2HVJB

Crystal structure of kcsa-fab-tba complex in low k+
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab heavy chain
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 53
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2006-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hvjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hvjB01
2Q20A 4KDTC 3TNMB 3D39A 2J5LC 1BM3L 4IRSC 1FFOA 2O93L 1A6ZB 2PR4L 2J3SA 1NAMH 1BX2B 2FL5B 4I8DA 4YHIA 6FABL 2IG2L 1ZLWK 1DL7L 4V2BA 2BCKA 4RRPA 1FJ1A 3D2UA 3U9UB 2NY7L 1G9ML 3UEZA 2XWJB 1EEUA 5D2LF 4XVUC 1Q0YH 3OF6D 5GGTA 4O4YH 3STLB 4DUXA 1CN4A 5F3BA 2OS7A 3L95B 1Q9KB 3WL9A 4Y1AA 1TDQA 4YAQB 1QPXA 1QEWA 4O58L 5F9WC 2HTKD 3O3BB 1E27B 1YECL 5F9DC 3LN9A 1ZMYA 4HWUA 2GAZB 3H42H 1P2CB 4U0RC 3MLXL 3A6CH 5I71C 4PRIA 1RZKL 5T3XE 3RWIA 3CDGB 2R69H 2ZUVA 1AO7B 4P23C 4PYGA 4X6CA 2AJVL 1FZMB 4HKJB 4WI3A 1NAKL 4P3CL 3VMOA 4Z7UB 5IB2A 1A7NH 2GCYB 1IEBB 2EDWA 2G5RA 1MQKL 3QUYB 5D96B 3MROA 5J11B 4Y19B 3O3EA 3KYNA 1AGCA 3VG9B 1M71B 2FO4A 4QXGL 4MHHG 2NTFB 1KGCE 1TCRB 2C7UB 3AS2A 2PTUA 1YEKH 1J0KA 5IUSA 2VLRD 4XVSL 4PRHA 5DJXA 4R2GD 1I3VA 5CSGA 4KI5F 3GSRB 3V5HA 5GGQL 3CLFH 4EN3A 2N56A 2VRAA 1I1AA 4X9FA 1F6AB 4D0CB 5JPNB 1ZE3C 4N0FA 4NC0B 3SGEH 5FO8B 5TFSH 3C5ZD 2PUQT 2C3XA 3FQTB 2GI7A 2H6PB 5HHOA 2BHYA 3F5WB 5FK9B 1RK0A 4LCIH 5ADOL 2VDLL 1R5WB 2PTTA 4KJYB 1IM3A 4F57H 2UYLB 1VEPA 5DA4A 4M7LH 1XH3B 2D4FA 3O3AA 1NMBH 3Q48A 5GIRA 5ID1A 1A7OL 3HG1B 4F58L 5I15H 4A6YA 4DJMA 3ARGB 5D1XB 1QG3A 5F9AC 4FQIH 2HMID 4WIQA 4ZNEA 1SMAA 5CP7A 4PJ9A 3VFUB 1R0AL 3FCTA 1K2DB 3R06A 3LKOA 4FQHA 1MLBA 4G6KL 3HNVL 3MFGB 2F53A 2X6MA 4L3AA 2DQTH 4POYA 4P3DA 2AERT 4JE4B 4POZD 1JTOA 4NYLB 3J7HA 2V7HB 4Y2OA 2PN5A 3P9MB 3RVVD 3KLHD 4NUGL 2JCCA 2X70B 1SYVA 5E8OA 3C2AL 4XHJD 2NY2C 1JZ6A 3PV6B 1JGDB 4C4KO 1NUNB 1FQ9C 3MV8E 2EDYA 2VTFA 3P0YL 2Z35A 4LF3A 5JUEH 1QTYT 2NLJB 3BQUD 1YDPA 4MXWH 2HJKA 4KDTA 3TCLB 1RIHL 2R1WA 4YDKL 1RURH 5AYUL 1I9JH 2F19H 4M5YH 1H8NA 1R6VA 1U8MA 1P84K 5DVOA 4Z7WE 5EC2A 4HWNA 4PP1C 2HRPH 3ILPA 3UCRA 3FB6B 1DQJA 4JG0H 3EGSB 4U1JA 1ZOXA 1HQ4B 1KJ2H 1RUML 1LK2A 1LP9A 3AS0A 5CUSL 4ZFZB 4OF7A 1MY7A 5DD3H 1MREL 5H37H 2EDBA 3N1PC 3QFJE 4OZFA 1CLOH 4RQQB 5BS0B 1IGCH 5EA0H 3RPIB 3O6FB 2PCPA 4R7DB 5KVFL 2WUCL 4GO6B 5I0DA 3O41A 5EO0A 3BP5B 3MRCB 1GGTA 1A64A 1AIFB 1BJ1H 12E8H 3OXRB 5CJOH 3W9EA 2UV3A 4UIMB 5HDQH 1GZPA 2IWGA 3IFOB 3DX6A 2OJZH 4OIAA 4EBQL 3HC3L 5CLTA 5ANMA 4JAMB 4X7FC 2AJYH 2LU7A 2MWCA 3DUUA 4GXUN 4IRJD 1EJ6A 2L7UA 2XYCA 2ICEB 1CE1L 1NPUA 1I1YB 1II4E 3GBNL 5A2JH 4YXLL 3A6BH 4Z78A 4OI9A 3Q6GH 1V7NL 3P9WB 3JWDL 2WANA 5IOPB 1I8LC 1X3DA 3WFEH 4CVXB 4OV5A 1IE5A 1F2XK 2O5XH 5JXED 4D9LL 4JRYD 1MJJA 4YPGB 2RHEA 4HK3J 4I2XE 4Q6YA 3UYOD 4MNQB 5F1NA 4M8VA 5H2BA 3CVIH 1BM3H 3O4LA 1BGXH 1WWWX 1A1NA 1JYNA 4U05A 4O9HL 3U30B 5JHDE 1I7UB 2QHRL 1ROWA 4ESKA 1DL7H 4FFVD 1CFVH 1TZGH 5TF1L 3GKZA 1MVUB 3G5YB 3RIFK 2CLVB 2KBGA 2WUBH 4PJDB 5L6YH 5I1IL 2FECI 2R2HB 3PWPE 4DTGH 4TULH 4ONOA 4XT1C 1ZHKB 4QHNB 4CVZA 1L7IL 2JIXA 3TO2A 3NIDF 4P5TB 3QXDA 3MUGB 2VC2H 1RIUL 5J3HC 1WFOA 1CF8L 1J5OH 4KK8C 3RBSA 3L3DA 5LBSL 3MLXH 4GAFB 5CGMA 3QDJD 2PETA 1KLUA 3CZJA 3RRQA 3CFKA 2E7CA 5I1KH 1AHWB 2XZQL 5HVHB 4LQ1A 3RAJH 3PGCB 4HHAA 4RFOH 1CDUA 5SX4H 4JFXB 3OKOA 4ZS7H 1U2CA 1L9MA 1IBGH 1HCVA 3U0WH 5BV7C 4QOKD 3S5LA 2GTZA 5F9JB 1MHEB 5J12C 1F4AA 4KUZH 5E6IB 2XFXB 5C8JB 3NA9L 2I25N 4YQXH 1VGEH 3DRQA 4X7TB 5BVPH 3MX0A 4X7DC 4PRNB 4HMCA 4YFDB 1I1RA 4XVSH 4XCCL 5CGTA 4JY5H 2HT2C 3WFHA 3FQRB 1GAFL 3JUZA 2FH6A 5D7JB 3IVKA 2CKBH 2OBGA 1HK6A 1J0YA 4YDLC 1IFHH 5IT2L 3KXFA 1RHFA 3WUWA 1MCOH 1T21A 4A6YL 3HNTH 1FAIH 3K0WA 4CL7A 5IKCA 4TNVF 4R4FL 4NO2B 1XGUA 4PJAB 3WFBL 1LO2H 1JTTA 3E8UL 2CH8A 4L8CA 4X6FB 3QPQC 3B6SB 1X5ZA 3CLEH 4XCFL 3VMNA 3TO4D 1QVOA 1RPQA 1A7PH 4TOYL 1PAMA 4ODSH 1FC1A 1N5AA 5L7XL 3RY4A 5FF6A 3H3PL 4NPYB 2CKNA 1BF8A 3KYAA 4ONGL 4F58H 5DEZA 3RNKB 2SEBA 5KVEH 4MD0B 4DGYL 4F7CB 2WNGA 4ZXBB 1QHOA 3HNVH 4Z0XA 1A7RH 2DWDB 4RZCA 3WIFA 2FECL 3OG4B 3D2UD 4NSKB 3NAAL 4NQDA 5JO5A 2R4RL 2Z8SA 4XCNB 1RUQL 1Z9LA 4MQXC 4JFDB 4N1HB 2WIIA 5FXCH 2F8VA 1U8NB 3IKCB 4HPYL 1WZ1L 5FUZL 3P0YH 1T2QH 4D9QE 1JRHI 4Y1AD 1D7FA 3EAKA 1RIHH 1H3VA 2N1KA 2W1NA 3NTCH 4EUPG 3O8XC 1ZWIB 4PRID 3QAZB 1QLFA 3K2UL 5C0CB 3UTQB 4NRXB 4WFGD 4FZ8L 4HUVB 1KULA 1Q9OA 2DS4A 4RAHA 5K9OA 4L4TA 5TH2A 2YEZA 5AUMA 3LPGA 4E0RB 2LFGA 4MJ5A 2ADFL 4AENA 5CUSH 4PREA 5CD3A 4JN2A 1VA9A 3IAGC 1JUFA 4G8EB 3S9DB 4JRXD 3QDHA 4JREB 3DO7B 1AD9A 3PDDA 3SE3C 1TJGL 4QRPD 2XTLA 4WU5A 2CMRH 5FA4B 5KVFH 2EE3A 5EIQA 3D69A 3QP3A 3TP4A 3KPOA 2D2OA 4LU5L 1O7VA 3H7BA 2PW1A 2J8UA 3ALWA 1YEGH 4MJ4A 3DBXA 5CGYD 2H32A 3DURB 2FHCA 4PRHD 3MLZL 1KEML 2VDKL 4R96A 2Z4QB 3PGDB 5IIEB 2EYSA 4YHKH 4KJPD 2NY0C 1I1AD 4YFLF 3SCMA 1KYOJ 1BJ8A 2VL5A 4PJBA 4C56E 4AJ0A 3P77B 1ZLUK 1JNJA 2O26U 3M45A 1TNMA 5IW1A 5HHQA 3JWDH 2OL3A 4LPTA 2GSGA 2IPUK 1E0OB 4WY7H 5INDB 1N59A 5D72H 1CT8B 5GGTH 4PV8A 5DD5L 3CC5B 2VB5A 3OAYH 1CQYA 4LEXH 1NC4A 4V1DA 1VGKB 3V4VL 2JJTC 4O9HH 1PBYA 2QHRH 1TQBC 1KTDB 4IRZH 4PJEE 1KJMB 