3MFGB

Crystal structure of toxic shock syndrome toxin 1 (tsst-1) in complex with the human t cell receptor beta chain vbeta2.1 (ep-8)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
110
Chain Sequence
AVVSQHPSRVIVKSGTSVKIECRSLDFQATTMFWYRQFPSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSGFYICSALAGDTQYFGPGTRLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin/immune system
total genus 28
structure length 110
sequence length 117
ec nomenclature
pdb deposition date 2010-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mfgB00
1KENH 1FNEB 2FCBA 5T5NG 5KZCB 3QAZB 3O3AB 4POYA 4PV9A 2FEEL 2HAZA 2H2PC 1MCQA 2MQ0A 4JFOA 3EYVB 3JWNC 3ZKND 2Y9RT 2GT9A 5GGTL 4Z6AT 2XTJE 2YPLB 3T3MF 1CL7H 5E9DD 2FDBP 1QSVA 2BRRH 4YFLI 2BDNH 4FG6C 1PBYA 2UZYB 4LCCC 2F74A 3N9GH 2KZWA 3ULVD 2EDDA 3HA0A 3S37L 5T3XH 5HGAA 2Q86B 1IGIL 4QY8A 4B7IA 1ZTXL 2YRZA 1JYVA 3I75A 5K9OB 3RWFB 1AGFA 1R24B 3RDTB 5B8CC 3W0WE 2IPUG 5I2IB 1MCIA 3ARVA 4YGVB 4N1CA 3JTSA 2B2XH 1MFCL 1FIEA 3U4EB 2BOBB 4DN3L 1L0QA 1JF1A 4WV1C 3MYJB 4YDIH 2GK0B 4LOUC 2OTUB 4M5ZH 1VCAA 3MCKA 2R8SL 4P3CL 2QJDA 4JR9L 4M5YH 5TE6H 4GRWH 3EO9H 4LRNH 1INQB 5HYJB 1MCOL 1F11B 1I3RB 4OTXL 1PKOA 1JPGA 4D9RD 3KWWA 3IDIA 1C1EL 5JXEA 1IC1A 4DOHB 4P9HC 1M6OB 3CX5J 5JLZA 5FYKE 3MLWH 1NDGA 1EEQA 1I9JH 5CFHA 1P2CB 1DDHB 2NZ9C 3RWEA 5IB2B 5IP4A 1F13A 2OQJB 5JO5B 4FQLL 5ALCH 4K3GA 5E2UL 3VW3L 4L1HA 1N6QH 7CGTA 4ZS6D 3PQYE 4JLRB 1EAPB 2GSIA 1KCVL 1CDBA 1N2RB 4HKJB 2ARJQ 4LSVL 3B9DA 3ZT7A 1MCRA 4QT5B 5JPMA 5T5FH 4DTGL 3SDXF 1EO8H 4KXZI 4LCWD 2Z31B 4HC1L 4WHYG 3VXUA 3BVNB 3QO0B 5FHBH 2VXSL 4MX7B 2GKIA 1TPXB 3PDDA 1AR2A 4NKIH 1FFOA 1M4KA 2NTFB 3BE1H 3MLTA 5BRZD 4XB7A 1KC5H 3HAEA 1FNLA 2FBOJ 1BLNB 3C08H 2I25N 2EKSB 1RPQA 1MWAA 3U83A 2R39A 3RKDD 5JXAH 1MI5B 1DQDH 2QV2A 3RNQA 4L4VA 2NR6D 5C07D 1N5YH 2EDFA 2ORBH 2BNRD 4ZO6A 3QXDA 2NY0B 5SWZA 4ETYA 1BHGA 3NPZB 5BJTB 4G6FD 5F6HJ 4PJHB 4R4BA 5I76A 2V17L 4HUWB 3K46A 1MJ8H 5EZIL 5EIVA 1A6TB 4MJ5A 1LD9B 4UTAL 4HV8B 1XF3B 3EKCA 4MJ6A 3RBSA 5CIPA 2NYYD 1FL6A 3G6JF 4IM8A 3T3ME 4W4NA 1KLGA 4G9FD 2GQHA 2D7OA 2XZAH 4O9HL 4NC0B 2FZ3B 5IG7B 5E2VL 2GJZA 3IAQA 2WWMC 1CS6A 3CFBB 2IBBA 4YIQB 4NO2B 4Q2ZB 3TH4T 4G7VL 4XNZB 4PJIB 3B5HA 3MCLH 3NTCH 3V0VA 3FT2B 2A77L 1GZQA 3DSFH 4PJHF 5F7EH 5F7DB 3T4AB 1N6UA 4R0LB 3QIUA 3DXAB 2A6KB 4XPAH 3PL6D 1DBJL 3FN9A 3AREA 3NZ8B 3OJMB 1ZT4B 3TWCH 4NJAL 3C5SB 4XX1G 1JWSA 2JLLA 2C3VB 5I19H 3KLHC 2PUQT 2B20A 4RRPG 1MRCL 4ORZC 1OARH 3LQAL 4GLRH 3BFOA 2CO6B 4PGJA 3CDYA 1I4FA 2OJEB 4HFWB 4I18A 4YPGB 1FP5A 4WWKC 1TVHA 3VXTB 3T1FB 1NH6A 3CFDB 4PJIF 3RGVA 4OLUH 2Y07H 1T04A 4WW2B 1HEZB 4OF3A 4U1LA 5IW6B 4KAQH 3DYMA 3WKMH 2DYPA 3FRPG 2VDQL 4PRNA 4Z7WF 1RAMA 3VCLA 3O11B 4LARH 5J11B 4JB9L 1U8MB 1CICB 1EFXD 2HFTA 5B39G 3IDGB 1DR9A 3BPCB 3KPMB 3HZKB 3SDXE 2APFA 1IEBB 1LDPH 4H20L 1WTGT 5GGTA 5FYLE 5I30H 2YKLL 5HYJE 3CX2A 2DL2A 3WD5H 2X05A 4EQ3A 2Z4QA 1NBYA 5GIRA 4OB5H 5D7LB 4QHMB 3QEUB 3P73B 2ENSA 2HTKD 4DOHE 3F6IA 4LNRB 1RUML 2BVYA 2FGWH 3PDOB 4RBPK 3WKNA 3QHZH 3RTQD 4KGLA 3C6LC 2WQ8A 1UM4H 3WE6A 2HVKA 1S7UB 1OOAA 4QWWD 3UTSE 2H9GB 3HE6B 4WI2A 4PRPD 5ETUB 2Q76B 3HI6L 2Z93B 3LKRA 3WN5C 3O41A 4ODHL 5DS8A 4OLVL 1A7PL 1ZLSL 1K8DB 1E6JL 5CMAA 4L3CA 3VE0B 4EDWH 5CBAA 2BFVL 3F7YA 3G6JE 4JFQB 4KI5F 3IAGC 1T20B 3P9WB 4NZJA 3A6CH 4JFFD 1C16A 2JE8A 2DM2A 4JFDA 1LEKA 2Y23A 1UH4A 3MJ8B 5EIQA 4OLXL 3TBTA 1QOKA 2FJGA 3FQXB 3RY5A 5T3ZL 5EUOB 2NW3A 1BBJB 2AK1H 4Q9RL 1NMCB 3DV6A 1SQ2N 2R2HB 4XCYB 3MOAL 3VFMB 1KG0A 3CK0L 4NKMA 1X5XA 1BZ7B 4K23L 4PJHE 4GG6F 3QG7L 4ETQA 2D2OA 3NCYS 4BA8A 2NX5A 5KVDH 2JB5H 4AIZB 3ROLB 4ZTOH 1MCFA 3V6FA 1GAFH 4DEPB 5ISZD 3V7MA 4TNVK 1VACB 3RX7A 3TZVD 1KCUL 2MQ3A 4L29B 3AAZA 2P45B 2UWEB 3GSOA 1AKJA 4HC1A 4K9EC 5HHVL 5E94A 4RFNB 3DHMA 3N1FC 1RZJC 3U30B 1XGQB 3RWDA 3ULUC 4NO5A 3UBXB 2C26A 1EBPA 3REVB 5ANMA 2ARJB 4PJIE 3AS2A 3QDMD 3RUGA 2JKXA 1JUFA 4ZOBA 4F33A 3RI5K 4OCXH 3RIFK 4OZIB 2YBRB 4OFYD 4EBQL 4MVBC 5IMLA 3KPSB 4KUCF 5DRZB 3DXAE 5F1KC 3WFEH 3FMGH 2EDKA 3HCVA 4Z76B 4KMQA 4GW1B 1MCSA 3L95A 1XIWC 4Z7WE 1UB6A 4CVZA 3S88H 5ESQA 2EDWA 3D69A 2XRAL 4HIJB 1S7QB 4FQXB 4XAKE 3JWOH 3RX8A 3TV3L 1KEGL 3LS4L 3CMGA 3IKCB 1U0QA 3DURA 3DUSA 3CU7A 2UWEF 3CXHJ 1L9NA 1I3GL 4U1MA 2R29L 3VGAB 4Y2DC 2CIIB 4NQSA 4NQEB 1QBLH 3S5LA 3WIFB 5DJCB 1TTFA 1V7NH 3N1QC 2DQJL 3JVGC 1EGJA 3FO1A 1KJVB 4OT1L 1SY6H 3C8DA 4HDIA 4Z95L 5LVEA 4H5SB 4Z7VA 4CJ1A 3SDAB 5H94A 4OZIF 3L5JA 4MD4A 4PJ9A 5GS0L 4PBXA 1JZ4A 4JY6A 3BJ91 2AEIT 4EN3A 5L0QB 1G0XA 2ITDA 3NH7L 4IHOB 3V4UH 4IMKC 5BS0D 1H5BA 4NWUH 1IC4H 4XPGH 1S9YB 5FHAL 4XNUH 1RZ8B 5HPMB 3BW9B 5FUCE 3LHPH 1KEMH 4YE4L 2GYSA 4FFZL 3VFOA 3IDXH 4KTEH 3D39B 4KI5E 5DR5H 3L9RB 5IVOA 3MLYL 1QA9A 2VDNH 4GRWB 1QO3A 5F9OL 5C0FB 5D7LE 3D0LA 5AYQA 1A6WH 3GHEH 4QOKA 4RGNB 3O9WC 3ECBA 1P84K 1K2DA 2OTWB 3LMJH 4MXWL 2NZIA 5F7YC 1CWVA 1MIMH 4GAJH 1WBXB 5EU7C 1LE9A 1P7QA 1KB9J 1AXSB 5A3IC 5LGHH 7FABH 2EYTB 2ESVD 5GGRY 5ADOL 4JPKL 4GG6E 1UXSB 1FVEB 2FD6H 2G9HB 2C1PA 3DARA 5CLTA 2VDLH 4LLYA 3LN5A 3LKQA 1IGFL 4KY1L 3HR5A 4BFBD 2EYSA 2MPAL 4BSWA 5IF0B 4FTVA 1NC2D 