3MFGB

Crystal structure of toxic shock syndrome toxin 1 (tsst-1) in complex with the human t cell receptor beta chain vbeta2.1 (ep-8)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
110
Chain Sequence
b'AVVSQHPSRVIVKSGTSVKIECRSLDFQATTMFWYRQFPSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSGFYICSALAGDTQYFGPGTRLTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin/immune system
total genus 28
structure length 110
sequence length 117
ec nomenclature
pdb deposition date 2010-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mfgB00
2NY0C 4JO1L 5K59F 5ESVB 5IVOA 2EH8L 2NX5A 1FO0A 5GGRA 2WM0A 3RNKA 4XVSH 3IETB 5EZOL 5F70A 5JW4R 5A1AA 1WEJH 4PBVC 5D1QD 1NJ9B 3RWFA 4RGOL 4AIZB 4HUXA 5EH1A 2A83B 1J9CT 1XR9A 2VISB 1C5DA 4PRIA 5CUSH 3IRPX 1FYHB 5BS0B 2ITCB 4GMTH 3BAEH 3O8XD 1JF6A 5GRVL 1WAAE 3BP4B 1OAXL 4NC1C 3N0PB 4QRRA 4KPHL 3O0RH 3T2NL 2Z4QB 4G9DB 3PWUB 3X14A 5F96L 3U7WL 1DBJL 2XTJC 3QPQD 1RUMH 1XF3B 3TP4A 4WUKH 4PJCE 3QDJE 3LSOA 2Z8VC 1AIFA 4OFIA 2DQDL 2FZ3A 2ICES 1QA9A 2MTPA 4PRID 4S11A 5IFJA 1YY8A 1ES0A 4UTBH 1NCAH 1GGCH 2HT3C 3BE1L 1NGYA 4R26L 1GZQA 4YE4H 4QRRD 1SEQH 3ET9F 2X4NB 2M26A 1G7LB 5I1AA 5IJVB 5JW3H 4TVSa 3PHSA 2PTVA 4PJGA 2YC1A 5T1MB 5HDBF 3NPSC 5FCUH 1MJ8H 3DX7A 5HHMD 1CLOH 3MSPA 1UWXK 1QSEE 4JFOA 3VXPB 5IB4B 3UC0H 1TDQA 4HIJB 3DARA 4TQEL 4Q9QL 4GAFB 1DBMH 2BJML 1S9YA 3LPWA 1K3ZA 4C55A 3IFNL 3QUKB 4WFHD 2WWKO 4GBXA 2PO6D 4BZ1L 1R6VA 3TA3A 1QYGL 3CZFA 4Y4KC 1Q0XL 2OZ4A 2HWZL 1YDPA 2J4WL 3L3HB 1C1EH 2BVPB 5BRZB 4WUUA 4NQSA 1F4WH 4LLVB 3TN0C 3HC3H 3MLZH 3O3EA 2AXFA 3ES6A 5FYKD 2ARJB 3V0VA 1J8KA 4H26A 4U1MB 5FO7B 2X40A 1BFTA 3BQUB 5I6XC 4ELMF 3ULSB 5IVNA 3W5MA 4NUJB 2QTEA 3JV6A 3HG1B 1UKQA 3PHQB 1NGXA 4WIQA 5EN2A 2DQCH 3GSUA 4LIQL 2XTLA 4YZFE 3KS0J 5FYLH 1N6QL 2GCYB 5EC2A 3HN3A 2Y1VA 5F1OB 3QCTL 1F4AA 2CLVA 4N1HB 4QOKB 4R8WL 3ARPA 5HVGB 4Z7WE 1EEZA 1KN4H 2JJVA 4OTXH 5KVDH 1YNKL 1A7QH 1ORSB 4M8QB 2JCCF 2KUTA 4AEIL 1CQKA 1A1MB 3A6OA 1F2QA 5BV7H 4KXZH 5EU6A 3GJFA 3L7FB 32C2B 4KMTH 2NY2D 1S9VA 1IGMH 5MHSE 4GKZB 1E27A 4HSQA 4ZNEE 3QWOB 3VFOA 4UINL 1PQZA 2YHGA 5D2LB 1MY7A 3GFUA 1FVEB 1MCRA 3UTQB 2AJVH 2N1KA 1YEFH 2N56A 5DK3A 2E5EA 2FX9H 4XNUL 5CINH 1BBJB 4ONOA 4Q9CA 1N6VA 4JHBA 3QB7C 3EZJB 4NN7B 1I9RH 5C2BL 3OAZH 1BREA 4HFUH 1OM3H 1TJHL 4AG4L 5EO0B 2NR6C 2GJ6A 4X4MA 4Y4FD 1CFSA 4MWFA 5DJAA 3V4UL 1HKLL 4L8SC 3GO1L 4U1SB 2DQTL 4MAYC 5GGSB 2O61A 1AE6H 1WGOA 5INDA 4O4YL 1ZHBA 3C6LB 3PXHA 2GSGB 1AD9B 4Y4HB 5KVMC 1PYWA 4G6FB 4TVPL 1V7MH 2FBJL 4X7CC 1JWUA 4JN2A 3GUTA 1JGDA 3MXVL 4J1UA 3JBG7 4H20H 4JG0L 3ZSSA 1YEDB 1ADQL 1HXMA 3LEVL 2F74B 3FHAA 3VXMA 1CGSH 9CGTA 1Z5LB 5HHPA 5EOCJ 3U7YH 4P9MH 5JHDB 3AXLB 4JFHE 3LKNB 1EAJA 1YMMA 1BWMA 5GISH 4LHJB 2BSSA 4OJFH 3PJSB 2FH6A 4NCC2 4EDXB 2VXQL 2X1PA 4XHQA 5CZXC 3ZLQC 5E2TH 5A3IC 1FLTX 2D3VA 2Z93B 1GZPB 3CSGA 3SQOH 1PLGH 2DJSA 1HHKA 3WJLC 4AK1A 2FD6H 4UOW1 4F58L 1INQA 4WI9A 3VXMD 3K2UH 2DQEL 5CIPH 1YNTB 5CCKH 5IEHB 1WCBB 3FO1B 3C9NB 3EUUA 4WCYH 4P9HL 2IFFL 4D94A 1LEKB 1TQCC 2YD8A 3OG4B 2UWEB 5F89B 1NBYA 1YEJL 3GNML 2YD3A 1VHPA 3GKWL 1RK0A 2GFBA 1UCTA 4M6OL 1OSZB 1FFRA 2RR3A 2WQRA 3KLAA 2NY3C 2NPLX 4JGMA 2CDEA 4JZJC 5I8CA 3DX8A 3HZKB 4WGVB 1BD2E 1HIMH 5KN5B 4BKLB 1QQDA 2I07B 3RI5K 4XH2A 3UYRH 1OQXA 5D7IE 4UAOC 4WY7H 3EOBA 2R56H 5D72L 2R0LH 3H2WA 1I9IH 5CD5C 3VI4E 3STZA 3BZEA 5FV2A 1QSFD 1G9MC 3VMOA 2Y07L 1A6VH 5FM4A 2I5YH 4HT1H 4PJIA 1ZA6B 3MRQA 2XQBL 4XPGH 1J8HB 5HI4C 4F7EB 2R23B 2C3VA 4OGXH 4R0LC 1MRDL 5HI5C 4R2GB 2P5WA 4X6FA 4DN3L 1OARH 5LBSH 4OIIH 3OKDB 1I8MB 1DE4A 4QEGA 4XVJH 1FNEB 4IEFB 3T2QA 3RKDC 5CHNA 1KYOJ 1FFPA 3MOAL 4YHOH 5F3HB 1G9EA 3TC9A 3VMPA 3CCHB 5SWSB 1M4KA 4OF6A 1EGJH 3PGDA 4PV8B 5CJQH 4Y7MA 2HKHL 2WIIB 4JKLA 1BZ9A 2VTFA 3RTQB 5IGXH 5D7JD 5L88H 1JMXA 1AD0B 3MRPA 3IDGB 2HJKA 5DJYA 3V6ZA 3DVIA 4Z0BL 3ARBA 3LMJH 4LSDA 3GSNL 4OCXH 1WQVT 2NMSA 4MJ6B 5DI8A 5D7KE 1LDSA 1EO8H 3DHJA 5GRUH 5T1LA 1U8PB 4L4TB 1HHJB 4FFVC 1XCTB 2MQ3A 1HHHB 2H26B 1OAKH 3O2DL 4NSKA 3RWEB 1P6AB 3MRKB 3RL2B 3CZJA 4G6ML 5ALCL 1I7UA 2QSTA 3BDYH 1U8QA 4HZLA 4HAGA 2XT1B 1JPGB 5SV4A 4JFDA 4L8CB 1R24B 5F7WC 1Y0LB 2L4OA 3KLDA 4RRPA 4W6WB 2GYSA 4JPVH 5TQ0H 1RK1A 2YBRA 3B8SA 5C0IB 1P4LB 4N8VB 3LKPB 4HF5L 3U4EA 4J4PA 1PG7X 3O2VH 4E0RB 4JVUA 3SPVB 3A67L 2A6KB 3BDXA 1RIVL 2OK0H 3OKOB 5HVHB 5KS9A 4IBLT 4K7PH 3KVQA 4ESKA 5DRNB 4WW1B 2EXWC 4TN9A 1U41A 4W4NA 2XN9B 3KXFA 5SX4H 4OB5H 1QO3B 2VZTA 3QA3A 1H3PL 1BJ1H 5BS0E 1KJ2B 3GBML 3ZE2F 4WWKB 5L7XL 3ZDYF 2X9WA 5EPMA 3R8BB 4GG6A 1FFNB 5E8OA 5DMJB 3GMQB 2R9HC 2VERN 4J4PD 4M1DL 3OR6B 1NEZG 2AV7B 3CFCH 3W2DL 5CGYD 2HJFB 4LKXA 5IHZB 1G7HB 1XGYH 2QADB 4YHKH 5DRZB 3S37L 2HVJA 1MIML 1BGXH 1T2QH 2HKFH 3WL9B 1GIGL 4JFZL 4X99B 1U8IB 2IMNA 3HC0B 2OQJA 3NCJL 5DYOA 3ULUC 2BNQA 4KVNH 1YPZA 1J0YA 3FMGH 1I85A 4P3DA 4PBWD 4AENB 1EVTC 1CCZA 2FBOJ 2OSLB 1JNLH 3HPJB 2VJXA 4JM4H 5BXFA 4FXLA 2HLAA 4HIHB 4MVBD 3F7QA 4LVHB 3MRRA 3LZFH 3MLRH 5TQ2H 2NZ9D 4HPYH 4MQSB 3BD5A 3BEWB 4QXGH 5F1IB 1BAFL 2YPVL 2W65A 4HLZG 3SOBL 5C92A 4ODBD 5E95B 4BSWA 4JLRA 2BNRB 2QQLL 3C5ZD 4JY5H 1RMFL 1NEZB 1LVEA 