2HVJB

Crystal structure of kcsa-fab-tba complex in low k+
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab heavy chain
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 53
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2006-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hvjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hvjB01
2DQEL 4KC3B 1FL5B 3SOBL 3C60B 1F58L 3K7UA 4UILL 4OZFG 4XBGA 5JIIA 2D4DA 2AKRA 2IQAA 4UOW1 1T6WA 1N3NB 2ZCLL 1NMBH 5FO9A 3V4UH 1RZFH 1UCBH 3VFNB 4E41A 1T1YA 5C8JA 3KNBA 4HUWB 4CGTA 3OKEA 5D1XB 5CJOH 1AD9B 1JI1A 2A6JB 4JRXA 4XPGL 2CO7B 1JGUH 1KTLA 5C0CA 1E6JH 3RGHA 1IGTA 2C7UB 1FFOA 5L2KE 3H9SA 4GO6B 2D7TH 3SY0A 5DJDA 1AP2A 4NQDA 3ZLQC 4GRWH 1U3HA 1T21B 3OXRB 3QNZB 4ZO6A 2DYPA 1PG7X 5KANG 5I1AB 5CWSB 4RAVA 3KJ6H 3GGWA 1MY5A 4Z0BL 3VMNA 5L0QB 2BNRA 3AVEA 3Q5TA 3CFDA 4H20L 3F6IA 4E41E 3ZKMC 1L6XA 3SKJH 3NFSH 2JE8A 4HH8A 4HKBA 2W0PA 4Y4FA 1Y18B 3SDCD 4JRXE 1LO4L 3GUTA 4K3JH 4G8GD 3R8QA 2X1QA 2BSTB 3H9SE 4M5ZH 4OUOA 2XWTB 5ISZD 4PY7B 4WDIA 3S36X 2JCCF 2ITCB 4GT7A 5JDJA 3MJGX 2DLFH 1EDQA 1EO8L 4M00A 4TRPH 4OD2B 4ODVH 5D1QA 5SWSB 1TZGH 2BNRE 3PJSB 1MJ8H 3HR6A 4X9GA 5HYFA 3G9VA 1FV1B 4OAWB 1S9WB 1ZHBB 3VWKB 1GYAA 1RZJC 3KDMB 4ZXBB 4Z7NE 4MCZB 3WIIH 5C2BH 3D48R 3DROA 5BW7C 4KDTC 2P47B 4L3CA 1I9IL 5C92A 2X1OA 2VH5L 5DI8B 1L7TH 3B9EA 1MHEB 3WHXA 43CAA 3DRTB 4WUUA 4UTAL 4P4KC 4ZFGL 1KXQE 3TV3H 3IVKA 2YBRB 1DQJA 5E5MB 3DX9A 3GIZL 3CFEB 1QSFA 5D96C 5GIRB 2DQTL 5E2WH 3D2UB 3U7YL 1UA6H 2P44B 4JPIA 4PLJD 2B4CH 4YDIL 2P42B 5D7LD 3L7EB 2DQGL 3CH1B 5A43C 4TUOB 3WIFA 2Q8BL 4LSPL 4Y2DA 3MLYL 4BKLA 3V6BR 1H3PH 5MEPA 4FQQB 1A4KA 1FIGH 5C7XH 1WBZB 4I3RL 4OGXL 1CGVA 5C07B 1S9VA 4RIRB 3KPMB 2LE9A 4X6FB 4ZUWB 1ED3B 4NN7C 3BD3A 1RUKL 1QSFE 4JANA 4LASH 1NDGB 4HX1A 5E9DA 1XGYL 1GJIA 5D9SB 4NYLA 3STLB 3MRDA 1BGXH 25C8L 1IJ9A 2FZ3B 4XPAL 4MCYB 4U7SA 5T1KA 2HYMA 4G7YL 1U8QB 4K9EH 1S3KH 4Y16D 5IB5A 4PJBB 4UV4L 1L0QA 3IAPA 5EBGA 4RRPG 5IESL 4Z18A 1MCSA 1JPSL 4K7PL 4H26A 3LKQB 4HPYL 2NR6D 1KJMB 4I77H 1UENA 5HHME 1MIML 1MELA 1RZIB 2XNAA 3KLDA 3X11A 3GMPA 4WO4A 1PX4A 3O2WH 3ULSB 1MLBA 3TBTB 3BPLC 1JL8A 1CL7I 2IANB 2CGRH 1JRHI 1S7VB 1YQVH 3GI8H 5E9DE 5FYJE 2HA1A 2R0LH 2NY5L 5JHDD 3T1WA 3VGBA 5H37G 5HJ3B 4M1GL 3LZFH 2QHRH 3SPVB 4TTGA 5DRWB 1A3RH 4XVSL 4AL8H 1LP9B 1NC4A 1RJZB 4NPYB 5L2JA 5IB2B 4YHYB 1M05B 3I9GH 3BZEA 3WO4B 2OZ4L 4IMLA 3UO1H 4N0UA 2X09A 1KENL 3VW3H 1YEEL 3IFOA 3ZT6A 5DEZA 4XP5H 4G6JH 4NWTL 4Y5XC 4KQ4H 3P77B 2DWEA 2F5BL 2FEDC 1HQ4A 1AGDB 3PP4L 3SJVB 1NDMB 2HFEA 3U4EA 2VXQH 5IGXL 3DRQB 3HMWL 3GSNB 3GSRB 2FCBA 3Q6GL 3ARZA 3HG1D 1YY9D 5D7KE 5IP4A 1SEBB 1S7XA 4PRAA 1IC7H 3BP6A 4GW1B 4LU5H 5FUOL 5IB1B 1AO7B 3MLUL 5HBBA 3QUML 5GGQH 5IMMA 4E5XB 4N0UE 1M1SA 5IJKA 4HIJA 2IBBA 2D9CA 4YX2L 3D3VB 3FO0H 5EO9A 1MVUA 3EOBA 3RWCB 3QUZA 2NTSP 3GMLB 3O6FA 1JGVL 3MXWL 1MCOL 5J11C 1P5UA 3QBTB 4F33A 1LHZA 1R5WB 4XVJH 3WSQH 1S5IL 3EJZC 5EFIB 2OR7A 1QLRA 3QUYA 1OM3H 3F65A 1BM3H 3F5WB 3WFCL 4JO2L 4PIRF 5IMLA 5IFHL 1IEAA 2GYSA 1OQOA 1JNLL 1XGUB 5I1KL 3QEUB 3N9GH 1T0PB 5KW9L 4JJ5A 1W72H 4XH2B 4PUBH 4KJWC 3B3IA 5D2LB 2Z35A 5DJCB 5CGMA 2HLAB 3GSOB 4WV1B 4XT1C 3AROA 3EHBD 3OG4B 1QSED 5CHNA 2P43B 5HY9A 3SCMA 2N7BA 1KEML 4LIQH 3AXLA 4G3YH 5EO1B 3B6SA 1CFQB 3FQXB 1FZKA 4MVBD 1P5VA 4JQXA 1CG9B 4YH6A 4LLUB 5H94A 1GCFA 3TLRA 1AGCA 1Q9LA 3NPZB 5LWYH 1YNKL 3W9EB 5DC9B 2FATH 1T22B 1S7WA 4GKZB 3HI1B 5I16A 3JWOH 4QY8A 2VXTH 4U1GC 2P8LA 4I5BB 3ULVD 2VE6A 3GSVA 3GBML 4PRDB 4XBEH 5GS3A 2X89D 1A3LL 3SE4C 1RUPL 4I18C 4NUGH 1UM6L 4XP6H 1GOGA 3PF2A 5T3XH 4TSCL 4CVZB 4PG9A 3PWPA 3C08L 4X9HA 2XZAH 2F54B 5B38A 4DZBA 3B83A 1AIFA 4WI3A 1OD9A 4ZTPH 4NQSB 4F3FA 4LHUA 3SKUD 2VIRA 1D5ZB 4GRLC 4OGZA 3MROB 3UTOA 1AE6L 4PV9A 1VEOA 3QNYA 2WZPD 5L2KD 4MXWL 5IVZA 2FL5B 3HE7C 1FAIL 2BJML 1CWVA 4MQXD 1R3JB 2XA8H 1CFVH 2H1PH 3GSNH 4M4RA 4XZUA 4LLDB 3TBWA 1M6OA 2W0FB 4BELD 5BS0B 1QA9A 4CVWA 3UTTB 3T0BA 5IB3B 3PWPE 3MCLL 2EH8H 4JPKH 4AG4H 4OB5H 3LPGA 3DGCR 3V4PH 4YBQD 2BZDA 3ZTJH 1N5AB 1QQDA 2Y23A 4YEEA 4BH8A 3W9DA 5IW1A 2RCSL 4JRXD 5C0CD 4IS6A 4UTBH 5F96L 1AQDB 2BNUA 3DNKA 3H9SD 3IKCB 4ZSOB 5J13B 5FOBA 1U6AL 1BVZA 3RDTA 3B9AA 4NQDD 1FGVH 4OI8A 3QDJB 4NRYA 1U3HD 3TJHC 1WBYB 1NAMA 4HIEA 5IHBA 2R2HA 4HK0A 5EWIL 5I71C 1I3RB 2R1WA 1XR9B 1DDHA 5TFSL 1JWSB 1LEKB 2BNRD 2PUQT 3B9KC 2LU4A 3MV11 3QEGL 1A1NA 1KV3A 2H2PD 1V7ML 4WEMB 4UQ3A 2EKJA 4Y4FD 1ZTXH 3NCEB 1SJHB 3H7LA 2AABH 3AC0A 3F8UB 5D6DA 3JWDC 4L8BB 2WUCL 3FRPG 3OX8A 2P5EE 4FG6D 5D96B 3C5ZA 2OM5A 1DUYA 1E4KA 3KXFB 1RHHB 4ZUUB 5IROA 5IR1B 4YFDB 5JW5B 4MNHB 2ICWA 4U33A 3BRGC 2FD6L 4S1RL 4G42B 5ETUA 5DJ6B 3HC3L 3NCJL 5D1QD 4KVCL 1TETL 3REVA 3WYRA 3H0TA 5F6HI 3CMGA 1GC1C 5ID1B 2PW1A 2MCG1 2ZCKL 3VXRA 4ODUA 1MHPL 1CXEA 4PYHA 3BZFA 4NN7B 3HNVL 4P3DB 3ZTNL 3ARBC 1PZ5A 1P9MA 2GEEA 1YY8B 5HYSA 3NZ8B 3MA7B 5EC1B 4P57B 1U8MA 2YD8A 1HYRC 2X42A 3GI9L 4O2EA 3D5OF 4ZFOA 2UWEA 4FQLH 4AYFA 2VERN 4WUUD 3ARSA 1ZA6A 3UC0L 3TVMC 2GFBA 1U41A 3S96B 4J3OC 3ILQD 4UZGA 4ONHB 4NQEB 5HHNA 4XNXH 4KPHL 5E99H 1QSFD 4YZFF 2Q86A 