3MFGB

Crystal structure of toxic shock syndrome toxin 1 (tsst-1) in complex with the human t cell receptor beta chain vbeta2.1 (ep-8)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
110
Chain Sequence
AVVSQHPSRVIVKSGTSVKIECRSLDFQATTMFWYRQFPSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSGFYICSALAGDTQYFGPGTRLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 28
structure length 110
sequence length 117
ec nomenclature
pdb deposition date 2010-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mfgB00
3MBEC 4JFOA 1QLEH 3CLEL 3WD5L 2MMXA 1LMKA 3ZHLA 3TESA 2VZVA 2AJ3A 2P5WE 4UNVA 3HAEG 3CVHH 3B2VL 5IVXB 1LO0H 5SWZB 1VGEH 1FN4B 3FN0H 2X9XA 4ZXBC 3NIDE 1LK3L 5MENE 1NDMB 5JW4N 1TVDA 2JJVA 5FHBL 4YXLL 1Q72L 3LQAL 5GGVH 4S1DD 1DSFL 2CPCA 2VH5L 1EFXA 3WJLC 3MZGB 4GT7A 4P46A 5T1MB 3VI4E 2VR9A 1IC4L 1TQCB 5I8OL 1CFNB 2X05A 3DX6A 2AW2A 4HC1L 2BVYA 1FAIL 1NKOA 2NX5B 3T0BA 4OI9A 1LE5B 1ACZA 1I9IL 3KDMB 4G6JH 4TNWF 2R1WA 5ELIA 1P84K 4PJIA 2IGFL 5FYJD 1JWMB 3VFTB 1NQBA 1ND0B 2IPTL 2P5WB 4LLQA 5FO9B 4OLWL 4K9EH 5DC4B 1UA6L 4BFIA 2E7BA 3ROLA 4WHDA 1HKFA 1NAKL 3K1KC 4RAVA 4JFEE 3FOLB 5MENB 1UQSA 4FMKA 1KB5A 1EMTL 3BRFA 5IK3B 5I0DA 1T3FA 5ISZE 4F7EB 3VFNB 4HH9B 2F53D 1IKFL 1TZHB 4R7DB 4L8BA 3V6FA 2R69L 3UTPE 2XNAB 4HXBL 3REWB 3KNBA 4NRXB 2V2XB 3O6ML 3DMMC 1FVCA 4LPCA 1O5DT 3CMOL 3QCUH 1JN6B 5D1XB 3M07A 4MHHG 3TJHD 1R0AH 3WXWL 2D03L 2X4TA 1ERNA 4HK3J 4DAGH 2VZOA 5GRXG 3JTSB 4HSQA 2WUCH 3L9RB 4KVNH 4BKLB 3KYMB 1T7YA 1QYGL 2XT1B 2A6IA 5F7EL 2VDNH 4JFEB 4PB0L 2A9NH 3HZKB 2PETA 2OM5A 1NBVH 2X4PB 4PRHD 5ISZB 5FYJH 1INDH 4JANB 3HRZB 4FABL 3CH1A 3RVUD 2J6EL 4I5BA 4AK1A 3MRGA 4HIIA 4JRXA 3VFRA 1H15A 2HFGH 5IFAH 4YHPB 3AB0C 3EDEA 4GBXB 1INEL 4NO5B 3HNTL 4X80L 4G8GA 1OGTA 5CEZD 4TUOA 3EOAA 3SE9L 1RZGB 1HYSC 1DQQA 1MY5A 5T1LA 5IQ7H 4PLJD 4QOKE 1AR1C 5ILTH 1FYTB 1OD9A 2X4QB 3P4OB 4S2SB 4Z6AT 1P4BL 2EICA 4IOFD 2K3TA 3GUTA 2AQ1A 2MQ0A 3LD8C 3MLZL 4P2QE 5HHNA 3B3IB 5KS9E 1FIGH 4F9PC 3LKNB 1DP0A 2G60L 1MJ7L 1RURH 4ODUB 3WKMH 4L8CB 1L7TH 5L2JA 1CICD 4HWBH 3BPNB 3O4LD 4LVHC 2J88H 1VGKB 1UENA 2YPVL 1YEEL 2VR5A 4BK5A 1M71A 3NBNA 3FT3A 4AENB 1CL7H 3IAPA 3A67H 4Y2DD 3ARVA 2LU7A 4MGXA 4Z7QE 2NY2D 3DVGB 4JZJA 3L1OL 1G9NH 1NEUA 1YMMD 1MLCA 5DUPH 4IRJD 1MNUH 5IHZB 4WFFE 1CFBA 4QOKB 1WITA 3QHTC 2R2CA 5DJCB 1J5OL 5C0BD 3AREB 5C0DA 1C8PA 2Q8AH 4JPWL 5CCKH 4RAUB 1QR1A 2P8LB 5E6ZA 4OZHE 2X9WA 3P0VL 2JB5L 3O9WD 2B1HL 4PG9A 3IYLW 4LFHD 4P2QB 4FFVC 5EO0A 2J5LC 1I3UA 5DC0A 5CEZH 4KQ4H 1PGRB 5KS9B 5GGQL 4P59L 1DJSA 4ELKA 5JDSB 4EDWL 4XBGA 4XVSL 3RX7A 4POYA 2BVUA 3VFPA 4HIXH 3CLFL 5CLTA 3BGFB 4JFPA 4LPXA 4DW2H 4DGIH 3O4OB 4E42A 5I66A 3M1BA 4U1MA 4YHKL 5HGHA 3QQ4B 3TO4B 5JHLH 3WE6A 3ULUE 3PWPD 4H88H 4N5EC 1E0OB 1MRCL 1NDGA 3H9HA 3NPZB 4M3KB 4QTHA 3SDCB 1X7QB 4MMZC 1NFIB 1G7JA 1YYLL 2EYRB 1XGTA 1JGLL 3DGGA 3UBXB 1EEQA 4TVSa 3UTTA 2DICA 4IOIB 3K2UH 3LEXA 1U8LA 4NC2B 4XWOD 1G9MH 2H32B 1OGAA 5I15H 4PJDE 1MF2L 1U3HD 4XBPA 3U7WH 1J11A 4HKBB 2EXWD 3RGVC 4MXVE 1IFHL 3NFPB 1U3YA 1VFOA 3MODL 2ILLA 3L3JB 2YS4A 3BPLC 5I74B 4OZ4A 1DL7H 3UJIH 3IFOB 1YMHB 4Z7UF 1N5AB 5ADPH 5SWQB 5C0FB 2ADIA 4U1NB 2DQEL 2HJLB 3RUGA 2HT3D 4TNVK 1I9RL 1KELH 5D5MF 4MZ2A 1DCLA 3O8XA 5D7IA 3X11A 4OF3A 1U91B 1AGDB 4KROB 1RFDH 4LLDA 1T83A 4ZTPL 3X12A 1S7QB 1ZT1B 1ITBB 5KSUA 4P2RE 4CGTA 1AI1H 1KPRA 1ZVSA 2F54D 4G6AD 3B8SA 2DAVA 5EZLA 2H41A 3GMOA 3ISWA 2R1XB 5DD1H 3LOWA 4PJFA 5BXFB 1BF8A 5DR5L 3BO8A 3JWOL 4PJDB 5HHXL 2J3SA 2AXHA 4JY5L 2NY6B 2K1MA 1OL0A 3C5ZD 1KN2H 1TZGL 3QQ3A 4NZUL 3ECBA 1X5LA 2QADD 4UINL 4NOFA 3NGBC 4X4XB 4AM0A 2X44D 1HHHA 1KSRA 4M5ZL 2NY5H 4FQ2H 2OTUB 1RUML 3ZHDA 2A6KA 2AV1A 4Z7NF 3PV7A 4WHCA 1RZ7L 3DV6B 3HUJB 1IEHA 2FLBT 2H3NB 1IC5L 5F7KC 3QIUA 4TPRH 5IR1A 2IEPA 4PFEA 4JO3L 5E9DD 2DL9A 1UACH 3KPSD 5L8KB 5C09A 4LIQE 1J10A 5JPMB 2XKNB 4K71C 3O2DA 4P2RB 1HXMA 1SJXA 3BZFB 3K8LA 4DEPB 1UWXK 4RFEB 1T22A 1MOEA 3VDAA 4P2OA 1TMCB 3IXTA 3LAFA 4MMXC 1AD9A 2ZUVA 3HR5B 3RIFK 2VZ1A 4KMTH 2YEZA 1NCDH 3CSYB 4XCFH 2BJML 5IVOA 1D9KA 4JM2B 1JMXA 4GG8A 5T1KD 4I48B 3GBNL 4KHTL 2VDML 3I6KB 3PXHA 5I16B 1G6RB 5ESAA 1C1EH 1RIHH 1C16B 5E94A 5L6YH 4YWGL 5FYKE 3PHSA 1SM3L 3N50A 3F65A 1QO3A 2C1PB 3C09B 1UWGH 4JAMA 4C56D 1T4KB 3KJ6H 4NO0A 1A2YA 3O45B 3ULVF 4XCCL 4XBEL 1Z5LB 3OJDB 5HI5D 1JYNA 5TDOB 4FS0A 1F11B 2F8VA 1QPPA 1N7ML 4OTXL 3RDTC 4K7PX 5FUZH 3ZYOA 4XP4L 5IM7B 3SKOA 3QXAB 3GMLB 4DCQA 2DD8H 5IOPA 5I1KH 4U1SB 1VEMA 1ORQB 1J0HA 3D5OF 4J8RA 4HKJA 4UB0L 2HTLC 4KDTA 4ZS7H 4QRTB 4NJAH 1T1WA 4O58L 4PJ8C 3QWQB 3BWAA 4JFZL 4M93B 1S9KC 1TLKA 5HDBF 5HYSB 2OZ4A 3ABZA 1J86A 5IVZB 3LV3A 2OLDA 3HN3A 3U83A 2NXYD 2HMIC 5KG9A 2BVOB 1B3JA 4HCRL 4X6BA 2VDLH 1AY1H 5GJTH 4M62L 1I7TA 3EDKA 4JDTH 4WO4C 2R0ZH 4ZUUB 2B1AL 4LBEA 3QUKB 1S7UB 4UBDC 1L6ZA 2A9ML 4PBXA 1MVFA 4U0QB 1A14H 4KXZI 3RPKA 4XTRD 3PWLB 4M03A 4PGDB 3T77A 5LXGH 1E4JA 1IAMA 2QJDA 4GW4A 4O4YL 5I1GH 3PQYE 3GB7A 2H2SC 4L29B 5T3XL 4P2CG 4WV1B 4X6DA 1RZFL 2JJWA 3KWWA 4KC3B 3KYKH 3BMWA 1FSKB 1QACA 5B38G 2VLKE 1T04B 1KLUB 2Z8SA 3QA3A 4ZODA 5ICXB 5I6XB 4P5TB 5KAQG 5EUOE 3OG6B 1JGEA 