5CILL 3UYPA 2YOCA 4N0UA 3U1SL 3BIBX 2I24N 3C08L 5EOTB 5JW4R 4PJ9D 3GUTA 1YA5A 2FATL 4OIIH 1MFDL 1QLRB 2Z31C 1HHGB 4Y5VC 1Q9LA 4ODWB 4N9GA 2BXZA 5E2WL 2VZ1A 1BJMA 1MH5A 2F53D 4G80B 3HS0A 3V5KB 3MBXL 1W72L 4RFEA 4ZQKA 2EC8A 2UUDK 3IDUA 3MLYL 4NRZA 5CINH 1P7HL 1OP9A 1EJOH 1FAKT 3BWAB 3BN3B 2NY3B 1URLA 1X6LA 1NCAH 4XNUH 5FKAB 1JZ5A 4U0QB 1JRHL 5EULV 4JFQB 3HUJE 4QYOA 4MJ2A 1LE5B 4UT6H 1INDL 5JZ7C 3FB8B 4P2OA 4FQXC 4XP9L 5A40E 1EFXB 1ZGLP 1ZVSB 4XP5L 2PW2A 3CVHB 4LDOB 4IRSD 5FGCB 4FZEL 3VE0B 4M4RA 4KAQH 4OI8A 1FPTL 2EEAA 3U6RB 4GSDL 4ODUA 4AH2B 4BKLB 3SJVB 2DWEB 5AZ2H 3CXDL 3QUXC 4HS6B 5FEBA 5FKPA 3OKNB 2G5BB 4PLNC 3QNZB 5DUPH 4XVUD 3RDTC 1ZVYA 4HUMB 1J1XL 1DFBH 4OZGF 3E6FA 3MYJB 4NC2B 4MNGA 4G43B 3KPMA 3DETC 3C60B 1GAFH 5EG6C 4AIOA 3VA2C 4NBYB 5CZXD 4AZ8A 1QLEL 3NIDE 4O51B 4X7CC 3VMPA 2I9TB 2OR9H 2NY1B 2ADIA 4CMMB 5EN2B 3O8XA 2E9JA 1I85C 2WBKA 3MUZ1 4JM2C 4A6YH 3O3DA 2XN9A 1R3KB 3VD5A 4P23D 2NMSA 3NCBB 1WEJL 4G42B 2XOTA 1JF5A 2CIIB 5KSBF 3KPRB 1MRCH 5F7LB 2HP4A 1N7MH 1XGQA 2IPKB 2UY6A 4Y16B 3PDOA 4AT6B 2ZCHL 3QZWG 4TOYH 1A6VH 1GOGA 1CD9B 1BP3B 4X6EA 1B6UA 1KF9B 3OKDA 4ONGH 2WAHA 1HHKA 1WBXB 1TQCB 5KS9F 2F5BH 4I3GA 4N0CC 4PR5A 1WC7B 4XNZB 5FYKL 4FMFA 3STZB 2AEQH 1G7LA 4OCWL 5CAYB 4TTGA 5ADPH 2DQUL 5ITBL 1C5CH 2FR4A 4XC3L 1IAOA 2EIDA 2B20A 2MCPL 3U36A 1PG7L 3VFMB 3EYQC 2VXSH 4LL9A 3T3PF 2W59A 4YZFE 2Y9RT 1J10A 1WWCA 3MLVH 5C08A 4HS8H 3C5JA 4KXZI 5JXAL 1UXWA 1KPVB 3OGCB 2YPLD 5E8NB 3KYMA 5DRZA 2OI9C 3ZE2E 5DJ8B 1TMCB 1VADB 1ZT4A 2DQEH 1MLCB 4ZDHA 5MERB 2JIXD 3LN4B 1OP3K 2OQJA 4TNWK 4DW2H 4HLZG 5HHMD 1CFQB 4GKNB 1I1FB 2BXYA 3ILQC 1AJ7L 2IFFH 2RCSH 1JNHB 4YBHA 4OZFH 2HKFH 3OAZH 2JJTA 4G3YL 2XKSA 4JO2H 4L4VE 2H2PC 2VDOL 2OYPA 1V8HA 5M7QA 1QRKA 2DLFH 2NR6C 1AGFA 1S8DA 4P57A 3SO3C 1UZ6E 4GAJH 1E4XL 5D5MB 3N9GL 3LRHA 4FTVE 5ESAB 1HH6B 1F4YH 4R3SA 5DMGC 4ACPA 2VDMH 4S1RL 5C0RH 5CD5C 1T2XA 4XGZA 1QRNB 3HPLB 2P5WE 4LEOA 4IOIB 4KROB 4OLZH 5BV7L 4HQQL 1PYWA 5HYJB 3OX8A 4F9LC 3Q6FB 5DHVB 2AJ3A 2NY2D 1AXSA 3MV9B 3DUSB 3IDYB 5DEFB 4U1KB 4QXTB 5E2TL 3VXUD 1DSFL 4YGAB 4LLYB 5JQHC 3O2DL 4RGNB 1JI2A 3BGMB 2DD8L 3RWCA 4G8IA 3IDJA 5BRZE 4M61A 1TPXB 2X7LA 4PP1D 3HE7B 1CFTA 1EEQA 1FGNL 1NGQL 2ENSA 3FFDA 5BW7C 4JPIB 1BLNB 2DMBA 1G6RB 4QRRE 4OZIB 5C09E 1HH9A 4M6NL 1GPOL 4GKOA 4GRMA 3CH8A 5I19H 3RDTA 3RHWK 1QSEE 5BO1H 4DKFH 1UJ3B 3ZTNL 4XNQA 4PG2C 3WFCH 3FFCE 5DLMH 4E41B 2X4NA 1BD2A 1YQ2A 1ORSB 3Q1SL 1JGEB 3I3EA 1WZMA 3S88H 3C08H 2P24B 1Z5LA 5AD0B 3KLDA 4KZEH 3NN8A 3PWUA 3CZFB 5CEYB 2DQDL 2GUOB 4MJIB 3HC0B 4DVBB 4BK5A 4PS4L 3GHBL 2BRRL 5A2FA 2LTQB 4MA8H 3MLYH 2YD3A 3MV8A 5ENWA 2PYEB 2W0LA 2IFGA 4NQDD 3FQNB 4UUJB 5HHXH 5ESQB 4UB0H 2W07A 5HYQA 5FYKD 4OKDA 5JOPE 2AXHA 5D7LA 4KPHH 5T5NG 1G7IA 3MGOB 2AK1L 1M7XA 4Z7WA 1D3CA 2VUYA 4FG6C 1UGNA 5E1HB 4KWUA 3P30H 2X9XA 5JIPA 3L5WB 3P4MA 4QTHA 1P7KB 1KIRB 5E2VL 3UBXA 4YHLL 4DUWA 1FPTH 5KSVA 1OP5K 1VESA 4QHKI 5I76B 4Y0GA 1I9RL 1HILA 4GSDH 3D18B 4L4TD 4L29B 3CXDH 1FO0L 2J8HA 2NNAA 3VGAB 3WSQL 2QQKH 2OCFD 3O81A 1DANT 4QXWA 1NEZG 1RUAL 5EZOL 4BSJA 3G6AB 1JF1B 2BZDA 3CD4A 3BP7A 3GSXB 1LEKB 5IM7A 3RPKA 1RY7B 4S0SD 1RSFA 3FO1B 1FFPB 3OR6A 4U1HB 1KB5B 5JW3H 5J3HD 1N5YH 3BZFB 4APQC 4OIBA 4UT9H 5IK3A 4KK8D 3OJDA 4KI5C 3U48A 2Y5TA 3R8BB 4QGYA 3KR3L 3X14A 1WEJH 3FMGH 4EI6B 2MCG1 3VFRA 2MNUA 2VMFA 1M7DA 1ZHBB 1NGYB 5L2KE 3NCFB 1PKQE 2MQCA 4LPUA 4N8VA 4LQFL 2BMKB 1KT2A 1VEMA 3BEWB 4NZUL 5FYLH 32C2B 1G6RH 5JHDA 4XPGH 4F9LA 1KCSL 3BWUC 3FO2B 4RAUB 4QRTB 5IMKB 1IGJB 1NC4D 1UYWH 2DQUH 3GMLB 1R5IB 2HT2D 2W60A 1DVFC 1PG7H 4F7TA 3EJYC 3PWPA 3FHAA 2ZG2A 2J88H 1FGVL 3ARBB 3ZKSD 1PEWA 2OP4H 3EOTL 2OTWA 3B3IA 3PWVB 4HS3A 3G6DH 2WQ8A 1JYXA 1JBJA 2HN7A 3VH8A 4R7NB 5BW7A 4G8GA 2QQLL 3RIAF 1RZGA 4GKZB 2DM4A 2W92A 3QCVL 3C2SA 1KLFA 5KSBE 3QPQD 1F2QA 4NHUB 5E0QA 1AJ7H 2YMXH 4XWGL 3IDGA 3HFML 2X89A 3C6SA 5FM4A 3GJFA 4YJZL 1T7ZA 4G3YH 3HZVB 3E6HB 2ZJSH 5FAAA 3JV4B 2LAGB 5DYOB 2A1WL 5DEGB 2QADB 2H32H 3NCJH 1YNLL 1BQHG 1KB9K 3QCUL 4J3WA 4S1RH 3VD9A 3VXRB 1XGYH 5B8CB 4Z76A 5HHPB 3BKJH 3ECBA 5D2LA 1MIEL 1D6VH 4GKSA 3OWEA 3VXNA 4IBLT 3T3PE 4M1GL 1CFSA 4MQXD 3RY6C 1X5JA 1N26A 4GMTL 3BMWA 1LE9A 2OL3H 4JANA 5DWUH 4HC1L 1YUHA 3AB0B 1CICC 2XQBH 1MAJA 1GHFH 4HK0A 3DTXB 2QEJA 2HFTA 1NGWA 3I6GB 5EUKA 5IBTH 2CJUL 2F74A 5SX5H 3O8XD 2A74B 1CDBA 2HT3C 5HY9B 1C7TA 3L6FA 4XRCA 4HIXL 3WKNA 3H9YA 3KLAB 1KN2L 2BSSB 4Y8AA 1MFEH 1P84J 4GH7B 3L3GB 1ZLSL 3H9SE 5HYFA 3WN5A 5C07E 4ODHL 5E8PA 1L6XA 5ITFA 3M17A 5HHNA 4KKCC 2APBA 5GGSY 4Q0XH 3T4YA 4AG4L 3NBNA 1MF2L 4JVPA 3TH4T 2GITB 1JPFB 1VACB 2JLLA 3E3QC 3IRZA 3LQAC 4QRSA 2EIEA 5GSVB 4APQA 3I2CL 1L0YA 3A67H 4XZUB 3SKNB 5D9SA 3RWFB 4ELKA 1S9WB 2P8LA 3QIWC 4ODXA 4BQ9A 3Q3GB 1OTUC 2BC4B 1CIDA 2XPGB 5GJSL 2DQJL 2VLME 1WBYA 4YXKL 1D5MA 1QR1A 4WTXA 3RWHB 1E4JA 4IDJL 2YS4A 4D0BA 2NY0D 4FQCL 5DFWH 4HX1B 1KLGA 4R90H 4FQJH 5C08D 1KCVH 5F89B 5IG7A 5T1KA 2X4SA 4DKDC 5J9PA 4MNHB 1D5XB 1YPZB 3MV7E 3TA3A 1NGXB 2EDRA 5DHYB 5DD1H 1AD0A 2GT9A 4JHAL 3VGHA 1ZVHA 1BZ9A 3WXWL 1WWAX 3JTTB 4GXVH 3TN0C 1S7SA 2ATPA 5E4EC 5T3XD 3DX7B 