4K3JH 3MRIB 4QXGH 1LWRA 1DBKH 3P4OB 25C8L 4X6BB 3SDCB 3V95A 5SWSA 4GW4A 2FIKB 1FZOA 1LK3H 3GUTA 3BISA 3U1SL 1A1OB 4KK9C 3G04A 1D5XA 3VXSD 1FLTX 3O6FB 5GQBA 1SYSA 4N8CL 2J2ZA 1MPAH 4I0PB 4E0RA 1FE8H 4O58L 3L3JB 3QNYA 4FQ1H 1G7HB 5DJ0B 5L2KB 2IFFH 4JG0L 4UQ3A 3BJLA 3R06A 5DF0A 1FN4B 1S78C 1DQML 3H7BB 5DEZA 2EXYD 2DICA 5EPMB 4HJ0C 1NMBH 1S8DA 4LSSL 1NEZG 4LVNC 1SM3L 4GJTB 3WFCH 1BIIB 1SVCP 2NY4C 2LU7A 3QNXB 4GMTL 5EU3B 4FQJL 3HMWL 1MLBB 3CFCH 1UA6L 5DMKA 2UWEE 1RUQL 4MSWB 3LKNB 1ACZA 5GGSA 1BQHG 4OBSA 3ZMRA 1KPVA 3FAXA 1I9RH 2G5RA 3GJFA 3UAJC 2EDQA 2X4RB 1CLYH 4APQD 5SX4H 3C60C 2BY1A 4RAHA 5JIHA 3PWVB 4Y4FA 4OZIE 1JNJA 3MUGA 2R0KL 5IROC 2QKIB 1RUAL 2WMPA 2WUCH 3B9KC 3EHBD 3CSYB 4L3EA 5GJTH 1HK6A 4PGBA 4A6YB 1JGEA 2I9LA 3FTGA 1DL7H 4XP9L 3MA7B 2ZUVA 5E5RB 1P4LA 1MNUH 4PTTA 1BAFL 5MP6L 3FFCD 1F6AB 2VERN 4QXUL 3X12A 1EFQA 4PJEA 5C0CB 3KPRB 4NQEE 4MDJB 5F6HI 4MNHA 5T3XE 4M7LH 4UT9H 5IW1A 4HKZA 4XXCC 4PJFF 1IT9L 2A0LD 4D3CH 5DSCB 5IVNA 4OI7A 1UWXH 2C4FU 3MJ9A 2J5LC 2JCCF 5C0BB 3TA3C 1I1YB 1KIQB 4O5LH 5F9AC 5EO0B 2AP2A 3PWPD 5DQJA 1QYGL 4X5XB 3OJDA 4OQTL 4HWZA 5JA9A 2VLME 2XTJC 4LK4A 3DI2B 3QUXD 1XGPB 5C70A 4GKNB 4NQCD 4CU6A 5L6YL 2UUDH 4DVBA 4M6MH 2PTUA 1UVQA 2HN7B 2BY2A 5BO1L 3BIKA 5GGRA 3CVIH 1U42A 1KTRL 2DBJA 4P5TB 5E6ZA 4P3WA 3RHWF 5ID1A 1BD2D 2C4FT 2H1PL 3D39E 3QWRD 2F53E 4UV4L 3MRPA 1MVUB 3S4SA 3LB6C 2XWJB 2VN7A 1B0GA 3GMQB 4RGOH 2YK1L 1SJEA 1T2XA 3NA4A 3GO1L 1A1MA 4WTZG 4RGNE 5DJYB 1I9IH 4JEGB 3RGHA 4PGDA 3SKJH 3O2WH 1GXEA 2V2TB 2FHFA 3BP4B 1DEEB 3C5JA 3RVXD 1CLZH 3AY4C 4PGZA 4WGVB 4PRBA 5HY9B 1TQCB 2X4NB 3ORJA 1KYOJ 1GYAA 1VPOH 1FFQA 1T22A 3EDKA 2J4WL 5AD0A 5KTEL 4ZYKB 2P8PB 4PJDB 4Y8DC 4M1GL 4XTRC 4HKXA 3MFFB 3BZFA 3RIAK 3EW3B 4Z18A 3GFUA 4PUBH 3QZWG 2R2EB 4OQ1A 3CDCA 3QQ4B 1U2HA 5EU6D 5IBUG 2HT2C 3U0WL 1ZHKA 4YFDB 1MCPH 4S1QL 3PGCB 1LK2B 2BRQA 3EYQD 4OLZL 5BV7H 5HI5C 4NP4H 2P24A 3U2SA 3U7AA 2YMXL 1OCWL 5JR1L 3HS0B 5MEQB 1S7SB 3JWDL 3EYOB 3MLZL 3KDMB 1QEWB 2FJHA 3MRBA 4P5MA 4OGYH 5CLWA 4J3XA 3PP4H 5D8JH 4WCYL 4N5UA 4HCRL 3RA7L 1QRNB 3ARGB 5L2KE 4JVUA 1JYXA 5EBLB 1K8IB 5ID0B 3ARSA 5I18H 1E27A 3BMVA 4R7NA 3ROOB 4KKBC 4LQ1A 5F1IB 1JRHH 3VWJB 4P3DB 1L0XA 2LTQC 2AS5M 2AXGA 5F97E 4U6YB 2XOTA 3GSNL 1K6QH 2FBJL 4HWBH 2R4SL 3SN6N 5EC1A 5FA4B 2IH3A 1DANT 4GAYA 2DTSA 5TF0A 3PGDB 3BX7C 4WIQA 1QHPA 3LPWA 5IFAL 5EBWA 5GSRB 1NGWA 1ZVSA 4P2QB 4QCIB 4YXKH 5HYQA 3O8XB 4PJFE 4JFZL 3HFML 2LU4A 4G43A 1I7ZA 1PYWA 4QRSA 4Y19A 1Q0XL 4JRYB 2E6QA 5F9WC 2JCCE 4JM2B 4PG9A 3WLBB 1V7MH 2VXTL 5EBMA 4LSRH 4N9GB 3T65B 4HZAA 3GMOB 1IAIH 3GDBA 4X0KB 3EUUA 1M71A 6CGTA 3WNMA 3INUL 2HG5B 4ZSOA 3VRLF 1ND0A 4CADA 4L4TB 5JQHC 1W8OA 1KCSH 3AB0B 5EN2A 4WUUD 4JAMA 2PXYC 4Z0XA 5T3ZD 1N64H 4DCQA 4M93B 4LPYA 5EU4B 2DQDL 4PV9B 1A1NA 5C0CE 3KPRE 4JFOB 4P23D 1W0YT 1Q9KA 2VR9A 2HMIC 2GT9B 4FP8H 4RNRA 5J7CC 5D1XB 1CFTB 4WU7B 3IU4L 3MBEA 3HZYB 2BVOA 2CPCA 3B5TA 4DK3A 5IB3A 3QAZC 1HWHB 4JM2F 1AO7D 3QEQD 4XP4H 2DMBA 1MF2H 3R8QA 4FNLL 1OVZA 2F5BH 5I1KL 5HVHB 4K8RD 4P2RB 2DM4A 4KMTH 4BH7B 1M7XA 5HGAB 3FQWB 3D9AH 2M2DA 1L7TH 3HE7A 3SY0A 1U92A 3E2HB 5EB9A 3HHRB 1KPUA 4U1SA 1AGFB 2ZWLT 3V2AR 4U7MA 2RJMA 1JWUA 1B4RA 3VWKA 1JZ3A 1QKZL 4NUGL 5C6TL 1JF1B 1LMKA 3CXDH 4K71B 1ZWIB 4OJFH 3VFGH 2EDYA 1C08B 4PRHD 2D7MA 1TETL 3I6KB 3RDTC 1FLRH 3CFEB 4UU9B 2J6EL 5EA0H 4N0YL 3ZDYF 1PKQE 1A6UH 3IDIB 2XIDA 3DYPA 4R96A 2CD0A 5JLZB 1NBZA 1NDGB 3IB4A 2QHLA 4X7CC 3QP3A 3AFLA 3ZLQC 1AC6A 4OQTA 5DD3L 2V7HA 2UVEA 1IKFL 5J56B 3ES6B 3QFJA 3TO2A 3GK8H 3TO4D 5IJKC 1A5FL 3CSGA 3DNKA 3T77A 1J0ZA 2GSIB 4GXUN 3U7YH 4MAUH 3JV4B 5DO2D 3VXME 3D85D 5JPMB 1G9NH 1VFOA 3VXUB 2ZPKH 5DVNA 2O93L 4M48L 2PO6B 1KTKE 1A2YB 4AMKH 5I1EL 2FJFA 5I1IH 2WK2A 4ZUTB 2PW1B 3SDDD 5DWUH 5JZ7D 1QRNE 4AT6A 3T8XB 1MWAB 2AQ3A 4WJ5B 5D71L 2Z31C 5TDOA 4KTYA 1TPXC 1IGMH 3VRLE 5SWZB 1MY7A 4KRMB 2CDFA 4X6CB 4X6FB 1GHFH 4GW5A 3WHXA 4KJYB 1DSFL 4R4BB 4MNQA 1ZMYA 2GITA 5D6DC 3GRWH 4MJ5B 2VE6A 4JFYA 4P59L 4RISL 2ADJB 4JG1H 4MJ6B 3SJVD 1IAKB 2UY6A 1VGKA 2EDXA 2YPVH 1S7VB 5HDQL 4R9HA 4MB5A 2BOCB 2NY0C 3DTXA 5C1MB 1G6RH 3SDYL 4MJIB 3WUWB 1TJGH 4UTBL 5J1AA 3LEYL 4LU5L 4JRYE 3GMPA 3L3GA 3IDMA 1U8IA 1WFUA 4UT6L 2GJZB 3BN9C 3SE9L 1OAUH 2CIKA 3GJFH 3ZYZA 1NC4D 1LHZA 4WDIA 5GS1A 1V05A 3TT3H 2Y5TB 4L4TE 1PY9A 4OFVA 2HFGL 3WO3B 1RZ7L 5ACMA 4IOSD 1GZQB 1NGQH 4IRSC 5CP7A 3GIZL 3MRMB 3MRKA 3OJ2C 2X70B 3TN0D 4X8JB 1EZVY 5CD5C 3S3JA 1FO0A 3AREB 2BNUA 2HFFA 1KCLA 1QSZA 2G60L 1RIVL 1FL3A 3GSNA 4P9ML 4UIMA 4U3XA 4XNZC 2P8LA 4FS0A 3V5KA 4Y2OA 4MS8C 1OTTD 4LSPL 4R3SA 4XZUA 5JQ6L 5TDPA 4M7JL 4KKCD 4R0LC 4MD5B 1UWGL 1KELL 1BZ9A 2NY5H 5KSAD 5JHDD 1I4FB 4HJJL 5KVGH 3GHBL 5DD5L 1KGCD 2PF6A 3ZDYE 3V8OA 3LY6A 2FYYA 1MH5B 3N1PC 5ADPL 1Y0LB 2A9NL 2MCPH 3CJJA 5K9KA 3IJSA 4U1LB 5EO9A 2ED9A 1BJMA 1RIHH 3VXRA 5D5MA 1NCCL 1UM6L 3CVHL 4KZDH 5EORL 4PRNB 2FX8H 1AR1C 3VCLB 4RWHA 2OR9L 4IIQB 1PD6A 4K07A 1VEPA 2E7HA 2EXWC 4HPYL 4ONOA 4P49A 4WW2C 1ETZB 3H9HA 4DQOH 1MFBH 1Q1JH 3V52H 4TSBL 4AENB 3MJ7A 2EE6A 1MFEH 3PE9A 5D1ZD 2F19L 1EV2E 2Z4QB 3LEVH 5J11C 2HFEB 12E8L 3SKMA 3ZT6A 1CICC 4YDKL 1A7OH 