5C0RH 3VFVA 4NUJB 1TNNA 3MGOB 4WNQA 5DQJA 1KLGA 5JNYB 4MSWA 4UOJA 4OCWL 5INDB 1QRND 4YQXH 4MJ5B 5CJOH 3FO1A 3V4VH 3NA9H 1T6WA 3GM8A 1DQDH 4HW6A 3R0MA 4C59B 4XAWH 4FFWC 1XCQA 1BQHB 3TYGH 4P46C 2FH6A 3EUUA 3PV6B 3F7RA 4AJ0A 2ESVE 4Y16A 3HZMB 2XTJC 4AEFA 4YDVB 3GMQB 1CDYA 4G6MH 5C3LD 5DFTA 3R8BB 3CLEH 3WD5H 2DLGA 1AQDB 2OL3B 2PYEE 3QO0A 2EDNA 3PQYB 4U3CA 4W4NA 2R2HA 5DEFA 4RGOL 2W9LA 3WIHA 1BLNB 2ZUYA 4G9DB 4X7EC 2P8PB 1IZJA 3B2VH 3ARUA 5F1NA 1KIRA 4XXDB 2W0FA 4LLUA 1IGTB 5D8JL 2VLKB 3SCMD 2GSIA 2X6MA 5DTFB 1BMGA 4DZBB 1FNFA 5EUOB 1LK3H 2VLLB 3ARBD 3GIVB 3QDJE 3FB6A 4ZUTA 2B4CC 1I7UB 4YXLH 5FHBH 3BD4A 3T2OA 2VWEE 3S96A 2Y9RT 3HFML 3LQAH 3TYFB 1DSFH 2VH5H 3ILQD 4OZIF 3VGFA 5IFJA 2IANA 3WLBA 1AFVL 1J12A 5EPMA 3VXTB 3WNKA 4LLYB 2Y06L 1IC4H 5C0GB 1H8NA 5I8OH 1NBZA 1N26A 4NDMA 4EUPA 4HC1H 3MRNA 4U1KA 2ESVB 1FAIH 4MVBD 3MJ6A 5FYLD 3FT2B 5F72S 1I9IH 2NY0B 4G42B 3X14B 3VXMD 3FT4B 2IGFH 1AGCA 3BT2L 3BQUC 2PYEB 5F21B 3MJ8B 1ES0B 3CFIC 4F58H 2IPTH 5HY9B 1EHLL 4OLWH 4NRYA 1UA6H 3HS0B 2Q76A 2CKBA 4HQQL 1NAKH 4KRPB 5LGJA 4QHLA 3QH3B 5IMLA 4YJZL 4L8SB 2BNQB 2I07B 5A16A 4XPBL 1EMTH 1XH3A 2I60H 1C7SA 3QDJB 1FL6A 5DUML 3TBWB 2QL1A 1IKFH 3HLAB 2OQJA 2R69H 3ARDC 4LF3B 4MNQD 4Y5YB 1QG3A 1SVZA 3O6MH 5TGBB 3REVB 5DJYB 3CMOH 3TM6A 5EBMB 1S9WB 1C12A 4U6VL 4A6YL 1CDCA 3WXWH 3TCXA 2F15A 1HYRC 2D03H 3GSVA 5BOZG 1OOAA 1DBML 3SQBA 2V7HB 4JO4L 4ZNEA 3KPQB 4QHUA 4FTVD 1S5HB 2EIZB 4OD3L 4ZUVB 5FHAL 1HOCB 5DD0L 1NBYA 1QYGH 3ZKQD 3N85L 1CXIA 5F7EH 5HGAB 1RZ8B 3OKNB 4O2FB 4PB0H 4EXKA 4IIQC 5ESVA 2PW2A 3CUPA 2NY3C 3BPCA 1CG9B 4M1CD 4ZAKA 1A6PA 1ZT7B 5DJ2B 4I4WA 2J6EH 2XXMB 3ARFC 3QHFH 5JOFA 5J1TC 1A7OL 1EJ6A 3QQ9D 3TBVB 2D3VA 1T1XB 5FA3A 4UQ3A 4TULL 2DWEB 1INEH 3HNTH 4X80H 3IJSB 5D4QA 3SE9H 2CKNA 2YK1L 3UAJD 5C0JA 1N2RB 4YEFA 4Z77A 3F58L 3D9AL 4JZJC 1OCWL 1IC7H 3ZE1F 2HFFB 1RULH 2A6DB 2FR4A 1A6UL 5EU6E 1P4BH 4GKOA 4XXCA 3NIFE 4L9DA 3BP6B 1UZ8A 4YBQD 1X5GA 1BZ7A 1KCUL 3MLZH 2PO6A 3TIDA 3IDIA 1GAFH 2G60H 3WFHB 1MJ7H 7FABL 4XVUC 4PJ7F 2VLJD 4U1IB 3MRJA 1BVKA 3FONA 1XR8B 1HSAA 2QSQA 4BSWA 2YPVH 1YEEH 5BS0A 4S11A 1P9MA 4U7KA 1ZHKA 5BMFL 2CIIA 3MGTB 3DX7B 4LSUL 2NW2B 3L1OH 4X8XA 5C9KA 3LH2L 2HJKB 3P77B 1E6OL 3MNZB 1J5OH 4BH8A 4AT6A 5IKCA 4YDIH 5EU6B 3QJHB 2C26A 4Z7UA 1MH5A 4JPWH 1QQDA 5D7LA 4EI5A 3E0GA 1A7PL 2JB5H 2B1HH 3EHBD 3SDAB 1UT9A 3ZE0F 3RIAF 2HVJB 1P1ZA 1KCSH 2BFVL 4P59H 4EDWH 4XVSH 5IP4A 5D1QB 4QCIA 4YPGA 4HUWB 3CLFH 1OQXA 1WISA 2W0LA 4L4TE 5FK9A 5J89A 3TZVC 5DDHB 5DJ8A 3ARGA 4LLMA 2P8MA 1NANH 5E6ID 1MJ8L 4WFED 1MRCH 5TDNB 3MJGX 2AI0L 5FAAA 5JMRA 2YPLE 1YYLH 3CFJA 1RJLA 1J88A 5GSVB 5C0AD 1DBBL 2NW3A 1ITCA 1QFWM 2EYSA 2CRIA 2YUXA 4ZUWA 1HXYA 3BD5A 2HYMA 2G2RA 5JW4R 2BHZA 3WDHA 1MF2H 1PY4A 1CXEA 3C5SA 4LCCB 3QP3A 4CVUA 1IFHH 1A6TB 4HH8A 2QQKL 3B9AA 4MZ3A 3MODH 4UU9A 1YN7A 4Y4FB 1DN0B 1H3GA 4DKEL 2EDDA 2DJ4A 1R5WB 1WLHA 3VXRA 3L3DB 5FECB 4JDZB 3U6RA 4L3AA 1T7VA 2DQEH 5IF0B 4WHTB 1QSED 1FP5A 2GK0B 3KGRA 1I9RH 4LFHG 2ICCA 4DKFL 1PQZA 4XNMA 3UZEA 4YPJA 3JZ7A 5F1IB 4BH7A 5JA8B 2GSGB 2FEDC 4CU7A 4KMLB 1JF1A 2YPLB 3D6GA 4ZTPH 2UYLB 3EDDA 3L3OB 3MMEA 4NPYB 4NRZA 3VMPA 1CDBA 3P73B 4X6EB 4B7LA 1TTGA 1FDLL 5DR5H 2HP4A 4XNYL 3ALPA 1WCBB 1T6VN 3ARXA 3JWOH 3SPVB 1UH2A 4PLNC 4ZOBA 5HHXH 4OF7A 3IU4L 3VGAB 4JY5H 5KSAA 4O2EB 1XF3A 3NCMA 1TZGH 4NZUH 4UINH 1IGFL 1X5IA 4FZEL 5TH2B 3QXVA 5EC1A 4M5ZH 1HEZB 1T89A 1RUMH 3FFCE 1H3UA 3NVQA 1KJ2L 4V2CB 1RZKL 3I9GL 1CDGA 3ZKMD 3UROR 3ORJA 1IC5H 1HHIB 4N0FA 1N0LA 4GJTB 4FG6C 2VL5B 3V5KB 1IZKA 4KU1A 4JO3H 1LNUA 3NCCB 5JLZA 1U8IB 3LN4B 3HKFA 4ZO9A 4PJ9A 4WW2A 3ILPB 4Z18A 3CFEB 2Q3ZA 4PRAA 4YLQT 2AERT 4NKIH 5JXEA 2IH3A 4ELMF 2QR0B 1EV2E 4MCYA 4M5YL 3DV4B 4WJ5B 2P5ED 1N0XL 4QRPE 4Q74A 3M17A 3IDJB 4MCZA 2BJMH 2IPKA 2JB6A 2WBJC 3UTOA 4KDTC 5K33A 4BQ8A 5M95B 4KHTH 2VDMH 4U6YA 3FFCB 4OD2B 5IT2L 3MRRB 4YWGH 3VXQB 1SM3H 5DRZA 5D2NE 2B2XH 1JHTB 3HI5L 4UDTA 5AYUL 2EDHA 1NCCL 2EDTA 4LVNC 5DYOB 3VXUA 3D18B 1IAKA 1I7RA 1MQKL 1UM6L 4XCCH 4XBEH 3O2VL 5EBWA 3MBEB 1YDPB 4IRZL 2DQDL 4KZEL 3RVXC 4OTXH 5GS0D 2ZPKL 4LGPB 4E0RA 4E41D 4HUVA 1FE8L 43C9A 4MD0B 3UTQA 2HG5B 4XP4H 5KJRL 3H7BA 1RMFH 3HAEA 2NXZD 4AEIL 4OIBA 1EAJA 1BBDL 2DB8A 3RRQA 2OI9C 1AGFB 3GFUA 4QRPB 4XMPL 4I3SL 4JPKL 4O58H 3FO2A 4YHYC 4R4ND 4ZXBB 4C58B 2GTWB 4Y1AD 4GAYA 1BQSA 5BVPL 2MOVA 5KN5A 4KKNA 1R3HB 3H9SA 2X89A 1PBYA 1ZA3B 5D2NB 4PJEF 1HHJA 2C4FT 1QP1A 2WANA 4HCRH 4IJ3C 3RZCD 5E08L 5KAQF 1CU4H 5EBLA 3KHOA 4M62H 2DQTL 4P5MA 3FOMA 2B1AH 2O61B 4XPTH 2YN3A 3DI2B 3MRLB 4OJFH 5B39B 4L4VE 4G8EA 1NFDF 1S7XB 3PGDB 2KBGA 3L7EB 3OF6A 1Q8MA 4Y16C 5DVNA 1FFOA 1JCKA 2AEPL 5EB9A 3A6OA 1ZGLA 1FO0A 4O4YH 2B4CL 4S10A 5DJ0A 5T3XH 3UTSB 2D7MA 3C87A 4QXGL 1RZFH 2C3WA 3ZKSD 5A43C 3G6DL 1W0WA 3P4NA 4OZIA 2MJWA 4QHNB 1V7NL 4HAGA 5GS0H 2WWMD 4IRSD 4P48A 1F58L 4GKNA 4K2UL 4LNRB 4X5WA 2VJXA 5E8OA 1NGWA 3VWJC 2Y25A 4JY6A 2LVCA 3AXLA 4OCWH 3ES6B 5DD6B 5BQ7A 1U95A 1KPVB 3B9VA 3DMMB 4WWKD 1AD0A 4Z7WE 2EEDA 2D7QA 3MRFA 5IMKB 1B0RB 1PZUB 2UUDH 2YD1A 4Q7DA 3PDOB 4L4VB 2D7OA 4PRPD 1SEBB 1CLYL 1UJ3A 4YNYA 3WN5C 3QEHA 3AROA 1LHZA 4RGOH 