1H8OA 3OKKA 4MDJB 4CMMA 2LV4A 5HYEA 1UGNA 2BSSA 1VA9A 4IRSB 3IB4A 4JDZB 5TE6H 4RBPK 3LN5B 2VR9A 3GSQB 3OGCB 1BP3B 3BPLB 3GMMA 2A6DB 5EN2B 2NY7H 3D85A 3KYKL 1LDSA 2J4WL 4DOHE 4Y2DD 2NXZC 4L4VA 3MRNB 4PGCB 1IAIM 3QR2A 5TDNB 1D5BB 1XCQA 2PO6C 3R06A 4JB9L 2O61B 5EDXA 2UWEE 2FX9H 2XOTA 2MHAB 2MPAL 3C8KA 3JTTB 1Q1JL 1K2DB 3MGTA 3STBA 2HMID 2W38A 1G9ML 1A7QL 5CJXA 5I1EL 2HG5A 4G9DA 1PY9A 1RURH 1ZT7B 2NX5B 5E9DD 1PFCA 5JUEH 4Y16C 1R24A 2CRYA 3MMEA 1E28A 3MLRL 3UCRA 3QO1A 5DFWH 1UJ3C 1QYGH 4WI5A 5T1KD 1A2YB 5H8DA 5KANI 3UYOD 1D6EA 2JJUA 5SWZA 1TVBB 5IFJA 3FB6B 4JO4H 4Y1AA 1KB9K 5J3HC 4ZNEA 2X4PB 5E2TH 1DZBA 4IIQC 1X6LA 2YSSA 2HJLA 4NM4H 1WFTA 5TDOA 3VGDA 4LLYB 1OTUD 4WUKH 4X5XA 3MRCB 4L8DA 2CDGA 5E8PB 5LGHL 4M7LH 1DBAH 4ORZC 4WO4D 1GGUA 1RULL 5GRVL 3GMNA 1M7IB 3BUYA 4Q97A 4C4KT 4JO3L 4WWKA 3LKSA 1JPTH 3PGCA 4ZMAT 3G5YB 1FYTA 4DKFL 1JK8B 4PB9H 2I9TB 1IGYB 3LIZL 3QIUB 1OSPH 5FGBA 5J6HB 4PRNB 1Z3GH 1T3FB 5AAWA 3CDFA 1NC4D 3FQTA 1IAKB 3MBXL 5SWZE 2GK2A 1RK1B 3AS3A 3ROLB 4LNRB 5T1LA 4Y1AE 3TCXA 3SKOA 3V6ZA 1YZZA 3BPCA 1AD0B 4RFEB 2VLRA 2ZPKH 3MNWA 5E95B 1BX2A 3JTSB 1CN4A 4PGBA 1KNOA 1FORL 5GHWH 3P4NB 1Z9OA 4P2YA 5EU3B 3U9UA 1FYTE 2AI0L 1B6UA 1A3QA 2EZ0C 4QHMA 1BZ7B 3QEQA 3V0AC 5DD3H 4ONGH 5I2IB 4LKXA 1R5VB 4XP4H 3RY5A 5GRWA 3T3MF 1KLFA 4U31A 4N9GA 2DRUA 1VSCA 3BXNA 5I1GH 2VLRE 3C8HA 4YXLH 4FABL 3RUGF 1JGDB 5JQ6H 2HFTA 5FYKU 1R3HB 1GGCL 1O7SA 4OLWH 2QQNL 3PHQB 3GSXA 2NW3A 3LKRB 3QUZD 2J7LA 4WHTB 1JZ5A 1JHTB 2GIYA 3V5KA 1LD9B 3O6FD 1BEYH 2E9WA 3LEYL 1XF4A 4Y5VB 2ARJB 5F8QC 5DK2B 4L9LB 3KPPA 4I18B 4Z7UA 3U30B 4NO5B 3MRBB 3QEQE 3HI5H 3LQZA 5TQ0L 4F2MB 2P8MB 3BPNC 2V2WB 3LQAL 4KMQA 1RIUH 5JW4N 3LVEA 5BQ7B 1T4KB 2NZ9D 4IRJA 2H8PB 5EUKA 4XCFL 1K4DB 4XMPH 4U7MA 1QKZH 4NN5C 5IOPB 4CN1A 3MV7B 3IFPA 3EO0B 1F4XH 4OZIA 3EZ8A 3MODH 1CFTA 4GRLB 3TF7C 4KRPC 4YDKH 4PRBB 5CGYC 3SCMD 3FT2A 4OD3L 2J88H 2XFXA 1DL7L 3KYMB 2X1XR 3G6DH 2ORBL 4HDIA 4GG6A 4Z7UE 2R8SL 3LS4L 4TOYH 5BVPL 2AK1L 1YC7A 4GRMB 1I7UA 1AFVH 3UTPD 3P30H 1JF5A 5E08L 2DTSA 3IYLW 1ODAA 3ULVC 3TA3A 2R23A 3OV6A 1BECA 3DYMA 1SJEB 3QG6A 4HJ0D 2MWCA 3WUWG 5D7JC 3THML 3KPOA 1CI5A 4JREC 2WQRA 4GSDL 5CEZL 3WLWD 2NYYD 1KCUH 4POZC 3O0RL 3HR5A 1T0MB 3V5DB 5J9PB 1NGWB 4OZIE 4J7RA 5HGBB 4YHLL 5DURD 1HI6B 2EDDA 2XI9A 4F9PC 3PWPD 1AGFB 1K8DB 5GJTL 4ELMF 5C0BA 2AEIT 4GG6E 1XAUA 1X9QA 1UZ8A 5KZCD 4CMHB 2W59A 4FFVC 2X4TB 3IS1X 1DANT 3KHQA 4XNYL 4MYWB 1AKJA 5DMKA 2X4UA 4JFXA 3S3SA 1H3XA 3SDCB 3BGFC 4MQXC 4P4RA 3VGFA 5CD3A 4HFWB 4G8GB 4HZLB 5IVXA 4MNGA 1MRCH 5GGUA 3STZB 1B0WA 1MCNA 2FYYB 2QV2A 3VFUA 1F6LL 3QFDA 5ISZB 1QBLL 3IDMA 4HW6A 4IOIB 5DD1H 4HUKB 5D6CA 4YBQC 1M71B 5DMIL 2EDWA 5BXFB 1MWAB 1XT5A 5C0BE 2VDOH 3GHBL 3QP3A 2Z93B 5EUOB 3DUSB 3MLVH 4GH7B 5I1DA 2OJEB 3BJ91 4PREB 1J1XL 2G5BB 5DA0B 5DK3A 4XVUC 1F6AB 2UZXB 4PJCA 5B3NA 2QLVB 3S3JA 4LEXL 3FN9A 1RUML 5IVXE 3KPNB 4NT6B 3MOAH 4MNGE 4HC1H 4F7PB 2QL1A 2DAVA 3VXPA 1F3DJ 3MUHL 5BRZA 4U1IB 5JW4Q 4QHLA 3K1DA 4EIZC 5C0JB 4O2CB 3EFDL 5BZDA 4YHNA 4F7EB 2ICEB 5I66A 1LILA 3IS0X 1WEJL 3BAEH 4HGKC 5E94A 3VFPB 1P7QA 4GS7B 3V7AG 1EMTL 3SBWA 2FNBA 3TN0A 2BMKB 5T1DH 4UDUB 2C4FT 1ZLVK 5BV7L 4JY4A 4PJCE 5GSVB 3BH9B 2ZZUT 2R1XA 3HI6L 4W6YB 5SWQA 3C5ZD 3NACL 4IM8A 2ZJSH 4QF1B 3RVWD 5C0ND 3FT4B 5D7LB 3P9LB 4LSRH 4N0CC 3S5LG 4EDXA 1NJ9A 1GZPB 5D1QC 2A74A 3INUH 5BRZE 5A2IH 2R4SL 2O93L 3I2CL 5T5FL 3D0LB 4K8RL 3IJHB 2DQEH 4NKMB 1WFUA 4HHAA 2WIIA 4X99A 3SOBH 1F58H 3UJJL 1JNNL 1I8IA 4UILH 3RAJL 1OTTD 3VXRD 3ZL4L 2ZCLH 5CLWA 3GJFA 5JZ7D 4K3DL 5DHVA 1ZLSL 1FNEB 4AQ1B 5IEHA 3IT8D 4XPGH 2XIDA 1K5NB 2FO4A 4Y16B 2VLJA 4JPWL 3RZWA 4XP1L 2V2TB 4RA3A 4KKBC 1EEZB 4FZEL 4GG8A 2W91A 1LE5B 1INQB 4RGOL 4O4YL 2R2BB 3MUZ1 1LEIB 4EVNB 5DJZA 4QRTB 5EC2B 1CT8A 3MRMA 2EDHA 4YHML 4EEEA 4QXGH 2CD0A 4LDLB 5ANMA 2SEBA 2LU3A 3PWLB 4Z0BH 3P9WB 1DQLL 2D2OA 5E8EA 1U8NB 5FM5M 4HWUA 1VGKA 2CPCA 4H20H 4Y2DC 5IKCA 5JHDB 1X4YA 1WCQA 3E0GA 3CC5B 3WS3A 3D85D 3N85L 3VFRB 1LO4H 2AXHA 4L4VD 4MQTB 2YN5A 3IAQA 4PS4L 3G5VB 4QEGA 5F1NB 1J9CT 2YA1A 3HC0B 1FZMA 4HT1L 4OCSL 4DQOL 1T5WA 5K59E 1IAIL 3ZE1F 3VFMB 4PYGA 2R2EA 4HUNB 4PJDB 4K7FB 5K9QG 1NH6A 3V6FA 2X5PA 1H9VA 3WE6A 1EO8H 5ANME 2P8PB 1MFBL 3ZO0A 3T77A 5E7FA 3BT2L 1NANI 5E7BA 1PQZA 3HPLB 1Y0LA 2LAAA 4X7SL 1A1MB 3H9YA 5IQ7L 3K8KA 5MEOB 1NBZB 3IDIB 4P46A 3LRGA 2H6PB 2WBWB 3PXJA 1FO0B 1J05A 5SWZD 1H3WM 2NY4D 3HG1B 1OTUC 3KWWB 4YHKL 4Y1AD 3IFLL 1JPFA 3DBXB 1UQSA 4MGXA 2M1KA 4J1UB 1NKOA 1I9IH 1M7DA 2VH5H 3HUJA 1J8HA 4UTAH 5CEYB 2X7LA 4DKAA 4ZFGH 4UQ2A 3TT1H 3FQRB 4AT6A 5GRUL 2APFA 1T20B 1TCRA 3GIZH 4YC2B 5E8OA 2DQTH 1YEJL 1X3DA 3MLWL 4LVNB 3U7YH 2DM7A 2W0KA 2ZNXA 3KPQA 5FF6B 4MLSA 5HPMB 2BC4B 4MD4A 3NTCL 1L7IL 5EU4A 4WU7B 1IEHA 4L29A 4MS8D 4YDIH 5T1LD 3T1FA 4Z7UF 3WKNA 2DQGH 1D3CA 3EYOB 2Q8BH 4LSPH 1T04A 3MLYH 1ZT1A 2VLRD 4WI4A 8FABA 4X7EC 5CIPA 3SDAC 4YQXL 1QRKA 2XKSA 3HUJE 1J8HE 4I3RH 3HZVB 4JKMA 4OGXH 4PTTA 4PGDA 4N1CA 2GUOA 3UAJD 4LAQL 4X7FC 5TJWK 4OFYD 1G6RA 4CN6A 4X4ME 1RUKH 1QSEB 4NN5B 3EAKA 3L3KB 4UNTA 5FYKE 4OZIF 1XGYH 5CD5C 3QEQD 1XGRA 4G9FA 25C8H 