1JYXA 5I1IL 3MBEA 4JO2H 4CUCA 3TM6A 4WHTA 3T4AB 1UH4A 4YO0B 2ESVB 3NFPA 2F8OA 4OF5A 1OGAB 4RNRA 1ZV5A 5BRZE 3VJ6B 4HXAL 3QWQB 4YHMH 2AABL 3DJ9A 5DUMH 4YQXH 1IC4L 2WLYA 4A6YB 5FA3B 4ZO6A 3QBTB 2VH5L 2HLFC 3HE6B 1X5AA 1KTDA 3HG1E 1TZGL 2OCFD 1YN6A 5SX4I 3QDGB 1S9XA 3DGCR 4O2CB 4EIGB 1PKQA 1FGVL 1KB5L 4FQXA 4R4ND 2VC2H 3W0WD 4LFHG 4UQ3B 3GBLA 3L3DA 4QOKE 4YWGL 5T3XL 2R0KH 3SDCC 2J7LA 5DVKA 4CJ0A 1QSZA 2P46B 5F1KC 3O41A 1XIWD 2XFXB 3Q6GL 4N0YH 1ZHLA 5FUZL 1S3KL 2WBJD 4Q97A 4NZUH 1KXTB 4HKBA 4FQXD 2PYEB 2C4XA 1CS6A 2PW2A 2R29L 1YA5A 5FYLD 1GRWA 4LCWD 4XP4H 1VDGA 4HFWA 4PJAB 5IHBA 1ZK9A 3P30H 4PJDA 3PWJB 1K4CB 5D2LE 5FXCH 1MCPH 3AS0A 4F7PA 5I2IB 3AB0C 4KV5E 1Z3GL 1ZHNB 2IPKA 5DJ0A 4G8IB 4M7ZC 3V95A 4CVXB 4GAGL 4OAWA 2EDDA 2CKBA 1AI1L 1G1YA 4D2NA 4G6KL 1GJIA 4OQ1A 3A6BL 4ZAKC 4X7SH 5C0JA 1IARB 1AGBB 5T33L 3DX9B 4LSUH 2CH8A 5I75B 1YYLL 1WAAA 3TBTB 2P43B 1T21B 1FNSH 1WBZA 4UV7H 4PJHA 1CDCA 1I1AC 1J18A 4OF3A 1KEMH 1NDMA 5HSFA 4ZO9A 5E08H 1GAFL 4JFXB 3QDJA 5CSZB 1J7VR 2D9CA 1KACB 3RGVC 3SGJC 4RX4D 3VGAB 3TNMA 1EHXA 2Q7YA 3ZKXC 1UCBL 2QQNH 4I8DA 3ZTJG 5GXBB 2R4SH 3G6AA 5F3BA 4EJ1C 5ILTH 2R2HA 3QFJB 4B7LA 1KELL 2P4AB 4Y16B 3IU3B 3HZYB 1P4IL 3NIGE 3LOWA 5JHDE 3SKJH 1UVQB 5D1ZB 4ZO8A 1I4FA 3UAJC 4LPYA 1M7DA 5DGRA 1KIUA 2NY5C 4P4RA 5H35B 3BP7A 2BNUB 3QDJD 3DO3A 1D6VH 2X4SB 1X4ZA 1II4E 3DOSA 3T4YA 2PYFA 3C2AH 3OAUL 4Z95H 1RVFH 4RAVB 3Q1SL 3KYKH 1N7MH 3WDIA 2HG5B 2F5AH 2B1HH 1ZEAH 3ZKNC 2FNBA 2W0KA 3GGWB 1CL7L 2XZCH 2EDLA 4RAHA 1DJSA 2GK2A 1A4JB 4I4WA 2X1WL 3QIBA 1JRHL 5CIPA 4K3DH 5DSCA 4QRTB 2DKSA 2UWEE 4NWUL 1CZ8H 2WANA 4JM2B 1WSST 3WV0A 1FVDA 3U4BL 3VXTA 4HUVB 1QSED 1F3JB 3ZMRA 1ZMYA 1CDHA 2Y5TB 1R5VB 2JIXB 3BIAX 3BJLA 3KPTA 4NQDB 2X1QA 3QQ3A 3MJ8B 4KUCF 5J6HA 4PRAB 3ARDC 3V5DB 1N3NB 2RQ8A 4J3WA 4RFNC 1E4WH 4ZMAT 1U8OA 5J89A 1Q94A 1ORQB 1FNGB 5CZVH 4JHWH 5EBWB 2YMXH 2XTJB 3NFNA 3OG6B 4UI2A 3LKQB 4WI3A 1J8HE 2QHRH 3ETBF 5IVXB 2YD7A 3DMMA 1LO5B 3QNYA 1WBYB 1DP0A 1A64A 3VFGL 3AU1B 1UM5L 2C3GA 2FB4L 2A9NH 3NH7L 1S7SB 2LU7A 3BEVA 4RWYL 5FHBH 2ID5A 5SWSE 2GSIB 3F7VA 5TFSL 5GJSH 5AG9A 5KANG 3V4PL 3RZCC 3OAYK 4P57B 1MCKA 3NPSB 1N5YH 1OY3B 1DUYA 3RGHA 5IB3A 1G7IB 4PRDB 2DLFL 3QO1B 4MS8C 3GRWL 3DSFL 2B4CL 4J3SA 3MA7A 1EVUA 1GYAA 3FFDA 1GC1H 4L4TE 2JTDA 5LJYH 4MD5A 1NBZA 1RD6A 5C7XH 5TE7L 5C09B 4JKKA 3ZKMD 2C3XA 1OAZL 4HJGA 4RA0C 3B9AA 1LE9B 3JWOH 5MHSD 2GJZB 3H0TA 4LPWA 3QIWC 3FJTA 5DQDH 3QXDB 4WFGE 1D5IL 3FB7B 4WW2C 4NRYA 3Q6FA 2FJGA 1RSFA 5F1NB 2R4RH 4BH8B 2FX8L 1XR8B 3O3AA 1NKOA 4P23A 1ZS8A 4ZDHA 4M9OA 4CVZB 1T1WA 2ZKHL 5ADPL 5I6XB 4JPWH 4LEOB 2JE8A 4KK8C 5KVFH 1M1SA 4PYHA 5KTEH 2HT2C 3TBYA 5BO1L 5BMFL 2XN9E 1TJGH 4DUWA 1R3HB 1JGVL 4DFHA 1CD9B 5H94B 4HG4J 3BRFA 1QVOA 2D2OA 4X6BB 1E4KA 3ARFC 1UB6B 2WAHA 4ONHA 1S7RB 4X9BA 4HEME 4QNPF 3T3ME 3GSOB 3MV8B 3BO8B 1LO4H 1ND0B 4OZHA 1OCWH 4CDGC 3H42L 1P4BL 4RDQG 4HUUB 4XB7A 4IRJC 1BZQK 3IDIA 5C07E 3O4LA 1I75A 5IFHH 4XWOC 3RBGA 5SWQB 3EJZD 1Z9MA 4HUMB 1ZLSL 4A2MA 3NFSH 1NCCH 4NQCB 4PUBH 1FAIH 1VADA 4M7LT 4KROD 3D0LA 5F9OL 4KUZH 4MQ7A 2VWEC 4P5MA 1CG9A 5IKCB 4LVOC 1K5NB 4PRHA 4JFHD 1E6JL 4S1DC 1J0KA 4APQC 5HYQB 2R1WA 3DYMA 3SDXF 1G6RL 3EYUL 3IXTB 5JW4M 1QOKA 4W70A 2NXYD 1B6DA 5GS0C 2BNRE 4NO0A 3KPNA 5BZDA 2WLZA 3LKSA 1OTUC 3LV3B 3V5KB 3MUY1 3DRQA 3QO0A 3UTZA 3VFTA 4FQLL 4Q7DA 1NLDH 3EO0B 3EAKA 1DDHA 35C8L 1UENA 2CD0A 4MAYB 1BM3L 3RWHA 4PP1C 1RZ8A 4JGUA 3VFUA 2ESVE 3RA7L 4TUOA 1U8MA 2CMRL 2DKMA 3QI9D 2JK5B 3R1GH 4OQTL 1U8HA 1G0DA 1OGAE 3ROLB 1EFQA 1EPFA 2X4PB 4PJ9A 5IV2B 2NY4C 4LDEB 4NO0D 4KC3B 3RX5A 3ESVF 2EDJA 3MUGA 1IKNC 3B2UC 1DBKL 1XH3A 2CPCA 2IH1A 4L8DA 2A1WH 3BZ4A 1IAIL 4FFYL 2ADFL 5CLWA 5DEFB 1BD2D 1J1XL 1RZJH 1KC5H 4YHIB 4RQQB 2J8UF 3CVIL 2Q20A 3V6OE 5E6IA 2WBKA 4IMLA 5T3ZE 3QH3A 4HJ0D 1MRCH 3QDGE 4XXDB 1RUPL 3UP1A 4PJ7B 1AFVL 5DJXA 2X7LB 3T04D 1NCWH 1BJMA 2G2RA 3DHMA 3X11A 4X5XB 4ZFOL 3CLFH 5AD0B 4KWUA 4GS7C 4Q2ZA 2OP4H 1OTSC 3D1MC 2V17L 4U1NA 5I8KL 1B0RB 4MNHA 4EBQH 2FJHA 2RBLA 5C6TL 5I8EA 3OPZL 1BX2A 1YN7B 3IDMA 2X89A 1RZKL 3QZWG 1ZSDA 4KK5D 4WO4D 4Y2DC 1V3MA 5E6ID 5LGHL 4BELD 2OL3A 3A6CH 4IHOA 1W72L 2PYEE 4IS6A 1R3JB 3KYMB 1TQCB 1L9MA 4KRMB 4P48A 3DXAA 1AQDB 4PJAE 3RWGA 4F37K 2A6IB 2X44D 3N50A 2NY3B 2XRAL 5GGVH 4KJWC 5ESVA 4XPTL 4JZJB 4Z7OF 3IETA 5D7KD 3MLTB 3L1OH 3WFCH 2ENSA 2N4IA 1IM9D 2R1XB 3BGMB 3M1BA 3L9RA 1MF2L 1FGNH 4NHCH 1UADC 1FL6B 3VFWA 2LQRA 1C12A 4EN3D 4NHUB 5EUOF 2V5MA 1RPQA 1L7IL 3BW9B 2HP4A 4X6EB 1NCBL 4IMKA 5ALBL 3CVHA 1T5WB 3H3PL 4NRXB 4B7IA 1KJ2H 5IR1B 1K2DB 4FFWC 2CDGA 5E8PA 2IADB 2ITCA 5IESL 2IGFH 4R0LB 4K94H 1AGDB 5IFAL 2V2XA 5JUEH 5IB1A 4PGBA 5D6DC 4I13B 1XF3A 2J6EH 2IH3B 4OLYL 3K3QA 5AEAA 3IJHA 1N59B 3UTSA 1HH6A 3BFOA 4XX1G 4PREB 5BS0D 3ROOA 4XNYH 4QHLA 2Q8BH 4CW1A 3QFJE 4PS4L 5C0GA 5DTFA 3NOIA 3FRPG 1VPOL 4KJYA 5IJVA 3O6MH 3REWB 1FSKC 1VEPA 4M62L 1MCEA 1ZVSB 5B4MC 3T1FA 4KKLC 4NO3A 1A02N 4YHLH 2UYLB 3VXPA 2AP2A 4EI5B 1NDGA 4TTDC 1MY5A 4KHTL 3Q5YA 3SKMA 3EDEA 1O7VA 4XRCA 5IBUB 5M7QA 4P2OA 5EOQL 3DURB 2V7NA 2IPUG 4GG8B 4ODVL 4DGYL 3R8QA 2LABA 3O6FA 1UZ6F 3RIAF 4JANA 2DQJL 4D3CH 4HDIB 