3WFEL 4NBZB 1I1YA 4RNRB 5DGRA 3MUHL 5IVXF 4K3JL 1C5BL 3I75B 4OFIA 5D8JH 3KPPB 4U1LB 2P4AB 1HZHL 4HXAL 1N59B 3U4EA 3MRQB 1FZKA 2GCYB 5DQ9A 3TBTA 4OBRA 3HFMH 4GO6B 5CKAA 4MD5A 3AB0B 1WF5A 4MJ2A 2XFXB 1IAIM 5GGTA 4Z7WB 1XGRA 1NJ9A 3F7QA 4LVEA 4PP1C 1QKZL 4MHHI 1L9MA 1AFVH 3BKCL 3WV0A 1XR9A 2Y06H 3QUYC 5LG1A 3FN9A 5CZVL 4NSKB 5E8DL 2AABL 5GS1B 3EFDL 3GHBL 3QIWC 2BHUA 1YECL 2BVPA 5FM5M 3GZKA 3HG1D 3LD8B 3PABA 4JRYB 1EHLH 3ZDZE 3D0VA 1D6EB 2YC1B 4YUEL 1NGYB 4Q6YA 3QNZA 1LQSR 3O41B 1TJGL 1UB5A 1EO7A 4HQQH 5ALBH 1OWRM 1SJHA 5EA0L 5F7UA 1A22B 4XPBH 2BVQB 5E2WL 4JQIL 2XACC 5DUMH 5DI8A 1QBBA 1T2JA 1FNLA 3VI4F 1ZSDB 3SDDA 5D6DA 2IPUG 4WVRA 2CR3A 4NNPL 3RL2A 5HYEA 1T7ZA 5EU3B 1I8KA 4U6VH 4A6YH 4BK4A 1CQYA 4YHZL 1RIVH 1G7PA 4ZPTB 1DBMH 4JO4H 3B5GA 1M05A 3EYVA 4GAGL 5DA0B 4OD3H 1BVLB 2HVKB 5FHAH 4XXCC 3M8OL 4UDUB 1GZQA 2AXFB 3N85H 3MV8A 2PO6C 4OUUA 3VFWA 2ARJA 1WWWX 2KL6A 5C08D 2X70B 3IRZA 4XC3L 2R9HD 4LEOB 5MEND 1EPFA 4JCLA 4J3TA 3L3KA 4FQQB 2CK0L 1GL4B 5D7SL 1Y18B 4HUXB 3OAYH 4XNZC 3SKNB 1P9MC 1VKXA 4TULH 3U9UA 5D2LE 1XIWC 3RWDA 3CPLB 2YK1H 4PGBB 2VQ1B 2DIAA 3KXFD 3F58H 3O11A 3D9AH 1OCWH 1H8SA 1G7LB 1WUNT 5GZOC 3MLPA 1A6UH 5LGHL 5C9JA 2IH1B 4IM8A 5L0QC 3RGVB 3TNNA 2R23A 4NM8L 5HYJD 1NAML 1KCUH 3BPLB 2PTUA 3BP5A 1CFTA 4JN2A 4H1LH 7FABH 5DO2C 2R8SL 1KT2B 5ECJE 3LDBB 3A6CL 4LCWD 2BK8A 4H0IA 1YUHA 2W65A 1TVHB 1CQKA 4PY7A 2Z31D 4RX4D 4ZFOB 5ISZD 1QVOB 5HPOA 2O93L 2H26A 1GOFA 3DUUA 4FQHA 5TDPB 3JUYA 4PJCE 3CVIL 1WZMA 3DVNA 5D2LB 1ZHLA 2LTQC 4LSUH 3LH2H 1JPGB 2JCCE 1FAKT 3QSKB 4ONGL 5DJXB 2AXGB 1CFQB 4AL8L 1E6OH 4NCC2 1UXSB 4XRCA 5KZCD 3U2SB 1M6OB 3VXNA 2OJEB 4XPGL 2FZ3A 2PCPA 3OAZH 4EKXA 4ESKA 5DK2A 3NGBB 1TZIA 2ZUXA 2FSEA 4HKXA 3V6OC 3DECA 2UV3A 4OV5A 1CGSL 3L95A 5KS9F 3FTGA 4NQCE 3T0VA 3S5LB 5I1AB 3IJYB 1YEGL 2BFVH 3BZEB 2KH2B 3KPMB 1IE5A 5JW3L 2E8YA 5SX4I 2H6PA 2Y23A 4JFDE 3TIEB 4ODHL 5F9AC 3D1MC 1NCUA 5CP3A 3RQ3A 1X44A 2XA3A 2YXFA 2WV3A 1RHHA 4GG6E 5ANMA 4EQ3A 1Q9KA 3H0TA 5DMKA 1MJ8H 3IKCA 1AO7E 4NO2B 4PJCB 4K71B 2EKJA 2XWBB 2AI0H 4ZQKA 3SY0A 4WDIA 5HHME 3T0EC 3RWIB 5DC9B 5ABDE 5TE6L 1DBBH 3WNMA 5J6GA 2GJ6A 4Y19A 4D8PA 5GIRB 1JWUB 2IWGA 5C7XL 5IBUB 4PS4L 1MWAA 5ID1B 1E28B 3D0LA 4QGYA 4C55A 3RWHB 1RHFA 1F6AA 4GRWH 5L9DL 3CU7A 3MACL 4M6AA 4NQCB 4QT5B 4HAFA 4EI6B 5KSAC 2QQKH 3V95A 5CSBA 4P2QD 4DKEH 1CGXA 2YD4A 5IQ9B 4JFDB 5TFSH 3K0WA 3MCLL 3OKMB 3MOBH 1T89C 2FDBP 3LQZB 3S3SA 3OKOA 5HHQA 3BZ4B 5ETUB 2P7TB 2XZQL 3P11L 3D2UB 3OWEA 4ELMA 3WS6A 2AS5M 4MAYD 3ULUF 4GG6B 1QRKA 3MOAL 4CN1A 1AO7B 2W59A 2X4RA 3RDTB 3HMXA 4MS8C 2X40A 4P3CL 3WNOA 4LSDA 2ZCKL 1IL1B 2DI8A 3VD7A 1MI5A 5HHMB 4YHIA 1I9JH 3K3QA 2NY4C 3AAZA 3QPQC 5CJBA 4PJ9C 4WW2C 5DHXB 5HDOA 4JLRB 3IDGB 1FDLH 3BPOC 4PJBF 4PJDF 4XNYH 5JXEC 4PJ8B 1VFBA 2R0KL 5GRZA 4YR6A 1IT9L 3IU4H 3MV01 4JDVA 1A4KA 4MXVF 4IEFB 1I8MA 1HHKA 4KK9C 4FZEH 1F4WL 4RMUA 3BEWB 4AMKL 4G9FD 2IG2L 1LILA 1S7TA 3L5WB 1A3RL 3HUJF 1KJ2H 2FJFB 1RZKH 3ZHKA 3I9GH 3C6SA 4I9WE 4WO4B 1ZV5A 2VAAA 3HPJA 4X6FA 3FKUS 4U6XA 1TQBC 5SWSB 2XTJE 1YNLL 5IB5A 1MCEA 1TJIL 3ULUD 4LGRB 3H9YA 3PWUB 2WIIB 1Q94B 1OW0A 3T3ME 2XG5A 4YGVA 5LAXA 5FKAB 4KKLD 3WDIA 2VOTA 2JIXA 4ODWA 4LAQL 5JOEA 1WQVT 4DZ8A 2AJUL 4M5YH 1V7MH 1A9BA 3I3BA 4Y5XA 2AJ3B 4LK4A 4CNIB 1N0XH 4PJEA 4NQXA 5B38A 4FN0A 3GK8L 4Q58C 3UPAA 4JM2F 4NZJA 2G5BB 2AP2A 4L3ED 2C3VA 4X7CC 5IT2H 3O6FC 2VXQL 4WU7A 5FKPA 3I84A 1NFDA 3CDGA 5AYUH 3HI5H 1EFXB 5IESL 1NCCH 4P46B 5F9DC 1KTDB 3MUGB 3VDCA 4D9QE 5DD3L 1MQKH 1UM6H 2XTJB 4HUUB 3O2VH 3DX6B 4IRZH 1CXKA 4PJAE 1WIOA 3PG2A 4KZEH 4LVOC 2ZPKH 1NC4A 2CMRL 2CLRA 3D69A 2IAMA 3CVHA 5KJRH 5L2KA 3MQIA 5HJ3A 1KG0A 5C0EA 4HDIA 1JV5A 2OR9L 4IS6A 3NZHL 4LLQB 3CFDA 4I3SH 1KLFA 4ZFZA 4JPKH 2MKWA 1CXHA 5FUCE 3CX5K 3WLWD 3ROLB 1FFPB 2BDNL 3UYOD 3ELAT 2A1WL 4RAVB 5BVPH 5FDWA 2D2OA 2HLAA 1VFUA 1UQSB 3OB8A 4J1UA 4PLKD 4OZFH 5GS2D 1KB5B 2AK4B 4NQTA 4CJ0A 2VE6B 3P3YA 4NC1C 4N1CA 5K9OB 4L8BB 3V6FB 2VLME 4FMFA 2YD9A 4ZOCA 3KNBB 4JRXE 2O5XL 2DQTH 3LKRB 1ZE3C 3C6LA 1FVCB 2HJFB 3AVEA 1KPUA 1U92B 4PJAB 4G8GE 5IWLC 3BESR 5SWZA 2HT2D 5MI0C 3BQUB 3MX0A 4JFFE 5IROA 1ZEAL 1A6WL 3B2UC 3S37L 3ALXA 1NDMA 4H8WL 3HMWL 4HKZA 1FL3A 3VD9A 3Q6FB 2CUIA 2B4CH 3W5MA 1UJ3C 2XXCB 4P57B 3HE6A 4LNVA 4YZFF 2DM2A 3DARA 5FO8A 3C8HA 2VTFA 4QXGH 3ZKND 1EEZA 3G6DH 2A6IB 5DSCA 1X6NA 1V7NH 1RJYA 3QNXB 4KPHL 1F58H 5DXWA 2NX5A 4W6WB 4K2UH 3KDMA 3ARDB 4KAQL 2FIKB 1Y6NR 3CH1B 1R24B 4I5BB 3MRIB 3MRGB 1JWMA 1UVQB 4HIIB 2FEEI 2ADGA 4JRXB 1YY9C 1X5JA 1ND0A 2P5WA 2O5YL 4HMEA 4RISL 5A40E 4XWGL 2QQLL 4G8GB 1OGTB 2UY6A 4TUOB 3EOAB 1DQQB 5T1LB 3RNQB 1NLBH 4JFFB 3FOLA 5J06A 1NUGA 1CLYH 4D2NA 2HKFL 3N1GC 2DMCA 1MRDL 3VFNA 1NGQL 4XCNA 1AE6H 3WFEH 1TZHA 2XNAA 3REWA 1F4AA 4K3JH 3RU8L 1C5BH 2ZG1A 5HHNB 2NY3B 2V2XA 2QKIB 5EUOF 1JVKA 1EVTC 5INCB 5D1XA 4LLWB 1K4DB 1HZHH 4HXAH 4MB4A 1KYOJ 1TETH 5L2JB 1BIHA 2ZSWA 4KJQD 3ARFB 5GRWA 1CCZA 2WLZA 3WHXA 1M71B 1I7ZA 3FT3B 3E8UL 1QKZH 4HIJB 3BKCH 2N1KA 4OLUL 2AXJA 3KYMA 3WHE0 2JTDA 5D6DC 5CZVH 1XAUA 4JZJB 5E8DH 2F53A 3SE4A 1M7IB 1ZS8B 3EFDH 4JFEA 1MLCB 4HZAA 5C70A 5IW6A 3GHBH 1FLTX 1EUUA 