3GBLA 3V79C 4M43L 4XPAH 4LSQL 1G7QA 5IJKC 1ORQB 4G7YH 4YPGB 1T1WA 1MNUL 5FO7A 4UV4H 3HB3C 2FBJL 3BP5A 2VXVL 5IESH 2KZ1B 3NIGE 3O6FC 1JPSH 1X5HA 4K7PH 4LEOA 5DA4A 2X4NA 1TTUA 2Z31A 4HPYH 1ULVA 2H2SD 2ZUUA 1MIMH 1UWXK 3ZKXC 2XRAL 3L3JA 1FZOB 4APQA 1JFQL 3NMEA 4LSTL 3QUYC 4OLYL 5HTSA 5EOTB 3P4OA 4UUJA 5I0DA 1FJ1A 1HHHA 2NY5H 3UTSA 4HH9A 3C2SA 4M1GH 5FB8A 4Q6IA 4YXKL 4XVSH 3GB7B 2HT4C 1GSMA 2NXYD 3IXTB 4M8QA 1OWRM 2CLVA 2BY3A 4IRJD 1GH7A 3SDXA 1TJGL 3HZKA 3WNMA 2D3VA 1U91A 2OZ4H 5L2KB 1KENH 4U3CA 4URTB 2ATKA 4KKCC 1YEEH 5A16A 4NWTH 5AG8A 3BGFB 3MO1A 5DJYA 5JO5B 4XPTL 1EFXD 4JQXC 4CNIB 1CGXA 2F5BH 4UIKL 3NVQA 1EGJA 32C2A 3PP4H 3UTSE 4YIQB 4XBGB 2AKRB 2IQAB 5IGXH 2E8ZA 2BVOA 4HJ0C 1I4FB 5FO9B 3HMWH 5C2UB 2KKQA 1T1YB 2DI8A 3AU1A 3KNBB 3Q6GH 5C8JB 1CXHA 2LTQB 2NYYC 1WBXA 3OKEB 3LKOA 1I8LA 3SDXE 4JRXB 5FUOH 2RQ8A 2VZ3A 3MLUH 5C0CB 2CXGA 5C0GA 4PP2B 3QUMH 5L8JB 1IGTB 1MCEA 1P4LB 2GT9A 3H9SB 1QFWM 4ORGA 1Q38A 5I8CA 1NCTA 3SY0B 5DJDB 4YX2H 1AP2B 1Z0MA 4NQDB 4PJIA 3VA2C 1U3HB 3U0TB 3QWRA 5C0BD 1K6QL 1F4WL 1RIVL 2EIBA 1JGVH 1K9TA 3MXWH 3BZDA 4RAVB 1MCOH 3GGWB 2XZZA 3WFZA 5CBAA 3GSUA 3M1BB 2BNRB 3CFDB 5IM7B 1A6ZA 1S5IH 1AKJD 3RNKA 4UOW0 4HKBB 4Y4FB 3WFCH 4JO2H 8CGTA 5IFHH 1K3IA 5JOPD 1JNLH 1K3ZA 3RVVC 2BOBA 1WAAA 2IH1A 3JZ7A 5DSCB 5I1KH 3ELAT 2JB6A 2APBA 5KW9H 2DIBA 4WDIB 1DQDH 1KOAA 4PJIE 4PJHB 2MQCA 4OF5A 4Q0XH 1U3YA 2Q76A 2ATPA 5I6XC 3DIFA 4QOKE 5DK0A 1KEMH 3FO9A 5D1QB 3ESUF 5F1KC 3OKDA 4EN3C 4M3JA 1VEPA 2ZKHL 3UZVB 3UPRA 1AH1A 2ZUWA 4OQTL 3RDTC 3OF6A 4DVRL 2HKFL 4FS0A 5FEBA 1X4XA 4U3XA 1YNKH 5F7LB 4OSUL 1OCWL 1WAAE 3DROB 3SDDD 2OS7A 2ZWLT 3QIBA 4TULL 3U0WL 2CMRL 5F3BA 1EUTA 3GBMH 3MV8A 3FAXA 4L3CB 4TPRL 1A3LH 2HP4A 1RUPH 6FABH 1FVCB 1FVEA 3U82B 3WHXB 43CAB 3ARGA 4WUUB 4J3VA 4TSCH 1P7QD 5K59F 3IVKB 3C08H 2ZG3A 1G7LA 3D9AL 1DQJB 3DX9B 4R26L 3TN0D 3ARVA 1QSFB 2G2RA 3EJJX 3O4LD 2H32A 1E4KC 5C0NC 3VFWA 3QXAA 4P49A 3LRSA 2WBKA 4JPIB 4GAJL 2E7MA 2GITA 2RHEA 1AE6H 2VDQL 1XR8A 3WIFB 4MXWH 5HDBE 3MV8E 3NH7L 1FAIH 2BJMH 1A4KB 1Z2KA 1ZVYA 3MJ6A 3FN3A 3HAEG 5I1IL 2F74B 3AS2A 1S9VB 4Z78A 3MCLH 4M5YL 1M4KA 2PN5A 4Q9CA 4JANB 4W6WB 1IFHL 1P9MC 4M7KL 5FK9A 2IFFL 3WXWL 4HX1B 2ADGA 5E9DB 5I17A 1FNSL 3MRDB 1NBYA 4V1DD 5LQBL 3T0XA 5JOEA 2FHCA 2RCSH 3U9PL 1KJ2A 3SGDH 1NCBL 5B3JE 5DWUL 2DQJL 2DTML 5T1KB 5A3ID 3CFJA 2AQ2A 2FR4A 5F96H 4AZ8A 3IJSA 5IB5B 2VLJD 1CL7L 1KXTB 4R8WL 1U6AH 1R6VA 1W8OA 1XF5A 2X1PA 3CSPA 4H26B 3BFOA 2ITDA 4MSWA 1CD9B 5EWIH 5K9KA 4MJID 2A1WL 4JFPA 3L5HA 4J6RL 5JHLL 1DN2A 5TFSH 4OZHF 1G7IB 4MD0B 2CJUL 1S7UA 2XNAB 3GMPB 4WO4B 4AM0B 3S6CA 3TC9A 3QEGH 1HXYB 3ZDXE 1V7MH 1U8IA 4R4NC 4BK5A 2F5AL 4EZMA 2WUCH 2X9YA 1B0RA 1NC4B 1IM9D 4GXUM 4XX1G 4AY0A 4I3GA 3RVUD 2HJKA 2H26A 3IFNL 3TWCL 4R7DA 5CJXC 5IHZA 4IMLB 5FGSA 4N0UB 4G6KL 4N0FA 4C83A 3O41B 5AZEL 2FD6H 2FIKA 4S1RH 3IFOB 1IAMA 4PGJA 3HC3H 1OAKL 3NCJH 3WNKA 4KVCH 1TETH 3G6JA 3NIGF 2DWEB 2EIZA 4JCLA 1YJDC 2ZCKH 5ACZA 2EDFA 3BWAA 4P46D 2HFEB 1GOHA 1I1CA 3VXUE 1MHPH 1FYHB 4ENED 3OAUL 3LPWA 3HNVH 5JMRA 3KPRD 4EI6A 1S7XB 3ZTNH 3BP6B 3SGJA 3E2HB 1GOFA 3FOLA 1AXIB 1HWGB 2BVPA 4LAJH 4HWNA 3IF1A 5IMMB 1JZ8A 3GI9H 4WWKC 1TZHA 1KGCE 3LOWA 3UC0H 5FGBC 1T1ZA 3PE9A 1MVUB 3QCTL 5EO9B 3EOBB 3QUZB 3G6JE 4KPHH 5D7IA 5MHSD 3G04A 2VWEE 5FYKD 2ESVD 1N5YL 1QFHA 4F7CA 2OTWA 4F33B 2V17L 3V0VA 4Z77A 1KPUA 1QLRB 5C0DA 3KYKH 2J4WH 5IMLB 1IEAB 3K2UL 1SY6L 1HEZB 4JM2D 5DD6A 4EXPX 3BEWB 5IQ9B 3UAJC 5E4EB 2VXUL 4JB9H 5JPMA 2PTTA 4JJ5B 1HILA 2MPAH 1FBIL 1Q1JH 3MUGA 3PG2A 3T4YA 3G08A 2V5TA 3L5WA 1G9MH 1A7QH 2Z35B 5I1EH 5ILTL 4LP5A 4KHXH 3SCMB 5HY9B 1HK6A 3U4BL 4O58L 3RWEA 4G9FD 3B6SB 3MLRH 1S78C 3FHAA 3VRJA 2OYPA 4HJGA 2EDYA 3N1FC 4Q9RL 1RZ7L 1AGCB 4PJ7B 4NNYA 5J89A 1Q9LB 5FUZL 2VZTA 3CPLA 4G43B 2V7HA 1S7WB 2H2SC 1NC2A 4QY8B 5C6PB 2DD8L 2Z31D 4X6DA 3MYZA 2VE6B 3GSVB 5LGHH 1UXWA 1JTOA 1RULH 4KXZH 5DURB 3W0WA 3R1GL 4APQD 4PG9B 4JO3H 3PWPB 4PJGA 4R0LC 4DKFH 3MJ8A 4FFWD 4IRJC 3LIZH 2Q1EA 1I1FA 5C08D 4DZBB 2J5LB 1AIFB 3U0PA 5KZCB 5BJTA 1BREA 1LEGA 2OCFD 4K23L 4F3FB 3MBXH 5ESAA 2VIRB 3T3PF 5JOFB 5DJ0B 4M62L 3DVGA 5D70H 4R97C 3QNYB 1ZAGA 4PR5A 5IVZB 4PJHF 3MNVB 4TVPL 1FORH 3RBGA 1UB5B 1OVZA 1VADA 3TBWB 3SKMB 4QT5A 1FLRL 1QA9B 4A2MA 4KI5D 4MNQE 2Y07L 4PJGE 3TA3C 2EDXA 4FP8L 2AI0H 1MFAL 3LV3A 3NIFE 4XWOD 4WNQB 1OOAA 1QQDB 4MAYA 4BH8B 1D5IH 5IW1B 3VRLF 1ORSA 1QG3A 4IS6B 4AQOA 2BNUB 2RBLA 3DLQR 4FABH 1PYWA 5GZND 3MOQA 1CS6A 1PGRB 4LGPB 3CVHA 5E6ID 5FUCE 5C3LD 2RB8A 4KZDL 1QFWL 1GGCH 2IPKA 4NRYB 2QQNH 1QHOA 5I9QB 1NAMB 2R2HB 2IF7A 3QWRD 3QUXD 2AJZA 1EEYA 2R1WB 3UZQA 4M1DL 1RIHL 1DDHB 5HDBF 1TCMA 3LEYH 3OKOA 4K3GA 1OP3H 3BMVA 4EUPH 3C09B 4Z7WA 1XGPA 3S88L 5TQ0H 2DQIH 2C3GA 4UQ3B 4G8IB 1TPXB 4GOSA 2W07A 4CVXA 3LQAH 2AP2A 2BVEA 2KQNA 3F7YA 3OX8B 3C5ZB 1WIOA 4XCFH 1DUYB 5B3JF 3QIWA 5JMOC 2ICWB 2WBJA 4WHYG 1BOYA 3GIVA 1EBPA 1T83A 2VQ1A 3ALPA 3FQUA 5ETUB 4OD3H 5F7DA 2E9JA 3TYFB 4Z8FL 1DL7H 2GY5A 3REVB 4ZQKA 2ORBH 3H0TB 4Z7WE 2R8SH 3LS4H 5BVPH 2PW1B 4YO0A 3VXRB 5AYUL 2FIRT 5E08H 4ODUB 1EPFA 1XF3B 4PLNC 4NC1E 4U2ZA 3UYPA 