4M7LL 3MLUH 5I30H 1UM4L 1ED3B 1RFDL 5GSVA 3FT2B 1M05B 4UIKL 3QEQA 4QO1A 4NQDE 1H0DB 4HQQL 2BMKA 1ZLVK 3GJEB 4X7TB 3BMVA 4U1MA 3WJJC 5C0FA 2EO1A 1UACH 3B2VL 2JJUA 4NC1E 4G8GB 3HG1A 5E2VL 3DBXA 4GW5A 4HLZH 1WZ1L 4W68A 3PHQA 4OM1H 5T3ZH 2RIKA 1FIGL 4OGAC 2PNDA 5C0AB 2XTJE 1PZUB 4H8WC 1F58L 3SDAA 5BRZD 3QAZC 3AY4C 4PY8I 4WDIB 4MZ2A 5IVXE 4YC2C 1VFOA 4QOKA 4RMQA 1KN2H 1VENA 3SE9L 3C09B 4FNLH 4KJQC 1NCDL 3QIUA 3I3EA 3BQUD 4TSCH 2OTUB 2AEPL 1ORSA 5D1XC 4FQHB 3HG1D 3QP3A 4XCCH 5HVFB 3VRIA 3TNNA 3NA9H 5IHLB 5JQ6H 4XCYB 4HH9B 3L7FA 32C2A 4OD2B 3OZ9L 1LO0H 1EO7A 2QV2A 4MB3A 1IE5A 1CWVA 2G5BB 1EZVX 2E7LC 4QOKD 1I7RB 2ZUXA 4L4VB 1ONQB 3L6FB 5C0ND 3N1GC 3E6FA 5C9KA 1VACB 1Z6JT 3V4VL 1FVEA 1UH2A 3WSQL 2ADIA 4MQTB 4Z5RB 5C09E 3QNXB 5HYFA 5IB5B 4MAUL 1ZT7B 1C8PA 4HCRL 4JPIA 1WC7B 4MD4B 4UTAH 3LEYL 1NMCC 5EO0A 3QHFL 5CGMA 5C86A 1UQSA 1MWAL 3GMMB 1G7PB 2IBBA 3J8F7 5CSBA 5B38A 5KSBB 4WI4A 1HSAB 5I1LB 3VRJB 3SCMB 4QHMA 3EYFA 3SKUD 5EG6C 3BKCL 2D7OA 3GSQB 1BIIB 2JELL 3O9WC 4DKEL 4WRLA 1NGPL 3AVEA 3FB5B 5FUCE 3QUYB 4ZUTA 1P7QA 2AEQL 4PLJC 5DJ8B 3EYSL 4MXWH 1LNUA 1G6VK 3O6LL 1HI6A 3I84A 3B8YA 1FC1A 1AD9A 1YY9D 5CZKA 5CBAB 3CXHJ 5JXEC 4LGSB 3ZHKA 3EGSA 3AC0A 4M43H 1MFEL 1HQRB 3MV8E 1MHHB 4M00A 1BFOB 3GI9H 3K1DA 4QRQB 3SDCB 2R8SH 3VWJC 2CIKB 43CAB 5J6GA 1MFDH 1DQDL 1S7XA 4G8FB 1IGFL 5DFTA 3VXUB 3C6LD 3LKNA 4LSSL 5E00B 4CMMB 5JOPE 3VCLB 4TNWF 1KOAA 4EDXA 1A7PL 4Y4HD 4G6FD 1S7QA 4MD0B 1Q8MA 3VXNA 4NQCE 2APBA 5BOZG 3PGCA 5ISZB 3NCCB 5LG1A 1DQMH 3B9EA 5GRVK 1FH5L 4OLZL 3DRTB 2J8HA 1YNTA 1FJ1B 1MFBH 4FTVB 1WCBA 4DZBB 3H7LA 3QPQC 3G6DH 1CIDA 5IK3A 3H9YA 5F6IC 5JHDD 1LEKA 4CRPA 2H6PB 4G6JH 2UWEA 1WJ3A 5F89A 5A2KH 4O2FA 3EO9L 5A16A 4U0RC 2ZP0T 3SKOB 2V2WA 5FO9A 3OJ2C 3ZTJH 4KTEH 3WFHB 4ZAKB 4LSQH 4G6AD 4ZG1A 3OXSA 1OTTD 1ACZA 5C9JB 2UZYB 2RHEA 4NJ9L 3VXOA 3QCVL 3C60A 1Y18B 3I6GA 5H2BA 1CTNA 1X44A 3GMPB 1EAPA 3LQMA 3KNBB 3OXRB 1BMGA 1IGYB 4LMQE 1AP2B 3GSRB 4Y0GA 2YRZA 4OCYH 3SHSA 3U9PH 2X1OA 4OZGB 3KPMB 1H3TA 1G7JA 1I1AB 4X4YB 5CJ8A 2DM3A 3BP5B 3OAYH 5MENB 4F7EA 3AAZB 1UEMA 5JR1L 3FL7A 1EBPA 1T80A 3RGVB 4X6DF 5HJ3B 1RJCA 4NQXA 4OKVA 3RJQB 2VSCA 3ZKXB 4C83B 3OKDA 2DBLH 3F5WB 4FHBD 5HGDB 2GIYA 4F80A 2EXYD 1IGCL 2D03H 1L0QA 4WVRA 1CK0H 3VA6A 4H25A 3HC4L 4JY4B 1V7NL 4PJ7E 4DWHA 3SE8L 4OFVA 4LL9A 1KJVB 1HE7A 4KTDH 2G5RA 3IDGA 1U8JB 4CKVX 1MPAH 1J8HD 2VDOH 3I50H 4NO2B 3RY6A 4YDJA 1RJYA 2FSEA 3BRDA 4R2GD 1VGEL 3HS0B 4GBXC 3MJ7A 3VI3E 3T65B 3TA3C 1CGTA 4N0CD 2CIIB 1HILB 1HHJA 5C3LD 3KGRA 5SWSD 3WN5A 1LHZA 1NCUA 4I48A 3S36H 5JORB 3IKCB 3JTSB 1XF5B 2VQ1B 5DD5L 1K4DB 3RWEA 3MRKA 3RTQD 1YQVL 1U58B 1E28B 5SWZB 1KCKA 2HTKD 3G08A 1U8NA 1KCSH 4V1DA 1G7QB 4JFYA 2E7HA 2ICWI 1LK2A 2XKSA 5JHLL 4OLVH 5FB8A 4HIXH 4KAQH 5C0IA 4N8VA 2VR5A 4L4TD 3ARDB 1OD7A 4GKSB 4RIRB 2WUBH 3MCLL 2OR8A 2EEAA 5D5MB 1MSPA 2XY1A 5ID0B 2HFTA 3OKOA 4RFNB 1IGIH 5DFVD 4YR6A 2P47B 2VDLL 2R2EB 5DRNA 4IIQA 4AT6B 5JZ7D 2H3NA 4WFGD 4LLYB 2ATPB 1FNAA 2XY2A 3VXQA 5IB2A 1MJJB 1DFBL 4XVUD 4XP9L 2AERT 5FHAH 1U8LB 2XZQL 4FXGB 4ZFGL 3GMQA 1NFIA 1TVBB 1S5IL 2X4UB 12E8H 1A0QL 1D5MB 1Q9LB 3NABH 4X5LA 5IHZA 4NIKB 5DRZA 1CL7I 2V2TA 4OT1H 5CP7A 4EOWH 3WL9A 2XN9D 4X99A 2Z35A 1U8IA 4M4PA 3BPLB 3RZCB 3P9MB 5AYUH 3HC0A 5DFWH 1QR1B 4R4BB 4WWKD 1GL4B 4HK0B 3K46A 2DQIL 2PETA 3O2WH 2OSLA 2UVEA 3CXHK 2QADD 4HD9A 5HHQA 1NSNH 4GFTB 4EDWH 4AM0B 4MNQA 1BOYA 5C07D 3S9DB 4PP2B 2AJSL 3MACH 1BZ7B 1QEWB 2DJ4A 3THML 3KPRA 3X3FL 2D7TH 5I1HH 5BZWA 4LCYA 3QIWB 4PJFB 3IU4L 3I6KB 4MHHG 1QUNA 4WW2B 2E9IA 2J3SA 2WINA 2EDHA 3UTOA 1WITA 3ZT5A 3KJ6L 1QBAA 2IG2H 3GDBA 5E2WL 5I1DB 3MOBH 1CDYA 2HTLC 1QLRB 4U1JA 4G42B 1UJ3A 3JTTB 4BQCA 3LRSA 5KW9H 1BIHA 1HNGA 4NKDB 5MERA 1R3LA 4MJ5B 4OZIB 2C4FT 4OCNC 2BNRD 4U1IB 5FCSH 3PGFL 1FCGA 3DYOA 5KANI 1FFQA 4IRZL 2APVA 2QSCH 3ARFB 5FUOL 3S35H 3MLSL 3QXUA 1U2CA 2VXUL 2VZ1A 1SMOA 5T1DH 3JSSA 2XQYK 4G8GE 3CIQA 3QHZH 5DVNA 1AR1D 5I1KL 3BJ91 2ESVD 4Q9BA 1SM3H 4FABH 3L5WA 2AEIT 1OWWA 3FN9A 1DLHB 2DLIA 5HGBB 2DWDB 3QDGA 5C0AE 5F71A 4IRJB 4OV5B 1OGAD 5EIIA 2AJ3B 3TWCL 2DI8A 2C1PA 4LSVL 4QXUH 5J57B 4XC1L 3MRLA 4UB0H 3RDTB 4HWZA 1UA6H 3N1PC 4U6YB 3ULUE 4L1HA 4Y5XC 2AK1H 3HE6D 3ARZA 3NPZB 4IOFC 3CSBA 4YHNA 5E7FA 1VEMA 2XFXA 3FB8B 1FZMB 2ZPKL 3QPXH 4ZUUA 5T3ZD 3QDGD 3MV01 4S1SH 4F33B 4LVOB 4APQB 1JHTB 1HEZB 5D70L 2XWBB 4L4VE 4BUGA 4PR5A 1ROWA 5D96C 2YEZA 5JDJA 3HUJA 4QHKI 1FPTL 4Y5VC 2JF1A 1ZHNA 43C9B 4KRLB 5EO9B 1BQSA 4QXWA 4N0FB 4CVXA 4LCCB 1RULH 1SBSL 5HYJA 4Q6YA 2AI0L 3OKKA 5DD0L 4QTIL 4XMLL 1HDMA 1MVFA 2PYED 3U1SH 4YXKL 1JHKH 3KPSA 3KPQA 1CXLA 1IGJA 4QT5B 5B39A 1MJUL 4P2YA 2NY4B 3H6JA 5KSBE 4ETQA 1NFDB 4LDOB 3T3PE 2IANA 4ZPTB 1NBVL 3RIFK 1I8LC 1AXTL 4OZ4A 3G5VB 3TPUB 3X3GH 2KZ1B 4QRPB 5JDSB 2IQAA 1JPST 1JVKA 3TBTA 3TBSA 4HC1L 1MREL 3MGOB 4JVPA 4Q0XL 1NPUA 4ZS7L 1K8IA 3RAJL 3BWUC 3N9GH 2EKSB 4U3CA 4PGEA 3K4AA 2VLJA 3ARBC 4JFXA 5CSZA 4U6HA 2JLLA 4KGLA 4LLUA 4BA8A 1YYML 4OCSH 5ICZA 1XGPA 2ICWJ 2XG5A 5C8JA 5JPMB 4LHUB 1DVFB 4N8CH 1P6FA 1QFWL 2DAVA 2ERJC 1K6QL 3FN0H 3L3JB 4FZ8H 1MNUH 4P3WA 2MSPA 4M02A 3HZYA 3IAGC 4Y19B 1TNMA 5D1ZA 