3HZKA 5EN2A 3VDBA 3UTTE 1YECH 3BH8A 3WKNA 2X4OB 3NFSL 1OGAE 1U8HA 1OSZA 1QR1B 1XGQA 4PG9B 4QRRD 5BV7H 5EO0B 2XA8L 3KLHD 4YHPA 5DFVC 1TJGH 1LDPL 4HWBA 4XBGB 5EA0H 2R2BB 1RZGA 1VESA 2AQ3A 2VLKD 4Y5VC 4JQIH 2WWKT 4OLXH 1FYTA 5I66B 3M1BB 3RUGE 2X4QA 3P4OA 5J11C 5HGHB 2CSPA 1K3ZA 4LASL 2FD6L 2E5EA 3WE6B 4KQ3L 3H9HB 4QTHB 5D7IE 3X17A 4NNPH 4RZCA 1NMCC 1G7JB 1SBSL 5TF1H 3SO3C 3B3IA 3RKDC 1XGTB 4YHZH 3C9NA 3LKNA 1JZ5A 3UTTB 4PJFE 1KXVC 5EIQA 5JO5A 2FB4L 3IDMA 1U8LB 4HS8L 2Z93B 2YWZA 1OGAB 3GSNL 1VGKA 4GAGH 1R5IB 1U3ZA 4PTTA 1U9KA 2PYED 2XQYK 4YHOL 4AENA 4KMQA 2GJZA 1RK0B 3DVGA 5T3ZL 5H8DA 4OZ4B 5DHYA 4YXKH 1XF2A 4Q2ZA 4NQED 2ZJSH 3TZVB 1NAMB 4HT1L 4XC3H 3STZB 1CL7I 4HIEA 4CVXA 2FECL 4QOKA 5DJCA 1MY7A 1OT1A 3RUGB 3AREA 2CK0H 3E1F1 4WW1A 5D7SH 3QEGL 4S0TD 4Y88A 4CJ1A 1EDQA 5D7IB 3X11B 3BKML 1QEWA 2P8LA 3V4PL 1EZVY 4XPHL 4LLDB 4ZFGL 3GSOA 5C09E 3X12B 1YEJL 3VFSA 5KSUB 1ZVSB 3B9KC 3KPRD 3T3PF 5JDSA 3GMOB 4PJFB 1PY9A 1BFSA 2DQFB 3MSPA 5B22A 3BW9A 3S4SG 5LGHH 3RX5A 5C6WH 2YKLL 3W0WD 3AU1B 4YDLC 4NM8H 4MWFA 1NAMH 3DXAD 2NCMA 3QQ3B 4IRJA 1CVSC 3G5YB 3RHWF 5HGBA 3UZVB 4AM0B 3INUL 5C0BA 3SDCA 4AEHL 4H1LG 3TVMD 2YMXL 2CDEB 2AV1B 4LPWA 3NPSC 3BN9C 1KTLA 3GIZL 5T5FL 3NA4A 3TN0D 3A6CH 2EXYC 4A2LA 5JUEH 5DRWA 5BOPA 3QIUB 4L9LC 5IR1B 3SOBL 4K8RL 1A9EB 4XHJC 2FX7L 1CD1B 4HGWA 1ACYL 3CVIH 2VQUA 2VR4A 5C09B 2V5MA 3ZTNL 1HXMB 3CX5J 1BF2A 1T22B 4ONGH 4ONHA 1MCKA 4AL8H 1OAUL 3PWPA 3UC0L 4P2OB 3D25B 4XPGH 3NIFF 5SWQA 3LIZL 4LKCA 4U1NA 1AH1A 4M7LT 1JK8B 5HHOE 2YEZB 35C8L 2I9LA 1XF5A 2HLFD 2WBWB 1CGSH 1DQJA 3MNWA 4GG8B 1YEGH 5ESAB 5E94B 2YHGA 5GISL 1S7QA 1D6VL 5CGMA 4XX1G 4ODHH 1MUJA 4HLZH 1QO3B 2ARWA 1IVLA 4JAMB 5F7MC 4NO0B 1PLGH 4KH2A 4PJBA 4LEXH 2VERN 2X42A 3GMRB 4GKZA 1CGWA 4UTBL 2VABA 3VU2A 5B8CA 5EG6C 5GGRA 2LFGA 4P9HC 4O2CB 1QTYT 2VUYA 1S3KH 3SKOB 1XFPA 4DCQB 5IOPB 1IAOB 1F3RB 5BJTB 3LMJL 2N4IA 5J0BA 3HUJA 4QWWD 5E4IA 2H3NA 5C7XH 4PS4H 4X6DE 5HHOB 2V9TA 3IGAA 1T1WB 3MACH 4PYGA 3I50L 4NT6A 5DVKA 1MCFA 1XZ0A 2VIRB 2Q8BL 1MAML 4JGUA 3ARZA 2L7JA 1K9TA 3LV3B 3CDYA 5JPMA 4OV6F 2XKNA 4P2RA 3BZFA 3MCLH 4LVNB 4KKCD 5KG9B 2CRZA 3P11H 4Y7MA 4X6BB 1ZK9A 1WT5A 1MHEA 3UMTA 3RVTC 3MOAH 3RTQD 1EEYB 3JV4B 2ZCKH 5I1CL 4JM2A 2X4SB 4I48A 5I16A 2OI9B 3MRMA 1P6FA 3A6BL 2BRRH 5E2VH 1OW0C 4GRLD 3KPSA 4H20L 1B9ZA 1J7VR 4YHYB 2R0KH 1HK6A 1IT9H 3PE9A 4X6DB 2HRPL 3KWWB 5FM8A 4OAWA 4EN3D 4Y5XC 1JNNL 1PG7X 4HG4J 4C54A 5CZXC 3MRCB 4KJWC 1S78C 3PIQA 1UWXH 1KFAL 1F4WH 1Z5LA 3OJDA 4OFVA 4AMKH 3VFVB 2IG2H 5JOPE 4TSCL 4GH7B 1I8IB 1A3RH 2D9CA 4IJ3B 5DQJB 1KLGB 4URTB 4X9GA 3W11D 4MSWB 4E9LA 5IM7A 3QXAA 5EZIL 3GMLA 3ZSTA 4WUKL 1UH3A 4K7FB 1OAZH 5T1KA 3LB6D 1MEXH 1ZLSL 3RVWD 4L4TD 1ZXQA 1XCQB 1AJ7L 3FRUB 1T0PB 1MAKA 1YNLH 4MX7A 1FO0L 1TJIH 4NCDA 5EO1B 4Y16B 2NY1C 1VACA 4JZNA 4WI7A 4PRBB 4WGWB 1ZAGA 1YQ2A 2RCSL 4LAQH 3QO0B 4KTDL 2AJUH 5DEZA 1QUNA 4UAOC 5CGYC 2R2HB 2IAMC 4MYWB 1FFNA 5F1NB 1KIRB 2W0FB 3UPRB 4LLUB 1T21A 2P42B 2EE9A 3UCRA 2Q7NA 2YRPA 4BQ9A 3OKLB 4F7TA 3QHZL 1S7UA 4FQCL 3V0WL 1Y6MR 3ZL4L 4ZUTB 2VXQH 5JR1L 3S96B 1QD0A 2VMFA 3PWLA 3HC3L 5DVOA 5IESH 4OCMC 4KJYA 5EOQL 4HWUA 2V9QA 3WLBB 5EPMB 15C8H 5DD3H 1NBZB 5I0ZA 5IW3A 4NDMB 5DJDA 2DBLL 4EUPB 3MRNB 1Z0MA 3C6LC 1KLUA 2IPUK 3WN5B 1I1AC 1OTUC 2CMRH 4FHBD 1QFPA 2KUTA 5SX5H 1AGCB 2BSED 4OFYD 4XH2B 3N1MC 2Z35A 5AUMB 1DANU 5JNYA 2OR9H 4BUGA 5INDA 5L88L 3QI9A 5CIPH 3L5JA 3NZHH 4MJ5A 3SGEH 1BIIA 1I1RA 4NRYB 3HE6C 5F97E 2CKBB 4P4KD 1QSVA 2BDNH 4RDQG 4G80A 5LGJB 4QHLB 1HNFA 4PTUA 4JQVA 4KGJA 4OZFG 4D9RE 5H35B 5A16B 2E7MA 1XH3B 3HZMA 1FL6B 1FLRL 2F8XC 3G08A 1YQVL 1YEDA 4RMRA 1KJMA 2BOCA 4F7PA 1I4FA 4HC1A 2FLRT 5EFIA 2X4UA 3J8F7 2P8PA 5ERWA 1VDGA 3QIWB 1VEPA 4RGMB 2AAVA 4XXDA 1QRNA 1IGTA 1Q9WB 2FL5A 1K2DB 4DZBA 1RZIA 3QEUA 3MBED 5EUOA 1ZEAH 3CD4A 5JIPA 1EFQA 2WP3T 1A6WH 4S1DC 3S37H 4H8WH 2X1WL 3HMWH 3CU1A 3HC0B 4PV9A 5C0GA 3T2QA 3WO4B 4K7PL 3V8CA 1JIBA 5ESVB 2CO6B 1GIGL 2PW2B 4KPHH 3SQOL 3BPCB 2ESVA 3GGWA 2CUHA 3MZTA 5LKNA 4FXKB 4KAQH 3X14A 4OM0L 4BFGA 4I4WB 4CL7A 5BS0E 3MJ8A 1ES0A 2A0LD 5JOFB 3K8MA 2O5YH 5FA3B 4UQ3B 4RISH 5CEXA 4JM4L 3HS0A 2QQLH 4MQXD 4P23D 4XWGH 2W38A 1TTFA 1XF4B 2ZUTA 1A5FL 5C0JB 4BM7A 3S36X 2BNQA 2J1KA 3SE4C 4OCSL 2FR4B 2HKFH 1DBAL 1TVBB 3KLSA 1MRDH 4Z7UE 3FQXB 1NGQH 3LHPH 1PEWA 1UZ8B 3D48R 4FXLA 5D7LE 1BZ7B 3AS2A 4OQ1A 1J87A 1LE9A 3KVQA 2X1PA 2PO6B 3RU8H 3TIDB 3KPNA 3HNVL 4JKLA 3TJHC 3W81A 3IDIB 3REVA 2DJUA 3HE7A 5EBMA 5F88A 2J6EA 2WK2A 2C5DC 1R3LA 3MRJB 2NLJA 1BVKB 5AAMA 4JN1L 2VC2H 4J2XA 4XNZB 4BSWB 4Z7WF 5BS0B 5T3ZE 1LEIA 1QSFA 1R3IL 3KPQA 1ZHKB 3E8UH 1S5HA 4OLUH 5IV2A 1ZGLP 2CIIB 1ROWA 3VFGL 1OD7A 4BQ6A 2KZ1B 3ARSA 2J8HA 5HGAA 4O2FA 3STBA 5L0QB 1KEML 3RVUC 1CVRA 4BH8B 3TFKD 5IKCB 1JHLL 3DUSA 1D5BA 3FAWA 5IG7A 1G7MA 1ZT7A 4Z7UB 1MH5B 2M2DA 1QQDB 5DURB 3L7FB 4NBXB 3FQTA 5D7LB 5B4MD 3H42L 3DX9A 1P6AB 5D6CB 2VXTH 2XA8H 3VRIB 1U8KB 4HHAA 4MA3A 1P1ZB 1QSZA 2J4WL 1T1XA 2XN9A 1LDPH 2PKDA 4PLJC 3CCHA 2DWEA 3GSNB 4QCIB 4JHAL 4YPGB 3VXRE 1Y6KR 3HB3D 4GQPH 1JTOA 5J6HA 5C86A 1CDIA 1VB9A 2UZIL 4IOFC 5FK9B 2HFFA 4N8VG 8FABB 5DJ8B 