L 1CG9B 4LVOB 4KROC 2FL5A 1LP9A 3VFUA 4UV4L 2A9NL 1CE1L 1F3DJ 3SBWC 2ZCKH 1X7QA 1RI8A 3GI8L 1PAMA 5K9JH 4XCYB 4AK1A 5FECB 3ZHKA 4J2XA 3HC4L 4TUOB 2NNAA 5E4IA 3IFPA 1BX2B 4XTRC 1KIRA 4JO1H 1ZMYA 2OI9B 4KMTL 3MREB 4RRPA 4FFWC 4RA3A 3N85H 2H9GA 2NY1C 1FNSH 2CQVA 4M6AA 1NPUA 5AWNH 1OF2A 4HJJH 3V6BR 5CP3A 2KZWA 5EUKB 4MAYA 1IGIL 3Q0HA 3QO0B 2QV2A 4PJ8C 4L5FL 5DC9B 1FL5B 2JIXB 4W4OC 1AE6L 3QA3B 1IZKA 3L3JA 5CINL 1H5BB 2BNRA 5LGHH 4JFDB 3JWOH 1OAXL 3KXFE 3R1GH 4QRUA 4QRTB 4MNHB 1MIEH 1ZLWK 1KIQB 1KLUB 4Y4KC 3IDYB 2V5YA 2VDPH 1WLHA 3VXQB 1XGTB 2AV1B 1OSZB 1GIGL 3VI4E 1KENL 3X13A 3O2WH 4S2SA 3DPBA 5BOZG 2BSSA 3DRQA 4LSUL 4LSTL 2AXFA 3EFFA 1DBMH 1G7IB 5K93A 1KGCE 15C8H 2OQJA 3ET9F 3WIIL 4V1DB 1KUMA 3K74B 4N5UA 4P4KA 1BLNA 4RGMC 3RTQA 4HJ0D 1PSKH 3NMEA 4OCYH 2GSGB 4IOSD 4TNWK 3IDUA 4RIRA 5I6XB 2HN7A 4CVZA 3JVGA 1W72A 5IM7B 3MJ9L 4YJZL 4JY4A 3QWOB 5HYJA 2W65A 4K8RD 4MWFB 1QFPA 5I1AA 5E5UB 2NCMA 1BPVA 3HG1A 2H1PL 1E28B 3F12A 1F90L 1Q72H 3S9DB 4U7SA 3S8WA 4HKBA 1PY4A 1UG9A 4Z7UA 4A2MA 4ODUB 4PB9H 4PJ5E 5DJZA 5IW6B 3GHBH 5IT2H 5J13C 5B22A 3U6RB 5EZIH 2NZ9D 4K94H 5B39B 5DD5L 1T2JA 3MV9E 1FL6B 2ERJB 4EOWH 2ARJA 3F65A 3BDXA 2QKIB 4KK5C 5CIPA 4Y16C 3QIBD 1CZ8H 4KMLB 3QI9C 2AKRB 3UXFA 3QDMB 5I1JL 2JCCF 2F54D 2HFFB 1FJ1B 1UYWH 2XACC 3MBED 4POZD 5D1QD 1KULA 5BCAA 5IGXH 3KPTA 4FN0A 1D5IL 1RULH 3D0LA 1F58H 4OSUH 1MFAH 4PRAA 4HX1A 2ARJQ 4Y5XC 4N0YL 4UILL 1ADQL 5D1XD 4M62H 5I76A 2FGWL 1NFDF 1K4DA 2D7OA 3GBLA 1HQRB 4ONHB 3MXVL 5JLZB 2VXVL 1MWAL 1P7KB 1T89C 2X1WL 3MSPA 3VXPB 1CFVH 1H3WM 3B9DA 1CFNB 1DQLH 2B7DT 5IFHL 4NRXA 4PTTA 5C9JA 3T3PE 4CNIA 5SWSB 2RCSH 1KJ3H 4LCWB 4WTZG 5DJ8A 1TVBA 1MFBH 4HS6A 1C8PA 1HNFA 1GYAA 3TO4B 1ZLUH 2D9CA 3VXTA 3ULUL 4LIQL 4XGZB 4UQ3B 3G5VB 5EZLB 5KW9L 4YXKH 4MQ7A 1M7IB 1MPAL 2VL5A 3DOSA 2WBJB 1T0NA 2Y7QB 1U8NB 2Z31D 4GQ9H 4R2GD 3WCYA 3THML 1UWEL 3E3QC 4PRIB 1HH6B 4PP1C 5KVEH 1UJ3C 3DLQR 5FIEA 1OAZH 3I02A 4U1JB 1S9YB 3O6KL 4QRPB 5C07B 1QEWB 2VLRA 3TYFA 1QRNA 1UCBL 3MV8A 4NQDB 4PJAF 5JW3L 4PGZA 1HHJB 1ZT7A 5IROC 3P2TA 1TVDA 3MOAL 1XFPA 3JV4B 1OOAA 1NCBH 4WWKC 4O4YH 5DDHB 1JPSL 1QBAA 4XHJD 2OR7A 1I8LC 1FNSL 1SBBA 4KGLA 2AJSH 3G9AB 3TNNA 3NABH 2AEWA 3BUTA 3MRGB 2IAND 5H94B 1RHHA 1LEKA 2Z8VC 1SVCP 2X4SB 3N1MC 3DRTA 4RAUA 2DI8A 4DOHB 4Q9QH 2RB8A 1L4IA 2BVUA 4HWZA 1RFDH 2I5YH 4JB9H 4ONGH 3LQAC 4Z78A 3PP3K 1CFQA 3SCMB 3L95A 3JWOL 5IJVA 5J0BA 4I48A 1G7LA 5KS9E 4P3CH 2VDOL 4QWWD 4MJ2A 1MIEL 1S78D 2VDPL 2D4FA 1DBBH 1NEZG 1MCWW 4OFIA 3B2UC 4ZO9A 2EXYC 3B6SB 4Q2ZB 4L4VE 2J6EH 2KL6A 3V5HB 3P0GB 4BSVB 5GRJH 4L8SB 3O2WL 1T6VN 5ITFA 2AXGA 2AEQH 3HI5L 5FHAL 4X5WA 2WM0A 2A77L 4XVTL 4XXDB 1DBML 4JM2B 3EOYG 5DQDL 4FQCH 5DHXB 3GMOB 5EBWA 5H37G 2E5EA 4MJ5A 2Z8RA 1J0ZA 1NL0L 5ICXA 4AL8H 4X83A 1PSKL 2F8VA 5CJXA 2E27H 3H9SD 1WEJH 3GIVA 5JW4R 4XVSL 1AR1C 5JDSB 1SHMA 4K3GA 1GGTA 3NH7H 4Y5VA 4ZO7A 1P4LA 4OF3A 1LGVA 4Z7OF 1MSPA 5DQJA 5ESQB 5LG1A 3FRPA 5E2TL 1H3UA 5ANMB 