4LPVA 3VXUE 3S97C 1XCQA 2ZOLB 4Y2DB 1I3GH 4G8EB 5DR5L 1T20A 3MREB 1D5ZA 5E0QA 1XF1A 2X4SA 5L2JB 2QQQA 4L3CB 4PGDB 3B5GA 5GRXG 4F7MA 3BT2L 5ISZE 2EC9T 3OMZA 3G6JB 3P2TA 4QTHB 1UXSB 5EU3B 2EH7H 3I9GL 4J4PC 4NKIL 4EUPG 1H3XA 1I3RB 4FQJL 4GKOA 3GGWA 3QFJD 1K85A 4FTVE 4Y16D 1YMHB 5TPWH 1OQOA 5D1ZD 5IQ9A 3SDYL 4JRWA 2D31B 5LQBH 4QRTA 1I9JH 3FT4B 5DUBA 3HAEA 4JM2A 1RJZA 3VDAA 2IBZX 4P2RA 4ODUB 5GSRA 2Y5TA 1BFVL 1OGTB 1P2CA 2CDFB 3L3GA 3VFSB 4CGTA 1TETH 1KEGL 2ADGB 5IMKA 4PRAA 1D5BA 3WD5L 1N3NA 4PJ8A 2O93L 4O2EB 3B4NA 1FV1B 1MOEA 4V2BA 4OI9A 5DGQA 2CK0H 4OZGE 2ICCA 4JM2D 1FNGA 3UTTA 2ED9A 2F19H 5K9JL 4X8XA 4LK4A 5MENE 4JRYA 4KK9C 2COQA 1I85C 2JIXD 4NQDD 4U1LB 5JW4Q 1LO5A 2W9EH 2H1PL 1WBYA 2FEEI 3ULUH 3HRZB 4IOIA 2J5LC 5IHUL 3F58L 3AU1A 5TDNB 4HUWB 3GM0A 3QEGH 3VGDA 3MRCA 2GUOA 1S7SA 5E6ZA 1T0MB 2GSIA 1CLYL 5CSGA 4YUEL 1FSKB 5C0EB 2YZ1A 2XTJD 1J05A 4P57A 5LAXA 3BIBX 3LN5B 2EDWA 4FQPA 3MBEC 4PJBB 1G7IA 3B6SB 5DJ2B 3QO1A 2HFFB 3MNWA 4BSVA 3AMKA 5EBMB 2EE6A 3RU8L 1W2KT 1INEH 4ODTL 4U2ZA 2HT3D 4RFOH 3BUYB 1IRAY 1FYTB 4P46B 5CILL 4ZQKB 5DLML 3QUXA 4R4NC 1KCUH 4YX2L 5SWZE 2GJZA 7FABH 2YD1A 4MDJA 1KPUB 3NCEB 1IAOB 4S0TD 1SVCP 3BKYL 1V8HA 4H88H 2A6DA 3MRIB 5CD3A 3RVTC 5AUMA 3V5HB 5ETUB 3X13B 2APTA 3BP6A 3QT2A 2UV3A 3L3IB 4XMKH 2MCPH 3MFFA 5C09D 5D5ME 4RGMC 4FQXC 4LEOA 4YXHH 2AJXH 1NAKH 1TVDA 1CVRA 4QXTA 4CADA 1R3HA 5GS1B 4X6BA 2BOBB 1UB6A 3VH8G 3QAZB 4PJEB 3CU7A 5CJBA 1ZLUK 4LOUD 1S7RA 5DMKA 5TF1L 4LCUA 3GSOA 3G04A 3DTXA 4K7PY 3QDMA 4QHKJ 3X12B 4XP1H 3ZKQD 3BO8A 5BV7C 3MJ9L 4KPHH 3DV4A 2CO7B 4H1LA 4HUUA 2OJZL 5KVGL 3KWWB 5D1XB 8CGTA 4U6XA 4XAWL 3C5JA 3OJDB 1JGLH 2YKLH 3ARGA 3KR3L 5L6YL 1HINL 2DQDH 2V7HB 2FL5A 1WZMA 1M7IB 4Z7QE 1PSKL 2ZJSH 1EFXB 1JPSL 5L8JB 5GS2H 1NC2B 1FRGH 2RCSH 4K8RL 3MV8D 4TRPH 1KJ3L 1HHIA 1Q9WB 3HZVA 5FYJL 2P8PA 5E4EB 5FKPB 2WWKT 2CR6A 2YPKB 1TNNA 3N1FC 5DUPH 1XGUA 1K5NA 1Q0YH 1RZGB 4NNPL 2Z31B 3BSZH 5JOPD 1H3UA 5HYQA 5I16B 4G7VH 3IXTA 3NIFE 2YK1H 3DO7B 1C5CH 3PIQA 3GHEL 4PJFE 1GGBL 3P0VH 2D7PA 5DQJA 4NQCD 1NMCB 2CUMA 4TYUA 3HFMH 4Q9QH 2VITB 1QTYT 3EO0A 3B9VA 3T0DA 3MRJB 2EYRB 5I66B 3HCVB 5I15L 2DIJA 1VKXA 1VGKB 1QYGH 2DD8H 3O9WB 1A7OH 1GSMA 3HI1B 2HWZH 3ROLA 4OZIE 3K8MA 3AFLA 4D9LH 1SYVB 2NR6D 3FO9B 5DEFA 1TPXC 5ICXB 2FX7L 2P8MB 2BFVH 1WWBX 4MAYD 1KB9K 1QLFA 1B88A 2HFGH 3PQYB 3VWJB 1T04B 4X4ZA 2X5PA 1MCIA 3F7YA 3IFOB 3IKKA 4HIEB 4JAMB 2NY5H 2ZUYA 4LIQH 1DLFH 4XXCA 1JYNA 5JIHA 5AD0A 1Q72H 5A2FA 3QUMA 3WXWL 5GHWH 1B0RA 4UV4H 2NX5B 5GGRB 1FO0B 3RNKB 3QIBC 3NAAL 1GGYA 1RU9H 3UEZA 3S36X 1YNKH 4U33A 5L9DH 1YN7A 2LFGA 5DHXB 4NFCA 3CX5K 4PB0H 1QBML 4Z9KB 5F6IB 4HJJH 1BEYL 1UWGH 4HUXB 3WCYA 2FH8A 4R4FH 4FP8H 1XR9B 1X5ZA 5C0CB 4WHYH 4U0RB 3OSKA 3T0AA 3BZFA 4XMPH 1DUZA 5A3ID 3O45A 1FAKT 3TH2T 2R1YA 3MRGA 4IDLA 2R1XA 5FYKL 3UXFA 3X14B 1BQLL 1FL6A 3ULVC 4CNIA 1UFUA 4UILH 1TCMA 3LSOB 1AJ7L 4NHUA 4ZTOL 3LEXA 5BQ7B 1AIFB 3DMMC 1Z0NA 1QA9B 4DVRL 1T5WA 2VDKL 2OR7A 5IFJB 1YEIL 2GTZA 3Q5OA 4DN4L 1NFDE 4PY7A 5IR1A 1YY8B 1ES0B 2NY3D 1CLZH 3C08L 1NGYB 4LPTA 1HKLH 1GZQB 4O5LL 2DQTH 4JRXA 3H9ZA 3TESA 2NQCA 5I1AB 4B41A 4OCWL 2ZG3A 2ZUSA 4PJGB 2GW5A 2YC1B 4DVBA 5IROA 2O5ZH 3VD4A 5DC9B 3DX7B 4I5BB 3GSXA 2EEBA 3OJMB 4TSAL 2FATH 5CD5D 2Y36H 1QD0A 3GHBH 4GH7B 3MPCA 3RVWC 3ZSTA 3LRGA 1AC6A 5HI4D 3MXVH 1S9YB 2VDQL 2FR4A 5HI5D 1ADQH 4GBXB 4JFQA 4Y19E 3TA3B 4FXKA 3CZFB 4UBDD 3KYOB 1U92B 2VXSL 4LDLB 5DT1L 5HHXH 1A3RH 1JF5A 1YDPB 5I1JL 4IM8A 4EZMA 1X5LA 1P53A 2I60L 2O5XL 4WUUB 2EIEA 4NQSB 3G6JE 4P23C 1NMAH 3O3EB 1DANU 4EI5A 4NJAH 4KHXH 1LO3H 2AXFB 4JEGB 3ES6B 4PLKC 5D2NA 4H26B 4FFZL 3E2HC 1WAAF 2VB5A 5I1EH 1CFVH 3FO2B 3DSNA 4K2UL 3JV6B 3FT3A 1SJXA 2ED7A 4HS3A 2RAMA 5EZIH 4P9HH 1NGXB 1IAIM 4Z7VB 3GSUB 4J23A 4PJCF 1E4KC 3K8LA 5J3HC 3PNWA 5MP6H 3GNMH 4XBEL 3TO4A 1OLLA 1NCTA 4O02H 5EC2B 4R96A 4RGNB 1ED3A 2VZSA 5LWYH 2CLVB 4EI5D 1WICA 3RPIB 3BVNB 3S35X 1EEZB 2VIRB 4LLQA 4DK6A 2R69H 2AW2A 4F3FB 2YD5A 1XF4A 3L5XH 4YNYA 3CDCA 5EU6B 3GJFB 3WNOA 2GJJA 3HMXA 4YHPA 5D72H 1S9VB 3S34H 5DHYB 5C0AA 4FS0A 1GHFL 1J1PL 5F93C 1E27B 3PWVA 5CJXA 1MJ7L 1MLBA 2EXWD 2Y07H 3MGTB 3S4SB 4MXVE 4KVCL 1S9WA 1EV2E 1PQZB 1JNHB 5J1TC 1MI5A 4OZFB 4RISH 4TNVK 1W0VA 2OTUA 3GJFK 4FQ2H 3ZT6A 1PY9A 4I77H 5AZEL 4DK3A 2R9HD 4G8GD 3K81A 3WFDL 4HH9A 5C0AD 4UT9L 4ZXBA 2VLKA 1U93A 3D85A 3MODH 4O58H 3WXVH 4PJBE 2FO4B 2GJ6B 4ZFOB 1CFSB 4MWFB 5DJAB 1DQJB 5GS0H 1ONQA 3GSNH 1VACA 3ULUD 2O61B 3CC5A 2FLRT 4JN1L 1UYWH 1FYTE 4H0IA 5INDB 1AQKL 3QNXA 5E8DH 1WIOA 1ZHBB 4PJ9C 1I9EA 4M7KL 1KENH 2ATKB 4QLRA 1I7TA 3S3PA 4YZFF 1WC7A 5ALCH 4LNRA 4AL8L 5IP4A 2DLHA 4OIBA 2B20A 1J88A 1JWUB 1NLBL 4L4VD 1JGDB 1G7PA 4J1UB 4Z7WF 4LSRL 1HSAA 4DJMA 1HXMB 4KQ4H 3OGOE 3SCMA 5E6IC 3V52L 5HHPB 4HF5H 1D6EB 1WTGT 3VFMB 5F9WC 1MAML 1YMMB 3QUYA 2BSSB 1BVLA 2P5EB 5GGSY 4UT7L 2C1OA 4U6VH 1X7QA 2ARWA 4JPKL 4PJEE 4KZEL 1H3PH 3CMOL 4FZEH 5HPOA 3WIHH 1INDH 4YIQA 4K3EL 1HHKB 1L0XA 4OLWH 2YXFA 3PDOA 1INQB 4JDTL 3SCMD 1CU4H 3FTGA 2EYTA 2X10A 3W11D 2YRLA 4J3UA 4Y5XB 2HLFD 3JZ7A 3W2DH 3VDCA 4G7YL 4TPRH 4MHHI 3QUYD 5AZ2H 1T5XA 5TH2A 1NBYB 1JP5A 4CMMA 1IC5L 