1EHLH 3P11L 3VFUB 1EX0A 4TNWF 5FUCC 3SGKA 2VDOL 5DK0A 2I27N 3LOWA 1X5GA 1IL1B 4KI5C 5TDNA 5GHWH 2O26U 1A22B 2YWZA 4OSUH 3KYOB 4OZHA 1KN4H 4KDWA 3DVFA 2X89A 1FZKA 2VL5B 4XAWL 1J8HD 5BV7B 3CDGA 1PDKA 4MCZA 5CJQH 4JDVA 3VXUE 5CBAB 1MHPH 3F7YB 3PDGA 1SEBA 2YSSB 1UYWL 3LCYA 5IB1A 1QR1A 2AJVL 1C16B 4OZFG 2I07A 2NY1D 3KLSA 1LEKB 4JKPH 1I7RB 1AGCA 2J6EA 1LEIB 1ORQB 2FJGB 3H8NA 5GZOD 5CILH 3I2CH 3GSQA 1I8LC 2AXHA 1J0YA 2C3WA 4L4VE 3U0PB 3TIDA 4R4FL 4GRLA 1BBDH 2HJKA 5SWZE 4IOFC 5I66A 5CGMA 3RVUD 3QXAB 1PSKL 5IHZB 5JMRA 2Y7QA 3I84A 5C2BH 2D7TH 4M61B 5CKGA 4ETQB 4L3AA 4IRJA 2NX5B 2WANA 3FO0L 5IVZA 4LLVB 2WWKT 5JPNA 1NMCC 2CXGA 1I8IB 4HK3J 3WFDH 1QFWM 2W59A 5GS2H 5T1LD 2DD8H 4QXWA 4CL7A 1VKXA 4U1KA 4MJIE 4X5WB 1OQOA 1HQRA 4DUWA 4ODTH 2C4XA 3AAZB 3VFNB 2K9UA 5E08H 1T03H 3ALPA 1MRFL 3MZGB 5I6XB 5DK2B 1AD0A 3F58L 4LP5A 2VL4A 1XZ0A 2VQUA 15C8L 5LWYH 1KOAA 4DEPC 3GGWA 5HD8C 2JIXD 5EDXA 3RUGB 1E4XI 4F33B 3MX0A 4HPOH 5B4MD 4UBDC 1UKTA 3C9NB 4Y5VB 4JN2B 3MRQA 3PHOA 3HCVB 3DLQR 4HFUL 2DTML 4IJ3B 2NY2B 2IEPA 4HT1H 1FAIH 3ESUF 3N50A 4JPWL 5D72H 3T2PA 4DGVH 1NCBL 3OR6B 2D7QA 4LLUA 3NCBB 1DUZB 3DURB 3DUSB 1FNAA 1L7IH 4P9HL 3BKCL 4U1MB 2VLKA 4PJAA 4F7PA 4LSTL 2FSEA 3MXWH 3S5LB 4LVHB 3PIQA 3STLA 1BMGA 2C3XA 5JDJA 4HDIB 4FQXC 4OGXH 5ITBL 3QDAA 4KJWC 3RUGF 4O02H 4UMGA 5EWIH 4JO2L 5EO1A 5ICXB 4MD4B 4N0UA 5E6YA 4JFEB 5E00A 1KLUA 3Q6FA 1FNGB 2XG5A 4J3VA 3Q1SL 5E8PA 2ITDB 2Y6SD 3T09A 3VH8B 4OCWL 2IPTH 1A21A 1H5BB 3CCHB 4H26B 4K7FA 4DK6A 5JOFB 1EMTL 1F6LL 1RD6A 3SDAC 3MLSL 5DQDL 2HJFA 3JBG7 4RDQF 1DFBL 1ZHLB 4PRAB 3SGJC 1L4IA 2W9DL 4O2CA 3ZZ1A 3MV9A 1QO3B 3JUYA 4M43H 3F5WB 3D0LB 2X4UA 2HWZL 1KUMA 1XF4A 4PLOB 3BQUD 4QOKB 2WSKA 2A6DB 3ECBB 5ACZA 4G8IA 2D0FA 2PTTB 1L9MA 1OAKH 5CJXC 4M3JA 4WO4D 4WFGE 5F96H 2EDTA 3ZHKA 3HC4H 1HHJA 2DQEH 3TNMB 4DKEL 4XP6H 2F54A 3TCXA 4RGNC 1EUUA 4HIIA 3WXWH 3CVHA 3LN5B 4GKZA 1TFHA 2A73B 1R5WA 4I3RH 4OLEA 4AM0B 4CRPA 1KXTB 2WBKA 1BFOB 4YDVA 5JW3L 4XPHL 1UB5B 5SWSB 2DM7A 4GW4B 3HMXA 3QDJB 3O3EA 4LCIL 4PR5A 2KBGA 4XI5D 1OP3K 4V1DD 1LO0L 4JHZA 3FO9A 1FGVH 1D5XB 3G04B 4U6VH 4FXKA 4KQ3L 5IT2H 4RAVA 2DLTA 1XF2A 5GPRA 1EXUA 5DTFA 2AEQL 2CGRL 5I1CH 3SDCC 5C08D 1FFNB 4RZCB 4ELMA 1KCKA 5C0EB 4E0RB 4LRIA 1FH5H 5DLMH 3TJEL 2NCMA 1YJDH 2NW2A 3R06B 1D9KB 1PG7H 5I0ZA 2NX5E 1Q9LB 3FJTA 3QDMA 4QXTA 2NNAB 4HH9A 2E7BA 1JNHA 1S8DB 5E8OA 4NN7C 4I0PC 2MMXA 3DRQA 2DDQH 3DMMA 1JPSL 2AK4D 3AMKA 5I71B 1G6RB 4FQIH 4DAGL 1WK0A 1QP1A 4KJPC 5JW4M 5FM8A 5DMKB 3IU3A 1XMWA 1CGSL 4FFYL 3H3KA 3MV01 1HN1A 5GGSB 1I1AD 5DJDB 5F1NB 3QHFH 3T0BA 1G7MB 1KPVB 1NGYA 3GJFB 1O7VA 3OJVC 3RUGE 5HHPA 2P49B 3CLEL 5F7LB 3RNKB 1NLDH 4GO6B 5FYJD 4HLZG 4H1LA 1J0KA 4DGIL 4FABL 4MAYD 3A6BL 1VGEL 2VAAA 5EU5A 4GXVH 1IFHL 3DVNB 2I9LB 4L9LB 5KVEL 1YPZB 5E6IB 3T2OA 3ULVH 1P4LB 1A4KB 3GMRB 1KBGH 2P42B 4Q97A 2Y72A 4LCCA 4NBZB 4LLAA 4G8FA 3X12B 5LXGH 1RJYA 1ZT7B 5TQ2L 1MLCA 3RZCB 2DWDB 4I5BA 4F7MA 4ZXBD 1J1OH 5JUEL 2BSTA 3TNNA 5H2BB 4HKZB 3K74B 4L8CA 2ITCA 5B8CA 2L0DA 3VXOA 2NXYC 4PBWD 5I1JH 1Q8MA 4HXAL 1EK3A 1PJ9A 4OLWH 3VFTB 4JFEE 1X5ZA 3RPKA 1W0VA 4DW2L 1LDSA 4LCUB 5F6IB 5LGJB 5B3JF 1N8ZB 3B2VL 2IAMD 4C4KO 3JV6B 4AIOA 3NACH 5HVFB 1JNLH 4PLKC 4PRDA 3MGOA 3QUKB 4GKOA 4KI1A 2DB8A 2YD1A 5ID1B 4CMMA 4PJ8C 3FQRA 3ALWA 4XBGA 3BO8B 4HAGA 3C87A 3HTLX 1B0GB 4NO0B 5J9PB 4YFEA 3I02A 4KK8C 4M02A 5ICYA 4QOKE 4X6EB 4I9WE 2CK0L 2EC9U 3EO0B 3IFOB 4PGDB 4ODVH 4O2EB 3E6FA 4P5TC 3TF7C 3C5JB 4Q58C 5C0JB 4PRBB 4Y5YB 3K0WA 4OF5A 5HGDA 5IMOB 1E4KC 4Y5XB 3QPXL 1T5XA 5IEHA 4I77H 4NNYB 1T22B 3BKMH 5AD0B 1Z9OA 4MA3A 3ZDXF 3MV7D 2GJ6D 4ELKB 3QXWA 1PG7X 4K3EH 3DBXA 4K9EL 1ZS8B 4IMLB 5F3HA 3HC0A 4FRWA 4FTVE 1MUJA 2NXZB 3ULUL 2EC9T 1TQCC 3VG0L 5E5MB 3GJEB 5SWSE 3WL9A 3D87B 1RZKH 3O2VH 1CK0H 3SQOL 5C0RH 5FO9A 2E8YA 4XMKL 2N7AA 4U31A 1CLOL 3PUCA 3T0ED 1BQLH 5E99L 4G7YL 1FORL 1RZGA 1YEKL 1HYRC 2A6IA 4WNQA 1FIGL 4DN4L 4U6HA 4UV7L 3L5WA 1RMFH 3N06B 1AQDA 1Z3GH 3GSUB 4X80L 4AQOA 1CQKA 2IJ0C 5I1DB 2Z92A 3DO3A 4H8WC 1EH9A 1AHWA 3VMOA 4JN1H 4NKDA 3VU2A 5AWNL 1FSKB 4JO3L 4NYLB 4KPHL 3PWUA 2QQKL 1MFDL 4R7NB 1I8MB 3MOBL 4NQTA 1YYLH 2NY6D 3L5XL 1J87A 4X4XA 4NZUH 2AXGB 5I8CA 4XMLL 5EC1B 5JOPE 2IH3B 3ARGC 4HIXH 4JRXA 1QSEA 4HULB 4H25B 5E8DH 4KHTL 1HXYA 3LN9A 3MV8B 1BJ8A 3FKUS 5EBWB 4AZ8A 3VWJC 5T1KA 1S9XB 4U1GB 1H8NA 2D9QB 1R0AH 4QRSB 4Y19B 2PYEA 4WFED 3LKPA 4H0HB 1V3KA 2VXUH 3DYOA 4W81A 3AC0A 4H88H 4PJCA 2YD9A 4NRXA 1CFSA 4YHZH 1JZ5A 5MERA 5B3JE 4CADB 3C2SA 2F8XC 1ND0B 1F2QA 1ZANH 4Q7DA 3MSPA 3W81A 3O8XC 5EN2B 1P7KB 3O0RH 4Z0XB 1IM9A 1E4XL 1XFPA 4JM2C 4DCQB 4JVPA 2Z0BA 1R3HB 3V9FA 4HGMA 2CLZA 3QUXA 4U0RB 4WFFE 4WHYH 4WWKA 1FYTD 3WJLC 1CU4H 4ODUA 3SCMD 4JZOB 3AB0C 2J8OA 2ZUTA 4CDHA 4X4MA 3I6GA 4TPRH 3QI9D 3FB6A 3HI5H 5IB3B 4M93C 1S3KH 4LASH 3B2UD 3CLFH 3OX8B 1KT2A 5DUML 3FRUB 3ARFA 3WEXA 3SY0B 5D1XC 3V7AG 2OR7A 1WIOA 3NCJH 3OZ9H 4ERSL 5DYOA 1OAZH 1QFUH 5HHMB 3ZDXE 4LHJB 1KPUB 3GI9H 2HKFH 3NFSH 2MFNA 3MACH 1ZLWK 3VWKB 5BW7A 1NMAL 1YZZA 3WFHA 3GSRA 2R15A 2EEBA 2Y25A 2VDML 3I6LD 4LOUD 3E2HC 1F4XL 4ONGH 4FQ2L 5IGXL 3P4NA 4NOFA 4Y88A 1D6EA 2D31B 5EFIA 