2MSPA 3MNVA 2KZ1B 5GXBB 2IFGA 5GZND 3HB3D 4Y19B 5D7KE 3A6OA 1XAUA 3GHBL 5IT2L 4AIZA 3UTZA 1KXQE 4BELD 5EZIL 3VXUB 2Z35A 4K94L 1I7RA 2AVGA 3BMWA 3HNTH 3IDIA 4A6YA 3KPPA 4EOWL 3EOBB 5HPMA 4WHYH 5BJTA 3T0ED 2GSIB 5L2JB 1G7JA 1Z9SA 2B8OT 3O11B 4PY8J 5AAWA 4NQSA 4WI8A 2VN7A 1NCDL 5T3ZE 2C3HA 3KXFA 2F15A 5CD3A 1UYWL 4L3ED 4WW2C 2GJ6E 1I4FB 4Y89A 4QHNA 5IGXL 3QRGL 3CFJA 4O2EA 3VFWB 1FE8H 1CIDA 1RULL 2OSLB 4PJCE 1F58L 1MFAL 4R26L 3MCKA 4OUUA 3VD9A 3QDAA 5C2BH 5CBAA 4XPTH 3KYMB 3WUWG 2V9TA 2VE6A 4M62L 3HCVB 4AH2A 1FLRH 4RGOH 3CFKA 3CU7A 5C09B 4HH8A 1FZJA 1I7ZB 1U2CA 3KJ6L 1KCRL 3HE7D 5DJYB 5SWZB 3LIZH 1CFVL 5KG9A 5DMYA 5L2KE 3UTSE 5DD0L 2AK4B 3WJJA 5K9OA 3IJYB 4GRLD 4D3CH 5IBLC 1IRAY 1WIUA 2FYYA 3PGFH 3K3QA 2WWMC 2NY4C 4OIAA 3RY4A 4XCFH 1MFBL 1AC0A 1JGLL 5CSZA 4HXBL 2BERA 3F7RA 1WTGT 3TWCH 4NRZB 4ZXBD 1RIHL 4NQUA 1V3MA 1WZLA 2CH8A 4HK0A 4YXKL 2A73A 3P73B 3VGAC 7FABH 3P4MA 5EWIH 1WBYA 1A1MB 2P24B 5C6TL 5IEKA 1T1WB 5KVEL 4H25A 4PJ5A 2NYYC 4HIJA 5B8CA 1KXVC 4IOFD 2CKNA 4RGNC 1FVEB 3NCYS 2BFVL 4ZFZB 5FKPA 5IFJB 1IMHC 3MV9A 5FOJA 4MNGB 1DEEA 4KK6D 5TGBB 2J2ZA 4YDVB 3E0GA 5EBMA 4OCWH 1GAFH 4NC2B 3S4SA 1NCBL 5FYKL 4HK3N 3AREB 1KEGL 3ROLA 1S9KC 3GGWA 3U7WH 2X2YA 2CGRH 5TPWH 4QXTB 1XGQB 3FMGL 1XZ0A 3H7BB 3SDXE 4HLZH 5CGMA 4DUVA 1JHTB 4JHZA 4FNLH 4DK3A 3EYOB 3ZDXE 3BPOC 4JDZA 3PE9A 1CD1A 5D96C 4L8DA 4Q9QL 1JTOA 5B3NA 2I5YL 4ONGL 4MD4B 5F6HJ 2DDQH 4M5ZH 1R3HA 3QT2A 1A5FH 3UYRH 1KT2A 1OT2A 4H1LG 3ZHLA 3TH4T 2Y23A 1ZLUK 2J12B 1L7TH 5FF6B 2PXYA 4U49A 1KCKA 2P1YA 2GUOB 1DBBL 1ZGLA 1ZHBB 2PCPB 5I2IA 3IJHB 3RWEB 3Q5OA 2HTLD 2YHGA 5C08D 3HPJA 5I18H 2B1HL 3DETC 2CJUH 5IOPB 1CICD 5CFHA 2Z8WC 3X14A 5GGSY 2AEQL 4QXGH 1CDCA 1KPRA 1D6EA 4AENA 4N90D 3OR7B 3RX8A 4AEFA 1XGPB 4GBXA 4H5SB 1RSFA 4HH9B 1Q94A 4KKBD 4EUPB 3GB7B 4I77H 4ZOAA 4XC3L 1HXMB 5KOVC 1CQKA 3GSWA 4LMQE 1LO5A 2V2TA 5HI4D 3QIUA 3L9RA 3WN5A 5FB8A 1KB5B 2NZIA 2XTJC 3ZKSD 5KVMC 4U1GC 2J4WL 4L8CB 3FOLA 2F74A 2IH3A 5CZVH 3ARDD 4I0PA 3NH7L 2GK2A 5LAXB 1NAKH 1HQ4A 2NXYD 5K59F 5F89A 3BPCA 5HVFB 4JDTL 5EU6D 3PDOB 4YX2L 3W39B 2RHEA 3GSQA 2BXYA 4IRSA 3I6KA 4LGPB 4ZUSA 4QF1B 4M6OL 4KK8D 5J1AA 3W5MA 1XF5A 5IK3B 4G42A 3DROA 5HYIA 5GGRA 2EH8H 5FUOH 3LS5H 3LZFL 2Y5EA 3ULUD 2ED9A 3T3MF 5DD3H 2ZSWB 4X9GA 3FAWA 3WFEL 4KHTL 2OXHA 1CFSA 5HJ3B 3WKNA 1IAKB 3DJ9A 4ELMA 4KY1L 1VKXB 1K85A 1YDPB 3S5LB 1MHEB 1U8JA 4X6BA 1LE5B 4K3DL 4NO0D 4JREC 1NGPL 1CR9H 5C2UB 1IM9D 2DYPA 2DMKA 4BQ9A 4F33B 5DS8B 4MA8H 5JIPA 3DV6B 4NNPH 4JANA 1AGDB 2P5WB 4U1HA 4MA3A 2ICWA 4FXKA 1OTTC 1FE8L 1SJEB 3CXDH 4PS4H 3MC0A 4X98B 4L4VA 5C2BL 2HJKA 5CWSA 3F58H 3N50A 4FQXA 4DTGL 3QUMH 2EDYA 3VXRD 3W9DB 4IRJC 3LIZL 4KTYA 3TF7C 4WUUB 3ZKMC 1U3HC 4YPGA 4CU6A 2Y6SC 1R6VA 3P77B 5DJDB 4LKCA 1MRFH 4DCQA 4D3CL 3PGFL 3VWJA 3EIFA 4HEME 3RWIA 3TA3D 3QB7C 3BQUD 2FH6A 3LCYA 3MLVH 1BBJB 4JKPH 5IHZA 5JXAL 3B2VL 1FSKB 4UIKH 1CTNA 3MV7A 1NGYA 2GAZA 2DQIL 1Z3GH 4X4XB 1OW0A 3QQ3A 5HHXH 