2YPVL 3RWHB 2Y5EA 3AUVA 2ICES 2A0LD 1PZ5B 4CU6A 4LCWA 3THMH 3ZDZE 4J2XA 3QIBD 4GSDH 5CEZH 4RMRA 3MV8D 3O0RH 3GMRA 3CXHK 1NCWL 1U8MB 3QFJA 4LFHD 3DWTA 4YHLH 3ARGD 2UWEB 3TN0C 1CVRA 1R3LB 4U1SA 1JNHA 3A6OA 4H1LA 3KPSE 2GFBB 4IMKA 1PD6A 4NZTL 2M8XA 3D69A 1IKNA 2HT2C 3FZUC 1HZHL 5HHNB 5GJTH 4WW2B 2Q86B 3V7MA 3CU7A 3OKKB 4CMMB 4KK8C 2X1WL 4M03A 4JN2B 5LXGL 4XNYH 3EKCA 4O5LL 3GMMB 2ERJC 3D85B 5DZLA 3P4LA 1VERA 3RU8L 1ZVSA 4NCDA 4PGEB 4LCWE 4JQIL 3F58L 4L4VB 2W9DL 4WGVB 4UAOB 3L3OA 3EYQD 5FHBL 3QFJE 1XCQB 3R06B 1QBLH 3TGXA 3C8KB 3MGTB 5DMIH 2EICA 1DQQA 4WENB 1OGTA 3ZYOA 4G9DB 4RFOL 1KB5L 3MTRA 4FRWA 1DBBL 3GHBH 4X9BA 3EOYG 3SE3A 3WL9A 1R24B 3E3QC 3MMEB 1E28B 5IG7A 1J1XH 3PGFL 3EBAA 3VD9A 3QO1B 2PYFB 3AB0C 4F57L 1OPGL 2DKMA 4PJAB 2XWBA 3H6JA 4LEXH 4F37F 2CRMA 2OBGA 5SWZB 1RUMH 1MIEL 2NY4B 5IFJB 4P23A 5ICYA 4Y1AB 4OCXL 4WFFE 4ZS6D 3CUPB 3V6OA 4QRRD 2YSSB 1DUZA 2HJLB 5TDOB 4GKOA 5HI5C 4X5XB 3ULUE 3EFDH 2CDGB 3MJ7A 2NY5C 4XI5C 2QEJA 1WEJH 2E6PA 3GMNB 3L5XL 3CFIC 3BUYB 4XNUL 3LKSB 4K7PX 3RGVA 3PGCB 3BWUC 4Y4KA 1IC1A 3F7QA 1UVQA 2PNDA 2UYLA 4OLUL 5BV7H 4ODXA 5JQHC 5K93A 3HI6H 3NACH 2WP3O 1XH3A 1P7HL 5DVOA 1DLHA 1GRWA 4NHUA 5T1LB 3NCMA 2JJTC 3SKOB 3V6ZB 1OY3B 5F44A 5I0ZA 3BPCB 3OAZH 2J6EA 2HVJA 3V6OE 2VLRB 3WNPA 2R4SH 3MNWB 5E1HB 1BX2B 1KGCD 3I2CH 3IU4L 4NUJA 5AWNL 5T5FH 4K8RH 1FRGL 1KNOB 1EVTC 4P46C 3ZSSA 1MCBA 4L8SA 3UJJH 1JNNH 4ENEC 3DOSA 3RAJH 3ZL4H 3U9UB 1D5XA 2X4OA 2C3HA 3NCCB 4RQQA 3VD5A 1MHCA 3QEQB 1CK0L 4K3DH 1ZLSH 3T4AB 2Q7NA 4QCIA 3DGGA 1IZJA 2GSGA 2Q7YA 4LKXB 1XF2A 3HNSL 4BQ6A 2Y7QA 3L7FA 3TIDA 4JPWH 4YK4B 4N9GB 4XP1H 5DJ8A 4FZEH 3O2DA 4X8JA 3BXNB 4RGOH 4O4YH 2GTZA 3TBVA 3Q6FA 5GXBB 4XCCL 2WLZA 3HMXL 2RIKA 4YHMH 3GSXB 2NW3B 4ZTOL 2I27N 3VFVA 3MJ9A 1DQLH 3ARPA 4K2UL 1XF4B 5CLTA 3KPPB 3ZHDA 4HULB 1IQWL 4MA3B 3LQZB 1KYOK 1T6VN 3N85H 3O4OC 1LE9A 1AI1L 2NXYB 3O3AB 3VGAC 4PS4H 4ETYA 1ITCA 3K0WA 1HH6A 4OUUA 4HT1H 5HGAA 4OCSH 5EUKB 4DQOH 1YMHA 1KLUA 4JKPL 1IAIH 1OGAE 4KRLB 5M94B 1NBQA 3KG5A 1BJ1J 4GQ9L 2AV7A 3IFPB 4L5FL 5CZKA 1U2HA 4I13B 3D18B 1CFTB 5F7FA 1MFBH 3BT2H 3MRQA 5H35A 1EFXB 5I76A 3FT2B 5DS8A 3O3UN 2XFXB 2BY1A 4HQQL 4X7SH 4AK1A 1ZT4B 4HDIB 5IQ7H 4GG6B 3FKUS 4KUCF 1TDQA 4OT1L 4UMGA 4FQ2H 1I7UB 2F8OA 5F6IC 1Z5LA 1WVZA 5TH2B 4X83A 5KSBF 4YHKH 1OAZL 1Q94A 4LCCA 2AJ3A 3IFLH 1YEDA 3QG6B 4X4YA 4BSVA 1KACB 2HTKD 4LQFL 3DTXB 1YMMA 3HR5B 5KVFL 3EO1B 1DBML 3W0WD 4MQ7A 1F3JA 2EO9A 4Y7MA 5GRUH 5IB4B 1TNNA 4QHKJ 4W6XB 3HLAA 4XTRC 4PGZA 4JKLA 4QRSA 2OL3L 1YEJH 5C0BB 4KK6D 1UZ8B 4CVUA 1MQ8A 3BN9C 4U2YA 3NTCH 5B8CA 3VXNA 1L7IH 1A1OA 1AR2A 1RJCA 1C12A 4HWBL 3HTLX 5K9OA 4KU1A 1AKJB 2X4UB 4JFXB 3K1KC 2KPNA 3QSKB 2DM3A 5ADOL 5CD3B 1CLZL 4NFDA 4MNGB 4YQXH 3QFDB 1NFDA 1YMME 1WF5A 3CFCL 4P0DA 1YEIL 5HD8C 5ERWB 5IWLC 3EDDA 3IDMB 1EZVY 4X5WA 4LAQH 1BIHA 2VDRL 2OJZL 5D6CB 5ESQA 5JXEA 4ODHL 1I8LC 1NL0L 1RU9L 1T2JA 1XIWA 2C1OA 4M7ZC 4M43H 1FL6B 4LSQH 5B38G 4MAYD 4BK4A 4FQIL 3N1QC 1I3VA 4GAGL 4EI5C 4LHUG 1MNUH 4LF3B 4YHIA 2FBJH 1JYXA 2VXVH 1ZEAL 1XF1A 1JYVA 3BDYL 3O6KL 4GFTB 1U8KA 3O2VL 3E6FA 3SDDB 3CLEL 3VXPB 4X6CB 15C8L 4QHLB 3U6RB 1VESA 2XRAH 5CP3H 4GJTB 3KAAA 4YHNB 1JFQH 5I66B 4LSTH 5ITBL 4OLYH 3WMSA 2XICA 4WW2F 5E94B 1P7QB 1CVSC 3WBDA 4JFYA 3TN0B 4YXKH 3BYTA 3DXAA 4PJ9D 3O4LB 3RNQB 1OAUL 2R1XB 4UDTA 1TJGH 5SWQB 1WT5A 1BZQK 3TFKD 1S9XA 1RSFA 3LKPB 2V5RA 4EDXB 2XQYK 3QIWD 1LDPL 1NJ9B 2G9HA 4C54A 1LNUA 4Z95L 4GW5A 2A74B 5F72S 2WBJD 3MFGB 5CJ8A 5F9JB 3GKWL 4XPTH 4UIKH 2MTPA 4HHAB 2WIIB 3NFNA 4O02L 5HI4D 1I8IB 3IDNA 4NJAL 2CO6B 3DXAE 1N0XL 3GJFB 5GGVL 5CGTA 5LAXA 4U6TA 4LGRB 3ARDC 3OL2A 4TTDD 4V1DB 5DHVB 2FX7L 4PJAF 5IEHB 4HUVB 1MAML 4OKVA 3ZYIA 3FQWA 1K4CA 4HUUA 2IPTL 4ZAKC 4H5SA 4LCWD 5GGSA 4G80A 2FO4B 4TN9A 2VLJB 3O9WC 1Z9SA 4GG8B 4RSVA 3FRUB 2XXCB 2CR3A 4U1KA 3RTQA 3QHTC 1SM3L 5DDHA 1VFAA 4OBSA 5DJZB 1MAKA 3MRMB 4MJIB 3OHXB 2AEWA 5DT1L 4X5LA 2SEBB 1K6QH 1F4WH 1RIVH 4AH2A 2XACC 1W2KT 2P7TA 2ZCHL 4NO0A 1REIA 5HHPB 2X70A 1MJ7L 5E8EB 1ADQA 4KK9D 4EQ2A 1NMAL 2FECI 4YEFA 1IZKA 2YUVA 5IKCB 1CQKA 1NCUA 4IOFD 3WCYA 2YD3A 2JJSC 5GS2D 3BQUA 1CD8A 1HXMB 3EYQC 1QOKA 4HFUL 1E4WL 3T0WA 1SBSL 4WFFD 1IM9B 3QZWA 3BP4A 3QHZL 2IPUG 2L4OA 4HKZA 1FZMB 4LGSB 1T5WB 1WIUA 5HYSG 1G9MC 3ULUD 3HE6C 2R2EB 4PBXA 4JVWA 3LMJL 2DQFA 3AFLA 1UM5L 5I74C 5A2KH 4YUEL 4BA8A 3ES6A 3T77B 1CXKA 2BXZA 3WJJA 1TQBC 4P9ML 1ACZA 4QGTA 1Y0LB 2ZKHH 5I8EB 1D9KA 4OQTH 4ZS6C 4DVRH 2HKFH 2VLLA 4ELKB 4P2OA 1OF2A 1KN4L 1J05B 1KCLA 3DPBA 3Q1SL 4OSUH 1P84K 1OCWH 4YXHL 4LSDA 4P23D 5JXAL 3KPRB 1S7QB 1WCBA 4TULH 3U0WH 2CMRH 3C5JB 2Y36L 4FHBD 4TPRH 1M7DB 3UEZA 1RZ8B 3HUJB 2PXYA 2IQ9L 1I1AA 3MV9A 3S5LA 1MJJB 2X7LB 4RNRB 4FQXC 4YFLF 4UQ2B 4AT6B 1U8JA 1HHGA 3D9AH 5F9WC 5E8OB 1TCRB 2EXWD 4R26H 1YDPA 3RGVD 4D0BA 5I1LB 1R0AL 3R4DA 4Y4KD 1T7VA 2ESVB 4Z7VF 4KGLA 5HHQA 5BW7A 2R29L 5JA9A 4KDTA 1A6WL 2ZOLA 3V7AE 4X0KA 4MD4B 4GAJH 1RJLB 1GZQB 5EU4B 1F3DH 4L29B 5DQ9B 2VDQH 3T1FB 1T04B 1SQ2N 5DMJB 2EE6A 4JM2B 3CK0L 1UWGL 8FABB 3NH7H 2FH6A 4PJXB 2VWEC 3O4OB 1LO3H 2C3VA 3CXHJ 3MV9E 4JJHA 1AY1L 4HKXA 1A6VL 