3VCLA 2GFBB 3FQXB 4HWBL 2EDKA 3KLAB 3RWCA 2CDEB 3EFFB 5ISZA 1FE8L 25C8H 3DX8B 3NCJH 5EWIL 1IQWH 1A7RL 3V2AR 1U95A 1T6VN 2GITA 2NXZC 1QQDB 1XEDA 5D96B 3SDCD 2BX5A 2J1KA 1TJIL 4XH2B 4CDHA 4Y5VB 4YFLF 4DZBA 1HCVA 4MA7L 2VE6A 3EOBB 5IM7A 4AEHL 4KK6C 3VXUD 1A5FH 4IMKC 1SY6L 5KG9A 3BZEB 4UDUB 4XNMA 4PJIB 3MRQB 2YPVH 1BQHA 4HK3N 4HMCA 4YJZL 5F7EH 2VDMH 3D3VB 5ISZD 2VNCA 5GS2D 4Q6IB 2P5WB 4X6FB 5C9JA 1JGUL 1DE4B 4TOYH 4I18A 4RRPG 3ARYA 3ALPA 4FTVD 3WFZA 2CKNA 5CHNB 1FFPB 1CVSC 3OXRA 3NZ8A 4LP5A 4XVSL 1IGYA 3GSRA 1ZT4A 3U2SA 1BZ9B 4OZGA 4G5ZH 4X4YA 2HJKB 5DJYB 3R4DA 3V6ZB 3V7AG 4H0GA 5GGQL 3ARBB 4ZAKD 5MENA 2AABH 4Z7NE 4DUVA 5DI8B 4KKAC 1CXKA 5T1LB 5A2IH 2YPLA 3MYJA 2AXGB 5HGAA 2XPGB 4C83A 5CUSL 1JZ5A 2GI7A 5HGDA 4GMTL 2MJWA 1FFOA 2BDNH 3PQYE 4JY4A 3PDGA 3CFKA 3UJTH 2D9QB 1I1AD 3O0RL 3LVEA 1CR9H 1K8DB 1R5IA 1U8QB 1ZHKB 2VQUA 3T09A 3MZGB 4LPUA 4JFDB 4JCMA 5MEND 1RUML 2EE2A 2VXVH 4WUKL 3C8HA 4YWGH 2NX5E 1RK1B 3RGVD 2YBRB 2P44B 4P2OC 2DQFA 2E3VA 1JN6A 2QL1A 1I1RA 3O6FC 5JPNB 1MIEH 5CKAA 5D7IF 4UTBL 1NCAL 1GGCL 2HVKA 5KS9B 5JORA 1SEQL 3MV9A 3IKCA 1A2YA 3JTSA 1XF5A 1FBIH 1AGFA 1K4DA 2KQNA 5EU4A 2BY0A 3UAJD 3VI4F 4F15C 1U58A 1E28A 2E7BA 3B9DA 4R7DA 5SWZA 3KXFB 3QA3B 5C0CE 1HH9A 1G7QA 5FCUL 3TGXA 3OB0H 1MJ8L 1JL8A 1CLOL 5F7LB 5EPMB 1A14H 2AQ1A 4GG6B 3GZKA 3U4AA 5E8OB 4ZO7A 1ZLUH 3LN9A 1F4XH 4AQ1B 3K7UA 4YDIH 3IDYC 3UC0L 4XNZC 1YJDC 3ZKND 4LKXB 4GKSA 1DBML 3SDAC 1A6UH 1QFWI 5IW3A 4G6KH 4HS6A 4LAQH 5SWZD 2R2EA 3PXJA 2XV6B 5EUKB 4AT6A 4H8WH 5DMIH 2OQJB 3BH9B 5DYOB 2BNQB 3QIUC 1YPZB 1MWAB 3V6FA 4DKFH 1A6ZA 1UB5A 4LGRB 1C1EL 4JKPH 3B9KA 1F4WL 4P4KA 3HC3L 5E7BA 3ARDD 2HLAB 2J5LB 4PJGE 3MRBA 2X4UA 1D5MA 2ZCLH 3NTCH 2ORBH 5DDHA 3MRRB 4N1EA 4AEEA 2F8VA 3PABA 4JFEA 3RHWF 1GAFH 3JV4A 2W65B 4JGJA 5JW4N 4XCEA 4BSWB 1Z2KA 2JKXA 2OS7A 2I26N 2DQCL 3MBEB 4R4BA 1OHQA 5FYLL 1GC1C 4L3AA 4WHTB 4BK5A 4PGJA 1TVHB 2Q3AA 1HKFA 1UGNA 4ONGH 1KPRA 1ADQA 3QCUH 1KN4L 1DBBH 1GGTA 3JWOC 3FAWA 3FOLA 3NFPB 1FCCA 3DV6A 5I71C 4RNRB 4WUUE 3NCFB 3JWDC 3RZCD 4P2CG 2FHBA 3U0WH 4PJFA 4DEPC 3VDBA 3SN6N 1KLGA 4MS8D 3S5LB 2OMNA 1KTDB 2A73B 2BVTA 3M17A 2ILLA 1F11A 1YN6B 4HBCH 1LE5A 1S9XB 4Z7VE 2AJVL 1PKQB 1PY4A 1YEFL 3P3YA 3DI3B 3JTTA 3UBXA 3U4BH 2FX9L 3L3DB 5CINL 1CD1A 1GH7A 3QIWD 4YBQC 4XCNA 4U1IA 2X2YA 1I9RL 4HFUL 1NKRA 1REIA 3AREA 3GB7A 1ZHLB 5EU6E 3ILPA 1GCFA 3D25B 5BV7B 5F7KC 4OFDA 3KJ4C 2D7MA 1AE6L 4WEBH 2PW2B 4PJXA 4KK8D 2HT2D 4HFWB 3D9AH 1IZKA 1DZBA 4P5KB 3RDTA 5AWNH 1FO0H 3ARFD 4WU7B 5F72S 3H9SA 3RRQA 1V7ML 3LCYA 1KBGH 1W0WA 3NH7H 1MHPH 4H20L 4OAWB 2XWJA 2VDRH 2CKBB 4Q9RH 5JIIA 1H3GA 2E6PA 1CGSL 2Y25A 4IRJD 4F33A 4OV6F 1A1OA 3RPKA 3U7YL 4P9ML 4BJLA 5C0JB 2GJ6E 1JHTA 4LF3A 3LQAL 4XWOD 1R5WA 3RBSA 2A74B 3RDTD 2XWBA 3C60C 2PTUA 5GISL 2DLFH 4OJFL 2GAZA 4X6CA 2I25N 3DSFH 3JWNC 1U8KA 3GSNA 3SE4A 1FDLH 2EXYC 5E2TL 4MA8H 1WBZB 2HRPL 4PJHB 3SQOL 5DO2C 1PLGL 2P45B 4N0FA 2GK0A 1NDMB 4LCCA 4RA3A 4OCRL 3VMNA 3O2DA 1MHCB 1IEHA 4WCYL 4S1DD 4APQD 5J12C 1FQ9C 4K3HA 4J3XA 3LQZA 2QSQA 4S1QL 4S1RL 4E5XA 1C08B 3TNMB 5GS0D 1D5IH 4F7CA 3LRHA 1RZJC 3G6AB 3FQRB 5F3BB 3G5VA 1MLCA 1OTUD 3TPUA 2R2HB 1ZAGA 3OV6A 4QRPA 3QJFA 1CIUA 5FO8A 2A2QT 4RMSA 1TPXB 5CAYB 1I4FB 2ZKHH 2IALA 1HIML 1MCCA 1N4XH 2LTQC 1YMME 1M7DB 2XA8H 5SX5K 1ZWIA 1NANH 3DVFA 3BP7B 3UYRL 1AGCB 2YRPA 1MQ8A 3RY6C 3T4YB 4WY7L 1FZJA 4D0DA 2R56L 2R0LL 2QBWA 2NY4D 1I9IL 2L0DA 5D2LF 4KV5F 3B2UD 1A6VL 4LBEA 1DVFA 4HT1L 3VA2C 4JJHA 1OPGH 2X4RA 4JZOA 4QRPD 4XPGL 4KDWA 3WN5C 4I4WB 4BZ2L 1F3DJ 3QIBB 4L3EB 4OGXL 4Y5YB 4D9QE 3L3JA 4F9LA 2BY1A 5DSCB 5D93B 4U31A 1U3ZA 3IT8D 2OZ4H 1Y6NR 3CXDH 1OARL 5LBSL 4OIIL 4CU6A 4XVJL 4ZUVB 1FVDB 3VXTB 4YHOL 5L2JA 5CJ5A 1KJMA 1EGJL 5CJQL 4ZFZB 4NOFA 2CR3A 3QQ3B 3IB4A 3G6JA 5HY9A 4QTHA 4LHUD 2K3TA 1OF2A 2EDOA 5J6HB 5L88L 1DVFD 1OTSD 3WUWA 1WTLA 4ZOCA 5BVPH 1I3RA 2D4FA 3LMJL 1EXUA 5F6HJ 2X1XR 4Y19D 4G9FA 2W9DH 1U8OB 1Q94B 4IIQC 3FT4A 4Y2DD 1EO8L 3CDYA 5GRUL 5FECB 3QFDA 4HMDA 1J0ZA 3UJIH 5GRJL 4C58B 5IMLA 4PJIE 5AAWA 1U0QA 4M5ZH 4WHCA 2DIAA 3B43A 2MQ0A 3D3VE 4ODUA 1OAKL 4HKZA 4AIXA 3DMMB 5I8OH 1OGTA 3QNYB 4JB9H 3PWLA 3T2OA 2P5WE 3BDYL 2Y7QB 3H9HA 4K94C 2VZUA 3MLXH 2CRIA 2EICA 3OHXA 4KJWD 3RY4A 4DKDC 5F7DA 3BEVB 5TQ0L 3B83A 3NIGF 3U79A 5J1SC 1FV1A 3GJFH 4NBYB 3TEUA 5CEZE 1J10A 5EO1A 3WFEL 2VYRE 4N5UA 3GI8H 3O2VL 3RVXC 4X9IA 4K71C 1DUYB 5IB3B 2PTTA 4K7PL 2X70B 4MX7A 1B6UA 5F8QC 4OZFH 5JW5A 3FFDB 3HRZA 2DM2A 1NANI 4MD5B 1ZKAA 1NBZB 3F62A 2XZAH 2FYYA 5C70A 2X09A 1T0MA 1AKJB 1X5XA 5IOPB 4WU5A 3H0TB 1IT9H 1XGYL 4YHKL 1BBDH 1KB5A 4JFDE 4PJBA 1S7UA 1UM6H 1BGXL 3Q6FB 3L5IA 1T2QL 2FJGB 2HKFL 2V17H 3O3AB 4P23B 5I8KH 4ZDHB 3L95A 4UDTA 1GPOL 1T1WB 5D8JH 3SGEH 1ETZB 2EDQA 2F58H 3P4MB 5EB9A 4KVNL 1RZKH 3E2HB 1QRKA 3Q0HA 1FYTA 3FMGL 1UJ3C 5ACMA 3WDJA 1T3FA 5KS9E 4P46A 2FIKB 1ZGLP 3WNKA 3WKMH 1JNLL 4XHJC 3TBYB 5E6YA 4JG1H 3KXFE 4EKXA 5B4MD 4ELMA 5J13C 5F9JA 1QVOB 4KKLD 4MYWB 2FECL 3LZFL 3JVGA 3MLRL 4HPYL 5ADOH 4J12A 4QXGL 4GG6E 1QLEH 2XRAH 2XKNA 4OZHB 4JY5L 1FYTD 4PRNB 4JO2L 4P46D 1YUHA 3L3IA 3RUGB 1OAQL 3OWEA 3O4LB 3EIFA 4DFIA 5E99L 1QFWM 