4ZUVA 2EZ0C 3WNOA 2PTVA 1JE6A 3LSOB 4GMSL 2Q87A 3I50L 4NC2B 1CE1L 4K71C 1DVFB 4TUKL 4YQXH 4PJBA 4R96B 1UKQA 4YO0A 5IVXA 2X40A 4GQ9H 2ERJB 2WM0A 4HK0A 3RAJL 5I8KH 4LLWA 3UJIL 2V7HB 1QFWI 5EZLA 1IM3B 3D2UB 3G9VA 3QFJB 2E27L 3KPNA 3TO2B 4C57C 2FR4A 1H3WM 2IADA 5JXEC 4JO1H 4HWUA 3IFPB 4WHTA 5FA3B 2WBJA 4PD4J 3D5OF 4ZAKA 3UJTH 1TJHL 3QFDA 1FVDA 3UTQA 1OSPH 4P2OD 3BP6A 2EEDA 1KULA 4JKLA 1FRGL 5GRUL 4MJ4A 2Q7YB 3HMXH 1NSNL 4DFHA 3IDNA 5FO7B 2DJ4A 1ZLUH 2A1WH 3UYOD 3ARUA 4NOBA 4NGHH 5AYUH 3QCUL 2FO4B 3F6LA 4N68A 4FQQA 3TT1H 4POZD 1UCBH 2PO6C 4LGSB 3OMZA 1ADQL 5GRVK 4QRRD 3E6HB 2CKBH 1TZIB 2CDFB 4K94H 4GW5B 4EVNA 3WHXB 5FF6B 1JHLL 2D0GA 2FB4H 3LRGA 3DUUB 1OY3B 2BSSB 5MEPB 1YNKH 3U4BH 4N1HB 2GITB 2WUBH 4IDJH 5DRWB 2VE6B 4Z0BH 5J89A 3IS0X 4WUUA 3WIIH 3MV8E 1A3LH 2NTSP 3DTXB 2DQIH 3PHQB 2AV7A 4R8WH 2F8OA 2X9WA 1KN2L 3CSBA 4ZFOL 5FKAA 4Y19E 4Z8FL 3GMPB 1HZHH 3L3GB 1GGUA 3KPPB 1YN7A 4X7DC 4KZEL 5E9DB 5C3TA 4Q0XL 4WDIB 1MHHB 3V5DA 1T1YA 1G7QA 2OR8A 3V8CA 5F72S 3UTTD 1FV1A 1NEUA 4S1DD 3BHBB 3E8UL 4XPFH 5M94B 3QA3A 4WU5B 3L3KB 3BD5A 4WI7A 5IHUH 1XR9A 5E4IA 1A7NL 3IDYB 3MRKB 3VXPA 3D0VA 3QEGL 4HUXA 4Y4HA 5DGRA 1ONQA 4Y1AA 4OM1H 1FO0B 2B4CL 4MA8L 3BGFB 3WLWD 3MR9B 3I9GL 3DX7A 4UIMB 1FL3B 3IXTB 2P8LB 3KLHD 3V5KB 2ADIA 5DFWH 1LO2L 5INDB 4GBXA 4NUJA 3QCTH 4ZPVB 5IW3A 5TDPB 4EEEA 3NIDF 4MZ2A 1F5WA 1A47A 1NKOA 1BZ9B 3AREC 3R0MA 5EOCJ 4HK3N 4YX2H 5HHXL 2AXFA 4IMKA 4C56D 2ZCKH 3DGGB 2QQLL 4WW1B 5HHME 3IJSB 4KKLD 5EO9B 1N4XL 5CBEA 4GSDL 5FYKL 5TFSL 4ONFL 1U2CA 1ZXQA 5D5MB 4Q9BA 1TVBA 2XWTB 5MEND 2BMKB 1H15B 1RK1A 4JO4L 1ACYL 1B3JA 1MFNA 3RGVC 5DVKA 2RCSL 1FNSL 4BELD 1R3KA 3GI8H 3TYFA 5ESVB 2X1WL 1JJUA 1GZPB 2KDGA 4S1RH 3REWA 4ISVB 2CDGA 3EGSB 3MJ7B 4CU8A 1CF8H 2WINA 4ZNEA 3KR3H 4G6AC 4LDEB 1U3ZA 5FK9B 2WAHA 2EDEA 4IIQC 3SKMB 4XVSL 4LCWB 2VYRE 4QNPF 1J11A 5H37G 4QRUB 1EUTA 3BDYH 5DK0B 3MC0A 2VIRB 5BRZB 1P9MA 3C6LD 2OX5A 5D5MF 5C8JA 1JPFB 3HNSH 4JDTL 1A4JA 1BWMA 3QFJE 1M7IA 4BZ1L 3P0YH 1O5DT 3L1OL 5BXFA 1FPTL 1DQLL 4G8GD 4NRYA 2BVUA 5C07B 3EJYC 2BNRB 1D3CA 3CDGB 2VTFA 4NT6B 4NRZB 4P3CH 4YWGH 4G6FB 4OCSL 4U7SA 4LEXL 1HDMA 1MCOH 5IB1B 1D5IH 1QR1B 1YC7A 3LEXB 2O5XL 2QQQA 5F9DC 3FQNA 1LP9A 1C1EH 2BHZA 3O45A 3MLXH 4G8EB 3SEPA 1UJ3B 4F7TA 2W60A 5BV7C 4MWFA 3BEWA 2H8PB 1RY7B 4G9FB 4EXPX 2XZQL 1G0YR 4RFOL 2F8VA 2HJKB 3S96A 1WBZA 1U8QA 4NQVA 2Q3ZA 2D0HA 2Y7QB 4OZHF 4MNQE 3VJ6B 1KCVH 4YXLL 4RGMC 2DBLL 5DJ2A 2D7NA 2UY7A 3NCYP 1SEQL 2HH0H 4NSKA 3UCRA 4CNIA 1I3VA 4UZGA 4JM4H 4U1KB 4PJXB 1G9MH 3PL6B 1HQRB 1Q0YL 1WFOA 2JF1A 2F5AH 4N8VG 5IROA 3NIDE 1G7IB 3B9KA 4EI6A 2YC1A 3TIEA 1I1FB 1ORSA 1UM5H 3ULUD 3ARQA 1P69B 1HNGA 1XGUB 5E9DE 1J12A 3AXLB 1XZ0B 3GGWB 3B6SB 5C92A 4PY7A 1E6OL 3P30L 1FVCA 1YMMD 3MLVL 1YEJL 3TC9A 3P0GB 3ARZA 3MRQB 1ADQA 3PHOB 3C8HA 5I6XC 2GTZA 4L8BB 1XIWD 2AJZA 5IIEA 5SWQB 4C83A 4U6XB 5D93B 4XXCA 4CN1A 3VD5A 3UTOA 1V3JA 2FX7H 4LAQL 2F58L 2CUHA 4Y5VC 4Y2DD 4PJAB 1IBGL 2HA1A 3BD3A 4F7PB 2FSEB 2QHRL 1EFXB 3QQ3A 2NY2C 2Q20A 3QXVA 5FYLL 4ZFOA 3M1BB 3STLB 5D7JA 3W2DL 1I85A 1I7UA 3RY4A 3VRIA 3MRDA 5GRXG 2EC8A 4QNPE 2MOVA 1HE7A 4DVRH 3SHSA 1KJ3H 5B3NA 2A77H 4N0UB 1H3PL 1NUDA 1QQDA 4D9RE 5E00B 1YY8B 1KLUB 5D5ME 3Q6FB 3ZKMC 4OCLC 1AJ7H 5E8PB 3BWAA 3RKPA 3FO2A 4TUOA 2ARWA 2PYFA 1BFTA 4K7FB 3WJJA 1A02N 3ZKXB 3RTQB 5TPWH 2H2SD 4TTDC 1HQ4A 1WWAX 4HUKB 4HZLB 3LQAH 1QFOA 4PJAF 4PRPB 3VFRA 4EN3C 4O2CB 4BYHA 3QO1A 1S7XA 2X4UB 1H5BC 3VFPA 4C54A 4UILL 3O9WD 4LCWE 4S10A 5DJAB 4RA0C 3K4AA 3UO1L 3QCVH 3SKUD 1CBVL 4JFFB 4KJQD 4OUUB 3RVTC 3O6MH 3LS5H 5DD1L 3G6DL 1YECL 3HNVH 1MAJA 2YPKA 1OP9A 4Z78B 2DLFH 1CZ8L 4OZHE 4HIIB 5J13B 4TVSa 1CFNA 2VDPH 4GKZB 3K1DA 5JW4N 5TJWK 1MHCA 3U6RB 1O7SA 4I8DA 1VENA 2EYRB 1O0VA 1MCEA 4JJ5B 1QFWL 4NHCL 3L7EB 3TYGH 3CFKB 2P5WD 1CVSC 3BZEA 3CSPA 3O3EB 3HPLA 4PR5B 3AM8A 1LO4H 4L5FL 4KK9D 5T1LA 4XVJH 4OIAA 1XF2B 1EXUB 1N0XH 1F90H 3KPOB 2AAVA 4HG4J 1OGAD 4NC1E 4Y4KD 1D6VL 1JV5A 1V3LA 2YHGA 5MHSD 1DE4B 1PZ5B 2Z8SA 5I1HL 1JHKL 1WCBB 3F7PC 2QQNL 5B39B 1S78D 4UNVA 5CEZD 3IJHA 5GJSL 1JPTL 4GLRI 3QDMB 4HJ0D 2AABL 2UZXB 5IM7B 3OKEA 1ZLSH 2W9LA 4TULH 4XHJC 5DJZA 2NY4D 1MAML 2VLRA 1XT5A 3DRQB 5E03A 5CSGA 3DMMB 4P4KD 3STZA 1Z0MA 2V2XA 5C0NC 3IU3B 5E8NB 5BOZG 1D9KC 4XWGL 4QF1B 4PYGA 1BFSA 1A7QH 2ICES 3HR6A 5T3ZH 1UFUA 5CCKL 1AFVH 1MJUL 1NGYB 3UAJD 1IAIM 4LDLB 4ELMF 5I71C 3C60D 1T4KA 5HHPB 3KXFD 2APVA 3MOAH 1XCTB 4K23H 5EOTB 5I8OH 2AJUL 4E41A 4H1LB 1VESA 5GZND 2VAAB 5EU5B 4P4RA 3LIZL 3SPVA 3U9PL 4M6AA 2P46B 3V4PH 1A9EB 1WAAA 4K8RH 1BEYL 1FNEA 2XN9A 4OCMC 4POUB 4DFIA 2VWEC 5CHNA 3O3AA 1KCUH 2X2YA 1ZEAL 2DM3A 1W0WA 1EJOH 3B9AA 3UPAA 3VFWB 4CJ0A 2VLKE 4PJAE 1QBBA 2YD3A 4L9LC 5ERWB 2YPLA 4AEIL 2R56L 4S1SL 3BAEH 5AUMB 1ZOXA 4HS6A 5KBNC 4K2UL 4OGAC 2KUTA 4QEGA 4LHUG 1TDQA 3TA3D 4R6UA 1RVFL 4ZOAA 2Y4SA 4W6XB 4N0UE 1MCBA 5CEYB 4EBQH 2OK0L 1W0VB 2Q86A 1DLFH 4X5LA 2XTJD 2OXHA 3KLDA 1WEJL 5ECJE 3PXJA 3EYUH 5GRYA 3RWFA 2QBWA 4XNXL 2RQ8A 3NZHL 1R24A 2VB5A 3ZL4L 3JZ7A 5I2IA 2QEJA 5BOPA 4YGVA 4IBLT 3U4EA 4MLSA 5L88L 2BOBA 4G80B 5TE4H 4F8QA 1U8KB 1HKLL 2ESVB 3FQRB 5F6IC 2GK0A 1J1PL 