3O3DA 3CSBA 3V5HA 1KBGH 4PGDB 1BFVL 5I1IH 5DTFA 5CJBA 4M5YH 4BYHA 4A6YA 1G6RB 4WY7L 5EZJA 3VWJA 3IJYB 4UNVA 3C6LA 4Z7QE 1KTKE 3OB8A 4M6OL 1IFHH 4M7KH 3WXWH 2IFFH 3SGJC 1EHAA 1FNSH 1XGRB 4G9FB 5LQBH 3DV4B 1BBJB 1QBML 3U9PH 1NCBH 3B2UD 5ENWA 5DWUH 2DQJH 2DTMH 5HYQB 3DURA 4PTUB 1QRND 1T1WB 1JTTA 1CL7H 3H9HA 4R8WH 3Q0HA 3BP5B 1J86A 3WLBB 3EJYD 1HOCA 3RZCC 1JWUA 2E27L 2WANA 3S9DB 2X4NB 2Z31B 2D7QA 2A1WH 5JHLH 4J6RH 4ZODA 3X17A 1N6UA 2E7HA 4ISVB 4K55A 4DZ8A 2CJUH 2XG5A 3L3JB 3MNZA 3FFDA 4APQB 5EULV 1LO5B 2GSIB 3BPOB 1CD0A 3P4OB 1RI8A 1HHHB 1S9YA 3LQAC 3RQ3A 4ZFFB 4HH9B 3I75A 4Q6IB 3BH8A 3MRIA 5C08B 2F5AH 3RY4A 2R9HC 4LLMA 2DMBA 4HJJL 1FN4A 4LPYA 4M8QB 3TT3L 2CLVB 4H8WC 3SDXB 3NFPB 4KROC 3IFNH 1F8TL 3TWCH 1V3LA 2ARWA 3TEUA 1U91B 3V4VL 4DUXA 4UT6L 1TNMA 1SVCP 3AAZB 1JP5A 3LY6A 5AZEH 3VXQB 1MEXL 4HS6B 2ATKB 3WIHA 3EYFA 3JBG7 1N7ML 4XGZA 3MO1B 5KSAC 5DJYB 1OAKH 4GMSL 1MI5A 3TO4A 2IAMA 2DS4A 4OCWL 1CBVL 3KYAA 4JQVA 4HD9A 2EEAA 1KXVC 2LABA 1A21A 3OAUH 3AU1B 4E0RA 3T0EA 4QNPF 3LKOB 3PDGA 4Y5XA 4YGAB 5HI3D 5C0GB 1RD6A 4M7ZB 5E00A 2NY1D 5EO0A 3H2WA 4MHHI 1YMMD 1S9KC 4M6NL 4RISL 1DANU 4X6CF 1J5OL 5E6IB 5DFVD 4PJIB 3QCTH 4M1CC 1MI5E 4S0SD 3QUXB 4M9PA 4JVPA 4Y19A 1N5YH 4NDMA 5CBAB 2V17H 3GSUB 4BSJA 3RWGA 2DDQL 3G5XA 1A6ZB 3T0EE 1PEZA 5FUCC 5MEND 1DVFC 1V3MA 4KKLD 4Z7OE 3K2UH 1SY6H 4XMKL 3KS0H 1KTRL 4PJ5D 2V5SA 4YR6A 4R96B 5ICZA 4B0MM 1E4XI 2VXUH 2E9BA 1RZGB 2JB6B 3DETD 2J2ZA 1LK2A 5F3HA 1NEZA 1FBIH 4HKJA 5KS9A 1L4IA 5C0RL 2Q76B 2YZ8A 4HPOL 3QAZC 2ATPB 5ICXA 3DIFB 5ILTH 4MAYC 4Y19E 3U4BH 1NCDL 1XIWD 5DK0B 4EBQL 4O58H 3FO9B 3BW9A 1JZ3A 4PJFA 4LKCA 3B2VL 2E6QA 1GXEA 3OKDB 5KVGL 1Q72L 2JIXA 3UPRB 1BQSA 3GRWA 3OJDA 4LLAA 4Q9RH 4F15B 2NW2A 1RZ7H 3ZDYE 4U0RC 3RX8A 5FUZH 2HVKB 4RFNC 3EDEA 1Q8MA 2Z8SA 1B4JL 2DD8H 4I48B 3QIBB 4HUXB 3MV8B 4JZOA 4YDVA 2MJWA 1FVEB 3CFBA 3RWIA 5KS9E 2F15A 3ARGB 3R1GH 5GSRA 3CZFA 1FSKC 3EUUA 4KY1L 5F7UA 2D0GA 3OSKA 3CVIL 1PEWA 2RAMA 4NC1C 4JFQA 3R8BB 2V7NA 3SKNA 1G7LB 4PJFE 2F19L 5BV7C 3GEWB 4LLVA 3DXAD 2WP3T 1YEKL 2H32B 1QFOA 1AXTL 4JFFA 4K23H 3VFWB 4OGYL 3QXAB 4OZFB 3C5SA 3QULB 3LRSB 7FABL 3SE4A 2VZ1A 1P6AB 4EJ1C 4M62H 2WBJC 1Q0YL 4XRCB 4N1HB 1XR8B 2BHYA 3GK8L 4K8RC 3BHBB 2R15A 2WW8A 4WI2A 4J3SA 1A6UH 4G6FD 1KIRA 1QEWA 4TVPH 5AD0A 1YC8A 2GQHA 3QDHA 1TENA 3FB5A 4ZPTA 1FLRH 4NZUL 1NMCC 3WFHA 2W1NA 2Y07H 4Z78B 4FP8H 4XWGL 3K3QA 1MFAH 3ZE0F 1AQKL 3EO9L 4J3TA 1X5ZA 5FK9B 3N06B 3OKMA 2DB8A 5I17B 2ADGB 5L6YL 1D6VL 4JHWL 3AS0A 1NBYB 1F5WA 3BE1L 4FTVA 4JFFE 5I74B 4X7TB 4ZNCD 1IEBA 3HE7A 3FT3A 1KJ2B 1VFUA 3MLZL 1CGUA 2VNCA 4MX7A 5CZXC 5EH1A 4IMKC 2Y6SD 4KJYA 1JCKA 2X4RA 1ROWA 4NKDA 1IKNC 3RTQD 1XF5B 4O51B 2PKDA 1CGYA 1QFWH 4QRRB 5T5NF 2ITDB 4MSWB 5K9KB 4KK9C 4JFPB 3B4NA 1FHGA 4M1DH 3W39A 1RIHH 3IDUA 3MCG1 2DLEA 4PV8A 1S7UB 3BIKA 4NO0D 1JHKL 4DN3L 4OCLC 2WUBL 4OIIL 1NSNL 4AIXA 2EIDA 4JKWA 3FN0L 4MB3A 4MLIA 1U8OA 2W60A 1BD2B 3S88H 4WFEE 2DQHL 4RGNE 5FHAL 4JPVL 3C9NB 4FTVE 3ZYZA 2DWDB 3RPIA 3BQUD 2NZIA 3VMPA 3UTZA 5GRVK 3ULUC 3L9RA 1B0RB 4UBDC 3P0VL 3X13B 4ZOAA 2HJKB 4JM2F 2H26B 4PPTA 3VG9C 3VXSE 4C83B 2A9NL 3ILPA 3VFSA 3B9KA 5CEXA 2QSQA 2FIKB 4AEHL 2X05A 1H3TA 4X6EB 5CFHA 1J88A 4YHOH 4Z8FH 3NCBB 1F4AA 3PQYA 1RJYA 2WM0A 2N7AA 2J1KA 2EIZB 3ARWA 1DBKL 1CU4L 1C5DA 1I8KB 3MGOA 1G9EA 5ACZB 4P23C 3BWAB 3BO8A 3V6OC 4DGYL 1BIIA 4P2OD 4F58L 5IK3A 3NZHL 2YPVH 4BQCA 1UM4L 4AMKL 1H15B 4EI6B 1EBAA 4WIQA 4F37K 1UC6A 1PSKL 2OI9C 3FOLB 1NCWH 3I84A 2PXYD 1I1AD 2C4XA 5EG6C 1R3IL 4HIXL 4Y4KC 4OZFH 3ALXA 4KMTH 1T1ZB 4NZTH 4ESKA 4H25A 3PQYE 1HZHH 1Z6JT 4X7DC 5D7IB 2X9XA 3G04B 3HAEA 3MFFA 3F7VA 4OKDA 1BQHA 4F7CB 3VXTA 4YDJB 5LXGH 2O26U 3V0VB 1H3VA 2YD1A 2Z91A 9CGTA 4O5LH 2AXJA 2VZOA 4Z77B 1KPUB 4GXVH 3RU8H 1C7SA 1KCSL 3QJHA 1FFQA 4P4KD 1MCQA 4JQIH 3F58H 5GGRY 2W9DH 3TVMA 1OP3K 5DD6B 1N64L 2YC1A 4XNMB 2R1YA 4L8SC 1MCLA 3V8OA 5FHBH 1C08A 3Q5OA 5JPMB 2JTDA 1MF2L 2JCCA 1X6NA 2PTTB 1ZKAA 1HILB 4ERSL 3IDGB 1AHWC 3MUGB 3T4YB 3G08B 5C6TL 3L5WB 4OZGF 5A40E 3C6LD 3WDJA 4RFOH 1KB5H 4Y5YB 1DBBH 1TXKA 3U48A 3RWEB 3PGFH 1U8HA 3VRJB 3PV6B 4MAUL 4F57H 1OPGH 4P5TC 4P9HC 4F9LC 4KVNL 4CJ1A 5LGJA 4NNYB 4U1LA 3D25A 5HXMA 3MRLA 5CP7A 3DECA 2AXGA 1MIEH 3HRZA 1RPQA 5L88L 12E8L 1J1OL 3CPLB 3HCVA 4NKQB 2V7HB 3MRFA 4OCXH 4CDGC 4MDIA 1F4HA 4OLEA 1MCFA 4PG2A 5D5ME 4X6DB 5H2BA 3I3EA 4Z7OF 1UXWB 4NZRL 1UJ3A 3W0WB 3M8OL 3L5XH 2FH8A 2V6HA 4NN6C 4XNUH 4PJGB 5JNYA 3MJ8B 5INDA 3NA4A 1JGLL 5ID0A 2BHUA 1I1FB 4WI9A 4IIQA 3U0PB 4OLUH 5BJTB 4C55A 1A7RL 1F11A 5L8LB 4FMFA 4AEEA 3T0DA 1LO2L 4F7MB 5ESAB 4NNXA 4EDWL 5JW4M 2CIIA 1ZGLA 4D0CA 3JXAA 3DVGB 4R6UA 5IT2L 1J0IA 2K1MA 2VISA 4BZ1L 5FM8A 4PR5B 2R2CA 1NFIA 1H5BB 3A67L 3IU4H 3QT2A 5AWNH 3PHOA 1FRGH 5INCA 3PWJA 4QT5B 2IAMD 2H3NA 2ID5A 1MAJA 1YEGL 4LCCC 5FYJU 5CBEB 1JUFA 4HZAA 3LV3B 1MFNA 5HI3C 1CK0H 2NY1C 3T0ED 4O2FA 2GCYA 4P59L 4XP9L 1CDCA 4MAYB 3UZEA 3MLPA 2R4RL 3HNSH 1OSZB 3L3HA 4JZNA 5DFVC 1G7JA 2D7PA 3QYCA 1RZKC 4ODSL 1PYWB 1GAFL 3RWDA 1BJ8A 1PX3A 2EE2A 1UEMA 4XCCH 2IPKB 3HMXH 2PCPB 4ZUTA 4RMSA 4RFNB 2YK1L 1YA5A 4PRPA 2AJZB 