4C54A 1OAUH 5HI3C 2JCCA 5TE4L 1A9BA 5ALBH 5GS1A 2BNQE 3H3PH 3QSKB 1YPZE 2CK2A 1VADB 3GBNL 2EEDA 2QQKH 3D0LB 4JDVA 3I6LE 4FMKA 1F4YL 4YHML 1AGEA 2X4QA 4MQ7B 5IESH 1QHPA 1T83A 4GAJH 5DUML 4YQXL 1CFNA 3LHPH 4P5MB 3S37X 1CG9B 3KYNA 3OR7A 4PRHB 3KWWA 3V79C 3B3IB 4TUKL 2R1WB 3MV7A 3IDUA 3OJDA 4OGAD 5DURB 1J1OH 5DA4A 4OLYH 4RFEA 5T5FH 1MFAH 3KPNB 3GMNA 4K23H 3EW3B 1EFXA 3LKSB 1T03H 1NC2A 3DRQB 3QO0B 3UTZB 3VFTB 4ALAH 1GVIA 3LS5L 1DDHB 2PXYA 3TT3L 3QISA 2R0KL 2AQ3A 3RWHB 5FV1L 5D1XD 2YPKA 3LIZH 2KKQA 4KKNA 1U8HB 3AMLA 4M62H 2Z31A 4JY6A 1OL0A 2QSVA 4PJ9B 4N0YL 2WK2A 2NY7H 4KMLB 3MUGB 1EFXD 5F8RC 2IH1B 4NZUL 4L8DB 1J0HA 3WE6B 1NC2D 3P11H 3T3MF 3DUSA 1WISA 4JHZA 5LXGL 1DQQA 2P8LA 3P30L 1QKZH 5K9OB 3HNTH 2JB6A 4JREC 1MCPL 2EYRA 3Q2CA 4LASH 4XNQB 3QH3B 5CEZH 4DGYH 1PKQE 2Z31D 4NM8H 5DJXB 2P7TA 1S7VA 2BHZA 4I1NB 2G2RB 3HI1A 3X11B 3VGAC 3VXRA 4P49A 4M7LH 1A3LH 1RFDH 4Q2ZB 4AMKH 3V6BR 3DVGA 1BLNA 8FABB 2FJHB 4U1KA 5I8EB 2X9YA 1EK3A 1PG7W 1BX2B 4X7SL 4AYFA 4I2XA 3E8UH 3IDMB 5D1ZC 2P8MA 4KZDH 4BFBD 4U4BA 3H8NA 2X4TA 2OL3B 1YECH 1FC2D 2YSSB 3CSYA 4IHOB 4LSUL 3O9WD 4U49A 4NWTH 3SQBA 1FNSL 3DXAB 3ARUA 1AH1A 4PLJD 4YXLH 4PJDE 5JMOC 3RWGB 1KEML 5E08L 3CH8A 1ITCA 5EBLB 4WI8A 5JXED 4CMHC 1Z9OA 3VFNA 2WMPA 4L9LA 3L9RB 3M1BB 2NXZB 5I9QC 4LHQB 4F2MA 1EMTH 2P48B 2QQNL 4JM2C 5EZJB 3VFWB 1S5HB 1PEWA 3PQYD 3VWJD 2R4SL 2A77H 3ZYOA 3BHBB 1C12B 1JHLH 3MXWH 3WIFB 5HBBA 3SKJL 3CVHB 4LVNC 4UT6H 4CN6A 4OSUH 4DQOH 5C0CA 1DN2A 1C7TA 2CXKA 2CDGB 4CN4A 5E8PB 1D6VL 2NX5D 4PJ8C 4XTRC 3C2AL 2CO6B 1MRFH 2IQ9L 3GRWA 5DZOA 5KVEL 1RVFL 4YGVA 4PJHE 1N7ML 5IQ7H 2A6JA 3NACH 2V2XB 1IKFH 2F5AL 2B1HL 5D9SA 5IB1B 4UQ2B 4PGBB 3F8UB 3FQUA 3FZUC 2XZCL 2XACC 1HZHH 4MAUH 1MCWW 3SKNA 4K7FA 4K3DL 4NGHH 5BQ7A 2Q8AH 3IJHB 3UTSB 3GSVA 1HH6B 5C0CD 1JIBA 1CZ8L 1DQTA 3ROOB 1MWAH 2DL2A 4X0KA 4QHLB 4CW1B 5C0GB 4HPOH 4QYOA 4RMVA 4ZOBA 5DTFB 3BKJL 3BKCH 4KJYB 2O5YH 3E0GA 5E24E 4GKNB 1DL7H 2BK8A 2H2SC 3T1FB 3WIIH 4NO3B 4I5BA 3EYSH 3RVUC 5JQHC 3O6LH 4PJAF 2CGRH 3LN4A 5EZLA 1F02I 2E7CA 4JHWL 1UXWA 1NDGB 2YMXL 1J0IA 5T1KA 4YLQT 4HKXA 4PD4J 1MFCH 4B0MM 3NCBB 3FKUS 3SKMB 2QHRL 4XRCB 3QUXC 4L3EE 4P2OB 2PW1A 5EFIA 2V7NB 3TVMA 3CFDA 1DQDH 1U92A 3KYOA 3O6FB 1CF8H 2EDTA 4XP5H 4JANB 2GY5A 4XPBH 2GT9A 2A9NL 5GSVB 3P0YH 2CQVA 3QEQB 5GJSL 1ULVA 4AZ8A 1I7ZB 2YA1A 4LOUC 2UVFA 4F15B 4AIOA 3UYOD 2AKRB 2BMKB 3UO1H 4G80B 1N5YL 4NN6B 4RMUA 1MAKA 3H7BA 5C0FB 2DTSA 4GBXD 3FO2A 4OGYH 5FUCC 3TA3D 2W07A 3DBXB 4GW5B 3IDYB 4XNZB 1GC1L 3ULVE 4Z7VA 3GMOB 5K33A 3SDAB 4JO4H 4WUUD 5C7XL 4YEEA 1WV7T 1G6RA 1JGEB 3HNSL 3RPIA 5C71A 2C26A 4Z0XA 3BVNA 5IMOB 1CGWA 5DQDL 5DXWA 2VIRA 3QIUB 4ONFH 1X5JA 4NNXA 1T7ZA 2LAGB 3MV11 5B38G 4F3FA 4ZYKB 1NFKA 3VRIB 2QKIA 2R4RL 3TNNB 4OBSA 3ARGC 4ZNCD 1Z0MA 5DHYA 1EHNA 1TQBC 2PUQT 4XP6L 4RGND 4JPWL 3O6KH 5KVFL 4OUUA 1KCVL 1OB1A 2DYPB 3MGTA 3S4SA 5KTEL 3E6FB 1R3IH 1JNHA 3NZHH 3LPGA 1TJGL 2BVQA 4Z77A 3DUHA 4OZFA 1GOHA 2Z91B 5IT2H 2ADIB 5KZCB 3QWRA 1C5BH 2YN3A 5TE6H 2CKBH 5EU6D 3VFVB 3L7EA 2X05A 4JM2F 4BFIA 1OCWL 3SE8H 4JPIB 2MCG1 5DMGC 1WFNA 5I71B 1UQSB 3HB3C 2FO4A 1S78C 5EU7E 4ZFOA 4XZUA 1UZ6E 5B38B 5IFHL 1DQJA 3VD5A 4LQFL 1WBXA 3L3KB 3NFSL 3EYFB 4QHMB 4DEPB 1NCCL 1U3JA 4PUBL 1FAIL 2YWZA 2IEPA 4KUZL 3KLSA 4ZUTB 1P7QB 3HE7A 3P9LB 5SX5H 2IBGA 1LNUB 2ATKA 1W72A 1HI6B 5DHVA 2GJ6D 3AROA 4QRUA 4DW2L 3UTPE 5IVXF 4ZD3H 3DYPA 3EGSB 4L8BA 4XPFH 4AQOA 2QLVB 4M7JH 3CFBA 4E41B 2B5IB 4OZHE 2GTWA 1FG2A 1E0OB 4GRWF 1A6PA 5J6GB 1S7XB 3RUGE 3QQNA 1D6EA 3VFMA 3O4LE 1NLDL 4XXCC 5HHVH 1CDBA 4L29A 4O9HH 4NRZA 3MZTA 1EDQA 3QUZA 2HTLD 1B3JA 3KJ4B 2P5EA 5DD1H 1S7QB 3VXNB 4KDTA 1RZFL 5ACZA 3PGCB 3R1GL 4M5YH 5EU5B 2Q6WA 1EA9C 2VXTH 1DFBH 2P24A 4R7NB 4ZFFA 4KXZI 1LD9A 1X5HA 1J87A 1KGCE 5IK3B 3P40A 2A1WL 4PRHE 4Y5XA 3DPBA 4NPYA 4XPAH 2ENYA 1YMMD 1TZIA 3PHOB 4O2FB 1N26A 1YQ2A 5A16B 4KI1A 2P5ED 2V2WB 5FO9B 3FQXA 1MRCL 1F5WA 2AS5M 3N1QC 2LV4A 3EFFA 5BVJA 3OXSB 1NCWL 4KH2A 3VXOB 3C60B 3I6GB 5H2BB 1OVZA 2OP4L 2P42B 1EAPB 4D9QD 4Y5VA 3EOAA 4EBQL 4PD4K 4P3CL 4IOFD 2IAMA 3QXAA 2EECA 1G7JB 3ULVH 1J0JA 1DBAH 2OLDA 4UDUA 3QULA 1PW3A 4GXUN 4KQ3H 1MCDA 4ZUSB 3D3VA 4P2QA 5J12B 3U48A 4ZPVA 3AUVA 3QRGH 3SGDH 1CI5A 1T22A 3INUH 4Q6IA 2ZCKH 4NQXB 1QFHA 4N8PA 1JFQH 4OKVB 1CD0A 1T7XA 5IROC 4UBDC 4S0SD 3WNPA 4NZRH 1I8LA 4NCDA 3TZVA 4MQXC 4K07A 3I2CH 2VL4A 4H25B 2ITDA 4NO5B 4LPXA 4N8VG 5E2WH 3L1OL 3WFCL 4UUJB 2LTQB 4NHCL 1FGNL 3FN3A 5DJCB 3ARVA 3D3VD 4LCIH 4YDJB 1R0AH 1RJYB 2KPNA 2FSEB 2P5WD 3MJ7B 4U3HA 1KJ2L 3VW3H 2AXGA 1AO7A 2VXUH 2XPGA 5KSAA 2DLEA 1FG9C 1HWHB 1PEZA 5D7SH 3WN5B 1XZ0A 4I48B 1AXSB 1KIPA 5CEZD 2B2XH 2EIBA 1N64L 3FQWA 2KL6A 4IOSD 3DXAE 1OSPH 4EI5C 3G08B 1K8DA 1U8NB 1ZHKA 1BOGA 1X5FA 4V1DB 5B22A 4LSVH 5JUEL 4QRSA 5D2NC 4JFYB 5HGHA 3ARBD 1LK2B 5FIEA 4RDQF 4CN1A 2J6EL 1A21A 4HX1A 5FB8B 1EHAA 5IIEB 5T1LD 4ERSH 1Q1JL 2J88L 4PBXA 1T2JA 2L7JA 5JPNA 4XNYL 5DRWA 3TO4C 3IJYA 2Q8BL 4YR6B 3MGAA 3ALXA 4GQ9H 4IIQB 3LKRB 2H3NB 4JFDD 1JWMB 5KOVC 3REVA 5HGGS 3VXQB 4J3TA 4OCMC 5IB2B 1UKSA 2VLLA 5BJTA 3LDBC 1JNNH 2Q1EA 4Z78B 4LAJH 1NFIB 2VOTA 2F53B 5F7NC 4GRLA 2DQHH 