1H9VA 3DIFA 2P8MB 4LASH 2FD6H 2LTQB 4KK6D 1B0WA 1CTNA 3QDGE 4KQ3H 4F7MB 1QOKA 2WQ8A 1T5XA 3RI5K 1AIFB 1T7WA 3QR2A 5EOCL 1SBSH 4FQJL 3CFJB 1RJLB 3JWNC 2E6QA 1FV1A 2CDGA 5C6TL 2FB4H 1G9MC 2EYSB 4HS8H 1P5UA 4ZUWB 3ZDZF 1HXYB 2G2RB 5T1DL 2Y7QA 4Y2DC 1B6UA 1SMAA 4H26B 2NY2C 1SVCP 2YZ8A 3C5SB 4K07A 1BBJB 4G6FD 1W0VA 4HK0B 5I1HL 4UU9B 1YN7B 4IRJC 5T3ZH 5FEBA 1JGVL 2FHFA 2AJZA 2UWEF 1TCMA 3VXRB 1FG2A 5ITFB 5CJQL 1U58A 3MNZA 3IETA 3QO1B 5F6HI 5F8RC 3O9WC 2C7UA 4Z76B 5FV2A 5JPNA 1PQZB 3QDGB 1A3QA 3BKMH 5EUKA 3EGSB 2VLJA 1TDQA 4XPHH 1BVZA 3V4PH 5TJWK 2V17L 4ZFGH 1S8DA 2HVJA 1JF1B 3B4NA 4P0DA 1YEJH 3LKQB 3MMEB 4HJ0D 3G04A 1K5NB 3QT2A 5D1QA 1V3JA 5F1OB 4GKSB 4PD4K 1PG7W 2YKLH 4F7CA 3PWNB 4W4OA 5KSAB 2B8OT 4XNXL 4LARH 5EC1B 4AEHH 1UKQA 2YMXH 4IBLT 5D93C 1Z9LA 4G43A 2X10A 3GIZH 5T5FH 2OSLB 4XWOC 3OGOE 1GCFA 5GSVA 3CDFA 4N0FB 1U3HC 3AY4A 1IEBA 2EXWC 3BKYL 3Q48A 4LDEB 3VXUE 1R5VA 1FCGA 1PEZA 3MC0A 4LP5A 4K8RH 3SOBH 1FRGL 2FX7H 4N5ED 5JLZB 2NY4B 1ACYH 4MJID 3TBSA 1U8PA 4PJ9B 1LVEA 4WW2B 4WEMB 2IQ9L 3ZTNH 5FOJA 3BPOB 4FQXD 4FRWA 2XQBL 1EO8L 2EDYA 1R5WA 2IH3B 5B8CC 1N6QL 3Q6GL 3HTLX 1OAUH 4X7TA 3UC0H 2HT3C 2W07A 4MCYB 5D9SA 3L3DA 3QQNA 1MCWM 4GMSL 3LIZH 4M6NL 1FFRA 4WHTA 2YN5A 2GK0A 3M17B 4M8QA 35C8H 5ACZA 3BX7C 2IPKB 4JEGB 4R97B 1CD9B 4G6AC 4JJ5B 4KVCL 4U6YB 5GISH 2YUWA 1U0QA 1D6VH 3L3OA 3H9SE 4X6EA 3MBXL 1TQBB 2XZCL 4S1RL 3S6CA 3GSQA 4NNXA 3OKYA 3C5ZC 5CLWA 3VXUB 1BQUA 2QADC 4OCRL 4PJCF 1WT5C 5EBWB 4UTBH 4RGNC 8CGTA 1NUNB 2Z8RA 1QSEA 4U3HA 4E0RB 1A7BA 4HUVB 1KJ3L 4S1SL 3ZZ1A 3OGCA 3RAJL 43C9B 3UTQB 4OF6A 4ZNCD 3H7BB 3Q3GA 3HAEB 2DKUA 1T03L 3LMJH 4F2MA 3O3EA 5I75C 2ZOLA 2JKXA 1HHIA 3CH8A 1MQ8A 4HD9A 4NKDA 3P0GB 3FO2B 3V5KA 3I50H 3WFZA 3T65B 4OZIE 2Q8BH 1NEZB 4GAYB 1MAMH 4N90E 2QSCH 4UMGA 4DK6A 2NTFA 4JY4A 1U8IA 3O6FB 4NC1E 3FAXA 3CFEA 3H9SB 1PFCA 1IGIL 5I8EA 1QLEL 1OM3L 5F6HJ 3MLVL 1I85A 1PSKL 5D7JD 4GG6F 5EBLB 3K4AA 3VE0A 4WJ5A 5GRVL 5C0CD 4WENB 4YK4B 4P5MB 4LVOB 3UO1L 1KGCE 2VYRE 3GBLA 3JVGA 3IDJA 5I1CH 4N1EA 1OTTC 4Y4KD 2UUDK 1FFOB 2QHRH 3NACL 3MRRA 1ZGLB 1FO0B 3VXQA 4H20H 2VB5A 3E2HC 2NYYD 1JHTA 2P1YA 3V6BR 2HRPH 5HI5C 1Q9OB 2R1YA 2WSKA 5DYOA 5KVFH 3P4NB 3D18A 4LPUA 1S7SB 1KB9K 1KFAH 4R2GD 2DL2A 3SBWC 1UH4A 3HI1A 2P5EA 4NQCD 5I1EL 4GKNB 1DQML 1D5ZA 4HCRA 3KR3L 1A47A 1KF9B 4X5WB 5E8OB 1NGWB 4JY6B 4MD0A 5DJAA 5EZIH 4WUKH 4EZMA 3KYNB 1AD0B 5F7HA 1X5AA 2GTZA 3MRFB 1ZLSH 1HQ4B 3D2UD 1AJ7H 3SJVD 1GGYA 4ZXBA 2VZUA 3TP4A 3RDTD 2NXYC 4GAFB 2LQRA 5J1AA 1UJ3B 4YNYB 3QEHB 2RCSH 5E2UL 3WJLA 1AHWA 4KTDH 1ZA3A 3C8KA 1QLRB 1I1YB 1AGEA 1V8HA 3QDME 5HHPA 3M45A 3N1PC 2RB8A 4E41A 4K23L 1RUAL 4C4KT 3QCUL 5GGSB 3CC5A 1LO4H 3MLXL 4Q9RL 3QHZH 1UKTA 4FQCH 4NFBA 5D71H 4XTRC 5F9OH 3V0WH 3ZL4H 1OTSD 3U4EB 1S7XA 1T5WA 3PGDA 2FCBA 3LQAC 4RDQF 1FZKB 5JR1H 1KXQE 5DQ9B 2HMID 5I30L 3IB4A 4Y1AA 3TNMB 3HC3H 1XGRB 3W5NA 4KGLA 1NJ9B 4L3CB 5EOQH 3UTSA 4O00A 3VRLF 1BJMA 2M26A 3W9DA 2I9TA 2DBLH 3AMKA 4QHNA 3EZ8A 3T3MF 4ZO8A 4WEBL 4R0LA 4KY1L 2BVPB 5F7DA 4LNRA 5FYJL 4ALAL 2H2SD 3PABB 4HPOL 3QDMB 5DD6A 5L88H 2VDOL 2FNBA 1KPVA 1Z6JT 2HFGL 3QNZB 1BPVA 5DMJB 5IMKA 1UB5B 1HILB 2GYSA 1SJHB 3MV8E 2WW8A 2YPKA 3EYQD 3CFBB 1J1XL 4L4VA 4PGEB 5JA9A 3IJHA 1FLRH 1WV7T 5D7KE 1YQVH 5DI8B 1AGBA 1SJVA 5A2JH 1JGDA 2B39A 3IDYC 3KLAA 4IRSA 2DM7A 4I9WD 3SCMC 1MFDL 3MYZA 4P46D 4PJAF 3RL2B 2YD7A 2CLVB 3ZE0E 2CXGA 3I75A 3EO9L 1I8KB 1JRHI 3KPPA 5T5NG 4L1DA 1ZLUK 3BJ91 3ZYJA 1GYAA 4Y0GA 4U4BA 3QJFA 1O7VA 3EYUH 3ILQC 1M05B 2DM4A 3MRQA 2GCYA 5C3TA 1LP9F 3EYVB 1CK0H 3QXTA 4PRDA 3BRGC 1GZQB 2X1QA 4D0CB 1F00I 4HBCL 4MVBC 3MV8B 4UT9L 4Y5VB 3VGBA 4K7PH 1A6VL 5BRZE 1CTOA 2VDPL 3GJFH 2ARJB 1GIGH 4NSKA 4OUUB 3VFWB 3SQOH 3LY6A 32C2A 3Q0HA 1M7DA 4X9IA 5DUPL 5E24E 5J11B 3QBTB 4G8FA 4OUOA 4OM0H 3L3KB 2W0KA 4I2XA 1U6AL 1NMCB 4A6YA 4JRYA 3KS0H 3SO3B 1VKXB 1D6EA 5F7LB 4PP2A 4KI5D 3U9UB 5LBSL 4JM4H 3O41A 5CEZL 1A5FH 2Y5TA 2IBBA 3O11B 2A2QT 4OCSH 4HIXL 1DBAH 2VLRD 1K6QH 1B0GB 5GSRA 2KDGA 1HCVA 1BM3L 3BXNA 3HNVH 3OAZK 1E27A 1CFTB 2GQHA 5BRZB 4M4PA 1P7QB 4JN2B 2VXSL 3LQMA 5EU3A 2GITA 4WRLA 2W65B 3RWGA 4MD4A 4JN1H 4PY7B 4YO0B 1YPZE 1ZLWH 3QULA 2ZZUT 1R3IH 3DUUB 2CDFA 3U7WL 3LVEA 2VITA 1E4XI 3EYFA 3B9KB 3VFGH 1CE1L 4JRXD 5HDQL 1ZHLB 2DIBA 2XZZA 4H5SA 5E5MB 4UDUA 4EEEA 5ID0A 3QG7L 4M1CC 3S4SA 3PL6D 2ORBL 3UJIL 1KEMH 4JG0L 4XRCB 4YDLB 2UWEA 3WO3B 1JHLH 2GJ6E 5T1LD 4Y19E 3VMNA 3UYPA 1G84A 2PCPB 2VDRL 5H2BB 3QQ9C 4LEOA 5DK2B 3W9EB 1TZIB 5SX4H 1IKNC 2FSEB 3Q5TA 4HKXB 4KK8D 1A8JH 3H42H 4OV5B 4H1LA 3WIFB 4D0BB 2Q7YB 1PZ5A 3I6LE 3SKNA 4JKKA 3NPSB 4LU5L 4M1GL 1M4KA 2J4WH 3UAJC 3LSOA 4ODXB 1K3IA 1U8NB 2H6PB 4JHAH 5DHVH 3CPLA 4OGYL 3DROA 4O51A 5I1DA 4ZO7A 4KUZL 2UZIH 5CBAB 1G7LA 2FO1A 5GZND 1YPZB 4OKVA 4ELME 1RHHB 2IH1A 1OF2A 3QZWG 3IKCB 3L3IA 5C08A 3RL1A 5HI4D 4WDIB 4N5UA 1MI5E 5EOCH 1RAMA 4ZS6D 1KIQB 4FQJH 2AJSH 2GKIA 2OMBA 3I85A 4OCNC 1ETZA 4CMHB 2D9QB 4X4MA 1KB9J 5J6GB 1BWWA 1KT2A 1ZHBA 2RR3A 4JE4B 5C6TH 3VGEA 2GJ6B 4Y19B 4D8PB 1P7HL 5JHDE 2J8UA 5T1DH 1MWAB 4TPRL 4OIAA 4QEGA 3KXFA 1CD0A 1Z9SA 4LGSB 5TDPA 1UACL 3EBAA 5I1HH 3B8YA 1JGVH 2I5YL 