4G6FB 5D4QA 5DHXB 3S96A 4B7IA 3TT3H 4JO4L 4G6JH 1CG9A 3TBSA 4YHLH 2N7BA 4PJ5E 4R9HA 1GGBL 1S7RA 5D2NE 3NABH 5IVZA 4M93C 5IEKB 4R26L 1HIML 3FOLA 4LLDB 2Z31D 3NPSC 3MJ8A 3EOBB 4X98A 1VSCA 5LVEA 3HN3A 2R4SH 1K8DA 1OAUL 5FECB 5SWQA 3RWDA 3SE9H 4UU9B 5F88A 5D7IF 1J0ZA 5I16B 5B4MC 5T3ZD 4ELMA 1TZIB 1DBAL 5DD6A 3LMJL 3FT2A 1VCAA 5ALBL 1MOEA 2APWA 5FCSH 2LE9A 5JQ6L 3L3KA 1NDGA 4OT1L 1KN4H 5D93C 3MRIB 2C1PB 1E6JL 1HHIA 3EO9L 3KPQA 4PJCF 4XCYA 4PJHB 2FLBT 2CLRB 5JZ7D 4FQXD 1A8JH 3MOQA 3TFKC 3HAEG 3CFIC 4B7LA 3HMXA 3UYRH 2X4TA 1YC7A 3I6LE 4LHUG 1OAQL 3DYPA 1BEYH 1MFCL 4JFFE 3C8DA 3ZTJH 1P9MA 2XICA 5ID0B 5EO9A 4WFEE 4XMPH 3QUXD 3RY6A 4C57C 3BKCL 1D5IL 1VB9A 2DTMH 4HGMA 3X12A 3FB5B 1JPST 3RDTD 4BSWA 1EX0A 2RFXB 4LASL 4M9PA 1T20A 1CLYL 1UM6H 4UV7H 5CSZB 3NFNA 3DETD 4OLUL 3IDMA 3NCYS 5T3XH 1T89A 3LS4H 2ZP0T 2ZUYA 1C5DA 4LVHC 1BD2D 4NQEA 4Y2DA 2QJDA 2DLIA 4OLYL 2VLKE 3DIFA 3RL2B 1IC5L 4JM2D 1KOAA 3BD3A 5JPMA 4Y89A 2BVPA 3QFJB 4MSWB 2ZOLB 3C5SA 5E99H 2GJJA 3MV8D 4Y4FA 3IXTA 4PYHA 4N5UA 4HWZB 4K7FA 1C5BL 2ARJA 1JI1A 2VQ1B 5C92A 1KCUH 5T3ZH 5KW9H 4JGMA 1JWSA 4GS7C 3GSNB 4X8XA 5DQDL 1JK8A 5D7LD 2AKRB 1F90L 3EZJB 4L9DA 4QRQA 1EGJA 4N0CD 4EI5B 5D71L 1SVZA 3QIWA 3I6KA 4TRPL 1FDLH 1HWGB 1EXUA 3VRIB 5KG9B 1HKFA 5C0JA 4HAGA 3WIIL 3EYQD 4NNXA 4FS0A 4LNVA 1FG9C 3DVGB 4WTZA 1F13A 3CSPA 2DOCA 2R56H 1T6VN 4I2XB 3T4AB 1X5HA 4UOW1 4N1EA 1FYHB 3BXNA 4MMXC 1RVFL 2CGRL 4MCYB 3O4OB 3DSFH 1CZ8L 2VDQH 3QA3B 4K3DH 3S35L 1OAKH 4X4YA 2AK4E 3BQUB 4LSSH 3ILQD 5FO9A 1MWAA 5D1QB 3D0LB 3ARDC 1PQZA 3LEXA 5IB4A 1TFHA 2H2PD 1QA9A 3CXHK 2NR6D 3T0EE 3DV4B 1ZT1B 3I85A 4K94C 4HZLB 2A6DA 1A4KA 5JLZB 1JGLL 5DMGD 5CD5D 2IQ9L 1RJYA 5H94A 4TYUA 4ZODA 3VD3A 1V3JA 4NZTH 4ZOCA 3OKEB 1JNLL 1MF2H 4JR9L 4M6OL 5DFVC 4LCCB 3WIHA 4LMQE 4OFPA 2OXGA 3UJJL 1FVEA 3AC0A 1Z3GH 5C0DB 5EWIL 2Y5EA 5BOZG 1VFBB 3U4EA 1V7MH 3HMWH 3DX8A 3MXVH 1ZT7B 3TIEB 5DJYB 4O2CA 4F2MA 1N3NB 2R23A 1U93B 3HB3C 3LDBC 4MQ7A 3BX7C 1ZS8A 2X4RA 3SGDH 1MAKA 2DQJH 5ACZA 1MCPH 5I8KL 2DQFA 1WQVT 2N7AA 1ACYL 4I0PB 5IVXF 5J13B 4PJXE 5MEOB 3GNML 3OZ9L 4BJLA 2FD6H 4IOFC 4FQCH 5E94B 1B4RA 2IF7A 4MDJA 4PJ7F 4M7JH 2A6JA 1VHPA 1FNHA 1T3FB 1TZHB 3O45B 4G8GD 4WHTA 2CR3A 3WXWH 1S5HA 1UWGL 3VI3F 2B7DT 3DV6A 1INEL 2AJSH 2AXGB 5F7EH 1S7TA 2NY5C 2A0LC 1YC8A 4L4VA 1QQDB 2QQNL 3BMVA 3GB7A 4JRYB 5CJQL 5I17B 4YXHL 4HK3N 3JSSA 5DK0B 2AJZA 5DJ0B 1I3UA 1O7SA 2X89D 3IDIB 3WJJC 4O5LL 1HNGA 5DUML 4FTVA 2MQ0A 4M4PA 1CGXA 1JPSL 4UAOC 5I6XC 4M43L 2Y4SA 4P46C 2FJGB 5MEPB 1F11B 3EO0A 4W6YB 5TE4H 2R1XB 4J3OC 4JJ5A 1IKFL 3H9HA 4JZJB 4NN6C 2V5RA 5IR1B 1A1MA 3OR7B 5J6HA 3NFPB 5IHBA 3D9AL 5L88H 1RJZB 4YHYB 1CXHA 2PYFA 1IC4L 3GMPB 5K9QG 4PRPA 5KTEL 1U6AH 25C8L 1XF2A 2VAAA 4NN5C 2D31A 2A6IB 2LQRA 4NBXB 4OF8A 3QO0A 4XXDA 2HFEB 4KQ3L 3PF2A 5J4MA 3V8OA 1B0GA 1AGDA 2YUZA 4FG6D 3EFFB 5HVFB 4F33B 4UV4L 4LLMB 4JFEE 3ROOB 3IFPB 3R0MA 4QRRA 5C09A 5I9QB 1X6NA 1OAQH 2ICWI 3K4DA 1UXSA 2P8PB 1MFCH 3UTTE 5TGBB 2G75B 5DJ6A 1ZAGA 3ORJA 3BGFB 4Y5XB 1T6WA 2P7TA 4Z6AT 3W5MA 4H1LA 3BPNC 1ADQL 4RIRB 3FFCA 3MLUL 3BKCH 4Q2ZB 3O0RH 1D5IH 4G6ML 4K3JL 4I77L 3QIUC 1T2JA 1G1YA 4HH9B 4JFZH 3NFSL 5T1MA 3QJFB 4C83B 1CLYH 3QUML 2JB5L 5D7IE 1A14L 5F7WC 3NZHL 3IU4L 4RMSA 1QO3B 1JNNL 4IJ3B 4UDUB 2JK5A 3QEUB 4APQD 5I8OL 1G7QB 3ARDA 3QT2A 3BDYL 4X9HA 2R1YB 4KI5D 4DN4H 3LQAL 1U3HC 5JOEA 4BZ1H 2EKJA 3WFDH 3GFUA 5C0GA 4JG1H 4OKVA 4PJCE 1OF2B 4JFOB 5E00A 2Q86B 3O6MH 2FZ3B 3TF7C 3B4NA 4UILL 2RB8A 1C5BH 4MAYA 5T1KD 1BAFH 3VFNB 3L3IB 3X3FL 3WNLA 1XGTA 5D1ZC 2DQGH 2FX7L 2JB6A 2X4QB 2VXQL 3GZKA 4PRBB 4NN7B 1BFSA 4OM1H 1XR9B 2ZPKH 5D71H 3QI9C 4NQUA 5E9DE 5EZLA 3L9RA 4C56B 2IBZY 1KACB 1UENA 4DVRL 2AQ2A 1DVFD 1SHMA 5I74C 1PW3A 3EJYD 3R1GL 3EO1A 4F37F 3U82B 3QXWA 1HXMA 4OGXH 2WSKA 1N8ZA 3L3HB 1MAMH 1YEJH 1UCBL 1VENA 4IS6A 2XA3A 4K8RL 3LOWA 1MY5A 4JFYB 3UDWC 5I1AA 1E28A 4PBWD 4PJEB 4QTIH 15C8L 4LP4A 2UZYB 1T4KA 2NW3A 3VFVB 5SWSE 4QWWC 4PRAB 2BDNH 3BFOA 3EJJX 4LKCA 5CCKL 2D0GA 3WJJA 5HXMA 2AGJH 3NA4A 5IP4A 1BVKB 1LEGA 3PHOB 4UIKL 4ZO8A 1YYLH 5IHUH 2OSLB 3TBWB 3AS3A 3D3VE 2OMBA 2E7LC 5DC4B 3I9GL 3DROA 3VW3H 4OD1L 4NZDA 1P5VA 4ODTL 5DVKA 1ZEAL 3QR2A 5DXWA 3HUJB 1NFIB 5JW4N 4JRXB 1JGUL 3RGVB 4YFLI 4QRPB 3B9VA 4KGLA 3ZL4L 1J8HE 4NO0D 1CGYA 4TPRL 5AZEL 4OZGA 3QB7C 4YDIL 4EQ2A 4PJ8A 1LWRA 1XF4A 4Z7NF 3QEGH 2D7TH 4GW5A 1CICD 1QSVA 4XI5C 2VISB 3IGAB 4OAWB 4MYWB 5B3NA 5K9QI 4ZOAA 1FL6B 1T83C 3TM6A 4NQED 5L8LB 2BJMH 1RV6X 2CUHA 4J4PA 2HT3D 2W65A 5KSBA 3FT3B 3UAJC 5IFJA 1CTNA 1EEYB 1KIQA 2P49B 5D7SL 1RZFL 3CUPA 3BZ4A 3SOBH 1DQQA 2BVUA 2IANE 2QQNH 3QIUA 2ED8A 5DFTA 4YXHH 4WI5A 4PGEA 4KKCD 2L7JA 4DCQB 5KS9A 1MHHA 5CJ5A 5JMOC 4HIEA 3OKMB 4TUOA 5DRXA 5C9JB 4YGVA 4YHNA 3T0VA 2XTJE 3QIWD 1QBLH 1MFBH 5D6CB 1OTUD 1R5VA 1U3HA 4U6VH 3QDGE 4CMHB 3GSQA 5AAWA 4K7PH 2EIBA 3HMXH 4JO3L 25C8H 3LIZL 1EAPA 1MUJA 3TPKA 4OCMC 4LCUA 2BP3A 4KRNA 1OB1B 2YBRB 1NCNA 1U92A 4GAGL 1NBVL 3DGCR 3SGKC 1XF5A 5LGHH 5GRUL 4K9EL 5I75B 1ES0B 3TN0D 4MZ3A 4PG9B 2Y7QB 2Z9TA 3IF1B 4LLVB 3T65A 2R0ZH 4WEUD 4KZDL 3QI9A 1JWMA 3HR6A 4QCIB 2A2QT 