4GOSA 3BZDA 5E1AA 1I1YB 1ZLWK 5CJXC 4PJ7F 2AI0H 2V2TB 5CP7B 2AAVA 2B1AH 3KXFD 5F88A 3UTSE 1F6FB 2Z35B 3SGDI 5EUKA 1MEXL 4HCRA 3VGEA 3C09C 1MHEB 5GIRA 4PRBA 3BH9A 4K71B 4F8QA 1JV5A 4D3CL 4EXKA 1MWAA 2ZG1A 3MLUL 3VI3F 3CJJA 1IBGL 2KBGA 4XI5C 4A6YL 1FLRH 4ZXBC 3VXSA 5HHQB 2OX5A 5GS3A 4JR9H 4Q0XH 4R9HA 4MNQB 1UACL 3KPRB 3T2PA 2B7DT 2VLME 5ICYA 5BZWB 4OM1L 4LCYB 5T3ZL 1F3DH 2BNQD 2EIDA 3EDFA 4MMZC 4C57C 4KK9D 1TFHA 3I6LD 2WINB 5DVLA 3HI5H 1TVHA 2HFEA 4OF7A 1ZGLM 4AEFA 1N0XH 4FNLL 4LEXH 1XFPA 4TSCL 3OKEB 4U1JB 1UJ3B 3LRSB 4XCCL 5MERB 4D0BA 3PP4H 1YEKH 2RFXA 3QEQE 1R3LB 5JQ6L 5M95B 4KRPC 5J13B 3EOYG 1LO0L 3MBED 3SCMC 2LAAA 3BESR 1AHWB 2B8OT 5E2UH 3G5ZA 3PP3K 4FQIL 4YFLI 5F9AC 3W11C 3D0VA 4FQJH 3S5LA 4XB8A 4DGVH 2A73A 3QUYC 4JFFB 3MCKB 3DROB 2NW2A 3L5WB 5ITFB 4U0QB 1RZIA 3ILQD 1KTLB 4DAGH 5EIIB 4TUJA 2C1PB 5I1GL 2AJYH 3MRLB 4NUGL 2KH2B 4HWZB 1U2HA 4L5FH 1QSVA 3BPCA 3IDJA 4UTAL 1Y6KR 3WS3B 5B39G 5ERWA 1F6LL 3WD5H 2NNAB 1LDPH 4YHNB 1CGVA 1LP9F 3TYGL 3RVTD 2OL3H 2Y06H 4ZUUB 3D25A 2E9WA 5BW7A 4YAQA 2XWTA 1K3IA 4N5ED 1KYOK 3O3DA 4PR5B 2YEZB 3DI2B 4J3VA 4P5KA 4MXWL 3HUJB 4BSJA 4LRIA 1CQYA 2H1PH 1EIBA 4WU7A 3SDXA 3GK8L 1J12A 4LQ1A 2HJLA 4MXQD 2FECI 3F58H 3P9WB 3D5OF 4M43L 2HT4C 4JFPA 5HYJB 3OKKB 3GI9L 4H5SA 5LCVL 1HDMB 4PLNC 2R8SL 1UZ8A 4C56B 3CVHH 1KLUA 3D6GA 1MFDL 3KPSB 3O4OC 3KPQB 3S88H 1IGJB 2YZ8A 5B39B 2QHLA 1HN1A 2A74A 1P5UA 4ETQB 3TH4T 4I18C 2IANB 1G7MA 4JHAL 1CXFA 4OZ4B 1QZ1A 1B9ZA 2IQAB 2KQMA 1CGYA 2W1NA 3TBSB 4MJIB 2L7UA 1DQML 1V05A 3K1KC 3ESUF 1XGQB 4ODWB 1X6NA 2CRYA 1K8IB 4JREB 3OKNA 1XGTA 3MNVB 1MFBL 2FWOA 4PGEB 4A2LA 2G75A 2VLJB 1E6OH 1VSCA 3G6DL 4HWNA 1MHCA 4WI7A 4BH7A 4U6HB 2MKLC 4LLUB 2J8UA 1UWXH 5HD8C 4OKDA 3HAEG 4G6JL 5ICZB 5KSUB 1XGPB 1RURH 5C8JB 1C08A 3BKYH 5ANMA 2XOTA 3BISA 1V3KA 3ULUF 3SDDA 4E41E 4KTEL 3FQRA 1T1XB 3FRUB 1MCQA 4Y89A 4LSQL 1HOCB 4F9PA 1XCQB 3HZMA 1IC1A 1T20B 3VFRA 3QYCA 3S98A 1D5ZB 1KIQA 4HV8A 1AGCA 4F7MB 4OCYL 3FFCA 3PL6A 3UPCA 2C4FU 5LGKA 3X17A 5TF1H 3VD3A 3SBWA 4CMHB 4Y5YA 4L3EA 2PCPB 5IQ9B 3MJ9H 3CAFA 4X80H 5I9QB 5KVGH 5DUBB 1RUAH 2K9UA 3HAEB 2OR9H 1ZTXH 3WBDA 1RJZB 1DSFH 4P2RB 4ZUVA 4EQ2A 4MNGB 5EIVA 1CK0L 1UWEH 5GSRB 4I0CC 4ZFZA 1G0XA 4I3RL 1TITA 4MSWA 2BSTA 4LVNB 1P2CB 5KSBF 3L3GB 3T3PF 1F13A 1JPSH 4KTDL 5IMKB 1U42A 3AS2A 4L9DA 5EUOA 4EXPX 1D5BB 1QG3A 5I19H 1MPAL 3I50L 5D6CA 4PJ8B 3QIBD 4L3ED 1JK8A 2F5BH 2VKXA 1L4IA 3NN8A 4M48L 1YJDH 4PLOB 1A4KA 1I3UA 2C7UA 3WEXA 3BKMH 1P7KB 5FECA 3UTTB 1ITBB 4NNPH 3CLEH 4JRYB 3NGBC 3TBVA 4OUOA 4N9GA 3B9KC 2Z92A 3WFBH 3TV3L 4P4KC 4JQIL 4IOIB 2Y7QA 1XMWA 4CU7A 1KCSL 5KJRH 3MLWH 3I75A 4KI5C 3MRCB 2GUOB 4PV9A 4OLVL 4HIXL 5GJTH 2E7MA 3EYOB 3ULVD 1J05B 3BPLC 1L7TH 3CD4A 4M1GH 4M6MH 3EJYD 2WUBL 5LAXB 5EORL 4ODHH 5FDYA 1T89A 5HYSA 1WFTA 3DMMD 1IGIL 2X70A 4PB9L 1IJ9A 2DDQL 1LK3H 3MNWB 3OF6A 4BSVB 4XVTH 2FX7H 3N85H 5D4QA 3MRDA 3QUXB 5FHAL 1RUKH 3QEUA 4I3GA 1FZKB 1AKJA 2ZWLT 2V5SA 4YK4C 5IOPA 4V1DE 12E8L 4MDJB 1BJ1J 3NCYP 1NC4A 3B5HA 4Z76B 5FA4A 4OIAA 3JWDH 4DZ8B 3LH2H 2A6DB 4OT1L 4EOWL 3RVWD 5CD3B 1NL0L 5AUMB 1Q38A 1TZHB 2BRRH 3EYVA 1ETZA 3P4MA 3BP6B 2EDXA 4ZS6C 5AYUL 4OD3H 4JZNA 5FFLA 2EE3A 4P9HC 1FZOA 1BF8A 3ZKSD 2JJSA 3D39A 3MFFB 3JV0A 1U6AH 5F21B 2HH0H 2FIKA 1AKJD 4OZGF 3O2WL 3OKMB 3BH8A 5DK2A 1Q9KB 4QXTB 4CADB 4NZTH 1UG9A 5J56B 1NSNL 1LILA 2FGWH 3UYPA 1FL5A 5DMKB 3HR5A 2J8OA 3IFLH 4P23D 3UPRA 2D7TL 4LCUB 2EC9U 3AREC 3DTXB 3G04B 5I1HL 1QFUH 3IF1B 3QDMB 4PLKD 2F53E 1O7SA 3CK0H 5JMRA 5AAMA 4M03A 3DV4B 4H1LB 1PFCA 4PRNA 4GW4A 1FL3A 4JVWA 1BQLH 4U6XB 3C5JB 3RUGA 5GZOD 1KPVB 3ARGB 3KPPA 1X5KA 4ETYA 1AJ7H 2FEDC 3RDTC 2IG2L 1GGIH 2FL5B 5J3HD 5I18H 3MOBL 1TQBB 4HS8H 3UTPD 2W59A 1YEIH 2VABA 1F00I 3ELAT 4KY1H 1HHIB 3HZVB 2YD4A 1CICA 2P8PB 4O5LH 4Z7UB 4KTYA 4ISVA 4XPHH 3F7PC 3UJJH 2QSCL 4GW1A 3HPLA 3ABZA 1XGUB 2M8XA 4MNQE 3O4LD 4HC1A 2B0SH 3B3IA 3EDDA 3KPRE 3ZTNH 5T1DL 5EA0H 3QHZL 3BOVA 3PIQB 3K80A 3GEWB 5CBEB 4OFYA 1WUNT 4FABL 4K3JH 5DQJB 4NT6A 3SE4C 1FORH 2ZUQC 3ZYJA 3GM8A 4RZCA 3NIDE 3M8OH 1BF2A 4QXUL 1HXYA 2LE9A 2H8PA 1WWCA 3EOTH 4LCCC 5E5MA 5CEXA 2CJUL 4X7FC 3T8XA 1KGCD 1UA6L 4PRHD 5D5MF 1VKXB 3EO1A 3I3BA 4G3YL 5CP3H 2AK1L 2VXSH 3U9UA 2C5DC 4O00A 3LKOA 3CU1A 1JE6A 3MRFA 5DURD 5MI0C 1HHGA 4OFYD 3QPXL 2Y6SD 1EJOL 4S1SL 3VU2A 3NA4A 3WE6A 3KPOB 1TLKA 3MROA 4Z6AT 5ESQB 3U0TA 4EUPA 3KS0H 1QLFB 5K9OA 4JFFE 3STBA 4K2UH 4WEMB 4XNQA 5MEPA 1YEGH 1FVCA 3F7YB 5E94A 2CXGA 5F7HA 4PJ9D 4W6XB 2AJZA 1RULL 5K9KA 4HH8A 4Z7QF 1DVFC 3QUMB 3U1SL 8FABA 1JHKL 4F9LC 2DQGL 4GXVL 1G9ML 2JB5H 2F15A 3X3GL 2YSSA 3MRMA 3EBAA 4KKBC 4TULH 4Z18A 2FEEL 3BIKB 3NIFF 2VLRA 1PBYA 3BYYA 1J1PH 3EYQC 3WYRA 2MHAA 4PJFF 3BZFB 3HUJE 1IL1A 3N9GL 4KVCH 1DUZB 5EBLA 5DJDA 4WW2F 3O45B 2X89D 2R1YB 3MRGB 4OCSL 1G9NH 5DJZB 5HYJE 5AZEH 4YDLC 3E3QC 5EZJA 4CNIB 1S5HA 3VE0A 5DQ9B 3ZE1E 3BHBA 4C56E 1ZLWH 3G5YB 1MNUL 4FZ8L 4HMEA 4UT9H 3LEXB 4QCIA 5GGRY 3DXAD 3LAFA 3KPSE 3ME0A 3WIFA 1EUTA 4OZIF 3OX8A 5IBTH 5DWUH 1I3GL 2GTZB 2BOCA 3TIDA 4PY7B 2IANE 3I3DA 4DGIH 4QF1A 1Q9OA 2F54A 4CBPA 1RJLA 3CFEA 5LVEA 4JRXB 2E8YA 4S2SB 1T4KA 2NXZD 2R2CA 