5CJQH 5DJXA 2AXGA 1CFQA 3RUGF 3BAEL 4TVPL 1M6OA 3F62A 3EHBC 5D7IF 5TE7H 1P53A 4K3DL 1TITA 2YD3A 1MPAL 2Z4QA 2X4RB 4B41A 3G6JA 1YZZA 4LCWA 3PWJB 2GJJA 2V17H 3L3HA 1MI5B 4GLRI 4RCAA 4YHIB 2Z31A 4FXGB 3BZEA 3KPMA 3T4AA 5I8KL 4U7SA 5CSZA 3LRSB 3JWOC 1EO5A 4QYOB 3CMGA 4DKAA 5JHDB 3BWUC 1VFBB 4R96B 5E6IC 4YR6B 3QAZC 4XNXH 1CGTA 1I8MB 2RQ8A 1HHKB 4JJHA 1MCOL 3ZO0A 2XWBA 3H3BC 4MB5A 3ZDYE 3OAUL 4X8JB 1S7TB 3G6AA 1XT5A 2ZCHL 3DETD 3DURB 1JYXA 3C6SB 1NFDE 4KFZC 3BP4B 2HAZA 2VAAB 3PWVB 4U6XB 3BKYH 5GIRA 5ID1A 1Q0YL 5CFHA 1FRGH 3RWHA 5IB5B 3O8XD 1GVIA 2IQ9H 2L7UA 4JREC 4QT5A 4EI6A 3PDGA 4YGVB 2DYPD 2XQBH 1EO8H 1N6QH 3Q6GH 2JIXB 4ODWB 4UI2A 5F8QC 4U05A 1CF8L 4Y5XB 4GMSH 4M6NH 3KPOB 4NQXB 3H7LA 1AY1L 4TNVF 1G0YR 4R26L 1W72H 4XB7A 2MKLC 4FQLL 1KJ2A 4KUCF 3V5HA 2C3VB 1PX3A 4OCXL 4KVCH 4Q9BA 4MXQD 4HZLB 4LL9A 3EO1A 5FKPB 2NZIA 1F3DJ 1NFDB 1QFWI 3O2WL 2HT4D 3MBXH 4S1RH 2B7DT 1NC2B 2BSSA 4OCRH 1I85C 3QIUD 3MJ9L 5C2BL 2NY1B 2EIBA 2D4DA 2P45B 2F74A 4Z78A 5HVHC 1RUQH 4MAYA 3BEWA 4CAGA 1KJ3H 4S1SH 1NC4B 3ZKMC 4UAOB 3D69B 2IAMB 3CVHB 2XI9A 1KG0B 1T03H 4MDJA 2FJFA 5C0EB 2DLFL 4HDIB 4V2BA 4IS6B 4KKBD 4YQXL 3CFDB 4P2OD 4ZFZB 3RWJA 1A7QL 2VDQL 1X5ZA 5SWSA 5FDWB 4WTZG 2HLAB 5DWUH 1D9KD 5I1IL 3NH7L 1CT8B 2WIIA 4AQOA 1Q94A 1IGIH 1CDHA 3KPLA 5FKAA 1OM3H 1MCRA 2NR6C 2EDOA 3MLVH 1PSKH 4OGAD 4JGJA 2HA1A 5DJZA 4Z7OF 4CNIA 3C6LB 3BDYL 4PJHE 1I1AB 3UO1H 4NQUA 3RIFF 1KPUB 4LKXB 2CLZA 2OJZL 3IFLL 2G5BA 1IEAB 1C08A 3O3AA 1KN4L 3WYRA 1S9VA 2EKSB 3O3DB 1MCPL 5EWIL 4HKZB 1FL3B 1NEZG 3NACH 1FNAA 3QFJB 5CJXC 3HE6B 4X6DF 3QISA 5FO8B 2R15A 1AHWC 1KTDA 3MUGA 1EEZB 4OZFA 5DSCB 1CWVA 5IBTL 1RJYB 5GS0C 4HUUA 5FYJE 25C8L 3SDXB 3UBXI 4UILL 3IU3A 1GH7A 5EDXA 3HCVA 1JPTL 4DKDC 2NXZC 1DQMH 5I1EH 2Z91A 3KR3H 2BY2A 4OLEA 4OD1L 4L3EA 5FYJU 4XP5L 2ADGB 4UV7L 3MV9A 4R4NC 4F58L 5MEQB 1P4IL 4PJHB 3OKDA 1KIUA 2ED9A 5I1JL 4Q0XL 4LSSH 1TNMA 1FFPA 4DVBB 1UEYA 2F53E 2GY5A 4O5LL 1FVDB 4WUUD 2AK4A 2I60L 4I8DA 2BOBA 4UNUA 5E2UH 2VE6A 3RZCC 3V52L 1XMWA 5IJVB 2N7AA 3NZ8A 4R0LC 4XCNB 1IGJA 4U1HB 3QPXH 5K9OA 4GW5A 4U3XA 4D0DA 1HNGA 4K23H 1RUAH 3LKRA 2HJFA 2ICES 1U92A 3MLXH 4PJAA 4Q9RH 1WZ1L 4NYLA 3BQUA 2EO9A 2DQHH 2ZSWB 4MJ6A 4PGCB 5I30H 4UUJB 1FYTE 3WHXB 3Q6FA 1LD9B 2MTPA 1I7ZB 2ZG2A 4P57A 1LP9A 3DJ9A 2A6JA 1IJ9A 2DTML 4M48H 4DJMA 5DRNA 5I73B 5KBNC 2WWMC 4IRSC 1IGYA 2F53B 5FYLL 4ZSOA 5IW6B 5EN2B 3QNXA 1ZGLM 4WEBH 3BH8B 4KY1H 1F4HA 5F9WC 4WWKC 2AEWA 3ARDA 2LVEA 3MLTB 4ALAH 1MVUA 2FIKA 4DQOL 1U8HB 1OSZB 1R24A 5CEZE 4HPOH 1UFUA 3MRIA 5T5NF 2VDOH 1UVQA 1XGQB 2DQCL 4V1DD 1J0KA 3QHFL 5EBGA 4LHUG 5CD3B 2OTPA 1BJ1J 1PDKA 1J1XH 1OB1A 1U8OB 3BHBB 3RNQA 4JFFA 1RUKL 1CE6B 4ETYA 1IC7L 3GMNB 1RULL 1BX2B 4M61A 3T0XA 1T20A 3EJZC 1KUMA 4PV8A 4XGZA 3MCKA 1U8QA 4PRHB 1G7QB 1MFDH 2BCKA 4RZCB 4IIQA 2IAND 3EO9H 3MXWL 2QKIA 3C9NB 1GAFL 5INCA 4LLWA 2XV6B 5JO5B 4PBWD 1K4DA 3IAQA 3IDMB 4RBPH 2DQUL 5KVMC 3ARFA 3FQNA 3AS0A 4PR5B 1WEJL 4GRMA 3CX2A 4I3GA 4PTTB 4AEEA 4EDXB 4MJ4A 4HIJA 1YA5A 5AYQA 1WIUA 5C0BE 2GJZB 3G5ZB 1SYSA 4HBCH 4FP8L 4UT9H 1KEGL 1A6VH 5DHYB 2VDPH 1XF2B 4Q2ZB 5E6YA 1M7IA 2VN7A 4N8VA 1ZS8A 4HIEB 4CVXB 4LOUD 2NZ9D 3C5JA 2DWDA 5CJ8A 2X4OA 4YDIL 4EBQL 4WW1B 1U6AH 3WDJA 1QEWB 1WAAF 3GSOB 5LBSH 3O4LB 3VFSB 1KCSL 2GY7B 2XWJA 3RY6C 2R2BA 5EC2B 5B3NA 2Y07L 3OB0K 1KIPA 3PWPE 5GGVY 3MA7B 3BW9B 3V79C 1RQ5A 5E03A 1LO5B 2NY2B 1EVUA 5EOTB 3FO0L 1IAII 4MWFB 4N0YL 4PUBL 4IRJB 5HGBB 3IF1B 5AD0A 1BM3H 3V0VA 1TQCC 2FJGB 3OZ9L 5C0BB 4NQVA 3RNKA 2VXSH 3IT8D 3VRJB 1KTLB 2EE2A 3F5WA 3O9WB 1MLBA 4QRRA 3LPWA 4APQD 4ODSL 5DRWB 2Z93A 5CD5D 4ZAKD 4PJBE 4HIHA 1S7RB 1R5IA 4HGWB 3BP7A 4Z0XA 1CE1H 5HDQH 2YUZA 3MNVB 5T33L 2NQCA 1NMBL 4HFUL 4YXHH 4R90H 3QG7H 1RK0A 4HS3A 2R9HC 3GJEB 4ONHB 2ORBH 3FFDA 3PWPB 4JG0H 3TZVA 1NAMA 3STZA 3HUJE 2VDRH 2XOTA 4X4YA 5K9KA 4LKCB 4TVPD 3DO3A 4LMQI 2I9LB 1XF5B 2Y1VA 1OP5H 1NGZA 2XRAL 3CSBA 1DQJB 5D93B 3MNWB 4LU5H 4M1GH 2EE3A 4L4JA 2PO6D 2AGJL 1U3HB 3SGJA 4OGYH 1MUJB 2DQFA 4KUZH 2H2PD 4PJBB 5J57B 4RGNE 3AU1A 4X99A 5K9JL 4NQEA 4GKZB 4UIMA 4DFIA 2VABB 3FCTA 3G5YA 2ZG3A 3MLRL 4YHLH 1JHKL 3WFBL 4KV5E 5B8CB 3UX9B 5GGRB 2V5TA 1YEIL 4G3YL 1EGJL 4AG4L 2CDEA 4N0CD 2Z31C 3L6FA 3KPSE 5LCVH 2UVFA 3ARPA 3IGAB 2F54B 3IRPX 3KPRA 1CZ8L 2Z8WC 4NT6B 3HR6A 1XZ0B 1A9EA 2HKHL 4JPIB 1CD1A 1G7IB 4EI5D 5MEPB 4XI5D 3GM0A 3CZJA 5DO2D 1X4XA 2I5YH 3ZLQC 3RWFB 4HFWA 3DXAA 4NKIL 1T0NA 2QADB 4U6HB 4PRID 3CXHK 4DUVA 3BAEH 3EJYD 2CR6A 2V9RA 4TVPH 1N64L 1JTTA 3D25A 1MHEB 3TPKA 1H0DA 1B90A 4PPTA 4RGNB 2Q6WA 4PGZA 4K3DH 3WXVH 1MPAH 1MFCL 4ETQA 4R6UA 1JK8A 5KSBE 4W70A 3SGKC 3ARGD 3TN0A 5JIIA 2P44B 1JF5A 5IEKA 4AIOA 2OX5A 4C56E 5JTWA 4HX1A 5E4EB 1WFNA 3UJTL 3MRMB 5I8KH 3NCJL 5E9DB 4LDOB 5AZEL 3KPSB 1JPST 4ODBD 2B2XL 3BPNC 3QWRA 4OAWB 4GAJL 2XTLA 2LU4A 3BYTA 1E6JL 1EHNA 3PIQB 3GMRA 4ZDHA 1MCOH 3OAUH 1DVFD 1F6FB 1EHXA 4LRNL 1RZKC 3RWCA 4O2CA 2ZCHH 2BC4A 3Q5OA 1RD6A 1RMFL 4ZUSA 5HYFA 1UEMA 3VXRD 1IAOA 3L5HA 5BJTA 1D5MA 3N1QC 5T1KB 2BNRD 2XICA 4Y2OA 5KVDL 2ADFL 1Q0YH 2WBJA 4PG2C 4B50A 4YZFE 5HHOA 5KSBB 4MX7B 4WW2F 1DUYA 3VG9B 3DNKA 4HV8A 2VIRA 4X0KA 4C56B 