2VB5A 2VSCA 7FABL 4XRCB 4OZIB 4Q6IA 4AG4L 2XXMB 5FA3B 4P2QD 5DHVB 4ZUWA 4XVJH 1G7MB 2DMCA 3MMEA 3ULVH 2J1KA 1KEML 1M1SA 1EFXB 4N0CC 1OTSC 3KYOA 3L5IA 3WLWD 1J18A 5I66A 3SKNA 2VTFA 2GFBB 1JHLH 4DVBA 4MXVE 1GAFL 3QXAB 4N8CH 3N1PC 3WXVH 5FOBB 2G75A 1OAKH 3MLRH 4MHHI 6FABH 2Y9RT 2IMMA 4ODBD 3KPSD 3TP4A 1KELL 1MEXH 3IS1X 2CGRL 2DTSA 5TPWL 2GTWA 1KCVH 5CILH 1KFAH 2V5SA 1C16A 4D9RD 4F80A 4FNLL 2VERN 4PJCA 4WU5B 4ZTOL 1B0WA 1BQUA 4MD5A 4AIXA 4CW1B 4XBPB 2ZUTA 5JPNB 1D5ZA 1PZ5A 1DLFH 2CDGB 4M5ZL 3O2VL 2KBGA 4DZBA 4R9HA 1BM3L 1A5FL 2G2RA 1HHIA 2DF3A 2G9HA 3ECBA 4PJFF 2HTKC 4HJGA 1QLEL 1NBZA 2NXZD 2CPCA 4ENED 4P57B 2P8MA 2HLFC 4FZ8H 4YHZL 1CBVH 4UOW1 5J11C 5JZ7D 5I18L 3G5YB 4APQA 5JMRA 2CJUL 3MRKB 5CP7B 1RZIB 4XH2A 2NPLX 1G7QB 3JBG7 1CF8L 1JGVL 3ARGD 4LRIA 3MJ8A 5KSBE 2BVOB 1KCSH 4XNUL 3SGKA 1BP3B 3O8XC 2PO6A 2HJFA 5DUPH 3WEXA 4XCCH 2SEBB 2BMKB 4N8VA 4O2CA 5L88H 1ES0B 2NY7H 3WMSA 3DUHA 5IQ7H 5CZVL 4UOW0 3D6GA 1NAKL 2FNBA 4Z7UF 1A6UL 4Z7NF 4YK4C 1P84K 3OJVC 3DMMA 1VHPA 1P1ZB 4M6NH 2WIIA 2VZOA 4MAUH 1J0HA 3LMJL 1TZIA 5DEFA 3NIFE 3DXAA 1P4BH 3NACL 1LO3L 2W38A 3MRJB 3DVGB 3CMOL 2EH8L 5E95B 4IS6B 1A7NL 5HI3D 3WIFB 4XNMB 5F9WC 3GBMH 4HKZA 3SDXA 3SE3A 2QQNH 1ZT1A 4RWHA 3PWLA 4PG9A 5MHSD 1MFEL 1V5JA 3G04B 4QRSB 4PREB 5LBSL 5TQ0L 3HLAA 2P4AB 4LMQI 4R96B 2W1NA 3VGDA 5FDWB 1CR9L 5IIEB 1AP2B 3P30H 1UKSA 1YMMA 3VMOA 4MA8L 4NNPL 5CEYA 3M1BB 4FOMA 3OHXB 3VGGA 3R0NA 3D3VE 5DUBB 3V52L 1HSAA 3W9EB 5B38G 2Z9TA 5HYQB 5HVHB 4PS4L 5FYKD 3QIWB 4UT7H 5IR1B 1QHOA 3V0WH 1N8ZA 1MQKL 3F58L 1W0WA 3WIHA 3QUML 4R90H 4XAKD 3X12B 1OTUD 1G7PA 5FCUH 3DX7B 4CMHB 4HC1L 1ACYL 4NP4L 1YPZB 3RY6A 3W0WB 3HZMA 4OIBA 1RZ8A 3BPNB 5BZWB 1MRFL 4I1NB 4Z7VE 3SDAA 1IQWL 1KJ2B 5F7EH 1OWWA 2H41A 1OGTB 5I74C 4UIMA 1RU9H 2IQ9H 2EDWA 4RMSA 4GKSB 5IFAL 1F6AB 4JFYA 2BVPA 5DURB 5IHUL 4POYA 3VA2C 1T80A 4GW5B 1A6AA 3BIKB 1A3LH 4IHOA 4TRPH 4WO4D 1P4IL 3BO8A 5HHXL 1A64A 4L4TE 3MCG1 2R4SL 1MJUH 2X42A 3CDFA 5T1MA 5JA8B 3TCLB 3PHSA 5FGCB 2P44B 2C3XA 1T5WA 2IG2L 3ULVL 2X4OB 4WI6A 1U58A 4Z95L 4JO4H 5F7DA 2HT3D 3QDJA 2DQCH 1DBAH 3HKFA 2Q87A 2PN5A 1FBIH 3BYYA 4EN3C 3HRPA 3MLRL 4HUUB 4YDKH 5ESAA 4MSWB 1V3KA 1MEXL 5EC1A 2O93L 5CILL 3BUYA 5E94A 5I1LA 1KFAL 4RQQB 3FQTA 1AD0A 5BXFB 1DQJA 5JIHA 2VAAB 3LKPB 4HIEA 2ZOLB 3G5XA 4ERSH 4Z5RA 5HGAB 5KTEH 2W9EH 3LRHA 1A9BB 2ZSVB 1IGYA 1DLFL 2Z92A 2Z91A 3VFRB 1PYWA 1I1YB 4F3FB 3MLSL 2X9XA 3IJSA 3U48A 1XR8B 2R9HC 3KPOA 2YPLB 4HKJA 3DTXB 3GBNH 5JR1L 3GDBA 1GCFA 3FQXA 4LSRH 3IGAB 3ZDYE 3SDCA 2D0FA 32C2A 5IVOA 1J8HB 5JXED 1QSFE 4NQCE 2YPVL 3GSNB 3L3IA 3O4OC 4I2XB 3OKEA 4UB0H 5GS3A 4W6YB 5ALBL 5JORA 2E6JA 4ORZC 5JTWA 1F45A 2CRMA 3K4AA 2IMNA 1Q0YH 5KSAD 4OGAC 5H2BA 5HGHB 1EJ6A 3MA9H 2VZSA 3L3HA 1HYRC 1T21B 4QCIA 4PBXA 3RZCA 1KCSL 4HFUL 1KG0A 5FO7B 4XCCL 5CEXB 1T22A 4KVNL 5BQ7A 3PHQA 2NY7L 3VMPA 4JFDE 1FVDB 4O00A 3MRFB 1QPXA 1LEIA 1BQSA 2R8SH 2QSVA 4PRHB 1KPVB 4UT9H 5D7JC 3AFLA 2AQ1A 2NY0C 