1WF5A 3LB6D 2DQJH 1MJJB 1SJHA 4J3TA 2OTUA 4OT1H 5ICYB 1N3NA 3F8UB 5HTSA 4YHIA 1U41A 3W0WD 4F57L 5FGBC 3O3BA 4KDVA 1INQA 2WV3A 4JFFE 4XCCL 1F11A 3C8KB 3NPSB 4KQ4H 4EUPG 1JIBA 5IEHB 1M6OA 1G7PB 4LSQL 4J6RL 2F54E 3VXSB 4MA3B 4RMVA 1JZ2A 1P2CA 1DDHA 1N59A 4RSVA 4XTRD 1NANH 3F12A 1R5IA 2VUYA 3OPZH 4NNXA 5GXBB 3T1WA 2OQJA 1NL0L 3NCEB 4NCDA 1J1XL 5F3HB 1YEFL 1P84J 4LMQE 4Y5XC 2HT2D 4JLRA 1EAPA 2E9IA 4HKJA 5F9OH 5FO9B 1UQSA 5FYKD 2BNQA 2AERT 3OGOE 1F4AA 2W9EL 4OD1L 2CKNA 3BVNA 3QO0A 5A1AA 1F4WL 1RZGB 4MX7A 1GL4B 5JORA 3OKYA 3J7HA 1B9ZA 3FB8A 4WNQB 2V5YA 4HF5H 1WWBX 2NXZC 3L5WB 3SE8H 2W1NA 4ELME 3PQYD 4X9BA 4X7FC 1BLNA 2BY0A 4XVUC 2EKSA 2Z92B 4LPVA 1AHWB 4NKDB 4XNQB 3IFLL 1A0QL 1MI5A 1T6WA 3P77B 1NAMH 2VXQH 3QDME 4APQB 4J4PC 4MCYB 4LHUD 4YHKH 5BJTA 5C0GB 4X4XB 4PJHA 3MBXH 4JKMA 4ONHB 4HUWA 3QRGL 4JHAL 1FSKC 1A6TA 3U1SH 4HV8A 1XF3A 2BRRL 1X5FA 2BDNL 4QGTA 3N9GL 3LV3B 1HYSC 3FFCB 1JGLL 4ZFGH 5JMOC 2DWEB 5T3XL 3LDBB 3G5XB 2FZ3A 4W70A 3KLAA 5IG7A 5D7IB 1P5VA 1YEEH 2DS4A 4OAWB 4BQ6A 5GGQH 3QUMA 4YIQA 4NO2A 1GPOH 1DQMH 3S7GA 5MERB 2YD8A 3FT2A 1SM3H 2B2XL 4R2GB 1CDGA 2PXYD 3PV7A 4I3SH 4YDIL 1AY1H 3NZ8A 3GKZA 1ZT4A 3QUXB 4U05A 5KVFH 4M5ZL 3C5SA 4NQCB 4YZFF 2HT4C 4UDUB 2C3VA 2HMID 4ODUB 4MA1B 3TBVB 5IQ9B 1RV6X 4M5YL 5TE6L 4CKVX 1PQZB 3EO9L 4LRNL 4Q74A 5TGBB 3VD9A 3FB6B 3PGFH 1BD2B 2OL3A 4RMUA 5BZWA 1Z5LB 2RHEA 4U0RC 2G75B 2VAJA 3MLWL 4YPGA 1KT2B 1I9JL 3ARFB 3T1FA 5GGVY 3TBWA 1QSFD 2GCYA 1G9EA 3GMNB 2AJYL 4WW2A 5ALCL 1HEZA 5IW6A 1AXTH 2X41A 3R1GL 1BAFH 3EOAB 2VABA 2PETA 3O11A 2ESVE 1BQHB 1GGCL 5T5FL 3HE7C 4CVXA 4EDXB 2Y36L 1CICA 1NAKH 4N8PA 4QHNA 1KB5H 5FHBL 1F45A 1BFVH 3BPCA 4F2MA 4NKIL 2FWOA 1IT9H 3RDTD 5HYSA 1KC5L 1F3JB 5FOBA 4R4ND 4FZ8H 5EU6B 1DQTA 5T33L 3VWKC 3C08L 1ZAGA 2LQRA 5JXAL 3NCMA 1DQDL 3QEUA 5CZVL 3P73A 3UZVB 4LNRA 1N5YL 2ORBL 4PJBB 3Q2CA 3VXSE 3PDOA 4YO0B 5IVXB 4HK0B 4ACPA 4PFEA 4HMDA 3KYNB 4LLWB 5FYLD 5J57B 4Y7MA 3MPCA 5BO1H 5EZLB 5HYJD 4TUJB 1S7UA 1MJ8L 3KPNB 1DVFC 3HE6A 1WZ1L 4NHUB 1D5MB 2R4RL 4WHTB 4YDJB 2WBJB 5B38G 2ERJC 4OM0H 4ZAKB 5C7XL 2I5YH 3QFDB 2MCG1 2XZAL 3BP6B 3VE0A 2P44B 2J7LA 1HHHB 1Y18A 4JFQA 1M05B 3UTSD 2BJMH 1YEIH 1MSPA 4TYUA 3MJ8A 3RFZC 3P0VH 2OJZL 3SQBA 2CO7B 4L1DA 1GH7A 4JKKA 4BK4A 1A6ZA 4PJBF 3HPJB 4HXBH 1HCVA 1WGOA 3KYAA 5IVXF 3MCLL 3NTCL 5EUOA 1QBML 5F7EL 3AS1A 4R90L 4XBPB 2CR6A 4LVOC 4YHNB 1JHTB 2R2HA 4XPAL 5I74B 3VFMA 1BF8A 1BZ7A 1LO3L 3UYRH 3TWCL 5JIKA 1R3LB 3U0WH 3MXVH 5I19L 1BVKA 1BF2A 4S1QH 4B53A 3HB3D 4OLZH 4ZFZB 4AIZA 2FO1A 4YZFE 4WUUB 1OARL 4WEBH 3JWDH 3FT3A 3MLZH 4NWTH 5D2NA 3UXFA 3FFCE 1VACA 4OCRL 2HJLB 4L29A 1EEYB 2CJUH 3QDGD 2UWEA 2PYEE 4HCRH 4P23B 3DIFA 1XGQA 1U8JA 2QADC 3S36H 4OLUL 2Y07L 2DQGL 1N5AA 4PYHA 3REVA 1BJ1H 4KAQL 3WKML 3V5DB 1G7QB 3QZWB 1AO7B 3QEQB 1A64A 3BD4A 3T0DA 4F15B 5HHOA 1NUGA 4CMHB 4IRSD 3KPSA 4LARL 1BVZA 4LVEA 3D0VB 3ZKNC 4Y4HB 4GW1A 6FABH 2D7PA 4HIJA 5GS1C 1S7QA 1LDPL 2VZTA 1WSST 4DKAA 3IKCA 4OZFH 4M62H 3ULVC 4MS8D 5I30L 4X4ME 4KK5C 3WD5L 4GBXB 2ZSVB 4JFZH 4OB5L 3DXAD 3CMOL 4WUKH 3IDYC 2CIIA 2VSDA 5CINL 4NQEA 4PRHB 3WIFA 5DJCA 4GH7B 3S3PA 3BGFC 3MGAA 4H0IA 2FGWL 2DQHH 3QHZL 4H5SA 4XAKD 1ES0B 3INUH 3VXNB 2WWKO 3ZKQD 2QSTA 4MMXC 5CBEB 2Q8BL 4MGXA 3X17A 2PKDA 4EJ1C 2DQDH 4RX4A 1GIGL 1TVBB 1G7JB 1AR1D 4XCEB 4G9DB 4EDWL 1R3KB 5HPMA 3TYFB 3IU4H 3H9ZA 3A6CL 4TQEH 5E56A 3REWB 3TO4B 5EU6E 1U6AH 3D39A 2EDLA 3L9RA 5I1KH 5C0FA 3UC0H 4NQDD 5CUSH 2ADGB 3BYYA 4JANB 2MKWA 3D85B 1IEHA 4NNPH 2AK1L 3UBXG 1JRHI 5EC2B 5D96B 1RHFA 3GBNH 4PJBE 1H0DB 2OTWA 5IVXE 3VA6A 2EKJA 4LAJH 1R3JB 5DA0B 2EH8H 4MHHI 3B9EA 3FHAA 1AXSA 2X7LB 1B6UA 3SDDB 1YQ2A 1XF5B 5KVDL 5C6TH 3O6LH 5ENWA 2H26A 5D7LD 2NPLX 1SBSL 2JB5L 2ZJSH 3PF2A 1OTSC 1UXSA 1FVEA 2G9HA 4I48A 1GAFL 2CLVB 3IXAA 3QG6B 3VGBA 1TETH 3SGKC 2OZ4L 1JWMA 2H3NB 2PCPB 4HEPG 5IF0A 3MMEA 4KUZH 4P99A 1OAYH 4DGYH 5HDOA 3MRIA 5EOCL 3P4OA 5HI4D 3SDCA 1IAII 5J4MA 1HDMB 2VOTA 1CTNA 3QR2A 4N0YH 3RKDC 2KZ1B 4AL8L 1A1OA 3VFSB 5AG8A 1IKNC 3SJVB 1NBQA 3O45B 3NCFB 1IGCH 4F7TB 2W60B 4BK5A 3O6FA 5MI0B 3S36X 3BEWB 1F00I 4M9PA 4PB9H 3BT2L 1NAMB 4I0PA 1IKFH 1LNUB 4IOFD 3WFEL 5KS9B 3CIQA 3FMGL 3L3JA 1S9WA 4NQVB 3BOVA 1SHMA 1A5FH 4QHKJ 3S88L 3NCCB 1FN4A 1UJ3C 1NC4B 2NYYC 2VH5H 4NM8H 3JV5A 5EPMA 1U95B 4ZPTB 3OB0H 5DJ2B 3ARTA 4WUUE 5FYJH 4CNIB 4GRLC 1BIIA 4M48H 2IQ9H 5EU3A 4M4PA 5DHVH 3OF6A 5T1MB 1SJVA 3LKOA 4N0CC 4KUCD 1LEGA 4MSWA 1SY6L 4PPTA 1W2KT 3LKNA 4EI6B 4O4YH 3TIEB 4PS4L 3BI9X 5HVWA 5GS3A 1GC1C 2VSCA 3ARBD 4EQ2A 2VQ1B 3K2UH 5AZ2H 9CGTA 4OFIA 5HD8D 5KS9F 3RVVC 3PP3H 5A2JH 1AO7E 3H9SA 3PL6C 3PWVA 3ISWA 1FVCB 5KSAB 3BKYL 5DURD 1DUYB 1T7XA 5JHDB 3EJZC 2QKIA 4Y8AA 3V4UL 3CSYA 2PR4L 4JY4A 4Y1AE 1IC4L 4XPGL 2GTZB 3BPNB 4XNUL 3UZEA 1NJ9A 3MA7A 1U93B 1KTDA 1KEML 2YD2A 3MRCB 1QACA 1F3DH 5D2LB 5HDQH 1R3IH 2XZCL 3IDXL 3G9AB 4WI8A 4HKBA 4KVCL 5DR5L 1JTTA 2VDNL 1F6AA 1YN6A 4X6DB 2DQTH 5MENA 1WV7T 1A6WL 4G6KL 3GHEL 1KCRH 4MQXD 4HMEA 4E5XB 1QD0A 1LGVA 4UT6H 5GGUA 4NPYB 3VD4A 4HX1B 5D93C 3EDEA 4FQXD 1I7UB 2D03L 5DSCA 3VRIB 1T0NA 5C0BA 1GOFA 2OL3H 3FCTB 5F9JB 1I1YA 3BZ4A 4HH8A 2A6JB 4RAUA 4TN9A 