5ALCH 3EW3B 3JBG7 4IRSB 2ESVA 5HYIA 1G0DA 4XVTH 1LNUA 2J4WH 3QEHB 4OLXH 3GSOA 4YNYA 1UH3A 2BNRE 3VRLF 1G0YR 5FOBA 1MJ8L 3P73A 4FNLL 3ESUF 3NFSH 1KV3A 3FONB 2C26A 3HA0A 3PP4L 4XNMA 3UDWA 1IMHC 4OBRA 4DAGL 5B4MD 1JGVL 1I3RA 2H1PL 4K94L 5EU6D 4LLUB 1QSFA 5FM5M 3QQ9C 4FRWA 4W4OC 2YXFA 2H45A 3DX9B 1EBAA 2FX8H 4JB9L 1PSKH 3T77B 2B0SH 5F9WB 5DJCB 3GM0A 4XMLL 3AY4C 1BHGA 3QFDB 4P4KB 4LSRH 1BBJB 2IPTL 3MOAH 2VDNL 3ULUL 1EGJH 1WJ3A 3DX6B 4LARH 5I71B 3LV3A 3MLRL 3MV7A 1IAIL 3QCTL 4P23B 2OTUB 2P5WB 3TFKD 2E7LA 1HSAB 1IL1B 3BH9B 1JHTB 3CMOH 1HSBA 3ZYZA 3QNXA 4HDIB 4ETYA 1G9NC 1PDKA 2L4OA 3LQZA 4EVNB 5FGBC 4J2XA 1DUYA 1XR8A 4PJ5A 5D2NA 4GQ9L 1DN2A 1FORL 4NZJA 5MP6L 4OV5B 1CGVA 4XMKH 2OK0H 5BRZB 5DI8A 2FGWH 4OCYL 1XGPA 3MRKB 4HFUH 2FEDC 2V5YA 1ZXQA 3BHBB 4FTVD 3FO0L 1IGIL 2XZAH 4C58B 1P6AB 1MWAH 3EDJA 2VLLB 1REIA 4H26B 5SWZE 1L9NA 2B1AH 3OJMB 4WCYL 4BUHA 1QSEB 1ORQA 3GRWL 4LHJB 2PXYC 5DGRA 2YPLB 4HBCL 3GBMH 5T1LA 4UQ3A 4J23A 5I18H 2NQCA 1VFUA 3P4OA 4ZG1A 4PRPD 3UJIL 5JDJA 3CFBA 1RFDL 1E4KC 5HGAB 1T1WA 3HI5L 5ABDE 2JIXB 2VN7A 3MV01 3VWJA 1BVLB 5HHMB 3TBTA 1C16A 3W39A 4D8PA 3QQ3B 2EECA 4XBGA 5D70H 5F7DA 3WIHH 2EO1A 3OXSA 5H35B 1JWUA 4UIKH 2ITCA 4U1IB 2J6EH 4DGVL 1J05B 3V0VA 3M1BA 1W72B 2A9ML 3IJSA 4HWEL 5GGRA 3S36L 3V5DA 4AEHH 5J57B 1S3KL 2HJLA 3MRPA 3M8OL 4BH8A 4HJJL 5E5MB 3CSYB 3U9PH 4HV8B 4JQXC 2GTZB 5CIPA 4NKMA 1MFAL 1F58H 1C12B 3VWKC 2HFFA 1KB9J 1UM4H 4TPRH 4CVUA 3ZSTA 1CK0H 1JN6A 1AFVH 1FRGH 3L3OB 5HGHA 3JV6A 3X13B 3DRQB 1XCTB 4IMKA 5MHSD 1IZJA 5I1LB 3SGKA 1IM9D 2Q8BL 2IPUG 4B53A 1BBDH 1EO8H 2HVKB 3GSUA 1IEAA 1CVSC 1VEOA 5CBEA 4YX2H 2FEEI 2CIKB 3VXUB 4UQ2B 3GMRA 2HVJA 4HUWA 1L0XA 2I9LA 3QDME 1I8KA 4R4BB 3HRZB 2E8ZA 3ARDD 5ISZA 3FN3A 2IBZX 3G5VA 3SKJL 1CDYA 3PQYE 2R0LL 3BPLB 2EDKA 5K9JH 4RSVA 3THML 3CK0H 2VYRE 5EU3B 4D3CH 5IKCB 1U95B 4M7KH 1P4LB 4PJDF 1D9KB 1DLFL 2IH1A 4CAGA 4JZNA 4QRUA 1NDMB 1T1ZA 2QSTA 5DFVD 4W4OA 4JDTL 2XXCB 1MCNA 3I50L 1FYTA 5FF6B 3RIFF 3DRTB 4GW1B 4WUKH 3MJ7B 3GHEH 1F45A 1AQKH 1ZA3B 3VGEA 5L2KB 4AIXA 4Y4HB 4PGDA 2SEBB 4YBQD 1XF3B 3HB3D 4FFYL 1PKQB 1F8TH 2NW2B 4OF3A 3HC4H 5EBMA 4Z7NE 3WO3B 3QHTC 3AGVA 2IC2A 4MX7A 3QUZC 3F7VA 3MODL 4HXAH 4IOFD 4JO3H 5IEHA 3IS0X 1KG0A 2VSCA 3QXAB 4GRWE 4X6DA 3TNNB 1FSKC 4Q74A 5JO5B 2DBJA 5FGBA 1X7QA 4AM0B 4H1LH 5C0EB 3O11A 5I66A 1U8QB 4ZUSB 2A0LD 1BFVL 1CBVH 3QRGL 2WK2A 4ZUWB 4BZ2H 3BISA 3A0OA 4NO5B 3T0EA 2EYTB 5KVGH 2X1WL 1A9EA 2I07A 5KVMC 4LVOB 3K80A 2DKMA 4WRLA 4TUKH 3SDDC 2R2BB 1CL7H 4K71C 2H41A 5EBGA 3PV7A 1CDIA 5CEXA 1YZZA 1N64L 4I9WD 3CFEA 1HYRC 4NT6A 1XGRB 1MJ8H 5DJDA 3FB7A 4OLWL 2AABH 1BZ7A 3PP4H 2YSSB 1B88A 4K94H 4M1CC 4WGVB 1RZIA 1IAKA 1E4KA 5DR5L 4FHBD 1AO7E 3OMZA 4PJAF 4XCEA 5C6TH 4JB9H 1N6QH 4JKMA 4EDWL 4L9LC 1OPGL 1TJHL 3BE1L 4JN1H 5D7KE 1B2WL 3ALPA 4WW2C 3MLRH 4XAWL 1OSPH 2OJEA 2ENYA 5E1AB 4Y19E 2XZCH 3ULUE 4J1UB 4E42B 3D1MC 2VSDA 3T0XA 1H3GA 3PABA 4NGHL 2ZCKH 3WO4C 1XZ0A 4LIQL 1KPUB 3SKMA 3LZFL 5BV7B 4JQXA 1JFQL 5J12B 4RCAA 4WHYG 1RZJL 4MZ2A 35C8H 4Z7QE 1H15A 1S7UB 4BFIA 4JCMA 3N50A 2O5YL 3VRLE 3GJEB 3QIUD 4LKXB 3BP4A 1RHHB 3ROLA 3GI8L 1T0NA 3RNQB 2ICES 1IVLA 2NY5H 4CADB 3QEQD 1S7VB 1LDPH 1OCWH 3SEPA 1NJ9A 4X9IA 1IGTA 1UA6L 4JGUA 3H9SB 5C07B 2IBBA 4U6HB 4JPKL 3VXME 3WJLC 4YDLB 3LKRB 1U3HD 1BOGB 1Q9LB 3MBEA 4EUPB 5IB1A 1DQLH 5I1GL 4HBCH 3OBAA 4M7ZC 4QEGA 5J1AB 1X5GA 1HHJB 3HR5B 5FCUL 2FH8A 4F7PA 5HHVL 1QFPA 4ETQA 1JZ3A 1DUZB 3CFDA 3MCLL 3WEXB 5C1MB 3L7EA 4XVJL 3JVGC 1NLDH 5T33H 5C0BE 1WBZA 5D1ZD 3G5ZB 4QY8A 4N0RA 2Q8AH 2GK0B 5TDPA 1BFTA 1NCDL 1EERB 4U1GC 4CNIB 3QI9D 2MQ3A 3MNZA 5D6DA 4HWEH 4FABL 3OKLA 5BZDB 5E03A 3NACL 4HCRA 1P7QB 2ESVD 5JDSA 3C6LC 1AC0A 3BUTA 4M8QB 2WBJC 3QUZA 1MRDL 1DBML 3FOMB 2YPKA 3W2DL 5GRXG 3OSKA 3VFGH 5D7IA 5E8EA 1WISA 4DN3L 2C3GA 3OB8A 4AIZA 1L7TH 5KSAA 7FABL 3BZEB 3BT2H 1QNZH 1G7JA 3QULA 1KIPA 3WXVH 2UZXB 1W8NA 2HG5A 5JOFA 2CDGB 3FTGB 1QSFD 1UB6A 2ORBH 1NEZA 4QWWD 4KKAC 5L2JA 4PJCA 1H3XA 5GGVH 2K9UA 3SDDA 4KGJA 1FO0B 1MNUL 5IESH 5TQ0H 2QHLA 3IKKA 3NH7L 2HLAA 1N0XL 3QG7L 3K7UA 2GSIA 5IW6B 1S9YA 1FFRA 1WAAF 3LEYH 4GBXA 1CVRA 1DN0A 4WI8A 2F8OA 3NCEB 4UT7L 5FDWB 1UQSA 5DD0H 4ISVB 3UJTH 5KANG 1U8HA 4PJ5D 1G9NL 1CLZL 5DGQA 3ABZA 1HHKB 2CDFA 4PP2A 4XBPA 3IS1X 4L9LA 4HWBL 2DI9A 3W81A 2EE6A 2V6HA 1I9IH 5IHZB 5DZLA 4XI5D 4JFFB 2FR4B 4L3CA 5F8RC 3VI4F 3U36B 2R2EA 4P5KB 2EYRA 5F1IB 5CJXC 4FQQB 3G5XB 1EHAA 1FV1B 4MNQE 3UAJD 2YD6A 1IARB 2F8XC 3HZKB 3ZMRA 4HFWB 1TTUA 1A3RL 4LVNC 1ZHLB 1LO3L 5E6ZA 3ZKMC 4CDHA 1BFVH 3QSKB 4JZOB 2JELH 1BECA 1FFNB 1LHZA 2VLKB 4XP1L 4XPHL 5FO7A 2AXFB 4Y4KC 3TV3L 1MPAL 4C55A 4JKLA 2FIKA 2DQIH 3D3VA 1GC1L 4QF1A 1KBGL 1FL3A 1AR1C 1KENL 3UO1L 2CK0L 1TQBB 2YD4A 3KS0J 4P0DA 1H0DA 3FZUC 1DTUA 5F7FA 4X4XA 5ERWA 2VR4A 2EH7L 3HRPA 2Z31B 4Y5VB 1J8HA 3W0WD 4NNYA 1YQVL 3HCVA 4WEMB 1UKQA 3MR9B 3F58L 4XP6L 1TETL 1J0IA 1OARL 4XGZB 2QR0A 3WV0A 4Z7VB 3T1FA 1U2HA 1NANH 3EUUA 1UACL 4GOSA 3SE8H 5TPWH 2P8MA 3JVGA 5GS0D 1U8PA 3MLSL 4MDIB 3HZMA 2IMMA 5EPMA 4LCYA 5MENE 3KYKL 4HUXB 4FQXB 4IEFB 4FXKB 2R9HC 2IAMC 5EC1B 5DJZB 3GSWB 1V3KA 