3C60C 5D1ZB 4M6NL 3FJTA 2DQJH 3B9AA 5JMOC 1HK6A 1QUNA 4YBLC 2HKFL 1CE6A 4YNYB 1ZWIA 1SQ2N 4F57H 1G9MH 4DZ8B 4GH7B 4HBCH 3D69A 1IC7L 3I75B 3GBML 1T4KA 5TDPA 3MLUL 2W9LA 4CKVX 2R56L 2AJXH 5E8NA 3TZVD 3ARXA 5MERA 1K8IA 3QDGA 2FEDC 1R3LB 3HC0B 5L0QB 1HCFX 1NUNB 2HVJB 3FO0L 4KRMB 1SEBB 4PJXB 1N6UA 3AM8C 4X4ZA 3P30L 5C0BE 2VLLB 5F1SA 2CIKB 5DEGA 1YY9C 3VI4F 4C58B 3IDJB 4AT6B 3WHXB 2CXGA 2WUBL 4U6XA 4TVPH 1ZLSH 4QHUA 1EO8L 3ZDZE 5DMIH 3SKUD 1UH3A 3D39B 4J3OC 2XZCH 4U3HA 3L3OA 4PJ9B 1UB6A 5HPOA 4Y4HB 4UT7L 1JMXA 3V0WL 1A47A 1UH2A 4JPWL 3V2AR 1WZMA 1SYSA 3B9KC 3DGGA 4ZUVA 1YNTA 4HS3B 3RX5A 2AEIT 3QUZC 5DMKA 4KQ3H 5KSBA 4KVCH 4X5LA 4WJ5A 3NBNA 2DKMA 5FO9B 1MCNA 2ICEA 5F7EL 1TZHA 3LKOB 4HIHB 4DK6A 1WBXB 4XMKH 1CXEA 3JTSA 2IQ9L 3VXMD 5IUSA 1VGKA 3Q6GH 4X7TB 4OZFA 4YZFF 5C0RH 2DLHA 1OD9A 4LNVA 3INUL 4OQTA 4QOKE 4TRPL 2HKHL 1T1ZA 4HIIB 4XNXL 3LVEA 3MRMA 5C3LD 1JYNA 5D7LB 1EFQA 1HI6B 1HEZB 1I1AC 4HUXA 1SY6L 1ZVSA 2XKSA 4NBYB 4LLMB 4ZFOA 2R39A 1P6AB 3BPLB 3IU3A 3WO4C 3FQWA 1AD9B 5CP3H 3IXTB 1DJSA 3PXHA 3TN0D 3JXAA 1T83C 4D8PA 1VFAA 2DQCL 1DBAL 1UB5B 4NZRH 3EDJA 1JZ5A 4LHUB 3N1GC 2IJ0C 1SJXA 4QY8B 1INEH 1ED3A 3VFNA 2FBJL 3QNZB 1FBIL 3VJ6B 4ZDHA 2Y36H 2FWOB 5EB9A 4QHMA 4JZJB 3I6GA 5MEPB 3UTPE 1U92B 3FB7B 3TPUA 1JK8B 3EGSA 4WDIA 5D7IA 2H32B 4LCCC 1KTDB 1X6LA 1OAYH 4Z7WE 2D31A 1BIIB 1JV5B 4ERSL 3OAYH 2VSDA 2W9EL 1U95B 2I25N 3QUYB 3T3PF 2BXZA 4Y4FA 3SPVA 3MRQB 2FATH 1U8QA 5C07E 4NFDA 3KR3H 3SDDC 4FTVB 1B4RA 1MHCA 3ULVC 3GBNL 4HWUA 2QSCL 3VD3A 4RRPG 3BP4B 1W72H 2F5AH 4Z7VA 5BVJA 2CLZB 4WFFE 3TJHD 1IKNC 3H0TA 4R7DB 3JWDL 3V7MA 5I17B 1T1YB 2DMBA 4U0RB 1BD2D 3ZT6A 1Y0LA 4H0GA 5DC4B 5DA4A 1NDMA 3UEZA 1K3IA 3MA9L 2NTFB 4LRNH 4OD3H 4X4YB 1BOYA 4LLQB 4MCZA 4NN5C 5FCSH 1QFUL 2VZTA 5INCB 2J8UE 4GS7C 5IMKB 4MCYB 1RZJH 2VABB 1XR9B 4H20H 4E5XA 1NAMB 1JMZA 4J3SA 4JCLA 1MFDH 2C1PA 2UY6A 2HJLB 2JJVA 2R8SL 4UT9L 2GJ6D 4FQIH 5CIPH 1UQSB 3CH1A 3EOTH 3V4UL 4E0RB 4KROB 3B3IB 2DQJL 1RHFA 2OZ4L 3OTTA 4HWEL 3PHOA 4IOIA 5GJSH 4OKVB 1RD6A 1BFSA 4HS8H 3GJFB 1GC1H 3V4PL 4F57L 3P9WB 1OB1A 1BFVH 3X3FH 4HBCL 2EE2A 4LKXA 5C71A 4GAYA 2EDJA 5HI5D 2V7NB 4X9BA 2AJXL 4WV1C 4J1UB 3KPRA 3RKDD 5KS9F 3GSVA 5J4MA 5L2KD 1FNHA 4UBDD 2X89A 3GMMA 4QNPE 2NY1B 3VXNB 3PABA 3MUGA 3TBSB 2IH1B 2G5BA 5CD5C 2XYCA 1DSFL 1MH5B 4G3YH 1OLZA 1I1FA 1JN6A 3FQRB 5JUEH 4P23A 4OJFH 4K3HA 1BVKB 4TVPL 3G9VA 1KSRA 5CZXC 4PJ8B 2GY5A 5DMIL 3MX0A 1L0XA 5DTFB 1BAFH 3FO1B 2ZUVA 5ANME 2CLRB 2Z31C 4BH8A 1AGEB 1QSFA 4NQCA 5ICYA 3VFTA 5JW5A 3T1FA 1R5WB 3I3DA 4LEOA 4GMSH 1M7DA 3BMVA 3CPLA 4FQLH 4OZGE 3LEYH 1FN4A 3OKOB 1G0XA 4Y4KB 5IQ9B 1E4KC 4PBWD 2F54B 4YGAB 3PGCA 1FZKA 3C5SB 5TJWK 4KQ3L 1F4YL 4MNQD 4KHXH 1RK1A 1UXSA 2DLFH 3GMRB 2BY1A 3U1SH 1VEPA 4GW1A 3KNBB 2VR9A 5CEZH 2ESVE 5D6DC 4KPHL 4XHJC 4XMKL 2BCKB 4JHAH 5D2LA 2VZVA 4NJAH 3Q6GL 1OCWH 1QSEB 2IEPA 5C0RL 4PB0L 2DQFA 2Y5TA 4LCIL 4Q58C 4I4WB 5JNYA 1T66D 4HMDA 1ZVHA 5DUMH 1S7RB 3S35H 3Q6FB 