5B4MC 4ZTOH 3TBYA 1L0XA 1G7HA 4Y19D 2CUIA 5J4MA 4BJLA 4K2UH 3OKOB 1S7RA 4KKLC 4Z7WB 3QO0A 2Y72A 5EU6E 1XGPB 1IQWH 3VE0A 3MA9H 1FSKB 2O5XL 2XKNA 3OR7B 4I2XE 2V5YA 1VEMA 4CVXB 4PJ9B 4HF5L 1AI1H 3DETC 1ZWIB 4PJEF 4KZEL 1TVDA 2FJHA 5TF1L 4JKPH 5JXEC 2Y06L 4TQEL 5F71A 5EBLA 2VQTA 3HC4L 5FV1L 3QQ3A 4GQ9H 3QIWB 1BBDL 4L5FH 2BY0A 3P4MA 3H3PL 1I9EA 1JYWA 3GBNL 2WBJB 1DQTA 4ETQA 3VI3F 3S8WA 3DVFA 3EJZD 5EOCJ 3GIVB 4WI8A 4DCQA 3FQUB 1VCAA 5F7DB 1NGPL 1H8NA 4HQQH 3OAZK 1BFSA 2JIXD 4JAMA 1HH9A 1A7PL 3GM8A 1BFTA 4GRWE 4OT1H 4YO0B 4D3CL 2D31A 3DO7A 4LVOC 4ZPVA 4MJ5A 4RZCA 2Z92B 4R9HA 4KJWD 1OAZH 4RWHA 4QRPA 2EDLA 4CL7A 2G75B 4M02A 1MFCL 1FFNA 4LCWB 3BD4A 1SYSA 3DUHA 4LQFH 3VFTB 5DGRA 5KVFH 2IG2L 1DBMH 3TESA 1JF1A 1JNHB 4H1LB 5F21B 2GAZA 5T3ZD 2WINA 3E1F1 3D69B 4IJ3C 2OL3H 2I5YL 1WT5C 5HYIA 3IDYC 4PJ8A 4NBYB 4JFFD 5C1MB 3UDWC 1JV5B 4HWBH 2YWYA 4QRPE 3TZVA 2DI7A 1D7FA 5ADOH 1ZVSB 1G0XA 1CLZH 4F80A 3RKDC 3WEXA 3PL6C 4I0KA 3L3OB 3CFCH 4XAKE 5CKAA 3NIDE 1YEIH 4LPUA 5GS0C 3H3KA 2VDRH 1HHIA 2OJZH 2ADIB 4M4PA 1FL5A 1DQQB 1OGTB 4ODHH 1NL0H 1RU9H 4XC3L 3S7GA 3VG9B 1T5XA 4GKNB 4BZYA 4WFED 5D71L 3WL9B 5EZIL 4FTVD 5GRJL 3SHSA 1DJSA 2Y6SC 3HE7D 4R3SA 1F3RB 4FQIH 5D1XA 2EE9A 4GAGH 4DEPB 2A6JA 3RTQC 1TZIB 2XWBB 1LWRA 4RWYL 1OAYL 1ZEAH 3UPAA 3BDYH 3O6KH 4P23B 1MY7A 5EBWB 3O2VH 3WO3B 3CLEH 1DUZB 4KRMB 3FMGL 4BQ8A 15C8H 4XB7A 1JPGB 3OXRA 4WGWB 4BFBD 4WU5A 3MJ7B 2BXYA 3BZ4A 5ITBH 3DX8A 3O6ML 4L8CB 4YNYB 3BQUC 1KEGL 4B41A 4NHCL 3RGVB 4MJ2A 4S1DD 4Y4KB 1PVHA 3O11B 2NY3D 1V8HA 3NCYP 1JMXA 1HQRA 1UVQB 2OR9L 1OAUH 2UYLB 1N0LA 3TJHD 4ODXB 4YDLB 5JPNA 1RY7B 1XH3B 4DGVL 1WTLA 5D1ZC 1DLHB 4U1MA 5E03A 4KRNA 4NHUB 3HZMA 4J3WA 1B2WL 2YUXA 3TO2A 5IF0A 2AGJL 3DV6A 3ZE2E 4MA1B 3JWDL 1LDPH 2HVJB 3WJJC 4Z95H 3B9KD 3QPQC 2ITCA 3KLSA 4R2GC 4NUJB 1BHGA 1D9KC 1MWAL 3GKWH 3K80A 3PUCA 3PQYD 2CDEA 2VZSA 4O02H 3ARYA 5D5MF 4P2OC 5D8JL 2L0DA 5DQDL 3OKNB 1D5XB 2X4OB 4NJAH 1N0XH 5GGVH 4RQQB 1MHCB 2XN9D 4J23A 2B5IB 2FX7H 1GC1L 1MAMH 4QCIB 3DGGB 2GSGB 1II4E 3QH3B 4NZDA 2B2XL 3KDMA 2PXYC 2IPTH 3MLTB 1I1AC 4MCZA 2AJVL 1QRNB 2Y7QB 3L7FB 3TIDB 4LVHB 5DJ8B 4X8JB 5DI8A 1UWXH 3BUTA 3TBVB 1SM3H 3Q6FB 1J0ZA 3HN3A 1CFNB 4LPTA 3KR3L 4NC2B 1A7BA 2NTFA 3N0PB 2WAHA 1DEDA 1F13A 1T66D 4M3KB 4YGVA 5DT1H 2ZCHH 4ZO9A 3VFVB 5GIRA 1MJ7H 3ARBD 5MP6L 1NMAH 5F1OB 1KULA 3S97C 5ESVA 3IRPX 2NCMA 35C8L 2QQLL 4NQTA 1YNLL 2FO1A 4HFUH 4L4TD 5DJAA 1IT9L 3VFOA 1E4WH 3L7EA 1SBSH 3TVMD 5C9JA 1LE9B 1NANH 3IETA 4PP1C 1T7ZA 1HH6B 4OUUB 4ACPA 1P7KA 4FQQA 4P5KA 1YMHB 1KLUB 1EVUA 3Q3GA 3VWJC 3X3FL 3C6LC 1KCKA 1P4BL 3LMJH 2AV7B 4Z0XA 1UM5H 4RIRA 3KPMA 4YUEH 2VDNL 4MD5A 5I1CL 2P46B 1ED3A 2ADJA 2P5WB 5H35B 5I76B 4P9MH 4FQ1L 5DS8B 1NDGA 1A9BB 2NXZD 4Y8DC 1B4RA 4POUB 5D9SA 4UU9A 3STLA 3TPUA 3I6LE 1W72A 1FNLA 3KLHC 5DQJB 2FZ3A 1S7SA 4C56D 2PO6D 1JBJA 4EUPG 1KN4H 3Q1SH 3I02B 4YXHH 5JXAH 1Q94B 4D94A 1AXSA 4X98B 2AJ3B 4M61A 1YEDB 2GTWB 4X4YB 2Y36H 4W4OC 4U1NB 2NY1B 5FYLL 3OPZL 5TE4L 1ZV5A 1YMMB 2IQ9H 2YD2A 1BWWA 5C07E 3ULSA 4MQ7B 3TBTA 2IANA 5FYLD 1S7VA 3HLAB 4ZUSA 4QRSB 1R0AH 5J3HD 1HKFA 4XXCA 4JHZA 1BOGA 1A6WH 3SPVA 3D87B 1KG0A 5B8CB 3VXNB 1A1OB 3LDBC 1C12B 5D2NA 4PJBE 1UCTA 5K9OB 2B0SL 5MENB 5IBTL 2J8UF 1JN6A 4LIQE 4GRWF 1UWGH 4PJ5B 3T08A 3TO4C 2IAMC 3QJFA 4A2LA 5HHXL 3WDIA 1QSVA 5HVHC 1NFDB 4FQHB 4JQVC 3NPSB 1AY1H 1A6VH 3WNOA 5CILL 4X5WB 4P5MA 4HS3A 2IANE 5ESQB 3T0EC 4WY7H 4YZFE 5T33L 4QTHA 4M6OH 2ZUSA 1MCWW 4UT7L 1XIWB 2C1OB 4LSUL 4L1HA 2JK5A 1FO0L 4KDVA 3AY4A 3SDAA 1QBMH 4HCRL 5T3XE 2AQ3A 5D2NE 5F97E 3PV7A 1YPZF 4YHIB 3TNNA 2XPGA 2YMXL 2EDJA 2YHGA 2E27H 4LVOB 1U8KB 5GS1B 3E6FB 3UBXG 2EZ0D 2IC2A 3PHSA 1TLKA 2LVCA 4PRPD 3RWCA 1QNZH 2XYCA 4U6VL 3NIDF 1FLTX 2B39A 5IBUB 4NOBA 2NPLX 4UV7L 1JGEB 4L1DA 4JFYB 4CADA 1CQYA 1N6QL 3DXAB 4HJJH 3TT3H 1AO7E 3TNMA 4UDTB 3LD8C 3I3DA 1NUNB 1F8TH 1WJ3A 3RIAK 3V4VH 1S9XB 4TNVF 4UT6H 3RHWF 1MEXH 1LNUB 4GW5B 2VL5A 3WUWB 1CICC 1N7MH 1G9NC 4G6FB 3GSOA 3ESVF 4GMSH 5GZOC 4OCWH 1UYWL 1CBVH 2O5YL 5MI0C 4NFBA 1YYML 3IDNB 1IQDA 4WHCA 2YRZA 1CG9A 4MB4A 4HBCL 5LAXB 3S98A 1OP5H 2WNGA 4QRPD 5KJRL 3PGDB 4OKVB 1BJ1H 3FQWB 4HUUB 2QSCL 4KRPD 5CGYD 5GGSB 4G80B 5F8RC 4OCMC 4ZYKB 2VLKA 3ULVL 5M7QA 2DJ4A 2FECL 4M6NH 4XAKD 5EOCL 3RUGA 4RISH 1J5OH 4U1KB 4ONOA 5DDHB 1VFAB 2NY6C 4CVZA 1QPXA 4HAFA 3HS0A 3ZE2F 1FNGA 1ZHNB 3OAYH 5C86A 5AZ2L 2WLYA 4AH2B 2M26A 2P7TB 4NO0B 5EU5A 5D7JD 3DSFL 2DDQH 3MACL 4POZD 4K94C 2FLBT 5F89B 1OHQA 4ZOEA 3T3ME 1PKQA 3BQUB 1D5ZA 3MROA 1F2QA 4XMKH 2XTJE 4KH2A 3QXVA 2VLKE 4JFOA 3BP4B 1KSRA 2W65A 3RUGE 4HKZB 1ZGLP 1R3JA 5BO1L 1I9JL 2CKBA 4FFVD 3UTTA 5C0RH 2YPLA 1IM3B 2X44D 4HPOH 5IB3A 4RGNC 1S7TB 2D0FA 2UVFA 3T0VA 4H1LG 4AIZB 1O5DT 1NCDH 3ES6B 2FWOA 4EBQH 2HH0L 4JN1L 1QR4A 4BH7B 3B2VH 5J1AB 5KVGH 1UJTA 1FCCA 1Q72H 3RA7L 3CSGA 3P73A 1B0GA 2P1YA 2XV6B 2MQ3A 2VLLB 1PKQE 4P2OB 1OF2B 3X14A 4DGIL 4E41D 3IKCA 3DMMA 3LN9A 1B4JH 1T89C 2VKWA 5DUML 1HSBA 1WCBB 3QDJA 3T0AA 2P5EA 1I3RA 2PXYB 4EN3A 5BS0E 1I1AB 3UTTE 2YPLE 2ICWJ 3S5LB 2DM2A 3DVIA 4S1DC 4XVUD 4KY1H 3CVIH 2G60H 2NY3C 1T7YA 5C0EA 