5LGHL 5ELIA 2BERA 3QB7C 1G0DA 3K4DA 2V5RA 4M7ZB 1A6PA 2VDLL 5C09D 3KPQA 1XGPA 3FO2B 4GKNA 2G60H 4KGJA 5DK3A 1LVEA 2HN7A 1KJ2H 3GM8A 1J05B 1HQ4B 5KN5B 3RU8H 2ICEB 1QRKA 3Q48A 4ZNEE 3VFRB 1IZJA 2HTKC 1E4KA 2VLMD 3QO1B 2APBA 2XWJA 1YNLH 3GMQA 3GHBH 5DD5H 5CKAA 2EIEA 2QSCH 4XBEH 1MREL 1J8HB 1PW3A 3ZKXC 1I9EA 5DJYA 3RTQC 4R7DA 4Z77A 1MPAL 1FE8L 4HLZH 2X9YA 4FQ1L 5C0AD 2V2TA 1CFVL 1DEEA 2NY1B 2IFFL 2F53D 5HY9A 2X4NA 5TF1H 3MUY1 1YDPA 3HLAB 5F7MC 1NKRA 4RGND 1AP2A 4ZYKA 2P8PA 4PJDA 1D5BA 3S98A 2DJSA 4PJ5A 1U8PB 2BY3A 3DX8B 5HGHB 4TSBH 2EDOA 3K8MA 4ZUSB 2CUIA 2R2EA 3QQ4A 1TITA 2Y5EA 4I0KA 1GGTA 2ZG3A 5JTWA 1T5WA 3MGTB 4JGMA 3HPLB 3PGCA 1LK2A 1L0YA 3DETC 3KPTA 4XC3L 1B0RB 1H8SA 4PY8J 2EDRA 3WDHA 5J13C 3HS0A 4JFPA 5MEQA 1S7SA 5T1LB 3SE3C 3EYOA 3A67H 3KDMA 4P46D 2VDOH 2IF7A 3UP1A 2EEAA 3AU1A 1H3VA 1T2JA 1WISA 5KS9E 5SX5K 4JKWA 4M6OH 4BH8A 3ARGA 1EBAA 1DL7L 1FGNH 2AI0H 3LQZA 3X11B 5EBLA 2OXGA 4YHLH 4C55A 4XAWH 5ID0A 1R5VB 3BIAX 2JIXB 3SO3B 2XI9A 3PV6B 3AS0A 4KVNH 5F1IA 2EICA 3VWJA 5DJZB 1XR8B 4U6YA 3STZB 5IB5B 4K94C 5FA4A 4K3HA 5L7XH 5E2WL 4UINH 5L2KD 4M7LL 3GIVB 4UT9L 3EJJX 4LFHG 3PGDA 4MYWB 5GSRA 4P2QA 4QCIA 1KFAH 4O5LL 5LAXB 1QHOA 1DLHA 1ZGLA 2V7NA 1PG7W 3DMMC 3QSKB 1T4KB 4TVPE 5IHBA 4JM2A 2EE3A 5FB8A 1DZBA 1PSKH 4N9GA 3T65A 1ZVYA 3W39B 5KJRH 3GMOA 5CJBA 1KGCE 3OXRB 3JTTB 4OIIH 1Z9MA 4X0KA 4M6ML 3WJLA 1GGBL 4P4RB 5KANG 2HG5A 4ZD3H 3SPVB 3HNTH 3QXTA 5IBLD 3CVIL 2XN9B 4UNTA 1QFPA 2PNDA 4ZTPH 2HTLC 2XQYG 5CHNB 5EU4A 2X4OB 4RGOL 1W0WB 3UTZB 1MRFH 3VG9B 1I9IL 3PABB 5D1XA 1MJ7H 1CFTA 4WU7A 3SKJL 4AYFA 3O2WL 4HS6B 15C8H 1SY6A 3HZYA 3BUYB 3ULSB 1WC7A 2NXYD 5E8EB 3FB7B 5E7FA 5C0CD 1F8TH 4P2RA 3KPRD 4BH7A 3FQWA 1K85A 4Z7NF 3OKOA 3BQUB 1E28B 1UENA 1JK8B 4KK6C 5JW5B 5HPOA 1KYOK 3PWLA 1WAAF 1IQDB 4PLKD 4PUBL 3WSQL 3BESR 3EYSH 4ZOEA 2VXVH 4WO4B 2V9RA 3MJ6A 3U4AA 3QRFM 4F8TA 4P9HH 3ARDD 5M7QA 1JZ8A 1MCPL 4PJ8D 4U0QB 4IOIB 5BV7L 1ZWIA 2BZDA 4NP4L 4Z5RA 5L8LB 1C08A 4TSAL 3NN8A 1S7RB 1SJHB 4BKLA 1J8HE 4OGYL 3TBYA 1N3NB 2AXJA 3MLRH 3I6KA 5ITBH 3PP4L 4YHIB 3QXUA 2DQFB 5D8JL 3AGVA 4JO2H 3CFEA 2BHYA 3MROB 4UU9A 3O3BB 5I73B 2FRGP 4P5TD 4RIRB 4FA8A 2OMNA 4V1DB 4LFHD 4F80A 3Q1SH 3FN0H 3Q5OA 3QQ9C 5I18L 4OCWH 1JRHL 5JW4Q 2DMKA 1N59B 5CWSB 3LZFH 5A2IH 3F12B 5FIEA 1R5IB 4ZO9A 4EOWH 4NNXB 1PLGH 1OGAA 5C08B 1K6QL 4TOYH 1A9BB 1NGPL 3ES6A 2VKXA 4ORGB 4F37K 1DFBH 5D70H 3NPSC 4RQQA 2OM5A 1K4DA 4NZTH 3JV4A 4GRMA 1UQSB 2APWA 3OG6B 2BNQB 3DO7A 1HIMH 4PTUA 4PJ7B 5JORB 3PHSA 2PO6A 2AK4B 4P4KA 1A2YA 3FB8B 4YEFA 3V0WL 3S8WA 4LSRL 3C6SA 5BVPH 1IAIL 4ZUTA 2PW1A 4N1EA 3VXMD 3T8XA 1I1AB 1RK0A 4QLRA 3CC5B 1KCSL 4WJ5A 1S5HB 2WNGA 5IBTH 4ZODA 1N64L 4X6CA 3ZYJA 4X6FA 3VGFA 3NIGF 2VLRE 4KJYA 4MAYB 1HHKA 1ODAA 1AHWC 1QRND 4FP8L 5DHVB 3UJJH 1IGYB 5SV4A 2ADJA 1IAKA 1S7VA 2CDEB 4G42B 2BOCA 4XP4L 4GXUM 3WFZA 1MF2L 2AEQH 4MJIA 3WUWA 3O81A 2CGRH 2F5BL 3EOTL 4AK1A 1EGJL 3GMLA 3D9AL 4G6JH 1MHEA 2XNAA 3KLAB 3WYRA 4E41E 5F3BA 3WS3B 5CZXD 4ZXBB 3QUMB 4Z7NE 2XKNB 2G2RA 2Y5TA 1YEDA 3HRZA 3L3IA 3LH2H 5FECB 4M7LT 1WZKA 3O4OB 3O8XD 1TENA 1WAAE 4JQVA 2XN9E 3LRSB 4PG2A 3CXDL 3VFGL 3MRMA 2X70A 4X8JA 5DRXB 3BP7A 1HNFA 5L8KB 2IAMB 4XPBH 2ILLA 1JI1A 1FLRL 2A0LC 4QHKI 2YPLE 2YA2A 3OAZK 2B0SH 2FIRT 4ODXB 2VLJD 5EA0L 4HUMB 4R2GC 4MD5A 5I1GH 1UT9A 3CLEH 3K80A 3HAEG 1A6UL 2OL3B 3H3BC 2DJUA 5BZWB 2HRLA 4DGIH 3QUXC 1C12B 3A6BH 3STBA 5HI3C 1VGEH 5ESAA 1MH5A 3D3VA 3MLUH 3TBWB 4MA1C 1AGBB 3V0AC 4AJ0A 1Y0LA 1IC7H 2GCYB 3MNZA 4LPWA 3GK8L 4QHLB 2X4TB 5FV2A 1KJ2B 4ALAH 4MAUL 4MLIA 1OT2A 2VABB 3ARFC 4IIQA 3WFBL 4CVXB 3LD8B 1QTYT 3MV7B 2V2WA 2GUOA 2ZPKL 4QHNB 5J12C 1ETZA 3EZJB 3WUZA 4AMKL 4F2MB 2FWOB 5HYSB 3RVXC 4AENA 5I1IL 5FDYA 5FOBB 1YNTA 1J88A 4HXAH 5BW7C 2BVEA 4HWEH 5DWUL 2HFEA 5L2JA 3S9DB 4V1DE 5JHLH 4HGKC 3T0EB 3VFUA 1J9CT 1S7WA 2ZCHH 1IGML 4WW2F 5IEKA 1BPVA 3DUHA 3DPBA 1GHFL 5AAWA 5HGBB 1IL1A 5C08E 1WFNA 2FL5B 4O51A 1DBAH 1JCKA 1OTUC 1OL0A 3NIGE 2CXKA 3GRWL 3ILPB 3KYOA 5JXED 4LPXA 5FGCB 3ZE2E 4OCNC 2ZG1A 4NJ9H 2YPVL 2VL5A 3BPOB 1Z2KA 2LAGB 2BNQE 3Q3GA 4X4YA 1G6RL 2ICWA 1TJGL 2NY6B 4NBYB 1Y18B 5K9JL 4TTGA 2YSSA 3FOMB 4WFHE 2O5ZH 2R0ZH 1X5HA 1XGYH 3RWJA 1I7RA 1OAUL 3QPXH 5FFLA 1T80A 4LDOB 4Y0GA 1LEIA 1ORQA 1A6ZB 3SOBH 2WBJC 3T08A 1MI5E 3RQ3A 3SKNA 1U8NB 3QIWA 4ZAKC 4MQTB 3VXUD 1NGQL 3U0PA 4K9EH 1J5OH 2J8HA 1RZJH 2DLHA 3OWEA 4X4ZA 2XACC 3QXAA 4OF0A 5FYJE 5ITFB 3ULUH 5IHZA 4M61A 4HWBA 1I1CA 2X4QB 3DX6A 1BVKB 2IQAA 4LLVA 1YEGL 4HAFA 1CLOH 1MOEA 1QLEH 1IEAA 1I8IA 4L4VD 1UEMA 1FORH 5DVOA 2N1KA 5D2NB 3FT3B 4FMKA 5SWZD 4AEHL 3NIFF 5I74C 1Z9LA 5K9QG 4X5WA 3L6FA 4DN4H 2NY5L 5DJ8B 1W72A 1WITA 3DV4A 5KVGL 4I2XA 4MQ7B 3VFNA 5H37H 2AJ3A 3BH9A 1FYTB 3DIFB 2WIMA 2ZCLL 1U8JB 5AWNH 1N6VA 5DK2A 3MJ9L 5EUOF 3QQNA 3SCMB 4LKXB 2CQVA 1N5AB 2W92A 1T7VA 4LKCB 2ZP0T 1YA5A 2ZOKA 3QI9B 1RIHL 1T89C 1F58H 3WS6C 2HT3D 4PY8I 5F89A 2J1KA 4KZDL 5HHOB 1CXEA 3C9NA 2FX8L 4Y5VA 4JN2A 2P7TB 4J8RB 5SV3A 1OHQA 3CU1A 4DQOL 1A8JH 2VR4A 1MFBL 1Q1JL 4KKAD 1RU9H 5FKPB 1DBMH 3OR6A 4JJHA 1NLBH 5GGSY 4F15C 1DUZA 3GSXB 4CMHC 1MFEL 4K8RC 1WT5A 3LEVL 3QIUD 1GOHA 4Y4HC 