3CFEA 2A74A 1PJ9A 2X4UB 5IB2B 5CKGA 5E9DA 2UUDH 1Q9OA 2LVEA 4NO2A 3PGDA 5C09E 1N2RB 3L3KA 5KJRH 1S78C 3CZJA 3QQ4A 5ADOL 2VWEC 3W11C 1S3KL 3E6FB 5M7QA 5HDQH 3U30B 1QG3A 1INEL 2RBLA 3QULA 1LD9A 4PJCF 2V2WB 5C0BA 1EXUB 1CLZH 2DQHL 2ZP0T 2ADIB 5GRYA 5I30H 1WCBA 3LHPH 4I9WD 4Y5YC 4EKXA 3QI9B 4JFHD 1VFMA 5EOCH 3MRRB 5DSCA 4DEPC 3H9HA 4WI2A 3WE6A 3SDYH 2QQLL 4OM0H 2XKNA 4OZ4A 2FATL 3O9WD 2R0LH 2C1OB 2OP4L 4N9GB 3KR3L 1OWRM 3OG4B 4F7EA 5C8JB 3EFDL 4LLUA 2XZAH 3UTTD 4MNGE 4N1EA 3CSPA 1R24A 1P7QB 2MNUA 1W72L 3BN9C 3GRWL 1O5DT 2F5AL 3AS1A 3LKRA 3SY0B 1OT1A 5M95B 1H15B 3OKNB 4OGYL 4X5XB 5ELIA 4YDIH 1OAQH 1A1NA 1II4E 4ACPA 2ADJA 4QOKA 3RL2B 4KJQD 4LRNL 4QRQA 5FEBA 3T0EC 1U6AH 1TNMA 3D85B 3PP4L 1ORQB 1OQOA 2WUCH 3FRUA 3H7LA 3OKKB 4FQHB 4TSBH 2VISA 3P9LA 5EO0A 4A6YH 5DK2B 1ZK9A 2Q7YA 5C0AB 3DURA 5GZOC 3MJ7B 1AKJA 2R2CA 4FQIL 4GJTB 1XIWD 1MCSA 3F6IA 3FHQA 1UJ3B 3G08B 3SDXF 2GT9B 43CAB 4G5ZH 3HI1B 3HRZA 3ARBD 5GJSL 2C9AA 3C8DA 2H6PA 1TIUA 4G9DA 3CIQA 4HHAA 3ZDXF 1EJOH 1QBLL 3QNYA 4PRBB 4HS8L 5HHQA 1GC1L 2WK2A 3BD5A 1BFVL 2VAJA 3X3FL 5J9PA 4NGHH 1GPOL 1IAIM 4RX4D 3OF6D 4Z7WA 1NKRA 1B4JH 4YUEH 5ETUB 4IIQC 4JRWA 1OGAD 4Y16A 1P69B 3C5ZC 1K5NA 4EVNA 2IPTL 5JUEL 3LAFA 5F3HB 5J7CC 1OPGH 3FRPG 4B53A 2AJ3A 4FQQB 1WFTA 1WBZB 1J1XH 3C6SA 1BAFL 2A6IA 3JV4A 1ETZB 4HD9A 1LEGA 4P46A 1I3RA 4ZOCA 2XY2A 4GMSL 2EYRA 3U46B 3L6FB 2AXHA 2VDMH 1RJLB 2CIIA 3PWPA 4G7YL 3KHQA 5INDA 2W59A 5ICZA 2HVKA 3MO1A 4X6CB 1G9MC 3QO1B 5F71A 3V5DB 1EH9A 4KHXL 3OB0H 2DICA 4PLKD 4OD1H 3U1SL 2J8UA 3FFDB 5IVXA 3NZ8A 1EERB 5MEQA 4I13B 2A1WH 5CEZL 3NCMA 4NDMA 2LU7A 5BRZA 3UPRB 4JKKA 1I8MA 4PJIB 5CMAB 3C9NB 1FORH 1BOGA 3G6DH 4CDGC 2A38A 3F62A 3S37H 3V9FA 3MUJA 5T1KA 1ZHLB 2XWJA 2EH7H 1A02N 4I3RH 1TNNA 5BVPH 1X44A 4EBQH 1CLCA 2VITA 1IGFH 1YJDL 2EECA 3QWQB 4K9EH 5E5MA 3R8BB 2NMSA 1T03L 4IJ3C 1MLBA 4N0FA 2FJHA 2Q76B 5CJOH 5KJRL 3K0WA 3RAJH 4D9LL 1PQZA 3ZTJH 4WUUE 1OSPH 1UEYA 4DKEH 2ITCB 3D25A 5IROA 4X6FB 5HDQL 4J4PA 3MJ6A 3C8KB 1YEJH 3ARZA 3VD5A 1KIPB 5IW1B 1MCLA 1MI5E 4KTEH 3N1QC 1YECL 3MV11 1KJVA 4WWKA 2MCPL 3O6LH 1H3GA 5J6GA 1GXEA 1CLZL 1H3TA 1RZKH 3PJSA 5ENWB 1FC1A 2FRGP 1PG7X 5IP4A 1M05A 4JFFB 4KJPC 4ZD3L 2CMRH 3LHPL 3S36X 4IRZL 5MENE 5GJTH 3O6FA 3IF1A 4GUPA 5DD6B 1IM3B 4KI5E 5DRNA 4Y8AA 1E4XI 3EJYC 4Q9BA 1YEKH 1IVLA 1HCVA 4OM0L 4WW2B 4LBEB 5IEHA 3EOAA 4OZGA 3C2AL 4M5YL 5BO1L 3L7FB 2RFXA 4OCXL 5DQ9A 3QWRD 1S7SA 3P40A 2VQTA 5C0CA 4I5BB 5K9KB 1JWSA 4MAYC 3S4SG 4L4JA 4F15B 2H45A 5GSVA 3TVMA 4P2RB 5J6HB 1G7HA 2BSTA 3CGTA 2ESVA 3JTTB 3T77A 1CTOA 1T2QH 4YDIL 1F5WA 3MRIB 2UUDK 1HILB 2A2QT 3G6JB 4UQ2A 1RJZA 4JLRA 3EYQC 3RVUD 2VXQH 3PL6A 4YHNA 3SE4A 5JOFB 1G9NH 4UAOC 1LK3H 2NY4B 1CT8B 4GSDL 4Y2DD 1FAIL 4QTIH 3AC0A 5EPMB 4MXVF 5C08B 2D0GA 4WFHD 3VFPA 1YMHB 4P5TB 5C0GB 1QACA 1MREH 1CICB 4A6YL 3FAXA 3KPLB 1GJIA 2X4QB 1FYTD 4ZAKA 2MWCA 3PWJB 5AEAA 1HHGB 3D3VD 1ZSDA 3HMWL 3KPQA 4OTXL 3RTQC 2QEJA 2XN9B 4G5ZL 4BQ6A 