4J3VA 4BQ8A 3OKKB 5TQ2L 3LEVH 5ISZD 1I3GH 1OL0A 4LNRB 1ZHNA 4NDMB 3C6LA 4M1DL 4ONFL 4I5BA 2WBJA 1JFQH 3O9WC 1FVDB 1VDGA 2AK4B 2ZG3A 3BUYB 4LIQE 5I0ZA 1IEHA 4L8DB 3BP6A 1S7QA 3RZCA 3QUXB 1DQMH 3T8XA 3T0WA 4L4JA 1VPOH 2M2DA 4DQOL 2QV2A 3RDTB 5CBAB 2FWOA 3KPSA 4UDTA 4O02L 4Y5YC 4NC1E 2P1YA 5BJTB 1QKZL 4TSBH 3MACL 3L1OH 3QQ9D 5TDNA 3SY0A 1I7RB 5MI0C 1T03H 1FYTD 4WWKC 1AI1L 1MCQA 3QDGA 4TVPE 4FQ2H 1BD2B 4KK6C 4BH7A 2E3VA 4H8WL 4MCZA 1OM3H 2G60L 4OQTA 1DE4A 4N5EC 4K55A 4A2LA 5IVXA 1HHHA 4JM2B 1A1OA 4PJ7A 5I1GH 1MCFA 4TNWF 5AG8A 1S7WA 4XNXH 3VXSB 2WINA 1F6LL 5HHVH 5BMFH 5C6PB 1IT9L 2XKNA 3CMGA 4HCRL 5D5MF 5KJRH 1HZHL 4XVJH 1GGIL 1A02N 5CIPH 3O2VH 3MSPA 3CNKA 1OOAA 4P3WA 4PJXB 5GS0H 4WNQA 4P9MH 5DTFA 5IROC 1W0VB 5E95B 4OD2A 3H0TA 4OZHE 1DLHB 2R8SL 2VABB 4K23H 2C4FT 2VXUH 5INCB 2FEDD 3P4MB 4JFDE 4LSTH 1A0QL 4E5XB 2AP2A 3DXAE 2VZSA 3X11A 4NQSA 1G84A 1MRDH 5AEAA 4Q9QL 3RWEA 4UMGA 3KAAA 2VR5A 5KANI 5CZVL 3WHXB 4M48H 1KIUA 2CRIA 2MFNA 4U2ZA 3G6JB 3ULVC 1DBKL 7FABH 2PXYD 3GMQB 4PV9A 5EU4B 2R29L 1KJ3L 1FIGH 1WFTA 2AJXH 5FA3B 4DUVA 4P2QE 5C0CE 4OZIF 3BRFA 1KTLA 2MHAB 1Q9WA 2XA8H 3UTPE 3BPCA 4MB5A 3EFDH 2XNAA 1ZSDB 5EU7E 3ZKXB 4WW1B 1P4IL 4WI2A 4IIQA 2XG4A 2A6KB 2ZUQB 3DVIA 4NIKB 1GZQA 2R39A 3OAUH 3RHWF 2AEWA 4YO0A 3KNBA 2ADGB 1F3JB 3VG0L 4C4KT 1B4JH 1C08B 2V5MA 3S4SA 1Q72L 1CFNA 3VU2A 4JLRA 2NX5E 3WNNA 3VWKD 1OAYH 1YN7A 3TPUB 4OLVH 1PKOA 1ZLVH 4U7SA 1KJVA 3ARFB 4JFEB 3U7YL 1Y18A 2PNDA 5I8EA 4RBPH 3ULSB 2DM3A 1T22A 4OZ4B 3WD5L 5DSCB 1CR9H 1AQDB 3KVQA 2HJFA 3UTTB 1A3LH 3VRJB 4PGCB 3I75B 1UKSA 3REWA 2A73B 1MI5E 4I18B 2GJZB 1ZTXH 2IAMA 5IF0B 2HH0H 1YN6A 4XPFL 4KHTH 4HGWB 2DLGA 1CD0A 4NKDA 2BVQB 2HN7B 4JDVB 1B0RA 3O9WA 1JHLL 4NRYB 1D5ZA 1LO3H 2F5AH 2H26B 3GJFK 4WHCA 4AEIH 3FKUS 4O2FB 1CS6A 3HHRB 5D96C 4WDIB 3SKOA 4XPHH 3U46B 4OTXH 5MEQB 1MPAH 2E9WA 5GJTH 3TVMC 2GHWB 1HEZA 4U1SA 5J11C 3L5IA 4Y5YA 3F12A 5IGXL 2FJHB 4WO4C 1MCKA 1WAAE 3O6LH 3GJFB 3OGOE 1SY6L 1NLBH 5E2UL 4WWKA 1PG7X 5E56A 4XPAH 1BIIA 1Y0LB 5EU5B 1X4ZA 3RU8L 2F58H 4WTWA 1XFPA 1YMME 4KHXH 1GGCH 4WV1B 3MLTB 4EIGB 3F7YA 3PWLA 4XP6H 3QUZD 4BQCA 2ZSVB 4YHZL 3VI4E 1I4FA 4CJ0A 5B38A 2CO7B 5IJVB 2A77L 1DP0A 1UZ8B 3QDMA 5FGCE 3MLSH 3KLHC 2Y36H 2VXTL 3VFWB 1MJUL 2D9CA 3MFFA 2PO6C 4WJ5B 3PQYA 1G6VK 4MJ6A 1AGBA 2FCBA 2OX5A 3VXTA 4F3FA 1MIML 4QHLA 1FZOB 4WUUA 4NQXA 4NHCL 3ARGC 5D1XC 3SDDD 4Z77B 5BZWA 3GGWB 2BNUB 5CJ8A 5GRYA 2G9HA 4L3EB 5GSRA 5H37G 1U58A 4GLRI 4OQTL 5SWSB 2AAVA 4P59H 1SQ2N 3AREA 1ACZA 3MA9L 1UM5L 5GGUA 2RAMA 4CU6A 3REVB 1X5AA 2EIZB 5IB3B 3B8YA 1EEZA 4M1CD 5DA0B 4J8RB 3T4YB 4G5ZL 1V3LA 4PY7A 2X1QA 4KH2A 5FOJA 1MCWM 4ZPVA 1U3YA 4DOHE 4JDZB 1U8JA 3P0VH 2F54D 3T2NL 4GW4B 3KPRE 1MCEA 3EOAA 1K3ZA 4X8JB 4F9PA 1F4WL 4LSQL 4ODXB 4KDWA 4ONHA 3T0AA 4OB5L 2D03L 3TNMA 2D7MA 1WBYB 2KL6A 3NZ8B 4I3RL 1A6ZA 1QR1B 1YEDB 4YC2B 2DIBA 1GL4B 2ZCLH 1BX2A 2FL5A 5I1JL 1N6UA 4KVCL 43C9B 5J9PB 3U9UA 3S37H 4EOWL 1DR9A 1ONQB 2XWJA 1BQHB 2W9DL 4ZTPL 1FIEA 2FX9H 2YD1A 4S0TD 1YYMH 3B5GA 4M7LT 3STLA 5A2IH 1DDHB 2Z93B 3L95A 1KEGH 3D3VD 4HGKC 1Q9KA 4YAQA 3O6FC 2RIKA 2ZG1A 1DVFB 3O3BA 1E27A 4KTEL 4YHOL 2GAZA 1P2CA 5CZVH 2IANB 2BRQA 1VFAB 3CDGA 1N4XL 4MB3A 1J8HD 1OAZL 3RL1B 1FZMA 4HKJA 4P2CG 5SWQB 3ZE1E 4Z7UA 2GCYA 1IEBA 3SGEI 3RA7L 3QUYA 4Y88A 5B3JE 2HLFC 2HYMA 1FZKB 4U33A 1NDGB 2B2XH 3BW9B 4Y19A 5D5ME 1JPTH 1Q1JL 4XPBL 1M71A 2BVOB 2BSTB 1FL5B 2NTFA 2YD2A 4YHML 5F96L 1TCRA 2RJMA 5EBLB 2IGFH 1SBSL 1NKOA 1ZGLM 2E9BA 5GRJH 1E6OL 1IGYB 3AROA 4HT1H 3U30C 3GO1H 3D87B 2QSCL 3GSRA 5J56B 3JV5A 5IFAH 3C6LD 2WBJD 4NFCA 3S7GA 1NAML 5CP3H 1F6AA 4D0CA 5JPNA 3PL6B 4JQIH 5SV3A 4NO0B 3B83A 4OD3H 4LAJH 3TZVB 4NQCE 3KHQA 3FQTA 2VL4A 3P9LB 3AXLB 1YPZF 2H6PA 5C0AE 2V2XB 4NWTH 3VDBA 3F5WA 1QBMH 3KPSD 1Q0YL 3CJJA 1QR4A 2HWZH 4O4YL 5FK9A 1CICB 4P5TC 1R5WA 4KJYA 2UYLA 1XH3A 5F71A 1ND0B 4OZIE 5CZKA 3HG1A 1HOCB 4NKQB 3CU7A 4HEME 2YN3A 3ARGA 1AHWC 5D1XA 3H42L 2C4FU 3SDCC 3A6CL 3VFUA 4WFFD 1K2DA 3V9FA 2Q87A 2P47B 2R69L 4E41E 5B39B 3F7PC 3MO1B 3QUMB 4MS8C 3V6ZB 3QIBC 3B9AA 4NYLA 2HKHH 1A7NL 2V7HA 4HEPG 3RWGB 5FB8A 3P9MA 4R8WH 5E2UH 3VGGA 43CAB 5IFHH 3EYSH 2X70A 5ICYB 2LU3A 3PV6A 1JGDA 5GS1B 3FQWB 5HYSG 4KTDH 4NKIH 3EYFB 3W9DB 1M7IB 2NLJA 3BD4A 5I1CL 1YEKL 1TJIL 4XH2B 3TCLA 4LK4A 3QJHA 1K3IA 4KVNH 4PJHF 1J11A 4Q9BA 5D7JC 1PLGH 2CO6B 1Y6NR 1P4BL 3HAEB 3RWJB 1JJUA 4NNPH 3FB6A 4L1HA 3QG6B 3F6IA 3EGSA 1A9BB 4LHUB 1HQ4A 5C7XH 3C9NB 1SEQL 1PY4A 4JKPH 4WI9A 5EFIB 4ZFZA 5TFSL 3ZKMD 3ULVL 1JMXA 3TN0B 1KTRL 1R3LB 3V52H 5E4EB 4Y4KD 2DKUA 5SWZB 4RQQA 5BS0A 4LCIL 3RPIA 3O6FA 3WDIA 3T3MF 4GT7A 4R7DA 4F57L 3IFNH 4M7LL 1AR1D 3BP5A 3MRCA 5FUCE 3WCYA 1NMBL 4ZO9A 1AIFA 1K4DB 3EYVB 3OXRA 3QDAA 4UIMA 3FZUD 5I15L 5BQ7B 4ZXBC 3DWTA 5KZCD 3IFOA 4JAMA 2NXZC 2KQNA 3NPSB 2Z8WC 1LD9B 3B2VH 3B5TA 4KFZC 1A4KB 1M6OB 5GISH 1YJDH 2X4OB 2ICEA 1UB5B 2BOCB 1I1YA 3JWOC 5EU6B 4G5ZH 3LKNA 1FVEB 3BKMH 3HZYB 5IOPA 4CVXA 2ICWB 1X5LA 1CDGA 4YPGA 2B1HH 1RMFH 4MNQA 2BVEA 4KJWC 5JUEL 1HDMB 2IAMD 2R9HD 2UVEA 4RRPG 4MXWL 3TIDB 1I7UA 1RURL 3JV0A 1I9JL 2F19L 3IFLH 3QAZC 3JUYA 