1A7OL 2AJSH 1RJZB 3ARED 2GW5A 1JYWA 1XAUA 1P4BL 3GKWH 2E6PA 5GHWL 3ILQD 4HJGA 5I75C 5ICXA 4GBXC 5MEOB 1TNMA 3O4LA 4JFEA 5IKCA 4OSUL 4XCFH 1E4XH 3TCLB 1KN4L 2B1AH 4YR6A 1FNGA 1RULH 3MRGB 3BRGC 2MKLC 3F62A 1KIPA 3V5HB 3VH8A 3HZMA 1EAJA 5I1LB 3NGBC 4MHHG 4H26A 3CCHA 3MV7E 3DRTB 4KROB 5CJQL 3RGVD 5JOFA 5F7WC 4GAFB 4BSVB 4UQ2B 4KRLB 3GMMA 2FH8A 3GBMH 2DYPD 1ZHLA 4PRAA 3VD7A 3BXNB 4G6AD 1YMHA 3G6AA 3F5WA 5CILL 3I2CL 3NABH 3MNWA 1PX3A 2A6DA 2BC4B 1BBDL 4P2OB 5CP3H 2B5IB 5BVJB 2PTTA 1JGUH 3TO4C 2UYLA 5C2BL 2D7TL 2AGJH 5DO2C 3TNMA 5ENWB 1K9TA 2H26B 1YQVH 2VDRH 5FGCE 5D96C 2KQMA 3UTPE 3WFDL 3WNKA 4I48B 4XMPL 5DMGC 2DD8L 3IXAB 2A73A 4AM0A 5IGXH 1JWMB 2OYPA 3MMEB 1P9MC 4ODTL 2DLEA 1LO5B 1BFOA 1VEOA 2VLLB 4WFGD 2IMNA 1QLFA 2ZZUT 5FOJA 4GRWF 1UB5A 3NIFE 3SDDC 3I50H 4RDQG 5JZ7C 5CEZH 3QDJA 3H3PH 1UKSA 3S5LG 5AEAA 4CU7A 4MMZC 5EUOE 1MQ8A 5DD6B 3U82B 2ZKHH 3RAJH 2Z35A 1MCCA 1N7MH 4CUCA 1FFNA 4RZCA 5C0EA 4WFEE 5DVLA 1S9WB 1U8LB 4JFDD 4PJGA 4HT1L 1FAIL 1M7DA 1D9KA 1Q9LA 4ENEC 5D72L 4DGVL 1JGVH 2NNAA 5MI0C 3UTTB 3GRWA 5DT1H 1TJHH 2VITB 1L7IL 1OP5K 5D2NE 4FXGA 5C9KA 5GRUH 1G6RA 2L7UA 3QUYA 3LKOB 4KU1A 4HBQA 1LEGB 2NX5D 4L9DA 4OGXL 5EWIL 5DJDA 1H3GA 3RWIB 1NFKA 3FL7A 5F1NA 1G7MA 4BSJA 3KNBB 1KXVC 2BVPA 4W6YB 2GI7A 2R23A 2N7BA 3H9SB 4QYOA 3RNKA 2YEZB 5C0DB 5E1AB 4XRCB 5HHOE 3X14A 1KPRB 3IDUA 2JJWA 1AKJD 3KPSE 2CLRB 4JY4B 3DVNA 4C56B 1FZMB 1N26A 4L9LA 1NJ9B 1YPZA 5E6IA 1OTTC 4ZS7H 1KTDB 1A4KA 3GMRA 2VJXA 4KKCC 2MHAA 4PRIA 3QWQB 4ZO8A 3WNLA 1ED3A 4HKBB 2VC2H 5KSAC 2B1HL 3P40A 4YC2C 1YN6B 4M43L 4HIEA 5MENB 1ZT7A 4XWOD 3RZCA 1VADB 2DWDA 3BPNC 4WY7L 5GGUB 4KZEH 1OWRM 1ZA3B 4QRTB 5H2BA 2YR3A 4Q0XH 3VD3A 4XVTH 1T0NB 2XT1B 4DKFH 3L7FB 5F96L 5TE7H 3HC4L 3BZ4B 3VFTA 4RAUB 4PGCA 4NQDA 2A38A 4XP6L 1MQKH 3NBNA 3QH3A 4LCUA 3ZKMD 4D8PA 3WXWL 4U49A 5LGJA 1BVLA 1J0HA 1N8ZA 3KPQB 3DI3B 4LMQI 5D7JC 4I3RL 1I85C 3JV6A 3N85H 1URLA 3AMLA 2BK8A 3WCYA 1X6LA 2BHUA 3QUKA 3C6LB 2KQNA 4Q9QH 5D6CB 1LO2H 5LBSL 5FGBA 5DJ6B 2AQ1A 2ZOLB 4RBPH 4PJ9D 1EERB 3DROB 3BO8A 4EN3D 4GRWE 4G8GB 1FGVL 4U6VL 1J0JA 4NO0A 5J9PA 5IT2L 3MA9L 3S35L 4EI5A 4GS7B 3ZHDA 4X6EA 3WJJC 3X3FH 5I1CL 4Z77B 4R7DB 4UOJA 2B4CC 3VDBA 3EO0A 2QQLH 3IFOA 3V4VL 5C0IB 5DLML 4NZRH 4O2EA 5FYKH 5C0JA 4Y5YA 2FHCA 5IMOA 2ADFH 4Y5XA 3BRDA 2A83B 4NNYA 4NKQB 1FAKT 1J8KA 1YDPB 1AP2B 1D5BB 1IC5H 3ZTNL 3LQMA 4ELKA 4PJ5B 5I8EB 2YD5A 4YHML 1RHHB 2DDQL 4GUPB 4TRPL 1ZS8A 4IMLA 4MXQC 4FQIL 5DRNA 1H3XA 1U36A 5E2JA 2NY1C 1P7QD 5KSVB 5E5MA 3GJEA 1JP5A 1YC8A 3BKJH 3IFNH 5IFHH 1T5WB 3QHFL 3MRHB 4XC1H 5CJ5A 1MIEH 5J6HB 4JFPB 1QBAA 3TLRA 1CE6A 4G6MH 4J4PA 4P2YA 4FTVD 3DVIA 3RVUC 5BZDB 1DANU 5DJXB 3AU1B 1SYVB 3GSUA 1CTOA 2OSLB 3DX9A 2D4DA 3C09B 5I1DA 4GXVL 2Q6WB 4BH8B 3AM8C 4NYLA 3ULVL 4FQCL 4KH2A 4PJDF 1EA9C 3LQZB 3QUZA 1FDLH 2RGSA 2RFXA 4DUXA 1I8MA 1YMMB 4K3DH 1FO0L 3BH8B 4XHJD 3QIBD 5IWLC 5HHQB 1TZGH 1CDJA 1FQ9C 2O5XH 2IGFL 4GOSA 1J1OL 3S4SG 4YNYB 4H25A 5F21B 3G5YB 3MV8A 3SO3C 3P9MA 3W9DB 5I1JL 2R1YA 2EIDA 4OLWL 1S9XA 5B4MC 3CUPA 4OZ4A 4X7SL 1W72H 4NM4L 4EUPH 1DLHB 1ZGLB 2V7NB 1TIUA 3L3HA 4ZDHA 3T0VA 3H9SE 4Y2DB 8FABA 2A9ML 2AJXH 3T0WA 5FB8B 1WZMA 4NDMB 3H42L 3P9LB 4UUJB 3NACL 1TJIH 1JNLL 4P57B 4YJZL 5IFJA 4OD3H 1P7KA 1VA9A 4Y4FD 4LNVA 2CRIA 2VZVA 1R3HA 3TM6A 1OPGH 4L3ED 5MENE 3TVMA 2ED7A 5HDBF 1GGIL 3RJDA 4JZOA 3QYCA 5D1QA 5DMIH 5IUSA 1CI5A 2MWCA 4ODVL 1BQSA 5DEGA 3MRJB 1E6OH 3WIHH 1WC7B 5C0BE 2CMRL 3OAUH 2AKRB 4LIQH 4WFFD 3OX8A 4XPTL 5KW9H 3FRUA 1ZHBA 3OKOB 2BVQB 5DDHB 3VG9C 4IRZH 3O9WB 3MFGB 1KLFA 1OGTA 4K3EL 4OV5A 5F93C 3PWLB 1EHXA 4OZGA 3CH8A 3BRFA 4LAQH 3VGGA 3O2VL 1CK0L 3WNNA 5C0RL 1WIPA 1U3JA 5ACLA 1IBGH 3OV6A 3BQUC 4Z5RB 1BQLL 2VZUA 4G8GE 2QHRH 1H3TA 5FYLH 1MEXL 3NN8B 3W2DH 4BKLB 4F7CA 3BPLB 1RZFH 3TBYB 1RJCA 4NFDA 2D31A 5ABDE 1QVOB 4V2BA 3L3DB 1JVKA 2EH7H 4WO4C 1Z3GL 5EH1A 3UDWC 1X3DA 3H6JA 4XHQA 5EZOL 3LSOA 3FFDB 1H3PH 3O3DB 3RRQA 2ZUWA 1DVFA 5L9DL 1AE6L 2V9QA 3SO5A 1P6AB 1W8NA 3AS3A 3RWCB 1PGRB 4PJDE 1YYLL 1X7QA 5F71A 4PJ5E 3C2AH 4NZUL 3PWJA 1GJIA 2P43B 3G5VB 1OGAB 5DD0H 3Q6GL 5I73C 4JY5H 4O2FB 1IM3A 1UEYA 3D2UA 2DQUL 4Y4KB 1GRWA 4HIXL 1CGWA 5BMFH 1GC1L 2BCKB 3IFPA 4RQQB 5FCUL 1K4DB 5E8DL 2EIZA 3MREB 5FA3A 5GS0D 1HH9B 4GRMB 3MRNB 1TCRB 3DO7B 5HJ3B 4PTUB 4BM7A 1R0AL 2P4AB 2Q7YA 1BOYA 1MRDH 3OAYK 4P4KB 4UIKH 1CD1A 1IAMA 1OP5H 5IQ7H 2VXUL 3C6SB 2X1OA 5DD1H 2FATH 4H88L 4RCAA 3G6DH 5FO7A 5C2UB 4PGEB 5E5UB 4YHZL 4LPUA 1RK0B 1OM3H 4Z7OF 1F3RB 1ZANL 3DOSA 2FO4A 3O0RL 1RFDL 3C60B 4OF7A 3KXFB 3TFKD 3E6HA 1TZIA 2VDKH 2FNBA 5FF6A 3TBSB 1HHKB 3WDIA 3DUUA 2BSSA 1CU4L 5MEPA 3RJQB 4Y16A 5DRWA 4R26L 2WIIA 4NO3B 3FHQA 3HI5L 1K5NB 2DAVA 5HDBE 4RMQA 4P2QE 3PHQA 1S3KL 3EDDA 2EE9A 1G1YA 2VQTA 4LASL 4MAYC 3CLFL 3GMLB 4YBQC 1MHEB 2XNAB 3KPPA 5I1HH 5F3BB 4JZNB 4O00A 3OZ9L 1RUKL 1OW0A 2QQNH 5E9DA 1QFUL 5BCAA 1MHHA 3GI9L 3L5HA 2HKFL 3NFSL 4Z7QF 2G2RB 5C3LD 2YN5A 1YEDB 3HRZB 3L3IB 3BHBA 4X6CF 3MACL 2ATPB 4WU5A 1MFAL 3L3KA 2R69L 1U91A 5ALBL 5F7FA 5EULV 3BP7B 4ONGL 2XA8H 3MR9A 1QNZH 4XWGH 1KACB 3IXTA 1WZLA 3SGEH 3O4OC 3RY6C 5INDA 3KJ4B 3C5ZD 4ZPVA 1SBBA 2CR3A 