1VACB 4JZNB 3EJJX 2QV2A 1X9QA 5JW5A 3FB7B 1GRWA 4PJGA 1FNEA 4MAYC 3I3DA 3BGFC 1CF8H 5GHWL 1H3PH 1Y0LB 3BGAA 4AQ1B 3DPBA 1CU4L 3JXAA 5SX5K 1FFNB 2B5IB 3MXVL 2B0SL 4R26H 1EEYA 1T21B 3JV4A 4M7ZC 4FQLH 5CGTA 4XPTL 3DO7A 3CFKA 4OCXH 4F7TB 2E3VA 3JSSA 1EEUA 4OJFL 2X4SA 3ULVD 5FF6B 4UT7L 5CILL 2Z0BA 3VD5A 3O2WH 5FGBA 1MFNA 3S98A 1F8TL 4M6OH 4KJYB 1RK1B 1OAYL 3MJ9H 5C2BH 3CDCA 4MS8D 5DJDB 5GGUA 1HQRB 1WWAX 3GMPA 5B3JE 3MRCA 1QRNE 1EZVX 1K4CB 3TF7C 5GS0L 3QPQD 5FOBA 4FFZL 4PJ9D 4IMKA 3RTQA 1I8IA 5FFLA 3EFFA 5FM5O 2Z35B 4XP1H 2DLFH 4JQXC 3QI9B 3QFDA 4K7FA 1P7KA 1J0YA 1BIIB 5JW4Q 1LEGB 1A7QH 1QPXA 2VDQH 2NNAA 4G80B 3EO0B 4KK9D 3FRUA 3IDNA 4PTUB 4O9HL 5EO1A 4KKLC 5I1IH 3NH7H 2IFGA 3G08B 4PRBA 4YX2L 1U41A 4EN3A 1YEDB 1KJMB 2BOCB 1UYWL 4R4BA 4F7PB 1BD2D 1JRHL 4XMLH 1I4FB 3TPUB 1PVHA 5EFIB 2X4UB 3BDYH 4OIIL 2YXMA 5ERWB 2ENSA 2OJZH 3IFLH 1QRNB 3UPRA 3TBYA 2FL5B 1KN4H 3RVVD 2OTWA 1RZIB 3ULVH 3QEUB 2X9YA 3VWJA 3OKLA 5CIPA 1MCPH 2BNQE 5EWIH 5E8NA 4NN7B 4ZFFA 1LGVA 2DJSA 3VWKA 3N1FC 2V5YA 5CHNB 4PV9B 2ED8A 4PJXA 5IBTH 2C3GA 4LCUA 1PD6A 25C8H 1WGOA 1BP3B 4UILH 3GGWB 1JPTH 5EZJA 1U2CA 5GS3A 3IDYB 3WN5A 2RGSA 2MHAA 4DEPC 2ICEB 4QF1B 5GGRY 1QFOA 3B83A 4W81A 1T1YA 3RKPA 4OD1H 3RFZC 3SE3A 1A1NA 4XH2A 3H9SD 3SCMB 5F1SA 3G5XA 4J3VA 1QSFE 4XP5H 1L0YA 5AUMA 1WC7B 2JK5A 4UV7H 3WLWC 3SGDH 1MHPL 1FFQA 4U49A 3FB8A 4QNPE 1P4IH 4LHJB 5CEXB 5I1JH 4Q0XH 2VXUH 3P9LA 4PLKC 4U1GC 5ALBL 3QXWA 3W82A 4MNQE 5E7FA 4WI6A 4ODVL 4O5LH 2JF1A 5H35A 3OHXB 5DUBA 5E00A 1ZWIA 3QEQA 3PHQA 4Y8AA 5ESQA 3SGEI 4X6CA 3V52H 4GXVL 1QFUL 1KXTB 4XNUL 5IMMA 4MXWL 3HA0A 3T2PA 1JL8A 3MREA 3C2SA 2IALA 3B43A 1LE9B 4Z0BH 4U33A 3QUML 3QUYA 2WINA 3KPNB 4CN6A 2HT2C 2XN9E 4OFYA 4EQ2A 3HE7B 3QIWA 5F88B 1YNTA 3HI6L 1Q9WA 1WZ1H 1E4XL 1R3LB 2NLJB 1K2DA 1RIVL 3T3PE 4P4KA 4D3CL 3HC0A 1YC7A 1QSFB 5FGCE 3ZKNC 4DK3A 1LEIB 3MRPB 1KTKE 1PG7L 2K7PA 1FIEA 5IV2B 3TCLB 1A1MA 2DTMH 2FO4B 1ONQA 5B21A 2APTA 5FYLH 4MNQB 1WJ3A 2G75B 3QWOB 3DUSB 1D5BB 3DTXA 5IG7B 1G7MB 2FX9L 4DQOH 4FXKA 3H6JA 3FQTB 4JFYA 3QG6B 5BV7C 2DQCH 1AQKH 2OXHA 3CXHJ 3DX9B 3ZYIA 1VERA 4HHAB 5TQ2H 4MA3B 3NFNB 2XN9B 4HPYL 4MQTB 5HYIA 1WAAA 5IGXL 3CCHB 1E4KA 2HFTA 1XF4A 4FTVB 2MCG1 3VGDA 5J6HB 2EZ0D 1WBYB 3BGMA 3GSWB 1PJ9A 4PJ5D 1RUKH 1KJVB 1MREL 1TTUA 4QRSA 2WAHA 5JQ6L 5FGCB 2ED7A 3DIFB 1TVBA 4J6RH 3FQXA 3PGCA 2XKUA 1T5XB 2VLJE 1IM9D 1B4RA 4HS6A 5J3HC 2V2WB 3MRKA 2OP4L 3MXWH 3IDXL 4KJQC 1FV1B 4FQPA 2CDGB 1U36A 1YJDL 4QRUA 4CKVX 2DQUH 2Y7QB 4QY8A 1WEJH 3MFGB 4H0GA 2A38A 1UCTA 5AEAA 1BECA 3DRTA 2YBRA 1XIWA 1FORH 1W0VB 1S9XB 1KEGH 4FP8H 2WQRA 2AJZB 1GC1C 1FG2B 1ZANL 3C08L 3D85A 1U58B 5FV1L 2AVGA 1NGPH 3IETB 1N6VA 3RZWA 2GAZA 3N06B 2C7UB 4EBQH 1MCHA 2P49B 4NNYB 5JPNB 3OKEB 3L7FA 5EUKB 2VISA 5HVGB 2VLJB 4D9LL 1ZA6B 2GUOB 2FGWL 1JYVA 3SDDD 5D6CA 3VRIA 1S8DB 4WHYH 1U8KA 4B7IA 3G04B 4JFXA 3GSNA 2XWTB 3EYSL 2Y07H 4BSVA 2J8OA 3TH3T 4NGHL 2OBGA 4F7CB 3U9PL 3FO0H 1SYVB 2Z92B 3MLUL 2NTSP 8FABA 4N0YH 4PUBH 2OCFD 4F7MA 3OZ9H 3VGGA 1AIFA 1JZ8A 4G43B 4X4ZA 2HFEB 1G0XA 2JJSA 3SKUD 4ODSH 5CEYA 3WS3A 3UTZA 1IEBB 3SGJC 3V6OA 1HE7A 2ZNWA 1R5VB 2WZPD 4H26A 4BQBA 1A02N 3TBSB 1U8PB 4LLAA 1DZBA 1CDUA 1BBJA 5T33H 1NMBH 4UIKL 4HFUH 1QSEE 4HK0A 3T1WA 3RKDD 1C5CL 1KACB 5E6IB 4WI3A 3LKSA 3WFCL 4X7TB 3QAZB 5TFSL 2QLVB 5ITFA 5D9SB 3MOBL 4DGYL 3QO1A 4R4FL 1AKJD 2YRLA 4M8QB 4Z76A 5ACZB 4HK3N 1QFWL 3QDGA 2XRAH 2BRQA 3MR9B 3T0EA 3EGSA 2FECI 3OL2A 1OP3K 3S36L 1HI6A 2AGJH 3LKQA 1I9JL 4XHQA 3L3GB 5BZWA 1K5NA 2NY7L 1YPZF 2XQYG 3DX8B 1HN1A 3ARWA 3GSQB 4NNXB 5I9QC 1SQ2N 4GKSA 4PRNA 2P24A 3PWNA 4YGAB 5K9JH 4JREB 2DQJL 3MRHA 4J3WA 3TVMC 3GSXA 3MLRH 3WFBH 1JHKH 1QSEB 1RUPL 3TN0C 1YEIH 4G3YH 3OGCB 1EGJH 5IIEB 4AG4H 2EYTB 2X5PA 4RIRA 3Q3GB 1ZVHA 2OSLA 4F2MB 3O3EB 4LSVL 2ZOLB 3S7GA 4NKDB 3RWEA 3U46B 1CZ8H 2R56L 5DMGC 2AEQL 2HKHH 1DR9A 5A2IH 1U8JA 2NTFB 4JY4B 1NLDL 2BY3A 3TA3D 3QIBA 1I75A 2P5EE 1M1SA 5I8EB 2ENYA 5EU4A 1S9YA 1NBQA 3NIGE 1MHHB 4XT1C 1N64H 1V7ML 3B5TA 3VE0B 4L8DB 2HLFC 3C60D 5HVHB 4JR9L 1MFCH 5C92A 1UKSA 1FNGA 2MFNA 1J18A 1HWGB 2MNUA 2KQMA 4JJ5A 5I19L 5I1LA 3UJTH 3P40A 5T3XE 3IDUA 4CU8A 3NCJH 2VZSA 5AZEH 1QNZL 2O5ZL 2FX8H 1T2QL 4WTZA 2R1YB 4FQXA 4E41E 4GAJH 2P48B 1WTLA 1E6JH 4OT1L 1WBZA 2MCPL 5F96L 1J1OL 3HI1B 2W91A 3GBML 2P5EB 1D5ZB 5DF0A 4LRNH 4U7MA 5HI3C 2XY2A 2EDKA 2VUOA 4QWWC 5DJAB 4BFEA 5HD8D 5C07D 1WK0A 1AP2A 1BAFL 4Y1AE 2MWCA 1ZLVH 2GTZB 5FGBC 3UTSE 5KVDH 3DYPA 2ADFH 3T0WA 2APFA 3OXRA 4QRQA 3T65A 3ULUL 1NEZA 4N9GA 1JZ4A 1FVEA 1DDHB 3O6FA 5D1ZD 5J1AB 4KKCC 4NN6C 1MI5D 3OSKA 3O3BA 1QLFA 2YSSA 3EOBB 5I17A 1AHWB 3C8KB 5IBLD 5CINL 4YBLC 4IMKC 5GHWH 1AGEB 4OF0A 3ARQA 5HHPB 3RTQC 4QTIL 1QR4A 3EKCA 4E41B 1YNKH 3MXVH 1H5BA 3BKJL 2B0SH 4WI9A 2NXZB 5HTSA 3ZDYF 3EZJB 3CC5B 3MV7D 1CGYA 5E56A 4GRLC 1DQLL 1T5WB 4UT7H 5CILH 3T8XB 5H37H 4Y1AB 1F8TH 3DHMA 4EN3C 1PYWA 2R29L 1OAYH 2I9TB 1Q9OA 2JJTC 3W9DB 3QUXD 2C1OA 5ICZA 1S7SA 5D7JA 3RZCB 1MJJB 1QA9A 4FFZH 4R0LB 2E7HA 5F7DB 4EVNB 4RWHA 3PGFH 3HNSL 5A2FA 3LB6C 1VFMA 5EU7C 2HTKD 3RVWC 1UM5L 5LQBL 1AXIB 1B88A 4RA3A 3VFUA 3KYNA 1FZJA 4P2YA 2VL4A 3VWKC 