1JHLL 1HHGB 4ELMA 2F19H 4Q9QL 4D0BB 3DX7A 1YDPB 3UJIL 2P45B 2DYPD 4RMVA 3W11C 1YEKH 5HHQB 1AXTH 1WISA 1MFEL 7FABH 2ZOLB 1WITA 4LARL 4X0KB 2VAAA 1Q0YH 4XHQA 3MRHA 3GK8H 1RHHA 4P4KB 2VITA 3QDJE 3V52L 4Z76B 4DJMA 1ZMYA 2C3VB 4JFZL 4NZUH 1I7ZA 4RGMC 4LCIL 4N5EC 3O3DB 1S5HA 5DTFB 4ELME 4XWGH 3IDXL 1AQKH 3EO9H 3TYGL 3C6LB 1X5FA 2DN7A 5FDWB 5L6YH 1D6VH 4JHWH 4N0CD 3BE1H 4OFKA 3QG7L 5E5RB 5ENWB 4X7CC 3MLZH 4RX4A 3DURB 1VKXA 4R90L 3B5HA 3H9HB 1YY8A 3KXFE 2DKSA 2IH3A 1T66C 1HOCB 3MLXL 1JWUB 5JR1L 4KV5F 4PJBF 3DI3B 1XGQA 4H0IA 1JHKH 4DN3H 3BIBX 3FFDB 2WUBH 3DI2B 4OIIH 1NSNH 5IVNA 4MDJA 3FN0H 3HFML 3I6LD 5F7EL 4QRUA 2DQHH 1S9YB 4JDZA 5FHAH 4KKBD 4JPVH 3LN5A 4JGJA 4M93C 3GSQA 3EDJA 3BH8B 4YBLC 2IJ0C 4BZ2L 4BUGA 1FN4B 3P0VH 4NQUA 2QJDA 5GGVY 3H7BA 5TDNA 1C16A 3P2TA 4FFYL 3WD5L 1LP9F 5GGTA 2A9NH 2BSED 2CQVA 5FO8B 2YUWA 5CINL 5LGKA 4AEHH 2R39A 3EYFB 4UT9L 3QPXL 4I3SL 1T80A 4NQEE 1PG7W 4XGZB 1DEEA 2IAMB 5FYJL 5EB9A 1DBKH 1CU4H 1OD7A 4MA8L 4XNZC 5DRXB 3NCFB 5HVHB 5HHMD 5E6YA 3UXFA 2A73A 5IW3A 4LCUA 1UZ6F 5GRYA 4NRZA 4F58H 4PG2C 3NZHH 4NQCA 5ACLA 3RBSA 5GRZA 3T0EB 1UM4H 5FYJD 4AMKH 3RWFA 4DFHA 2AJSL 1PSKH 2X4PA 4Y5XB 1TQCC 5E00B 5EO0B 3B9VA 2X2YA 3SO5A 5I1HL 1MUJB 2YRPA 4NC0B 3MRCA 1DFBL 5DO2C 1R3IH 4HIXH 5F7YC 5KAQG 4JG0L 3ARFC 3TCLB 2IAND 3MREB 3QQ4B 2D4FA 4U1JA 4OLVL 1CGTA 3BISA 2CR6A 1IGJA 1HIMH 3JV0A 2I9TA 5J56B 1E4XL 4FXLA 3QIUA 2UUDH 5FGCE 5J6HA 4J8RA 4NDMB 4GAYA 1T3FA 2FJGA 4HIIB 3RWGB 5T3XD 3G5XB 4NQCE 3DVNA 5JDSB 1KCSH 2BVUA 1JIBA 4CU7A 2QBWA 4RFEA 1N64H 5C0IA 4YR6B 5D7KD 3OG6B 3HHRB 3JTSA 4N1EA 1MF2H 4I0CC 2VC2L 5J11B 1LK2B 1ZSDA 5F3HB 4ERSH 4HKJB 4OTXL 5KS9B 5C6TH 2H41A 5ICXB 5EU3A 4CUCA 5LBSL 1O0VA 2EH8L 4JPKL 5D2LF 5I18L 3BW9B 4PJFB 2DKUA 4PLKD 1BZ7A 4LQ1A 2AV1B 3SDAD 5CJQH 2JIXB 4MAUH 5I2IA 1ZOXA 3OJDB 1HHJA 1R5VA 4KVNH 3SGEI 2AQ1A 5MI0B 1SMAA 2EC9U 5L88H 12E8H 1J1OH 5FXCH 3P3YA 5I75C 3EGSB 3ZE1E 1J1PL 3EDFA 1QZ1A 5CD5D 4JZOB 4NZRH 4J12A 4WHTA 3CFBB 3BVNB 3RWIB 2VJXA 1LD9A 4OLXL 5CSBA 3BP7A 3M8OH 5GSRB 3CZFB 4MXQD 5F1IA 2J3SA 4HC1A 4Y5VA 2ARJA 5DK2A 4HSQA 4JFQB 1FVDB 2MOVA 2V7NB 3SKNB 3HB3D 4NO5A 3MRBA 1BZ9A 2DIJA 1JGLH 3AS1A 3M07A 2PTVA 2VABA 1A7RH 4U1GB 5I15L 4JFFB 5J12C 1LO2H 1N26A 3C5SB 3DX6B 4EDWH 1HE7A 3C6SA 1F02I 4NZJA 4YHPA 5IT2H 3QUYD 3CDGA 4BZ1H 2VYRE 1V5JA 3A67H 1L6ZA 4R0LA 1JYNA 2CSPA 1QEWB 3S4SA 3LQMA 3FB5B 1Y6NR 4ZPTB 1D5MB 2HT4D 2L7UA 3RL1A 4LRNL 3QWOA 3WFHB 4HIHA 2I9LB 3KYMA 1YEGH 4LLQA 3MCKA 1A7NL 3AM8C 4LSVL 1CE6A 5IBUG 3S37L 5E4IA 3OKMB 1CD1A 3MZGB 3VA6A 3OB0H 2EDOA 4P59H 4FTVB 4WEUD 4KKCD 4XP9H 1IEBB 3HE7B 3FT3B 4AENA 2XTJD 5DJ2A 3OZ9L 2VSDA 2VLKD 4MX7B 4ODSH 4KJYB 2QADD 2X4RB 1BVLA 1GAFH 4NKDB 2EXYD 3V5DA 5DMGC 1NGWA 4NSKA 3AREA 1VHPA 5LJYH 1BWMA 4PJ8C 1HI6A 2YK1H 2R0ZL 1H3GA 3W39B 4G5ZL 4Q9BA 3TJEL 4PV8B 3QUKA 3BIKB 1K8DA 4NKOA 3TZVC 2R69L 2I26N 3RY6A 4ZD3L 1U8OB 2W60B 3UTQA 4ZUVA 1IE5A 2X4TA 1RK0A 3T8XA 3VGHA 2O5XH 2CKBL 2NY3B 4HF5H 3UTZB 1C7TA 2YD7A 4KZEH 4I9WE 3L9RB 1Z0NA 2B4CC 5TF1H 4HZLA 1ONQA 5I71B 3K8MA 4LHUD 5EZOL 1UACL 2Y06H 4TQEH 2IBZX 3ROOB 4G6AD 3C60C 3HC4H 3L5IA 1OB1B 1BBDH 2FX9L 3VFSB 4IOIA 3B9KB 3H3PH 5F88A 2YPLD 3UTTD 3LSOB 3GNML 3ARQA 2ENSA 4LL9A 5BXFA 1FFRA 5D1XC 3TIEA 1NGPH 3UBXI 3PQYB 1RJYB 3B43A 3BGMB 1A7PH 1C5DB 3RVVD 3MGOB 4D3CH 1F2XK 1LO0L 3QRGL 3FO2A 4GKSA 3ALWA 1BIIB 2XN9B 5LCVL 5IK3B 3L3DB 4G7VL 3DMMD 1MFCH 4K9EC 4ONFL 1H0DA 4F7PA 3QDJD 3QZWG 4TUJA 1NAML 4JDTL 4U1IA 2ZG2A 1TITA 3X3GL 1R3KB 5L0QC 2IG2H 5C0JA 2P5ED 4EN3D 3U4AA 4LOUC 4DK3A 3TP4A 4F7TA 3RDTD 1X5JA 4FZ8L 2I5YH 2VR4A 5B39G 4AJ0A 5EUOE 2BOCB 5IEKA 2WWKO 3HAEB 3ARBB 2EIEA 3MFFB 4UDUA 3F7VB 1BQHB 3EOAA 2X4QB 2EDEA 4R4FL 5GSVA 2Z91B 2MFNA 1FG9C 4JY6A 4L4TB 4QF1A 3FT4A 4GLRI 3TVMB 5T5NG 4EIGB 2HAZA 1MVFA 2R1YB 3WN5A 4HMDA 4B7LA 5AEAA 5CSGA 2JCCB 4YBLB 2AJXL 2XQBL 2AJUH 4NKMA 4LK4A 1TVHA 1JZ4A 4J4PA 4NBZB 4RMWA 2YA0A 3VWKC 2IALB 5IMKA 1ZS8A 4Y0GA 1FE8L 4IDJL 4XC3H 4JFEA 1Q9KA 5D71H 2QSVA 5EZIH 2NXZB 5GRJH 2QR0B 5C0AA 1F6FB 1U8HB 5SV4A 3VRIA 2VDLL 2EYTB 3L1OL 4C56B 4N0YL 3QI9A 2PO6B 2CIKA 4RX4D 4WW1B 2X4SA 4LPVA 5LGJB 4U1LB 2MKWA 3B5TA 1OAYH 3D25B 3MRLB 4RWYH 4XNZB 2AXGB 3HRZB 5D7LE 3VH8G 5FFLA 3HCVB 4MDIB 1LE5A 2C3XA 2DMKA 4ZFOL 1GVIA 3FMGH 5DEGA 5H2BB 1Q9OA 1TTGA 1UJ3B 3PWLA 3KYOA 3F12A 4JFEE 1KEGH 2FJFB 4NHCH 1MCKA 1QHPA 5JNYB 5FKAA 3GHEL 4BFEA 5INDB 1RAMA 1U8PA 5C0AE 1SJXA 5GGTL 2OR9H 4IIQB 4FNLL 4WRLA 4NQVA 4ODWA 4RCAA 4TVSa 2J8OA 4K3EL 3VXOA 4NNXB 2CIIB 1ZGLB 2R56L 3HC0A 4D0CB 1B2WH 2AGJH 4IHOB 3LS5L 2BX5A 3JWDH 2ED7A 2OTPA 4Z6AT 4N8CL 3VFMA 2JF1A 2VISB 4XMLL 1OTSD 1NFIB 3PHOB 3E3QE 1MWAH 2OLDA 4R4ND 3PWJB 2AS5M 3LEVL 3W81A 5D8JH 2OZ4A 5DQDH 1JUFB 1RVFL 5MEOA 4CKVX 1RQ5A 2JJTA 4D8PB 2H6PA 4I1NB 4NQCD 1NGQL 4O2FB 1GC1H 1YJDL 2GCYB 3KWWA 2B2XH 3QQ9C 3B8YA 1HKLL 3DUUA 1I1YA 2AJVH 1FH5L 3DBXA 2HT3C 3L3HB 1G7JB 3EFFB 3JWOC 4HLZG 3U7AA 4PJDE 1IGIL 3KR3H 5CEYA 1EA9C 2FEEL 4XXCC 2VXSL 4ZUTB 1FNAA 4OZHA 1ZXQA 4PRPB 3TBYB 3QUMA 1G7HB 3U46A 5D2NC 1VACA 3KS0J 5MP6H 1S7RB 4YHYC 2GK0A 3QO0B 3WO4C 2BC4A 35C8H 2QQLH 