3FTGA 1QFWL 4RGNB 3QAZC 3VFVA 4PJEF 5HD8C 4GT7A 5E6IA 2ATPA 3JVGC 4XZUB 5F7UA 2D7TL 2MQCA 3MRPA 1U42A 2ZUUA 4PJGA 5ISZB 5IHBA 5A3ID 1HSBB 3QHZH 3ARDB 5FK9A 2IF7A 4GRWH 5AD0A 1K2DA 1UZ8B 2YSSB 3RVWD 2PYFB 1Q9KB 5DC0A 3ZE2E 5BZDB 4NBXB 3I9GH 5DO2D 2ZKHH 1N59A 5TE7H 1LO4L 4M43L 4N0UE 3D18A 1U8IA 2N56A 1TJHL 4XWOC 5C0FB 1J05B 1RZJC 1YNLL 4R4ND 4GW4B 1OPGL 5GGRY 1FFPB 1CFTB 3BPOB 3MNWB 5D96B 2HFEA 4MNGA 4KZDL 1NBYA 1FO0A 1K8DA 1IC5L 4JFEA 3EJZD 5F3BA 3KLHD 4L4TD 1KNOB 3CDGB 3AU1B 5KSBF 1GZQB 5HHMD 5GS1A 4YHOH 3EYVB 1U8MA 1FL3B 4FHBD 1ULVA 4RFEA 4JJHA 2VDML 1T3FB 4U2ZA 5SX5H 3LPWA 1XH3B 4KH2A 1JZ8A 1KPUA 5J12C 2ZOKB 2APBA 3QCTH 4OD1L 5BS0E 2WIMA 4G9FA 1FZOB 4XPAL 1M7XA 2A1WL 3TBTA 4S1DC 3NIFF 1F6LL 4PUBH 5CGYC 3VG0H 3DX8A 1MLCA 1FORL 2BOCB 5KVDH 4MMXC 1QR1B 2GUOA 3LKQB 5KSUB 2XTJB 4N5ED 4WHDA 5T3ZH 3BHBA 4U1GB 3DSNA 4HULB 3CD4A 4P2OC 1ND0B 4E41B 3EYFB 4Y0GA 1GGYA 4WU7A 3BKCH 4U33A 5BVPL 2BRRH 2OR8A 4EBQL 1IGFL 1R0AL 1BQHB 2FJGA 2P7TA 4XX1E 2Q86B 4NRYA 4PGJA 5CJOL 4G7VH 4Y1AB 1YQVL 4FXLA 5F97E 3FB8B 4KUCD 4ENEC 1LNUB 3W0WE 1OSPL 3NCBB 5EUOB 3STLB 1RIVH 4NNXA 4OBRA 2HMIC 1YEJL 1RUAL 4PR5A 4KTEL 2P8LA 3QUKB 4GRMA 1IT9H 1RZKL 3KYNA 5DJAA 5TDOA 1JPGA 3O3BA 3SO3C 1OM3L 2C3GA 3VH8B 2MOVA 2VQ1A 4LPYA 1EGJL 3EO0B 2EDRA 4FQ1H 5I8KL 5IJKA 4HQQH 4X7SL 5JDJA 1NSNL 3ILPA 4W68A 3EKCA 1JWUA 5E6YA 3OZ9H 1YEKL 2JIXD 5KVGL 5FGCE 2A6KB 4Z7VF 5DMGD 1BVLA 4NKOB 1L0YA 3IT8D 4RMQA 3KPSB 4XP6H 1I8KA 1TLKA 1RK0B 2E9WA 1F11B 3C5JA 3LRGA 1WFNA 3F5WB 3BI9X 2FLBT 1P2CB 3FQNB 5KOMC 2DRUA 4YIQA 1MJ7H 1KYOK 1S9WA 2XRAL 1DLHA 2BVQA 3TBWB 3N1FC 4KMQA 4GXUN 2XQBH 4UINH 3FB5B 1IJ9A 1L7IH 5KN5B 4JKWA 1T2QL 1EHLH 5DK0B 1B2WL 1A7PH 3JV6B 4JFPB 5IMMB 5M94B 1U3HB 2RAMA 3WFBL 3FOMA 1BBDL 1HKLL 4V1DD 2AJVH 1G9NL 1BQLH 2OX5A 3EDFA 4QTIL 5I1KH 5IV2A 5I8OH 3O4LB 3QUXA 1DQDL 5C9KA 3QEGH 3QPXH 4M8QA 3NVQA 3I3EA 4EDXA 2XFXB 1YEGH 4FMKA 4ODXB 4P5KA 1IAOA 3FONB 4MHHG 1GGBH 4URTB 4KK9C 1BFOB 2B4CL 3H9YA 4EI6A 4U1LB 4AM0B 1J8HE 4MB5A 4CN6A 4G6AD 3VWKA 5IF0A 4EDWL 1MI5A 4XBEL 2IAMA 2VLRD 1J86A 5LGJB 2AI0L 1E6OH 1YUHB 4R7NA 5D5MB 3REWB 5LWYL 3LN4A 2NY6C 1WGOA 1TFHA 1FPTL 3HNVH 1AGFA 4Y5VC 5EFIA 5MENA 2Q8AL 3QEUB 5D9SB 4N8VG 4XRCA 3VRLE 4KUCF 2OK0H 4OB5H 3WIHH 3WFCL 1YN6B 2F53E 4HUNB 3I9GL 2K3TA 2Q6WA 5TE7L 1RZ7L 4NN7C 3ZDYF 4W81A 3MLPA 3AROA 2V2XA 1PVHA 1FIEA 3QDMD 4GXVH 4PRHE 1UM5H 4HDIA 1CD8A 4WO4C 4PRPB 4CBPA 2BSRA 4YHIB 3MRHB 1VFBB 2EZ0C 1NCCL 8FABA 2CSPA 3MGTB 4GKOA 4LSVL 1V8HA 5EU7E 4XNYH 4YHOL 2V5RA 5C0JB 3WXWL 4MD0A 1KB5L 2K7PA 4LQFL 4WUKH 4F7CA 3QISA 4WTZA 3HTLX 4YO0B 2IBGA 2HT3C 1M6OA 5J11B 1X5JA 3UC0L 2ZUXA 1QOKA 3VXSB 1S9XA 1I7TB 1UENA 3NGBC 4CW1A 1I3GL 1ONQA 5SWSD 1N0XL 2NW2B 4JPKH 4LCWD 1TDQA 4ODWA 1QFHA 4TYUA 4XMLH 5T1LB 3TO4D 2EDFA 4JPIB 4OCRH 3VG0L 4MJ6B 1SM3H 1FAKT 2PF6A 2WBJD 3WJJC 2P5EB 3AS2A 1MIML 1KB9J 4PRID 3RWHA 5I19H 4WEBH 1NGWA 4YK4B 4YDLC 3OKLA 5ABDE 2ZNXA 3KPMA 4QRPD 5C07D 