4EN3C 2G2RB 4Z95H 4LDEB 5HGDA 1MVUA 3G5YA 2CLVA 4PJDA 4L8BB 2HRPL 3O9WD 5SX4I 1MFNA 1B3JA 4ZTPH 2R2HA 1VFOA 4JG0L 4BFBD 1DBJL 3N06B 3UZEA 4U1LB 2BNQD 1KJ2L 3DV6B 5ICXB 1ZHKA 4QHNA 1R3HB 3GB7B 4YUEH 3ZZ1A 5DD3L 4P5TA 1FNEB 3MUGA 2XT1B 1MRFH 2YXMA 4WWKD 4KTEH 4ZUTB 1CLOL 5HPMB 5HGGS 4LVHB 5EA0L 4KK6D 5FYJD 3BZDA 3R4DA 3ARPA 3BIKB 4N5ED 5TF0A 1AHWA 2EDEA 1BFOB 5CJOL 4ZFGH 1OAZH 5HDQL 3PGCA 5EUOB 2OJZL 3B9KB 5A16B 3WYRA 4FFZL 4JFXA 3RBGA 1KPRB 1FNGB 3QWRA 2AJYL 1SM3H 3AVEA 4QLRA 2YK1L 2CSPA 5F9JA 1MHEA 3V7AG 3QIBA 2D31B 4P2RD 1F00I 5GHWH 4HULB 2XFXA 4OFYA 1E4WH 5C8JA 3A6BL 3BO8B 3BVNB 4GS7B 4GRLB 4X7TA 3Q6GL 5DJAB 1A5FH 1IGMH 3PQYD 4PRNA 4D9RD 3WFEL 2O5XL 4AY0A 4GRWB 2ERJB 4YHPB 3I02B 4MVBC 3FQRA 3GM8A 4WUUD 2QSCH 3CVIL 4J3TA 1EMTH 1BGXL 5D7JA 4ZUVB 4GLRH 1MCCA 1F4XL 5EZJB 3SDXF 5CHNB 5DVMA 1CFVL 4TSAL 1TZGL 3ULVD 1DQDH 2Q7YB 2WUBL 5L6YL 4NO2A 2Y06H 2FIRT 3WKMH 4PJAA 4X9GA 4DTGL 4LGSB 4JFHD 1IM9B 4TULL 4X6FA 3LRSB 5EIIB 3B6SA 1JV5B 2NY3C 1NKRA 4DGIH 4ERSH 3RFZC 2EEDA 2JK5B 2VC2L 3QUKB 4NPYA 2YC1B 3MRRB 5CZXC 4UOJA 1TVHB 1J5OL 5C0IB 2MKWA 3RNKA 5FYJH 4MD0A 5DQ9B 4F7CA 2VLJE 2HFGH 5J0BA 4ZXBA 3KYOA 5I1KL 2FJFB 3MRDB 1ZANH 3RAJL 1U8LB 2W9EH 4X7EC 1NSNH 3GKWH 2V2WB 4RFOL 5A2LH 4EIZC 5TE6H 2DWDA 2H8PB 4MXVE 4ZS7L 1IBGL 3U0WL 4NSKA 3INUH 4X0KB 4XCNA 4PD4K 1NBYB 2IH3B 4JFDA 4M6MH 4KUZL 4OF0A 1XGTB 3EOYG 1GIGH 1OSZB 3ZKQD 1U8NA 4PLJC 1VGEL 4YQXL 3IKCA 1T1XB 2K3TA 4O2EB 5BVPL 4LDLB 1Z0MA 5I1CH 3KJ6H 3BDXA 1TJIH 3C60C 1YPZE 3LDBB 1TVBB 4OCRH 5I1DB 1ETZB 1ZKAA 4JY5L 1NFDE 4JPVH 3IETB 3DLQR 5I1EH 2APTA 2V7NB 1ZWIA 1UH4A 4PGBB 2VXVH 1NCBH 1P4BH 4NQVB 2VOTA 3QWQB 5C0CA 1H3WM 3UTQA 2CKBL 4NRXA 5F70A 1IFHL 4HUVA 3EIFA 5LQBH 4H5SB 4JY4A 4LLWB 5IV2A 1EO5A 1MCOL 1SEQH 3HNTL 1FAIL 2ZNXA 2APFA 4OZFG 4UTAH 3ULVH 4G8EA 3QUYD 5IQ7H 1LO2L 3DO7A 1WFUA 3TVMD 1S9XB 4KJQC 1G7MB 3PE9A 3VXMB 3VXOB 4NUJA 3GI9H 4WENB 4WO4D 3U0TB 3CLEL 5FA4A 4PJIF 5FUOH 5ETUB 1A7PL 1TQCC 4OF5A 3KPPB 4ODSL 4UAOB 3U79A 2FGZA 4MB4A 4P46B 4OGAC 3DURA 5GRVL 4FP8H 4LCWB 3GIZH 4NN6B 5KVEL 1SJVA 2VIRB 3F6LA 3GMOB 1INQA 3PGDA 2YKLH 4I4WB 3PWJB 5C0BB 5IIEA 5JIKA 3T0DA 2FNBA 4HMDA 3V0WH 2OTPA 1A7RL 4PJHE 3S35X 1RIVH 3P77A 4PJGB 2BY3A 3KDMB 1HXYB 4NN5B 3AMKA 3FQUA 2ID5A 5KOMC 4HUKB 4F15C 4QHKJ 5INDA 2VZUA 2PO6D 5CLWA 5C86A 1CT8A 3CC5A 3OPZH 4PBXA 1T2QL 4UI2A 1VGKA 2GJ6D 3BAEH 1KTDA 3HG1D 4WI7A 4XBEL 1KJMA 1X5XA 2AEPH 3ARGD 4L5FH 3NTCL 5D1XD 2XI9A 3T3ME 5IMMB 4RNRB 5ILTH 5EOTA 2NY6B 4I13B 1G1CA 2VLRE 1QLRA 1HHGA 4J6RH 4ODWA 3DECA 1DBJH 2B4CC 3V8CA 3HNSH 3TYFB 3CUPB 4ZS6C 4G80A 3V5KA 4U3CA 5DO2C 5ECJE 3OJVC 2YPVH 1CXEA 4PGEB 4J12A 2CD0A 4KROC 4HKZA 2JTDA 4I48B 3BWAA 4PJEF 3C8KB 3QEQB 4NCDA 2EKSB 1LO0H 5HVGB 5FKAA 1A6TB 2CMRL 5F7UA 3IDYC 4JFQA 3LKQB 4UTBH 3MMEB 3FB8A 3QWOB 2DYPB 1EFXA 1ZVSA 5F1OB 5HYEA 1YEGL 3CVHA 4RGNC 5LGJB 1QFOA 3S5LG 4FFZH 3VE0A 1TPXC 3KPLB 2YK1H 4LAQH 4FQLH 2DL2A 4YIQB 4YHKL 1HCFX 4JQVC 3U6RA 4AH2A 4BKLA 3SJVA 1MCBA 2DWEA 4YE4H 1JZ7A 4NJAH 4NWUH 3VXQB 3HUJF 4HS6A 4XP4H 3OKNA 2G5BA 5D1ZB 3QNZA 1A7QH 5K93A 1UH2A 1SVCP 3MGTB 2EDJA 1ZK9A 3PHSA 4WY7L 1CGTA 4H25B 3MYJA 5D72L 5BS0D 4G43A 5GGTL 3C60A 3O6FD 3H9ZA 4LEXL 2I9TA 4O51A 3WUWG 3MRQB 3MLWL 4CMMA 5EN2A 1F4XH 4IRZL 2QTEA 5J6GB 2EZ0C 4TSAH 1R3KA 2CLZB 4OIIL 4G42A 1AP2B 2DTSA 2CIIA 2LTQC 1KELH 5C9KA 1JZ8A 3KPRA 4ZFOB 1NCCH 2E27H 1QSFB 2IPKA 4PTUB 2HLFD 4Y16A 4FOMA 3O6KL 4AT6A 5CINL 5GZNC 3UPRB 1NEUA 3D85B 1EJOL 5JA9A 2V2TA 5J8OA 1WBXA 4XNUL 1NCAL 2B5IC 1DCLA 2VWEC 1WC7A 3CDCA 3RUGE 1D5BB 3STZA 2R0WH 3SBWC 4UT6L 1Z9OA 4R0LB 5IW3A 4DZBB 2DQHH 1IQDB 3ELAT 4KMQA 3SCMC 1JMZA 3FRUA 4KAQL 1HQRB 5MENB 4K07A 4RMTA 2C3HA 1NMAH 1KPVA 3OGCA 5E8NA 2Q3ZA 3SDXE 5AZ2L 1LO4H 5DJ8A 4O00A 1VADA 1MLCA 2IALB 5DUPL 5MERA 3LN4A 4G6AC 4HKBB 3MNVB 5T5FH 4P5TD 1IILE 4KUCD 1CFQA 1DFBL 4G9FD 4GKNA 1I1FA 1JNHA 4YZFF 2X4UB 4MD4B 4JRYE 3UTSD 1UWXK 2OR9L 2VZVA 3RVUC 3SDCD 5F44A 4M62L 5D5MA 3ZE2F 3HPJB 3U2SB 5ESAA 3QWRD 1HH6A 1JP5A 5EOQH 2FBJH 1AR2A 4MS8D 4TQEH 1QRNA 1MRCL 3QIBD 3HPLA 5E5UB 3FT4B 2LVCA 1N7ML 4OFYD 4FQ1L 4IOIA 1FLRH 5HYJA 4XBGB 1A6VL 3Q6FA 5DHVA 3L3JB 3OXSB 2R0KH 1JWUB 2ZUSA 3MV9A 4LSUH 3DUSA 5DEFA 4U1KA 4QXTA 1UZ6F 2CK2A 1OHQA 2F5BL 4P2OC 3N1FC 2W0FB 4HG4K 5C2BH 2YD5A 3D39D 4LLYA 4X5XB 2AEQL 3TCXA 3W0WB 1K8IB 5ADPL 3ARBC 1C5CL 4BH8B 3BGMA 5D7JD 5CMAB 5JW5B 3QDJE 3HE7A 2VXSL 4BSVB 4QHUB 4JQVA 4N90D 4OZHB 4JPIA 4ZYKB 1P69B 3L5HA 3MLVL 1BLNA 4HS8L 4DKEH 4X83A 1G6RA 4NO3B 4OZIA 5I8CB 1I7TB 3DXAB 5LWYH 1A47A 3RX5A 4EXKA 4QOKE 3G08B 1KC5H 1WT5A 2DQEL 2ZKHL 4S1QH 5IMLB 1MHCB 4DW2L 1EUUA 2HA1A 4E41A 2O5ZH 5F9OH 4XBEH 3MGAA 1ORSA 2IFFL 3HI6H 2RCSL 2HKFL 1JGEA 1GXEA 2ATKB 4PJIE 3MRGB 2P24A 4JO2L 1RJCA 5AD0A 2QKIB 1ED3A 4P2QB 4ZXBD 3CZFA 2DLFL 3OHXB 5CEYA 2X10A 2GUOA 2NXZD 3HC0A 4MJIA 4DVBA 1U8KB 4GAJL 3MRHB 3MRBB 5LXGH 4RAVB 4H0HB 3GBLA 2IH1B 5JNYB 1F4YL 1U8OB 2PYEA 2VDML 2DJ4A 4R97C 4S1SL 4UNUA 5C0RL 1KXQE 3FQNA 4UUJA 1DJSA 4JFDD 5ESQA 1UWEH 4MWFB 3SDAB 4MLIA 1FYTB 4PY8I 3T2QA 4X80H 4OLZL 3HKFA 2UWEA 2XWTB 3MGOA 1YEFH 2I5YL 