3BKCL 5GISL 5E5UB 3VE0B 5CS7A 4WWKD 4X4MA 4WU7A 1FYTD 1YNLH 2AW2A 2XKNB 4TNWK 1IT9H 3CX5J 1EAPA 3EYOA 4L9DA 1A7OL 2A9ML 1FQ9C 1YYLL 2AEQL 5CCKL 4D0DA 1XGTB 4ZO7A 1OW0C 3OXSA 5EBLB 3X3FH 1P4BH 3GMOA 2NMSA 3MRJA 4PLKC 3P4MB 4OZHE 4ETQB 2VDNH 3AY4C 1XEDA 5I1CH 5K9JL 3BPNB 3L3KA 4FQ1H 2HFGL 1NFKA 4P99A 4JAMB 1HH9B 4ZOBA 4W68A 3OQ3B 2Q8AL 2D31B 3DO7B 1WZ1L 3BD5A 4Q2ZA 1DTUA 4ZPVB 4CW1A 1IGML 4RZCB 5IUSA 2EYSB 2JJWA 4XCEA 2C5DC 4QRPB 3GJEA 2WIMA 1QLFB 4KRPB 1FFNB 1HYSC 5FYLH 3OPZH 4M8VA 1SYSB 2MCPL 4MXQC 5TE4H 3P9MA 5KG9A 4L3EA 3B5GA 1S78D 4P2RA 1T03L 4OIAA 1UXSA 1WZLA 4LCYA 4PLOB 3MBEA 2Z4QA 1FZOA 1NEZG 1JF1B 3ISWA 5FIEA 4YFLI 1QSEE 3W82A 5EOTA 3NABL 4XXDA 2Y9RT 5L9DL 5D7JB 4JREB 5F1SA 3GB7A 5HPOA 2EYRA 4YBHA 1XZ0A 3MRRB 4P3CL 2B0SH 5IBTH 4K71C 3JV4A 2BFVL 2DL2A 5TGBA 4QHUA 2XXMB 4TNVK 3WEXB 5HHXH 2J12B 5JORA 3GSWB 2DBJA 4L3EE 3RHWK 4P2RE 4HGWB 2DLHA 4AEIL 2B8OT 3MSPA 5JO5A 4LVEA 5CILH 4CNIA 5DHYA 1HHIB 3ARXA 3K81A 1RUQL 5T33H 1B3JA 3OTTA 4UT7H 4YIQA 1FG2A 4LSUH 1KIQB 1T5XB 2XTJC 1FO0H 1I4FA 2YZ1A 1FZJB 4HCRH 4R3SB 2QADC 5E1AA 2EXYC 5EUOF 4I9WD 3MXVL 4NCC2 5IWLA 4PP2A 1NUDA 5F93C 2CUMA 2YMXH 4E41B 3BKML 4OCNC 1P4LA 1NBVL 3TA3D 1C1EL 1CGSL 4JFHE 3ARED 1TIUA 1INEL 4Y2OA 3MZTA 1KTLB 4IBLT 3U0TA 5E6ZA 1UEYA 1PJ9A 2ILLA 4QXGL 1FFOB 4WU5B 5DEFA 2A83A 1UG9A 3BZ4B 3DX8B 4XCNA 5J8OA 4U6VH 4EI5A 1JZ2A 1QR1A 3W2DL 5F6HJ 3M1BA 4UV7H 4OM0L 1DSFL 5IM7A 1N6QH 1EK3A 2DYPB 2RR3A 4AEFA 2YOCA 1SJVA 3E8UL 3F62A 4QOKA 1HQRB 4G6AC 2CRZA 5C0CE 5JPNB 2CRIA 1CLCA 3O45A 5DSCA 4U1MB 3WJLA 3HZMB 4G8EA 3TO2B 5IF0B 3DV6B 3ETBF 4PJHA 4NQDE 3GUTB 2QTEA 2I07A 2M2DA 4L3AA 2ED9A 1UYWH 2CDEB 4X4XA 2O5YH 1A5FL 3O8XA 1YYMH 3I50L 1J12A 2CK2A 3EZJB 3DMMC 5J13C 2OXHA 4HBCH 1MLCA 1U92A 2MQ0A 5KJRH 5E24E 1X5AA 1AJ7L 3T3PE 1HCVA 2QSCH 2ZUYA 4ODBD 3ULVH 5EOCH 1IKFL 1PBYA 4PJHE 1FVCA 1YECL 1R5IA 1A6TA 4WTXA 2NTFB 2IEPA 1KCRL 3TT1L 2FBOJ 5BRZD 4YGVB 3ARDA 1KC5L 5AZ2H 2OR8A 1H3UA 1UM6H 4KJPD 4ZAKA 1AC6A 2OMBA 3DSFH 4R7NA 3MACH 3FFCA 4KDWA 5ESVB 4KI1A 5DZOA 3O9WA 2HWZL 4X9FA 5IHLB 3VRLE 2E5EA 2JELL 3VGGA 1PW3A 5DJAB 3VFOB 5C9JB 3IETB 4QXWA 1WC7A 5E8NA 2HT2D 3FZUD 1ZA3A 1P7KB 3D39A 4WHDA 4P5KB 2BY2A 3Q3GB 5BO1H 1I9JH 4KK8D 4NWUL 4WUUE 5DRNA 4J4PD 4Z0XB 4Y2DB 2F74A 2FSEA 4BKLB 1EJOL 4MD5B 5MEPB 4JFED 4PJDF 3OBAA 2ADJB 2HH0H 2JJSA 1NQBA 4JN1H 5IBLC 5BMFL 3BX7C 3RA7H 2NNAA 3VFGL 4UU9B 2AAVA 5C0AD 5GPRA 3TPUB 1W72B 3FFCE 5HHMB 1BQHG 3G5ZA 1S7SB 2HRPL 4X80L 3QI9D 3BN3B 4XPHL 3MR9A 5CUSL 1DE4A 3HE6A 1MRDL 4DGIH 5DUMH 2WSKA 1AXSB 4NYLB 3MYJA 4M61B 2NLJA 3P0GB 2A6IA 3HPJA 4WHYH 3MOBL 3D39E 5J06A 4JY5L 2JKXA 4JE4B 1MQKL 2V9TA 4IRSC 1OP5K 1G7IA 4MD0A 1I7RA 1JRHL 1MH5A 4AM0A 4NBXB 1PLGL 4NP4L 2UY7A 1JHLH 2KL6A 4Q9QH 1F42A 4BFIA 4ZUSB 4HAGA 3UJIH 1HXYA 3N1MC 3N50A 3NBNA 1BOGB 5D4QA 2A38A 3X11B 4LPXA 1MLBB 1MFEH 4LARH 5HI5D 1KG0B 2AERT 5FOJA 3WXVL 5BOPA 2CK0L 5D2NB 2B1HL 1OTSC 3OAYK 3LKNA 1JN6B 4XI5D 4FQXA 3VXUA 5FCUL 1LMKA 3V52H 3QJFB 3PDOA 3O41A 3L95A 4JFZH 1WGOA 5DVMA 4LCIH 3EDKA 3KLAA 5L2JB 2HLFD 3CXDL 4P5MB 3BZEB 4HS3B 2KQMA 2NQCA 3IDXH 3TYGH 4QTHB 4S2SA 1QP1A 2JK5B 1U8LA 2KZWA 5DD5L 2W92A 4PD4K 3QG7H 3SDAB 1HQ4B 3WDHA 4R90H 3ARUA 3TNNB 3U4EB 4LMQE 2XPGB 5DLML 2IMNA 3FB8A 1F90L 3MLXH 5JR1H 1IILE 1HNFA 3NCYS 2B20A 3SE9L 2PW2A 4O9HL 4PRAB 1BAFL 3QIUC 3MX0A 4ODTL 4OFDA 5SX4I 2BDNL 2NY2D 3CCHA 2EDRA 5FYKL 1J8KA 1J8HD 4HIJB 2E6JA 3ULVF 1F00I 3HFMH 1UT9A 3LB6D 3PDDA 5F7EH 4CADB 3RZCA 5IIEA 2BVQA 3O6FB 4P2QA 1T7XA 5IFAL 4BZ2H 5I19L 3TNMB 1HEZA 4FQCL 3BEWA 3UPCA 1NGZA 5IQ9A 3ZKXB 4EUPA 3CDYA 4FFYH 3WD5H 2HN7A 3LN4A 3QUYB 1CIDA 5CINH 2UZYB 4M7LT 5J6GA 1DQDL 2VL5B 4XC1L 1P1ZA 4UT9H 3QPXH 4DTGL 4K71B 2Y5TA 4I3SH 4Q0XL 1G6RL 2MSPA 5E0QA 5DC0A 5FYJH 1KT2A 4MA8H 6CGTA 4DVBA 4X8XA 3B3IB 4QXUL 5DHXB 1IQDB 4KAQL 3WS6A 5EIQA 4UI2A 4ZG1A 1ZLUK 5CHNB 2D7NA 2EE3A 4P2QE 4PJ7A 5M95B 3QDAA 2GJ6A 3AXLB 4G43A 2AJSH 1FZKB 2XTJB 5KSAA 5I1HH 2VLKB 5H94B 4Y5VC 4L3ED 5HYJA 3RUGB 2QADB 4L9LC 4P2RD 1DFBH 2DIAA 2C1PA 1ND0A 3U30C 6FABL 2O5ZL 3MBED 3PIQA 4JG0H 1IC4L 1FGNL 3V2AR 5I16B 2WWKT 1ES0A 1V05A 2P8LB 2H9GA 3HS0B 4OLVH 1FNGB 5KVDL 1E4XH 5EU5B 4YFEA 3RVTC 2IBGA 4U05A 1X5IA 3UTPE 4MNQA 4PJ7E 1RHFA 5JOFA 3UTSD 2GJ6E 5DJ0A 1GGIL 1PKQB 3CSYA 5B38B 2VDML 1HHKA 4XCYA 3RRQA 1BQUA 3TBSA 5HDQL 4JFOB 4XTRD 4LHUB 2W65B 4JFHD 4WTZA 5HYJE 4W81A 4DK6A 1QSZA 3ME0A 3MNVA 2VC2H 1UB5A 4Z7NF 2CKBB 4NO2A 3SKMA 4OTXH 3BN9D 1TTFA 4PV9B 5ALCL 2YPLB 1EGJL 5EOQL 3WFDL 3UBXA 4MJ6A 5CEZE 5FM4A 5LBSH 1DVFA 1G84A 1ETZA 2FWOB 2C9AA 5I18H 4CBPA 4XZUB 4WNQA 3RJQB 1M6OB 4OF6A 4KTDL 4EOWL 1KLGA 3P73B 4K7PY 1B0GB 3L3IA 1NCCL 3U7WL 3FQNA 4S1SL 5HD8D 3VD7A 5KSBA 1EEQA 3AREC 5EPMA 1EAJA 5DF0A 3X14B 2APVA 3MRPA 3DMMB 5DUBA 3PWVA 1HSBB 5I6XB 1J1PH 4WWID 3W9DB 3RY6C 2P5EB 4CMHC 4EN3B 4OLXH 2VO5A 5FOBB 4EI5D 3RDTB 5C0EB 3SDCC 4ELMB 1EERB 3DX7B 4HIEB 4HK0B 2UZIL 1DLFL 1QFWI 3N1GC 4G8IA 4QOKD 5I15H 5KSBE 2VAAB 4NOFA 3A6CL 1A1NB 1EEUA 3RWJA 3MRHB 2VITB 2UUDK 5IW6A 3SQOL 4QO1A 1CGWA 1I7ZB 2N1KA 2BHZA 3TYFA 4LRNH 1N59A 1NLBL 1S5HB 2DJSA 2BCKA