4NUJB 2DM3A 1CQYA 3DIFB 4G7VL 3MODL 4NQDD 2FR4B 2GJZA 1S7VB 2KH2B 4MYWB 3MACH 4UV7H 3ZDZF 5JXEC 4LSQL 1RIVL 2JB6B 3IKCB 5F70A 2APTA 1JVKA 4WFFD 4NO5A 4G43B 4N0UA 1IT9L 3K8KA 5B8CC 1X5AA 3P3YA 2Q8BH 2XQYG 1RURH 2GCYA 2A6DB 2QR0A 4NWTH 4S1SH 5F1NB 3HMXL 2D0HA 3FFCA 3FT2B 1RQ5A 3B5GA 2ZJSL 4FQ2H 3ARSA 4LP5A 4HQQL 2C4XA 3DX6B 5SX5K 1CGYA 5HHOB 3GSUB 4MJIE 3U2SB 2HT2D 1XCQB 3VCLB 3E6HA 1NEZA 3MRDA 3SCMD 4OZHE 1GHFH 4MS8D 1VADB 4XP6L 3KLSA 5DRWA 4PJHB 2EE3A 4K9EC 1UH4A 1I1RA 1R3JB 1KLFA 3LSOA 4JVPA 4BFIB 1U9KA 2V7HA 3I3BA 5L7XH 5BS0A 1F2QA 5KZCB 3SGEI 4GKNA 2IALB 4CRPA 5HYSA 1AP2A 4O58L 1L7IL 1EHLL 3V8CA 2EYTA 3M1BA 1FG2B 4DUXA 5LXGL 4JM2D 2AV7A 4PTUA 3QEQD 3QEHB 2PXYC 2AJVL 3P9MA 1BQLL 3BP7B 3L5WB 1A9EA 1ZGLP 2NY2C 4B0MM 5HVGB 5AZ2H 3O8XA 5I1KL 3UTOA 5I8OL 5BMFL 4PP2A 2JCCE 1BECA 5SWQB 1NANH 2LE9A 4R8WL 4BKLA 1YEGL 2IBZX 4Y2OA 2VLJA 2FHBA 3FZUC 4GBXC 1AXSA 3MQIA 4Q0XH 2EDEA 1IGTB 3EO9H 1EX0A 4WGWB 3QIUC 4Z7WF 1INDH 3LY6A 4Y19D 3DI2B 3WN5C 3RVVD 1E6OL 5IVNA 5FHBL 3HZYA 4KKAD 1TCRA 4I0PC 3OAZH 3VXUD 4U1MA 1FZMA 4XVUC 4OLUH 3PWUB 1XF2B 4F7MB 3V95A 2OK0L 1DVFA 3WIHL 1FGVH 3V0AC 1XF3A 1D9KA 4K2UL 4NPYB 1CS6A 3UYPA 4EIGB 4GOSA 2UZIL 3RVXC 4RMTA 2X4OA 1MJJB 2EC9T 3HUJE 1DBKH 3WUWA 2Z93B 3HC3H 3O0RH 3TZVB 3NFPB 1TETL 2OBGA 5I0ZA 4JRXB 3ZSTA 4OF0A 4OZFH 4ZSOA 1X5KA 2J8UF 3WKMH 5MEOA 1JPST 1NC2A 1EHAA 4WUKL 4OQTH 5C0NC 3ZKNC 1WWAX 5I75C 2DWEA 3IDNA 3NIGE 4PJAE 3VE0A 5SWZD 3MPCA 3C6LA 3O4OB 5EC2A 5GGSB 4ZPTA 1N5YH 4NOFA 3EBAA 1G6VK 4YBQC 3DYMA 2GTZB 2CKBA 1S7QA 3QG6A 2AK4D 4H0IA 5D6CB 4Z76B 4RZCA 1FFOB 4DUWA 1XCTA 1V7NL 5KSVB 1EEUA 4O51A 3BDYH 3CZFB 5GGVH 4FQXC 2MHAB 2EKSA 2V6HA 4PLJC 1U8LA 3DX9B 5FM4A 5A16B 1S7XB 4JM2F 3KWWB 4D0BB 5EBLB 4JY6B 2VYRE 2GW5A 3U9UB 4F58H 5A43C 3WUZA 2R0WH 1FHGA 3VWJC 3OPZL 5I19L 4P2YA 4YDJA 5D7JB 1MJ8H 2NY0B 3C60B 2F54E 1UXWA 2XV6B 4QHLB 1S9VB 4TPRL 2DB8A 1CXIA 5E1AB 2DIAA 1R3IL 3MACL 1MQ8A 3S3JA 2A0LC 5DFVD 2R29H 2F53A 4N68A 4OAWB 4Q6IC 4W6WB 3ARED 1PY9A 3DARA 1NC4B 4OZFG 4EN3A 1A2YA 4QKXB 1P9MA 2YA0A 3RWDB 5E8OB 1RURL 4PRHA 3WD5H 4G8FB 4NWTL 3GSXB 3QPQD 4FQ2L 2YEZB 1CDHA 2V5MA 4H1LA 4O02H 5TFSH 5JPMA 2FIKB 4M1CD 4DZ8A 4YHPA 2XNAA 1GHFL 2FECI 3RNKB 2VR4A 3GSRB 2FX9H 1HDMB 4M03A 3DO7A 5FYLL 2EICA 2NR6C 4XP5H 4NKQB 3BJ91 5L7XL 4NN6B 2AJZB 3OX8B 3B9KB 3VD7A 2FX7L 3HPLA 1MHHA 2WANA 3O2DL 3RGVA 5JO5B 2YZ1A 3IU4H 1TQBC 3MXWH 4M7JH 3QUZB 3RP1A 4ORGA 4D0CB 1UM4L 4ZNCD 1K9TA 4Z9KB 5ID0B 4LLWB 5K9QI 2D4DA 5GRWA 3RKDC 2OR9H 4LSPH 5GIRB 2W92A 3K1DA 4NSKA 4WEUD 1J11A 3OR6A 1UACL 3RIAK 5C0IA 5AZ2L 1GZPA 2YKLH 4P9MH 3Q48A 4OLXH 4XB7A 1D3CA 2FHCA 3M17A 4APQC 4WW1A 1RIUL 4WI4A 1H8SA 3U0PB 3IXAB 1U8OA 1TJIH 2B20A 1YYLH 4HWBA 1I1AB 3QZWB 5CKAA 4LOUC 1NFDB 4Q0XL 2EIDA 4ZS7H 3SGKC 3EO9L 1ZA6B 2CDEA 1NGXA 3WO4B 1J7VR 2PO6C 5GGQH 1INDL 4HIHA 3SQOH 5D7SH 1PG7H 2R15A 3S36H 3QUMB 4XXCA 3RDTB 2XICA 1E4WL 1I9JL 2VZ3A 3O6ML 2CDFA 1NKOA 3Q5YA 4OLUL 3ARFB 4ISVA 