2EH7L 4DVBB 1PD6A 5CEYA 4UQ2A 2BERA 4RMTA 5IBUG 4X6DA 1JWSA 3GSXB 1AY1H 1BP3B 2VLJE 1NAML 5TPWL 2CUIA 4KK6D 5GGUA 4MB4A 2EC8A 2Z0BA 2DTMH 5LQBL 1TENA 3TPKA 1I9JL 3VG0H 5EOCH 3BGFB 2FR4B 4HG4K 4JFQB 1PAMA 4NFBA 4BK4A 3V52H 4FXKB 1TETL 1QRNB 2DICA 1PZ5A 1JTPA 4GKNA 2DQUH 5J4MA 3ZYIA 3UTSD 2CK0L 5D7IB 3WNMA 4UT7H 4IDJH 5D71L 4JPKH 2F19L 5D2NB 2ZCHH 1LMKA 1A8JH 4P46C 3SJVA 3FT3B 2DB8A 4HS3B 1EO5A 4KKAD 4Q58C 2W9EL 1DN0A 3V8CA 3W9EB 3ULUL 3MJ9A 5H37H 1KNOA 1H3VA 2VN7A 4HKJA 4P2RE 3PNWB 3QEGL 5B21A 3TO4B 3JVGC 2R0ZH 2Y5EA 3RWDA 1IC5H 4MNGE 3OGCA 4KMQA 4R96B 4O51A 4HWBH 2VLMD 2XNAA 4N0UB 5HHOA 1I7ZA 1NFDF 4AY0A 3IRZA 1FE8H 2AKRA 4LLQB 4G80A 1DANT 2EO9A 3LDBB 3U0PA 4P2OD 3OL2A 2AGJH 1XF4B 3LD8C 4YNYB 3FCTB 3KPLA 4QHNA 2CLRA 4BM7A 3O6FD 4PRPB 2MFNA 4YHPB 3MUJA 3UTTE 1INEL 1SVZA 5GS1C 4RFOL 2V9TA 3MA9H 4F57H 4X7EC 3GMOA 3ZDXE 3PWVB 1KIRA 1MLBB 4JRYE 3QEQD 4Q74A 3G9AB 1JGEA 1I1FA 1S9WB 3GMLA 1G1CA 4WTZA 1JPFA 1T83C 4LARH 4N0RA 5D1QA 1MI5B 5IMOA 7FABL 1W0VB 2VDNH 5CGTA 4H88L 4ZYKA 4UIMA 3O8XA 5IBLC 4ZXBB 1HYSC 2VLKB 3SO5A 2LU3A 1U93B 3SDAD 3D85B 3MR9B 2DLGA 1D9KB 4XMKL 5INCA 2MCPL 3F7RA 4ODSL 4YXHL 1LO2H 2AJXL 3GSWA 3G6JF 3VFPA 2I24N 5GGQH 2DYPA 3RHWK 1NAKL 2BSED 3RWIA 2PXYC 1JPTH 3QIUD 5E4EC 1U3YA 3CC5B 1GXEA 2Z91A 4MCYA 3WHXA 3A0OA 2Z31C 3U30C 1VFBA 1P84J 1NUDA 1LEIA 3VFVA 1H3WM 4XP1L 1I7TB 3VGFA 3Q5TA 3KLHC 3FONA 1XF2A 4LNRB 4J7RA 1NGQL 1NCNA 2DYPD 1P5VA 1KCRH 1JGLL 2YKLL 2AJUH 1F90H 1YC8A 4KRPB 2VR9A 3L3KA 2NY6C 4J6RL 3GMRA 2ZJSL 2ED8A 5KZCD 2ZOKA 1FRGL 2RCSL 3E6HA 4TRPL 2R2BB 3HMWH 1BVLB 3P9LA 4D0CA 1N6UA 4GMSH 2C1OB 3RNQA 2PO6A 1X7QB 5DUPL 3ARXA 1Q0YL 4MXVF 3BSZL 3TBWA 4YIQB 4D8PA 4OCLC 4G7VL 1EHLH 3PDOB 1BQHG 2YK1L 3QDME 5E9DB 1FN4A 3FTGB 2EYTB 1YEEH 1C5CL 4E41A 4YDVA 5A40E 3P0VL 1IEBA 2W0FB 3K4DA 3OJVC 4XNXH 4BQ8A 3HFML 1P7QD 1T5XB 5TH2B 1T0NA 3QXVA 1CFQA 3LPFA 1NMBL 3RWCB 1VESA 4PJBF 3Q3GA 5L0QC 1O0VA 3QXWA 1E4XH 2DD8L 4QY8A 4XBPA 3IFPB 4POZC 5CMAB 1A7OL 1JUFA 4Y2OA 4L9LC 5EIQA 5EU5A 1U95B 3P0GB 2GITB 4YBQD 4R7NA 4E41D 4Z7UE 4X7DC 4D9LL 2BVUA 2FHFA 2VE6B 1EEQA 2MQCA 5IM7B 1M6OB 3HAEH 3PHOA 5C0DA 2BFVL 2D0FA 4R97B 4IRSB 4DTGH 5KG9B 4CL7A 4XNMB 2BCKB 2HFGL 4PIRF 3MLVH 1BQHB 1I1CA 1IC7H 1FNLA 1SMAA 4TSBL 3O4OB 2B4CC 3IDXH 2NY5L 4HUNB 3SGKA 1DLFL 2MPAL 4GSDH 1CBVH 4I18B 1Q72L 1RIHH 5HDQH 3BRGC 5GHWL 2VDPL 4UV4L 2DRUA 3DWTA 3NZ8B 1ACYH 1RUQH 1B2WH 1ZT4B 3EHBD 4PTUB 3ZDZE 3U2SB 4BYHA 1RU9L 5CP3A 3IXAA 5L9DL 3ZL4H 3T0VA 2A9MH 3C6SB 1MH5A 4PB0L 3LB6D 1OW0A 4PJEF 2VZVA 4ZUSA 2YS4A 4HJJL 1UWGL 2GY7B 3D2UB 4R4FL 3SY0B 3C60D 4FP8L 2WWMD 1EBAA 2YPLB 2BHYA 3MYJB 4WHYG 5HGAB 3BD4A 1RIUH 4XMPL 2Y72A 4HHAA 4OF8A 1FFOB 1OAYH 4Y4FA 5E5RB 3P4LA 5I76A 3CFKB 4NO5A 1MCOH 5DO2D 2UZIH 4UUJA 1R5IB 1ZXQA 2PF6A 1YNLH 2VRAA 4OLUH 1KFAH 5DJCA 3D48R 4UILL 3RL1B 3T1WA 4XWGH 2DQFB 1J11A 4I9WE 5GGTL 4XCFH 1JN6B 4LSTH 3R06A 5E5UB 4HGWA 3TVMC 3ZE0E 1CLZL 4LSPH 1TMCB 2HVKB 3CMGA 1CLCA 3MV9B 1A2YB 1AXSA 1A6TA 1VA9A 1AGFB 4GJTB 4IJ3C 1E4XI 5EU4B 4R7DB 5BOPA 1KT2A 3SE3A 4HXBH 2DJUA 1DEEA 1HH9B 2O5ZL 2E27H 4PY8J 5CJOH 1MCFA 4QKXB 5C0RH 2H2PD 2FATL 1A9EA 2Y36L 3FB6B 3GHBL 5IIEA 4GUPA 2DIBA 4FA8A 1V3LA 1Z9SA 4DCQA 3U36A 4Y1AB 3FOMA 4B50A 4RGNC 4HS6B 4M6AA 1A1NA 4I0PB 2DF3A 3QDAA 2VN4A 4V1DD 4D9RE 3KHOA 3LKRA 4NM4L 4NN5B 4L1DA 5HHXL 1JWMA 3LQAH 1A3RL 4YH6A 1P84K 1RZ7H 4P99A 3V6FB 1A6ZB 1UB5B 5GPRA 3NGBB 4Z7NF 3P77A 15C8H 4JRXE 3B9KB 5IG7A 1CE1H 1EUUA 1QBLL 1NMAL 4Z78A 4P4KB 4NJAL 4KHXL 1LO3L 2F53A 2WW8A 4H1LH 3MRBB 2NY1C 5DD3H 2HRPH 5HPMA 4XGZA 5DDHB 3IS0X 1I1YA 5I1EL 4OLXH 5DRXB 3PABB 4KKCC 4X9FA 1CFVL 4JFEB 4OCRH 3JV4B 5TDOB 4XCEB 5EZIL 2XQYG 4ZSOA 1MHEA 5KSVA 1O5DT 4S1QH 4S1RH 5JIKA 3UBXG 3STLB 5MP6L 1A6WH 4GAYA 4O02L 3T08A 2NYYC 3C8DA 5LWYL 1QSFA 2F53D 1KPRB 5IJKA 5C6WH 1QRNE 1ODAA 1WLHA 3FOLB 3DV6B 3OKLB 2R69L 4X4XB 5IW1B 3LS4H 3L5XL 4YPGA 1EH9A 4YK4B 3RVXD 2V5YA 5K9QG 1IZJA 4LLDA 4X8JA 1H5BB 3S34L 4XC3L 5D2NE 5IVZA 4CVWA 4NNYA 1KLGB 1OLZA 5D7JA 1RZKC 3M17B 3CH1A 4BZ2H 1F11B 3HE7C 1LE5B 4RISL 1A7NH 1B0GA 4MNQD 4RAUA 3OKEA 4OD1L 4FQ2L 3KPRD 1SYSA 4I77L 5DZNA 3UBXB 4PG9B 3K74B 1BVZA 1CD1B 3CGTA 3U83A 4N0UE 4HWBA 4XCNB 3TIEA 1Y6MR 5IMMB 4ZUWA 3TO2A 3MODL 4O58L 1AHWA 3WXVL 1MCSA 3I02A 2I27N 3AREB 5GS0L 3GB7B 4PJGF 3FQNA 3ILPB 4JFFA 3WKNA 4PRPE 3MCKA 3DROA 3QUZC 4ODXA 3BN9D 5ITFA 2H32A 5J1AA 3M07A 4KDTC 4PJXB 1UYWL 1KTLA 3TT1H 2YA0A 5GRJH 4XHJD 1JTOA 1SY6A 1GOGA 5E56A 5E8DL 4Y8DC 4ZTPH 2ZZUT 1KENL 3QUMH 3RX7A 1ZGLA 1MI5E 3BXNB 1FNFA 3H9SB 3DVNA 3WS3A 4Z8FH 4LU5H 4LLMA 3P4OA 1W0WB 2NNAA 2VKWA 4JFFD 2XWJB 2D7NA 4KQ4L 1S7TA 2VLKE 1TCRB 3WFEH 4JJ5A 4FQ1H 1A1OB 1IFHL 1BQUA 4LF3B 1R5WB 2FJFB 1F3RB 5HI3D 2GAZB 4X6CB 2I9LA 3PV7A 1U8KB 3GSNB 2ZUQB 4U6VL 1VFAB 5IF0B 1CT8A 2IAMC 3C8KA 1TTUA 3PE9A 3MLYH 3MNZB 1INDL 4FZEL 4LHUG 3WIHL 5B3JE 3IVKB 4OLWL 2GK0B 2EDYA 4G43B 3V8OA 1CU4L 4Z7VF 1UH3A 1OT1A 2GEEA 4YHZH 4C56A 1PDKA 2NW3A 1U91B 4TPRL 3HLAB 3QG7H 3LQZB 5AZ2L 4Q6IC 4E5XB 5MI0B 4NFDA 1TXKA 4F7CB 3IJSA 1EX0A 5C07B 1RQ5A 2CRZA 1RAMA 3L5HA 1MLCB 1A22B 3VWKC 4M6NH 3TZVC 3QJFB 1GPOH 4LMQI 5FO8B