3DGGA 2OZ4A 3RIAK 2NX5B 5EBMB 5C0NC 4KJWD 3SBWA 3QNYB 2KQMA 1P7KA 1KIRA 3TJEH 3AUVA 4Q9RH 5A1AA 5I76A 1CQKA 1KG0B 3G04B 4MAUL 5C0CD 4EN3D 2C4XA 4X6DB 3D18A 4L29A 5L8JB 3GSVB 1MI5B 5K9KB 2KKQA 1IJ9A 3BSZH 4TVPH 3G6AA 1JF1A 5HHOD 1YEIH 2L0DA 2EDDA 3FAWA 3P2TA 3GSXA 1HKLH 1LEKA 5I19L 3FO1A 1FFPA 3IDXL 2NZ9C 4U1HA 5BO1L 5CEZD 1KB5A 4DKFL 3BZFA 5DRNB 3ARZA 3CFJB 3MLWH 3WFCL 5DLML 5JORB 1Z9SA 2VE6B 1UVQA 5IBLC 3KPNB 1T04B 2Y07H 5F6HI 4Y1AE 3S88L 4KZEL 2PXYB 1ZHBA 1NGYA 1JHKH 5DJ2B 5CKGA 1FZJB 5ESVB 3TWCL 4LLQB 2DIJA 4MA8L 4RWHA 4PRIE 4KRPC 4BELD 3O6KH 1YNKL 4WFGE 2A83B 3KG5A 2BMKA 3BEWA 4H88H 3MUHL 2VQUA 3JWOH 1YMMB 1EV2E 3CX5J 5HHXL 5I73B 32C2A 4UB0L 3BRDA 4XTRC 4F7EB 5IMOB 1N0LA 1NGPH 4ZOBA 3FO2A 4RAUA 4QRTA 5IMKA 4KPHL 1F5WA 4JRXE 1IGJA 4ORZC 1SYSB 4DFIA 1SMOA 3GMLA 4QRPE 2OJEB 4X99B 1R5IA 3RVXC 3V6FB 1HN1A 2BVTA 3GIVB 3P30L 3ZTJG 1N2RB 4HJGB 4MVBD 2APVA 3AS1A 2DIAA 4B0MM 3K3QA 1DEEB 3ARBA 1R24B 4OM0H 4JHWL 5I2IA 3PWVA 4P49A 3DNKA 4U1NB 3VWKB 3PGFH 4R7NA 1BREA 1T5WB 4BFIB 2MPAH 4GKZA 2QQKL 5DMIH 4CRPA 1W0YT 2XACC 2WQRA 1RUPH 4JKWA 3X3GH 1WITA 4NHUA 2NY3D 4Q7DA 3CH1B 2NXYB 4ZD3H 1NJ9B 4BA8A 1A6WH 4NZRH 3HZVA 3FQXB 4ZPTB 3SPVA 5JW3L 2KDGA 1N5YL 5CEZH 4UT9L 4MD5B 3E6HA 2EDLA 3MJ9A 3JV4A 1EFXD 4EEEA 5A43C 3IRPX 5DYOA 3ZDZF 1NC2B 4M62H 1Q0XH 4PUBH 5DEGA 1FE8H 2IJ0C 2W0KA 3VFOB 3FMGL 2IMNA 5E2JA 2X4PB 4DOHB 3VXRA 5B8CA 4ETQB 5HHPA 1Q94B 3EDFA 4ZNEE 3WS6C 3SJVD 4FQ1H 2XY1A 4Z0BH 2Q6WB 3AAZB 4PLJD 4LPVA 4LSVH 5FYLL 1G6RL 1RQ5A 5IB5B 4XPGL 1P6FA 3C60D 3DTXA 1A2YA 4G8FB 1RI8A 4L8SB 3I6GA 1UYWL 1MCJA 3O4LD 2Z8RA 1AGEB 3LN5B 3RQ3A 4PJFB 2A74A 5DT1H 4N8CH 4P5MB 5E70A 5HY9A 1J1PH 2J88L 5CWSB 1RK1B 2OP4L 1AH1A 2YZ1A 3HE6B 3KLAA 4Z8FL 1F97A 3G6DL 3T2PA 3L3GA 3D0VB 3QULB 2FSEB 2ZKHH 1HYSC 2DICA 4KJQD 1TCMA 2BSRB 4KDVA 2GITA 4ZO7A 1JPFA 1VACA 2YMXL 3S36X 1QP1A 1CE6B 1UKTA 5GSVA 5AWNH 4EI5C 4XZUA 3SKNA 1SJEB 3RWFA 2UUDH 3VFSB 1S9WA 4K71B 5DURD 1JYVA 3Q3GA 4OGAD 5F3HB 2BC4A 2ZJSL 2XPGA 2E8YA 3S3PA 3TYGH 1YEEH 3D5OF 3CVHH 3RWHA 1U91B 1CD1B 1WK0A 5HDOA 3NCJL 4HX1A 4E9LA 3H3BC 5BCAA 4S1SH 1XGYL 1I8MB 5F89A 4MNHA 1D5XA 1PG7W 1VFMA 1YPZA 3BKJL 5ANME 1NGXA 1OQXA 5DHYA 1D6VL 2D7OA 4ZSOB 2ICWJ 3K1KC 3JTTA 4PP2B 1PY9A 2F54B 5C3TA 5FM5O 1R3JB 1H5BB 2I5YH 5LG1A 2OL3L 3DX7A 5ELIA 3UBXG 5DWUL 2P46B 5D1QC 2XQBL 1TTFA 4WW2B 3U0PA 3UXFA 5KAQG 1GHFL 3QHZH 3FN0H 5J89A 3P3YA 4U6XB 1G9MC 1JPGB 5IBTL 5IEKA 4MAUH 4NQCB 3UZQA 4DK6A 4ORGB 3D6GA 4Y7MA 5DQJB 3ZT7A 5C0AB 3KXFD 3VXPB 1F3RB 4LLDA 3E2HC 3EOBA 3DYMA 1MFEL 5FECA 4ZS6D 4UU9A 4IMLB 5I16A 5DO2D 2DMCA 1AKJB 1CIUA 1U36A 2Q7NA 3OF6A 1QRND 2RR3A 2N4IA 2VQTA 1TZIA 2VITB 4LCCC 2WIMA 2OM5A 3IDXH 4KROD 4Q0XL 5HYJD 1MJ7H 2YPLE 3FL7A 3IJYB 3MRIA 2C1PA 3MV9D 4GXUM 5J1TC 2HTLC 1RJLB 4PJHA 2CLRA 3A67L 4H20H 5HHME 3GMNB 4RGND 1RU9H 5J13C 1I7ZB 4N8VG 4M7ZB 3TWCH 3MNWB 1LEIB 1T1YB 3HE7D 2X1OA 2QR0B 4HXBH 1MSPA 1YNKH 2XY2A 3BH8B 5E08H 1FP5A 4FQJL 4R90L 5DK2B 1KCVL 3WS6A 4Y8DC 1XMWA 5FYLD 5ID0A 3CPLB 3QO1B 2A9NH 1A6UH 2CDEB 4KQ4H 3FB5A 5DD1L 1OGAB 2RFXA 1Z0NA 2ITDB 4X6BB 3H7LA 4HIHB 4GXVL 1SJHA 5FYKU 3C8HA 1OLLA 1D6EB 2X1XR 5CSZA 4F7MB 4E41D 2C3VB 3TT1H 3TT3L 2HRLA 4G6JL 1U3ZA 3DMMB 3VH8G 4JHWH 1ZHNB 3C6LB 1CXLA 3HTLX 3NABL 3RL2A 3TLRA 4JZJC 1OP3H 4TSCH 3VXUE 2EZ0D 4MJID 3QFJA 4MSWA 2ZOLA 4YHYC 3WN5C 3K8KA 1A6AB 2R4SL 2B4CH 5KVDL 3SE9L 2PYED 4CKVX 4HWZA 4MA7H 4Q58C 2X9YA 2VQ1A 4LRIC 3WLBB 5GZND 3ETBF 1HINH 5GGSB 1CU4H 1J1OH 3GSNA 2AKRA 3V4UH 3IAPA 1KN4L 4BM7A 4XAKD 4YDVB 1RZ7H 1HNFA 5DHVH 4EI5A 1ERNA 3VD4A 1BQUA 1KSRA 1VKXB 1TLKA 3VRIA 5KG9A 2Y25A 4YBLB 1CGSL 5EOCJ 3UYRL 5TDOB 2ZSWB 2Z91B 3DVGA 1KCRH 3SCMD 1MEXH 4Y5XC 1BEYL 2V5TA 4I2XA 3TA3C 4EXPX 1C7SA 4Z7VF 4MCYA 3TGXA 3IXAB 3QA3A 4XMPL 2DTML 2E7BA 5F93C 4G6AD 4XNYL 4WFHD 1IC7L 4NQDE 5EB9A 1I1CA 3QXTA 4IJ3C 5D1QA 2JF1A 5KBNC 1UM6L 4V1DD 4UV7L 4U31A 5CJBA 3D0LA 5FYKE 5T3XL 4G7VH 3LS4L 1K4CB 4NKOB 3SGDI 2CRMA 1T5XB 4OSUH 3RVUD 1M4KA 4Z8FH 2YUWA 3DV4A 1ZT1A 1K85A 4CW1B 3UBXI 4HZLA 3CX2A 3U7AA 4ALAL 5JLZA 3ZDZE 1FC2D 3QXVA 5E99L 3D25B 1CI5A 3KLSA 1K6QH 4Y4KB 4CN4A 3OKEA 4L4TE 1KFAH 3CFCH 4LCCA 3KJ4B 2ADJB 3VCLB 1KCUL 5T3ZL 2X5PA 2DQCL 3BKYH 5KW9L 4NN7C 5C0DA 1FN4B 3MCKB 3WNOA 1VFBA 4AQ1B 3AU1B 4ZFFB 1ZT7A 3MPCA 3TIEA 5DJYA 4X7SH 1N3NA 3PDGA 1U93A 4P2OD 5KZCB 4PB9H 3B43A 3DPBA 1DEDA 4AMKH 4YK4B 4YO0B 2OZ4H 4I0PA 1FDLL 2P5EB 3ARBD 2H9GB 5MEOA 3S4SB 3AFLA 4JM2F 2EDNA 5E94A 2P43B 2IQAB 5TE7L 1I75A 2J8UE 1T3FA 1TZHA 1P9MC 3O45A 2BOBB 2R56L 3LKPB 2VUOA 2WWKO 5C70A 3WNKA 2FB4H 2LAAA 2AXGA 3QHFH 2QL1A 3O2WH 4M6AA 1QQDA 3DSFL 3HLAB 5HI3C 2I60L 4JRYA 2VDQL 5I17A 4PJBE 1OWWA 5ICZA 5DS8B 4K3DL 5DK0A 5DJ0A 1OAKL 4PJXF 3IDIA 1QBAA 4IOSD 1T89C 4LSSL 1NAMB 4Y2DC 4Z5RB 1KB5H 3KWWB 5HSFA 1J8KA 4LPCA 2FJGA 1PZ5B 4MXQC 5MEPA 1F11A 2R1XA 1C1EH 4K3GA 4JZJA 3IB4A 2XN9D 2YRZA 5IR1A 1I8IB 4NM4H 3OR7A 3QXUA 2FHBA 1OGTB 3NFPA 4HIIB 3VXRD 2BNQB 1RJZA 1FH5H 3GMPA 3EYOB 3SKOB 3G6JF 4PIRF 4Y4FC 3RGVC 1EFQA 1AC6A 3Q5YA 3PNWB 3BEVB 3BYYA 4ZAKB 1HEZB 1QBBA 4LRIA 1LO5B 2VLJB 4F37K 4NZTL 4W81A 2A6IA 