5IWLA 4OFDA 4GSDL 1HQ4A 2YPKB 4K94L 1MCIA 5DZNA 4O9HH 3HPLA 1U2HA 3NABL 3BDBA 3IJHB 1NLBL 5DZLA 4LAJH 4N0RA 4YX2H 3GKZA 1AGBB 1G6RL 1JGDB 3SKMB 4IHOB 3GJFK 1UYWH 1JRHH 3MUY1 4QHMA 1JNHA 4I2XE 3KLAB 4IRSB 3WMSA 1AE6L 4JRYE 1QLRA 3SE3C 5MHSE 5IMOA 1F02I 4GMTL 1MCWW 2BZDA 4OIIH 5F7YC 4Y4HD 3PP3H 1U42A 3K46A 4G8IB 4IMLA 4GS7C 5F9WB 4WWKB 5JZ7D 2R0LL 5GGSA 1EXUA 2HWZL 1JF6A 4H8WC 2DQGL 1SJEA 4LIQL 3QJFB 2R0WL 3U0WL 4K3GA 1TETL 4JFHD 5HPMB 4MQ7A 1NC4D 3SJVA 4LHUA 5L2KD 3BEVB 4GOSA 3TNMA 4PRDB 3VA2C 4M7KL 2BVEA 4L3CA 3I2CL 3SDXF 2YA0A 2AJXL 5A1AA 32C2B 3QXUA 4LSQL 1M7DB 3GI8L 4X7SL 2KZWA 4G8FB 3CSGA 3ZTJH 5FYKL 5C0IB 4I2XB 4JVWA 3RGHA 3S3JA 2J7LA 4P4KC 4PJHF 3QDMA 4A6YB 1MHPH 2ZSVB 4HWZB 1MAJA 4Z7VA 4PP2B 5BV7L 3E6HA 2A83A 1ZLWK 1KC5L 1MJUL 3V4UL 1DUZA 2Y5TB 1HILA 1IAIL 1RPQA 4NKOB 1GHFL 4ODVH 2EEAA 4LVHB 3CFBA 4AIXA 5SWZD 2UWEE 4PGEA 1XGPA 3KG5A 4GXVH 4XZUA 4GW1A 1QFUH 4OLXL 1WZLA 4WY7L 4XNUH 3OPZL 4MXWH 3C2AL 3R1GL 1XCTA 4TQEL 5GSRB 4TUKL 1W8OA 3IS0X 3GJFA 1L6XA 3QUMH 3BXNB 3FQRA 1L4IA 1E27B 4MNHB 4UV4L 4N1HB 3UYRL 3HG1B 3CZFA 2CLVA 5TF1L 1P4LA 1QBML 3HI6H 1E4XH 2GITB 1E4KC 3RWGB 3MO1A 4MD4B 3WSQL 1BOGA 1ORSA 4D3CH 2NX5D 3QULB 4TTDD 1DLFL 1PG7H 2CDFB 2J5LB 1SEQL 2VITB 3QUZA 3EYFB 5C08E 5EZOL 4XCYB 5E1HB 3OBAA 2P5WD 4H5SB 1Z9OA 1X4ZA 1L9NA 4D0CA 5ID0B 4Y5VA 3S4SB 1IILE 2FHCA 4X4ME 4YXKL 1JNJA 2D4FA 4F37K 2ZJSL 2UWEB 1GC1L 4OQTL 3K81A 2A0LC 2FX9H 5D2NC 2J8UE 1NCWL 3EDJA 5IJKC 2OL3L 4H1LB 5KSVA 1F3DH 3KXFE 1PZ5B 2VSDA 4MQXC 4P23C 4GFTB 1YN6A 4XX1E 4HPYH 1ZLUH 4QXUL 3UDWA 3LSOB 5IGXH 2QTEA 3JBG7 1TXKA 4RFNC 3GSRB 1NCBL 3GI9L 5HYJE 4TUJA 3DROB 1I8LC 3I02A 4O51B 1MREH 5D1XD 2IQAB 5I1DB 2Y36L 5JQ6H 4OKVB 3DBXB 2UY7A 5GRJL 5H94A 1Z0NA 2IBZY 1OF2B 1JTPA 3L3IB 4POZD 5DK0A 1B0GA 5C08B 3RL1B 3G6JE 1MHCA 5KVEL 4LCWE 2EC9U 5DZOA 1IQDA 3VXSA 4JPVL 2OP4H 4ZTOL 4BSJA 3P9MA 1ETZB 5BRZA 3IDXH 1CFVH 1P7QA 3BVNB 2PUQT 1ZHBB 2ITDA 2F19L 4JG1L 1YJDH 1JI2A 2BY0A 4GRWE 4JFED 5AZ2L 1DLHB 3GO1L 4KHXL 5JUEL 3VH8B 2FBOJ 2J8UB 2BSTB 4YO0A 3VCLA 3KXFB 1NCAL 4AY0A 2AV7B 5DHVA 2OR7A 4LSTL 3UTPD 3B9KA 1JWSB 2WM0A 2VLRA 3TFKC 2BVTA 5E5MA 4WFHE 1INQA 1OVZA 4GBXD 5HYJB 1ZANH 3C08H 4S1QL 4GLRH 1J8HA 3S34L 5B4MC 4QHKI 5H2BA 1T2XA 2JJSC 2W1NA 3W9EA 4U1JB 2Z4QB 1FYTD 1VADB 3G6JB 4LCWB 4D9LH 3WIFA 2FGWH 3L3HB 2Q7YA 4WHYG 5C0ND 4D0BA 3IVKB 4QLRA 3HB3C 2Z31B 3T4AB 3ZKXC 3EIFA 2CJUL 4ODXA 4QXTB 1U8NA 5CSZB 1FZMA 3EYSH 1KCRL 4GRWB 3U0TA 3ULSB 1PX4A 4L9LA 4NGHH 4KK6C 3U9PH 5CBAA 1G7HB 1F45A 1YPZA 1PLGL 3MLUH 4LEXL 3VD3A 3PL6A 5KZCB 1KTRL 1KYOK 4Q6IA 1KBGH 1KIQA 1U8MA 5GS1C 3G6AB 1S3KL 4K3HA 1SY6L 4KRNA 2K9UA 5IHUL 1RI8A 4U2ZA 4K8RC 4QOKD 1A6ZA 2RFXA 3ARED 3X3FH 3BSZL 3RJDA 1BOYA 3NN8B 4ORZC 2I25N 4UIKH 4AYFA 1C5CH 3FO9A 3WFCH 1ZT4B 4DGYH 2DMKA 4R4FH 3O81A 1F4YL 4JFQA 1IMHC 1FJ1A 3MYJA 1QFWH 5SWSE 4YFLI 1KJ2B 3LRGA 1KCLA 2CRMA 4HJ0C 4OM1L 3EYOB 1D5IL 3V5HB 1MCCA 2DS4A 3T1FA 3PWJA 3TO4D 3PNWA 3S36H 3V6ZA 3SDCD 3EO1B 4FXGA 3GNML 1LK2B 3QIBC 4JB9L 1JGUH 2NY7H 2BRRL 3CXDL 3KS0J 5E2VL 3LRSA 4QYOA 3IFPA 2BSSB 3D39A 4HJJL 4WFFD 5JHDA 3DUHA 1J05A 3T2NL 4R96A 3UXFA 4G9FE 5CUSL 1UB6A 2DQJH 3WNLA 2E6JA 2F74B 1L7IL 3OXSA 3O0RL 2NPLX 4Z78B 5HVFB 1MIML 5GRVK 1RUPH 4MAYB 1D7FA 4X8JA 2BNUB 4NQDA 1UC6A 4ISVB 4MDJB 3OX8A 1TCRB 3DSFL 3F12A 3DURA 1W72A 1BJ1H 3BP4A 4LSVH 4M7ZB 2YRZA 1OAZL 4F80A 3PWVA 3RWJB 1MEXL 2R56H 1IGCL 2AEQH 2GHWB 4H25A 1BQLL 4FQXC 2V7NA 1NLDH 3DWTA 3VRLE 5HYQA 2R4RL 3WL9B 3HC4L 2D0FA 4KROD 1T1ZA 3KPLB 5JIHA 3PUCA 4L3EE 4OZHB 5DJZB 4K3EL 4QHKJ 4XCEA 3MV9E 3KPOA 4G9FB 3LZFL 2C9AA 4OLZL 4JR9H 4DFHA 1ZHNA 4XC1L 2PXYA 4KV5F 4Z8FL 2CLZB 3KYOA 4LCYA 3LN5A 1C08B 2NY6D 3O3AB 3E6FB 5M7QA 3H8NA 1S9VB 5I19H 1NUDA 4XPAL 1JNLL 2ARJQ 2AK4E 4HZLA 3LDBC 5K93A 1QNZH 1II4E 4HGMA 3STLB 2O5ZH 2ERJC 1Q38A 4G7YL 2X2YA 1T2QH 1NC2A 1T66D 2DLHA 4OZFB 2DYPA 1F90L 2H32H 3DSNA 15C8L 3S35X 3P30L 4M7JL 3ZT5A 4OT1H 2MCPH 5F96H 2FHBA 2ID5A 1J1OH 1H5BC 2FWOA 3IU3B 1R3KB 3GBMH 4LLVB 3HCVB 1TPXC 3HZVA 2Z91B 4FQ1L 1EBAA 3BUTA 3KLDA 4L3EB 4P2RD 1GOHA 1BAFH 3JV5A 1KOAA 3MV9B 4BELD 5EOCJ 5KSBF 1LP9E 3OKDB 2KKQA 2QBWA 2MPAL 3IFNL 4RGND 3ULUH 4RAHA 4ZSOE 1LO3L 2W9DL 1A7RL 4AH2A 5DD5L 4JM2D 1CT8A 2F9BT 5D7JC 3UJJL 2BOBB 3QB7C 2YWYA 4XMKL 3NZ8B 4I0PA 1IGJB 1P84J 1S7WA 5CINH 2GW5A 4GW5B 5IHLB 4QTIH 1WWBX 3W39A 4D0DB 3DLQR 2P47B 3BKJH 1DEEB 4ZMAT 1I1AA 4Y4KC 4LKXA 1I1FB 1IEAA 3ET9F 4YC2C 4NYLB 4WI2A 4MJ6B 1DQLH 4TSBL 2EDLA 2EKSA 3O3DA 3RBGA 5H37G 5A2LH 3D3VA 4XP9L 2NYYC 4JHWL 1FC2D 2X4NA 3QFJA 2LABA 1A1OB 4U1GB 1LP9B 2A6JB 1EBPA 2R29H 5DRNB 4R2GC 1JPSL 2F8OA 1IGYB 4PREB 3B5HA 1OTTD 3OR7B 4ZSOB 1RSFA 4UT6L 3ZSSA 5D70L 3SDXA 3MRBA 5DRXB 3HNSH 2ZOKA 1MVUB 1QFHA 4KKAD 1UM5H 5LQBH 1JPFA 5FYKD 1IRAY 2DDQL 5FYKU 5AWNL 1DANT 1XGYL 3IXAB 4RBPK 1X5KA 2BHYA 5MEQA 4GSDH 4PJHA 5ICYB 4TNWK 4JHZA 4K94H 4DVBA 1GGUA 3U82B 5A3ID 1RY7B 5BW7A 3NABH 4WCYL 1OB1B 5GS2H 5F89B 5CWSB 4NOBA 3UEZA 5IB4A 1T0MA 1FVDA 1G6RH 2E9IA 3K7UA 4CADA 2H9GA 2ATKA 4M61B 5IJVA 1MIEL 3BH9B 3LHPL 3RBSA 1T20B 4U1HA 3FZUD 4PV8B 5EO9A 4XGZB 3MCKB 1U8QB 4XVJL 4GMTH 2BCKB