2H45A 1TLKA 2XG4A 4YQXL 5E24E 2IBZY 2AJUH 4P2RE 4RFEA 4XB8A 2IAMC 1A3RL 3QULA 3S34L 4GQ9L 5ESAB 3D3VB 4AG4L 3NFPB 3RHWK 3DGGA 1CGXA 4WW1A 3MNZB 5D7SL 5IB4B 3MBED 1NCUA 1BJ1J 2VKWA 4HIHA 4X7TA 4XCNA 4BZ2H 4ZFFB 4WVRA 1OB1A 2XWTA 2BMKA 1H15A 3HE7D 2HKHH 4P2CG 5DQ9A 2DKMA 1KIRB 1OSPL 2V2WB 2GUOB 4S1SH 5ESVA 3FB5B 3HMXL 1GZPA 4MZ3A 1II4E 3ABZA 4ISVA 4KC3B 4PD4K 3EGSA 1YNTB 3OR7B 3VWKD 1HHIA 4B7LA 2A1WL 5FK9A 3DGCR 4WWID 1HWGB 1JYNA 4NGHL 5L2JB 3LD8C 5D4QA 5AYUL 3Q0HA 4B5EA 4LCWA 1WCQA 1K4CB 3TT1L 1S7WB 1EPFA 1UCBL 5IEKB 4QRUA 1EO5A 35C8H 1HILA 3D25B 4D0DB 4Z7OE 5A40E 4K94L 2VIRA 5EOQH 5BRZA 4MDIB 1OGAE 2FB4L 5C6PB 1JPFA 1I7TA 4O51B 1P1ZB 3B3IA 1EVUA 1YNKL 2WBWB 1DN0A 1HKLH 2WUBL 3JV0A 4IDJL 1CR9H 2DMCA 1T66D 4Z0BL 3T0EC 2IMMA 1J1PH 1IKNA 4X98B 5CEZE 3WIIL 4TSCH 1A3LL 5C07A 4PP1D 2E6JA 2BNRA 2DQIL 3Q3GB 4X4YB 4R8WL 2YXFA 2ICWB 4NT6A 4NRZA 4LHUB 2O5YH 3IT8D 4ZUUA 5DFVD 3QFJD 2IAND 3HE6C 3LEXA 4EKXA 4JPIA 4K7PL 3RWJB 3TH2T 1G7LA 4MB4A 3EDJA 3BPOC 4G8EA 2XQYK 1UJ3A 4LSQH 4J6RH 1NCAH 4LQFH 5E0QA 1FZJB 3SKNB 3QIWB 2H8PA 2NY6C 4JQXA 4IEFB 4G9FA 4JQIH 4XPFL 4XNYH 5IHUL 1NL0H 1NUFA 4Z7QE 2BSED 4X6CE 4OM1L 3MRLA 4QTHA 3ZE1F 1UH3A 3VJ6A 1FC2D 4YUEH 4OKVB 3DX6B 2IQAB 3OKDB 1ITCA 1IEAB 5LCVH 4OI9A 3QCTL 2Z91B 2M1KA 3EAKA 4PJXA 1ZKAA 3L6FB 3PL6A 3VDCA 4EUPB 1W72B 3DV4B 4TNVF 4I2XB 4MNQD 4U33A 4YX2L 1G7IA 2AJ3B 1AGDB 3BH9B 4KDTA 1PX4A 4AQ1B 4J1UB 1I1FA 2QADD 3GB7A 2ZCKL 1CDCA 1XGUA 4J3UA 3W82A 3AXLA 1J18A 5GGVH 2YA1A 2ZOKB 5D2NC 4QRPD 3B6SA 1UACH 2XPGA 3RWHA 2FECI 5KAQF 4F7EA 5F89B 4KTDH 4NKOB 5I9QB 3RI5F 4RFNC 3X3GH 3RIFF 3DJ9A 4OD2B 5CJOH 3U30C 4FOMA 1D5ZB 3QRGH 4JHAH 1B4JL 5KG9A 1QSFB 4L8BA 4L8SA 3SCMC 1ZE3C 3U9UB 3GI8L 3PJSB 5SWQA 4U6XA 1KTLB 3QI9C 4S1RL 1BECA 5AAMA 5DHXB 1CF8L 3T4YB 3UX9B 3KR3L 1JGLH 4KK5D 1FNFA 4G3YH 3DVGA 4K7PY 3B2UC 4N90E 3LKSA 1AQKH 1CGYA 4HD9A 4OFPA 1NANI 1EFXA 4XT1C 1V3MA 2QSQA 3M1BA 2R2BB 4D9LH 3BDYL 3D3VE 3VRJB 3O2DH 3IGAB 1YEHH 3TESA 3HNSL 4HJGB 3ZYIA 1HINH 3SGDI 3P0YL 1VSCA 1ZHNA 3O4LB 1T0PB 5IKCB 3FOLA 1MCKA 3OGCA 5FGSA 3VGAC 1YY8A 4PB0H 1DBBH 2P8MB 4YR6B 5EIIB 1OD7A 4IDLA 1KIPB 3HZMB 3SDXB 4YWGL 3RTQA 4KRNA 5ILTH 1NBVH 2J12B 1EEZB 3GMMB 5LGKA 1D5IL 1CIUA 1F3DJ 3VXRD 4HZLA 4PRPA 1BM3H 3MLXL 5L0QC 3UROR 3IF1A 1YMHB 3G6AB 3JXAA 2HYMA 5CD3B 4KROC 2UZIH 3KYKL 3MNWB 5DJAA 1MAKA 2AJYH 1RIUH 2AEPH 1B2WH 3UTSB 4JFFA 3R1GH 2UYLB 4ZO7A 4OUUA 3B8SA 1OLZA 3OAYH 3WXVL 4Z78A 3GNML 1GGCH 3ZE1E 1OTSD 3VGDA 2Y36H 2HH0L 2R0LL 1PEZA 2IG2H 4I13B 4RRPA 4P2OC 2B5IC 3G6JB 3J8F7 2Y1VA 3SE3A 4JM4L 3VXQA 1G9ML 3U6RA 2F5AL 2EYRA 3U7WH 5T33H 4JJ5A 5JNYA 1QLFB 3L7EA 4ODWA 4I1NB 4D9QD 3CFKA 1MCHA 1UM5L 1TTGA 4JHWH 2JJSC 4FFWC 5CZVH 1HI6B 2X89D 3V6OA 4Q6IB 2EO1A 4UDTA 4POZC 5ISZA 2FEDD 4HGWB 2W0PA 2HLAA 2Z35B 3FRPA 4G5ZH 3TZVA 3KPOA 4PV8A 3QDGB 5DMYA 1C5DB 2JB6A 1X4YA 1DE4A 1PZ5A 2CKBA 1WZ1H 4PJGB 4CW1B 5IESH 1GGYA 1WCBA 3HUJB 4OF6A 1T2QL 5B39A 2R4RH 1M7DB 4W6WB 3B43A 4F9PA 2FX7L 3O6FC 4LGPB 1IARB 5IM7A 4ODSL 4JCLA 5C7XH 3CNKA 4OFYA 4GRLD 4FXGB 1HH6B 1BGXH 2JJTA 4IRSB 8CGTA 1EVTC 4HUVB 1CFQA 1PZUB 3RP1A 4N0CD 4I2XE 3QUYB 5LJYH 5E8NA 4DWHA 2OJZH 1FJ1A 4IRJD 4QF1A 2RR3A 2X6MA 3FN3A 3FZUC 3B8YA 4JDZB 4S1DC 5AG9A 5CJ8A 4DVRL 4IS6B 4URTB 4XP1H 1KJ3L 4FXLA 1QBMH 3L5IA 4R90H 1C5CH 3Q5YA 3RVVD 1FL5B 5JIPA 2BVPB 4A6YH 2LFGA 2R23B 4QYOB 1AJ7L 1XCTA 4PJGF 1LO3H 5EOTA 2ZSWB 3X14B 2Q7NA 3HUJF 2GSGB 3EJZD 4HUUA 5DHYB 4Z7WB 3BEVB 3WLWC 5B38B 1QSFE 1X4XA 5TPWL 5B22A 2LVCA 3OB8A 4I3GA 1A9EA 4XGZB 3TJHC 2MHAB 1CD8A 4PRIB 2DIJA 3A6OA 1KIUA 1ED3B 3BDXA 4FZEH 4OCRH 2QR0B 4CVUA 2I9TA 1U3HD 3VFWA 4HIEB 2NLJA 3T2QA 3CH1B 5J3HD 5BS0A 5FXCH 1HXMB 4Q6YA 5ERWA 4ZUWB 4LIQE 2DQGH 5AUMA 3QCVL 4CVWA 4KKLC 1S7TA 2E7LA 4W4OC 3O6ML 3K2MC 3LS5L 2VR5A 3HNVL 1ZSDB 4QO1A 1DTUA 2WP3T 3O4LE 1QPXA 4PGCB 5CEYA 4NQDB 2DLFL 2VLKD 4B50A 2GHWB 3QH3B 3VI4F 4D8PB 3ZYOA 1AI1H 1BVLB 1UWXK 2VDPL 2V5SA 1YPZF 2R9HD 4M1DL 2X4SA 4U7KA 1A3QA 5GRVL 3QJHB 3TYGL 4B41A 2QL1A 4G80A 2OMBA 2XZZA 1U8KA 3CMOH 4NN5B 2SEBB 2ESVA 1LO4L 4TNWK 5CINH 5EZJB 2UUDK 1UWEH 5CEXA 3WHE0 1MJJA 4XVJL 5DUBB 1Q72H 1N0XL 4EI5B 4E9LA 1F90L 1NC2A 2VZSA 2DQCH 3X13B 2Q8BH 3C8KA 4H1LG 4OBRA 4GG6B 3MV9D 2YA0A 1GIGH 1YY9C 2HVJB 2NY7H 1G7PA 4HG4K 4U2YA 3VXSA 4GS7C 1OD9A 5FV1L 4TULL 1WWCA 2IFGA 5DRNB 4H8WH 4Z9KB 1BP3B 4X99A 3MYZA 1IGTA 5A16A 1NCWH 3RIAF 32C2B 1IQWH 5TH2A 3QDJE 2H6PA 1A7QL 2J3SA 2GFBA 2F54D 2ATKB 3DETD 1AFVL 3SBWA 3OG4B 1Q94A 4QHUB 5EBGA 3OXSA 1UZ8A 3R0NA 1CE6B 2E3VA 4J3SA 5I8OL 4S11A 3QDGE 5JDSA 3DX9B 1S5IH 1T83A 4PJGE 4XNQA 1SBSH 3HUJE 4MA7L 3ARBB 4PP2B 4S2SB 3V4PL 3P77A 3QUZB 4K8RL 1YYML 4AEFA 2YD6A 4APQA 2OZ4H 4MCYA 2RFXB 3NA9H 5HXMA 2C3GA 5C0GA 5DURB 1EJOL 5EOCH 5C86A 4GT7A 3C09C 4OLYH 4ONHA 3PNWA 4D0BB 3BAEL 4AL8H 1RURH 1JNNL 4W68A 5HHNA 5KSUB 2Z8RA 3LV3A 3P9MB 3FFCA 5D7KE 4MD0A 2R1YB 4HQQL 3CUPB 3BT2H 2DWEA 4OZ4B 3MV11 2IC2A 3R4DA 3DMMD 1QPPA 3L3HB 4ZDHB 3FQUB 2VWEE 3G5XA 1DLFL 8FABB 1A14L 5D7IA 1CXHA 3BP5A 1PEWA 1F6FB 4OAWA 1KNOA 3EYUL 5IFJB 3VI4E 4WI6A 1YPZE 3P4MB 4HS8H 4PRIE 5TE4L 4M1CC 2HTLD 3PWPA 2D4FA 2FECL 3CZFB