5MI0B 3LHPL 4P4RB 2HFEA 4FXGB 2GTWB 5EZIH 1Z3GL 1V7ML 3EFFA 3HMWL 3MXVL 4RA0C 4F33A 4RWYL 5C0ND 4LLMA 3ROOA 2YR3A 3IFPA 1MCPL 2P8PA 1BQLH 1PD6A 4XPTH 4HUNB 2H3NB 5TGBA 4P9HH 4GAYB 2FD6L 2D0FA 3PP3H 4M7JL 4Y5XA 4P2RB 4RIRA 3MRFB 1EHLH 4NOFA 1OWRM 4Q2ZA 3RJDA 4HIJB 1J0JA 5L0QC 4HH9A 1GJIA 1NFDB 3QH3B 4DZ8B 3U4BH 1X5FA 2AJSL 5F7EL 4X5WB 3QJFA 3U7WH 4K2UL 3ZYOA 4C83A 1BVZA 3L7FB 4TUJB 2NZ9D 4KRLB 1QO3A 3KGRA 2DJUA 4UDUA 3DI2B 1G7QA 2Z92B 4JHBA 5IBLD 4H0IA 1UJTA 5T5NF 2R1YA 1LILA 2CUIA 5B39G 1BPVA 4HKXB 1Y6KR 2MJWA 2G9HB 4Q6IB 5GSRB 4HUUB 2NY4C 3MJ9H 5TE4L 1OF2A 4WU7B 2Q86A 4JFOA 3SQOH 1IQWH 4GUPB 2FZ3A 4S2SB 5KVDH 3NMEA 1KGCD 1PVHA 3PJSB 5L88L 4KRPD 3RKPA 2EDHA 4JKKA 3VFNA 3P11H 1U6AL 4PY7B 3L3IA 5FGRA 3QQ4B 2NTSP 5IBUB 5FHBH 2X4QA 4UINH 4G9DB 4PRBA 4XTRD 5EORH 1XR9A 4G6FD 4C56A 3RVXD 5LAXB 1M05B 4WTZG 5T1DH 1CGSH 5HGBB 1EZVX 1A3QA 1SEBB 2M8XA 2XV6B 3L3HA 4J3XA 3UTZB 3V0AC 1T0PB 3ES6B 5AAMA 3FRPA 1U8IB 1F3DJ 4JFYA 1F02I 3AM8C 4KU1A 3O0RL 4PJEA 3DVNB 4KI1A 1WIUA 4JFZL 4XNYH 1X4XA 1IC7H 5C0FB 5C08E 1WSST 4JO1L 3VFVA 4PRAA 5EIVA 4QT5B 2EH8H 2VLRB 2JJSC 1JZ2A 4M3JA 4R2GB 4P4KC 1BVKA 3PHOA 1WUNT 1EAJA 3MRLB 2OSLA 3TBWA 3B2UC 5LCVH 3P4NB 4DN4L 1KJ2B 2Q76B 4JHZA 3S37X 4BZ1L 3WFDL 4ALAH 4LSDA 3IU3B 4JG1L 3LSOB 3C5ZB 4G7YH 1H3PH 1FVCB 4RMWA 4CJ1A 3UC0H 4U1MB 2DDQH 4PB0H 1G7PB 3HUJA 1NFIA 4Q97A 4JRXA 2UZIH 3O6ML 4GG6B 2VH5H 3RGVA 4P2YA 3TVMB 4QRPA 1AY1H 1BAFL 4WO4B 1UG9A 2DQCH 3MRNB 1K5NB 1DANU 2XWBB 1A4JB 4JM4H 5F7KC 4YH6A 1QFUH 3MREB 3MOBL 3WFZA 2DQGL 4JCLA 1PX3A 4Z7VE 5T3ZE 4WI6A 2VISA 3IGAA 3NVQA 4HAFA 4OAWA 4OM1L 3V4PH 2ZPKL 1F6FB 1FL6A 1Z9MA 3WE6B 3PIQB 3BJ91 4HG4J 4YDJB 3L5XL 5TE7H 5EBWB 1XAUA 1QFHA 1UEYA 1GVIA 3FT3A 5DDHB 4JPWH 4OGXL 3QFJD 1EEYA 1MAML 1YEJL 3BPOB 2I60H 5KN5B 2PO6B 4QTIL 5IQ9B 1HYSD 4DCQA 2P44B 4FXLA 2B8OT 3OKMA 1NBZB 1JTPA 2BDNL 2GJ6B 4K3EH 5C9JA 4HJ0C 2AGJL 4EI5D 1MCHA 1T7VA 1ZA6B 5D6CA 1JIBA 1YYLL 5IHUL 1JCKA 3MQIA 1MHPH 1RUKL 1BD2E 3VW3L 1KNOB 2KH2B 3Q2CA 4BZYA 4LRNL 3VGDA 5C6WH 4RX4A 3LKSB 2MSPA 4U6TA 4MAYC 2E5EA 3IDNB 4HF5H 2EC9T 1ZGLB 3RUGB 5FB8B 1OB1A 3LS5H 1NH6A 4LLAA 3LHPH 2YBRA 4ELMF 2O61B 3VJ6B 4LSPH 4OGYH 3VXSE 5I1HH 5JHDD 3TBVB 4MGXA 1ES0A 2J6EA 5EO1B 3LD8B 4OUUB 3MJ6A 4PG9A 2Y7QA 4LBEB 3IF1A 4LLVA 5FDYA 5HJ3B 3QEGL 2D7TL 3BN9C 4RWYH 4YBQC 4ODVH 4QCIA 4GG8B 4RGMC 5D1QD 3GMMB 3QJHB 1L4IA 4IRSA 4ZTOH 1G7HB 3PWPD 5D7LE 2QLVB 3SDXB 4H1LG 4IRJB 3MA7B 2BJML 3BPLC 3MXWL 3QEHA 4I0CC 3RJQB 4KMTH 4OCXH 1RZ8B 2VJXA 1NQBA 2CUMA 4D0DB 1OTSC 3J8F7 4M5ZH 3OQ3B 1A21A 3TBYB 1D9KC 5KSUB 2IADB 3FONA 3AM8A 4KK5C 3SOBL 1W0WB 3QYCA 4K2UH 3L5JA 4RGOH 1SBBA 4LLUA 5B21A 3N85H 3DX9A 3G6JE 3T77A 2BERA 2JJSA 5DJCA 4U3XA 3B5HA 2CKBB 2AV1A 3QFDA 3IJHB 3GSNH 4P4KA 4Y4HC 1BBJA 2HTLD 1I9EA 3RI5K 2AVGA 2C1OB 5HTSA 8FABB 3K4ZA 4I0PD 2P5WA 1QBLL 1MFBL 2OTUA 4P23A 5DUBB 3W5NA 1HSAA 1IL1A 3BH9A 1JHTA 3VFPB 3MZTA 4W70A 4U6VL 3RVWC 3FO9B 3PHQB 4HDIA 1QUNA 4K7PL 5GRVK 3HMXL 4EVNA 4BUGA 3LKNB 4AL8H 1NL0H 1FNAA 4PJ8C 1NGZB 4RFNC 2DBLH 5BRZA 5LGHL 2BFVL 3CCHB 3QDJB 1OT2A 3MRKA 4GMSL 4LVOC 1WF5A 3BHBA 2R0ZL 5HYSB 2PR4H 1QZ1A 5ALCL 2GFBB 6FABH 2IG2H 2VLLA 4J4PC 1S9VB 2ZOKB 4H26A 4ZUUB 4MHHI 4PTTB 4XVTL 5HGDB 2NY7H 1G9MH 4QOKB 1QSEA 2J4WL 1S7XB 4OLXL 1XCQB 4JY6B 2DJSA 2YPLA 1NMCC 1KXVC 4MA3B 5DMKB 4EDXB 5HGAA 4JO1H 4PJIB 1WCBB 4O58H 1BVLA 1U3JA 1XIWC 3BYTA 4G9FB 1YNTB 4G8GE 4ZMAT 1YECH 3QQ3A 2FX8L 1T0MB 1PSKL 5H35A 2B0SL 4U1IA 5M95B 3PWNB 1RZKH 2HT4C 3VFTB 3UTSB 2FYYB 1YMHB 4LSRL 1J05A 3MOAL 4CN1A 3SDCB 2AJVH 1EGJL 1W72A 4LARL 1YY8B 2GYSA 5JIIA 1NAKH 4P3CH 2AV7A 5E5MA 3CMOL 3CSYA 1MQKH 4HV8A 4CGTA 1IGFL 4D9QD 2Y6SC 3QIBB 1C12A 1FBIL 5BVJB 3TA3D 3L3OA 4QXGH 3X13A 3TO4B 4YR6B 1XCTA 4PGJA 5I1LA 3MOBH 3SE4C 4QHMB 5BXFB 2HVKA 4U6YB 5D2LE 3MRJB 2HAZA 2CIKA 4XMKL 3VXUA 4UQ2A 2OK0L 1EK3A 2FGWL 3D39B 4R4BA 4HFUL 3WS3A 5CFHA 3HRZA 1FFOB 3L5XH 2R15A 1CYGA 5GGQH 2XZAL 3NPZB 1MWAL 1F4HA 4YHIB 1CDHA 2BCKB 3KS0H 3OAYK 1FJ1B 3D2UB 5EU3A 2B1AL 1U95A 1GOFA 1P4LA 1D9KA 3H3KA 3GBML 1CGUA 2YA2A 5I18L 2VKXA 5ADOH 2VDLH 1NDMA 4L3EE 5F3BB 3WNMA 3I84A 3TEUA 4Y1AB 3WL9B 2DMKA 1QEWB 3DRTA 1A7OH 1OQOA 1EBPA 1J18A 4GW1A 3MJ7A 1ZA3A 5D70L 3WIHL 5L2KA 4Y4HA 4C56D 1R0AH 1XF3A 4PRIB 1PKQA 3WDHA 2J6EL 2NW2A 2ZUTA 3KYOB 3RWIB 1RUKH 4G6KH 4X6CB 3KHOA 2NXZB 2E7HA 1CL7I 4LRNH 4AEHL 1BZQK 3QXAA 5EUOF 3ARQA 5IB2B 4KI5E 3TNNA 3U9PL 4XHQA 4MA1C 4KK9C 1F58L 4NUGH 9CGTA 3MROB 4IDLA 2K7PA 1P1ZA 3C2AH 4MLSA 4AM0A 3O3EB 1UM4L 3KYNB 1AGCB 5C0EA 5D2NC 1CK0L 1AFVL 1FRGL 2FO4B 1U8QA 1X5IA 4ZUSA 1I8LA 5K33A 3BJLA 5HI3D 4ZUWA 3N0PB 2D0HA 1BBDL 1EO8L 4NO5A 4DEPC 2GEEA 2EYTA 4YDKH 4YWGL 5AYUH 4YX2L 3SHSA 4Q9CA 1NFKA 4PRHB 3Q0HA 5DJXB 1NUDA 4Y2DD 4GRWF 2DAVA 3DYOA 2R2BA 3DO3A 3V5HB 3MXWH 4MXQD 4EN3B 4KV5F 4BFEA 1I1AB 4N0FB 1RUMH 4JY4B 5IV2B 1XGRA 3DJ9A 2Q1EA 5K9JL 3CK0L 1VERA 2NYYC 4D3CL 2YSSA 4M7KL 1MREH 4Y4FD 3RGVD 5HHOB 1U42A 3EDEA 3VWJC 4OCNC 5IJKC 1RK0B 4NUJB 2PTTB 1IM3B 1XIWA 1RULL 2WUCH 1OD9A 3O3AB 5GIRB 5ID1B 4X4ME 4WUKL 4ELME 3GHEL 4JVUA 4A6YB 1AQKL 4EBQH 3HC3H 1T66C 5F1SA