4JQXC 4UUJB 3DMMC 2VXSL 4MJIA 3I6LD 4GG6B 1FGVL 5DZLA 5CHNA 4OZHA 1X5YA 3AM8A 4LCCB 4X6DE 1JHKL 5DZNA 4EI5A 4K3EH 3OWEA 3SE3C 1DBKL 2P5WD 4LF3B 1V3LA 3HC3L 5E00B 2VDLH 3O0RL 1KN2L 5IBUG 3PIQB 4YHKH 5DZOA 2C7UA 5IVZB 2GKIA 4LLVA 3K2UH 4AQ1B 4O2FA 2NX5B 2PYEB 5DJXA 1K6QH 3H9SE 1DUYA 4YE4H 3SDDB 5I1DA 4R4BA 4G6FB 1IBGL 3LV3B 5DJ0A 7CGTA 4OQTL 1JPFA 5F6HI 3OXRA 1T20A 3ZL4H 4NKDB 2CRIA 3SOBH 1JFQH 1NDGB 3RWGB 4WUUD 1N5YL 2MQ0A 1J8KA 2X40A 1SJHB 2YOCA 4NFBA 3FN0H 5E70A 2JE8A 4PYHA 1FNGA 1QNZH 1QQDB 2JCCA 3BDYL 3D9AH 4JFQA 4ZQKB 1ZA3B 4P2CG 3RWJB 4NN5B 4U6HB 1INQB 2FD6H 3MROB 4GS7B 5HBBA 4O9HH 4YXHH 3GJEB 3PDGA 4NCC2 3QNXA 4KI5D 4PJBB 4QYOA 4F58L 2PTTA 1N6QL 5D72L 3OXSB 5EULV 2R0WL 1T1YA 3QHTC 1R3KB 1WUNT 3MRBA 2A6JB 2YWYA 3AGVA 3MR9B 1U0QA 1EFXD 4K7PH 4L3EE 3SKOA 1S8DB 3M07A 2BNUB 1ZEAH 2VLKB 2F9BT 2ZUQC 3SE9H 5I8CB 1T83A 1IGJA 1N4XH 4H26B 1QA9A 5T3XL 5F1KC 3T0VA 3BISA 1H0DA 2W91A 1DTUA 5A40E 4C56B 4NHCH 3T09A 2GITA 2R0ZH 1C7TA 1CXKA 2J5LC 3DHMA 4OLZH 4WV1B 3C09C 1QRKA 2DWDA 4JDVB 3T8XB 3HUJA 3STZA 2WLZA 4KJQC 5GGTA 3AAZB 3SE8H 4KAQH 3PG2A 1NCWL 1B0GA 4CADA 5C6PB 1WTLA 5ITBL 3BVNB 4TQEL 4MDIB 1J9CT 2WQRA 3D2UB 3NFNB 4O02L 5FYKU 1VSCA 5AYUH 5TFSL 2N1KA 2BC4B 1EEYA 1T7XA 5ESVA 5FO8B 1AHWB 1KBGL 3FO2B 3IETB 4HGWB 4PJAA 1QKZL 3O41A 3HZVA 1YY8B 3E1F1 1FFQA 3RWCB 3BOVA 4U1KA 4YAQA 4LVHC 2JB5H 1J88A 4KJWD 4FMFA 1MRCH 2C3VB 4Q9RH 2F5BH 3CLEH 3TBSA 3ARBC 4NNYA 1U91A 2WNGA 3HE6C 3MXWL 4WRLA 3CFDA 2HT4D 5IWLC 1C5BL 3SDAD 1HZHH 4PV9B 1G6RA 2YPKA 1T6WA 3V5KB 4YHLL 1WFUA 1WV7T 2GI7A 4LSPL 1AIFB 3RUGB 3UJTH 3QIBA 1XF4A 1U41A 1RJYA 4LASH 4P9ML 1LO2L 3CFBB 3FB6A 5B39G 4XP9H 1NCNA 4HBQA 2P8PA 3TYGH 1QO3A 3VFSB 2LU4A 2R1YA 2DLIA 1TJIL 3MBEA 3CSYB 4PJ7B 4N9OB 5D1QA 5DJCB 4GKZB 1JPTL 3LKSA 2FO4A 3WS3B 4NT6B 5DD1L 5E2VH 3RZCC 3MFFA 2O61B 5EU4B 4NM4L 5GGQL 3UP1A 3MYJB 5D7SL 1PG7L 4ZFGH 3GUTB 3NOIA 4KI5F 1BZ9B 5D1XA 3S36L 3TIEB 4YWGH 3W2DH 2APWA 1KYOJ 3DSFH 1EIBA 3DV4B 1JZ4A 1WZ1H 2VXUH 1MFCH 5IMLB 1I9RH 3LB6D 1A0QH 4C83B 2H26A 4JQIH 1VGEH 4G6MH 1U8PB 5C0EA 3BSZH 1QYGH 3NCJL 1GL4B 4DWHA 5C08E 5B38A 2R2BA 5DVLA 1HH9B 1JTPA 35C8L 2EYSA 3K2MC 4FABH 3DWTA 3GSOB 1VPOH 4Y5YB 4WFEE 4OI7A 2QHRH 5DI8B 4E42A 5E08L 5F88A 4HT1H 4N90E 4DEPB 4PGDB 1ZE3C 2BX5A 1UVQA 1RUPH 2B2XH 2JJSA 3RI5K 3I50H 1C12A 2Z31A 3DYPA 3KPNA 3QIWD 4JRYB 5J1TC 5HSFA 1VFOA 2QLVB 1X9QA 4P3DB 2B1AH 4D2NA 1BWWA 2R1XB 3SOBL 1JNNH 1JFQL 2BHYA 3CXHK 3MRCB 3VW3H 4HFWA 4XPHL 1XGRB 4G8GB 4KXZI 3W0WD 3R06A 1E27A 1J0IA 2OM5A 1H8OA 5D2NB 1QNZL 3TBYA 3D9AL 1ZHNB 2F53B 5F9JA 5L8LB 3EO1A 3TGXA 5DURD 5GISH 5FYLD 1R5VA 3TIDA 3ULUE 4L9LB 4PLNC 2GK0B 4LIQE 3V6ZB 4O9HL 2F58H 3OAUH 4OF8A 2IANA 4U7KA 4JJ5A 2P48B 2NY3C 4X5XA 1A7OL 5T5NF 4TSAH 3ZE2F 4ZUTB 4NZJA 2GYSA 4ODHH 5GRUH 4BH7B 2OL3A 4HKXA 5E2UL 3S96B 4OLEA 1L9MA 1ZEAL 3SE9L 1N4XL 2QTEA 3BZFA 4NZDA 3GK8H 1DQML 4BFEA 1HIMH 3TFKC 3BWAA 1NMAH 4M7LT 3PQYB 1S5HA 4PY7B 4DW2H 1TCMA